data_6KQD
# 
_entry.id   6KQD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.323 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6KQD         
WWPDB D_1300013444 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6KQD 
_pdbx_database_status.recvd_initial_deposition_date   2019-08-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zhang, Y.'     1 ? 
'Li, L.'        2 ? 
'Ebright, R.H.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            117 
_citation.language                  ? 
_citation.page_first                5801 
_citation.page_last                 5809 
_citation.title                     
'RNA extension drives a stepwise displacement of an initiation-factor structural module in initial transcription.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1920747117 
_citation.pdbx_database_id_PubMed   32127479 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, L.'        1 ? 
primary 'Molodtsov, V.' 2 ? 
primary 'Lin, W.'       3 ? 
primary 'Ebright, R.H.' 4 ? 
primary 'Zhang, Y.'     5 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   98.500 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6KQD 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     185.501 
_cell.length_a_esd                 ? 
_cell.length_b                     104.044 
_cell.length_b_esd                 ? 
_cell.length_c                     297.441 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6KQD 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                                                        35056.164  4 
2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                                                         125436.539 2 
2.7.7.6 ? ? ? 
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 2   2.7.7.6 ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                                                        11533.316  2 
2.7.7.6 ? ? ? 
5  polymer     man 'RNA polymerase sigma factor SigA'                                                                 50769.398  2 
?       ? ? ? 
6  polymer     syn 
;DNA (5'-D(*CP*CP*T*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*CP*CP*AP*GP*GP*G)-3')
;
6440.147   2   ?       ? ? ? 
7  polymer     syn 
;DNA (5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*GP*CP*AP*GP*G*)-3')
;
8421.432   2   ?       ? ? ? 
8  polymer     syn 
;RNA (5'-R(*GP*GP*A)-3')
;
974.660    2   ?       ? ? ? 
9  non-polymer syn 'MAGNESIUM ION'                                                                                    24.305     7 
?       ? ? ? 
10 non-polymer syn 'ZINC ION'                                                                                         65.409     4 
?       ? ? ? 
11 non-polymer syn "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                               347.221    2 
?       ? ? ? 
12 water       nat water                                                                                              18.015     
107 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B,K,L ? 
2 'polypeptide(L)'        no no 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C,M     ? 
3 'polypeptide(L)'        no no 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D,N     ? 
4 'polypeptide(L)'        no no 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E,O     ? 
5 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
F,P     ? 
6 polydeoxyribonucleotide no no 
;(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DC)(DA)(DG)(DG)
(DG)
;
CCTGCATCCGTGAGTCCAGGG G,Q     ? 
7 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGTCACGGATGCAGG H,R     ? 
8 polyribonucleotide      no no GGA GGA I,S     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLY n 
5 3    SER n 
5 4    SER n 
5 5    HIS n 
5 6    HIS n 
5 7    HIS n 
5 8    HIS n 
5 9    HIS n 
5 10   HIS n 
5 11   SER n 
5 12   SER n 
5 13   GLY n 
5 14   LEU n 
5 15   VAL n 
5 16   PRO n 
5 17   ARG n 
5 18   GLY n 
5 19   SER n 
5 20   HIS n 
5 21   MET n 
5 22   LYS n 
5 23   LYS n 
5 24   SER n 
5 25   LYS n 
5 26   ARG n 
5 27   LYS n 
5 28   ASN n 
5 29   ALA n 
5 30   GLN n 
5 31   ALA n 
5 32   GLN n 
5 33   GLU n 
5 34   ALA n 
5 35   GLN n 
5 36   GLU n 
5 37   THR n 
5 38   GLU n 
5 39   VAL n 
5 40   LEU n 
5 41   VAL n 
5 42   GLN n 
5 43   GLU n 
5 44   GLU n 
5 45   ALA n 
5 46   GLU n 
5 47   GLU n 
5 48   LEU n 
5 49   PRO n 
5 50   GLU n 
5 51   PHE n 
5 52   PRO n 
5 53   GLU n 
5 54   GLY n 
5 55   GLU n 
5 56   PRO n 
5 57   ASP n 
5 58   PRO n 
5 59   ASP n 
5 60   LEU n 
5 61   GLU n 
5 62   ASP n 
5 63   PRO n 
5 64   ASP n 
5 65   LEU n 
5 66   THR n 
5 67   LEU n 
5 68   GLU n 
5 69   ASP n 
5 70   ASP n 
5 71   LEU n 
5 72   LEU n 
5 73   ASP n 
5 74   LEU n 
5 75   PRO n 
5 76   GLU n 
5 77   GLU n 
5 78   GLY n 
5 79   GLU n 
5 80   GLY n 
5 81   LEU n 
5 82   ASP n 
5 83   LEU n 
5 84   GLU n 
5 85   GLU n 
5 86   GLU n 
5 87   GLU n 
5 88   GLU n 
5 89   ASP n 
5 90   LEU n 
5 91   PRO n 
5 92   ILE n 
5 93   PRO n 
5 94   LYS n 
5 95   ILE n 
5 96   SER n 
5 97   THR n 
5 98   SER n 
5 99   ASP n 
5 100  PRO n 
5 101  VAL n 
5 102  ARG n 
5 103  GLN n 
5 104  TYR n 
5 105  LEU n 
5 106  HIS n 
5 107  GLU n 
5 108  ILE n 
5 109  GLY n 
5 110  GLN n 
5 111  VAL n 
5 112  PRO n 
5 113  LEU n 
5 114  LEU n 
5 115  THR n 
5 116  LEU n 
5 117  GLU n 
5 118  GLU n 
5 119  GLU n 
5 120  VAL n 
5 121  GLU n 
5 122  LEU n 
5 123  ALA n 
5 124  ARG n 
5 125  LYS n 
5 126  VAL n 
5 127  GLU n 
5 128  GLU n 
5 129  GLY n 
5 130  MET n 
5 131  GLU n 
5 132  ALA n 
5 133  ILE n 
5 134  LYS n 
5 135  LYS n 
5 136  LEU n 
5 137  SER n 
5 138  GLU n 
5 139  ILE n 
5 140  THR n 
5 141  GLY n 
5 142  LEU n 
5 143  ASP n 
5 144  PRO n 
5 145  ASP n 
5 146  LEU n 
5 147  ILE n 
5 148  ARG n 
5 149  GLU n 
5 150  VAL n 
5 151  VAL n 
5 152  ARG n 
5 153  ALA n 
5 154  LYS n 
5 155  ILE n 
5 156  LEU n 
5 157  GLY n 
5 158  SER n 
5 159  ALA n 
5 160  ARG n 
5 161  VAL n 
5 162  ARG n 
5 163  HIS n 
5 164  ILE n 
5 165  PRO n 
5 166  GLY n 
5 167  LEU n 
5 168  LYS n 
5 169  GLU n 
5 170  THR n 
5 171  LEU n 
5 172  ASP n 
5 173  PRO n 
5 174  LYS n 
5 175  THR n 
5 176  VAL n 
5 177  GLU n 
5 178  GLU n 
5 179  ILE n 
5 180  ASP n 
5 181  GLN n 
5 182  LYS n 
5 183  LEU n 
5 184  LYS n 
5 185  SER n 
5 186  LEU n 
5 187  PRO n 
5 188  LYS n 
5 189  GLU n 
5 190  HIS n 
5 191  LYS n 
5 192  ARG n 
5 193  TYR n 
5 194  LEU n 
5 195  HIS n 
5 196  ILE n 
5 197  ALA n 
5 198  ARG n 
5 199  GLU n 
5 200  GLY n 
5 201  GLU n 
5 202  ALA n 
5 203  ALA n 
5 204  ARG n 
5 205  GLN n 
5 206  HIS n 
5 207  LEU n 
5 208  ILE n 
5 209  GLU n 
5 210  ALA n 
5 211  ASN n 
5 212  LEU n 
5 213  ARG n 
5 214  LEU n 
5 215  VAL n 
5 216  VAL n 
5 217  SER n 
5 218  ILE n 
5 219  ALA n 
5 220  LYS n 
5 221  LYS n 
5 222  TYR n 
5 223  THR n 
5 224  GLY n 
5 225  ARG n 
5 226  GLY n 
5 227  LEU n 
5 228  SER n 
5 229  PHE n 
5 230  LEU n 
5 231  ASP n 
5 232  LEU n 
5 233  ILE n 
5 234  GLN n 
5 235  GLU n 
5 236  GLY n 
5 237  ASN n 
5 238  GLN n 
5 239  GLY n 
5 240  LEU n 
5 241  ILE n 
5 242  ARG n 
5 243  ALA n 
5 244  VAL n 
5 245  GLU n 
5 246  LYS n 
5 247  PHE n 
5 248  GLU n 
5 249  TYR n 
5 250  LYS n 
5 251  ARG n 
5 252  ARG n 
5 253  PHE n 
5 254  LYS n 
5 255  PHE n 
5 256  SER n 
5 257  THR n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  TRP n 
5 262  TRP n 
5 263  ILE n 
5 264  ARG n 
5 265  GLN n 
5 266  ALA n 
5 267  ILE n 
5 268  ASN n 
5 269  ARG n 
5 270  ALA n 
5 271  ILE n 
5 272  ALA n 
5 273  ASP n 
5 274  GLN n 
5 275  ALA n 
5 276  ARG n 
5 277  THR n 
5 278  ILE n 
5 279  ARG n 
5 280  ILE n 
5 281  PRO n 
5 282  VAL n 
5 283  HIS n 
5 284  MET n 
5 285  VAL n 
5 286  GLU n 
5 287  THR n 
5 288  ILE n 
5 289  ASN n 
5 290  LYS n 
5 291  LEU n 
5 292  SER n 
5 293  ARG n 
5 294  THR n 
5 295  ALA n 
5 296  ARG n 
5 297  GLN n 
5 298  LEU n 
5 299  GLN n 
5 300  GLN n 
5 301  GLU n 
5 302  LEU n 
5 303  GLY n 
5 304  ARG n 
5 305  GLU n 
5 306  PRO n 
5 307  THR n 
5 308  TYR n 
5 309  GLU n 
5 310  GLU n 
5 311  ILE n 
5 312  ALA n 
5 313  GLU n 
5 314  ALA n 
5 315  MET n 
5 316  GLY n 
5 317  PRO n 
5 318  GLY n 
5 319  TRP n 
5 320  ASP n 
5 321  ALA n 
5 322  LYS n 
5 323  ARG n 
5 324  VAL n 
5 325  GLU n 
5 326  GLU n 
5 327  THR n 
5 328  LEU n 
5 329  LYS n 
5 330  ILE n 
5 331  ALA n 
5 332  GLN n 
5 333  GLU n 
5 334  PRO n 
5 335  VAL n 
5 336  SER n 
5 337  LEU n 
5 338  GLU n 
5 339  THR n 
5 340  PRO n 
5 341  ILE n 
5 342  GLY n 
5 343  ASP n 
5 344  GLU n 
5 345  LYS n 
5 346  ASP n 
5 347  SER n 
5 348  PHE n 
5 349  TYR n 
5 350  GLY n 
5 351  ASP n 
5 352  PHE n 
5 353  ILE n 
5 354  PRO n 
5 355  ASP n 
5 356  GLU n 
5 357  HIS n 
5 358  LEU n 
5 359  PRO n 
5 360  SER n 
5 361  PRO n 
5 362  VAL n 
5 363  ASP n 
5 364  ALA n 
5 365  ALA n 
5 366  THR n 
5 367  GLN n 
5 368  SER n 
5 369  LEU n 
5 370  LEU n 
5 371  SER n 
5 372  GLU n 
5 373  GLU n 
5 374  LEU n 
5 375  GLU n 
5 376  LYS n 
5 377  ALA n 
5 378  LEU n 
5 379  SER n 
5 380  LYS n 
5 381  LEU n 
5 382  SER n 
5 383  GLU n 
5 384  ARG n 
5 385  GLU n 
5 386  ALA n 
5 387  MET n 
5 388  VAL n 
5 389  LEU n 
5 390  LYS n 
5 391  LEU n 
5 392  ARG n 
5 393  LYS n 
5 394  GLY n 
5 395  LEU n 
5 396  ILE n 
5 397  ASP n 
5 398  GLY n 
5 399  ARG n 
5 400  GLU n 
5 401  HIS n 
5 402  THR n 
5 403  LEU n 
5 404  GLU n 
5 405  GLU n 
5 406  VAL n 
5 407  GLY n 
5 408  ALA n 
5 409  PHE n 
5 410  PHE n 
5 411  GLY n 
5 412  VAL n 
5 413  THR n 
5 414  ARG n 
5 415  GLU n 
5 416  ARG n 
5 417  ILE n 
5 418  ARG n 
5 419  GLN n 
5 420  ILE n 
5 421  GLU n 
5 422  ASN n 
5 423  LYS n 
5 424  ALA n 
5 425  LEU n 
5 426  ARG n 
5 427  LYS n 
5 428  LEU n 
5 429  LYS n 
5 430  TYR n 
5 431  HIS n 
5 432  GLU n 
5 433  SER n 
5 434  ARG n 
5 435  THR n 
5 436  ARG n 
5 437  LYS n 
5 438  LEU n 
5 439  ARG n 
5 440  ASP n 
5 441  PHE n 
5 442  LEU n 
5 443  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DT  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DC  n 
6 10   DG  n 
6 11   DT  n 
6 12   DG  n 
6 13   DA  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DC  n 
6 18   DA  n 
6 19   DG  n 
6 20   DG  n 
6 21   DG  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DC  n 
7 17   DA  n 
7 18   DC  n 
7 19   DG  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
8 1    G   n 
8 2    G   n 
8 3    A   n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   443 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'sigA, TTHA0532' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'HB8 / ATCC 27634 / DSM 579' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     300852 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample 1 315  ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
2 1 sample 1 1119 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
3 1 sample 1 1524 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
4 1 sample 1 99   ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 21 'synthetic construct' ? 32630 ? 
7 1 sample 1 27 'synthetic construct' ? 32630 ? 
8 1 sample 1 3  'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_THET8   Q5SHR6 ? 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 
2 UNP RPOB_THET8   Q8RQE9 ? 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 
3 UNP RPOC_THET8   Q8RQE8 ? 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 
4 UNP RPOZ_THET8   Q8RQE7 ? 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 
5 UNP Q5SKW1_THET8 Q5SKW1 ? 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 
6 PDB 6KQD         6KQD   ? 6 ? 1 
7 PDB 6KQD         6KQD   ? 7 ? 1 
8 PDB 6KQD         6KQD   ? 8 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6KQD A 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
2  1 6KQD B 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
3  2 6KQD C 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4  3 6KQD D 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5  4 6KQD E 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6  5 6KQD F 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
7  6 6KQD G 1  ? 21   ? 6KQD   1 ? 21   ? 1 21   
8  7 6KQD H 1  ? 27   ? 6KQD   1 ? 27   ? 1 27   
9  8 6KQD I 1  ? 3    ? 6KQD   1 ? 3    ? 1 3    
10 1 6KQD K 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
11 1 6KQD L 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
12 2 6KQD M 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
13 3 6KQD N 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
14 4 6KQD O 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
15 5 6KQD P 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
16 6 6KQD Q 1  ? 21   ? 6KQD   1 ? 21   ? 1 21   
17 7 6KQD R 1  ? 27   ? 6KQD   1 ? 27   ? 1 27   
18 8 6KQD S 1  ? 3    ? 6KQD   1 ? 3    ? 1 3    
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6  6KQD MET F 1  ? UNP Q5SKW1 ? ? 'initiating methionine' -19 1  
6  6KQD GLY F 2  ? UNP Q5SKW1 ? ? 'expression tag'        -18 2  
6  6KQD SER F 3  ? UNP Q5SKW1 ? ? 'expression tag'        -17 3  
6  6KQD SER F 4  ? UNP Q5SKW1 ? ? 'expression tag'        -16 4  
6  6KQD HIS F 5  ? UNP Q5SKW1 ? ? 'expression tag'        -15 5  
6  6KQD HIS F 6  ? UNP Q5SKW1 ? ? 'expression tag'        -14 6  
6  6KQD HIS F 7  ? UNP Q5SKW1 ? ? 'expression tag'        -13 7  
6  6KQD HIS F 8  ? UNP Q5SKW1 ? ? 'expression tag'        -12 8  
6  6KQD HIS F 9  ? UNP Q5SKW1 ? ? 'expression tag'        -11 9  
6  6KQD HIS F 10 ? UNP Q5SKW1 ? ? 'expression tag'        -10 10 
6  6KQD SER F 11 ? UNP Q5SKW1 ? ? 'expression tag'        -9  11 
6  6KQD SER F 12 ? UNP Q5SKW1 ? ? 'expression tag'        -8  12 
6  6KQD GLY F 13 ? UNP Q5SKW1 ? ? 'expression tag'        -7  13 
6  6KQD LEU F 14 ? UNP Q5SKW1 ? ? 'expression tag'        -6  14 
6  6KQD VAL F 15 ? UNP Q5SKW1 ? ? 'expression tag'        -5  15 
6  6KQD PRO F 16 ? UNP Q5SKW1 ? ? 'expression tag'        -4  16 
6  6KQD ARG F 17 ? UNP Q5SKW1 ? ? 'expression tag'        -3  17 
6  6KQD GLY F 18 ? UNP Q5SKW1 ? ? 'expression tag'        -2  18 
6  6KQD SER F 19 ? UNP Q5SKW1 ? ? 'expression tag'        -1  19 
6  6KQD HIS F 20 ? UNP Q5SKW1 ? ? 'expression tag'        0   20 
15 6KQD MET P 1  ? UNP Q5SKW1 ? ? 'initiating methionine' -19 21 
15 6KQD GLY P 2  ? UNP Q5SKW1 ? ? 'expression tag'        -18 22 
15 6KQD SER P 3  ? UNP Q5SKW1 ? ? 'expression tag'        -17 23 
15 6KQD SER P 4  ? UNP Q5SKW1 ? ? 'expression tag'        -16 24 
15 6KQD HIS P 5  ? UNP Q5SKW1 ? ? 'expression tag'        -15 25 
15 6KQD HIS P 6  ? UNP Q5SKW1 ? ? 'expression tag'        -14 26 
15 6KQD HIS P 7  ? UNP Q5SKW1 ? ? 'expression tag'        -13 27 
15 6KQD HIS P 8  ? UNP Q5SKW1 ? ? 'expression tag'        -12 28 
15 6KQD HIS P 9  ? UNP Q5SKW1 ? ? 'expression tag'        -11 29 
15 6KQD HIS P 10 ? UNP Q5SKW1 ? ? 'expression tag'        -10 30 
15 6KQD SER P 11 ? UNP Q5SKW1 ? ? 'expression tag'        -9  31 
15 6KQD SER P 12 ? UNP Q5SKW1 ? ? 'expression tag'        -8  32 
15 6KQD GLY P 13 ? UNP Q5SKW1 ? ? 'expression tag'        -7  33 
15 6KQD LEU P 14 ? UNP Q5SKW1 ? ? 'expression tag'        -6  34 
15 6KQD VAL P 15 ? UNP Q5SKW1 ? ? 'expression tag'        -5  35 
15 6KQD PRO P 16 ? UNP Q5SKW1 ? ? 'expression tag'        -4  36 
15 6KQD ARG P 17 ? UNP Q5SKW1 ? ? 'expression tag'        -3  37 
15 6KQD GLY P 18 ? UNP Q5SKW1 ? ? 'expression tag'        -2  38 
15 6KQD SER P 19 ? UNP Q5SKW1 ? ? 'expression tag'        -1  39 
15 6KQD HIS P 20 ? UNP Q5SKW1 ? ? 'expression tag'        0   40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6KQD 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.19 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.46 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.05 M Magnesium chloride, 0.2 M Potassium chloride, 0.1 M Tris-HCl pH 8.0, 10% PEG 4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-10-09 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.075 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6KQD 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.300 
_reflns.d_resolution_low                 45.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       155222 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             91.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.800 
_reflns.pdbx_Rmerge_I_obs                0.092 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.100 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.006 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         433949 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
3.300 3.360  ? ? ? ? ? ? 7932 93.600 ? ? ? ? 0.510 ? ? ? ? ? ? ? ? 2.700 ? 0.901 ? ? ? ? ? 1  1 ? ? 
3.360 3.420  ? ? ? ? ? ? 7776 93.300 ? ? ? ? 0.445 ? ? ? ? ? ? ? ? 2.700 ? 0.881 ? ? ? ? ? 2  1 ? ? 
3.420 3.480  ? ? ? ? ? ? 7931 93.400 ? ? ? ? 0.388 ? ? ? ? ? ? ? ? 2.700 ? 0.897 ? ? ? ? ? 3  1 ? ? 
3.480 3.550  ? ? ? ? ? ? 7819 93.100 ? ? ? ? 0.335 ? ? ? ? ? ? ? ? 2.700 ? 0.914 ? ? ? ? ? 4  1 ? ? 
3.550 3.630  ? ? ? ? ? ? 7830 93.200 ? ? ? ? 0.282 ? ? ? ? ? ? ? ? 2.800 ? 0.954 ? ? ? ? ? 5  1 ? ? 
3.630 3.720  ? ? ? ? ? ? 7864 92.900 ? ? ? ? 0.236 ? ? ? ? ? ? ? ? 2.800 ? 0.958 ? ? ? ? ? 6  1 ? ? 
3.720 3.810  ? ? ? ? ? ? 7764 92.600 ? ? ? ? 0.197 ? ? ? ? ? ? ? ? 2.800 ? 0.955 ? ? ? ? ? 7  1 ? ? 
3.810 3.910  ? ? ? ? ? ? 7786 92.700 ? ? ? ? 0.166 ? ? ? ? ? ? ? ? 2.800 ? 0.944 ? ? ? ? ? 8  1 ? ? 
3.910 4.030  ? ? ? ? ? ? 7855 92.500 ? ? ? ? 0.133 ? ? ? ? ? ? ? ? 2.800 ? 0.982 ? ? ? ? ? 9  1 ? ? 
4.030 4.160  ? ? ? ? ? ? 7790 92.300 ? ? ? ? 0.109 ? ? ? ? ? ? ? ? 2.800 ? 0.990 ? ? ? ? ? 10 1 ? ? 
4.160 4.310  ? ? ? ? ? ? 7744 91.900 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 2.800 ? 1.009 ? ? ? ? ? 11 1 ? ? 
4.310 4.480  ? ? ? ? ? ? 7727 91.800 ? ? ? ? 0.081 ? ? ? ? ? ? ? ? 2.800 ? 1.016 ? ? ? ? ? 12 1 ? ? 
4.480 4.680  ? ? ? ? ? ? 7730 91.400 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 2.800 ? 1.043 ? ? ? ? ? 13 1 ? ? 
4.680 4.930  ? ? ? ? ? ? 7752 91.300 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 2.800 ? 1.069 ? ? ? ? ? 14 1 ? ? 
4.930 5.240  ? ? ? ? ? ? 7698 90.800 ? ? ? ? 0.072 ? ? ? ? ? ? ? ? 2.800 ? 1.018 ? ? ? ? ? 15 1 ? ? 
5.240 5.640  ? ? ? ? ? ? 7661 90.400 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 2.800 ? 1.128 ? ? ? ? ? 16 1 ? ? 
5.640 6.210  ? ? ? ? ? ? 7692 90.000 ? ? ? ? 0.077 ? ? ? ? ? ? ? ? 2.900 ? 1.150 ? ? ? ? ? 17 1 ? ? 
6.210 7.100  ? ? ? ? ? ? 7613 89.300 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 2.800 ? 1.087 ? ? ? ? ? 18 1 ? ? 
7.100 8.940  ? ? ? ? ? ? 7591 88.600 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 2.800 ? 1.071 ? ? ? ? ? 19 1 ? ? 
8.940 45.000 ? ? ? ? ? ? 7667 87.000 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 2.900 ? 1.121 ? ? ? ? ? 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                218.500 
_refine.B_iso_mean                               83.0623 
_refine.B_iso_min                                18.360 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6KQD 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.3000 
_refine.ls_d_res_low                             44.3510 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     154582 
_refine.ls_number_reflns_R_free                  1337 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    91.3000 
_refine.ls_percent_reflns_R_free                 0.8600 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2070 
_refine.ls_R_factor_R_free                       0.2499 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2067 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4G7H 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 28.0200 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4400 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       3.3000 
_refine_hist.d_res_low                        44.3510 
_refine_hist.number_atoms_solvent             107 
_refine_hist.number_atoms_total               57160 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       7060 
_refine_hist.pdbx_B_iso_mean_ligand           97.03 
_refine_hist.pdbx_B_iso_mean_solvent          58.93 
_refine_hist.pdbx_number_atoms_protein        55228 
_refine_hist.pdbx_number_atoms_nucleic_acid   1770 
_refine_hist.pdbx_number_atoms_ligand         55 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.3000 3.4179  . . 133 15364 92.0000 . . . 0.3123 0.0000 0.2882 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4179 3.5547  . . 138 15567 93.0000 . . . 0.2856 0.0000 0.2671 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5547 3.7164  . . 137 15537 93.0000 . . . 0.3486 0.0000 0.2545 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7164 3.9122  . . 135 15395 93.0000 . . . 0.2652 0.0000 0.2313 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9122 4.1572  . . 135 15458 92.0000 . . . 0.2738 0.0000 0.2055 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1572 4.4779  . . 134 15324 92.0000 . . . 0.2520 0.0000 0.1899 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4779 4.9280  . . 135 15304 91.0000 . . . 0.2386 0.0000 0.1775 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9280 5.6398  . . 133 15226 91.0000 . . . 0.2221 0.0000 0.1919 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.6398 7.1009  . . 131 15144 90.0000 . . . 0.2446 0.0000 0.2099 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.1009 44.3510 . . 126 14926 87.0000 . . . 0.1947 0.0000 0.1744 . . . . . . . . . . 
# 
_struct.entry_id                     6KQD 
_struct.title                        
;Thermus thermophilus initial transcription complex comprising sigma A and 5'-OH RNA of 3 nt
;
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6KQD 
_struct_keywords.text            'Thermus thermophilus, RNA polymerase, initiation transcription complex, 3nt RNA, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 2  ? 
D  N N 3  ? 
E  N N 4  ? 
F  N N 5  ? 
G  N N 6  ? 
H  N N 7  ? 
I  N N 8  ? 
J  N N 1  ? 
K  N N 1  ? 
L  N N 2  ? 
M  N N 3  ? 
N  N N 4  ? 
O  N N 5  ? 
P  N N 6  ? 
Q  N N 7  ? 
R  N N 8  ? 
S  N N 9  ? 
T  N N 10 ? 
U  N N 10 ? 
V  N N 9  ? 
W  N N 9  ? 
X  N N 9  ? 
Y  N N 11 ? 
Z  N N 9  ? 
AA N N 10 ? 
BA N N 10 ? 
CA N N 9  ? 
DA N N 9  ? 
EA N N 11 ? 
FA N N 12 ? 
GA N N 12 ? 
HA N N 12 ? 
IA N N 12 ? 
JA N N 12 ? 
KA N N 12 ? 
LA N N 12 ? 
MA N N 12 ? 
NA N N 12 ? 
OA N N 12 ? 
PA N N 12 ? 
QA N N 12 ? 
RA N N 12 ? 
SA N N 12 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   AA2 ASP A 74   ? GLU A 84   ? ASP A 74   GLU A 84   1 ? 11 
HELX_P HELX_P3   AA3 ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   AA4 PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   AA5 THR A 206  ? TYR A 224  ? THR A 206  TYR A 224  1 ? 19 
HELX_P HELX_P6   AA6 GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P7   AA7 ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P8   AA8 ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P9   AA9 PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P10  AB1 THR B 206  ? THR B 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P11  AB2 TYR B 224  ? SER B 226  ? TYR B 224  SER B 226  5 ? 3  
HELX_P HELX_P12  AB3 THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P13  AB4 PRO C 35   ? ARG C 39   ? PRO C 35   ARG C 39   5 ? 5  
HELX_P HELX_P14  AB5 VAL C 42   ? PHE C 52   ? VAL C 42   PHE C 52   1 ? 11 
HELX_P HELX_P15  AB6 PRO C 79   ? ASP C 87   ? PRO C 79   ASP C 87   1 ? 9  
HELX_P HELX_P16  AB7 LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P17  AB8 ASP C 203  ? LEU C 211  ? ASP C 203  LEU C 211  1 ? 9  
HELX_P HELX_P18  AB9 TYR C 214  ? MET C 222  ? TYR C 214  MET C 222  1 ? 9  
HELX_P HELX_P19  AC1 ASP C 223  ? MET C 229  ? ASP C 223  MET C 229  1 ? 7  
HELX_P HELX_P20  AC2 ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P21  AC3 LYS C 249  ? ALA C 262  ? LYS C 249  ALA C 262  1 ? 14 
HELX_P HELX_P22  AC4 GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P23  AC5 VAL C 302  ? GLY C 316  ? VAL C 302  GLY C 316  1 ? 15 
HELX_P HELX_P24  AC6 THR C 335  ? MET C 359  ? THR C 335  MET C 359  1 ? 25 
HELX_P HELX_P25  AC7 THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P26  AC8 SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P27  AC9 ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P28  AD1 GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P29  AD2 HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P30  AD3 THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P31  AD4 SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P32  AD5 SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P33  AD6 ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P34  AD7 PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P35  AD8 ASP C 554  ? THR C 566  ? ASP C 554  THR C 566  1 ? 13 
HELX_P HELX_P36  AD9 LEU C 583  ? SER C 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P37  AE1 ASN C 683  ? ALA C 687  ? ASN C 683  ALA C 687  5 ? 5  
HELX_P HELX_P38  AE2 GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P39  AE3 THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P40  AE4 PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P41  AE5 LEU C 874  ? MET C 880  ? LEU C 874  MET C 880  1 ? 7  
HELX_P HELX_P42  AE6 LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P43  AE7 LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P44  AE8 ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P45  AE9 THR C 958  ? LEU C 968  ? THR C 958  LEU C 968  1 ? 11 
HELX_P HELX_P46  AF1 MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P47  AF2 GLY C 1033 ? GLY C 1044 ? GLY C 1033 GLY C 1044 1 ? 12 
HELX_P HELX_P48  AF3 ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P49  AF4 ASP C 1059 ? GLY C 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P50  AF5 PRO C 1082 ? LEU C 1095 ? PRO C 1082 LEU C 1095 1 ? 14 
HELX_P HELX_P51  AF6 SER D 14   ? TRP D 21   ? SER D 14   TRP D 21   1 ? 8  
HELX_P HELX_P52  AF7 LYS D 82   ? TYR D 88   ? LYS D 82   TYR D 88   5 ? 7  
HELX_P HELX_P53  AF8 ILE D 102  ? ASP D 107  ? ILE D 102  ASP D 107  1 ? 6  
HELX_P HELX_P54  AF9 SER D 110  ? ASP D 117  ? SER D 110  ASP D 117  1 ? 8  
HELX_P HELX_P55  AG1 SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P56  AG2 THR D 154  ? GLY D 164  ? THR D 154  GLY D 164  1 ? 11 
HELX_P HELX_P57  AG3 ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P58  AG4 MET D 456  ? GLU D 467  ? MET D 456  GLU D 467  1 ? 12 
HELX_P HELX_P59  AG5 ASP D 469  ? MET D 481  ? ASP D 469  MET D 481  1 ? 13 
HELX_P HELX_P60  AG6 SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P61  AG7 ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P62  AG8 PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P63  AG9 SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P64  AH1 PRO D 563  ? ASP D 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P65  AH2 SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P66  AH3 GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P67  AH4 LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P68  AH5 PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P69  AH6 ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P70  AH7 GLN D 680  ? ILE D 683  ? GLN D 680  ILE D 683  5 ? 4  
HELX_P HELX_P71  AH8 ASP D 685  ? HIS D 696  ? ASP D 685  HIS D 696  1 ? 12 
HELX_P HELX_P72  AH9 HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P73  AI1 HIS D 729  ? LEU D 731  ? HIS D 729  LEU D 731  5 ? 3  
HELX_P HELX_P74  AI2 VAL D 732  ? ASN D 737  ? VAL D 732  ASN D 737  1 ? 6  
HELX_P HELX_P75  AI3 SER D 752  ? GLN D 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P76  AI4 LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P77  AI5 ARG D 783  ? GLN D 794  ? ARG D 783  GLN D 794  1 ? 12 
HELX_P HELX_P78  AI6 THR D 808  ? ARG D 818  ? THR D 808  ARG D 818  1 ? 11 
HELX_P HELX_P79  AI7 SER D 835  ? TYR D 841  ? SER D 835  TYR D 841  1 ? 7  
HELX_P HELX_P80  AI8 ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P81  AI9 SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P82  AJ1 ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P83  AJ2 GLU D 907  ? GLY D 946  ? GLU D 907  GLY D 946  1 ? 40 
HELX_P HELX_P84  AJ3 GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P85  AJ4 GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P86  AJ5 THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P87  AJ6 ASN D 1018 ? SER D 1026 ? ASN D 1018 SER D 1026 1 ? 9  
HELX_P HELX_P88  AJ7 ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P89  AJ8 THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P90  AJ9 LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P91  AK1 SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P92  AK2 GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P93  AK3 ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P94  AK4 PRO D 1232 ? LEU D 1236 ? PRO D 1232 LEU D 1236 5 ? 5  
HELX_P HELX_P95  AK5 GLY D 1255 ? GLU D 1264 ? GLY D 1255 GLU D 1264 1 ? 10 
HELX_P HELX_P96  AK6 ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P97  AK7 GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P98  AK8 HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P99  AK9 LYS D 1397 ? ALA D 1409 ? LYS D 1397 ALA D 1409 1 ? 13 
HELX_P HELX_P100 AL1 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P101 AL2 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P102 AL3 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P103 AL4 GLY D 1461 ? LEU D 1468 ? GLY D 1461 LEU D 1468 1 ? 8  
HELX_P HELX_P104 AL5 ALA D 1474 ? SER D 1478 ? ALA D 1474 SER D 1478 5 ? 5  
HELX_P HELX_P105 AL6 GLN D 1489 ? GLU D 1501 ? GLN D 1489 GLU D 1501 1 ? 13 
HELX_P HELX_P106 AL7 GLY E 5    ? MET E 12   ? GLY E 5    MET E 12   1 ? 8  
HELX_P HELX_P107 AL8 SER E 15   ? HIS E 33   ? SER E 15   HIS E 33   1 ? 19 
HELX_P HELX_P108 AL9 GLU E 41   ? ARG E 45   ? GLU E 41   ARG E 45   5 ? 5  
HELX_P HELX_P109 AM1 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P110 AM2 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P111 AM3 ASP F 99   ? GLY F 109  ? ASP F 79   GLY F 89   1 ? 11 
HELX_P HELX_P112 AM4 THR F 115  ? GLY F 141  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P113 AM5 ASP F 143  ? GLY F 157  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P114 AM6 ASP F 172  ? LYS F 184  ? ASP F 152  LYS F 164  1 ? 13 
HELX_P HELX_P115 AM7 PRO F 187  ? ASN F 211  ? PRO F 167  ASN F 191  1 ? 25 
HELX_P HELX_P116 AM8 ASN F 211  ? LYS F 220  ? ASN F 191  LYS F 200  1 ? 10 
HELX_P HELX_P117 AM9 SER F 228  ? PHE F 247  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P118 AN1 GLU F 248  ? ARG F 252  ? GLU F 228  ARG F 232  5 ? 5  
HELX_P HELX_P119 AN2 LYS F 254  ? ALA F 275  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P120 AN3 PRO F 281  ? GLY F 303  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P121 AN4 THR F 307  ? GLY F 316  ? THR F 287  GLY F 296  1 ? 10 
HELX_P HELX_P122 AN5 ASP F 320  ? ALA F 331  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P123 AN6 PHE F 348  ? ILE F 353  ? PHE F 328  ILE F 333  5 ? 6  
HELX_P HELX_P124 AN7 SER F 360  ? SER F 379  ? SER F 340  SER F 359  1 ? 20 
HELX_P HELX_P125 AN8 SER F 382  ? LYS F 393  ? SER F 362  LYS F 373  1 ? 12 
HELX_P HELX_P126 AN9 THR F 402  ? GLY F 411  ? THR F 382  GLY F 391  1 ? 10 
HELX_P HELX_P127 AO1 THR F 413  ? ARG F 436  ? THR F 393  ARG F 416  1 ? 24 
HELX_P HELX_P128 AO2 ARG F 439  ? ASP F 443  ? ARG F 419  ASP F 423  5 ? 5  
HELX_P HELX_P129 AO3 GLY J 31   ? SER J 47   ? GLY K 31   SER K 47   1 ? 17 
HELX_P HELX_P130 AO4 ASP J 74   ? LYS J 83   ? ASP K 74   LYS K 83   1 ? 10 
HELX_P HELX_P131 AO5 ARG J 112  ? PHE J 114  ? ARG K 112  PHE K 114  5 ? 3  
HELX_P HELX_P132 AO6 PRO J 152  ? GLY J 157  ? PRO K 152  GLY K 157  1 ? 6  
HELX_P HELX_P133 AO7 THR J 206  ? TYR J 224  ? THR K 206  TYR K 224  1 ? 19 
HELX_P HELX_P134 AO8 GLY K 31   ? SER K 47   ? GLY L 31   SER L 47   1 ? 17 
HELX_P HELX_P135 AO9 ASP K 74   ? GLU K 84   ? ASP L 74   GLU L 84   1 ? 11 
HELX_P HELX_P136 AP1 ARG K 112  ? PHE K 114  ? ARG L 112  PHE L 114  5 ? 3  
HELX_P HELX_P137 AP2 PRO K 152  ? GLY K 157  ? PRO L 152  GLY L 157  1 ? 6  
HELX_P HELX_P138 AP3 THR K 206  ? THR K 223  ? THR L 206  THR L 223  1 ? 18 
HELX_P HELX_P139 AP4 TYR K 224  ? SER K 226  ? TYR L 224  SER L 226  5 ? 3  
HELX_P HELX_P140 AP5 THR L 19   ? GLN L 31   ? THR M 19   GLN M 31   1 ? 13 
HELX_P HELX_P141 AP6 PRO L 35   ? ARG L 39   ? PRO M 35   ARG M 39   5 ? 5  
HELX_P HELX_P142 AP7 VAL L 42   ? PHE L 52   ? VAL M 42   PHE M 52   1 ? 11 
HELX_P HELX_P143 AP8 PRO L 79   ? ASP L 87   ? PRO M 79   ASP M 87   1 ? 9  
HELX_P HELX_P144 AP9 LEU L 193  ? LEU L 200  ? LEU M 193  LEU M 200  1 ? 8  
HELX_P HELX_P145 AQ1 ASP L 203  ? GLY L 212  ? ASP M 203  GLY M 212  1 ? 10 
HELX_P HELX_P146 AQ2 GLU L 216  ? MET L 222  ? GLU M 216  MET M 222  1 ? 7  
HELX_P HELX_P147 AQ3 ASP L 223  ? MET L 229  ? ASP M 223  MET M 229  1 ? 7  
HELX_P HELX_P148 AQ4 ARG L 230  ? ARG L 243  ? ARG M 230  ARG M 243  1 ? 14 
HELX_P HELX_P149 AQ5 LYS L 249  ? ALA L 262  ? LYS M 249  ALA M 262  1 ? 14 
HELX_P HELX_P150 AQ6 GLY L 270  ? GLY L 282  ? GLY M 270  GLY M 282  1 ? 13 
HELX_P HELX_P151 AQ7 VAL L 302  ? GLY L 316  ? VAL M 302  GLY M 316  1 ? 15 
HELX_P HELX_P152 AQ8 THR L 335  ? MET L 359  ? THR M 335  MET M 359  1 ? 25 
HELX_P HELX_P153 AQ9 THR L 368  ? VAL L 373  ? THR M 368  VAL M 373  1 ? 6  
HELX_P HELX_P154 AR1 SER L 375  ? SER L 389  ? SER M 375  SER M 389  1 ? 15 
HELX_P HELX_P155 AR2 ASN L 399  ? LYS L 407  ? ASN M 399  LYS M 407  1 ? 9  
HELX_P HELX_P156 AR3 GLY L 424  ? ASP L 429  ? GLY M 424  ASP M 429  1 ? 6  
HELX_P HELX_P157 AR4 HIS L 431  ? TYR L 435  ? HIS M 431  TYR M 435  5 ? 5  
HELX_P HELX_P158 AR5 THR L 487  ? ASP L 492  ? THR M 487  ASP M 492  1 ? 6  
HELX_P HELX_P159 AR6 SER L 525  ? VAL L 529  ? SER M 525  VAL M 529  5 ? 5  
HELX_P HELX_P160 AR7 SER L 535  ? PHE L 540  ? SER M 535  PHE M 540  5 ? 6  
HELX_P HELX_P161 AR8 ASN L 543  ? ILE L 547  ? ASN M 543  ILE M 547  5 ? 5  
HELX_P HELX_P162 AR9 PHE L 549  ? ASP L 553  ? PHE M 549  ASP M 553  5 ? 5  
HELX_P HELX_P163 AS1 ASP L 554  ? THR L 566  ? ASP M 554  THR M 566  1 ? 13 
HELX_P HELX_P164 AS2 LEU L 583  ? SER L 591  ? LEU M 583  SER M 591  1 ? 9  
HELX_P HELX_P165 AS3 ASN L 683  ? ALA L 687  ? ASN M 683  ALA M 687  5 ? 5  
HELX_P HELX_P166 AS4 GLU L 692  ? ARG L 697  ? GLU M 692  ARG M 697  1 ? 6  
HELX_P HELX_P167 AS5 SER L 730  ? ARG L 735  ? SER M 730  ARG M 735  1 ? 6  
HELX_P HELX_P168 AS6 THR L 768  ? GLY L 779  ? THR M 768  GLY M 779  1 ? 12 
HELX_P HELX_P169 AS7 PRO L 854  ? MET L 858  ? PRO M 854  MET M 858  5 ? 5  
HELX_P HELX_P170 AS8 LEU L 874  ? MET L 880  ? LEU M 874  MET M 880  1 ? 7  
HELX_P HELX_P171 AS9 LEU L 882  ? GLY L 898  ? LEU M 882  GLY M 898  1 ? 17 
HELX_P HELX_P172 AT1 LYS L 910  ? GLU L 932  ? LYS M 910  GLU M 932  1 ? 23 
HELX_P HELX_P173 AT2 ASP L 937  ? LEU L 950  ? ASP M 937  LEU M 950  1 ? 14 
HELX_P HELX_P174 AT3 THR L 958  ? GLN L 969  ? THR M 958  GLN M 969  1 ? 12 
HELX_P HELX_P175 AT4 MET L 1000 ? MET L 1005 ? MET M 1000 MET M 1005 1 ? 6  
HELX_P HELX_P176 AT5 GLY L 1033 ? GLY L 1044 ? GLY M 1033 GLY M 1044 1 ? 12 
HELX_P HELX_P177 AT6 ALA L 1045 ? THR L 1054 ? ALA M 1045 THR M 1054 1 ? 10 
HELX_P HELX_P178 AT7 ASP L 1059 ? LYS L 1072 ? ASP M 1059 LYS M 1072 1 ? 14 
HELX_P HELX_P179 AT8 PRO L 1082 ? ALA L 1094 ? PRO M 1082 ALA M 1094 1 ? 13 
HELX_P HELX_P180 AT9 SER M 14   ? TRP M 21   ? SER N 14   TRP N 21   1 ? 8  
HELX_P HELX_P181 AU1 LYS M 82   ? TYR M 88   ? LYS N 82   TYR N 88   5 ? 7  
HELX_P HELX_P182 AU2 ILE M 102  ? ASP M 107  ? ILE N 102  ASP N 107  1 ? 6  
HELX_P HELX_P183 AU3 SER M 110  ? ASP M 117  ? SER N 110  ASP N 117  1 ? 8  
HELX_P HELX_P184 AU4 SER M 119  ? TYR M 128  ? SER N 119  TYR N 128  1 ? 10 
HELX_P HELX_P185 AU5 THR M 154  ? GLY M 164  ? THR N 154  GLY N 164  1 ? 11 
HELX_P HELX_P186 AU6 ALA M 228  ? TRP M 230  ? ALA N 228  TRP N 230  5 ? 3  
HELX_P HELX_P187 AU7 ASP M 423  ? LYS M 426  ? ASP N 423  LYS N 426  5 ? 4  
HELX_P HELX_P188 AU8 MET M 456  ? GLU M 467  ? MET N 456  GLU N 467  1 ? 12 
HELX_P HELX_P189 AU9 ASP M 469  ? MET M 481  ? ASP N 469  MET N 481  1 ? 13 
HELX_P HELX_P190 AV1 SER M 485  ? GLY M 506  ? SER N 485  GLY N 506  1 ? 22 
HELX_P HELX_P191 AV2 ARG M 508  ? TRP M 511  ? ARG N 508  TRP N 511  5 ? 4  
HELX_P HELX_P192 AV3 PRO M 521  ? ARG M 525  ? PRO N 521  ARG N 525  5 ? 5  
HELX_P HELX_P193 AV4 SER M 538  ? GLN M 560  ? SER N 538  GLN N 560  1 ? 23 
HELX_P HELX_P194 AV5 PRO M 563  ? ASP M 583  ? PRO N 563  ASP N 583  1 ? 21 
HELX_P HELX_P195 AV6 SER M 602  ? SER M 608  ? SER N 602  SER N 608  1 ? 7  
HELX_P HELX_P196 AV7 GLY M 612  ? LEU M 618  ? GLY N 612  LEU N 618  1 ? 7  
HELX_P HELX_P197 AV8 LYS M 646  ? PHE M 653  ? LYS N 646  PHE N 653  1 ? 8  
HELX_P HELX_P198 AV9 PHE M 653  ? LYS M 664  ? PHE N 653  LYS N 664  1 ? 12 
HELX_P HELX_P199 AW1 ASN M 669  ? ARG M 679  ? ASN N 669  ARG N 679  1 ? 11 
HELX_P HELX_P200 AW2 GLN M 680  ? ILE M 683  ? GLN N 680  ILE N 683  5 ? 4  
HELX_P HELX_P201 AW3 ASP M 685  ? ILE M 695  ? ASP N 685  ILE N 695  1 ? 11 
HELX_P HELX_P202 AW4 HIS M 709  ? LEU M 711  ? HIS N 709  LEU N 711  5 ? 3  
HELX_P HELX_P203 AW5 HIS M 729  ? GLU M 734  ? HIS N 729  GLU N 734  5 ? 6  
HELX_P HELX_P204 AW6 SER M 752  ? GLN M 762  ? SER N 752  GLN N 762  1 ? 11 
HELX_P HELX_P205 AW7 LEU M 764  ? ASN M 768  ? LEU N 764  ASN N 768  5 ? 5  
HELX_P HELX_P206 AW8 SER M 782  ? GLN M 794  ? SER N 782  GLN N 794  1 ? 13 
HELX_P HELX_P207 AW9 THR M 808  ? ARG M 818  ? THR N 808  ARG N 818  1 ? 11 
HELX_P HELX_P208 AX1 SER M 835  ? TYR M 841  ? SER N 835  TYR N 841  1 ? 7  
HELX_P HELX_P209 AX2 ASN M 845  ? HIS M 855  ? ASN N 845  HIS N 855  1 ? 11 
HELX_P HELX_P210 AX3 SER M 876  ? GLU M 891  ? SER N 876  GLU N 891  1 ? 16 
HELX_P HELX_P211 AX4 ASP M 892  ? ILE M 900  ? ASP N 892  ILE N 900  1 ? 9  
HELX_P HELX_P212 AX5 GLU M 907  ? GLY M 946  ? GLU N 907  GLY N 946  1 ? 40 
HELX_P HELX_P213 AX6 GLY M 950  ? ALA M 954  ? GLY N 950  ALA N 954  5 ? 5  
HELX_P HELX_P214 AX7 GLU M 958  ? MET M 980  ? GLU N 958  MET N 980  1 ? 23 
HELX_P HELX_P215 AX8 THR M 984  ? TYR M 1015 ? THR N 984  TYR N 1015 1 ? 32 
HELX_P HELX_P216 AX9 ASN M 1018 ? SER M 1026 ? ASN N 1018 SER N 1026 1 ? 9  
HELX_P HELX_P217 AY1 ASN M 1031 ? GLY M 1040 ? ASN N 1031 GLY N 1040 1 ? 10 
HELX_P HELX_P218 AY2 THR M 1066 ? HIS M 1103 ? THR N 1066 HIS N 1103 1 ? 38 
HELX_P HELX_P219 AY3 LYS M 1136 ? TYR M 1145 ? LYS N 1136 TYR N 1145 1 ? 10 
HELX_P HELX_P220 AY4 SER M 1167 ? ALA M 1180 ? SER N 1167 ALA N 1180 1 ? 14 
HELX_P HELX_P221 AY5 CYS M 1201 ? GLY M 1206 ? CYS N 1201 GLY N 1206 1 ? 6  
HELX_P HELX_P222 AY6 ALA M 1220 ? GLU M 1231 ? ALA N 1220 GLU N 1231 1 ? 12 
HELX_P HELX_P223 AY7 PRO M 1232 ? LEU M 1236 ? PRO N 1232 LEU N 1236 5 ? 5  
HELX_P HELX_P224 AY8 GLY M 1255 ? GLU M 1264 ? GLY N 1255 GLU N 1264 1 ? 10 
HELX_P HELX_P225 AY9 ASP M 1331 ? GLY M 1340 ? ASP N 1331 GLY N 1340 1 ? 10 
HELX_P HELX_P226 AZ1 GLY M 1340 ? GLN M 1359 ? GLY N 1340 GLN N 1359 1 ? 20 
HELX_P HELX_P227 AZ2 HIS M 1364 ? MET M 1376 ? HIS N 1364 MET N 1376 1 ? 13 
HELX_P HELX_P228 AZ3 LYS M 1397 ? GLU M 1410 ? LYS N 1397 GLU N 1410 1 ? 14 
HELX_P HELX_P229 AZ4 GLY M 1423 ? SER M 1430 ? GLY N 1423 SER N 1430 1 ? 8  
HELX_P HELX_P230 AZ5 SER M 1433 ? GLN M 1441 ? SER N 1433 GLN N 1441 1 ? 9  
HELX_P HELX_P231 AZ6 ASN M 1442 ? GLY M 1454 ? ASN N 1442 GLY N 1454 1 ? 13 
HELX_P HELX_P232 AZ7 GLY M 1461 ? LEU M 1468 ? GLY N 1461 LEU N 1468 1 ? 8  
HELX_P HELX_P233 AZ8 ALA M 1474 ? SER M 1478 ? ALA N 1474 SER N 1478 5 ? 5  
HELX_P HELX_P234 AZ9 GLN M 1489 ? ALA M 1502 ? GLN N 1489 ALA N 1502 1 ? 14 
HELX_P HELX_P235 BA1 GLY N 5    ? MET N 12   ? GLY O 5    MET O 12   1 ? 8  
HELX_P HELX_P236 BA2 SER N 15   ? HIS N 33   ? SER O 15   HIS O 33   1 ? 19 
HELX_P HELX_P237 BA3 ASN N 59   ? GLY N 71   ? ASN O 59   GLY O 71   1 ? 13 
HELX_P HELX_P238 BA4 PRO N 81   ? TYR N 93   ? PRO O 81   TYR O 93   1 ? 13 
HELX_P HELX_P239 BA5 ASP O 99   ? GLY O 109  ? ASP P 79   GLY P 89   1 ? 11 
HELX_P HELX_P240 BA6 THR O 115  ? GLY O 141  ? THR P 95   GLY P 121  1 ? 27 
HELX_P HELX_P241 BA7 ASP O 143  ? GLY O 157  ? ASP P 123  GLY P 137  1 ? 15 
HELX_P HELX_P242 BA8 ASP O 172  ? LYS O 184  ? ASP P 152  LYS P 164  1 ? 13 
HELX_P HELX_P243 BA9 PRO O 187  ? ASN O 211  ? PRO P 167  ASN P 191  1 ? 25 
HELX_P HELX_P244 BB1 ASN O 211  ? LYS O 220  ? ASN P 191  LYS P 200  1 ? 10 
HELX_P HELX_P245 BB2 SER O 228  ? PHE O 247  ? SER P 208  PHE P 227  1 ? 20 
HELX_P HELX_P246 BB3 GLU O 248  ? ARG O 252  ? GLU P 228  ARG P 232  5 ? 5  
HELX_P HELX_P247 BB4 LYS O 254  ? ALA O 275  ? LYS P 234  ALA P 255  1 ? 22 
HELX_P HELX_P248 BB5 PRO O 281  ? GLY O 303  ? PRO P 261  GLY P 283  1 ? 23 
HELX_P HELX_P249 BB6 THR O 307  ? MET O 315  ? THR P 287  MET P 295  1 ? 9  
HELX_P HELX_P250 BB7 ASP O 320  ? ALA O 331  ? ASP P 300  ALA P 311  1 ? 12 
HELX_P HELX_P251 BB8 PHE O 348  ? ILE O 353  ? PHE P 328  ILE P 333  5 ? 6  
HELX_P HELX_P252 BB9 SER O 360  ? SER O 379  ? SER P 340  SER P 359  1 ? 20 
HELX_P HELX_P253 BC1 SER O 382  ? GLY O 394  ? SER P 362  GLY P 374  1 ? 13 
HELX_P HELX_P254 BC2 THR O 402  ? GLY O 411  ? THR P 382  GLY P 391  1 ? 10 
HELX_P HELX_P255 BC3 THR O 413  ? ARG O 436  ? THR P 393  ARG P 416  1 ? 24 
HELX_P HELX_P256 BC4 ARG O 439  ? ASP O 443  ? ARG P 419  ASP P 423  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B  ASP 183  OD1   ? ? ? 1_555 S  MG  .  MG ? ? B ASP 183  B MG  2001 1_555 ? ? ? ? ? ? ?            2.511 ? 
metalc2  metalc ? ? B  ASP 193  OD1   ? ? ? 1_555 S  MG  .  MG ? ? B ASP 193  B MG  2001 1_555 ? ? ? ? ? ? ?            2.996 ? 
metalc3  metalc ? ? D  CYS 58   SG    ? ? ? 1_555 U  ZN  .  ZN ? ? D CYS 58   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.671 ? 
metalc4  metalc ? ? D  CYS 60   SG    ? ? ? 1_555 U  ZN  .  ZN ? ? D CYS 60   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.421 ? 
metalc5  metalc ? ? D  CYS 73   SG    ? ? ? 1_555 U  ZN  .  ZN ? ? D CYS 73   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.429 ? 
metalc6  metalc ? ? D  CYS 76   SG    ? ? ? 1_555 U  ZN  .  ZN ? ? D CYS 76   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.277 ? 
metalc7  metalc ? ? D  ASP 739  OD1   ? ? ? 1_555 V  MG  .  MG ? ? D ASP 739  D MG  2003 1_555 ? ? ? ? ? ? ?            1.912 ? 
metalc8  metalc ? ? D  ASP 741  OD1   ? ? ? 1_555 V  MG  .  MG ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.207 ? 
metalc9  metalc ? ? D  ASP 741  OD2   ? ? ? 1_555 V  MG  .  MG ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.746 ? 
metalc10 metalc ? ? D  ASP 743  OD1   ? ? ? 1_555 V  MG  .  MG ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?            2.226 ? 
metalc11 metalc ? ? D  LYS 840  O     ? ? ? 1_555 W  MG  .  MG ? ? D LYS 840  D MG  2004 1_555 ? ? ? ? ? ? ?            2.198 ? 
metalc12 metalc ? ? D  CYS 1112 SG    ? ? ? 1_555 T  ZN  .  ZN ? ? D CYS 1112 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.244 ? 
metalc13 metalc ? ? D  CYS 1194 SG    ? ? ? 1_555 T  ZN  .  ZN ? ? D CYS 1194 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.546 ? 
metalc14 metalc ? ? D  CYS 1201 SG    ? ? ? 1_555 T  ZN  .  ZN ? ? D CYS 1201 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.235 ? 
metalc15 metalc ? ? D  CYS 1204 SG    ? ? ? 1_555 T  ZN  .  ZN ? ? D CYS 1204 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.206 ? 
metalc16 metalc ? ? F  ALA 312  O     ? ? ? 1_555 X  MG  .  MG ? ? F ALA 292  F MG  2001 1_555 ? ? ? ? ? ? ?            2.786 ? 
metalc17 metalc ? ? F  GLY 316  O     ? ? ? 1_555 X  MG  .  MG ? ? F GLY 296  F MG  2001 1_555 ? ? ? ? ? ? ?            2.620 ? 
metalc18 metalc ? ? F  TRP 319  O     ? ? ? 1_555 X  MG  .  MG ? ? F TRP 299  F MG  2001 1_555 ? ? ? ? ? ? ?            2.566 ? 
metalc19 metalc ? ? I  A   3    "O3'" ? ? ? 1_555 V  MG  .  MG ? ? I A   3    D MG  2003 1_555 ? ? ? ? ? ? ?            2.091 ? 
metalc20 metalc ? ? J  VAL 170  O     ? ? ? 1_555 Z  MG  .  MG ? ? K VAL 170  K MG  1001 1_555 ? ? ? ? ? ? ?            2.766 ? 
metalc21 metalc ? ? M  CYS 58   SG    ? ? ? 1_555 BA ZN  .  ZN ? ? N CYS 58   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.440 ? 
metalc22 metalc ? ? M  CYS 60   SG    ? ? ? 1_555 BA ZN  .  ZN ? ? N CYS 60   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.426 ? 
metalc23 metalc ? ? M  CYS 73   SG    ? ? ? 1_555 BA ZN  .  ZN ? ? N CYS 73   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.465 ? 
metalc24 metalc ? ? M  CYS 76   SG    ? ? ? 1_555 BA ZN  .  ZN ? ? N CYS 76   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.470 ? 
metalc25 metalc ? ? M  ASP 739  OD1   ? ? ? 1_555 CA MG  .  MG ? ? N ASP 739  N MG  2003 1_555 ? ? ? ? ? ? ?            1.967 ? 
metalc26 metalc ? ? M  ASP 741  OD1   ? ? ? 1_555 CA MG  .  MG ? ? N ASP 741  N MG  2003 1_555 ? ? ? ? ? ? ?            2.430 ? 
metalc27 metalc ? ? M  ASP 743  OD1   ? ? ? 1_555 CA MG  .  MG ? ? N ASP 743  N MG  2003 1_555 ? ? ? ? ? ? ?            2.496 ? 
metalc28 metalc ? ? M  ASP 743  OD2   ? ? ? 1_555 CA MG  .  MG ? ? N ASP 743  N MG  2003 1_555 ? ? ? ? ? ? ?            2.834 ? 
metalc29 metalc ? ? M  LYS 840  O     ? ? ? 1_555 DA MG  .  MG ? ? N LYS 840  N MG  2004 1_555 ? ? ? ? ? ? ?            2.124 ? 
metalc30 metalc ? ? M  CYS 1112 SG    ? ? ? 1_555 AA ZN  .  ZN ? ? N CYS 1112 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.335 ? 
metalc31 metalc ? ? M  CYS 1194 SG    ? ? ? 1_555 AA ZN  .  ZN ? ? N CYS 1194 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.517 ? 
metalc32 metalc ? ? M  CYS 1201 SG    ? ? ? 1_555 AA ZN  .  ZN ? ? N CYS 1201 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.206 ? 
metalc33 metalc ? ? M  CYS 1204 SG    ? ? ? 1_555 AA ZN  .  ZN ? ? N CYS 1204 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.255 ? 
metalc34 metalc ? ? R  A   3    "O3'" ? ? ? 1_555 CA MG  .  MG ? ? S A   3    N MG  2003 1_555 ? ? ? ? ? ? ?            2.088 ? 
metalc35 metalc ? ? Z  MG  .    MG    ? ? ? 1_555 MA HOH .  O  ? ? K MG  1001 K HOH 1102 1_555 ? ? ? ? ? ? ?            2.612 ? 
metalc36 metalc ? ? DA MG  .    MG    ? ? ? 1_555 PA HOH .  O  ? ? N MG  2004 N HOH 2102 1_555 ? ? ? ? ? ? ?            2.033 ? 
hydrog1  hydrog ? ? G  DG  4    N1    ? ? ? 1_555 H  DC  24 N3 ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? G  DG  4    N2    ? ? ? 1_555 H  DC  24 O2 ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? G  DG  4    O6    ? ? ? 1_555 H  DC  24 N4 ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? G  DC  5    N3    ? ? ? 1_555 H  DG  23 N1 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? G  DC  5    N4    ? ? ? 1_555 H  DG  23 O6 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? G  DC  5    O2    ? ? ? 1_555 H  DG  23 N2 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? G  DA  6    N1    ? ? ? 1_555 H  DT  22 N3 ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? G  DA  6    N6    ? ? ? 1_555 H  DT  22 O4 ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? G  DT  7    N3    ? ? ? 1_555 H  DA  21 N1 ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? G  DT  7    O4    ? ? ? 1_555 H  DA  21 N6 ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? G  DC  8    N3    ? ? ? 1_555 H  DG  20 N1 ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? G  DC  8    N4    ? ? ? 1_555 H  DG  20 O6 ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? G  DC  8    O2    ? ? ? 1_555 H  DG  20 N2 ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? G  DC  9    N3    ? ? ? 1_555 H  DG  19 N1 ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? G  DC  9    N4    ? ? ? 1_555 H  DG  19 O6 ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? G  DC  9    O2    ? ? ? 1_555 H  DG  19 N2 ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? G  DG  10   N1    ? ? ? 1_555 H  DC  18 N3 ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? G  DG  10   N2    ? ? ? 1_555 H  DC  18 O2 ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? G  DG  10   O6    ? ? ? 1_555 H  DC  18 N4 ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? G  DT  11   N3    ? ? ? 1_555 H  DA  17 N1 ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? G  DT  11   O4    ? ? ? 1_555 H  DA  17 N6 ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? G  DG  12   N1    ? ? ? 1_555 H  DC  16 N3 ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? G  DG  12   N2    ? ? ? 1_555 H  DC  16 O2 ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? G  DG  12   O6    ? ? ? 1_555 H  DC  16 N4 ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? G  DA  13   N1    ? ? ? 1_555 H  DT  15 N3 ? ? G DA  13   H DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? G  DA  13   N6    ? ? ? 1_555 H  DT  15 O4 ? ? G DA  13   H DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? G  DT  15   N3    ? ? ? 1_555 I  A   3  N1 ? ? G DT  15   I A   3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? G  DT  15   O4    ? ? ? 1_555 I  A   3  N6 ? ? G DT  15   I A   3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? G  DC  16   N3    ? ? ? 1_555 I  G   2  N1 ? ? G DC  16   I G   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? G  DC  16   N4    ? ? ? 1_555 I  G   2  O6 ? ? G DC  16   I G   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? G  DC  16   O2    ? ? ? 1_555 I  G   2  N2 ? ? G DC  16   I G   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? G  DC  17   N3    ? ? ? 1_555 I  G   1  N1 ? ? G DC  17   I G   1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? G  DC  17   N4    ? ? ? 1_555 I  G   1  O6 ? ? G DC  17   I G   1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? G  DC  17   O2    ? ? ? 1_555 I  G   1  N2 ? ? G DC  17   I G   1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? P  DG  4    N1    ? ? ? 1_555 Q  DC  24 N3 ? ? Q DG  4    R DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? P  DG  4    N2    ? ? ? 1_555 Q  DC  24 O2 ? ? Q DG  4    R DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? P  DG  4    O6    ? ? ? 1_555 Q  DC  24 N4 ? ? Q DG  4    R DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? P  DC  5    N3    ? ? ? 1_555 Q  DG  23 N1 ? ? Q DC  5    R DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? P  DC  5    N4    ? ? ? 1_555 Q  DG  23 O6 ? ? Q DC  5    R DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? P  DC  5    O2    ? ? ? 1_555 Q  DG  23 N2 ? ? Q DC  5    R DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? P  DA  6    N1    ? ? ? 1_555 Q  DT  22 N3 ? ? Q DA  6    R DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? P  DA  6    N6    ? ? ? 1_555 Q  DT  22 O4 ? ? Q DA  6    R DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? P  DT  7    N3    ? ? ? 1_555 Q  DA  21 N1 ? ? Q DT  7    R DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? P  DT  7    O4    ? ? ? 1_555 Q  DA  21 N6 ? ? Q DT  7    R DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? P  DC  8    N3    ? ? ? 1_555 Q  DG  20 N1 ? ? Q DC  8    R DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? P  DC  8    N4    ? ? ? 1_555 Q  DG  20 O6 ? ? Q DC  8    R DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? P  DC  8    O2    ? ? ? 1_555 Q  DG  20 N2 ? ? Q DC  8    R DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? P  DC  9    O2    ? ? ? 1_555 Q  DG  19 N2 ? ? Q DC  9    R DG  19   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog49 hydrog ? ? P  DG  10   N1    ? ? ? 1_555 Q  DC  18 N3 ? ? Q DG  10   R DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? P  DG  10   N2    ? ? ? 1_555 Q  DC  18 O2 ? ? Q DG  10   R DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? P  DG  10   O6    ? ? ? 1_555 Q  DC  18 N4 ? ? Q DG  10   R DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? P  DT  11   N3    ? ? ? 1_555 Q  DA  17 N1 ? ? Q DT  11   R DA  17   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog53 hydrog ? ? P  DG  12   N1    ? ? ? 1_555 Q  DC  16 N3 ? ? Q DG  12   R DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? P  DG  12   N2    ? ? ? 1_555 Q  DC  16 O2 ? ? Q DG  12   R DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? P  DG  12   O6    ? ? ? 1_555 Q  DC  16 N4 ? ? Q DG  12   R DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? P  DA  13   N1    ? ? ? 1_555 Q  DT  15 N3 ? ? Q DA  13   R DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? P  DA  13   N6    ? ? ? 1_555 Q  DT  15 O4 ? ? Q DA  13   R DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? P  DT  15   N3    ? ? ? 1_555 R  A   3  N1 ? ? Q DT  15   S A   3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? P  DT  15   O4    ? ? ? 1_555 R  A   3  N6 ? ? Q DT  15   S A   3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? P  DC  16   N3    ? ? ? 1_555 R  G   2  N1 ? ? Q DC  16   S G   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? P  DC  16   N4    ? ? ? 1_555 R  G   2  O6 ? ? Q DC  16   S G   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? P  DC  16   O2    ? ? ? 1_555 R  G   2  N2 ? ? Q DC  16   S G   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? P  DC  17   N3    ? ? ? 1_555 R  G   1  N1 ? ? Q DC  17   S G   1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? P  DC  17   N4    ? ? ? 1_555 R  G   1  O6 ? ? Q DC  17   S G   1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? P  DC  17   O2    ? ? ? 1_555 R  G   1  N2 ? ? Q DC  17   S G   1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -3.52 
2  GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -2.91 
3  PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 3.23  
4  VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -6.04 
5  ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 0.16  
6  GLU 26  J . ? GLU 26  K PRO 27  J ? PRO 27  K 1 -3.93 
7  GLU 26  K . ? GLU 26  L PRO 27  K ? PRO 27  L 1 -4.16 
8  PHE 52  L . ? PHE 52  M PRO 53  L ? PRO 53  M 1 2.65  
9  VAL 108 M . ? VAL 108 N PRO 109 M ? PRO 109 N 1 -5.90 
10 ALA 705 M . ? ALA 705 N PRO 706 M ? PRO 706 N 1 -1.36 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 6 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 5 ? 
AC8 ? 2 ? 
AC9 ? 2 ? 
AD1 ? 8 ? 
AD2 ? 2 ? 
AD3 ? 4 ? 
AD4 ? 3 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 4 ? 
AD8 ? 2 ? 
AD9 ? 5 ? 
AE1 ? 3 ? 
AE2 ? 3 ? 
AE3 ? 4 ? 
AE4 ? 3 ? 
AE5 ? 4 ? 
AE6 ? 2 ? 
AE7 ? 3 ? 
AE8 ? 3 ? 
AE9 ? 3 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
AF4 ? 2 ? 
AF5 ? 4 ? 
AF6 ? 3 ? 
AF7 ? 2 ? 
AF8 ? 2 ? 
AF9 ? 4 ? 
AG1 ? 4 ? 
AG2 ? 2 ? 
AG3 ? 2 ? 
AG4 ? 2 ? 
AG5 ? 4 ? 
AG6 ? 4 ? 
AG7 ? 2 ? 
AG8 ? 2 ? 
AG9 ? 2 ? 
AH1 ? 3 ? 
AH2 ? 3 ? 
AH3 ? 3 ? 
AH4 ? 4 ? 
AH5 ? 5 ? 
AH6 ? 2 ? 
AH7 ? 3 ? 
AH8 ? 6 ? 
AH9 ? 2 ? 
AI1 ? 3 ? 
AI2 ? 4 ? 
AI3 ? 2 ? 
AI4 ? 2 ? 
AI5 ? 8 ? 
AI6 ? 5 ? 
AI7 ? 2 ? 
AI8 ? 2 ? 
AI9 ? 8 ? 
AJ1 ? 2 ? 
AJ2 ? 4 ? 
AJ3 ? 3 ? 
AJ4 ? 3 ? 
AJ5 ? 2 ? 
AJ6 ? 4 ? 
AJ7 ? 2 ? 
AJ8 ? 5 ? 
AJ9 ? 3 ? 
AK1 ? 3 ? 
AK2 ? 4 ? 
AK3 ? 3 ? 
AK4 ? 4 ? 
AK5 ? 2 ? 
AK6 ? 3 ? 
AK7 ? 3 ? 
AK8 ? 3 ? 
AK9 ? 2 ? 
AL1 ? 2 ? 
AL2 ? 2 ? 
AL3 ? 2 ? 
AL4 ? 2 ? 
AL5 ? 4 ? 
AL6 ? 3 ? 
AL7 ? 2 ? 
AL8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? parallel      
AD1 6 7 ? anti-parallel 
AD1 7 8 ? parallel      
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? parallel      
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AD9 4 5 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? parallel      
AE8 1 2 ? parallel      
AE8 2 3 ? anti-parallel 
AE9 1 2 ? parallel      
AE9 2 3 ? anti-parallel 
AF1 1 2 ? parallel      
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF5 3 4 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AF9 2 3 ? anti-parallel 
AF9 3 4 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG1 3 4 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG5 1 2 ? anti-parallel 
AG5 2 3 ? anti-parallel 
AG5 3 4 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG6 3 4 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG9 1 2 ? anti-parallel 
AH1 1 2 ? parallel      
AH1 2 3 ? parallel      
AH2 1 2 ? anti-parallel 
AH2 2 3 ? anti-parallel 
AH3 1 2 ? anti-parallel 
AH3 2 3 ? anti-parallel 
AH4 1 2 ? anti-parallel 
AH4 2 3 ? parallel      
AH4 3 4 ? anti-parallel 
AH5 1 2 ? anti-parallel 
AH5 2 3 ? anti-parallel 
AH5 3 4 ? anti-parallel 
AH5 4 5 ? anti-parallel 
AH6 1 2 ? anti-parallel 
AH7 1 2 ? anti-parallel 
AH7 2 3 ? anti-parallel 
AH8 1 2 ? anti-parallel 
AH8 2 3 ? anti-parallel 
AH8 3 4 ? parallel      
AH8 4 5 ? anti-parallel 
AH8 5 6 ? anti-parallel 
AH9 1 2 ? anti-parallel 
AI1 1 2 ? anti-parallel 
AI1 2 3 ? anti-parallel 
AI2 1 2 ? anti-parallel 
AI2 2 3 ? anti-parallel 
AI2 3 4 ? anti-parallel 
AI3 1 2 ? anti-parallel 
AI4 1 2 ? anti-parallel 
AI5 1 2 ? anti-parallel 
AI5 2 3 ? anti-parallel 
AI5 3 4 ? anti-parallel 
AI5 4 5 ? parallel      
AI5 5 6 ? anti-parallel 
AI5 6 7 ? parallel      
AI5 7 8 ? anti-parallel 
AI6 1 2 ? anti-parallel 
AI6 2 3 ? anti-parallel 
AI6 3 4 ? anti-parallel 
AI6 4 5 ? anti-parallel 
AI7 1 2 ? anti-parallel 
AI8 1 2 ? anti-parallel 
AI9 1 2 ? anti-parallel 
AI9 2 3 ? anti-parallel 
AI9 3 4 ? anti-parallel 
AI9 4 5 ? anti-parallel 
AI9 5 6 ? parallel      
AI9 6 7 ? anti-parallel 
AI9 7 8 ? parallel      
AJ1 1 2 ? anti-parallel 
AJ2 1 2 ? anti-parallel 
AJ2 2 3 ? anti-parallel 
AJ2 3 4 ? anti-parallel 
AJ3 1 2 ? parallel      
AJ3 2 3 ? anti-parallel 
AJ4 1 2 ? anti-parallel 
AJ4 2 3 ? anti-parallel 
AJ5 1 2 ? anti-parallel 
AJ6 1 2 ? anti-parallel 
AJ6 2 3 ? anti-parallel 
AJ6 3 4 ? anti-parallel 
AJ7 1 2 ? anti-parallel 
AJ8 1 2 ? anti-parallel 
AJ8 2 3 ? anti-parallel 
AJ8 3 4 ? anti-parallel 
AJ8 4 5 ? anti-parallel 
AJ9 1 2 ? anti-parallel 
AJ9 2 3 ? anti-parallel 
AK1 1 2 ? anti-parallel 
AK1 2 3 ? anti-parallel 
AK2 1 2 ? anti-parallel 
AK2 2 3 ? anti-parallel 
AK2 3 4 ? anti-parallel 
AK3 1 2 ? anti-parallel 
AK3 2 3 ? anti-parallel 
AK4 1 2 ? anti-parallel 
AK4 2 3 ? anti-parallel 
AK4 3 4 ? anti-parallel 
AK5 1 2 ? anti-parallel 
AK6 1 2 ? anti-parallel 
AK6 2 3 ? parallel      
AK7 1 2 ? parallel      
AK7 2 3 ? anti-parallel 
AK8 1 2 ? parallel      
AK8 2 3 ? anti-parallel 
AK9 1 2 ? parallel      
AL1 1 2 ? anti-parallel 
AL2 1 2 ? anti-parallel 
AL3 1 2 ? anti-parallel 
AL4 1 2 ? parallel      
AL5 1 2 ? anti-parallel 
AL5 2 3 ? anti-parallel 
AL5 3 4 ? anti-parallel 
AL6 1 2 ? anti-parallel 
AL6 2 3 ? anti-parallel 
AL7 1 2 ? anti-parallel 
AL8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
AA1 2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
AA1 3 ARG A 189  ? THR A 201  ? ARG A 189  THR A 201  
AA1 4 VAL A 174  ? LEU A 186  ? VAL A 174  LEU A 186  
AA2 1 THR A 96   ? GLU A 104  ? THR A 96   GLU A 104  
AA2 2 ARG A 137  ? VAL A 148  ? ARG A 137  VAL A 148  
AA2 3 PRO A 49   ? ILE A 58   ? PRO A 49   ILE A 58   
AA2 4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
AA3 1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
AA3 2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
AA4 1 LYS A 107  ? LYS A 110  ? LYS A 107  LYS A 110  
AA4 2 HIS A 128  ? LEU A 132  ? HIS A 128  LEU A 132  
AA5 1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
AA5 2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
AA6 1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
AA6 2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
AA6 3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
AA6 4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
AA7 1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
AA7 2 ARG B 137  ? VAL B 148  ? ARG B 137  VAL B 148  
AA7 3 PRO B 49   ? ILE B 58   ? PRO B 49   ILE B 58   
AA7 4 ALA B 164  ? PRO B 166  ? ALA B 164  PRO B 166  
AA8 1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
AA8 2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
AA9 1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
AA9 2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
AB1 1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
AB1 2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
AB2 1 ILE C 3    ? ARG C 5    ? ILE C 3    ARG C 5    
AB2 2 ARG C 900  ? ILE C 902  ? ARG C 900  ILE C 902  
AB2 3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
AB3 1 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
AB3 2 GLN C 91   ? ILE C 101  ? GLN C 91   ILE C 101  
AB3 3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
AB4 1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
AB4 2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
AB4 3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
AB5 1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
AB5 2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
AB5 3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
AB5 4 THR C 453  ? SER C 454  ? THR C 453  SER C 454  
AB6 1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
AB6 2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
AB6 3 ILE C 172  ? VAL C 176  ? ILE C 172  VAL C 176  
AB6 4 VAL C 182  ? VAL C 186  ? VAL C 182  VAL C 186  
AB6 5 ARG C 189  ? PRO C 192  ? ARG C 189  PRO C 192  
AB7 1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
AB7 2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
AB8 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB8 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB8 3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
AB9 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB9 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB9 3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
AB9 4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
AB9 5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
AB9 6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
AC1 1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
AC1 2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
AC2 1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
AC2 2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
AC2 3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
AC3 1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
AC3 2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
AC3 3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
AC3 4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
AC4 1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
AC4 2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
AC5 1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
AC5 2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
AC6 1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
AC6 2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC6 3 LYS C 838  ? ALA C 840  ? LYS C 838  ALA C 840  
AC6 4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
AC6 5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
AC6 6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
AC6 7 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
AC6 8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC7 1 GLY C 718  ? PRO C 719  ? GLY C 718  PRO C 719  
AC7 2 SER C 702  ? THR C 715  ? SER C 702  THR C 715  
AC7 3 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
AC7 4 GLY C 798  ? LEU C 806  ? GLY C 798  LEU C 806  
AC7 5 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
AC8 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AC8 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AC9 1 THR C 759  ? PHE C 761  ? THR C 759  PHE C 761  
AC9 2 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AD1 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AD1 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD1 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AD1 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AD1 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AD1 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AD1 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AD1 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD2 1 GLN C 1030 ? PHE C 1032 ? GLN C 1030 PHE C 1032 
AD2 2 LYS D 621  ? VAL D 623  ? LYS D 621  VAL D 623  
AD3 1 PRO C 1108 ? VAL C 1109 ? PRO C 1108 VAL C 1109 
AD3 2 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD3 3 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD3 4 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AD4 1 SER D 22   ? GLU D 25   ? SER D 22   GLU D 25   
AD4 2 MET D 90   ? ALA D 100  ? MET D 90   ALA D 100  
AD4 3 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AD5 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AD5 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AD5 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AD6 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AD6 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AD7 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AD7 2 SER D 392  ? VAL D 396  ? SER D 392  VAL D 396  
AD7 3 GLY D 201  ? TYR D 205  ? GLY D 201  TYR D 205  
AD7 4 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AD8 1 GLU D 190  ? ALA D 192  ? GLU D 190  ALA D 192  
AD8 2 VAL D 195  ? VAL D 196  ? VAL D 195  VAL D 196  
AD9 1 VAL D 317  ? GLU D 327  ? VAL D 317  GLU D 327  
AD9 2 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AD9 3 PRO D 208  ? PRO D 226  ? PRO D 208  PRO D 226  
AD9 4 GLY D 383  ? PRO D 390  ? GLY D 383  PRO D 390  
AD9 5 ARG D 360  ? VAL D 361  ? ARG D 360  VAL D 361  
AE1 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE1 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE1 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AE2 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE2 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE2 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AE3 1 PRO D 278  ? LEU D 284  ? PRO D 278  LEU D 284  
AE3 2 ALA D 268  ? ARG D 273  ? ALA D 268  ARG D 273  
AE3 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AE3 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AE4 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AE4 2 LYS D 366  ? ALA D 369  ? LYS D 366  ALA D 369  
AE4 3 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AE5 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AE5 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AE5 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AE5 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AE6 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AE6 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AE7 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AE7 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AE7 3 VAL F 335  ? SER F 336  ? VAL F 315  SER F 316  
AE8 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AE8 2 ILE D 827  ? VAL D 829  ? ILE D 827  VAL D 829  
AE8 3 ARG D 832  ? THR D 834  ? ARG D 832  THR D 834  
AE9 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AE9 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AE9 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AF1 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AF1 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AF2 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AF2 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AF3 1 PHE D 1123 ? ASP D 1126 ? PHE D 1123 ASP D 1126 
AF3 2 SER D 1131 ? LEU D 1134 ? SER D 1131 LEU D 1134 
AF4 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AF4 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AF5 1 SER D 1300 ? TYR D 1303 ? SER D 1300 TYR D 1303 
AF5 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AF5 3 GLY D 1279 ? GLU D 1285 ? GLY D 1279 GLU D 1285 
AF5 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AF6 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AF6 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AF6 3 ALA D 1416 ? LEU D 1420 ? ALA D 1416 LEU D 1420 
AF7 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AF7 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
AF8 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AF8 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
AF9 1 VAL J 10   ? GLN J 16   ? VAL K 10   GLN K 16   
AF9 2 TYR J 20   ? LEU J 28   ? TYR K 20   LEU K 28   
AF9 3 ARG J 189  ? THR J 201  ? ARG K 189  THR K 201  
AF9 4 VAL J 174  ? LEU J 186  ? VAL K 174  LEU K 186  
AG1 1 THR J 96   ? GLU J 104  ? THR K 96   GLU K 104  
AG1 2 ARG J 137  ? GLY J 147  ? ARG K 137  GLY K 147  
AG1 3 GLY J 50   ? ILE J 58   ? GLY K 50   ILE K 58   
AG1 4 ILE J 165  ? PRO J 166  ? ILE K 165  PRO K 166  
AG2 1 VAL J 87   ? PHE J 89   ? VAL K 87   PHE K 89   
AG2 2 VAL J 120  ? ILE J 122  ? VAL K 120  ILE K 122  
AG3 1 GLU J 108  ? LYS J 110  ? GLU K 108  LYS K 110  
AG3 2 HIS J 128  ? THR J 131  ? HIS K 128  THR K 131  
AG4 1 TYR J 150  ? VAL J 151  ? TYR K 150  VAL K 151  
AG4 2 ALA J 169  ? VAL J 170  ? ALA K 169  VAL K 170  
AG5 1 VAL K 10   ? GLN K 16   ? VAL L 10   GLN L 16   
AG5 2 TYR K 20   ? LEU K 28   ? TYR L 20   LEU L 28   
AG5 3 ARG K 189  ? THR K 201  ? ARG L 189  THR L 201  
AG5 4 VAL K 174  ? LEU K 186  ? VAL L 174  LEU L 186  
AG6 1 THR K 96   ? GLU K 104  ? THR L 96   GLU L 104  
AG6 2 ARG K 137  ? VAL K 148  ? ARG L 137  VAL L 148  
AG6 3 PRO K 49   ? ILE K 58   ? PRO L 49   ILE L 58   
AG6 4 ILE K 165  ? PRO K 166  ? ILE L 165  PRO L 166  
AG7 1 VAL K 87   ? PHE K 89   ? VAL L 87   PHE L 89   
AG7 2 VAL K 120  ? ILE K 122  ? VAL L 120  ILE L 122  
AG8 1 LYS K 107  ? LYS K 110  ? LYS L 107  LYS L 110  
AG8 2 HIS K 128  ? LEU K 132  ? HIS L 128  LEU L 132  
AG9 1 TYR K 150  ? VAL K 151  ? TYR L 150  VAL L 151  
AG9 2 ALA K 169  ? VAL K 170  ? ALA L 169  VAL L 170  
AH1 1 GLU L 2    ? ARG L 5    ? GLU M 2    ARG M 5    
AH1 2 GLN L 899  ? ILE L 902  ? GLN M 899  ILE M 902  
AH1 3 VAL L 579  ? MET L 580  ? VAL M 579  MET M 580  
AH2 1 VAL L 65   ? LEU L 73   ? VAL M 65   LEU M 73   
AH2 2 GLN L 91   ? ILE L 101  ? GLN M 91   ILE M 101  
AH2 3 ILE L 108  ? PRO L 119  ? ILE M 108  PRO M 119  
AH3 1 PHE L 127  ? ILE L 129  ? PHE M 127  ILE M 129  
AH3 2 ALA L 132  ? ILE L 136  ? ALA M 132  ILE M 136  
AH3 3 SER L 392  ? PHE L 394  ? SER M 392  PHE M 394  
AH4 1 ARG L 331  ? ARG L 334  ? ARG M 331  ARG M 334  
AH4 2 SER L 138  ? ARG L 142  ? SER M 138  ARG M 142  
AH4 3 ARG L 409  ? SER L 411  ? ARG M 409  SER M 411  
AH4 4 THR L 453  ? SER L 454  ? THR M 453  SER M 454  
AH5 1 GLY L 145  ? PRO L 150  ? GLY M 145  PRO M 150  
AH5 2 TYR L 158  ? ILE L 163  ? TYR M 158  ILE M 163  
AH5 3 ILE L 172  ? VAL L 176  ? ILE M 172  VAL M 176  
AH5 4 VAL L 182  ? VAL L 186  ? VAL M 182  VAL M 186  
AH5 5 ARG L 189  ? PRO L 192  ? ARG M 189  PRO M 192  
AH6 1 ALA L 291  ? GLU L 294  ? ALA M 291  GLU M 294  
AH6 2 GLU L 297  ? ASP L 300  ? GLU M 297  ASP M 300  
AH7 1 ARG L 460  ? VAL L 461  ? ARG M 460  VAL M 461  
AH7 2 ILE L 467  ? VAL L 475  ? ILE M 467  VAL M 475  
AH7 3 VAL L 478  ? MET L 486  ? VAL M 478  MET M 486  
AH8 1 ARG L 460  ? VAL L 461  ? ARG M 460  VAL M 461  
AH8 2 ILE L 467  ? VAL L 475  ? ILE M 467  VAL M 475  
AH8 3 PHE L 531  ? ASP L 533  ? PHE M 531  ASP M 533  
AH8 4 ILE L 496  ? ALA L 497  ? ILE M 496  ALA M 497  
AH8 5 VAL L 513  ? ARG L 517  ? VAL M 513  ARG M 517  
AH8 6 GLU L 520  ? VAL L 524  ? GLU M 520  VAL M 524  
AH9 1 LEU L 503  ? GLU L 504  ? LEU M 503  GLU M 504  
AH9 2 ARG L 507  ? ILE L 508  ? ARG M 507  ILE M 508  
AI1 1 LEU L 595  ? TYR L 596  ? LEU M 595  TYR M 596  
AI1 2 LEU L 654  ? ASP L 657  ? LEU M 654  ASP M 657  
AI1 3 ARG L 640  ? PRO L 641  ? ARG M 640  PRO M 641  
AI2 1 LEU L 620  ? PRO L 624  ? LEU M 620  PRO M 624  
AI2 2 ARG L 610  ? TYR L 615  ? ARG M 610  TYR M 615  
AI2 3 GLY L 601  ? VAL L 606  ? GLY M 601  VAL M 606  
AI2 4 ARG L 648  ? VAL L 649  ? ARG M 648  VAL M 649  
AI3 1 TYR L 629  ? ARG L 630  ? TYR M 629  ARG M 630  
AI3 2 ALA L 636  ? LEU L 637  ? ALA M 636  LEU M 637  
AI4 1 SER L 661  ? GLU L 662  ? SER M 661  GLU M 662  
AI4 2 PHE L 665  ? LEU L 666  ? PHE M 665  LEU M 666  
AI5 1 LYS L 971  ? VAL L 972  ? LYS M 971  VAL M 972  
AI5 2 ILE L 987  ? LYS L 996  ? ILE M 987  LYS M 996  
AI5 3 LYS L 838  ? ASN L 841  ? LYS M 838  ASN M 841  
AI5 4 LYS L 846  ? LEU L 853  ? LYS M 846  LEU M 853  
AI5 5 ILE L 688  ? SER L 691  ? ILE M 688  SER M 691  
AI5 6 VAL L 869  ? LEU L 871  ? VAL M 869  LEU M 871  
AI5 7 GLN L 670  ? ILE L 676  ? GLN M 670  ILE M 676  
AI5 8 ILE L 987  ? LYS L 996  ? ILE M 987  LYS M 996  
AI6 1 GLY L 718  ? PRO L 719  ? GLY M 718  PRO M 719  
AI6 2 SER L 702  ? THR L 715  ? SER M 702  THR M 715  
AI6 3 VAL L 819  ? ARG L 831  ? VAL M 819  ARG M 831  
AI6 4 GLY L 798  ? LEU L 806  ? GLY M 798  LEU M 806  
AI6 5 GLU L 748  ? VAL L 749  ? GLU M 748  VAL M 749  
AI7 1 ILE L 754  ? VAL L 756  ? ILE M 754  VAL M 756  
AI7 2 LEU L 790  ? ARG L 791  ? LEU M 790  ARG M 791  
AI8 1 THR L 759  ? PHE L 761  ? THR M 759  PHE M 761  
AI8 2 VAL L 785  ? ASP L 787  ? VAL M 785  ASP M 787  
AI9 1 HIS L 1006 ? ARG L 1008 ? HIS M 1006 ARG M 1008 
AI9 2 SER M 626  ? VAL M 633  ? SER N 626  VAL N 633  
AI9 3 GLN M 744  ? HIS M 748  ? GLN N 744  HIS N 748  
AI9 4 VAL M 700  ? ASN M 703  ? VAL N 700  ASN N 703  
AI9 5 ILE M 713  ? VAL M 721  ? ILE N 713  VAL N 721  
AI9 6 GLN M 641  ? PRO M 645  ? GLN N 641  PRO N 645  
AI9 7 ILE M 726  ? LEU M 728  ? ILE N 726  LEU N 728  
AI9 8 SER M 626  ? VAL M 633  ? SER N 626  VAL N 633  
AJ1 1 GLN L 1030 ? PHE L 1032 ? GLN M 1030 PHE M 1032 
AJ1 2 LYS M 621  ? VAL M 623  ? LYS N 621  VAL N 623  
AJ2 1 PRO L 1108 ? VAL L 1109 ? PRO M 1108 VAL M 1109 
AJ2 2 LEU L 1097 ? LEU L 1102 ? LEU M 1097 LEU M 1102 
AJ2 3 LYS M 7    ? LEU M 12   ? LYS N 7    LEU N 12   
AJ2 4 LYS M 1456 ? ASP M 1457 ? LYS N 1456 ASP N 1457 
AJ3 1 SER M 22   ? GLU M 25   ? SER N 22   GLU N 25   
AJ3 2 MET M 90   ? ALA M 100  ? MET N 90   ALA N 100  
AJ3 3 ILE M 513  ? VAL M 519  ? ILE N 513  VAL N 519  
AJ4 1 LEU M 152  ? LEU M 153  ? LEU N 152  LEU N 153  
AJ4 2 TYR M 132  ? ASP M 136  ? TYR N 132  ASP N 136  
AJ4 3 ASP M 453  ? ARG M 455  ? ASP N 453  ARG N 455  
AJ5 1 ILE M 141  ? LEU M 142  ? ILE N 141  LEU N 142  
AJ5 2 VAL M 145  ? PRO M 146  ? VAL N 145  PRO N 146  
AJ6 1 GLN M 166  ? PRO M 170  ? GLN N 166  PRO N 170  
AJ6 2 SER M 392  ? VAL M 396  ? SER N 392  VAL N 396  
AJ6 3 GLY M 201  ? TYR M 205  ? GLY N 201  TYR N 205  
AJ6 4 GLU M 184  ? VAL M 185  ? GLU N 184  VAL N 185  
AJ7 1 GLU M 190  ? ALA M 192  ? GLU N 190  ALA N 192  
AJ7 2 VAL M 195  ? VAL M 196  ? VAL N 195  VAL N 196  
AJ8 1 ARG M 318  ? GLU M 327  ? ARG N 318  GLU N 327  
AJ8 2 THR M 330  ? ARG M 346  ? THR N 330  ARG N 346  
AJ8 3 PRO M 208  ? PRO M 226  ? PRO N 208  PRO N 226  
AJ8 4 GLY M 383  ? PRO M 390  ? GLY N 383  PRO N 390  
AJ8 5 ARG M 360  ? VAL M 361  ? ARG N 360  VAL N 361  
AJ9 1 ILE M 241  ? GLU M 244  ? ILE N 241  GLU N 244  
AJ9 2 PRO M 303  ? ARG M 312  ? PRO N 303  ARG N 312  
AJ9 3 TYR M 249  ? ARG M 252  ? TYR N 249  ARG N 252  
AK1 1 ILE M 241  ? GLU M 244  ? ILE N 241  GLU N 244  
AK1 2 PRO M 303  ? ARG M 312  ? PRO N 303  ARG N 312  
AK1 3 VAL M 286  ? PRO M 290  ? VAL N 286  PRO N 290  
AK2 1 GLU M 277  ? LEU M 284  ? GLU N 277  LEU N 284  
AK2 2 ALA M 268  ? ARG M 274  ? ALA N 268  ARG N 274  
AK2 3 GLY M 257  ? GLU M 263  ? GLY N 257  GLU N 263  
AK2 4 ILE M 297  ? VAL M 298  ? ILE N 297  VAL N 298  
AK3 1 ASN M 352  ? VAL M 353  ? ASN N 352  VAL N 353  
AK3 2 LYS M 366  ? ALA M 369  ? LYS N 366  ALA N 369  
AK3 3 VAL M 377  ? ILE M 378  ? VAL N 377  ILE N 378  
AK4 1 ALA M 398  ? PRO M 402  ? ALA N 398  PRO N 402  
AK4 2 VAL M 443  ? GLU M 448  ? VAL N 443  GLU N 448  
AK4 3 GLY M 433  ? ASP M 438  ? GLY N 433  ASP N 438  
AK4 4 ARG M 414  ? VAL M 415  ? ARG N 414  VAL N 415  
AK5 1 VAL M 420  ? ALA M 422  ? VAL N 420  ALA N 422  
AK5 2 VAL M 427  ? LYS M 428  ? VAL N 427  LYS N 428  
AK6 1 MET M 527  ? GLN M 529  ? MET N 527  GLN N 529  
AK6 2 PHE M 535  ? THR M 537  ? PHE N 535  THR N 537  
AK6 3 VAL O 335  ? SER O 336  ? VAL P 315  SER P 316  
AK7 1 GLU M 805  ? PHE M 806  ? GLU N 805  PHE N 806  
AK7 2 ILE M 827  ? VAL M 829  ? ILE N 827  VAL N 829  
AK7 3 ARG M 832  ? THR M 834  ? ARG N 832  THR N 834  
AK8 1 VAL M 842  ? PHE M 843  ? VAL N 842  PHE N 843  
AK8 2 VAL M 864  ? TYR M 868  ? VAL N 864  TYR N 868  
AK8 3 LYS M 871  ? THR M 875  ? LYS N 871  THR N 875  
AK9 1 VAL M 1106 ? VAL M 1107 ? VAL N 1106 VAL N 1107 
AK9 2 GLY M 1199 ? VAL M 1200 ? GLY N 1199 VAL N 1200 
AL1 1 ILE M 1118 ? PRO M 1121 ? ILE N 1118 PRO N 1121 
AL1 2 GLU M 1185 ? VAL M 1188 ? GLU N 1185 VAL N 1188 
AL2 1 PHE M 1123 ? ASP M 1126 ? PHE N 1123 ASP N 1126 
AL2 2 SER M 1131 ? LEU M 1134 ? SER N 1131 LEU N 1134 
AL3 1 VAL M 1153 ? VAL M 1155 ? VAL N 1153 VAL N 1155 
AL3 2 VAL M 1158 ? LEU M 1160 ? VAL N 1158 LEU N 1160 
AL4 1 LYS M 1271 ? ALA M 1272 ? LYS N 1271 ALA N 1272 
AL4 2 ALA M 1329 ? ILE M 1330 ? ALA N 1329 ILE N 1330 
AL5 1 SER M 1300 ? LEU M 1305 ? SER N 1300 LEU N 1305 
AL5 2 LEU M 1290 ? GLU M 1295 ? LEU N 1290 GLU N 1295 
AL5 3 GLY M 1279 ? GLU M 1285 ? GLY N 1279 GLU N 1285 
AL5 4 TYR M 1318 ? VAL M 1319 ? TYR N 1318 VAL N 1319 
AL6 1 VAL M 1394 ? GLU M 1396 ? VAL N 1394 GLU N 1396 
AL6 2 TYR M 1378 ? ASP M 1383 ? TYR N 1378 ASP N 1383 
AL6 3 ALA M 1416 ? LEU M 1420 ? ALA N 1416 LEU N 1420 
AL7 1 GLN M 1485 ? ASP M 1488 ? GLN N 1485 ASP N 1488 
AL7 2 LEU N 73   ? GLY N 76   ? LEU O 73   GLY O 76   
AL8 1 LYS N 47   ? GLN N 49   ? LYS O 47   GLN O 49   
AL8 2 LEU N 54   ? ASP N 56   ? LEU O 54   ASP O 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLN A 16   ? N GLN A 16   O TYR A 20   ? O TYR A 20   
AA1 2 3 N PHE A 23   ? N PHE A 23   O LEU A 197  ? O LEU A 197  
AA1 3 4 O ARG A 198  ? O ARG A 198  N ALA A 178  ? N ALA A 178  
AA2 1 2 N ALA A 103  ? N ALA A 103  O LEU A 138  ? O LEU A 138  
AA2 2 3 O GLY A 147  ? O GLY A 147  N GLY A 50   ? N GLY A 50   
AA2 3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
AA3 1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
AA4 1 2 N LYS A 107  ? N LYS A 107  O LEU A 132  ? O LEU A 132  
AA5 1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
AA6 1 2 N GLN B 16   ? N GLN B 16   O TYR B 20   ? O TYR B 20   
AA6 2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
AA6 3 4 O TRP B 200  ? O TRP B 200  N ARG B 176  ? N ARG B 176  
AA7 1 2 N VAL B 97   ? N VAL B 97   O VAL B 144  ? O VAL B 144  
AA7 2 3 O ARG B 143  ? O ARG B 143  N SER B 55   ? N SER B 55   
AA7 3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
AA8 1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
AA9 1 2 N VAL B 109  ? N VAL B 109  O ILE B 129  ? O ILE B 129  
AB1 1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
AB2 1 2 N LYS C 4    ? N LYS C 4    O ARG C 900  ? O ARG C 900  
AB2 2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
AB3 1 2 N VAL C 65   ? N VAL C 65   O ILE C 101  ? O ILE C 101  
AB3 2 3 N LEU C 94   ? N LEU C 94   O GLY C 116  ? O GLY C 116  
AB4 1 2 N ILE C 129  ? N ILE C 129  O ALA C 132  ? O ALA C 132  
AB4 2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
AB5 1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
AB5 2 3 N SER C 138  ? N SER C 138  O SER C 411  ? O SER C 411  
AB5 3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
AB6 1 2 N GLY C 145  ? N GLY C 145  O ILE C 163  ? O ILE C 163  
AB6 2 3 N ALA C 160  ? N ALA C 160  O LEU C 174  ? O LEU C 174  
AB6 3 4 N GLU C 175  ? N GLU C 175  O SER C 183  ? O SER C 183  
AB6 4 5 N VAL C 186  ? N VAL C 186  O ARG C 189  ? O ARG C 189  
AB7 1 2 N ARG C 292  ? N ARG C 292  O LYS C 299  ? O LYS C 299  
AB8 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB8 2 3 N ARG C 473  ? N ARG C 473  O THR C 480  ? O THR C 480  
AB9 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB9 2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
AB9 3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
AB9 4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
AB9 5 6 N VAL C 513  ? N VAL C 513  O VAL C 524  ? O VAL C 524  
AC1 1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
AC2 1 2 N LEU C 595  ? N LEU C 595  O LEU C 655  ? O LEU C 655  
AC2 2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
AC3 1 2 O TYR C 623  ? O TYR C 623  N ILE C 611  ? N ILE C 611  
AC3 2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
AC3 3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
AC4 1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
AC5 1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
AC6 1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
AC6 2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
AC6 3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
AC6 4 5 O ALA C 850  ? O ALA C 850  N ILE C 688  ? N ILE C 688  
AC6 5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
AC6 6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
AC6 7 8 N VAL C 674  ? N VAL C 674  O GLY C 990  ? O GLY C 990  
AC7 1 2 O GLY C 718  ? O GLY C 718  N THR C 715  ? N THR C 715  
AC7 2 3 N SER C 702  ? N SER C 702  O ARG C 831  ? O ARG C 831  
AC7 3 4 O ALA C 828  ? O ALA C 828  N ILE C 799  ? N ILE C 799  
AC7 4 5 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
AC8 1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AC9 1 2 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AD1 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AD1 2 3 N SER D 629  ? N SER D 629  O MET D 745  ? O MET D 745  
AD1 3 4 O HIS D 748  ? O HIS D 748  N LEU D 701  ? N LEU D 701  
AD1 4 5 N LEU D 702  ? N LEU D 702  O GLN D 714  ? O GLN D 714  
AD1 5 6 O VAL D 719  ? O VAL D 719  N LEU D 644  ? N LEU D 644  
AD1 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AD1 7 8 O LEU D 728  ? O LEU D 728  N VAL D 632  ? N VAL D 632  
AD2 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD3 1 2 O VAL C 1109 ? O VAL C 1109 N THR C 1101 ? N THR C 1101 
AD3 2 3 N ASP C 1098 ? N ASP C 1098 O ALA D 11   ? O ALA D 11   
AD3 3 4 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD4 1 2 N TYR D 23   ? N TYR D 23   O MET D 90   ? O MET D 90   
AD4 2 3 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AD5 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AD5 2 3 N ASP D 136  ? N ASP D 136  O ASP D 453  ? O ASP D 453  
AD6 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AD7 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AD7 2 3 O VAL D 396  ? O VAL D 396  N VAL D 202  ? N VAL D 202  
AD7 3 4 O GLY D 201  ? O GLY D 201  N VAL D 185  ? N VAL D 185  
AD8 1 2 N ALA D 192  ? N ALA D 192  O VAL D 195  ? O VAL D 195  
AD9 1 2 N GLU D 325  ? N GLU D 325  O TYR D 332  ? O TYR D 332  
AD9 2 3 O LEU D 335  ? O LEU D 335  N ALA D 221  ? N ALA D 221  
AD9 3 4 N ARG D 209  ? N ARG D 209  O GLU D 389  ? O GLU D 389  
AD9 4 5 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AE1 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AE1 2 3 O ALA D 307  ? O ALA D 307  N TYR D 249  ? N TYR D 249  
AE2 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AE2 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AE3 1 2 O VAL D 279  ? O VAL D 279  N LEU D 272  ? N LEU D 272  
AE3 2 3 O PHE D 269  ? O PHE D 269  N LYS D 262  ? N LYS D 262  
AE3 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AE4 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AE4 2 3 N ILE D 367  ? N ILE D 367  O VAL D 377  ? O VAL D 377  
AE5 1 2 N TYR D 401  ? N TYR D 401  O VAL D 444  ? O VAL D 444  
AE5 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AE5 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AE6 1 2 N LEU D 421  ? N LEU D 421  O VAL D 427  ? O VAL D 427  
AE7 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AE7 2 3 N PHE D 535  ? N PHE D 535  O VAL F 335  ? O VAL F 315  
AE8 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AE8 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AE9 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AE9 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AF1 1 2 N ARG D 1108 ? N ARG D 1108 O VAL D 1200 ? O VAL D 1200 
AF2 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AF3 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AF4 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AF5 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AF5 2 3 O PHE D 1293 ? O PHE D 1293 N ARG D 1282 ? N ARG D 1282 
AF5 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AF6 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AF6 2 3 N THR D 1382 ? N THR D 1382 O ALA D 1416 ? O ALA D 1416 
AF7 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
AF8 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
AF9 1 2 N GLN J 16   ? N GLN K 16   O TYR J 20   ? O TYR K 20   
AF9 2 3 N PHE J 23   ? N PHE K 23   O LEU J 197  ? O LEU K 197  
AF9 3 4 O TRP J 200  ? O TRP K 200  N ARG J 176  ? N ARG K 176  
AG1 1 2 N VAL J 97   ? N VAL K 97   O VAL J 144  ? O VAL K 144  
AG1 2 3 O GLU J 141  ? O GLU K 141  N TYR J 57   ? N TYR K 57   
AG1 3 4 N VAL J 56   ? N VAL K 56   O ILE J 165  ? O ILE K 165  
AG2 1 2 N ARG J 88   ? N ARG K 88   O GLU J 121  ? O GLU K 121  
AG3 1 2 N VAL J 109  ? N VAL K 109  O ILE J 129  ? O ILE K 129  
AG4 1 2 N VAL J 151  ? N VAL K 151  O ALA J 169  ? O ALA K 169  
AG5 1 2 N GLN K 16   ? N GLN L 16   O TYR K 20   ? O TYR L 20   
AG5 2 3 N LEU K 28   ? N LEU L 28   O ASP K 193  ? O ASP L 193  
AG5 3 4 O TRP K 200  ? O TRP L 200  N ARG K 176  ? N ARG L 176  
AG6 1 2 N VAL K 97   ? N VAL L 97   O VAL K 144  ? O VAL L 144  
AG6 2 3 O GLY K 147  ? O GLY L 147  N GLY K 50   ? N GLY L 50   
AG6 3 4 N VAL K 56   ? N VAL L 56   O ILE K 165  ? O ILE L 165  
AG7 1 2 N ARG K 88   ? N ARG L 88   O GLU K 121  ? O GLU L 121  
AG8 1 2 N LYS K 107  ? N LYS L 107  O LEU K 132  ? O LEU L 132  
AG9 1 2 N VAL K 151  ? N VAL L 151  O ALA K 169  ? O ALA L 169  
AH1 1 2 N GLU L 2    ? N GLU M 2    O ARG L 900  ? O ARG M 900  
AH1 2 3 O TYR L 901  ? O TYR M 901  N MET L 580  ? N MET M 580  
AH2 1 2 N ARG L 72   ? N ARG M 72   O TYR L 95   ? O TYR M 95   
AH2 2 3 N LEU L 94   ? N LEU M 94   O GLY L 116  ? O GLY M 116  
AH3 1 2 N ILE L 129  ? N ILE M 129  O ALA L 132  ? O ALA M 132  
AH3 2 3 N VAL L 135  ? N VAL M 135  O GLN L 393  ? O GLN M 393  
AH4 1 2 O ARG L 334  ? O ARG M 334  N GLN L 139  ? N GLN M 139  
AH4 2 3 N SER L 138  ? N SER M 138  O SER L 411  ? O SER M 411  
AH4 3 4 N ILE L 410  ? N ILE M 410  O THR L 453  ? O THR M 453  
AH5 1 2 N GLY L 145  ? N GLY M 145  O ILE L 163  ? O ILE M 163  
AH5 2 3 N ILE L 162  ? N ILE M 162  O ILE L 172  ? O ILE M 172  
AH5 3 4 N GLU L 175  ? N GLU M 175  O SER L 183  ? O SER M 183  
AH5 4 5 N MET L 184  ? N MET M 184  O PHE L 191  ? O PHE M 191  
AH6 1 2 N ARG L 292  ? N ARG M 292  O LYS L 299  ? O LYS M 299  
AH7 1 2 N ARG L 460  ? N ARG M 460  O ARG L 468  ? O ARG M 468  
AH7 2 3 N ARG L 473  ? N ARG M 473  O THR L 480  ? O THR M 480  
AH8 1 2 N ARG L 460  ? N ARG M 460  O ARG L 468  ? O ARG M 468  
AH8 2 3 N ARG L 472  ? N ARG M 472  O MET L 532  ? O MET M 532  
AH8 3 4 O PHE L 531  ? O PHE M 531  N ALA L 497  ? N ALA M 497  
AH8 4 5 N ILE L 496  ? N ILE M 496  O ARG L 516  ? O ARG M 516  
AH8 5 6 N VAL L 513  ? N VAL M 513  O VAL L 524  ? O VAL M 524  
AH9 1 2 N GLU L 504  ? N GLU M 504  O ARG L 507  ? O ARG M 507  
AI1 1 2 N LEU L 595  ? N LEU M 595  O LEU L 655  ? O LEU M 655  
AI1 2 3 O ASP L 657  ? O ASP M 657  N ARG L 640  ? N ARG M 640  
AI2 1 2 O TYR L 623  ? O TYR M 623  N ILE L 611  ? N ILE M 611  
AI2 2 3 O ARG L 614  ? O ARG M 614  N GLU L 602  ? N GLU M 602  
AI2 3 4 N GLY L 601  ? N GLY M 601  O VAL L 649  ? O VAL M 649  
AI3 1 2 N TYR L 629  ? N TYR M 629  O LEU L 637  ? O LEU M 637  
AI4 1 2 N GLU L 662  ? N GLU M 662  O PHE L 665  ? O PHE M 665  
AI5 1 2 N VAL L 972  ? N VAL M 972  O ILE L 987  ? O ILE M 987  
AI5 2 3 O MET L 995  ? O MET M 995  N ALA L 840  ? N ALA M 840  
AI5 3 4 N LEU L 839  ? N LEU M 839  O GLY L 847  ? O GLY M 847  
AI5 4 5 O ALA L 850  ? O ALA M 850  N ILE L 688  ? N ILE M 688  
AI5 5 6 N VAL L 689  ? N VAL M 689  O ILE L 870  ? O ILE M 870  
AI5 6 7 N VAL L 869  ? N VAL M 869  O LEU L 673  ? O LEU M 673  
AI5 7 8 N VAL L 674  ? N VAL M 674  O GLY L 990  ? O GLY M 990  
AI6 1 2 O GLY L 718  ? O GLY M 718  N THR L 715  ? N THR M 715  
AI6 2 3 N GLU L 706  ? N GLU M 706  O VAL L 827  ? O VAL M 827  
AI6 3 4 O ALA L 828  ? O ALA M 828  N ILE L 799  ? N ILE M 799  
AI6 4 5 O GLY L 798  ? O GLY M 798  N VAL L 749  ? N VAL M 749  
AI7 1 2 N LEU L 755  ? N LEU M 755  O LEU L 790  ? O LEU M 790  
AI8 1 2 N SER L 760  ? N SER M 760  O LYS L 786  ? O LYS M 786  
AI9 1 2 N HIS L 1006 ? N HIS M 1006 O ARG M 628  ? O ARG N 628  
AI9 2 3 N SER M 629  ? N SER N 629  O MET M 745  ? O MET N 745  
AI9 3 4 O ALA M 746  ? O ALA N 746  N ASN M 703  ? N ASN N 703  
AI9 4 5 N VAL M 700  ? N VAL N 700  O PHE M 716  ? O PHE N 716  
AI9 5 6 O VAL M 719  ? O VAL N 719  N CYS M 642  ? N CYS N 642  
AI9 6 7 N GLY M 643  ? N GLY N 643  O GLN M 727  ? O GLN N 727  
AI9 7 8 O LEU M 728  ? O LEU N 728  N VAL M 632  ? N VAL N 632  
AJ1 1 2 N PHE L 1032 ? N PHE M 1032 O LYS M 621  ? O LYS N 621  
AJ2 1 2 O VAL L 1109 ? O VAL M 1109 N THR L 1101 ? N THR M 1101 
AJ2 2 3 N ASP L 1098 ? N ASP M 1098 O ALA M 11   ? O ALA N 11   
AJ2 3 4 N VAL M 8    ? N VAL N 8    O ASP M 1457 ? O ASP N 1457 
AJ3 1 2 N TYR M 23   ? N TYR N 23   O MET M 90   ? O MET N 90   
AJ3 2 3 N ALA M 99   ? N ALA N 99   O LEU M 514  ? O LEU N 514  
AJ4 1 2 O LEU M 153  ? O LEU N 153  N TYR M 132  ? N TYR N 132  
AJ4 2 3 N ASP M 136  ? N ASP N 136  O ASP M 453  ? O ASP N 453  
AJ5 1 2 N LEU M 142  ? N LEU N 142  O VAL M 145  ? O VAL N 145  
AJ6 1 2 N TYR M 169  ? N TYR N 169  O ILE M 393  ? O ILE N 393  
AJ6 2 3 O VAL M 396  ? O VAL N 396  N VAL M 202  ? N VAL N 202  
AJ6 3 4 O GLY M 201  ? O GLY N 201  N VAL M 185  ? N VAL N 185  
AJ7 1 2 N ALA M 192  ? N ALA N 192  O VAL M 195  ? O VAL N 195  
AJ8 1 2 N GLU M 325  ? N GLU N 325  O TYR M 332  ? O TYR N 332  
AJ8 2 3 O LEU M 333  ? O LEU N 333  N LEU M 223  ? N LEU N 223  
AJ8 3 4 N ARG M 209  ? N ARG N 209  O GLU M 389  ? O GLU N 389  
AJ8 4 5 O GLY M 383  ? O GLY N 383  N VAL M 361  ? N VAL N 361  
AJ9 1 2 N LEU M 242  ? N LEU N 242  O LEU M 311  ? O LEU N 311  
AJ9 2 3 O ALA M 307  ? O ALA N 307  N TYR M 249  ? N TYR N 249  
AK1 1 2 N LEU M 242  ? N LEU N 242  O LEU M 311  ? O LEU N 311  
AK1 2 3 O GLU M 306  ? O GLU N 306  N THR M 289  ? N THR N 289  
AK2 1 2 O VAL M 279  ? O VAL N 279  N LEU M 272  ? N LEU N 272  
AK2 2 3 O ARG M 273  ? O ARG N 273  N VAL M 258  ? N VAL N 258  
AK2 3 4 N GLY M 257  ? N GLY N 257  O VAL M 298  ? O VAL N 298  
AK3 1 2 N ASN M 352  ? N ASN N 352  O ALA M 369  ? O ALA N 369  
AK3 2 3 N ILE M 367  ? N ILE N 367  O VAL M 377  ? O VAL N 377  
AK4 1 2 N TYR M 401  ? N TYR N 401  O VAL M 444  ? O VAL N 444  
AK4 2 3 O ARG M 445  ? O ARG N 445  N GLU M 436  ? N GLU N 436  
AK4 3 4 O GLY M 433  ? O GLY N 433  N VAL M 415  ? N VAL N 415  
AK5 1 2 N LEU M 421  ? N LEU N 421  O VAL M 427  ? O VAL N 427  
AK6 1 2 N VAL M 528  ? N VAL N 528  O ALA M 536  ? O ALA N 536  
AK6 2 3 N THR M 537  ? N THR N 537  O VAL O 335  ? O VAL P 315  
AK7 1 2 N PHE M 806  ? N PHE N 806  O LYS M 828  ? O LYS N 828  
AK7 2 3 N ILE M 827  ? N ILE N 827  O THR M 834  ? O THR N 834  
AK8 1 2 N PHE M 843  ? N PHE N 843  O THR M 865  ? O THR N 865  
AK8 2 3 N VAL M 866  ? N VAL N 866  O LEU M 873  ? O LEU N 873  
AK9 1 2 N VAL M 1106 ? N VAL N 1106 O VAL M 1200 ? O VAL N 1200 
AL1 1 2 N ILE M 1118 ? N ILE N 1118 O VAL M 1188 ? O VAL N 1188 
AL2 1 2 N GLN M 1124 ? N GLN N 1124 O ARG M 1133 ? O ARG N 1133 
AL3 1 2 N VAL M 1153 ? N VAL N 1153 O LEU M 1160 ? O LEU N 1160 
AL4 1 2 N ALA M 1272 ? N ALA N 1272 O ALA M 1329 ? O ALA N 1329 
AL5 1 2 O TYR M 1303 ? O TYR N 1303 N VAL M 1292 ? N VAL N 1292 
AL5 2 3 O PHE M 1293 ? O PHE N 1293 N ARG M 1282 ? N ARG N 1282 
AL5 3 4 N GLY M 1279 ? N GLY N 1279 O VAL M 1319 ? O VAL N 1319 
AL6 1 2 O LEU M 1395 ? O LEU N 1395 N VAL M 1379 ? N VAL N 1379 
AL6 2 3 N GLU M 1380 ? N GLU N 1380 O LYS M 1418 ? O LYS N 1418 
AL7 1 2 N GLN M 1485 ? N GLN N 1485 O GLY N 76   ? O GLY O 76   
AL8 1 2 N MET N 48   ? N MET O 48   O PHE N 55   ? O PHE O 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B MG 2001 ? 3 'binding site for residue MG B 2001' 
AC2 Software D ZN 2001 ? 4 'binding site for residue ZN D 2001' 
AC3 Software D ZN 2002 ? 4 'binding site for residue ZN D 2002' 
AC4 Software D MG 2003 ? 4 'binding site for residue MG D 2003' 
AC5 Software D MG 2004 ? 2 'binding site for residue MG D 2004' 
AC6 Software F MG 2001 ? 3 'binding site for residue MG F 2001' 
AC7 Software G DG 101  ? 4 'binding site for residue DG G 101'  
AC8 Software K MG 1001 ? 6 'binding site for residue MG K 1001' 
AC9 Software N ZN 2001 ? 4 'binding site for residue ZN N 2001' 
AD1 Software N ZN 2002 ? 4 'binding site for residue ZN N 2002' 
AD2 Software N MG 2003 ? 4 'binding site for residue MG N 2003' 
AD3 Software N MG 2004 ? 3 'binding site for residue MG N 2004' 
AD4 Software Q DG 101  ? 4 'binding site for residue DG Q 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 ASP B  183  ? ASP B 183  . ? 1_555 ? 
2  AC1 3 ASP B  191  ? ASP B 191  . ? 1_555 ? 
3  AC1 3 ASP B  193  ? ASP B 193  . ? 1_555 ? 
4  AC2 4 CYS D  1112 ? CYS D 1112 . ? 1_555 ? 
5  AC2 4 CYS D  1194 ? CYS D 1194 . ? 1_555 ? 
6  AC2 4 CYS D  1201 ? CYS D 1201 . ? 1_555 ? 
7  AC2 4 CYS D  1204 ? CYS D 1204 . ? 1_555 ? 
8  AC3 4 CYS D  58   ? CYS D 58   . ? 1_555 ? 
9  AC3 4 CYS D  60   ? CYS D 60   . ? 1_555 ? 
10 AC3 4 CYS D  73   ? CYS D 73   . ? 1_555 ? 
11 AC3 4 CYS D  76   ? CYS D 76   . ? 1_555 ? 
12 AC4 4 ASP D  739  ? ASP D 739  . ? 1_555 ? 
13 AC4 4 ASP D  741  ? ASP D 741  . ? 1_555 ? 
14 AC4 4 ASP D  743  ? ASP D 743  . ? 1_555 ? 
15 AC4 4 A   I  3    ? A   I 3    . ? 1_555 ? 
16 AC5 2 ASP B  168  ? ASP B 168  . ? 1_555 ? 
17 AC5 2 LYS D  840  ? LYS D 840  . ? 1_555 ? 
18 AC6 3 ALA F  312  ? ALA F 292  . ? 1_555 ? 
19 AC6 3 GLY F  316  ? GLY F 296  . ? 1_555 ? 
20 AC6 3 TRP F  319  ? TRP F 299  . ? 1_555 ? 
21 AC7 4 PHE C  394  ? PHE C 394  . ? 1_555 ? 
22 AC7 4 ILE F  341  ? ILE F 321  . ? 1_555 ? 
23 AC7 4 GLY F  342  ? GLY F 322  . ? 1_555 ? 
24 AC7 4 DG  G  19   ? DG  G 19   . ? 1_555 ? 
25 AC8 6 THR J  51   ? THR K 51   . ? 1_555 ? 
26 AC8 6 VAL J  170  ? VAL K 170  . ? 1_555 ? 
27 AC8 6 PHE J  171  ? PHE K 171  . ? 1_555 ? 
28 AC8 6 SER J  172  ? SER K 172  . ? 1_555 ? 
29 AC8 6 ASP J  202  ? ASP K 202  . ? 1_555 ? 
30 AC8 6 HOH MA .    ? HOH K 1102 . ? 1_555 ? 
31 AC9 4 CYS M  1112 ? CYS N 1112 . ? 1_555 ? 
32 AC9 4 CYS M  1194 ? CYS N 1194 . ? 1_555 ? 
33 AC9 4 CYS M  1201 ? CYS N 1201 . ? 1_555 ? 
34 AC9 4 CYS M  1204 ? CYS N 1204 . ? 1_555 ? 
35 AD1 4 CYS M  58   ? CYS N 58   . ? 1_555 ? 
36 AD1 4 CYS M  60   ? CYS N 60   . ? 1_555 ? 
37 AD1 4 CYS M  73   ? CYS N 73   . ? 1_555 ? 
38 AD1 4 CYS M  76   ? CYS N 76   . ? 1_555 ? 
39 AD2 4 ASP M  739  ? ASP N 739  . ? 1_555 ? 
40 AD2 4 ASP M  741  ? ASP N 741  . ? 1_555 ? 
41 AD2 4 ASP M  743  ? ASP N 743  . ? 1_555 ? 
42 AD2 4 A   R  3    ? A   S 3    . ? 1_555 ? 
43 AD3 3 LEU M  839  ? LEU N 839  . ? 1_555 ? 
44 AD3 3 LYS M  840  ? LYS N 840  . ? 1_555 ? 
45 AD3 3 HOH PA .    ? HOH N 2102 . ? 1_555 ? 
46 AD4 4 PHE L  394  ? PHE M 394  . ? 1_555 ? 
47 AD4 4 ILE O  341  ? ILE P 321  . ? 1_555 ? 
48 AD4 4 GLY O  342  ? GLY P 322  . ? 1_555 ? 
49 AD4 4 DG  P  19   ? DG  Q 19   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6KQD 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.005391 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000806 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009611 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003399 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A  1  4    ? 31.128  18.132  145.060 1.00 113.85 ? 4    SER A N     1 
ATOM   2     C  CA    . SER A  1  4    ? 31.258  16.898  144.293 1.00 116.48 ? 4    SER A CA    1 
ATOM   3     C  C     . SER A  1  4    ? 32.455  16.971  143.351 1.00 114.72 ? 4    SER A C     1 
ATOM   4     O  O     . SER A  1  4    ? 32.524  16.246  142.357 1.00 110.67 ? 4    SER A O     1 
ATOM   5     C  CB    . SER A  1  4    ? 29.978  16.618  143.502 1.00 113.83 ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A  1  4    ? 30.060  15.380  142.818 1.00 106.98 ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A  1  5    ? 33.397  17.853  143.672 1.00 112.08 ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A  1  5    ? 34.590  18.045  142.860 1.00 110.09 ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A  1  5    ? 35.676  17.067  143.289 1.00 107.00 ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A  1  5    ? 35.933  16.898  144.486 1.00 106.35 ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A  1  5    ? 35.094  19.484  142.978 1.00 109.38 ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A  1  5    ? 36.394  19.766  142.232 1.00 106.67 ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A  1  5    ? 36.216  19.667  140.724 1.00 95.56  ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A  1  5    ? 37.510  20.003  139.993 1.00 95.96  ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A  1  5    ? 37.967  21.404  140.231 1.00 76.61  ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A  1  6    ? 36.306  16.427  142.307 1.00 96.34  ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A  1  6    ? 37.420  15.530  142.569 1.00 87.10  ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A  1  6    ? 38.673  16.344  142.869 1.00 83.47  ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A  1  6    ? 38.885  17.416  142.294 1.00 84.95  ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A  1  6    ? 37.646  14.611  141.365 1.00 85.76  ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A  1  6    ? 38.095  13.157  141.555 1.00 79.16  ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A  1  6    ? 39.540  13.071  142.011 1.00 86.72  ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A  1  6    ? 37.187  12.426  142.524 1.00 83.19  ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A  1  7    ? 39.495  15.838  143.785 1.00 85.42  ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A  1  7    ? 40.695  16.524  144.239 1.00 89.27  ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A  1  7    ? 41.921  16.037  143.464 1.00 83.47  ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A  1  7    ? 41.828  15.238  142.530 1.00 81.39  ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A  1  7    ? 40.879  16.330  145.746 1.00 93.21  ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A  1  7    ? 39.877  17.085  146.602 1.00 89.38  ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A  1  7    ? 40.017  18.588  146.426 1.00 94.93  ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A  1  7    ? 38.987  19.337  147.255 1.00 96.79  ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A  1  7    ? 39.127  20.814  147.115 1.00 88.52  ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A  1  8    ? 43.087  16.533  143.866 1.00 84.94  ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A  1  8    ? 44.326  16.214  143.160 1.00 81.46  ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A  1  8    ? 44.670  14.741  143.352 1.00 86.09  ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A  1  8    ? 44.718  14.267  144.493 1.00 86.08  ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A  1  8    ? 45.465  17.098  143.664 1.00 76.50  ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A  1  9    ? 44.900  13.986  142.280 1.00 89.26  ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A  1  9    ? 45.145  12.548  142.424 1.00 80.32  ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A  1  9    ? 46.580  12.246  142.828 1.00 73.34  ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A  1  9    ? 47.488  13.066  142.685 1.00 79.02  ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A  1  9    ? 44.844  11.986  141.028 1.00 73.09  ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A  1  9    ? 44.180  13.104  140.273 1.00 79.43  ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A  1  9    ? 44.716  14.362  140.871 1.00 84.36  ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A  1  10   ? 46.765  11.029  143.346 1.00 72.89  ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A  1  10   ? 48.087  10.566  143.753 1.00 80.34  ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A  1  10   ? 48.844  10.041  142.539 1.00 78.62  ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A  1  10   ? 48.272  9.441   141.609 1.00 73.69  ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A  1  10   ? 48.003  9.510   144.875 1.00 76.98  ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A  1  10   ? 47.366  10.109  146.121 1.00 86.66  ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A  1  10   ? 47.248  8.270   144.423 1.00 72.10  ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A  1  11   ? 50.155  10.279  142.565 1.00 73.47  ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A  1  11   ? 51.053  10.054  141.441 1.00 76.84  ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A  1  11   ? 52.199  9.165   141.907 1.00 79.91  ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A  1  11   ? 53.018  9.582   142.731 1.00 82.67  ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A  1  11   ? 51.570  11.387  140.899 1.00 79.19  ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A  1  11   ? 52.688  11.246  139.914 1.00 79.61  ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A  1  11   ? 52.488  10.595  138.712 1.00 74.21  ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A  1  11   ? 53.938  11.775  140.183 1.00 85.66  ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A  1  11   ? 53.514  10.464  137.798 1.00 72.97  ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A  1  11   ? 54.970  11.650  139.272 1.00 82.58  ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A  1  11   ? 54.756  10.993  138.078 1.00 76.53  ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A  1  12   ? 52.258  7.948   141.377 1.00 76.21  ? 12   THR A N     1 
ATOM   64    C  CA    . THR A  1  12   ? 53.256  6.962   141.762 1.00 73.80  ? 12   THR A CA    1 
ATOM   65    C  C     . THR A  1  12   ? 54.227  6.718   140.611 1.00 78.07  ? 12   THR A C     1 
ATOM   66    O  O     . THR A  1  12   ? 53.854  6.791   139.437 1.00 72.81  ? 12   THR A O     1 
ATOM   67    C  CB    . THR A  1  12   ? 52.591  5.642   142.175 1.00 77.20  ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A  1  12   ? 51.447  5.918   142.994 1.00 75.75  ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A  1  12   ? 53.566  4.767   142.954 1.00 76.14  ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A  1  13   ? 55.478  6.421   140.964 1.00 83.73  ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A  1  13   ? 56.558  6.207   140.006 1.00 66.23  ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A  1  13   ? 57.233  4.881   140.329 1.00 67.13  ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A  1  13   ? 57.603  4.634   141.482 1.00 79.85  ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A  1  13   ? 57.587  7.355   140.046 1.00 62.71  ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A  1  13   ? 58.719  7.095   139.074 1.00 69.37  ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A  1  13   ? 56.920  8.687   139.746 1.00 68.03  ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A  1  14   ? 57.396  4.031   139.316 1.00 71.77  ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A  1  14   ? 58.086  2.750   139.448 1.00 77.49  ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A  1  14   ? 59.126  2.662   138.338 1.00 76.04  ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A  1  14   ? 58.769  2.519   137.167 1.00 73.90  ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A  1  14   ? 57.105  1.580   139.362 1.00 72.12  ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A  1  14   ? 56.032  1.579   140.431 1.00 73.37  ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A  1  14   ? 55.216  0.301   140.373 1.00 76.66  ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A  1  14   ? 54.242  0.309   139.287 1.00 71.25  ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A  1  14   ? 52.935  0.474   139.462 1.00 78.25  ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A  1  14   ? 52.446  0.640   140.684 1.00 86.36  ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A  1  14   ? 52.115  0.464   138.419 1.00 72.21  ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A  1  15   ? 60.404  2.731   138.693 1.00 75.78  ? 15   THR A N     1 
ATOM   89    C  CA    . THR A  1  15   ? 61.473  2.782   137.706 1.00 77.93  ? 15   THR A CA    1 
ATOM   90    C  C     . THR A  1  15   ? 62.329  1.523   137.763 1.00 85.35  ? 15   THR A C     1 
ATOM   91    O  O     . THR A  1  15   ? 62.663  1.035   138.847 1.00 88.15  ? 15   THR A O     1 
ATOM   92    C  CB    . THR A  1  15   ? 62.360  4.011   137.920 1.00 78.45  ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A  1  15   ? 63.019  3.915   139.189 1.00 77.34  ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A  1  15   ? 61.529  5.279   137.881 1.00 71.23  ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A  1  16   ? 62.674  0.999   136.586 1.00 89.06  ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A  1  16   ? 63.695  -0.033  136.432 1.00 84.06  ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A  1  16   ? 64.846  0.599   135.662 1.00 84.98  ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A  1  16   ? 64.714  0.894   134.463 1.00 88.99  ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A  1  16   ? 63.155  -1.262  135.706 1.00 81.12  ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A  1  16   ? 62.042  -1.989  136.440 1.00 98.87  ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A  1  16   ? 61.698  -3.318  135.793 1.00 104.82 ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A  1  16   ? 62.552  -3.956  135.177 1.00 97.80  ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A  1  16   ? 60.443  -3.739  135.926 1.00 108.01 ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A  1  17   ? 65.958  0.821   136.359 1.00 86.85  ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A  1  17   ? 67.138  1.481   135.852 1.00 94.61  ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A  1  17   ? 66.798  2.801   135.196 1.00 94.55  ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A  1  17   ? 65.841  3.493   135.565 1.00 86.02  ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A  1  18   ? 67.607  3.162   134.206 1.00 89.96  ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A  1  18   ? 67.325  4.289   133.332 1.00 82.75  ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A  1  18   ? 66.572  3.867   132.081 1.00 81.05  ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A  1  18   ? 66.289  4.713   131.225 1.00 77.56  ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A  1  18   ? 68.628  4.988   132.935 1.00 86.68  ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A  1  18   ? 69.498  5.413   134.104 1.00 79.34  ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A  1  18   ? 70.769  6.091   133.618 1.00 76.04  ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A  1  18   ? 70.490  7.195   132.701 1.00 76.61  ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A  1  18   ? 70.236  8.442   133.086 1.00 76.28  ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A  1  18   ? 70.223  8.749   134.376 1.00 84.30  ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A  1  18   ? 69.997  9.385   132.183 1.00 75.51  ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A  1  19   ? 66.246  2.580   131.959 1.00 82.23  ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A  1  19   ? 65.654  2.044   130.743 1.00 85.34  ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A  1  19   ? 64.131  2.059   130.753 1.00 83.73  ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A  1  19   ? 63.523  2.261   129.694 1.00 79.23  ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A  1  19   ? 66.135  0.606   130.510 1.00 94.36  ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A  1  19   ? 67.649  0.397   130.615 1.00 102.35 ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A  1  19   ? 68.386  0.661   129.311 1.00 101.69 ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A  1  19   ? 67.914  1.497   128.511 1.00 102.99 ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A  1  19   ? 69.441  0.026   129.087 1.00 102.79 ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A  1  20   ? 63.483  1.850   131.902 1.00 86.40  ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A  1  20   ? 62.041  1.637   131.876 1.00 79.51  ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A  1  20   ? 61.357  2.294   133.068 1.00 77.12  ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A  1  20   ? 61.921  2.381   134.162 1.00 75.11  ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A  1  20   ? 61.729  0.138   131.838 1.00 73.85  ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A  1  20   ? 60.264  -0.196  131.914 1.00 68.60  ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A  1  20   ? 59.377  0.247   130.941 1.00 65.62  ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A  1  20   ? 59.771  -0.968  132.952 1.00 75.46  ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A  1  20   ? 58.034  -0.063  131.010 1.00 66.17  ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A  1  20   ? 58.433  -1.286  133.029 1.00 79.21  ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A  1  20   ? 57.568  -0.832  132.056 1.00 71.46  ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A  1  20   ? 56.233  -1.152  132.132 1.00 67.35  ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A  1  21   ? 60.126  2.743   132.845 1.00 76.31  ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A  1  21   ? 59.354  3.375   133.904 1.00 74.11  ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A  1  21   ? 57.863  3.170   133.747 1.00 68.32  ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A  1  21   ? 57.342  3.062   132.631 1.00 65.59  ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A  1  22   ? 57.174  3.112   134.888 1.00 70.68  ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A  1  22   ? 55.719  3.087   134.973 1.00 65.37  ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A  1  22   ? 55.275  4.248   135.849 1.00 61.49  ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A  1  22   ? 55.835  4.468   136.927 1.00 66.85  ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A  1  22   ? 55.202  1.770   135.557 1.00 61.11  ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A  1  22   ? 55.647  0.526   134.817 1.00 66.01  ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A  1  22   ? 55.009  -0.733  135.370 1.00 72.14  ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A  1  22   ? 54.057  -0.613  136.167 1.00 80.98  ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A  1  22   ? 55.456  -1.843  135.012 1.00 75.04  ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A  1  23   ? 54.268  4.982   135.391 1.00 57.75  ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A  1  23   ? 53.841  6.217   136.036 1.00 62.02  ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A  1  23   ? 52.331  6.170   136.202 1.00 67.70  ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A  1  23   ? 51.595  6.197   135.211 1.00 64.38  ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A  1  23   ? 54.287  7.428   135.219 1.00 57.05  ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A  1  23   ? 55.768  7.470   134.994 1.00 63.88  ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A  1  23   ? 56.343  6.770   133.946 1.00 69.62  ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A  1  23   ? 56.592  8.174   135.853 1.00 64.83  ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A  1  23   ? 57.710  6.788   133.750 1.00 70.47  ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A  1  23   ? 57.959  8.198   135.660 1.00 65.86  ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A  1  23   ? 58.518  7.503   134.608 1.00 68.44  ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A  1  24   ? 51.876  6.086   137.450 1.00 69.91  ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A  1  24   ? 50.468  5.903   137.773 1.00 63.61  ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A  1  24   ? 49.892  7.220   138.265 1.00 61.81  ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A  1  24   ? 50.514  7.930   139.064 1.00 66.62  ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A  1  24   ? 50.280  4.794   138.825 1.00 66.45  ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A  1  24   ? 48.800  4.514   139.052 1.00 70.08  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A  1  24   ? 51.006  3.533   138.401 1.00 65.97  ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A  1  25   ? 48.697  7.541   137.783 1.00 58.65  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A  1  25   ? 47.931  8.699   138.218 1.00 65.17  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A  1  25   ? 46.525  8.210   138.532 1.00 71.34  ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A  1  25   ? 45.841  7.679   137.644 1.00 66.68  ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A  1  25   ? 47.908  9.778   137.131 1.00 58.52  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A  1  25   ? 47.716  11.229  137.562 1.00 66.11  ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A  1  25   ? 48.932  11.708  138.332 1.00 67.40  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A  1  25   ? 47.467  12.110  136.351 1.00 72.06  ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A  1  26   ? 46.106  8.348   139.795 1.00 76.60  ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A  1  26   ? 44.756  7.917   140.147 1.00 73.13  ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A  1  26   ? 44.319  8.599   141.434 1.00 65.47  ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A  1  26   ? 45.159  8.900   142.284 1.00 68.57  ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A  1  26   ? 44.674  6.390   140.300 1.00 69.13  ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A  1  26   ? 45.264  5.830   141.578 1.00 67.17  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A  1  26   ? 44.807  4.406   141.837 1.00 70.63  ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A  1  26   ? 43.582  4.153   141.769 1.00 59.22  ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A  1  26   ? 45.671  3.539   142.093 1.00 69.18  ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A  1  27   ? 43.012  8.855   141.609 1.00 62.25  ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A  1  27   ? 41.942  8.605   140.638 1.00 62.46  ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A  1  27   ? 41.638  9.818   139.758 1.00 65.01  ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A  1  27   ? 41.853  10.959  140.177 1.00 57.39  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A  1  27   ? 40.750  8.271   141.528 1.00 65.40  ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A  1  27   ? 40.963  9.139   142.724 1.00 73.49  ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A  1  27   ? 42.465  9.250   142.919 1.00 71.27  ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A  1  28   ? 41.132  9.561   138.551 1.00 67.05  ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A  1  28   ? 40.808  10.600  137.586 1.00 64.86  ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A  1  28   ? 39.354  10.460  137.156 1.00 60.67  ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A  1  28   ? 38.779  9.369   137.207 1.00 63.68  ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A  1  28   ? 41.725  10.528  136.353 1.00 66.15  ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A  1  28   ? 43.231  10.718  136.568 1.00 66.45  ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A  1  28   ? 44.024  10.172  135.391 1.00 72.51  ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A  1  28   ? 43.563  12.185  136.788 1.00 70.41  ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A  1  29   ? 38.764  11.575  136.732 1.00 57.76  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A  1  29   ? 37.384  11.554  136.266 1.00 65.40  ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A  1  29   ? 37.251  10.658  135.041 1.00 67.08  ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A  1  29   ? 38.205  10.462  134.284 1.00 70.50  ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A  1  29   ? 36.910  12.971  135.941 1.00 67.60  ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A  1  29   ? 36.683  13.846  137.164 1.00 83.19  ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A  1  29   ? 35.399  13.500  137.909 1.00 99.52  ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A  1  29   ? 34.607  12.680  137.394 1.00 98.45  ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A  1  29   ? 35.179  14.054  139.009 1.00 97.90  ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A  1  30   ? 36.054  10.107  134.852 1.00 62.52  ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A  1  30   ? 35.836  9.148   133.774 1.00 67.11  ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A  1  30   ? 36.154  9.769   132.421 1.00 67.83  ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A  1  30   ? 35.680  10.860  132.093 1.00 70.77  ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A  1  30   ? 34.396  8.644   133.789 1.00 86.42  ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A  1  30   ? 34.086  7.647   132.677 1.00 92.24  ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A  1  30   ? 32.610  7.270   132.662 1.00 94.91  ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A  1  30   ? 31.770  8.385   132.236 1.00 87.99  ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A  1  30   ? 31.302  8.533   131.003 1.00 80.98  ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A  1  30   ? 31.586  7.629   130.076 1.00 89.04  ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A  1  30   ? 30.548  9.580   130.698 1.00 75.54  ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A  1  31   ? 36.967  9.065   131.634 1.00 71.94  ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A  1  31   ? 37.388  9.511   130.331 1.00 68.97  ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A  1  31   ? 38.742  10.188  130.314 1.00 60.74  ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A  1  31   ? 39.430  10.147  129.289 1.00 58.62  ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A  1  32   ? 39.144  10.803  131.428 1.00 63.59  ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A  1  32   ? 40.412  11.524  131.461 1.00 59.43  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A  1  32   ? 41.608  10.599  131.343 1.00 57.91  ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A  1  32   ? 42.720  11.082  131.091 1.00 57.08  ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A  1  32   ? 40.520  12.349  132.736 1.00 55.86  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A  1  32   ? 39.892  13.697  132.625 1.00 57.52  ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A  1  32   ? 38.514  13.829  132.590 1.00 61.20  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A  1  32   ? 40.674  14.834  132.537 1.00 53.87  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A  1  32   ? 37.929  15.070  132.481 1.00 59.53  ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A  1  32   ? 40.095  16.082  132.426 1.00 53.43  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A  1  32   ? 38.720  16.201  132.399 1.00 59.13  ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A  1  33   ? 41.405  9.294   131.525 1.00 61.33  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A  1  33   ? 42.457  8.329   131.296 1.00 62.46  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A  1  33   ? 43.106  8.562   129.954 1.00 52.83  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A  1  33   ? 44.296  8.877   129.881 1.00 52.46  ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A  1  34   ? 42.313  8.490   128.884 1.00 54.55  ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A  1  34   ? 42.883  8.702   127.558 1.00 58.58  ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A  1  34   ? 43.104  10.188  127.278 1.00 56.10  ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A  1  34   ? 44.056  10.538  126.571 1.00 59.07  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A  1  34   ? 42.018  8.039   126.468 1.00 52.36  ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A  1  34   ? 41.170  6.920   127.055 1.00 64.02  ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A  1  34   ? 41.163  9.055   125.743 1.00 47.00  ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A  1  35   ? 42.283  11.076  127.860 1.00 50.51  ? 35   THR A N     1 
ATOM   250   C  CA    . THR A  1  35   ? 42.466  12.513  127.662 1.00 50.04  ? 35   THR A CA    1 
ATOM   251   C  C     . THR A  1  35   ? 43.870  12.951  128.053 1.00 49.97  ? 35   THR A C     1 
ATOM   252   O  O     . THR A  1  35   ? 44.457  13.828  127.412 1.00 56.57  ? 35   THR A O     1 
ATOM   253   C  CB    . THR A  1  35   ? 41.428  13.296  128.467 1.00 54.14  ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A  1  35   ? 40.113  12.965  128.007 1.00 58.05  ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A  1  35   ? 41.648  14.800  128.322 1.00 48.59  ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A  1  36   ? 44.431  12.352  129.097 1.00 50.45  ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A  1  36   ? 45.821  12.645  129.413 1.00 52.22  ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A  1  36   ? 46.791  11.688  128.733 1.00 54.75  ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A  1  36   ? 47.844  12.123  128.252 1.00 54.13  ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A  1  36   ? 46.036  12.619  130.925 1.00 57.91  ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A  1  36   ? 45.550  13.876  131.638 1.00 64.05  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A  1  36   ? 45.993  13.850  133.088 1.00 73.44  ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A  1  36   ? 46.066  15.122  130.929 1.00 64.03  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A  1  37   ? 46.456  10.395  128.660 1.00 57.12  ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A  1  37   ? 47.420  9.416   128.187 1.00 57.60  ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A  1  37   ? 47.786  9.578   126.725 1.00 56.71  ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A  1  37   ? 48.964  9.504   126.364 1.00 62.79  ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A  1  38   ? 46.791  9.802   125.859 1.00 50.33  ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A  1  38   ? 47.076  9.796   124.425 1.00 50.50  ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A  1  38   ? 47.973  10.954  123.997 1.00 47.97  ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A  1  38   ? 48.979  10.702  123.309 1.00 52.74  ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A  1  38   ? 45.767  9.766   123.636 1.00 54.61  ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A  1  38   ? 45.994  9.589   122.155 1.00 57.55  ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A  1  38   ? 46.342  8.500   121.691 1.00 54.65  ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A  1  38   ? 45.804  10.666  121.398 1.00 56.10  ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A  1  39   ? 47.690  12.217  124.341 1.00 42.93  ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A  1  39   ? 48.600  13.290  123.906 1.00 48.88  ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A  1  39   ? 50.000  13.135  124.465 1.00 52.08  ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A  1  39   ? 50.981  13.446  123.777 1.00 46.69  ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A  1  39   ? 47.921  14.565  124.426 1.00 47.68  ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A  1  39   ? 46.556  14.166  124.775 1.00 44.31  ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A  1  39   ? 46.604  12.747  125.177 1.00 48.98  ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A  1  40   ? 50.120  12.667  125.708 1.00 56.09  ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A  1  40   ? 51.445  12.409  126.255 1.00 54.13  ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A  1  40   ? 52.169  11.350  125.441 1.00 52.76  ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A  1  40   ? 53.367  11.476  125.182 1.00 58.80  ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A  1  40   ? 51.347  11.992  127.721 1.00 55.48  ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A  1  40   ? 50.915  13.088  128.694 1.00 54.59  ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A  1  40   ? 51.245  12.670  130.119 1.00 47.10  ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A  1  40   ? 51.564  14.425  128.344 1.00 47.70  ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A  1  41   ? 51.454  10.308  125.009 1.00 51.70  ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A  1  41   ? 52.082  9.291   124.172 1.00 46.78  ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A  1  41   ? 52.538  9.882   122.848 1.00 49.78  ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A  1  41   ? 53.646  9.592   122.383 1.00 58.41  ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A  1  41   ? 51.123  8.127   123.930 1.00 48.46  ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A  1  41   ? 51.706  7.027   123.060 1.00 48.03  ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A  1  41   ? 50.665  5.977   122.706 1.00 54.19  ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A  1  41   ? 51.237  4.895   121.909 1.00 55.34  ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A  1  41   ? 51.262  4.873   120.580 1.00 55.59  ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A  1  41   ? 50.740  5.877   119.887 1.00 53.86  ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A  1  41   ? 51.810  3.846   119.943 1.00 53.19  ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A  1  42   ? 51.705  10.719  122.227 1.00 48.21  ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A  1  42   ? 52.087  11.313  120.948 1.00 50.88  ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A  1  42   ? 53.334  12.183  121.100 1.00 48.63  ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A  1  42   ? 54.285  12.074  120.313 1.00 51.75  ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A  1  42   ? 50.914  12.113  120.374 1.00 46.48  ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A  1  42   ? 49.691  11.249  120.075 1.00 40.36  ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A  1  42   ? 48.527  12.054  119.528 1.00 44.22  ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A  1  42   ? 48.882  12.808  118.331 1.00 49.60  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A  1  42   ? 48.887  12.302  117.101 1.00 53.79  ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A  1  42   ? 48.558  11.035  116.901 1.00 56.89  ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A  1  42   ? 49.224  13.064  116.070 1.00 53.49  ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A  1  43   ? 53.358  13.028  122.134 1.00 50.89  ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A  1  43   ? 54.506  13.901  122.368 1.00 51.99  ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A  1  43   ? 55.756  13.084  122.678 1.00 50.22  ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A  1  43   ? 56.847  13.379  122.175 1.00 54.70  ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A  1  43   ? 54.186  14.898  123.495 1.00 55.46  ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A  1  43   ? 53.011  15.787  123.095 1.00 58.76  ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A  1  43   ? 55.392  15.757  123.814 1.00 57.26  ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A  1  43   ? 52.441  16.571  124.241 1.00 55.53  ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A  1  44   ? 55.620  12.046  123.509 1.00 46.39  ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A  1  44   ? 56.757  11.198  123.851 1.00 51.53  ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A  1  44   ? 57.298  10.456  122.635 1.00 57.76  ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A  1  44   ? 58.510  10.226  122.537 1.00 62.19  ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A  1  44   ? 56.358  10.198  124.938 1.00 47.93  ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A  1  44   ? 56.142  10.714  126.360 1.00 54.12  ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A  1  44   ? 55.374  9.684   127.166 1.00 55.22  ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A  1  44   ? 57.467  11.025  127.024 1.00 59.27  ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A  1  45   ? 56.425  10.073  121.702 1.00 52.93  ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A  1  45   ? 56.884  9.367   120.515 1.00 47.03  ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A  1  45   ? 57.425  10.303  119.446 1.00 55.87  ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A  1  45   ? 58.165  9.847   118.569 1.00 66.42  ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A  1  45   ? 55.756  8.508   119.931 1.00 45.31  ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A  1  45   ? 55.414  7.234   120.715 1.00 45.02  ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A  1  45   ? 54.372  6.396   119.995 1.00 41.26  ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A  1  45   ? 56.659  6.408   120.994 1.00 45.06  ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A  1  46   ? 57.104  11.596  119.492 1.00 53.28  ? 46   SER A N     1 
ATOM   338   C  CA    . SER A  1  46   ? 57.581  12.501  118.453 1.00 59.11  ? 46   SER A CA    1 
ATOM   339   C  C     . SER A  1  46   ? 58.617  13.507  118.943 1.00 63.52  ? 46   SER A C     1 
ATOM   340   O  O     . SER A  1  46   ? 59.717  13.571  118.385 1.00 63.66  ? 46   SER A O     1 
ATOM   341   C  CB    . SER A  1  46   ? 56.397  13.235  117.811 1.00 53.11  ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A  1  46   ? 55.744  14.064  118.750 1.00 53.05  ? 46   SER A OG    1 
ATOM   343   N  N     . SER A  1  47   ? 58.308  14.302  119.969 1.00 57.24  ? 47   SER A N     1 
ATOM   344   C  CA    . SER A  1  47   ? 58.982  15.579  120.167 1.00 60.06  ? 47   SER A CA    1 
ATOM   345   C  C     . SER A  1  47   ? 60.010  15.579  121.293 1.00 59.10  ? 47   SER A C     1 
ATOM   346   O  O     . SER A  1  47   ? 60.387  16.658  121.770 1.00 54.42  ? 47   SER A O     1 
ATOM   347   C  CB    . SER A  1  47   ? 57.947  16.678  120.409 1.00 58.74  ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A  1  47   ? 57.102  16.825  119.286 1.00 55.23  ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A  1  48   ? 60.489  14.419  121.724 1.00 60.15  ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A  1  48   ? 61.443  14.339  122.822 1.00 64.45  ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A  1  48   ? 62.853  14.455  122.249 1.00 65.15  ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A  1  48   ? 63.242  13.612  121.426 1.00 62.07  ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A  1  48   ? 61.278  13.048  123.624 1.00 67.36  ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A  1  48   ? 59.927  13.061  124.342 1.00 59.14  ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A  1  48   ? 62.411  12.904  124.622 1.00 66.83  ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A  1  48   ? 59.666  14.332  125.128 1.00 60.53  ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A  1  49   ? 63.630  15.462  122.640 1.00 67.81  ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A  1  49   ? 64.998  15.579  122.124 1.00 71.71  ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A  1  49   ? 65.886  14.443  122.612 1.00 71.26  ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A  1  49   ? 65.780  13.991  123.755 1.00 70.38  ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A  1  49   ? 65.472  16.933  122.671 1.00 68.41  ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A  1  49   ? 64.214  17.676  122.997 1.00 68.65  ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A  1  49   ? 63.231  16.638  123.431 1.00 66.96  ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A  1  50   ? 66.771  13.987  121.726 1.00 66.06  ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A  1  50   ? 67.745  12.963  122.056 1.00 63.94  ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A  1  50   ? 69.041  13.155  121.299 1.00 66.65  ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A  1  50   ? 69.306  14.249  120.795 1.00 69.46  ? 50   GLY A O     1 
ATOM   368   N  N     . THR A  1  51   ? 69.865  12.112  121.214 1.00 66.05  ? 51   THR A N     1 
ATOM   369   C  CA    . THR A  1  51   ? 71.111  12.176  120.463 1.00 69.04  ? 51   THR A CA    1 
ATOM   370   C  C     . THR A  1  51   ? 71.181  11.025  119.468 1.00 71.64  ? 51   THR A C     1 
ATOM   371   O  O     . THR A  1  51   ? 70.614  9.950   119.692 1.00 70.06  ? 51   THR A O     1 
ATOM   372   C  CB    . THR A  1  51   ? 72.343  12.136  121.381 1.00 66.19  ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A  1  51   ? 72.412  10.868  122.045 1.00 66.74  ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A  1  51   ? 72.276  13.251  122.412 1.00 70.74  ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A  1  52   ? 71.891  11.265  118.365 1.00 69.56  ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A  1  52   ? 72.046  10.276  117.306 1.00 68.02  ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A  1  52   ? 73.303  10.584  116.505 1.00 67.08  ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A  1  52   ? 73.806  11.710  116.509 1.00 66.44  ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A  1  52   ? 70.824  10.248  116.382 1.00 74.39  ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A  1  53   ? 73.793  9.563   115.805 1.00 69.36  ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A  1  53   ? 74.992  9.683   114.980 1.00 60.59  ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A  1  53   ? 74.622  10.383  113.682 1.00 59.25  ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A  1  53   ? 73.817  9.868   112.900 1.00 68.37  ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A  1  53   ? 75.611  8.307   114.700 1.00 58.13  ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A  1  53   ? 76.816  8.444   113.784 1.00 59.52  ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A  1  53   ? 75.996  7.627   116.000 1.00 67.95  ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A  1  54   ? 75.213  11.552  113.443 1.00 55.84  ? 54   THR A N     1 
ATOM   388   C  CA    . THR A  1  54   ? 74.881  12.324  112.254 1.00 60.18  ? 54   THR A CA    1 
ATOM   389   C  C     . THR A  1  54   ? 75.908  12.209  111.133 1.00 66.16  ? 54   THR A C     1 
ATOM   390   O  O     . THR A  1  54   ? 75.565  12.504  109.982 1.00 64.34  ? 54   THR A O     1 
ATOM   391   C  CB    . THR A  1  54   ? 74.690  13.805  112.608 1.00 59.95  ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A  1  54   ? 75.895  14.331  113.175 1.00 65.02  ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A  1  54   ? 73.560  13.965  113.605 1.00 61.53  ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A  1  55   ? 77.144  11.789  111.417 1.00 75.40  ? 55   SER A N     1 
ATOM   395   C  CA    . SER A  1  55   ? 78.121  11.675  110.332 1.00 63.34  ? 55   SER A CA    1 
ATOM   396   C  C     . SER A  1  55   ? 79.176  10.634  110.686 1.00 59.73  ? 55   SER A C     1 
ATOM   397   O  O     . SER A  1  55   ? 79.398  10.326  111.856 1.00 68.64  ? 55   SER A O     1 
ATOM   398   C  CB    . SER A  1  55   ? 78.775  13.030  110.031 1.00 63.25  ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A  1  55   ? 79.569  12.973  108.861 1.00 62.95  ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A  1  56   ? 79.832  10.099  109.657 1.00 62.45  ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A  1  56   ? 80.859  9.067   109.827 1.00 67.87  ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A  1  56   ? 81.931  9.248   108.758 1.00 70.89  ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A  1  56   ? 81.617  9.382   107.571 1.00 70.23  ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A  1  56   ? 80.272  7.640   109.746 1.00 70.16  ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A  1  56   ? 81.378  6.616   109.549 1.00 67.56  ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A  1  56   ? 79.473  7.309   110.990 1.00 74.23  ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A  1  57   ? 83.198  9.245   109.176 1.00 73.56  ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A  1  57   ? 84.337  9.226   108.264 1.00 69.71  ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A  1  57   ? 85.218  8.035   108.600 1.00 71.93  ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A  1  57   ? 85.658  7.893   109.743 1.00 74.63  ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A  1  57   ? 85.164  10.509  108.359 1.00 71.76  ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A  1  57   ? 86.564  10.351  107.797 1.00 80.11  ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A  1  57   ? 86.780  10.305  106.425 1.00 81.63  ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A  1  57   ? 87.667  10.237  108.637 1.00 81.62  ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A  1  57   ? 88.054  10.160  105.903 1.00 81.78  ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A  1  57   ? 88.946  10.087  108.124 1.00 81.22  ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A  1  57   ? 89.133  10.050  106.756 1.00 85.01  ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A  1  57   ? 90.401  9.902   106.237 1.00 90.88  ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A  1  58   ? 85.488  7.192   107.607 1.00 72.97  ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A  1  58   ? 86.384  6.053   107.762 1.00 76.08  ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A  1  58   ? 87.616  6.300   106.904 1.00 84.77  ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A  1  58   ? 87.495  6.641   105.721 1.00 88.42  ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A  1  58   ? 85.699  4.730   107.377 1.00 76.05  ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A  1  58   ? 84.374  4.579   108.126 1.00 78.96  ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A  1  58   ? 86.608  3.555   107.687 1.00 74.01  ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A  1  58   ? 83.623  3.299   107.803 1.00 70.67  ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A  1  59   ? 88.797  6.135   107.502 1.00 85.78  ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A  1  59   ? 90.038  6.367   106.777 1.00 80.92  ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A  1  59   ? 90.162  5.392   105.613 1.00 81.57  ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A  1  59   ? 89.854  4.203   105.742 1.00 81.05  ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A  1  59   ? 91.237  6.226   107.718 1.00 89.32  ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A  1  59   ? 92.576  6.548   107.066 1.00 100.75 ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A  1  59   ? 93.741  6.481   108.038 1.00 102.81 ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A  1  59   ? 93.497  6.389   109.260 1.00 97.91  ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A  1  59   ? 94.903  6.520   107.578 1.00 104.13 ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A  1  60   ? 90.603  5.915   104.466 1.00 85.14  ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A  1  60   ? 90.756  5.142   103.231 1.00 84.50  ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A  1  60   ? 89.421  4.581   102.744 1.00 76.76  ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A  1  60   ? 89.373  3.525   102.108 1.00 75.88  ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A  1  60   ? 91.789  4.021   103.389 1.00 92.53  ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A  1  60   ? 93.209  4.548   103.560 1.00 97.26  ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A  1  60   ? 93.540  5.594   102.958 1.00 92.76  ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A  1  60   ? 93.995  3.916   104.298 1.00 96.69  ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A  1  61   ? 88.329  5.279   103.051 1.00 79.34  ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A  1  61   ? 87.001  4.964   102.538 1.00 74.35  ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A  1  61   ? 86.439  6.222   101.892 1.00 70.73  ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A  1  61   ? 86.408  7.289   102.519 1.00 71.26  ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A  1  61   ? 86.063  4.445   103.644 1.00 72.56  ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A  1  61   ? 84.630  4.404   103.146 1.00 69.32  ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A  1  61   ? 86.501  3.062   104.097 1.00 71.47  ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A  1  62   ? 86.005  6.100   100.641 1.00 67.23  ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A  1  62   ? 85.573  7.262   99.874  1.00 68.67  ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A  1  62   ? 84.082  7.553   100.018 1.00 66.40  ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A  1  62   ? 83.681  8.722   100.035 1.00 64.17  ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A  1  62   ? 85.927  7.064   98.400  1.00 61.18  ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A  1  62   ? 87.424  7.093   98.106  1.00 53.42  ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A  1  62   ? 87.693  6.880   96.624  1.00 60.17  ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A  1  62   ? 88.003  8.413   98.581  1.00 56.83  ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A  1  63   ? 83.254  6.515   100.115 1.00 64.61  ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A  1  63   ? 81.809  6.680   100.155 1.00 64.19  ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A  1  63   ? 81.200  5.510   100.917 1.00 65.83  ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A  1  63   ? 81.903  4.602   101.370 1.00 67.01  ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A  1  63   ? 81.238  6.783   98.741  1.00 63.10  ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A  1  63   ? 81.724  5.710   97.820  1.00 59.88  ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A  1  63   ? 81.327  4.395   97.935  1.00 60.15  ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A  1  63   ? 82.588  5.753   96.779  1.00 61.73  ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A  1  63   ? 81.919  3.676   96.998  1.00 61.86  ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A  1  63   ? 82.691  4.476   96.284  1.00 64.24  ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A  1  64   ? 79.870  5.530   101.044 1.00 63.50  ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A  1  64   ? 79.182  4.515   101.836 1.00 64.53  ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A  1  64   ? 79.184  3.149   101.162 1.00 66.33  ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A  1  64   ? 79.095  2.130   101.855 1.00 67.38  ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A  1  64   ? 77.745  4.962   102.124 1.00 67.12  ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A  1  64   ? 76.985  4.053   103.087 1.00 72.55  ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A  1  64   ? 75.594  4.570   103.426 1.00 83.51  ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A  1  64   ? 75.239  5.682   102.978 1.00 88.53  ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A  1  64   ? 74.856  3.860   104.145 1.00 78.85  ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A  1  65   ? 79.302  3.098   99.836  1.00 69.93  ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A  1  65   ? 79.254  1.844   99.097  1.00 68.75  ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A  1  65   ? 80.612  1.160   99.011  1.00 68.26  ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A  1  65   ? 80.797  0.275   98.168  1.00 66.52  ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A  1  65   ? 78.694  2.088   97.694  1.00 61.03  ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A  1  65   ? 77.390  2.827   97.694  1.00 59.97  ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A  1  65   ? 76.197  2.147   97.864  1.00 58.38  ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A  1  65   ? 77.358  4.205   97.546  1.00 63.20  ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A  1  65   ? 74.993  2.826   97.875  1.00 59.64  ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A  1  65   ? 76.159  4.889   97.555  1.00 60.72  ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A  1  65   ? 74.975  4.199   97.720  1.00 61.49  ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A  1  66   ? 81.558  1.550   99.861  1.00 67.01  ? 66   SER A N     1 
ATOM   490   C  CA    . SER A  1  66   ? 82.890  0.970   99.855  1.00 65.31  ? 66   SER A CA    1 
ATOM   491   C  C     . SER A  1  66   ? 82.919  -0.314  100.687 1.00 64.72  ? 66   SER A C     1 
ATOM   492   O  O     . SER A  1  66   ? 81.909  -0.764  101.236 1.00 63.66  ? 66   SER A O     1 
ATOM   493   C  CB    . SER A  1  66   ? 83.908  1.985   100.373 1.00 69.01  ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A  1  66   ? 83.805  3.219   99.681  1.00 69.48  ? 66   SER A OG    1 
ATOM   495   N  N     . THR A  1  67   ? 84.101  -0.919  100.766 1.00 70.11  ? 67   THR A N     1 
ATOM   496   C  CA    . THR A  1  67   ? 84.339  -2.085  101.605 1.00 69.64  ? 67   THR A CA    1 
ATOM   497   C  C     . THR A  1  67   ? 85.793  -2.052  102.049 1.00 73.50  ? 67   THR A C     1 
ATOM   498   O  O     . THR A  1  67   ? 86.686  -1.771  101.245 1.00 76.98  ? 67   THR A O     1 
ATOM   499   C  CB    . THR A  1  67   ? 84.034  -3.394  100.868 1.00 69.35  ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A  1  67   ? 84.649  -4.487  101.561 1.00 71.61  ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A  1  67   ? 84.553  -3.338  99.439  1.00 67.87  ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A  1  68   ? 86.023  -2.331  103.322 1.00 69.16  ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A  1  68   ? 87.341  -2.190  103.938 1.00 65.14  ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A  1  68   ? 88.041  -3.542  103.898 1.00 70.27  ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A  1  68   ? 87.445  -4.542  104.320 1.00 70.22  ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A  1  68   ? 87.236  -1.677  105.383 1.00 69.75  ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A  1  68   ? 86.371  -0.420  105.434 1.00 76.35  ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A  1  68   ? 88.618  -1.392  105.941 1.00 72.82  ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A  1  68   ? 86.079  0.054   106.833 1.00 72.30  ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A  1  69   ? 89.274  -3.619  103.395 1.00 77.74  ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A  1  69   ? 90.022  -4.879  103.481 1.00 71.86  ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A  1  69   ? 90.349  -5.205  104.930 1.00 72.72  ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A  1  69   ? 90.696  -4.324  105.721 1.00 68.80  ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A  1  69   ? 91.288  -4.602  102.660 1.00 61.06  ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A  1  69   ? 90.935  -3.435  101.782 1.00 59.27  ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A  1  69   ? 89.981  -2.609  102.588 1.00 74.91  ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A  1  70   ? 90.211  -6.485  105.277 1.00 75.84  ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A  1  70   ? 90.372  -6.937  106.642 1.00 74.38  ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A  1  70   ? 89.129  -6.834  107.498 1.00 78.40  ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A  1  70   ? 89.154  -7.283  108.650 1.00 82.12  ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A  1  71   ? 88.046  -6.264  106.975 1.00 81.42  ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A  1  71   ? 86.803  -6.069  107.711 1.00 71.83  ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A  1  71   ? 85.716  -6.897  107.039 1.00 74.22  ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A  1  71   ? 85.552  -6.839  105.815 1.00 75.08  ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A  1  71   ? 86.405  -4.582  107.767 1.00 68.35  ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A  1  71   ? 85.074  -4.408  108.473 1.00 71.74  ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A  1  71   ? 87.485  -3.769  108.459 1.00 68.26  ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A  1  72   ? 84.972  -7.662  107.843 1.00 75.88  ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A  1  72   ? 83.920  -8.515  107.296 1.00 74.70  ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A  1  72   ? 82.722  -7.693  106.834 1.00 71.33  ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A  1  72   ? 82.161  -7.948  105.761 1.00 68.36  ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A  1  72   ? 83.492  -9.550  108.336 1.00 66.68  ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A  1  72   ? 82.360  -10.450 107.884 1.00 70.73  ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A  1  72   ? 81.927  -11.401 108.985 1.00 79.76  ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A  1  72   ? 80.645  -12.131 108.599 1.00 83.14  ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A  1  72   ? 80.136  -13.036 109.669 1.00 84.63  ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A  1  73   ? 82.311  -6.711  107.627 1.00 71.06  ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A  1  73   ? 81.179  -5.873  107.265 1.00 70.58  ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A  1  73   ? 81.587  -4.832  106.233 1.00 69.82  ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A  1  73   ? 82.717  -4.332  106.241 1.00 73.08  ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A  1  73   ? 80.604  -5.179  108.502 1.00 68.55  ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A  1  73   ? 79.879  -6.100  109.478 1.00 77.63  ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A  1  73   ? 80.817  -6.807  110.441 1.00 83.30  ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A  1  73   ? 82.045  -6.767  110.217 1.00 85.14  ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A  1  73   ? 80.325  -7.399  111.427 1.00 83.07  ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A  1  74   ? 80.660  -4.514  105.335 1.00 65.47  ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A  1  74   ? 80.834  -3.402  104.417 1.00 65.87  ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A  1  74   ? 80.526  -2.093  105.142 1.00 64.22  ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A  1  74   ? 80.085  -2.081  106.293 1.00 65.92  ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A  1  74   ? 79.949  -3.590  103.188 1.00 66.84  ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A  1  74   ? 78.542  -4.037  103.544 1.00 72.92  ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A  1  74   ? 77.700  -3.164  103.847 1.00 72.83  ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A  1  74   ? 78.279  -5.261  103.525 1.00 75.48  ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A  1  75   ? 80.758  -0.968  104.464 1.00 61.56  ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A  1  75   ? 80.532  0.326   105.101 1.00 57.69  ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A  1  75   ? 79.050  0.543   105.384 1.00 64.18  ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A  1  75   ? 78.691  1.184   106.380 1.00 69.43  ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A  1  75   ? 81.114  1.455   104.238 1.00 56.85  ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A  1  75   ? 80.923  2.800   104.915 1.00 54.99  ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A  1  75   ? 82.583  1.196   103.968 1.00 67.98  ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A  1  76   ? 78.167  0.016   104.531 1.00 61.99  ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A  1  76   ? 76.731  0.157   104.765 1.00 62.03  ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A  1  76   ? 76.344  -0.493  106.086 1.00 64.47  ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A  1  76   ? 75.661  0.112   106.919 1.00 64.93  ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A  1  76   ? 75.930  -0.439  103.595 1.00 61.23  ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A  1  76   ? 74.446  -0.453  103.926 1.00 55.39  ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A  1  76   ? 76.187  0.353   102.329 1.00 67.83  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A  1  77   ? 76.779  -1.738  106.296 1.00 66.72  ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A  1  77   ? 76.448  -2.441  107.531 1.00 63.06  ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A  1  77   ? 77.129  -1.809  108.738 1.00 65.04  ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A  1  77   ? 76.552  -1.786  109.832 1.00 72.34  ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A  1  77   ? 76.825  -3.918  107.407 1.00 61.45  ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A  1  77   ? 76.515  -4.749  108.641 1.00 66.69  ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A  1  77   ? 76.579  -6.241  108.372 1.00 77.15  ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A  1  77   ? 75.933  -7.009  109.118 1.00 77.68  ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A  1  77   ? 77.268  -6.646  107.412 1.00 77.02  ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A  1  78   ? 78.344  -1.284  108.567 1.00 63.64  ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A  1  78   ? 79.007  -0.594  109.670 1.00 65.97  ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A  1  78   ? 78.197  0.628   110.085 1.00 63.83  ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A  1  78   ? 77.948  0.855   111.273 1.00 65.87  ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A  1  78   ? 80.451  -0.222  109.285 1.00 64.93  ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A  1  78   ? 81.301  -1.486  109.135 1.00 65.73  ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A  1  78   ? 81.070  0.701   110.329 1.00 59.22  ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A  1  78   ? 82.715  -1.223  108.671 1.00 71.26  ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A  1  79   ? 77.750  1.417   109.107 1.00 61.62  ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A  1  79   ? 76.951  2.603   109.408 1.00 66.43  ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A  1  79   ? 75.607  2.211   110.014 1.00 66.43  ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A  1  79   ? 75.076  2.907   110.889 1.00 65.69  ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A  1  79   ? 76.789  3.456   108.137 1.00 65.42  ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A  1  79   ? 78.119  4.123   107.787 1.00 58.17  ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A  1  79   ? 75.698  4.497   108.309 1.00 67.41  ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A  1  79   ? 78.065  4.945   106.532 1.00 69.50  ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A  1  80   ? 75.038  1.087   109.570 1.00 66.82  ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A  1  80   ? 73.801  0.597   110.173 1.00 63.80  ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A  1  80   ? 74.005  0.250   111.642 1.00 63.17  ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A  1  80   ? 73.174  0.591   112.491 1.00 66.15  ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A  1  80   ? 73.287  -0.618  109.401 1.00 55.95  ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A  1  80   ? 71.990  -0.427  108.619 1.00 51.96  ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A  1  80   ? 72.037  0.873   107.836 1.00 61.36  ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A  1  80   ? 71.760  -1.609  107.693 1.00 48.10  ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A  1  81   ? 75.105  -0.435  111.960 1.00 66.17  ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A  1  81   ? 75.429  -0.713  113.354 1.00 64.30  ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A  1  81   ? 75.726  0.568   114.125 1.00 68.46  ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A  1  81   ? 75.503  0.626   115.338 1.00 72.97  ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A  1  81   ? 76.613  -1.672  113.437 1.00 62.07  ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A  1  81   ? 76.294  -3.036  112.860 1.00 62.94  ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A  1  81   ? 75.130  -3.418  112.750 1.00 62.86  ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A  1  81   ? 77.329  -3.781  112.494 1.00 67.81  ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A  1  82   ? 76.227  1.598   113.444 1.00 65.03  ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A  1  82   ? 76.467  2.876   114.101 1.00 69.69  ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A  1  82   ? 75.178  3.647   114.349 1.00 71.59  ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A  1  82   ? 75.141  4.504   115.239 1.00 72.04  ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A  1  82   ? 77.435  3.719   113.270 1.00 63.62  ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A  1  82   ? 78.858  3.161   113.204 1.00 65.92  ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A  1  82   ? 79.673  3.851   112.120 1.00 69.68  ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A  1  82   ? 79.538  3.288   114.555 1.00 68.89  ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A  1  83   ? 74.130  3.372   113.576 1.00 65.76  ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A  1  83   ? 72.838  3.998   113.837 1.00 69.96  ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A  1  83   ? 72.238  3.555   115.167 1.00 77.14  ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A  1  83   ? 71.410  4.278   115.730 1.00 78.24  ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A  1  83   ? 71.856  3.685   112.709 1.00 69.83  ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A  1  83   ? 72.211  4.296   111.372 1.00 70.03  ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A  1  83   ? 71.111  4.032   110.356 1.00 73.63  ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A  1  83   ? 69.776  4.591   110.834 1.00 77.20  ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A  1  83   ? 68.674  4.351   109.858 1.00 74.21  ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A  1  84   ? 72.634  2.390   115.676 1.00 73.76  ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A  1  84   ? 72.121  1.862   116.933 1.00 75.31  ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A  1  84   ? 72.895  2.359   118.147 1.00 73.57  ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A  1  84   ? 72.614  1.916   119.266 1.00 73.92  ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A  1  84   ? 72.137  0.328   116.904 1.00 75.68  ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A  1  84   ? 71.332  -0.291  115.767 1.00 81.35  ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A  1  84   ? 69.831  -0.098  115.927 1.00 100.35 ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A  1  84   ? 69.371  0.109   117.071 1.00 109.10 ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A  1  84   ? 69.108  -0.154  114.908 1.00 104.56 ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A  1  85   ? 73.852  3.261   117.961 1.00 73.30  ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A  1  85   ? 74.662  3.749   119.068 1.00 70.72  ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A  1  85   ? 73.869  4.754   119.896 1.00 67.96  ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A  1  85   ? 73.334  5.730   119.360 1.00 59.23  ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A  1  85   ? 75.947  4.386   118.540 1.00 70.80  ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A  1  85   ? 76.990  4.768   119.590 1.00 67.91  ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A  1  85   ? 77.592  3.518   120.201 1.00 71.49  ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A  1  85   ? 78.069  5.653   118.992 1.00 68.05  ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A  1  86   ? 73.798  4.512   121.203 1.00 70.60  ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A  1  86   ? 73.083  5.374   122.139 1.00 70.07  ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A  1  86   ? 74.124  6.136   122.947 1.00 69.70  ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A  1  86   ? 74.864  5.543   123.741 1.00 69.21  ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A  1  86   ? 72.148  4.573   123.056 1.00 72.10  ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A  1  86   ? 71.438  5.504   124.027 1.00 82.05  ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A  1  86   ? 71.144  3.779   122.232 1.00 72.89  ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A  1  87   ? 74.184  7.451   122.752 1.00 70.68  ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A  1  87   ? 75.189  8.299   123.381 1.00 74.02  ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A  1  87   ? 74.482  9.295   124.286 1.00 77.86  ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A  1  87   ? 73.599  10.033  123.834 1.00 77.37  ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A  1  87   ? 76.051  9.032   122.337 1.00 76.45  ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A  1  87   ? 76.961  10.038  123.015 1.00 76.52  ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A  1  87   ? 76.867  8.038   121.530 1.00 77.79  ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A  1  88   ? 74.882  9.326   125.554 1.00 81.87  ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A  1  88   ? 74.303  10.220  126.544 1.00 76.08  ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A  1  88   ? 75.271  11.368  126.796 1.00 76.69  ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A  1  88   ? 76.440  11.141  127.140 1.00 78.43  ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A  1  88   ? 74.008  9.477   127.842 1.00 73.08  ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A  1  88   ? 73.596  10.392  128.969 1.00 82.12  ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A  1  88   ? 73.628  9.684   130.306 1.00 81.76  ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A  1  88   ? 73.141  10.555  131.369 1.00 73.83  ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A  1  88   ? 73.074  10.205  132.646 1.00 78.05  ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A  1  88   ? 73.467  8.996   133.026 1.00 80.52  ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A  1  88   ? 72.615  11.065  133.544 1.00 88.92  ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A  1  89   ? 74.785  12.593  126.611 1.00 77.53  ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A  1  89   ? 75.542  13.792  126.940 1.00 80.69  ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A  1  89   ? 75.257  14.165  128.388 1.00 92.90  ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A  1  89   ? 74.106  14.439  128.747 1.00 96.17  ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A  1  89   ? 75.171  14.953  126.020 1.00 82.51  ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A  1  89   ? 75.610  14.775  124.598 1.00 89.88  ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A  1  89   ? 76.437  13.727  124.233 1.00 85.01  ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A  1  89   ? 75.203  15.673  123.624 1.00 93.72  ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A  1  89   ? 76.840  13.571  122.920 1.00 81.71  ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A  1  89   ? 75.605  15.523  122.309 1.00 87.38  ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A  1  89   ? 76.424  14.471  121.957 1.00 79.29  ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A  1  90   ? 76.301  14.177  129.217 1.00 92.98  ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A  1  90   ? 76.129  14.605  130.599 1.00 87.26  ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A  1  90   ? 76.007  16.120  130.710 1.00 88.80  ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A  1  90   ? 75.276  16.616  131.572 1.00 92.24  ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A  1  90   ? 77.289  14.101  131.462 1.00 83.42  ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A  1  90   ? 77.387  12.603  131.787 1.00 77.42  ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A  1  90   ? 76.021  12.007  132.084 1.00 76.84  ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A  1  90   ? 78.091  11.819  130.689 1.00 84.45  ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A  1  91   ? 76.692  16.864  129.847 1.00 94.59  ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A  1  91   ? 76.647  18.319  129.890 1.00 99.57  ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A  1  91   ? 75.461  18.821  129.076 1.00 100.80 ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A  1  91   ? 75.418  18.586  127.861 1.00 101.29 ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A  1  91   ? 77.939  18.908  129.350 1.00 101.27 ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A  1  91   ? 78.029  20.409  129.556 1.00 107.59 ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A  1  91   ? 77.113  21.034  130.092 1.00 106.47 ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A  1  91   ? 79.148  20.993  129.143 1.00 112.05 ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A  1  92   ? 74.489  19.505  129.688 1.00 102.17 ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A  1  92   ? 73.321  19.966  128.917 1.00 103.14 ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A  1  92   ? 73.653  20.985  127.840 1.00 101.01 ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A  1  92   ? 72.858  21.154  126.908 1.00 102.34 ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A  1  92   ? 72.402  20.569  129.991 1.00 104.48 ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A  1  92   ? 72.860  19.972  131.279 1.00 107.78 ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A  1  92   ? 74.338  19.763  131.130 1.00 103.23 ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A  1  93   ? 74.793  21.668  127.930 1.00 99.32  ? 93   SER A N     1 
ATOM   703   C  CA    . SER A  1  93   ? 75.179  22.648  126.925 1.00 100.35 ? 93   SER A CA    1 
ATOM   704   C  C     . SER A  1  93   ? 75.913  22.029  125.744 1.00 101.44 ? 93   SER A C     1 
ATOM   705   O  O     . SER A  1  93   ? 76.124  22.714  124.737 1.00 101.12 ? 93   SER A O     1 
ATOM   706   C  CB    . SER A  1  93   ? 76.056  23.730  127.559 1.00 104.34 ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A  1  93   ? 75.425  24.275  128.704 1.00 106.12 ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A  1  94   ? 76.292  20.758  125.842 1.00 103.90 ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A  1  94   ? 77.036  20.079  124.788 1.00 103.50 ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A  1  94   ? 76.080  19.670  123.673 1.00 102.42 ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A  1  94   ? 75.105  18.951  123.917 1.00 102.58 ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A  1  94   ? 77.756  18.863  125.367 1.00 98.69  ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A  1  94   ? 78.842  18.198  124.527 1.00 86.32  ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A  1  94   ? 79.884  19.220  124.111 1.00 86.91  ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A  1  94   ? 79.477  17.070  125.323 1.00 83.03  ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A  1  95   ? 76.354  20.130  122.450 1.00 94.62  ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A  1  95   ? 75.465  19.884  121.325 1.00 97.60  ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A  1  95   ? 76.076  19.022  120.227 1.00 89.86  ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A  1  95   ? 75.363  18.669  119.280 1.00 92.30  ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A  1  95   ? 74.988  21.215  120.721 1.00 104.47 ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A  1  95   ? 74.029  22.000  121.619 1.00 112.73 ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A  1  95   ? 73.394  23.189  120.912 1.00 126.11 ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A  1  95   ? 73.607  23.404  119.718 1.00 130.25 ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A  1  95   ? 72.606  23.967  121.649 1.00 122.43 ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A  1  96   ? 77.360  18.674  120.316 1.00 90.76  ? 96   THR A N     1 
ATOM   726   C  CA    . THR A  1  96   ? 77.981  17.831  119.302 1.00 80.33  ? 96   THR A CA    1 
ATOM   727   C  C     . THR A  1  96   ? 79.289  17.258  119.834 1.00 72.74  ? 96   THR A C     1 
ATOM   728   O  O     . THR A  1  96   ? 80.050  17.951  120.514 1.00 73.71  ? 96   THR A O     1 
ATOM   729   C  CB    . THR A  1  96   ? 78.233  18.608  118.004 1.00 80.93  ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A  1  96   ? 79.070  17.835  117.133 1.00 84.36  ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A  1  96   ? 78.895  19.948  118.295 1.00 83.78  ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A  1  97   ? 79.543  15.989  119.508 1.00 69.99  ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A  1  97   ? 80.745  15.280  119.931 1.00 69.52  ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A  1  97   ? 81.284  14.503  118.737 1.00 76.09  ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A  1  97   ? 80.530  14.091  117.851 1.00 79.81  ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A  1  97   ? 80.462  14.337  121.130 1.00 66.21  ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A  1  97   ? 81.687  13.513  121.500 1.00 59.19  ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A  1  97   ? 79.999  15.135  122.330 1.00 81.70  ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A  1  98   ? 82.604  14.329  118.695 1.00 75.34  ? 98   THR A N     1 
ATOM   740   C  CA    . THR A  1  98   ? 83.252  13.509  117.676 1.00 73.41  ? 98   THR A CA    1 
ATOM   741   C  C     . THR A  1  98   ? 84.018  12.383  118.361 1.00 75.19  ? 98   THR A C     1 
ATOM   742   O  O     . THR A  1  98   ? 85.074  12.613  118.960 1.00 76.10  ? 98   THR A O     1 
ATOM   743   C  CB    . THR A  1  98   ? 84.171  14.353  116.796 1.00 74.64  ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A  1  98   ? 83.385  15.321  116.089 1.00 73.51  ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A  1  98   ? 84.912  13.471  115.797 1.00 74.45  ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A  1  99   ? 83.476  11.170  118.269 1.00 74.01  ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A  1  99   ? 84.134  9.981   118.790 1.00 72.88  ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A  1  99   ? 85.167  9.474   117.796 1.00 76.07  ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A  1  99   ? 84.967  9.546   116.580 1.00 75.77  ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A  1  99   ? 83.116  8.874   119.066 1.00 70.81  ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A  1  99   ? 82.305  8.862   120.361 1.00 73.75  ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A  1  99   ? 81.398  10.076  120.468 1.00 72.81  ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A  1  99   ? 81.495  7.578   120.434 1.00 71.39  ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A  1  100  ? 86.265  8.941   118.322 1.00 77.70  ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A  1  100  ? 87.333  8.374   117.515 1.00 69.60  ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A  1  100  ? 87.502  6.901   117.852 1.00 70.82  ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A  1  100  ? 87.424  6.508   119.020 1.00 67.95  ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A  1  100  ? 88.649  9.123   117.738 1.00 67.23  ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A  1  100  ? 88.621  10.595  117.325 1.00 69.67  ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A  1  100  ? 88.435  11.512  118.530 1.00 62.14  ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A  1  100  ? 89.875  10.955  116.542 1.00 87.13  ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A  1  101  ? 87.732  6.091   116.821 1.00 77.78  ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A  1  101  ? 87.924  4.656   116.964 1.00 76.16  ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A  1  101  ? 89.123  4.248   116.125 1.00 79.08  ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A  1  101  ? 89.187  4.569   114.934 1.00 81.71  ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A  1  101  ? 86.671  3.887   116.528 1.00 69.35  ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A  1  101  ? 86.622  2.379   116.787 1.00 75.14  ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A  1  101  ? 85.207  1.959   117.145 1.00 78.98  ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A  1  101  ? 87.112  1.588   115.585 1.00 74.95  ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A  1  102  ? 90.079  3.566   116.753 1.00 81.14  ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A  1  102  ? 91.256  3.024   116.079 1.00 77.87  ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A  1  102  ? 91.462  1.606   116.587 1.00 83.28  ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A  1  102  ? 91.794  1.409   117.760 1.00 96.26  ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A  1  102  ? 92.497  3.878   116.341 1.00 81.23  ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A  1  102  ? 92.382  5.322   115.891 1.00 90.04  ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A  1  102  ? 93.654  6.097   116.203 1.00 98.60  ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A  1  102  ? 93.537  7.542   115.750 1.00 104.23 ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A  1  102  ? 92.336  8.202   116.335 1.00 94.25  ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A  1  103  ? 91.267  0.623   115.712 1.00 83.90  ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A  1  103  ? 91.385  -0.771  116.109 1.00 88.70  ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A  1  103  ? 91.961  -1.573  114.952 1.00 88.93  ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A  1  103  ? 91.894  -1.163  113.789 1.00 92.90  ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A  1  103  ? 90.034  -1.352  116.544 1.00 89.76  ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A  1  104  ? 92.532  -2.724  115.287 1.00 86.80  ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A  1  104  ? 93.156  -3.583  114.292 1.00 89.84  ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A  1  104  ? 93.301  -4.980  114.884 1.00 86.06  ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A  1  104  ? 92.809  -5.264  115.981 1.00 87.40  ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A  1  104  ? 94.501  -3.005  113.842 1.00 103.75 ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A  1  104  ? 95.466  -2.721  114.978 1.00 101.90 ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A  1  104  ? 96.793  -2.181  114.484 1.00 115.10 ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A  1  104  ? 97.602  -1.731  115.324 1.00 119.92 ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A  1  104  ? 97.027  -2.205  113.256 1.00 117.70 ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A  1  105  ? 93.977  -5.857  114.149 1.00 92.01  ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A  1  105  ? 94.198  -7.209  114.593 1.00 92.27  ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A  1  105  ? 92.927  -8.026  114.552 1.00 91.56  ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A  1  105  ? 91.864  -7.548  114.146 1.00 94.05  ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A  1  106  ? 93.014  -9.281  114.984 1.00 93.72  ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A  1  106  ? 91.837  -10.164 114.959 1.00 97.11  ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A  1  106  ? 90.895  -9.930  116.131 1.00 99.08  ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A  1  106  ? 91.005  -10.603 117.161 1.00 102.86 ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A  1  106  ? 92.455  -11.570 114.999 1.00 94.79  ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A  1  106  ? 93.872  -11.385 115.508 1.00 97.41  ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A  1  106  ? 94.176  -9.920  115.622 1.00 97.62  ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A  1  107  ? 89.973  -8.976  115.996 1.00 96.17  ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A  1  107  ? 89.104  -8.620  117.112 1.00 92.75  ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A  1  107  ? 87.748  -8.169  116.594 1.00 89.88  ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A  1  107  ? 87.632  -7.651  115.484 1.00 91.71  ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A  1  107  ? 89.718  -7.515  117.982 1.00 93.40  ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A  1  107  ? 89.730  -6.137  117.334 1.00 86.55  ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A  1  107  ? 90.098  -5.059  118.342 1.00 92.74  ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A  1  107  ? 89.146  -5.063  119.530 1.00 88.21  ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A  1  107  ? 89.536  -4.049  120.547 1.00 97.72  ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A  1  108  ? 86.723  -8.361  117.412 1.00 91.41  ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A  1  108  ? 85.379  -7.888  117.100 1.00 87.68  ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A  1  108  ? 85.168  -6.558  117.814 1.00 86.77  ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A  1  108  ? 85.012  -6.519  119.039 1.00 86.31  ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A  1  108  ? 84.336  -8.923  117.508 1.00 90.38  ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A  1  108  ? 84.491  -10.243 116.773 1.00 96.10  ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A  1  108  ? 83.403  -11.238 117.116 1.00 111.22 ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A  1  108  ? 82.490  -10.883 117.893 1.00 114.04 ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A  1  108  ? 83.463  -12.377 116.606 1.00 114.24 ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A  1  109  ? 85.173  -5.470  117.045 1.00 82.87  ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A  1  109  ? 85.123  -4.127  117.610 1.00 84.50  ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A  1  109  ? 83.726  -3.861  118.156 1.00 83.44  ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A  1  109  ? 82.726  -3.989  117.439 1.00 83.81  ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A  1  109  ? 85.515  -3.084  116.556 1.00 73.66  ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A  1  109  ? 85.494  -1.688  117.149 1.00 74.35  ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A  1  109  ? 86.881  -3.406  115.989 1.00 78.09  ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A  1  110  ? 83.653  -3.489  119.429 1.00 77.35  ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A  1  110  ? 82.415  -3.087  120.075 1.00 73.35  ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A  1  110  ? 82.411  -1.574  120.262 1.00 72.64  ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A  1  110  ? 83.395  -0.885  119.982 1.00 75.84  ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A  1  110  ? 82.246  -3.810  121.411 1.00 74.64  ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A  1  110  ? 82.374  -5.318  121.314 1.00 77.83  ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A  1  110  ? 81.341  -5.902  120.365 1.00 78.79  ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A  1  110  ? 81.478  -7.415  120.271 1.00 88.26  ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A  1  110  ? 80.391  -8.028  119.457 1.00 88.20  ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A  1  111  ? 81.285  -1.057  120.754 1.00 70.08  ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A  1  111  ? 81.163  0.380   120.960 1.00 69.37  ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A  1  111  ? 82.014  0.874   122.122 1.00 76.73  ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A  1  111  ? 82.312  2.071   122.188 1.00 77.45  ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A  1  111  ? 79.697  0.753   121.187 1.00 80.11  ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A  1  112  ? 82.416  -0.017  123.034 1.00 80.69  ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A  1  112  ? 83.295  0.375   124.132 1.00 80.94  ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A  1  112  ? 84.682  0.771   123.645 1.00 86.24  ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A  1  112  ? 85.399  1.479   124.361 1.00 83.45  ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A  1  112  ? 83.414  -0.763  125.148 1.00 75.98  ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A  1  112  ? 84.180  -1.971  124.627 1.00 80.25  ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A  1  112  ? 84.174  -3.136  125.604 1.00 81.73  ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A  1  112  ? 82.853  -3.745  125.726 1.00 85.29  ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A  1  112  ? 82.054  -3.598  126.779 1.00 95.06  ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A  1  112  ? 80.867  -4.188  126.798 1.00 95.93  ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A  1  112  ? 82.443  -2.868  127.818 1.00 84.78  ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A  1  113  ? 85.071  0.335   122.443 1.00 88.79  ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A  1  113  ? 86.398  0.599   121.899 1.00 83.15  ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A  1  113  ? 86.579  2.039   121.436 1.00 81.37  ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A  1  113  ? 87.689  2.401   121.032 1.00 86.86  ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A  1  113  ? 86.681  -0.366  120.745 1.00 83.87  ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A  1  113  ? 86.547  -1.823  121.158 1.00 87.47  ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A  1  113  ? 86.845  -2.141  122.329 1.00 82.53  ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A  1  113  ? 86.141  -2.650  120.314 1.00 89.86  ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A  1  114  ? 85.532  2.858   121.475 1.00 77.23  ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A  1  114  ? 85.691  4.281   121.213 1.00 77.79  ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A  1  114  ? 86.527  4.920   122.312 1.00 77.82  ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A  1  114  ? 86.387  4.587   123.492 1.00 78.28  ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A  1  114  ? 84.329  4.969   121.133 1.00 84.39  ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A  1  114  ? 83.609  4.743   119.838 1.00 78.27  ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A  1  114  ? 83.980  5.433   118.698 1.00 79.39  ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A  1  114  ? 82.551  3.854   119.762 1.00 75.42  ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A  1  114  ? 83.315  5.232   117.501 1.00 78.05  ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A  1  114  ? 81.883  3.651   118.574 1.00 74.32  ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A  1  114  ? 82.265  4.340   117.440 1.00 73.77  ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A  1  115  ? 87.405  5.832   121.921 1.00 78.09  ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A  1  115  ? 88.248  6.503   122.900 1.00 78.09  ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A  1  115  ? 87.392  7.431   123.755 1.00 79.36  ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A  1  115  ? 86.658  8.265   123.208 1.00 73.57  ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A  1  115  ? 89.369  7.277   122.211 1.00 79.87  ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A  1  115  ? 90.486  6.386   121.660 1.00 81.32  ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A  1  115  ? 91.649  7.220   121.134 1.00 81.08  ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A  1  115  ? 90.954  5.402   122.725 1.00 72.42  ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A  1  116  ? 87.444  7.308   125.085 1.00 81.68  ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A  1  116  ? 86.487  8.029   125.934 1.00 79.91  ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A  1  116  ? 86.658  9.541   125.854 1.00 79.63  ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A  1  116  ? 87.769  10.058  125.709 1.00 76.03  ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A  1  116  ? 86.797  7.499   127.340 1.00 79.24  ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A  1  116  ? 87.481  6.185   127.116 1.00 63.74  ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A  1  116  ? 88.273  6.370   125.860 1.00 75.52  ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A  1  117  ? 85.531  10.245  125.942 1.00 75.42  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A  1  117  ? 85.482  11.699  125.909 1.00 83.57  ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A  1  117  ? 84.799  12.181  127.182 1.00 95.52  ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A  1  117  ? 83.928  11.501  127.734 1.00 96.56  ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A  1  117  ? 84.745  12.219  124.651 1.00 79.38  ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A  1  117  ? 84.839  13.738  124.547 1.00 77.52  ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A  1  117  ? 85.304  11.561  123.398 1.00 80.13  ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A  1  118  ? 85.214  13.353  127.657 1.00 96.58  ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A  1  118  ? 84.638  13.918  128.870 1.00 93.97  ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A  1  118  ? 83.170  14.277  128.662 1.00 96.39  ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A  1  118  ? 82.785  14.809  127.616 1.00 93.65  ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A  1  118  ? 85.424  15.155  129.302 1.00 94.91  ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A  1  119  ? 82.351  13.973  129.674 1.00 95.20  ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A  1  119  ? 80.917  14.280  129.678 1.00 93.28  ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A  1  119  ? 80.170  13.559  128.559 1.00 91.20  ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A  1  119  ? 79.209  14.092  127.998 1.00 92.47  ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A  1  119  ? 80.664  15.789  129.594 1.00 96.58  ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A  1  119  ? 81.157  16.534  130.819 1.00 97.70  ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A  1  119  ? 81.812  15.906  131.679 1.00 96.03  ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A  1  119  ? 80.883  17.749  130.922 1.00 94.57  ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A  1  120  ? 80.601  12.343  128.223 1.00 85.75  ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A  1  120  ? 79.975  11.542  127.174 1.00 82.57  ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A  1  120  ? 79.989  10.089  127.624 1.00 80.06  ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A  1  120  ? 81.064  9.516   127.834 1.00 84.25  ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A  1  120  ? 80.696  11.683  125.822 1.00 82.40  ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A  1  120  ? 80.139  10.684  124.818 1.00 82.60  ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A  1  120  ? 80.579  13.104  125.290 1.00 78.97  ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A  1  121  ? 78.809  9.486   127.764 1.00 74.55  ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A  1  121  ? 78.707  8.093   128.182 1.00 76.69  ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A  1  121  ? 78.035  7.272   127.092 1.00 77.51  ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A  1  121  ? 76.965  7.643   126.601 1.00 79.71  ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A  1  121  ? 77.925  7.954   129.488 1.00 89.89  ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A  1  121  ? 77.804  6.513   129.962 1.00 91.17  ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A  1  121  ? 76.833  6.347   131.111 1.00 88.32  ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A  1  121  ? 76.294  7.369   131.591 1.00 90.28  ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A  1  121  ? 76.607  5.192   131.530 1.00 82.68  ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A  1  122  ? 78.651  6.151   126.729 1.00 81.72  ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A  1  122  ? 78.072  5.228   125.758 1.00 85.55  ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A  1  122  ? 77.201  4.238   126.523 1.00 84.31  ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A  1  122  ? 77.704  3.430   127.310 1.00 83.51  ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A  1  122  ? 79.153  4.512   124.938 1.00 78.65  ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A  1  122  ? 79.766  5.460   123.901 1.00 79.32  ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A  1  122  ? 78.576  3.288   124.248 1.00 75.60  ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A  1  122  ? 80.925  6.294   124.418 1.00 88.24  ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A  1  123  ? 75.887  4.297   126.284 1.00 79.83  ? 123  MET A N     1 
ATOM   933   C  CA    . MET A  1  123  ? 74.936  3.508   127.062 1.00 81.83  ? 123  MET A CA    1 
ATOM   934   C  C     . MET A  1  123  ? 74.945  2.032   126.681 1.00 84.33  ? 123  MET A C     1 
ATOM   935   O  O     . MET A  1  123  ? 74.602  1.185   127.512 1.00 91.34  ? 123  MET A O     1 
ATOM   936   C  CB    . MET A  1  123  ? 73.526  4.075   126.893 1.00 79.84  ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A  1  123  ? 73.411  5.563   127.184 1.00 81.01  ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A  1  123  ? 73.802  5.982   128.895 1.00 97.51  ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A  1  123  ? 72.539  5.059   129.770 1.00 90.44  ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A  1  124  ? 75.315  1.701   125.440 1.00 84.88  ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A  1  124  ? 75.340  0.322   124.952 1.00 84.71  ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A  1  124  ? 76.758  -0.012  124.501 1.00 91.44  ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A  1  124  ? 77.051  -0.028  123.294 1.00 88.53  ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A  1  124  ? 74.334  0.107   123.820 1.00 81.80  ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A  1  124  ? 74.380  1.209   122.772 1.00 78.50  ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A  1  124  ? 74.869  2.311   123.028 1.00 77.85  ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A  1  124  ? 73.856  0.917   121.587 1.00 77.33  ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A  1  125  ? 77.664  -0.294  125.441 1.00 86.68  ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A  1  125  ? 79.049  -0.592  125.052 1.00 85.29  ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A  1  125  ? 79.212  -1.947  124.386 1.00 84.16  ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A  1  125  ? 80.222  -2.164  123.704 1.00 83.96  ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A  1  125  ? 79.804  -0.523  126.384 1.00 84.27  ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A  1  125  ? 78.790  -0.923  127.388 1.00 80.33  ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A  1  125  ? 77.474  -0.375  126.899 1.00 77.72  ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A  1  126  ? 78.255  -2.858  124.547 1.00 86.43  ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A  1  126  ? 78.329  -4.175  123.926 1.00 85.19  ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A  1  126  ? 77.828  -4.182  122.488 1.00 87.08  ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A  1  126  ? 77.732  -5.261  121.891 1.00 88.04  ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A  1  126  ? 77.532  -5.193  124.746 1.00 95.56  ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A  1  126  ? 77.926  -5.199  126.210 1.00 112.05 ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A  1  126  ? 77.483  -4.292  126.950 1.00 118.21 ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A  1  126  ? 78.682  -6.107  126.619 1.00 110.89 ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A  1  127  ? 77.503  -3.021  121.924 1.00 82.55  ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A  1  127  ? 77.023  -2.966  120.550 1.00 78.57  ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A  1  127  ? 78.121  -3.388  119.585 1.00 82.55  ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A  1  127  ? 79.208  -2.801  119.570 1.00 82.25  ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A  1  127  ? 76.537  -1.559  120.213 1.00 75.90  ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A  1  127  ? 76.263  -1.302  118.727 1.00 74.89  ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A  1  127  ? 75.155  -2.205  118.196 1.00 71.09  ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A  1  127  ? 75.924  0.161   118.491 1.00 78.43  ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A  1  128  ? 77.830  -4.402  118.778 1.00 85.15  ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A  1  128  ? 78.771  -4.842  117.760 1.00 83.79  ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A  1  128  ? 78.843  -3.821  116.631 1.00 74.23  ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A  1  128  ? 77.820  -3.311  116.168 1.00 76.49  ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A  1  128  ? 78.351  -6.203  117.210 1.00 84.99  ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A  1  128  ? 79.280  -6.749  116.172 1.00 81.14  ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A  1  128  ? 80.268  -7.663  116.466 1.00 88.69  ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A  1  128  ? 79.372  -6.508  114.843 1.00 83.70  ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A  1  128  ? 80.929  -7.963  115.362 1.00 89.55  ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A  1  128  ? 80.406  -7.276  114.363 1.00 85.05  ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A  1  129  ? 80.060  -3.522  116.186 1.00 71.46  ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A  1  129  ? 80.289  -2.592  115.084 1.00 75.73  ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A  1  129  ? 80.823  -3.316  113.850 1.00 77.81  ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A  1  129  ? 80.189  -3.307  112.792 1.00 74.57  ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A  1  129  ? 81.224  -1.439  115.510 1.00 70.62  ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A  1  129  ? 80.504  -0.527  116.503 1.00 64.27  ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A  1  129  ? 81.692  -0.648  114.298 1.00 67.46  ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A  1  129  ? 81.198  0.787   116.728 1.00 64.77  ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A  1  130  ? 81.982  -3.961  113.968 1.00 82.60  ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A  1  130  ? 82.574  -4.651  112.830 1.00 83.30  ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A  1  130  ? 83.537  -5.721  113.325 1.00 85.03  ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A  1  130  ? 84.211  -5.547  114.343 1.00 85.13  ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A  1  130  ? 83.302  -3.674  111.900 1.00 79.51  ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A  1  131  ? 83.604  -6.822  112.582 1.00 81.75  ? 131  THR A N     1 
ATOM   995   C  CA    . THR A  1  131  ? 84.552  -7.894  112.858 1.00 79.33  ? 131  THR A CA    1 
ATOM   996   C  C     . THR A  1  131  ? 85.818  -7.645  112.046 1.00 81.79  ? 131  THR A C     1 
ATOM   997   O  O     . THR A  1  131  ? 85.762  -7.563  110.815 1.00 83.43  ? 131  THR A O     1 
ATOM   998   C  CB    . THR A  1  131  ? 83.947  -9.256  112.515 1.00 80.67  ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A  1  131  ? 82.777  -9.478  113.312 1.00 84.18  ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A  1  131  ? 84.949  -10.370 112.780 1.00 87.68  ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A  1  132  ? 86.952  -7.513  112.729 1.00 83.83  ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A  1  132  ? 88.228  -7.219  112.103 1.00 77.22  ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A  1  132  ? 89.118  -8.452  112.121 1.00 81.48  ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A  1  132  ? 89.208  -9.161  113.132 1.00 82.04  ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A  1  132  ? 88.932  -6.060  112.811 1.00 73.44  ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A  1  132  ? 88.661  -4.660  112.261 1.00 70.84  ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A  1  132  ? 87.184  -4.307  112.328 1.00 69.45  ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A  1  132  ? 89.498  -3.637  113.008 1.00 80.12  ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A  1  133  ? 89.791  -8.671  110.999 1.00 86.47  ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A  1  133  ? 90.612  -9.834  110.716 1.00 88.19  ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A  1  133  ? 92.077  -9.513  111.023 1.00 92.30  ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A  1  133  ? 92.425  -8.396  111.413 1.00 96.82  ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A  1  133  ? 90.406  -10.224 109.251 1.00 92.94  ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A  1  133  ? 90.768  -11.635 108.851 1.00 98.45  ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A  1  133  ? 90.749  -11.805 107.340 1.00 94.26  ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A  1  133  ? 90.503  -10.807 106.624 1.00 84.93  ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A  1  133  ? 90.984  -12.933 106.868 1.00 88.37  ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A  1  134  ? 92.947  -10.506 110.847 1.00 87.32  ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A  1  134  ? 94.381  -10.269 110.960 1.00 89.67  ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A  1  134  ? 94.824  -9.289  109.882 1.00 90.75  ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A  1  134  ? 94.590  -9.515  108.691 1.00 92.93  ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A  1  134  ? 95.149  -11.586 110.837 1.00 97.07  ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A  1  134  ? 95.862  -12.029 112.111 1.00 106.03 ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A  1  134  ? 97.073  -11.172 112.445 1.00 107.43 ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A  1  134  ? 97.523  -11.207 113.611 1.00 100.98 ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A  1  134  ? 97.578  -10.467 111.544 1.00 109.28 ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A  1  135  ? 95.454  -8.193  110.299 1.00 87.13  ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A  1  135  ? 95.878  -7.168  109.372 1.00 94.45  ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A  1  135  ? 94.803  -6.189  108.958 1.00 88.61  ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A  1  135  ? 95.110  -5.223  108.247 1.00 90.12  ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A  1  136  ? 93.555  -6.403  109.368 1.00 91.50  ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A  1  136  ? 92.515  -5.421  109.119 1.00 89.71  ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A  1  136  ? 92.648  -4.239  110.066 1.00 89.76  ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A  1  136  ? 92.967  -4.389  111.245 1.00 88.04  ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A  1  137  ? 92.405  -3.046  109.528 1.00 89.66  ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A  1  137  ? 92.569  -1.800  110.267 1.00 92.39  ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A  1  137  ? 91.318  -0.956  110.088 1.00 90.13  ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A  1  137  ? 90.921  -0.665  108.955 1.00 91.88  ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A  1  137  ? 93.805  -1.035  109.787 1.00 99.84  ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A  1  137  ? 95.116  -1.769  110.002 1.00 106.65 ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A  1  137  ? 96.263  -1.022  109.346 1.00 123.53 ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A  1  137  ? 96.205  0.409   109.633 1.00 135.24 ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A  1  137  ? 96.738  0.979   110.709 1.00 133.73 ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A  1  137  ? 97.373  0.238   111.607 1.00 131.13 ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A  1  137  ? 96.637  2.290   110.887 1.00 127.61 ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A  1  138  ? 90.697  -0.567  111.200 1.00 82.40  ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A  1  138  ? 89.511  0.282   111.188 1.00 81.99  ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A  1  138  ? 89.825  1.539   111.990 1.00 80.65  ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A  1  138  ? 90.033  1.470   113.206 1.00 90.29  ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A  1  138  ? 88.305  -0.460  111.761 1.00 84.46  ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A  1  138  ? 86.961  0.270   111.735 1.00 83.55  ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A  1  138  ? 86.597  0.649   110.316 1.00 78.98  ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A  1  138  ? 85.868  -0.586  112.358 1.00 82.55  ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A  1  139  ? 89.873  2.681   111.308 1.00 74.54  ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A  1  139  ? 90.132  3.971   111.938 1.00 79.07  ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A  1  139  ? 89.078  4.949   111.438 1.00 78.16  ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A  1  139  ? 89.086  5.324   110.261 1.00 81.22  ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A  1  139  ? 91.545  4.468   111.626 1.00 77.76  ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A  1  139  ? 91.863  5.798   112.294 1.00 88.25  ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A  1  139  ? 91.070  6.323   113.078 1.00 91.35  ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A  1  139  ? 93.036  6.345   111.989 1.00 88.55  ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A  1  140  ? 88.180  5.365   112.329 1.00 75.16  ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A  1  140  ? 87.054  6.189   111.914 1.00 76.85  ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A  1  140  ? 86.661  7.175   113.004 1.00 72.76  ? 140  MET A C     1 
ATOM   1065  O  O     . MET A  1  140  ? 86.866  6.938   114.198 1.00 75.13  ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A  1  140  ? 85.841  5.330   111.530 1.00 75.80  ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A  1  140  ? 85.340  4.399   112.617 1.00 78.35  ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A  1  140  ? 83.805  3.582   112.135 1.00 77.70  ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A  1  140  ? 83.574  2.445   113.501 1.00 78.02  ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A  1  141  ? 86.071  8.283   112.566 1.00 71.14  ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A  1  141  ? 85.538  9.320   113.437 1.00 72.34  ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A  1  141  ? 84.045  9.461   113.176 1.00 75.76  ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A  1  141  ? 83.626  9.641   112.027 1.00 77.38  ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A  1  141  ? 86.242  10.657  113.197 1.00 72.02  ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A  1  141  ? 87.757  10.576  113.213 1.00 77.50  ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A  1  141  ? 88.408  11.891  112.833 1.00 88.71  ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A  1  141  ? 87.671  12.838  112.482 1.00 90.87  ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A  1  141  ? 89.654  11.979  112.886 1.00 88.55  ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A  1  142  ? 83.246  9.388   114.240 1.00 76.02  ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A  1  142  ? 81.795  9.525   114.148 1.00 74.66  ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A  1  142  ? 81.384  10.836  114.813 1.00 70.78  ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A  1  142  ? 81.885  11.185  115.889 1.00 72.78  ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A  1  142  ? 81.066  8.310   114.762 1.00 69.97  ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A  1  142  ? 81.902  7.044   114.593 1.00 70.08  ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A  1  142  ? 80.704  8.525   116.223 1.00 72.96  ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A  1  143  ? 80.510  11.585  114.148 1.00 66.31  ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A  1  143  ? 79.957  12.818  114.686 1.00 63.19  ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A  1  143  ? 78.548  12.539  115.187 1.00 67.32  ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A  1  143  ? 77.676  12.135  114.400 1.00 67.11  ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A  1  143  ? 79.934  13.936  113.644 1.00 58.37  ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A  1  143  ? 79.113  15.130  114.103 1.00 62.77  ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A  1  143  ? 79.241  16.322  113.185 1.00 67.64  ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A  1  143  ? 78.404  17.427  113.645 1.00 68.41  ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A  1  143  ? 78.432  18.651  113.129 1.00 77.72  ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A  1  143  ? 79.262  18.933  112.134 1.00 85.48  ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A  1  143  ? 77.634  19.595  113.610 1.00 74.24  ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A  1  144  ? 78.341  12.775  116.485 1.00 69.63  ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A  1  144  ? 77.087  12.546  117.193 1.00 64.74  ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A  1  144  ? 76.527  13.902  117.604 1.00 64.92  ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A  1  144  ? 77.203  14.677  118.296 1.00 71.37  ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A  1  144  ? 77.297  11.647  118.423 1.00 64.87  ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A  1  144  ? 76.016  11.526  119.231 1.00 64.86  ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A  1  144  ? 77.813  10.276  118.008 1.00 65.12  ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A  1  145  ? 75.295  14.189  117.186 1.00 67.33  ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A  1  145  ? 74.628  15.445  117.497 1.00 72.88  ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A  1  145  ? 73.348  15.192  118.283 1.00 76.41  ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A  1  145  ? 72.737  14.122  118.201 1.00 77.83  ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A  1  145  ? 74.281  16.241  116.227 1.00 72.67  ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A  1  145  ? 75.483  16.935  115.617 1.00 79.17  ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A  1  145  ? 76.623  16.479  115.845 1.00 79.48  ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A  1  145  ? 75.284  17.948  114.912 1.00 83.85  ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A  1  146  ? 72.947  16.207  119.043 1.00 73.56  ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A  1  146  ? 71.663  16.210  119.725 1.00 69.39  ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A  1  146  ? 70.645  16.926  118.850 1.00 70.42  ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A  1  146  ? 70.911  18.022  118.347 1.00 65.28  ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A  1  146  ? 71.770  16.891  121.089 1.00 76.98  ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A  1  146  ? 70.435  17.122  121.781 1.00 82.63  ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A  1  146  ? 70.635  17.890  123.071 1.00 97.32  ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A  1  146  ? 71.246  17.061  124.105 1.00 103.99 ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A  1  146  ? 72.018  17.530  125.079 1.00 97.59  ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A  1  146  ? 72.290  18.826  125.148 1.00 102.62 ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A  1  146  ? 72.525  16.703  125.980 1.00 85.68  ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A  1  147  ? 69.496  16.293  118.658 1.00 73.59  ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A  1  147  ? 68.432  16.860  117.865 1.00 68.18  ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A  1  147  ? 67.108  16.264  118.279 1.00 69.01  ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A  1  147  ? 67.002  15.592  119.308 1.00 69.06  ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A  1  148  ? 66.091  16.513  117.459 1.00 73.80  ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A  1  148  ? 64.736  16.056  117.740 1.00 79.37  ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A  1  148  ? 64.182  15.350  116.512 1.00 77.54  ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A  1  148  ? 64.355  15.817  115.380 1.00 70.04  ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A  1  148  ? 63.807  17.220  118.147 1.00 73.20  ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A  1  148  ? 62.459  16.684  118.596 1.00 70.94  ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A  1  148  ? 64.440  18.069  119.239 1.00 67.89  ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A  1  149  ? 63.503  14.229  116.740 1.00 73.41  ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A  1  149  ? 62.758  13.592  115.673 1.00 77.30  ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A  1  149  ? 63.637  12.776  114.739 1.00 68.95  ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A  1  149  ? 64.670  12.229  115.127 1.00 64.45  ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A  1  150  ? 63.205  12.701  113.481 1.00 72.32  ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A  1  150  ? 63.836  11.863  112.466 1.00 71.87  ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A  1  150  ? 64.241  12.740  111.290 1.00 72.27  ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A  1  150  ? 63.382  13.231  110.548 1.00 64.57  ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A  1  150  ? 62.892  10.746  112.014 1.00 66.59  ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A  1  150  ? 63.386  9.978   110.810 1.00 64.94  ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A  1  150  ? 64.379  9.015   110.935 1.00 65.54  ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A  1  150  ? 62.860  10.216  109.547 1.00 70.48  ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A  1  150  ? 64.837  8.311   109.833 1.00 64.73  ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A  1  150  ? 63.312  9.516   108.438 1.00 72.84  ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A  1  150  ? 64.300  8.566   108.587 1.00 65.24  ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A  1  150  ? 64.752  7.869   107.489 1.00 62.32  ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A  1  151  ? 65.544  12.929  111.113 1.00 70.15  ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A  1  151  ? 66.079  13.744  110.030 1.00 68.71  ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A  1  151  ? 66.850  12.820  109.089 1.00 72.73  ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A  1  151  ? 67.930  12.327  109.453 1.00 68.58  ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A  1  151  ? 66.969  14.875  110.559 1.00 62.08  ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A  1  151  ? 67.423  15.761  109.416 1.00 65.19  ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A  1  151  ? 66.219  15.686  111.596 1.00 66.57  ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A  1  152  ? 66.339  12.551  107.887 1.00 74.60  ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A  1  152  ? 67.049  11.664  106.960 1.00 68.70  ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A  1  152  ? 68.370  12.276  106.528 1.00 72.71  ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A  1  152  ? 68.641  13.462  106.729 1.00 75.04  ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A  1  152  ? 66.082  11.525  105.776 1.00 75.08  ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A  1  152  ? 64.751  11.969  106.301 1.00 72.60  ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A  1  152  ? 65.050  13.002  107.342 1.00 75.72  ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A  1  153  ? 69.208  11.431  105.922 1.00 73.15  ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A  1  153  ? 70.528  11.880  105.493 1.00 68.08  ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A  1  153  ? 70.430  12.991  104.452 1.00 69.08  ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A  1  153  ? 71.231  13.932  104.459 1.00 68.24  ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A  1  153  ? 71.328  10.696  104.952 1.00 68.80  ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A  1  154  ? 69.445  12.910  103.557 1.00 72.21  ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A  1  154  ? 69.302  13.925  102.521 1.00 71.69  ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A  1  154  ? 68.905  15.283  103.085 1.00 71.58  ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A  1  154  ? 69.066  16.296  102.398 1.00 73.18  ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A  1  154  ? 68.275  13.477  101.479 1.00 78.63  ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A  1  154  ? 68.492  12.063  100.951 1.00 85.79  ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A  1  154  ? 67.845  11.001  101.831 1.00 98.57  ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A  1  154  ? 66.621  11.089  102.077 1.00 90.91  ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A  1  154  ? 68.565  10.084  102.287 1.00 100.11 ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A  1  155  ? 68.393  15.330  104.313 1.00 69.98  ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A  1  155  ? 67.942  16.588  104.892 1.00 68.98  ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A  1  155  ? 69.071  17.356  105.570 1.00 70.02  ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A  1  155  ? 69.230  18.558  105.336 1.00 72.78  ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A  1  155  ? 66.805  16.330  105.881 1.00 72.54  ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A  1  155  ? 65.437  16.268  105.228 1.00 87.99  ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A  1  155  ? 65.079  17.608  104.599 1.00 102.42 ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A  1  155  ? 63.781  17.528  103.811 1.00 110.57 ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A  1  155  ? 63.898  16.612  102.641 1.00 112.02 ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A  1  156  ? 69.859  16.690  106.415 1.00 63.93  ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A  1  156  ? 70.913  17.412  107.117 1.00 63.48  ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A  1  156  ? 72.228  17.421  106.347 1.00 71.92  ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A  1  156  ? 72.916  18.447  106.328 1.00 83.02  ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A  1  156  ? 71.114  16.839  108.527 1.00 69.69  ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A  1  156  ? 71.574  15.413  108.563 1.00 66.49  ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A  1  156  ? 72.904  15.058  108.498 1.00 64.06  ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A  1  156  ? 70.884  14.256  108.705 1.00 64.90  ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A  1  156  ? 73.012  13.744  108.575 1.00 61.15  ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A  1  156  ? 71.801  13.233  108.701 1.00 60.68  ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A  1  157  ? 72.583  16.310  105.701 1.00 74.33  ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A  1  157  ? 73.786  16.225  104.890 1.00 69.89  ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A  1  157  ? 75.057  16.667  105.589 1.00 69.87  ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A  1  157  ? 75.857  17.408  105.017 1.00 77.93  ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A  1  158  ? 75.252  16.219  106.825 1.00 71.55  ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A  1  158  ? 76.355  16.698  107.651 1.00 69.49  ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A  1  158  ? 77.631  15.958  107.273 1.00 72.42  ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A  1  158  ? 77.679  14.723  107.294 1.00 72.22  ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A  1  158  ? 76.032  16.523  109.143 1.00 71.31  ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A  1  158  ? 74.894  17.460  109.558 1.00 68.14  ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A  1  158  ? 77.263  16.779  109.992 1.00 69.50  ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A  1  158  ? 74.559  17.388  111.028 1.00 67.28  ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A  1  159  ? 78.670  16.715  106.925 1.00 79.76  ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A  1  159  ? 79.974  16.151  106.592 1.00 76.61  ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A  1  159  ? 81.041  16.969  107.300 1.00 81.88  ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A  1  159  ? 81.146  18.179  107.076 1.00 83.75  ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A  1  159  ? 80.212  16.146  105.077 1.00 70.17  ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A  1  159  ? 79.202  15.318  104.298 1.00 70.92  ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A  1  159  ? 79.234  15.618  102.807 1.00 74.26  ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A  1  159  ? 80.066  14.597  102.045 1.00 76.99  ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A  1  159  ? 79.866  14.697  100.570 1.00 72.67  ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A  1  160  ? 81.819  16.314  108.167 1.00 85.64  ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A  1  160  ? 82.939  16.999  108.806 1.00 89.58  ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A  1  160  ? 84.098  17.208  107.838 1.00 90.06  ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A  1  160  ? 84.915  18.115  108.037 1.00 89.01  ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A  1  160  ? 83.412  16.215  110.031 1.00 90.47  ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A  1  160  ? 82.477  16.358  111.219 1.00 88.50  ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A  1  160  ? 81.803  17.406  111.331 1.00 81.39  ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A  1  160  ? 82.427  15.423  112.047 1.00 86.96  ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A  1  161  ? 84.191  16.388  106.796 1.00 86.32  ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A  1  161  ? 85.267  16.504  105.822 1.00 86.88  ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A  1  161  ? 84.763  15.988  104.476 1.00 87.81  ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A  1  161  ? 83.568  15.740  104.294 1.00 87.34  ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A  1  161  ? 86.514  15.758  106.311 1.00 91.11  ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A  1  161  ? 86.297  14.278  106.544 1.00 85.33  ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A  1  161  ? 87.596  13.604  106.935 1.00 88.12  ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A  1  161  ? 88.003  13.952  108.292 1.00 87.08  ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A  1  161  ? 89.199  13.683  108.803 1.00 91.72  ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A  1  161  ? 90.116  13.067  108.066 1.00 88.06  ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A  1  161  ? 89.483  14.036  110.049 1.00 93.58  ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A  1  162  ? 85.687  15.820  103.528 1.00 84.44  ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A  1  162  ? 85.297  15.507  102.155 1.00 84.83  ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A  1  162  ? 84.783  14.075  102.052 1.00 82.97  ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A  1  162  ? 83.761  13.810  101.409 1.00 83.69  ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A  1  162  ? 86.474  15.756  101.197 1.00 89.67  ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A  1  162  ? 86.974  17.200  101.321 1.00 84.54  ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A  1  162  ? 86.063  15.451  99.763  1.00 87.82  ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A  1  162  ? 86.110  18.222  100.612 1.00 83.48  ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A  1  163  ? 85.486  13.129  102.675 1.00 81.71  ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A  1  163  ? 85.142  11.715  102.595 1.00 81.55  ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A  1  163  ? 84.163  11.275  103.682 1.00 80.04  ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A  1  163  ? 84.018  10.070  103.918 1.00 71.58  ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A  1  163  ? 86.411  10.863  102.664 1.00 84.01  ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A  1  163  ? 87.235  10.946  101.397 1.00 90.93  ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A  1  163  ? 86.716  11.272  100.327 1.00 83.31  ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A  1  163  ? 88.526  10.641  101.507 1.00 94.07  ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A  1  164  ? 83.494  12.218  104.344 1.00 83.19  ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A  1  164  ? 82.559  11.883  105.409 1.00 75.82  ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A  1  164  ? 81.196  11.514  104.834 1.00 72.37  ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A  1  164  ? 80.709  12.144  103.890 1.00 70.54  ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A  1  164  ? 82.419  13.049  106.387 1.00 78.30  ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A  1  165  ? 80.582  10.490  105.414 1.00 70.84  ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A  1  165  ? 79.309  9.949   104.944 1.00 65.36  ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A  1  165  ? 78.204  10.464  105.861 1.00 67.67  ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A  1  165  ? 78.231  10.170  107.067 1.00 66.33  ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A  1  165  ? 79.330  8.414   104.922 1.00 57.91  ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A  1  165  ? 80.568  7.909   104.183 1.00 64.69  ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A  1  165  ? 78.077  7.871   104.263 1.00 63.34  ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A  1  165  ? 80.839  6.435   104.392 1.00 66.07  ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A  1  166  ? 77.222  11.204  105.349 1.00 60.02  ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A  1  166  ? 76.106  11.617  106.202 1.00 62.46  ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A  1  166  ? 75.219  10.417  106.506 1.00 71.97  ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A  1  166  ? 74.976  9.567   105.644 1.00 69.49  ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A  1  166  ? 75.366  12.663  105.356 1.00 57.73  ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A  1  166  ? 76.148  12.804  104.080 1.00 62.37  ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A  1  166  ? 77.005  11.589  103.949 1.00 63.06  ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A  1  167  ? 74.748  10.349  107.749 1.00 73.52  ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A  1  167  ? 74.007  9.203   108.258 1.00 65.59  ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A  1  167  ? 72.619  9.657   108.683 1.00 68.90  ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A  1  167  ? 72.431  10.787  109.146 1.00 68.48  ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A  1  167  ? 74.759  8.531   109.431 1.00 64.05  ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A  1  167  ? 74.044  7.275   109.890 1.00 68.00  ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A  1  167  ? 76.189  8.209   109.028 1.00 67.63  ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A  1  168  ? 71.638  8.772   108.496 1.00 73.93  ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A  1  168  ? 70.278  9.024   108.959 1.00 69.92  ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A  1  168  ? 70.240  9.066   110.482 1.00 68.54  ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A  1  168  ? 70.706  8.139   111.153 1.00 63.27  ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A  1  168  ? 69.337  7.940   108.435 1.00 74.11  ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A  1  168  ? 69.277  7.904   106.920 1.00 87.17  ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A  1  168  ? 68.968  8.952   106.313 1.00 88.53  ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A  1  168  ? 69.552  6.831   106.339 1.00 92.65  ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A  1  169  ? 69.676  10.139  111.030 1.00 66.74  ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A  1  169  ? 69.702  10.391  112.466 1.00 63.75  ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A  1  169  ? 68.309  10.195  113.054 1.00 69.37  ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A  1  169  ? 67.375  10.928  112.709 1.00 66.89  ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A  1  169  ? 70.219  11.799  112.756 1.00 60.67  ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A  1  170  ? 68.178  9.206   113.936 1.00 70.76  ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A  1  170  ? 66.964  8.981   114.714 1.00 62.33  ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A  1  170  ? 67.228  9.556   116.100 1.00 66.04  ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A  1  170  ? 67.793  8.886   116.969 1.00 73.36  ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A  1  170  ? 66.591  7.497   114.781 1.00 60.19  ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A  1  170  ? 65.167  7.330   115.300 1.00 60.50  ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A  1  170  ? 66.759  6.834   113.422 1.00 65.46  ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A  1  171  ? 66.809  10.801  116.316 1.00 64.84  ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A  1  171  ? 67.191  11.503  117.535 1.00 66.97  ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A  1  171  ? 66.415  11.007  118.749 1.00 69.49  ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A  1  171  ? 67.007  10.746  119.803 1.00 64.44  ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A  1  171  ? 66.992  13.006  117.349 1.00 67.24  ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A  1  171  ? 67.943  13.620  116.368 1.00 70.08  ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A  1  171  ? 69.308  13.610  116.614 1.00 67.84  ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A  1  171  ? 67.479  14.211  115.205 1.00 70.25  ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A  1  171  ? 70.192  14.174  115.718 1.00 62.28  ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A  1  171  ? 68.360  14.777  114.303 1.00 65.20  ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A  1  171  ? 69.718  14.761  114.562 1.00 60.69  ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A  1  172  ? 65.094  10.869  118.612 1.00 71.24  ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A  1  172  ? 64.189  10.631  119.727 1.00 70.34  ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A  1  172  ? 64.684  9.472   120.588 1.00 68.57  ? 172  SER A C     1 
ATOM   1314  O  O     . SER A  1  172  ? 64.871  8.361   120.071 1.00 67.25  ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A  1  172  ? 62.780  10.334  119.220 1.00 74.60  ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A  1  172  ? 61.863  10.234  120.301 1.00 74.28  ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A  1  173  ? 64.920  9.689   121.887 1.00 69.20  ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A  1  173  ? 65.438  8.600   122.725 1.00 65.15  ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A  1  173  ? 64.376  7.614   123.173 1.00 63.64  ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A  1  173  ? 64.731  6.521   123.633 1.00 59.53  ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A  1  173  ? 66.042  9.342   123.924 1.00 67.80  ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A  1  173  ? 65.190  10.558  124.051 1.00 69.69  ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A  1  173  ? 64.787  10.948  122.642 1.00 68.46  ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A  1  174  ? 63.098  7.952   123.037 1.00 62.76  ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A  1  174  ? 62.017  7.127   123.566 1.00 61.47  ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A  1  174  ? 61.780  5.941   122.638 1.00 60.93  ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A  1  174  ? 61.431  6.117   121.466 1.00 66.92  ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A  1  174  ? 60.736  7.952   123.740 1.00 57.91  ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A  1  174  ? 59.626  7.080   124.278 1.00 58.05  ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A  1  174  ? 60.995  9.134   124.657 1.00 61.94  ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A  1  175  ? 61.951  4.727   123.167 1.00 56.07  ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A  1  175  ? 61.754  3.535   122.350 1.00 51.18  ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A  1  175  ? 60.285  3.142   122.263 1.00 55.13  ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A  1  175  ? 59.824  2.707   121.201 1.00 52.20  ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A  1  175  ? 62.580  2.371   122.897 1.00 52.68  ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A  1  175  ? 64.074  2.617   122.869 1.00 63.69  ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A  1  175  ? 64.860  1.326   122.675 1.00 75.10  ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A  1  175  ? 66.293  1.582   122.524 1.00 95.16  ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A  1  175  ? 66.882  1.918   121.378 1.00 107.61 ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A  1  175  ? 66.165  2.043   120.267 1.00 113.60 ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A  1  175  ? 68.192  2.133   121.341 1.00 103.91 ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A  1  176  ? 59.532  3.279   123.355 1.00 63.35  ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A  1  176  ? 58.138  2.848   123.318 1.00 59.14  ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A  1  176  ? 57.344  3.517   124.432 1.00 57.81  ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A  1  176  ? 57.864  3.771   125.520 1.00 60.74  ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A  1  176  ? 58.027  1.322   123.426 1.00 57.73  ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A  1  176  ? 56.604  0.794   123.340 1.00 52.22  ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A  1  176  ? 56.513  -0.432  122.447 1.00 61.89  ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A  1  176  ? 57.271  -1.566  122.968 1.00 61.55  ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A  1  176  ? 56.736  -2.582  123.636 1.00 67.60  ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A  1  176  ? 55.431  -2.617  123.870 1.00 69.80  ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A  1  176  ? 57.506  -3.570  124.066 1.00 76.28  ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A  1  177  ? 56.075  3.800   124.142 1.00 57.70  ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A  1  177  ? 55.139  4.361   125.113 1.00 59.15  ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A  1  177  ? 53.809  3.634   124.980 1.00 61.72  ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A  1  177  ? 53.251  3.547   123.881 1.00 59.02  ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A  1  177  ? 54.931  5.875   124.920 1.00 54.98  ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A  1  177  ? 53.863  6.381   125.870 1.00 61.98  ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A  1  177  ? 56.224  6.623   125.139 1.00 56.75  ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A  1  178  ? 53.296  3.126   126.098 1.00 62.96  ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A  1  178  ? 51.989  2.484   126.123 1.00 61.83  ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A  1  178  ? 51.279  2.862   127.413 1.00 63.36  ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A  1  178  ? 51.884  2.831   128.483 1.00 65.90  ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A  1  178  ? 52.111  0.960   126.024 1.00 51.24  ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A  1  179  ? 50.000  3.210   127.333 1.00 61.96  ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A  1  179  ? 49.295  3.572   128.553 1.00 60.53  ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A  1  179  ? 48.051  2.719   128.745 1.00 63.46  ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A  1  179  ? 47.354  2.366   127.786 1.00 59.99  ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A  1  179  ? 48.949  5.076   128.597 1.00 59.99  ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A  1  179  ? 47.853  5.497   127.667 1.00 55.69  ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A  1  179  ? 46.530  5.448   128.068 1.00 55.11  ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A  1  179  ? 48.149  5.999   126.412 1.00 56.78  ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A  1  179  ? 45.520  5.854   127.223 1.00 57.01  ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A  1  179  ? 47.143  6.409   125.562 1.00 59.49  ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A  1  179  ? 45.826  6.338   125.970 1.00 61.11  ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A  1  180  ? 47.795  2.406   130.012 1.00 66.24  ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A  1  180  ? 46.721  1.535   130.463 1.00 60.36  ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A  1  180  ? 45.707  2.357   131.246 1.00 56.77  ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A  1  180  ? 46.082  3.208   132.058 1.00 61.22  ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A  1  180  ? 47.283  0.417   131.348 1.00 59.95  ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A  1  180  ? 46.325  -0.721  131.638 1.00 67.70  ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A  1  180  ? 46.388  -1.816  130.592 1.00 80.15  ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A  1  180  ? 47.077  -1.687  129.576 1.00 80.39  ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A  1  180  ? 45.668  -2.906  130.837 1.00 80.18  ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A  1  181  ? 44.427  2.107   130.989 1.00 52.46  ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A  1  181  ? 43.329  2.754   131.697 1.00 56.50  ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A  1  181  ? 42.514  1.666   132.381 1.00 62.68  ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A  1  181  ? 41.907  0.825   131.707 1.00 64.86  ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A  1  181  ? 42.452  3.586   130.749 1.00 55.19  ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A  1  181  ? 41.153  3.975   131.429 1.00 61.46  ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A  1  181  ? 43.207  4.819   130.287 1.00 53.43  ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A  1  182  ? 42.504  1.674   133.711 1.00 61.86  ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A  1  182  ? 41.815  0.635   134.462 1.00 62.92  ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A  1  182  ? 40.695  1.243   135.296 1.00 68.98  ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A  1  182  ? 40.702  2.434   135.607 1.00 67.36  ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A  1  182  ? 42.788  -0.134  135.361 1.00 60.36  ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A  1  182  ? 44.104  -0.458  134.687 1.00 63.44  ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A  1  182  ? 44.954  -1.422  135.489 1.00 77.73  ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A  1  182  ? 44.436  -2.495  135.867 1.00 84.12  ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A  1  182  ? 46.137  -1.105  135.744 1.00 70.65  ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A  1  183  ? 39.721  0.412   135.652 1.00 70.75  ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A  1  183  ? 38.605  0.890   136.456 1.00 70.47  ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A  1  183  ? 39.041  1.081   137.904 1.00 67.22  ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A  1  183  ? 39.852  0.315   138.431 1.00 59.62  ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A  1  183  ? 37.432  -0.085  136.367 1.00 74.95  ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A  1  183  ? 36.087  0.603   136.528 1.00 81.71  ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A  1  183  ? 36.067  1.774   136.963 1.00 82.52  ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A  1  183  ? 35.051  -0.019  136.205 1.00 81.80  ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A  1  184  ? 38.508  2.124   138.541 1.00 72.31  ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A  1  184  ? 38.834  2.450   139.923 1.00 67.60  ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A  1  184  ? 37.689  3.263   140.513 1.00 72.70  ? 184  THR A C     1 
ATOM   1412  O  O     . THR A  1  184  ? 36.869  3.841   139.788 1.00 75.04  ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A  1  184  ? 40.160  3.219   140.030 1.00 59.95  ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A  1  184  ? 40.736  3.014   141.323 1.00 51.80  ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A  1  184  ? 39.942  4.708   139.833 1.00 67.56  ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A  1  185  ? 37.647  3.301   141.844 1.00 80.54  ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A  1  185  ? 36.582  3.973   142.573 1.00 88.58  ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A  1  185  ? 37.158  4.651   143.807 1.00 85.84  ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A  1  185  ? 38.167  4.212   144.366 1.00 73.52  ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A  1  185  ? 35.473  2.993   142.988 1.00 94.07  ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A  1  185  ? 35.909  1.959   144.020 1.00 98.01  ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A  1  185  ? 34.777  1.004   144.366 1.00 102.97 ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A  1  185  ? 33.581  1.717   144.809 1.00 114.70 ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A  1  185  ? 32.421  1.130   145.089 1.00 121.47 ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A  1  185  ? 32.297  -0.186  144.971 1.00 121.82 ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A  1  185  ? 31.384  1.858   145.484 1.00 112.65 ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A  1  186  ? 36.513  5.742   144.214 1.00 86.38  ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A  1  186  ? 36.844  6.441   145.454 1.00 90.54  ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A  1  186  ? 35.558  6.604   146.255 1.00 99.29  ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A  1  186  ? 34.819  7.576   146.066 1.00 92.72  ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A  1  186  ? 37.497  7.789   145.186 1.00 86.04  ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A  1  186  ? 37.999  8.480   146.456 1.00 87.02  ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A  1  186  ? 39.223  7.760   146.999 1.00 90.99  ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A  1  186  ? 38.292  9.953   146.217 1.00 89.78  ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A  1  187  ? 35.305  5.655   147.154 1.00 100.99 ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A  1  187  ? 34.126  5.697   147.991 1.00 88.36  ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A  1  187  ? 32.834  5.692   147.202 1.00 92.27  ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A  1  187  ? 32.439  4.670   146.632 1.00 88.13  ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A  1  188  ? 32.168  6.846   147.171 1.00 99.97  ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A  1  188  ? 30.851  6.930   146.549 1.00 100.42 ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A  1  188  ? 30.933  6.786   145.033 1.00 103.20 ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A  1  188  ? 30.070  6.147   144.419 1.00 93.64  ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A  1  188  ? 30.185  8.253   146.930 1.00 105.09 ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A  1  188  ? 31.032  9.485   146.624 1.00 107.01 ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A  1  188  ? 31.391  10.284  147.865 1.00 112.54 ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A  1  188  ? 30.657  10.280  148.854 1.00 108.19 ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A  1  188  ? 32.528  10.973  147.818 1.00 110.50 ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A  1  189  ? 31.960  7.366   144.413 1.00 106.50 ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A  1  189  ? 32.019  7.462   142.959 1.00 91.28  ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A  1  189  ? 32.574  6.181   142.352 1.00 86.38  ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A  1  189  ? 33.589  5.646   142.812 1.00 80.01  ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A  1  189  ? 32.871  8.658   142.537 1.00 78.11  ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A  1  189  ? 32.376  9.975   143.090 1.00 86.69  ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A  1  189  ? 33.308  11.121  142.753 1.00 77.29  ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A  1  189  ? 33.435  12.036  143.883 1.00 99.40  ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A  1  189  ? 33.860  13.293  143.796 1.00 107.56 ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A  1  189  ? 34.194  13.806  142.618 1.00 106.40 ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A  1  189  ? 33.940  14.041  144.889 1.00 110.60 ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A  1  190  ? 31.901  5.694   141.320 1.00 83.95  ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A  1  190  ? 32.367  4.573   140.524 1.00 91.46  ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A  1  190  ? 32.727  5.062   139.124 1.00 89.41  ? 190  THR A C     1 
ATOM   1462  O  O     . THR A  1  190  ? 32.612  6.250   138.804 1.00 86.87  ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A  1  190  ? 31.307  3.472   140.466 1.00 90.27  ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A  1  190  ? 30.088  4.011   139.940 1.00 88.14  ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A  1  190  ? 31.058  2.907   141.854 1.00 91.59  ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A  1  191  ? 33.175  4.124   138.291 1.00 85.41  ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A  1  191  ? 33.530  4.380   136.897 1.00 89.05  ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A  1  191  ? 34.686  5.367   136.761 1.00 81.47  ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A  1  191  ? 34.863  5.979   135.703 1.00 77.40  ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A  1  191  ? 32.314  4.869   136.094 1.00 99.33  ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A  1  191  ? 32.359  4.444   134.630 1.00 113.81 ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A  1  191  ? 33.450  4.085   134.130 1.00 110.28 ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A  1  191  ? 31.295  4.476   133.973 1.00 115.78 ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A  1  192  ? 35.486  5.552   137.809 1.00 82.77  ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A  1  192  ? 36.681  6.358   137.635 1.00 76.69  ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A  1  192  ? 37.747  5.533   136.924 1.00 70.94  ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A  1  192  ? 37.672  4.304   136.858 1.00 70.69  ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A  1  192  ? 37.206  6.863   138.980 1.00 73.05  ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A  1  192  ? 36.261  7.701   139.838 1.00 63.59  ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A  1  192  ? 37.030  8.321   140.990 1.00 63.26  ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A  1  192  ? 35.573  8.767   139.001 1.00 68.66  ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A  1  193  ? 38.752  6.216   136.388 1.00 68.88  ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A  1  193  ? 39.833  5.528   135.704 1.00 70.10  ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A  1  193  ? 41.177  5.838   136.350 1.00 67.38  ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A  1  193  ? 41.397  6.917   136.910 1.00 65.23  ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A  1  193  ? 39.873  5.864   134.199 1.00 68.37  ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A  1  193  ? 39.476  7.293   133.898 1.00 71.69  ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A  1  193  ? 39.689  8.170   134.761 1.00 75.56  ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A  1  193  ? 38.942  7.533   132.791 1.00 68.22  ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A  1  194  ? 42.059  4.848   136.267 1.00 69.26  ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A  1  194  ? 43.417  4.889   136.787 1.00 63.27  ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A  1  194  ? 44.357  4.770   135.597 1.00 68.99  ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A  1  194  ? 44.253  3.810   134.819 1.00 66.59  ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A  1  194  ? 43.633  3.751   137.787 1.00 55.33  ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A  1  194  ? 45.064  3.309   137.998 1.00 57.12  ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A  1  194  ? 45.079  1.944   138.677 1.00 60.06  ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A  1  194  ? 46.488  1.459   138.976 1.00 71.78  ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A  1  194  ? 46.472  0.107   139.611 1.00 69.85  ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A  1  195  ? 45.245  5.752   135.439 1.00 67.04  ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A  1  195  ? 46.068  5.875   134.245 1.00 59.76  ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A  1  195  ? 47.497  5.444   134.545 1.00 61.26  ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A  1  195  ? 48.089  5.881   135.535 1.00 62.49  ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A  1  195  ? 46.047  7.313   133.730 1.00 59.37  ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A  1  195  ? 47.031  7.647   132.613 1.00 59.04  ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A  1  195  ? 46.761  6.771   131.404 1.00 60.82  ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A  1  195  ? 46.935  9.120   132.252 1.00 59.90  ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A  1  196  ? 48.052  4.592   133.687 1.00 64.80  ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A  1  196  ? 49.417  4.109   133.854 1.00 65.01  ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A  1  196  ? 50.176  4.291   132.548 1.00 67.44  ? 196  THR A C     1 
ATOM   1510  O  O     . THR A  1  196  ? 49.836  3.666   131.541 1.00 67.50  ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A  1  196  ? 49.435  2.640   134.281 1.00 62.94  ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A  1  196  ? 48.601  2.466   135.433 1.00 67.85  ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A  1  196  ? 50.854  2.211   134.615 1.00 61.88  ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A  1  197  ? 51.202  5.134   132.571 1.00 65.41  ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A  1  197  ? 52.076  5.359   131.427 1.00 55.00  ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A  1  197  ? 53.320  4.493   131.572 1.00 65.07  ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A  1  197  ? 54.051  4.621   132.558 1.00 70.88  ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A  1  197  ? 52.472  6.830   131.327 1.00 50.49  ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A  1  197  ? 51.482  7.778   130.666 1.00 55.19  ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A  1  197  ? 51.889  9.217   130.933 1.00 57.91  ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A  1  197  ? 51.436  7.507   129.179 1.00 56.73  ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A  1  198  ? 53.563  3.627   130.592 1.00 62.82  ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A  1  198  ? 54.752  2.794   130.524 1.00 56.94  ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A  1  198  ? 55.658  3.368   129.447 1.00 63.99  ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A  1  198  ? 55.238  3.511   128.290 1.00 64.06  ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A  1  198  ? 54.391  1.344   130.210 1.00 52.90  ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A  1  198  ? 53.224  0.823   131.015 1.00 57.51  ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A  1  198  ? 53.334  -0.671  131.232 1.00 63.52  ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A  1  198  ? 53.074  -1.443  130.024 1.00 62.67  ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A  1  198  ? 53.421  -2.717  129.867 1.00 70.58  ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A  1  198  ? 53.140  -3.348  128.735 1.00 79.21  ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A  1  198  ? 54.060  -3.357  130.837 1.00 71.65  ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A  1  199  ? 56.889  3.694   129.834 1.00 67.13  ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A  1  199  ? 57.850  4.371   128.973 1.00 61.86  ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A  1  199  ? 59.134  3.554   128.943 1.00 65.62  ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A  1  199  ? 59.775  3.355   129.985 1.00 62.87  ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A  1  199  ? 58.136  5.803   129.451 1.00 59.39  ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A  1  199  ? 56.858  6.640   129.429 1.00 62.34  ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A  1  199  ? 59.203  6.450   128.591 1.00 63.58  ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A  1  199  ? 57.064  8.053   129.916 1.00 64.42  ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A  1  200  ? 59.498  3.075   127.754 1.00 67.34  ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A  1  200  ? 60.808  2.505   127.477 1.00 63.64  ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A  1  200  ? 61.643  3.543   126.743 1.00 60.00  ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A  1  200  ? 61.221  4.046   125.693 1.00 61.94  ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A  1  200  ? 60.704  1.252   126.609 1.00 56.78  ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A  1  200  ? 59.956  0.105   127.192 1.00 60.43  ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A  1  200  ? 60.488  -1.014  127.764 1.00 59.92  ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A  1  200  ? 58.535  -0.063  127.224 1.00 59.15  ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A  1  200  ? 59.485  -1.864  128.164 1.00 57.31  ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A  1  200  ? 58.276  -1.303  127.843 1.00 61.05  ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A  1  200  ? 57.457  0.716   126.798 1.00 58.79  ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A  1  200  ? 56.983  -1.781  128.044 1.00 64.33  ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A  1  200  ? 56.174  0.240   126.998 1.00 64.09  ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A  1  200  ? 55.948  -0.997  127.616 1.00 64.94  ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A  1  201  ? 62.826  3.836   127.282 1.00 61.91  ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A  1  201  ? 63.788  4.750   126.684 1.00 63.35  ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A  1  201  ? 65.121  4.028   126.528 1.00 69.10  ? 201  THR A C     1 
ATOM   1558  O  O     . THR A  1  201  ? 65.351  2.970   127.120 1.00 71.28  ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A  1  201  ? 63.956  6.018   127.532 1.00 65.58  ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A  1  201  ? 62.687  6.397   128.072 1.00 74.94  ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A  1  201  ? 64.463  7.165   126.689 1.00 70.20  ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A  1  202  ? 66.006  4.613   125.719 1.00 77.48  ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A  1  202  ? 67.304  4.016   125.418 1.00 80.15  ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A  1  202  ? 68.348  4.266   126.499 1.00 78.27  ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A  1  202  ? 69.457  3.731   126.397 1.00 77.37  ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A  1  202  ? 67.825  4.532   124.068 1.00 80.55  ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A  1  202  ? 67.914  6.056   124.003 1.00 82.39  ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A  1  202  ? 67.751  6.724   125.045 1.00 82.66  ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A  1  202  ? 68.147  6.588   122.895 1.00 83.19  ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A  1  203  ? 68.029  5.058   127.521 1.00 80.93  ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A  1  203  ? 68.947  5.355   128.593 1.00 80.92  ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A  1  203  ? 69.580  6.730   128.525 1.00 81.70  ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A  1  203  ? 70.022  7.240   129.561 1.00 78.59  ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A  1  204  ? 69.647  7.339   127.336 1.00 81.57  ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A  1  204  ? 70.213  8.681   127.225 1.00 83.06  ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A  1  204  ? 69.410  9.674   128.056 1.00 78.30  ? 204  SER A C     1 
ATOM   1577  O  O     . SER A  1  204  ? 69.973  10.465  128.820 1.00 79.67  ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A  1  204  ? 70.274  9.115   125.757 1.00 83.29  ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A  1  204  ? 68.989  9.134   125.162 1.00 86.58  ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A  1  205  ? 68.090  9.644   127.924 1.00 76.12  ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A  1  205  ? 67.208  10.338  128.848 1.00 81.68  ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A  1  205  ? 66.423  9.284   129.616 1.00 82.89  ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A  1  205  ? 66.182  8.173   129.129 1.00 79.58  ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A  1  205  ? 66.267  11.341  128.143 1.00 79.20  ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A  1  205  ? 67.002  12.058  127.018 1.00 76.65  ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A  1  205  ? 65.012  10.652  127.637 1.00 76.19  ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A  1  206  ? 66.073  9.613   130.801 1.00 82.26  ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A  1  206  ? 65.385  8.658   131.650 1.00 74.21  ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A  1  206  ? 63.875  8.800   131.487 1.00 74.69  ? 206  THR A C     1 
ATOM   1590  O  O     . THR A  1  206  ? 63.377  9.905   131.250 1.00 74.06  ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A  1  206  ? 65.796  8.870   133.106 1.00 75.66  ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A  1  206  ? 66.680  7.815   133.498 1.00 76.68  ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A  1  206  ? 64.594  8.919   134.051 1.00 83.01  ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A  1  207  ? 63.132  7.683   131.570 1.00 74.34  ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A  1  207  ? 61.674  7.751   131.358 1.00 73.51  ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A  1  207  ? 60.993  8.878   132.118 1.00 73.03  ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A  1  207  ? 60.088  9.526   131.577 1.00 73.50  ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A  1  207  ? 61.197  6.370   131.826 1.00 69.97  ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A  1  207  ? 62.361  5.474   131.569 1.00 67.93  ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A  1  207  ? 63.592  6.305   131.820 1.00 74.11  ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A  1  208  ? 61.425  9.148   133.352 1.00 68.92  ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A  1  208  ? 60.875  10.283  134.085 1.00 69.18  ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A  1  208  ? 61.263  11.603  133.429 1.00 72.18  ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A  1  208  ? 60.432  12.514  133.326 1.00 74.62  ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A  1  208  ? 61.332  10.245  135.542 1.00 68.49  ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A  1  208  ? 60.775  11.361  136.431 1.00 64.93  ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A  1  208  ? 59.263  11.403  136.354 1.00 63.48  ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A  1  208  ? 61.225  11.167  137.863 1.00 76.67  ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A  1  209  ? 62.518  11.731  132.982 1.00 68.77  ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A  1  209  ? 62.919  12.934  132.257 1.00 67.89  ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A  1  209  ? 62.055  13.131  131.020 1.00 71.25  ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A  1  209  ? 61.593  14.246  130.744 1.00 68.72  ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A  1  209  ? 64.391  12.855  131.858 1.00 71.22  ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A  1  209  ? 65.360  12.522  132.975 1.00 73.73  ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A  1  209  ? 66.783  12.343  132.463 1.00 86.56  ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A  1  209  ? 67.597  11.695  133.154 1.00 86.85  ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A  1  209  ? 67.086  12.846  131.359 1.00 92.08  ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A  1  210  ? 61.830  12.055  130.262 1.00 71.63  ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A  1  210  ? 61.016  12.144  129.054 1.00 65.32  ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A  1  210  ? 59.596  12.579  129.382 1.00 66.94  ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A  1  210  ? 59.034  13.452  128.713 1.00 63.34  ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A  1  210  ? 61.011  10.801  128.324 1.00 62.65  ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A  1  211  ? 58.995  11.967  130.406 1.00 71.56  ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A  1  211  ? 57.634  12.327  130.793 1.00 64.79  ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A  1  211  ? 57.549  13.787  131.221 1.00 63.12  ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A  1  211  ? 56.593  14.492  130.871 1.00 61.57  ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A  1  211  ? 57.155  11.407  131.914 1.00 63.38  ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A  1  211  ? 55.811  11.724  132.568 1.00 64.43  ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A  1  211  ? 54.684  11.609  131.555 1.00 55.12  ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A  1  211  ? 55.574  10.800  133.756 1.00 61.65  ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A  1  212  ? 58.543  14.262  131.976 1.00 63.17  ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A  1  212  ? 58.544  15.657  132.402 1.00 63.60  ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A  1  212  ? 58.663  16.594  131.209 1.00 62.52  ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A  1  212  ? 57.939  17.594  131.121 1.00 60.73  ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A  1  212  ? 59.675  15.901  133.399 1.00 69.28  ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A  1  212  ? 59.481  15.138  134.700 1.00 73.16  ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A  1  212  ? 58.358  14.991  135.183 1.00 72.35  ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A  1  212  ? 60.574  14.645  135.269 1.00 69.21  ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A  1  213  ? 59.565  16.283  130.275 1.00 67.32  ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A  1  213  ? 59.697  17.112  129.081 1.00 65.94  ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A  1  213  ? 58.410  17.104  128.265 1.00 64.34  ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A  1  213  ? 58.005  18.137  127.722 1.00 62.82  ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A  1  213  ? 60.877  16.640  128.238 1.00 63.72  ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A  1  213  ? 62.214  16.717  128.955 1.00 70.14  ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A  1  213  ? 63.349  16.137  128.136 1.00 81.68  ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A  1  213  ? 63.509  16.464  126.959 1.00 89.00  ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A  1  213  ? 64.141  15.264  128.753 1.00 75.98  ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A  1  214  ? 57.737  15.954  128.194 1.00 61.67  ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A  1  214  ? 56.489  15.863  127.442 1.00 60.48  ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A  1  214  ? 55.400  16.718  128.077 1.00 61.25  ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A  1  214  ? 54.681  17.450  127.383 1.00 60.39  ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A  1  214  ? 56.039  14.406  127.352 1.00 57.24  ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A  1  215  ? 55.251  16.619  129.399 1.00 61.05  ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A  1  215  ? 54.253  17.424  130.095 1.00 62.22  ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A  1  215  ? 54.553  18.906  129.917 1.00 64.14  ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A  1  215  ? 53.644  19.722  129.708 1.00 59.28  ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A  1  215  ? 54.192  17.023  131.579 1.00 57.70  ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A  1  215  ? 53.345  18.007  132.364 1.00 59.13  ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A  1  215  ? 53.639  15.611  131.713 1.00 52.78  ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A  1  216  ? 55.835  19.274  129.978 1.00 62.63  ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A  1  216  ? 56.206  20.667  129.768 1.00 61.86  ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A  1  216  ? 55.860  21.123  128.356 1.00 66.29  ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A  1  216  ? 55.380  22.245  128.161 1.00 72.91  ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A  1  216  ? 57.693  20.856  130.057 1.00 69.20  ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A  1  216  ? 58.226  22.245  129.738 1.00 80.11  ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A  1  216  ? 57.494  23.360  130.474 1.00 85.58  ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A  1  216  ? 56.890  23.106  131.541 1.00 87.20  ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A  1  216  ? 57.526  24.505  129.974 1.00 82.53  ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A  1  217  ? 56.088  20.263  127.360 1.00 61.45  ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A  1  217  ? 55.729  20.599  125.983 1.00 63.89  ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A  1  217  ? 54.229  20.842  125.868 1.00 63.48  ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A  1  217  ? 53.781  21.822  125.257 1.00 62.29  ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A  1  217  ? 56.185  19.486  125.024 1.00 59.35  ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A  1  217  ? 57.707  19.458  124.915 1.00 60.62  ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A  1  217  ? 55.549  19.671  123.654 1.00 58.84  ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A  1  217  ? 58.231  18.252  124.167 1.00 64.31  ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A  1  218  ? 53.430  19.943  126.446 1.00 56.68  ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A  1  218  ? 51.980  20.076  126.340 1.00 56.42  ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A  1  218  ? 51.493  21.345  127.028 1.00 65.07  ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A  1  218  ? 50.623  22.052  126.503 1.00 64.59  ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A  1  218  ? 51.297  18.839  126.921 1.00 58.46  ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A  1  218  ? 49.776  18.717  126.774 1.00 54.55  ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A  1  218  ? 49.301  19.108  125.379 1.00 43.95  ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A  1  218  ? 49.340  17.298  127.109 1.00 50.66  ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A  1  219  ? 52.049  21.659  128.199 1.00 63.56  ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A  1  219  ? 51.682  22.897  128.878 1.00 63.09  ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A  1  219  ? 52.059  24.113  128.038 1.00 63.80  ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A  1  219  ? 51.271  25.061  127.894 1.00 63.34  ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A  1  219  ? 52.356  22.954  130.246 1.00 62.53  ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A  1  219  ? 52.303  24.324  130.879 1.00 69.90  ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A  1  219  ? 53.531  24.588  131.721 1.00 72.87  ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A  1  219  ? 53.873  26.003  131.691 1.00 70.81  ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A  1  219  ? 54.841  26.515  130.943 1.00 70.35  ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A  1  219  ? 55.084  27.818  130.965 1.00 79.23  ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A  1  219  ? 55.574  25.721  130.179 1.00 75.42  ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A  1  220  ? 53.270  24.105  127.479 1.00 60.68  ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A  1  220  ? 53.707  25.212  126.642 1.00 60.34  ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A  1  220  ? 52.786  25.388  125.445 1.00 65.73  ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A  1  220  ? 52.540  26.519  125.010 1.00 69.50  ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A  1  220  ? 55.149  24.978  126.196 1.00 66.28  ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A  1  220  ? 55.760  26.109  125.395 1.00 83.09  ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A  1  220  ? 57.186  25.808  124.983 1.00 92.33  ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A  1  220  ? 57.822  24.950  125.634 1.00 91.43  ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A  1  220  ? 57.668  26.421  124.007 1.00 95.82  ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A  1  221  ? 52.256  24.286  124.914 1.00 63.47  ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A  1  221  ? 51.297  24.390  123.819 1.00 65.09  ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A  1  221  ? 49.966  24.946  124.301 1.00 67.16  ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A  1  221  ? 49.310  25.707  123.581 1.00 68.15  ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A  1  221  ? 51.100  23.029  123.158 1.00 69.09  ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A  1  221  ? 52.050  22.769  122.035 1.00 64.92  ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A  1  221  ? 53.377  22.456  122.240 1.00 60.51  ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A  1  221  ? 51.870  22.792  120.694 1.00 56.50  ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A  1  221  ? 53.971  22.289  121.074 1.00 62.12  ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A  1  221  ? 53.079  22.487  120.119 1.00 67.74  ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A  1  222  ? 49.546  24.568  125.510 1.00 69.61  ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A  1  222  ? 48.336  25.151  126.081 1.00 70.11  ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A  1  222  ? 48.475  26.657  126.250 1.00 70.95  ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A  1  222  ? 47.474  27.384  126.221 1.00 67.71  ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A  1  222  ? 48.019  24.494  127.420 1.00 62.26  ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A  1  222  ? 47.540  23.052  127.294 1.00 64.05  ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A  1  222  ? 47.375  22.414  128.661 1.00 65.27  ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A  1  222  ? 46.235  23.018  126.512 1.00 64.36  ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A  1  223  ? 49.707  27.134  126.435 1.00 65.34  ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A  1  223  ? 49.936  28.573  126.536 1.00 63.57  ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A  1  223  ? 49.473  29.313  125.283 1.00 71.85  ? 223  THR A C     1 
ATOM   1726  O  O     . THR A  1  223  ? 49.024  30.462  125.373 1.00 72.33  ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A  1  223  ? 51.417  28.851  126.796 1.00 66.93  ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A  1  223  ? 51.849  28.106  127.940 1.00 73.57  ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A  1  223  ? 51.656  30.333  127.048 1.00 75.29  ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A  1  224  ? 49.549  28.667  124.115 1.00 76.20  ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A  1  224  ? 49.303  29.340  122.842 1.00 78.56  ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A  1  224  ? 47.863  29.807  122.668 1.00 82.15  ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A  1  224  ? 47.592  30.580  121.741 1.00 82.78  ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A  1  224  ? 49.682  28.421  121.678 1.00 75.45  ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A  1  224  ? 51.145  28.042  121.645 1.00 81.09  ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A  1  224  ? 52.108  28.859  122.226 1.00 78.49  ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A  1  224  ? 51.564  26.866  121.035 1.00 80.85  ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A  1  224  ? 53.448  28.514  122.199 1.00 79.91  ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A  1  224  ? 52.902  26.513  121.002 1.00 75.26  ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A  1  224  ? 53.840  27.341  121.586 1.00 76.17  ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A  1  224  ? 55.171  26.993  121.560 1.00 74.85  ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A  1  225  ? 46.939  29.371  123.523 1.00 79.61  ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A  1  225  ? 45.553  29.812  123.462 1.00 82.86  ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A  1  225  ? 45.329  31.136  124.180 1.00 86.68  ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A  1  225  ? 44.184  31.468  124.507 1.00 88.90  ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A  1  225  ? 44.633  28.738  124.044 1.00 80.27  ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A  1  225  ? 44.569  27.487  123.222 1.00 77.62  ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A  1  225  ? 45.481  26.463  123.421 1.00 76.10  ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A  1  225  ? 43.601  27.337  122.244 1.00 77.36  ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A  1  225  ? 45.424  25.311  122.660 1.00 72.99  ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A  1  225  ? 43.539  26.188  121.481 1.00 69.97  ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A  1  225  ? 44.451  25.174  121.689 1.00 66.87  ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A  1  226  ? 46.394  31.899  124.426 1.00 88.57  ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A  1  226  ? 46.288  33.107  125.237 1.00 96.73  ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A  1  226  ? 45.655  34.265  124.469 1.00 101.50 ? 226  SER A C     1 
ATOM   1756  O  O     . SER A  1  226  ? 44.597  34.774  124.854 1.00 99.50  ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A  1  226  ? 47.672  33.499  125.757 1.00 94.25  ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A  1  226  ? 48.634  33.467  124.715 1.00 95.60  ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A  1  227  ? 46.292  34.699  123.381 1.00 96.96  ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A  1  227  ? 45.916  35.948  122.733 1.00 100.51 ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A  1  227  ? 44.960  35.689  121.580 1.00 98.64  ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A  1  227  ? 45.378  35.123  120.559 1.00 105.82 ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A  1  227  ? 47.158  36.682  122.236 1.00 102.47 ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A  1  227  ? 48.009  37.203  123.371 1.00 108.47 ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A  1  227  ? 47.526  37.378  124.490 1.00 101.58 ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A  1  227  ? 49.282  37.458  123.093 1.00 118.34 ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A  1  228  ? 43.693  36.084  121.678 1.00 96.28  ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A  1  228  ? 42.763  35.889  120.563 1.00 92.15  ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A  1  228  ? 42.975  36.938  119.479 1.00 95.78  ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A  1  228  ? 43.706  37.914  119.650 1.00 99.38  ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A  1  228  ? 41.380  36.041  121.213 1.00 91.32  ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A  1  228  ? 41.627  36.059  122.702 1.00 100.90 ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A  1  228  ? 43.008  36.607  122.868 1.00 102.17 ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A  1  229  ? 42.315  36.710  118.345 1.00 92.42  ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A  1  229  ? 42.357  37.637  117.215 1.00 79.86  ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A  1  229  ? 41.177  37.414  116.272 1.00 72.60  ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A  1  229  ? 40.502  38.362  115.871 1.00 67.15  ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A  1  229  ? 43.672  37.496  116.447 1.00 79.08  ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A  1  229  ? 44.572  38.722  116.527 1.00 87.57  ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A  1  229  ? 45.767  38.524  117.446 1.00 94.27  ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A  1  229  ? 46.365  37.448  117.487 1.00 94.97  ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A  1  229  ? 46.119  39.567  118.189 1.00 98.90  ? 229  GLN A NE2   1 
ATOM   1783  N  N     . LYS B  1  7    ? 57.893  28.868  115.537 1.00 101.27 ? 7    LYS B N     1 
ATOM   1784  C  CA    . LYS B  1  7    ? 57.551  30.145  116.154 1.00 110.26 ? 7    LYS B CA    1 
ATOM   1785  C  C     . LYS B  1  7    ? 56.263  30.053  116.968 1.00 110.20 ? 7    LYS B C     1 
ATOM   1786  O  O     . LYS B  1  7    ? 55.615  29.009  117.003 1.00 109.93 ? 7    LYS B O     1 
ATOM   1787  C  CB    . LYS B  1  7    ? 57.416  31.234  115.090 1.00 110.18 ? 7    LYS B CB    1 
ATOM   1788  C  CG    . LYS B  1  7    ? 58.714  31.566  114.375 1.00 119.08 ? 7    LYS B CG    1 
ATOM   1789  C  CD    . LYS B  1  7    ? 58.536  32.692  113.362 1.00 125.64 ? 7    LYS B CD    1 
ATOM   1790  C  CE    . LYS B  1  7    ? 58.427  34.061  114.032 1.00 125.11 ? 7    LYS B CE    1 
ATOM   1791  N  NZ    . LYS B  1  7    ? 57.087  34.340  114.628 1.00 115.57 ? 7    LYS B NZ    1 
ATOM   1792  N  N     . ALA B  1  8    ? 55.903  31.150  117.622 1.00 110.83 ? 8    ALA B N     1 
ATOM   1793  C  CA    . ALA B  1  8    ? 54.673  31.196  118.407 1.00 97.49  ? 8    ALA B CA    1 
ATOM   1794  C  C     . ALA B  1  8    ? 53.467  31.227  117.476 1.00 92.52  ? 8    ALA B C     1 
ATOM   1795  O  O     . ALA B  1  8    ? 53.377  32.122  116.625 1.00 91.24  ? 8    ALA B O     1 
ATOM   1796  C  CB    . ALA B  1  8    ? 54.670  32.413  119.326 1.00 99.13  ? 8    ALA B CB    1 
ATOM   1797  N  N     . PRO B  1  9    ? 52.530  30.289  117.593 1.00 87.77  ? 9    PRO B N     1 
ATOM   1798  C  CA    . PRO B  1  9    ? 51.419  30.233  116.638 1.00 82.35  ? 9    PRO B CA    1 
ATOM   1799  C  C     . PRO B  1  9    ? 50.403  31.335  116.881 1.00 73.53  ? 9    PRO B C     1 
ATOM   1800  O  O     . PRO B  1  9    ? 50.238  31.828  118.000 1.00 82.13  ? 9    PRO B O     1 
ATOM   1801  C  CB    . PRO B  1  9    ? 50.800  28.852  116.891 1.00 83.14  ? 9    PRO B CB    1 
ATOM   1802  C  CG    . PRO B  1  9    ? 51.813  28.099  117.716 1.00 84.15  ? 9    PRO B CG    1 
ATOM   1803  C  CD    . PRO B  1  9    ? 52.526  29.141  118.512 1.00 83.98  ? 9    PRO B CD    1 
ATOM   1804  N  N     . VAL B  1  10   ? 49.709  31.718  115.810 1.00 71.73  ? 10   VAL B N     1 
ATOM   1805  C  CA    . VAL B  1  10   ? 48.642  32.706  115.904 1.00 74.97  ? 10   VAL B CA    1 
ATOM   1806  C  C     . VAL B  1  10   ? 47.325  31.996  116.180 1.00 78.22  ? 10   VAL B C     1 
ATOM   1807  O  O     . VAL B  1  10   ? 47.068  30.878  115.694 1.00 78.61  ? 10   VAL B O     1 
ATOM   1808  C  CB    . VAL B  1  10   ? 48.560  33.579  114.636 1.00 71.20  ? 10   VAL B CB    1 
ATOM   1809  C  CG1   . VAL B  1  10   ? 49.890  34.270  114.385 1.00 75.27  ? 10   VAL B CG1   1 
ATOM   1810  C  CG2   . VAL B  1  10   ? 48.128  32.765  113.429 1.00 77.34  ? 10   VAL B CG2   1 
ATOM   1811  N  N     . PHE B  1  11   ? 46.494  32.662  116.983 1.00 75.70  ? 11   PHE B N     1 
ATOM   1812  C  CA    . PHE B  1  11   ? 45.218  32.151  117.470 1.00 73.18  ? 11   PHE B CA    1 
ATOM   1813  C  C     . PHE B  1  11   ? 44.145  33.165  117.091 1.00 77.39  ? 11   PHE B C     1 
ATOM   1814  O  O     . PHE B  1  11   ? 44.143  34.292  117.595 1.00 84.62  ? 11   PHE B O     1 
ATOM   1815  C  CB    . PHE B  1  11   ? 45.275  31.923  118.981 1.00 73.78  ? 11   PHE B CB    1 
ATOM   1816  C  CG    . PHE B  1  11   ? 43.966  31.505  119.590 1.00 83.67  ? 11   PHE B CG    1 
ATOM   1817  C  CD1   . PHE B  1  11   ? 43.344  30.332  119.199 1.00 81.29  ? 11   PHE B CD1   1 
ATOM   1818  C  CD2   . PHE B  1  11   ? 43.372  32.275  120.579 1.00 90.87  ? 11   PHE B CD2   1 
ATOM   1819  C  CE1   . PHE B  1  11   ? 42.144  29.943  119.768 1.00 78.90  ? 11   PHE B CE1   1 
ATOM   1820  C  CE2   . PHE B  1  11   ? 42.173  31.892  121.152 1.00 86.80  ? 11   PHE B CE2   1 
ATOM   1821  C  CZ    . PHE B  1  11   ? 41.559  30.724  120.747 1.00 83.00  ? 11   PHE B CZ    1 
ATOM   1822  N  N     . THR B  1  12   ? 43.250  32.767  116.196 1.00 74.34  ? 12   THR B N     1 
ATOM   1823  C  CA    . THR B  1  12   ? 42.237  33.645  115.632 1.00 73.22  ? 12   THR B CA    1 
ATOM   1824  C  C     . THR B  1  12   ? 40.852  33.175  116.051 1.00 75.30  ? 12   THR B C     1 
ATOM   1825  O  O     . THR B  1  12   ? 40.594  31.973  116.162 1.00 75.08  ? 12   THR B O     1 
ATOM   1826  C  CB    . THR B  1  12   ? 42.330  33.681  114.103 1.00 74.12  ? 12   THR B CB    1 
ATOM   1827  O  OG1   . THR B  1  12   ? 43.708  33.708  113.711 1.00 70.20  ? 12   THR B OG1   1 
ATOM   1828  C  CG2   . THR B  1  12   ? 41.620  34.911  113.547 1.00 75.12  ? 12   THR B CG2   1 
ATOM   1829  N  N     . VAL B  1  13   ? 39.957  34.137  116.272 1.00 79.47  ? 13   VAL B N     1 
ATOM   1830  C  CA    . VAL B  1  13   ? 38.627  33.878  116.806 1.00 77.00  ? 13   VAL B CA    1 
ATOM   1831  C  C     . VAL B  1  13   ? 37.592  34.538  115.906 1.00 74.95  ? 13   VAL B C     1 
ATOM   1832  O  O     . VAL B  1  13   ? 37.797  35.659  115.426 1.00 73.25  ? 13   VAL B O     1 
ATOM   1833  C  CB    . VAL B  1  13   ? 38.494  34.387  118.258 1.00 76.05  ? 13   VAL B CB    1 
ATOM   1834  C  CG1   . VAL B  1  13   ? 37.119  34.072  118.810 1.00 73.66  ? 13   VAL B CG1   1 
ATOM   1835  C  CG2   . VAL B  1  13   ? 39.577  33.779  119.143 1.00 73.19  ? 13   VAL B CG2   1 
ATOM   1836  N  N     . ARG B  1  14   ? 36.484  33.832  115.668 1.00 77.70  ? 14   ARG B N     1 
ATOM   1837  C  CA    . ARG B  1  14   ? 35.353  34.350  114.899 1.00 85.30  ? 14   ARG B CA    1 
ATOM   1838  C  C     . ARG B  1  14   ? 34.073  33.844  115.553 1.00 86.32  ? 14   ARG B C     1 
ATOM   1839  O  O     . ARG B  1  14   ? 33.795  32.642  115.523 1.00 83.38  ? 14   ARG B O     1 
ATOM   1840  C  CB    . ARG B  1  14   ? 35.441  33.911  113.437 1.00 90.21  ? 14   ARG B CB    1 
ATOM   1841  C  CG    . ARG B  1  14   ? 34.154  34.044  112.637 1.00 97.54  ? 14   ARG B CG    1 
ATOM   1842  C  CD    . ARG B  1  14   ? 34.368  33.610  111.187 1.00 104.37 ? 14   ARG B CD    1 
ATOM   1843  N  NE    . ARG B  1  14   ? 35.335  32.518  111.079 1.00 110.70 ? 14   ARG B NE    1 
ATOM   1844  C  CZ    . ARG B  1  14   ? 36.559  32.645  110.569 1.00 111.93 ? 14   ARG B CZ    1 
ATOM   1845  N  NH1   . ARG B  1  14   ? 36.968  33.819  110.106 1.00 107.48 ? 14   ARG B NH1   1 
ATOM   1846  N  NH2   . ARG B  1  14   ? 37.373  31.596  110.521 1.00 97.80  ? 14   ARG B NH2   1 
ATOM   1847  N  N     . THR B  1  15   ? 33.292  34.749  116.141 1.00 90.14  ? 15   THR B N     1 
ATOM   1848  C  CA    . THR B  1  15   ? 32.169  34.371  116.986 1.00 91.97  ? 15   THR B CA    1 
ATOM   1849  C  C     . THR B  1  15   ? 30.846  34.837  116.397 1.00 93.20  ? 15   THR B C     1 
ATOM   1850  O  O     . THR B  1  15   ? 30.761  35.895  115.766 1.00 96.52  ? 15   THR B O     1 
ATOM   1851  C  CB    . THR B  1  15   ? 32.306  34.957  118.397 1.00 92.74  ? 15   THR B CB    1 
ATOM   1852  O  OG1   . THR B  1  15   ? 32.199  36.385  118.335 1.00 93.85  ? 15   THR B OG1   1 
ATOM   1853  C  CG2   . THR B  1  15   ? 33.643  34.579  119.003 1.00 88.24  ? 15   THR B CG2   1 
ATOM   1854  N  N     . GLN B  1  16   ? 29.809  34.034  116.624 1.00 93.50  ? 16   GLN B N     1 
ATOM   1855  C  CA    . GLN B  1  16   ? 28.426  34.411  116.363 1.00 101.84 ? 16   GLN B CA    1 
ATOM   1856  C  C     . GLN B  1  16   ? 27.658  34.248  117.668 1.00 98.45  ? 16   GLN B C     1 
ATOM   1857  O  O     . GLN B  1  16   ? 27.514  33.127  118.179 1.00 92.49  ? 16   GLN B O     1 
ATOM   1858  C  CB    . GLN B  1  16   ? 27.814  33.566  115.250 1.00 103.32 ? 16   GLN B CB    1 
ATOM   1859  C  CG    . GLN B  1  16   ? 28.442  33.789  113.887 1.00 113.04 ? 16   GLN B CG    1 
ATOM   1860  C  CD    . GLN B  1  16   ? 27.709  33.043  112.791 1.00 128.54 ? 16   GLN B CD    1 
ATOM   1861  O  OE1   . GLN B  1  16   ? 26.521  32.744  112.920 1.00 138.30 ? 16   GLN B OE1   1 
ATOM   1862  N  NE2   . GLN B  1  16   ? 28.414  32.731  111.708 1.00 124.70 ? 16   GLN B NE2   1 
ATOM   1863  N  N     . GLY B  1  17   ? 27.186  35.370  118.206 1.00 98.27  ? 17   GLY B N     1 
ATOM   1864  C  CA    . GLY B  1  17   ? 26.463  35.454  119.453 1.00 92.31  ? 17   GLY B CA    1 
ATOM   1865  C  C     . GLY B  1  17   ? 27.247  34.861  120.607 1.00 89.77  ? 17   GLY B C     1 
ATOM   1866  O  O     . GLY B  1  17   ? 28.479  34.766  120.595 1.00 86.04  ? 17   GLY B O     1 
ATOM   1867  N  N     . ARG B  1  18   ? 26.504  34.467  121.633 1.00 87.53  ? 18   ARG B N     1 
ATOM   1868  C  CA    . ARG B  1  18   ? 27.048  33.717  122.752 1.00 83.19  ? 18   ARG B CA    1 
ATOM   1869  C  C     . ARG B  1  18   ? 27.024  32.219  122.504 1.00 82.87  ? 18   ARG B C     1 
ATOM   1870  O  O     . ARG B  1  18   ? 27.485  31.457  123.358 1.00 83.80  ? 18   ARG B O     1 
ATOM   1871  C  CB    . ARG B  1  18   ? 26.264  34.030  124.030 1.00 89.97  ? 18   ARG B CB    1 
ATOM   1872  C  CG    . ARG B  1  18   ? 26.330  35.478  124.491 1.00 84.94  ? 18   ARG B CG    1 
ATOM   1873  C  CD    . ARG B  1  18   ? 25.588  35.666  125.811 1.00 73.30  ? 18   ARG B CD    1 
ATOM   1874  N  NE    . ARG B  1  18   ? 25.993  34.681  126.811 1.00 70.17  ? 18   ARG B NE    1 
ATOM   1875  C  CZ    . ARG B  1  18   ? 27.115  34.755  127.522 1.00 76.52  ? 18   ARG B CZ    1 
ATOM   1876  N  NH1   . ARG B  1  18   ? 27.407  33.812  128.409 1.00 72.93  ? 18   ARG B NH1   1 
ATOM   1877  N  NH2   . ARG B  1  18   ? 27.952  35.770  127.343 1.00 72.24  ? 18   ARG B NH2   1 
ATOM   1878  N  N     . GLU B  1  19   ? 26.493  31.780  121.363 1.00 86.50  ? 19   GLU B N     1 
ATOM   1879  C  CA    . GLU B  1  19   ? 26.225  30.367  121.155 1.00 81.99  ? 19   GLU B CA    1 
ATOM   1880  C  C     . GLU B  1  19   ? 27.198  29.676  120.206 1.00 78.96  ? 19   GLU B C     1 
ATOM   1881  O  O     . GLU B  1  19   ? 27.314  28.448  120.271 1.00 75.11  ? 19   GLU B O     1 
ATOM   1882  C  CB    . GLU B  1  19   ? 24.789  30.177  120.648 1.00 77.75  ? 19   GLU B CB    1 
ATOM   1883  C  CG    . GLU B  1  19   ? 23.727  30.720  121.601 1.00 78.97  ? 19   GLU B CG    1 
ATOM   1884  C  CD    . GLU B  1  19   ? 22.322  30.270  121.235 1.00 96.30  ? 19   GLU B CD    1 
ATOM   1885  O  OE1   . GLU B  1  19   ? 21.387  31.099  121.292 1.00 98.42  ? 19   GLU B OE1   1 
ATOM   1886  O  OE2   . GLU B  1  19   ? 22.153  29.082  120.886 1.00 104.65 ? 19   GLU B OE2   1 
ATOM   1887  N  N     . TYR B  1  20   ? 27.911  30.399  119.335 1.00 83.68  ? 20   TYR B N     1 
ATOM   1888  C  CA    . TYR B  1  20   ? 28.767  29.698  118.382 1.00 76.10  ? 20   TYR B CA    1 
ATOM   1889  C  C     . TYR B  1  20   ? 30.103  30.403  118.189 1.00 73.69  ? 20   TYR B C     1 
ATOM   1890  O  O     . TYR B  1  20   ? 30.167  31.634  118.156 1.00 79.21  ? 20   TYR B O     1 
ATOM   1891  C  CB    . TYR B  1  20   ? 28.063  29.544  117.031 1.00 77.60  ? 20   TYR B CB    1 
ATOM   1892  C  CG    . TYR B  1  20   ? 28.934  28.922  115.971 1.00 77.88  ? 20   TYR B CG    1 
ATOM   1893  C  CD1   . TYR B  1  20   ? 29.443  27.641  116.128 1.00 78.34  ? 20   TYR B CD1   1 
ATOM   1894  C  CD2   . TYR B  1  20   ? 29.247  29.614  114.813 1.00 82.14  ? 20   TYR B CD2   1 
ATOM   1895  C  CE1   . TYR B  1  20   ? 30.247  27.069  115.160 1.00 76.52  ? 20   TYR B CE1   1 
ATOM   1896  C  CE2   . TYR B  1  20   ? 30.047  29.050  113.839 1.00 83.04  ? 20   TYR B CE2   1 
ATOM   1897  C  CZ    . TYR B  1  20   ? 30.544  27.775  114.017 1.00 79.46  ? 20   TYR B CZ    1 
ATOM   1898  O  OH    . TYR B  1  20   ? 31.339  27.199  113.051 1.00 76.26  ? 20   TYR B OH    1 
ATOM   1899  N  N     . GLY B  1  21   ? 31.163  29.614  118.042 1.00 68.91  ? 21   GLY B N     1 
ATOM   1900  C  CA    . GLY B  1  21   ? 32.491  30.171  117.832 1.00 73.62  ? 21   GLY B CA    1 
ATOM   1901  C  C     . GLY B  1  21   ? 33.389  29.261  117.021 1.00 77.56  ? 21   GLY B C     1 
ATOM   1902  O  O     . GLY B  1  21   ? 33.290  28.030  117.093 1.00 78.20  ? 21   GLY B O     1 
ATOM   1903  N  N     . GLU B  1  22   ? 34.283  29.883  116.240 1.00 75.96  ? 22   GLU B N     1 
ATOM   1904  C  CA    . GLU B  1  22   ? 35.326  29.201  115.480 1.00 68.60  ? 22   GLU B CA    1 
ATOM   1905  C  C     . GLU B  1  22   ? 36.688  29.729  115.907 1.00 66.51  ? 22   GLU B C     1 
ATOM   1906  O  O     . GLU B  1  22   ? 36.901  30.947  115.958 1.00 74.39  ? 22   GLU B O     1 
ATOM   1907  C  CB    . GLU B  1  22   ? 35.166  29.407  113.973 1.00 80.78  ? 22   GLU B CB    1 
ATOM   1908  C  CG    . GLU B  1  22   ? 33.825  29.017  113.408 1.00 89.14  ? 22   GLU B CG    1 
ATOM   1909  C  CD    . GLU B  1  22   ? 33.794  29.108  111.894 1.00 99.78  ? 22   GLU B CD    1 
ATOM   1910  O  OE1   . GLU B  1  22   ? 34.881  29.146  111.276 1.00 100.78 ? 22   GLU B OE1   1 
ATOM   1911  O  OE2   . GLU B  1  22   ? 32.682  29.145  111.324 1.00 102.36 ? 22   GLU B OE2   1 
ATOM   1912  N  N     . PHE B  1  23   ? 37.617  28.814  116.172 1.00 59.36  ? 23   PHE B N     1 
ATOM   1913  C  CA    . PHE B  1  23   ? 38.910  29.147  116.755 1.00 66.42  ? 23   PHE B CA    1 
ATOM   1914  C  C     . PHE B  1  23   ? 39.994  28.432  115.965 1.00 67.90  ? 23   PHE B C     1 
ATOM   1915  O  O     . PHE B  1  23   ? 39.997  27.201  115.884 1.00 71.70  ? 23   PHE B O     1 
ATOM   1916  C  CB    . PHE B  1  23   ? 38.957  28.754  118.234 1.00 68.65  ? 23   PHE B CB    1 
ATOM   1917  C  CG    . PHE B  1  23   ? 37.780  29.252  119.024 1.00 68.25  ? 23   PHE B CG    1 
ATOM   1918  C  CD1   . PHE B  1  23   ? 36.622  28.496  119.119 1.00 64.99  ? 23   PHE B CD1   1 
ATOM   1919  C  CD2   . PHE B  1  23   ? 37.823  30.483  119.654 1.00 66.84  ? 23   PHE B CD2   1 
ATOM   1920  C  CE1   . PHE B  1  23   ? 35.534  28.955  119.828 1.00 61.69  ? 23   PHE B CE1   1 
ATOM   1921  C  CE2   . PHE B  1  23   ? 36.739  30.945  120.368 1.00 67.02  ? 23   PHE B CE2   1 
ATOM   1922  C  CZ    . PHE B  1  23   ? 35.593  30.180  120.455 1.00 70.32  ? 23   PHE B CZ    1 
ATOM   1923  N  N     . VAL B  1  24   ? 40.903  29.200  115.380 1.00 66.14  ? 24   VAL B N     1 
ATOM   1924  C  CA    . VAL B  1  24   ? 41.974  28.666  114.553 1.00 66.21  ? 24   VAL B CA    1 
ATOM   1925  C  C     . VAL B  1  24   ? 43.293  28.860  115.282 1.00 69.05  ? 24   VAL B C     1 
ATOM   1926  O  O     . VAL B  1  24   ? 43.556  29.931  115.837 1.00 76.85  ? 24   VAL B O     1 
ATOM   1927  C  CB    . VAL B  1  24   ? 42.005  29.343  113.169 1.00 69.32  ? 24   VAL B CB    1 
ATOM   1928  C  CG1   . VAL B  1  24   ? 43.108  28.748  112.307 1.00 76.36  ? 24   VAL B CG1   1 
ATOM   1929  C  CG2   . VAL B  1  24   ? 40.652  29.218  112.486 1.00 64.26  ? 24   VAL B CG2   1 
ATOM   1930  N  N     . LEU B  1  25   ? 44.116  27.817  115.289 1.00 68.12  ? 25   LEU B N     1 
ATOM   1931  C  CA    . LEU B  1  25   ? 45.468  27.881  115.834 1.00 70.40  ? 25   LEU B CA    1 
ATOM   1932  C  C     . LEU B  1  25   ? 46.421  27.342  114.781 1.00 76.79  ? 25   LEU B C     1 
ATOM   1933  O  O     . LEU B  1  25   ? 46.325  26.168  114.399 1.00 71.95  ? 25   LEU B O     1 
ATOM   1934  C  CB    . LEU B  1  25   ? 45.585  27.084  117.135 1.00 68.08  ? 25   LEU B CB    1 
ATOM   1935  C  CG    . LEU B  1  25   ? 46.880  27.302  117.920 1.00 71.80  ? 25   LEU B CG    1 
ATOM   1936  C  CD1   . LEU B  1  25   ? 46.944  28.724  118.448 1.00 82.17  ? 25   LEU B CD1   1 
ATOM   1937  C  CD2   . LEU B  1  25   ? 46.999  26.304  119.055 1.00 70.26  ? 25   LEU B CD2   1 
ATOM   1938  N  N     . GLU B  1  26   ? 47.324  28.198  114.299 1.00 84.54  ? 26   GLU B N     1 
ATOM   1939  C  CA    . GLU B  1  26   ? 48.267  27.763  113.275 1.00 75.25  ? 26   GLU B CA    1 
ATOM   1940  C  C     . GLU B  1  26   ? 49.461  28.703  113.263 1.00 67.87  ? 26   GLU B C     1 
ATOM   1941  O  O     . GLU B  1  26   ? 49.314  29.886  113.583 1.00 78.89  ? 26   GLU B O     1 
ATOM   1942  C  CB    . GLU B  1  26   ? 47.608  27.724  111.886 1.00 77.64  ? 26   GLU B CB    1 
ATOM   1943  C  CG    . GLU B  1  26   ? 47.216  29.080  111.326 1.00 83.40  ? 26   GLU B CG    1 
ATOM   1944  C  CD    . GLU B  1  26   ? 46.881  29.019  109.847 1.00 91.40  ? 26   GLU B CD    1 
ATOM   1945  O  OE1   . GLU B  1  26   ? 47.695  28.465  109.072 1.00 83.52  ? 26   GLU B OE1   1 
ATOM   1946  O  OE2   . GLU B  1  26   ? 45.800  29.517  109.462 1.00 88.03  ? 26   GLU B OE2   1 
ATOM   1947  N  N     . PRO B  1  27   ? 50.656  28.212  112.903 1.00 60.82  ? 27   PRO B N     1 
ATOM   1948  C  CA    . PRO B  1  27   ? 50.968  26.823  112.565 1.00 66.69  ? 27   PRO B CA    1 
ATOM   1949  C  C     . PRO B  1  27   ? 51.417  26.010  113.771 1.00 70.95  ? 27   PRO B C     1 
ATOM   1950  O  O     . PRO B  1  27   ? 51.852  26.583  114.767 1.00 76.03  ? 27   PRO B O     1 
ATOM   1951  C  CB    . PRO B  1  27   ? 52.113  26.969  111.570 1.00 72.67  ? 27   PRO B CB    1 
ATOM   1952  C  CG    . PRO B  1  27   ? 52.859  28.150  112.091 1.00 68.56  ? 27   PRO B CG    1 
ATOM   1953  C  CD    . PRO B  1  27   ? 51.813  29.092  112.661 1.00 69.84  ? 27   PRO B CD    1 
ATOM   1954  N  N     . LEU B  1  28   ? 51.318  24.687  113.675 1.00 68.12  ? 28   LEU B N     1 
ATOM   1955  C  CA    . LEU B  1  28   ? 51.780  23.789  114.721 1.00 67.99  ? 28   LEU B CA    1 
ATOM   1956  C  C     . LEU B  1  28   ? 52.716  22.758  114.116 1.00 66.27  ? 28   LEU B C     1 
ATOM   1957  O  O     . LEU B  1  28   ? 52.619  22.430  112.931 1.00 69.03  ? 28   LEU B O     1 
ATOM   1958  C  CB    . LEU B  1  28   ? 50.619  23.062  115.416 1.00 67.55  ? 28   LEU B CB    1 
ATOM   1959  C  CG    . LEU B  1  28   ? 49.538  23.877  116.124 1.00 59.71  ? 28   LEU B CG    1 
ATOM   1960  C  CD1   . LEU B  1  28   ? 48.364  22.979  116.487 1.00 57.88  ? 28   LEU B CD1   1 
ATOM   1961  C  CD2   . LEU B  1  28   ? 50.098  24.554  117.360 1.00 65.23  ? 28   LEU B CD2   1 
ATOM   1962  N  N     . GLU B  1  29   ? 53.616  22.238  114.947 1.00 68.07  ? 29   GLU B N     1 
ATOM   1963  C  CA    . GLU B  1  29   ? 54.490  21.164  114.507 1.00 68.60  ? 29   GLU B CA    1 
ATOM   1964  C  C     . GLU B  1  29   ? 53.655  19.954  114.104 1.00 70.40  ? 29   GLU B C     1 
ATOM   1965  O  O     . GLU B  1  29   ? 52.497  19.807  114.501 1.00 70.77  ? 29   GLU B O     1 
ATOM   1966  C  CB    . GLU B  1  29   ? 55.478  20.795  115.612 1.00 78.29  ? 29   GLU B CB    1 
ATOM   1967  C  CG    . GLU B  1  29   ? 56.742  20.107  115.119 1.00 93.79  ? 29   GLU B CG    1 
ATOM   1968  C  CD    . GLU B  1  29   ? 57.453  20.888  114.021 1.00 103.74 ? 29   GLU B CD    1 
ATOM   1969  O  OE1   . GLU B  1  29   ? 57.400  20.453  112.849 1.00 106.09 ? 29   GLU B OE1   1 
ATOM   1970  O  OE2   . GLU B  1  29   ? 58.063  21.935  114.328 1.00 100.75 ? 29   GLU B OE2   1 
ATOM   1971  N  N     . ARG B  1  30   ? 54.255  19.087  113.291 1.00 72.71  ? 30   ARG B N     1 
ATOM   1972  C  CA    . ARG B  1  30   ? 53.503  17.989  112.697 1.00 75.06  ? 30   ARG B CA    1 
ATOM   1973  C  C     . ARG B  1  30   ? 52.922  17.078  113.771 1.00 70.24  ? 30   ARG B C     1 
ATOM   1974  O  O     . ARG B  1  30   ? 53.645  16.568  114.632 1.00 64.26  ? 30   ARG B O     1 
ATOM   1975  C  CB    . ARG B  1  30   ? 54.389  17.182  111.751 1.00 70.09  ? 30   ARG B CB    1 
ATOM   1976  C  CG    . ARG B  1  30   ? 53.630  16.057  111.063 1.00 71.98  ? 30   ARG B CG    1 
ATOM   1977  C  CD    . ARG B  1  30   ? 54.543  15.159  110.249 1.00 72.35  ? 30   ARG B CD    1 
ATOM   1978  N  NE    . ARG B  1  30   ? 55.450  14.377  111.083 1.00 69.42  ? 30   ARG B NE    1 
ATOM   1979  C  CZ    . ARG B  1  30   ? 56.388  13.567  110.605 1.00 69.46  ? 30   ARG B CZ    1 
ATOM   1980  N  NH1   . ARG B  1  30   ? 56.547  13.430  109.296 1.00 76.22  ? 30   ARG B NH1   1 
ATOM   1981  N  NH2   . ARG B  1  30   ? 57.171  12.892  111.436 1.00 68.43  ? 30   ARG B NH2   1 
ATOM   1982  N  N     . GLY B  1  31   ? 51.601  16.884  113.712 1.00 67.44  ? 31   GLY B N     1 
ATOM   1983  C  CA    . GLY B  1  31   ? 50.874  16.003  114.593 1.00 68.54  ? 31   GLY B CA    1 
ATOM   1984  C  C     . GLY B  1  31   ? 50.149  16.703  115.725 1.00 62.90  ? 31   GLY B C     1 
ATOM   1985  O  O     . GLY B  1  31   ? 49.138  16.185  116.216 1.00 59.39  ? 31   GLY B O     1 
ATOM   1986  N  N     . PHE B  1  32   ? 50.631  17.873  116.140 1.00 63.97  ? 32   PHE B N     1 
ATOM   1987  C  CA    . PHE B  1  32   ? 50.087  18.538  117.315 1.00 52.74  ? 32   PHE B CA    1 
ATOM   1988  C  C     . PHE B  1  32   ? 48.685  19.086  117.102 1.00 52.58  ? 32   PHE B C     1 
ATOM   1989  O  O     . PHE B  1  32   ? 48.016  19.405  118.090 1.00 60.94  ? 32   PHE B O     1 
ATOM   1990  C  CB    . PHE B  1  32   ? 51.027  19.653  117.757 1.00 52.53  ? 32   PHE B CB    1 
ATOM   1991  C  CG    . PHE B  1  32   ? 52.139  19.175  118.639 1.00 58.59  ? 32   PHE B CG    1 
ATOM   1992  C  CD1   . PHE B  1  32   ? 53.223  18.500  118.105 1.00 63.41  ? 32   PHE B CD1   1 
ATOM   1993  C  CD2   . PHE B  1  32   ? 52.093  19.384  120.008 1.00 70.19  ? 32   PHE B CD2   1 
ATOM   1994  C  CE1   . PHE B  1  32   ? 54.246  18.050  118.919 1.00 68.68  ? 32   PHE B CE1   1 
ATOM   1995  C  CE2   . PHE B  1  32   ? 53.115  18.937  120.830 1.00 65.90  ? 32   PHE B CE2   1 
ATOM   1996  C  CZ    . PHE B  1  32   ? 54.192  18.269  120.285 1.00 66.57  ? 32   PHE B CZ    1 
ATOM   1997  N  N     . GLY B  1  33   ? 48.219  19.189  115.856 1.00 52.43  ? 33   GLY B N     1 
ATOM   1998  C  CA    . GLY B  1  33   ? 46.837  19.585  115.631 1.00 58.98  ? 33   GLY B CA    1 
ATOM   1999  C  C     . GLY B  1  33   ? 45.852  18.664  116.326 1.00 56.57  ? 33   GLY B C     1 
ATOM   2000  O  O     . GLY B  1  33   ? 45.007  19.109  117.104 1.00 49.91  ? 33   GLY B O     1 
ATOM   2001  N  N     . VAL B  1  34   ? 45.971  17.359  116.081 1.00 60.50  ? 34   VAL B N     1 
ATOM   2002  C  CA    . VAL B  1  34   ? 45.078  16.410  116.738 1.00 58.14  ? 34   VAL B CA    1 
ATOM   2003  C  C     . VAL B  1  34   ? 45.455  16.229  118.207 1.00 52.99  ? 34   VAL B C     1 
ATOM   2004  O  O     . VAL B  1  34   ? 44.572  16.010  119.051 1.00 56.00  ? 34   VAL B O     1 
ATOM   2005  C  CB    . VAL B  1  34   ? 45.075  15.073  115.973 1.00 64.18  ? 34   VAL B CB    1 
ATOM   2006  C  CG1   . VAL B  1  34   ? 45.494  15.294  114.523 1.00 66.53  ? 34   VAL B CG1   1 
ATOM   2007  C  CG2   . VAL B  1  34   ? 45.972  14.042  116.643 1.00 55.73  ? 34   VAL B CG2   1 
ATOM   2008  N  N     . THR B  1  35   ? 46.749  16.360  118.534 1.00 53.89  ? 35   THR B N     1 
ATOM   2009  C  CA    . THR B  1  35   ? 47.203  16.253  119.919 1.00 53.65  ? 35   THR B CA    1 
ATOM   2010  C  C     . THR B  1  35   ? 46.531  17.295  120.802 1.00 51.06  ? 35   THR B C     1 
ATOM   2011  O  O     . THR B  1  35   ? 46.224  17.026  121.970 1.00 46.18  ? 35   THR B O     1 
ATOM   2012  C  CB    . THR B  1  35   ? 48.729  16.394  119.984 1.00 50.19  ? 35   THR B CB    1 
ATOM   2013  O  OG1   . THR B  1  35   ? 49.345  15.330  119.251 1.00 47.50  ? 35   THR B OG1   1 
ATOM   2014  C  CG2   . THR B  1  35   ? 49.223  16.355  121.426 1.00 47.55  ? 35   THR B CG2   1 
ATOM   2015  N  N     . LEU B  1  36   ? 46.289  18.488  120.264 1.00 49.15  ? 36   LEU B N     1 
ATOM   2016  C  CA    . LEU B  1  36   ? 45.515  19.486  120.993 1.00 43.53  ? 36   LEU B CA    1 
ATOM   2017  C  C     . LEU B  1  36   ? 44.012  19.340  120.786 1.00 45.24  ? 36   LEU B C     1 
ATOM   2018  O  O     . LEU B  1  36   ? 43.245  19.617  121.709 1.00 51.60  ? 36   LEU B O     1 
ATOM   2019  C  CB    . LEU B  1  36   ? 45.953  20.892  120.589 1.00 46.39  ? 36   LEU B CB    1 
ATOM   2020  C  CG    . LEU B  1  36   ? 47.356  21.290  121.042 1.00 54.78  ? 36   LEU B CG    1 
ATOM   2021  C  CD1   . LEU B  1  36   ? 47.674  22.728  120.663 1.00 57.08  ? 36   LEU B CD1   1 
ATOM   2022  C  CD2   . LEU B  1  36   ? 47.519  21.082  122.546 1.00 58.50  ? 36   LEU B CD2   1 
ATOM   2023  N  N     . GLY B  1  37   ? 43.565  18.907  119.607 1.00 50.06  ? 37   GLY B N     1 
ATOM   2024  C  CA    . GLY B  1  37   ? 42.138  18.920  119.328 1.00 51.56  ? 37   GLY B CA    1 
ATOM   2025  C  C     . GLY B  1  37   ? 41.359  17.881  120.112 1.00 45.44  ? 37   GLY B C     1 
ATOM   2026  O  O     . GLY B  1  37   ? 40.280  18.168  120.635 1.00 47.38  ? 37   GLY B O     1 
ATOM   2027  N  N     . ASN B  1  38   ? 41.876  16.649  120.183 1.00 47.19  ? 38   ASN B N     1 
ATOM   2028  C  CA    . ASN B  1  38   ? 41.093  15.584  120.812 1.00 51.24  ? 38   ASN B CA    1 
ATOM   2029  C  C     . ASN B  1  38   ? 40.886  15.812  122.306 1.00 56.51  ? 38   ASN B C     1 
ATOM   2030  O  O     . ASN B  1  38   ? 39.732  15.715  122.769 1.00 61.60  ? 38   ASN B O     1 
ATOM   2031  C  CB    . ASN B  1  38   ? 41.733  14.223  120.526 1.00 57.97  ? 38   ASN B CB    1 
ATOM   2032  C  CG    . ASN B  1  38   ? 41.295  13.645  119.192 1.00 62.85  ? 38   ASN B CG    1 
ATOM   2033  O  OD1   . ASN B  1  38   ? 40.126  13.748  118.813 1.00 63.09  ? 38   ASN B OD1   1 
ATOM   2034  N  ND2   . ASN B  1  38   ? 42.231  13.041  118.469 1.00 59.13  ? 38   ASN B ND2   1 
ATOM   2035  N  N     . PRO B  1  39   ? 41.918  16.110  123.110 1.00 54.73  ? 39   PRO B N     1 
ATOM   2036  C  CA    . PRO B  1  39   ? 41.669  16.332  124.545 1.00 49.42  ? 39   PRO B CA    1 
ATOM   2037  C  C     . PRO B  1  39   ? 40.706  17.465  124.811 1.00 47.44  ? 39   PRO B C     1 
ATOM   2038  O  O     . PRO B  1  39   ? 39.818  17.327  125.658 1.00 53.22  ? 39   PRO B O     1 
ATOM   2039  C  CB    . PRO B  1  39   ? 43.062  16.648  125.104 1.00 43.26  ? 39   PRO B CB    1 
ATOM   2040  C  CG    . PRO B  1  39   ? 43.995  16.147  124.112 1.00 47.37  ? 39   PRO B CG    1 
ATOM   2041  C  CD    . PRO B  1  39   ? 43.344  16.255  122.786 1.00 52.00  ? 39   PRO B CD    1 
ATOM   2042  N  N     . LEU B  1  40   ? 40.873  18.595  124.122 1.00 44.82  ? 40   LEU B N     1 
ATOM   2043  C  CA    . LEU B  1  40   ? 39.964  19.713  124.330 1.00 47.79  ? 40   LEU B CA    1 
ATOM   2044  C  C     . LEU B  1  40   ? 38.534  19.334  123.975 1.00 52.16  ? 40   LEU B C     1 
ATOM   2045  O  O     . LEU B  1  40   ? 37.594  19.755  124.653 1.00 54.85  ? 40   LEU B O     1 
ATOM   2046  C  CB    . LEU B  1  40   ? 40.421  20.927  123.525 1.00 48.07  ? 40   LEU B CB    1 
ATOM   2047  C  CG    . LEU B  1  40   ? 41.791  21.474  123.923 1.00 50.75  ? 40   LEU B CG    1 
ATOM   2048  C  CD1   . LEU B  1  40   ? 42.003  22.860  123.340 1.00 57.91  ? 40   LEU B CD1   1 
ATOM   2049  C  CD2   . LEU B  1  40   ? 41.962  21.487  125.431 1.00 51.83  ? 40   LEU B CD2   1 
ATOM   2050  N  N     . ARG B  1  41   ? 38.343  18.526  122.931 1.00 52.31  ? 41   ARG B N     1 
ATOM   2051  C  CA    . ARG B  1  41   ? 36.991  18.092  122.595 1.00 52.86  ? 41   ARG B CA    1 
ATOM   2052  C  C     . ARG B  1  41   ? 36.403  17.234  123.710 1.00 52.96  ? 41   ARG B C     1 
ATOM   2053  O  O     . ARG B  1  41   ? 35.251  17.436  124.123 1.00 55.65  ? 41   ARG B O     1 
ATOM   2054  C  CB    . ARG B  1  41   ? 36.984  17.336  121.266 1.00 51.67  ? 41   ARG B CB    1 
ATOM   2055  C  CG    . ARG B  1  41   ? 35.614  16.793  120.905 1.00 55.05  ? 41   ARG B CG    1 
ATOM   2056  C  CD    . ARG B  1  41   ? 35.617  15.988  119.623 1.00 52.31  ? 41   ARG B CD    1 
ATOM   2057  N  NE    . ARG B  1  41   ? 34.260  15.565  119.293 1.00 52.60  ? 41   ARG B NE    1 
ATOM   2058  C  CZ    . ARG B  1  41   ? 33.705  14.438  119.724 1.00 55.61  ? 41   ARG B CZ    1 
ATOM   2059  N  NH1   . ARG B  1  41   ? 34.396  13.607  120.496 1.00 49.16  ? 41   ARG B NH1   1 
ATOM   2060  N  NH2   . ARG B  1  41   ? 32.458  14.138  119.380 1.00 55.07  ? 41   ARG B NH2   1 
ATOM   2061  N  N     . ARG B  1  42   ? 37.186  16.276  124.223 1.00 46.37  ? 42   ARG B N     1 
ATOM   2062  C  CA    . ARG B  1  42   ? 36.702  15.446  125.326 1.00 47.43  ? 42   ARG B CA    1 
ATOM   2063  C  C     . ARG B  1  42   ? 36.329  16.303  126.534 1.00 54.22  ? 42   ARG B C     1 
ATOM   2064  O  O     . ARG B  1  42   ? 35.252  16.140  127.125 1.00 57.68  ? 42   ARG B O     1 
ATOM   2065  C  CB    . ARG B  1  42   ? 37.757  14.407  125.710 1.00 44.38  ? 42   ARG B CB    1 
ATOM   2066  C  CG    . ARG B  1  42   ? 38.173  13.488  124.578 1.00 44.87  ? 42   ARG B CG    1 
ATOM   2067  C  CD    . ARG B  1  42   ? 39.302  12.548  124.987 1.00 42.18  ? 42   ARG B CD    1 
ATOM   2068  N  NE    . ARG B  1  42   ? 38.877  11.589  125.998 1.00 37.01  ? 42   ARG B NE    1 
ATOM   2069  C  CZ    . ARG B  1  42   ? 38.243  10.454  125.728 1.00 44.27  ? 42   ARG B CZ    1 
ATOM   2070  N  NH1   . ARG B  1  42   ? 37.974  10.126  124.474 1.00 55.30  ? 42   ARG B NH1   1 
ATOM   2071  N  NH2   . ARG B  1  42   ? 37.891  9.635   126.710 1.00 48.29  ? 42   ARG B NH2   1 
ATOM   2072  N  N     . ILE B  1  43   ? 37.205  17.240  126.899 1.00 50.66  ? 43   ILE B N     1 
ATOM   2073  C  CA    . ILE B  1  43   ? 36.961  18.093  128.059 1.00 44.39  ? 43   ILE B CA    1 
ATOM   2074  C  C     . ILE B  1  43   ? 35.714  18.941  127.847 1.00 49.00  ? 43   ILE B C     1 
ATOM   2075  O  O     . ILE B  1  43   ? 34.850  19.036  128.726 1.00 57.81  ? 43   ILE B O     1 
ATOM   2076  C  CB    . ILE B  1  43   ? 38.194  18.966  128.339 1.00 41.51  ? 43   ILE B CB    1 
ATOM   2077  C  CG1   . ILE B  1  43   ? 39.387  18.084  128.704 1.00 45.98  ? 43   ILE B CG1   1 
ATOM   2078  C  CG2   . ILE B  1  43   ? 37.899  19.961  129.440 1.00 51.99  ? 43   ILE B CG2   1 
ATOM   2079  C  CD1   . ILE B  1  43   ? 40.699  18.841  128.809 1.00 49.14  ? 43   ILE B CD1   1 
ATOM   2080  N  N     . LEU B  1  44   ? 35.597  19.566  126.674 1.00 48.78  ? 44   LEU B N     1 
ATOM   2081  C  CA    . LEU B  1  44   ? 34.452  20.424  126.394 1.00 55.38  ? 44   LEU B CA    1 
ATOM   2082  C  C     . LEU B  1  44   ? 33.145  19.648  126.426 1.00 55.11  ? 44   LEU B C     1 
ATOM   2083  O  O     . LEU B  1  44   ? 32.115  20.183  126.856 1.00 54.77  ? 44   LEU B O     1 
ATOM   2084  C  CB    . LEU B  1  44   ? 34.629  21.100  125.035 1.00 56.38  ? 44   LEU B CB    1 
ATOM   2085  C  CG    . LEU B  1  44   ? 35.722  22.162  124.933 1.00 53.03  ? 44   LEU B CG    1 
ATOM   2086  C  CD1   . LEU B  1  44   ? 36.076  22.392  123.481 1.00 49.00  ? 44   LEU B CD1   1 
ATOM   2087  C  CD2   . LEU B  1  44   ? 35.269  23.452  125.587 1.00 63.38  ? 44   LEU B CD2   1 
ATOM   2088  N  N     . LEU B  1  45   ? 33.162  18.390  125.988 1.00 51.15  ? 45   LEU B N     1 
ATOM   2089  C  CA    . LEU B  1  45   ? 31.936  17.607  126.020 1.00 55.21  ? 45   LEU B CA    1 
ATOM   2090  C  C     . LEU B  1  45   ? 31.655  16.993  127.388 1.00 59.80  ? 45   LEU B C     1 
ATOM   2091  O  O     . LEU B  1  45   ? 30.516  16.586  127.644 1.00 54.10  ? 45   LEU B O     1 
ATOM   2092  C  CB    . LEU B  1  45   ? 31.987  16.514  124.951 1.00 50.16  ? 45   LEU B CB    1 
ATOM   2093  C  CG    . LEU B  1  45   ? 31.932  17.047  123.518 1.00 56.06  ? 45   LEU B CG    1 
ATOM   2094  C  CD1   . LEU B  1  45   ? 31.955  15.906  122.515 1.00 62.27  ? 45   LEU B CD1   1 
ATOM   2095  C  CD2   . LEU B  1  45   ? 30.703  17.922  123.313 1.00 49.20  ? 45   LEU B CD2   1 
ATOM   2096  N  N     . SER B  1  46   ? 32.642  16.923  128.279 1.00 60.16  ? 46   SER B N     1 
ATOM   2097  C  CA    . SER B  1  46   ? 32.425  16.255  129.556 1.00 55.79  ? 46   SER B CA    1 
ATOM   2098  C  C     . SER B  1  46   ? 32.490  17.181  130.761 1.00 58.60  ? 46   SER B C     1 
ATOM   2099  O  O     . SER B  1  46   ? 31.585  17.159  131.602 1.00 67.26  ? 46   SER B O     1 
ATOM   2100  C  CB    . SER B  1  46   ? 33.440  15.120  129.729 1.00 57.95  ? 46   SER B CB    1 
ATOM   2101  O  OG    . SER B  1  46   ? 34.762  15.598  129.567 1.00 56.94  ? 46   SER B OG    1 
ATOM   2102  N  N     . SER B  1  47   ? 33.538  17.993  130.885 1.00 55.69  ? 47   SER B N     1 
ATOM   2103  C  CA    . SER B  1  47   ? 33.899  18.574  132.172 1.00 58.74  ? 47   SER B CA    1 
ATOM   2104  C  C     . SER B  1  47   ? 33.553  20.058  132.312 1.00 58.76  ? 47   SER B C     1 
ATOM   2105  O  O     . SER B  1  47   ? 33.966  20.679  133.289 1.00 58.84  ? 47   SER B O     1 
ATOM   2106  C  CB    . SER B  1  47   ? 35.390  18.372  132.428 1.00 62.91  ? 47   SER B CB    1 
ATOM   2107  O  OG    . SER B  1  47   ? 35.691  16.989  132.496 1.00 64.59  ? 47   SER B OG    1 
ATOM   2108  N  N     . ILE B  1  48   ? 32.792  20.634  131.388 1.00 60.79  ? 48   ILE B N     1 
ATOM   2109  C  CA    . ILE B  1  48   ? 32.444  22.049  131.502 1.00 59.29  ? 48   ILE B CA    1 
ATOM   2110  C  C     . ILE B  1  48   ? 31.207  22.195  132.381 1.00 64.24  ? 48   ILE B C     1 
ATOM   2111  O  O     . ILE B  1  48   ? 30.145  21.644  132.048 1.00 64.89  ? 48   ILE B O     1 
ATOM   2112  C  CB    . ILE B  1  48   ? 32.223  22.694  130.130 1.00 62.89  ? 48   ILE B CB    1 
ATOM   2113  C  CG1   . ILE B  1  48   ? 33.505  22.612  129.298 1.00 67.21  ? 48   ILE B CG1   1 
ATOM   2114  C  CG2   . ILE B  1  48   ? 31.763  24.128  130.303 1.00 59.29  ? 48   ILE B CG2   1 
ATOM   2115  C  CD1   . ILE B  1  48   ? 34.712  23.312  129.915 1.00 61.93  ? 48   ILE B CD1   1 
ATOM   2116  N  N     . PRO B  1  49   ? 31.294  22.923  133.498 1.00 68.96  ? 49   PRO B N     1 
ATOM   2117  C  CA    . PRO B  1  49   ? 30.169  22.976  134.443 1.00 60.34  ? 49   PRO B CA    1 
ATOM   2118  C  C     . PRO B  1  49   ? 28.973  23.728  133.878 1.00 57.73  ? 49   PRO B C     1 
ATOM   2119  O  O     . PRO B  1  49   ? 29.112  24.803  133.289 1.00 56.24  ? 49   PRO B O     1 
ATOM   2120  C  CB    . PRO B  1  49   ? 30.761  23.708  135.656 1.00 58.00  ? 49   PRO B CB    1 
ATOM   2121  C  CG    . PRO B  1  49   ? 32.245  23.604  135.491 1.00 59.28  ? 49   PRO B CG    1 
ATOM   2122  C  CD    . PRO B  1  49   ? 32.483  23.614  134.019 1.00 66.51  ? 49   PRO B CD    1 
ATOM   2123  N  N     . GLY B  1  50   ? 27.789  23.153  134.078 1.00 57.97  ? 50   GLY B N     1 
ATOM   2124  C  CA    . GLY B  1  50   ? 26.551  23.747  133.617 1.00 63.52  ? 50   GLY B CA    1 
ATOM   2125  C  C     . GLY B  1  50   ? 25.375  23.328  134.475 1.00 74.78  ? 50   GLY B C     1 
ATOM   2126  O  O     . GLY B  1  50   ? 25.564  22.775  135.562 1.00 77.31  ? 50   GLY B O     1 
ATOM   2127  N  N     . THR B  1  51   ? 24.155  23.580  134.002 1.00 78.80  ? 51   THR B N     1 
ATOM   2128  C  CA    . THR B  1  51   ? 22.947  23.295  134.763 1.00 75.57  ? 51   THR B CA    1 
ATOM   2129  C  C     . THR B  1  51   ? 21.983  22.472  133.920 1.00 72.65  ? 51   THR B C     1 
ATOM   2130  O  O     . THR B  1  51   ? 21.999  22.537  132.687 1.00 79.17  ? 51   THR B O     1 
ATOM   2131  C  CB    . THR B  1  51   ? 22.249  24.582  135.228 1.00 74.15  ? 51   THR B CB    1 
ATOM   2132  O  OG1   . THR B  1  51   ? 21.679  25.255  134.097 1.00 78.43  ? 51   THR B OG1   1 
ATOM   2133  C  CG2   . THR B  1  51   ? 23.240  25.512  135.918 1.00 71.28  ? 51   THR B CG2   1 
ATOM   2134  N  N     . ALA B  1  52   ? 21.136  21.704  134.604 1.00 65.69  ? 52   ALA B N     1 
ATOM   2135  C  CA    . ALA B  1  52   ? 20.208  20.811  133.921 1.00 66.11  ? 52   ALA B CA    1 
ATOM   2136  C  C     . ALA B  1  52   ? 19.028  20.477  134.820 1.00 66.13  ? 52   ALA B C     1 
ATOM   2137  O  O     . ALA B  1  52   ? 19.152  20.438  136.047 1.00 71.14  ? 52   ALA B O     1 
ATOM   2138  C  CB    . ALA B  1  52   ? 20.896  19.516  133.486 1.00 68.35  ? 52   ALA B CB    1 
ATOM   2139  N  N     . VAL B  1  53   ? 17.892  20.202  134.183 1.00 62.74  ? 53   VAL B N     1 
ATOM   2140  C  CA    . VAL B  1  53   ? 16.681  19.768  134.874 1.00 65.23  ? 53   VAL B CA    1 
ATOM   2141  C  C     . VAL B  1  53   ? 16.782  18.265  135.111 1.00 66.55  ? 53   VAL B C     1 
ATOM   2142  O  O     . VAL B  1  53   ? 16.776  17.475  134.164 1.00 71.06  ? 53   VAL B O     1 
ATOM   2143  C  CB    . VAL B  1  53   ? 15.422  20.119  134.075 1.00 70.73  ? 53   VAL B CB    1 
ATOM   2144  C  CG1   . VAL B  1  53   ? 14.194  19.509  134.730 1.00 77.71  ? 53   VAL B CG1   1 
ATOM   2145  C  CG2   . VAL B  1  53   ? 15.278  21.627  133.959 1.00 72.01  ? 53   VAL B CG2   1 
ATOM   2146  N  N     . THR B  1  54   ? 16.852  17.869  136.381 1.00 68.56  ? 54   THR B N     1 
ATOM   2147  C  CA    . THR B  1  54   ? 17.129  16.490  136.759 1.00 71.90  ? 54   THR B CA    1 
ATOM   2148  C  C     . THR B  1  54   ? 15.904  15.719  137.242 1.00 75.16  ? 54   THR B C     1 
ATOM   2149  O  O     . THR B  1  54   ? 15.919  14.483  137.195 1.00 70.85  ? 54   THR B O     1 
ATOM   2150  C  CB    . THR B  1  54   ? 18.207  16.455  137.851 1.00 74.01  ? 54   THR B CB    1 
ATOM   2151  O  OG1   . THR B  1  54   ? 17.800  17.272  138.953 1.00 73.78  ? 54   THR B OG1   1 
ATOM   2152  C  CG2   . THR B  1  54   ? 19.532  16.981  137.311 1.00 77.54  ? 54   THR B CG2   1 
ATOM   2153  N  N     . SER B  1  55   ? 14.852  16.401  137.695 1.00 81.40  ? 55   SER B N     1 
ATOM   2154  C  CA    . SER B  1  55   ? 13.666  15.714  138.193 1.00 77.32  ? 55   SER B CA    1 
ATOM   2155  C  C     . SER B  1  55   ? 12.479  16.666  138.140 1.00 76.08  ? 55   SER B C     1 
ATOM   2156  O  O     . SER B  1  55   ? 12.633  17.878  138.321 1.00 74.75  ? 55   SER B O     1 
ATOM   2157  C  CB    . SER B  1  55   ? 13.885  15.200  139.621 1.00 74.75  ? 55   SER B CB    1 
ATOM   2158  O  OG    . SER B  1  55   ? 12.854  14.311  140.010 1.00 82.55  ? 55   SER B OG    1 
ATOM   2159  N  N     . VAL B  1  56   ? 11.294  16.108  137.889 1.00 76.66  ? 56   VAL B N     1 
ATOM   2160  C  CA    . VAL B  1  56   ? 10.075  16.902  137.736 1.00 82.91  ? 56   VAL B CA    1 
ATOM   2161  C  C     . VAL B  1  56   ? 8.913   16.159  138.382 1.00 90.57  ? 56   VAL B C     1 
ATOM   2162  O  O     . VAL B  1  56   ? 8.744   14.958  138.160 1.00 88.09  ? 56   VAL B O     1 
ATOM   2163  C  CB    . VAL B  1  56   ? 9.768   17.195  136.252 1.00 80.83  ? 56   VAL B CB    1 
ATOM   2164  C  CG1   . VAL B  1  56   ? 8.311   17.593  136.061 1.00 79.58  ? 56   VAL B CG1   1 
ATOM   2165  C  CG2   . VAL B  1  56   ? 10.676  18.294  135.733 1.00 87.11  ? 56   VAL B CG2   1 
ATOM   2166  N  N     . TYR B  1  57   ? 8.108   16.870  139.176 1.00 91.36  ? 57   TYR B N     1 
ATOM   2167  C  CA    . TYR B  1  57   ? 6.886   16.326  139.759 1.00 87.96  ? 57   TYR B CA    1 
ATOM   2168  C  C     . TYR B  1  57   ? 5.682   17.070  139.196 1.00 83.25  ? 57   TYR B C     1 
ATOM   2169  O  O     . TYR B  1  57   ? 5.635   18.303  139.239 1.00 78.92  ? 57   TYR B O     1 
ATOM   2170  C  CB    . TYR B  1  57   ? 6.903   16.428  141.290 1.00 100.62 ? 57   TYR B CB    1 
ATOM   2171  C  CG    . TYR B  1  57   ? 5.548   16.208  141.942 1.00 103.76 ? 57   TYR B CG    1 
ATOM   2172  C  CD1   . TYR B  1  57   ? 4.980   14.939  142.007 1.00 104.40 ? 57   TYR B CD1   1 
ATOM   2173  C  CD2   . TYR B  1  57   ? 4.839   17.270  142.494 1.00 96.82  ? 57   TYR B CD2   1 
ATOM   2174  C  CE1   . TYR B  1  57   ? 3.743   14.735  142.599 1.00 98.77  ? 57   TYR B CE1   1 
ATOM   2175  C  CE2   . TYR B  1  57   ? 3.602   17.074  143.087 1.00 97.56  ? 57   TYR B CE2   1 
ATOM   2176  C  CZ    . TYR B  1  57   ? 3.060   15.806  143.137 1.00 98.59  ? 57   TYR B CZ    1 
ATOM   2177  O  OH    . TYR B  1  57   ? 1.831   15.611  143.725 1.00 94.78  ? 57   TYR B OH    1 
ATOM   2178  N  N     . ILE B  1  58   ? 4.718   16.319  138.660 1.00 85.26  ? 58   ILE B N     1 
ATOM   2179  C  CA    . ILE B  1  58   ? 3.441   16.860  138.208 1.00 95.57  ? 58   ILE B CA    1 
ATOM   2180  C  C     . ILE B  1  58   ? 2.344   16.248  139.064 1.00 105.04 ? 58   ILE B C     1 
ATOM   2181  O  O     . ILE B  1  58   ? 2.361   15.043  139.343 1.00 102.84 ? 58   ILE B O     1 
ATOM   2182  C  CB    . ILE B  1  58   ? 3.182   16.593  136.712 1.00 97.13  ? 58   ILE B CB    1 
ATOM   2183  C  CG1   . ILE B  1  58   ? 4.351   17.096  135.866 1.00 102.41 ? 58   ILE B CG1   1 
ATOM   2184  C  CG2   . ILE B  1  58   ? 1.903   17.281  136.264 1.00 97.02  ? 58   ILE B CG2   1 
ATOM   2185  C  CD1   . ILE B  1  58   ? 4.207   16.794  134.391 1.00 91.45  ? 58   ILE B CD1   1 
ATOM   2186  N  N     . GLU B  1  59   ? 1.382   17.084  139.466 1.00 108.28 ? 59   GLU B N     1 
ATOM   2187  C  CA    . GLU B  1  59   ? 0.447   16.718  140.526 1.00 112.27 ? 59   GLU B CA    1 
ATOM   2188  C  C     . GLU B  1  59   ? -0.394  15.504  140.144 1.00 112.37 ? 59   GLU B C     1 
ATOM   2189  O  O     . GLU B  1  59   ? -0.332  14.457  140.800 1.00 112.60 ? 59   GLU B O     1 
ATOM   2190  C  CB    . GLU B  1  59   ? -0.443  17.918  140.859 1.00 112.68 ? 59   GLU B CB    1 
ATOM   2191  C  CG    . GLU B  1  59   ? -1.435  17.670  141.984 1.00 121.68 ? 59   GLU B CG    1 
ATOM   2192  C  CD    . GLU B  1  59   ? -2.272  18.896  142.306 1.00 124.74 ? 59   GLU B CD    1 
ATOM   2193  O  OE1   . GLU B  1  59   ? -1.895  20.007  141.874 1.00 120.07 ? 59   GLU B OE1   1 
ATOM   2194  O  OE2   . GLU B  1  59   ? -3.309  18.746  142.988 1.00 121.86 ? 59   GLU B OE2   1 
ATOM   2195  N  N     . ASP B  1  60   ? -1.192  15.625  139.085 1.00 110.25 ? 60   ASP B N     1 
ATOM   2196  C  CA    . ASP B  1  60   ? -2.127  14.579  138.696 1.00 113.17 ? 60   ASP B CA    1 
ATOM   2197  C  C     . ASP B  1  60   ? -1.510  13.550  137.754 1.00 109.15 ? 60   ASP B C     1 
ATOM   2198  O  O     . ASP B  1  60   ? -2.247  12.801  137.103 1.00 107.39 ? 60   ASP B O     1 
ATOM   2199  C  CB    . ASP B  1  60   ? -3.372  15.197  138.053 1.00 122.51 ? 60   ASP B CB    1 
ATOM   2200  C  CG    . ASP B  1  60   ? -4.290  15.861  139.068 1.00 124.83 ? 60   ASP B CG    1 
ATOM   2201  O  OD1   . ASP B  1  60   ? -4.322  15.413  140.234 1.00 123.01 ? 60   ASP B OD1   1 
ATOM   2202  O  OD2   . ASP B  1  60   ? -4.986  16.831  138.696 1.00 119.38 ? 60   ASP B OD2   1 
ATOM   2203  N  N     . VAL B  1  61   ? -0.185  13.490  137.673 1.00 108.79 ? 61   VAL B N     1 
ATOM   2204  C  CA    . VAL B  1  61   ? 0.512   12.606  136.747 1.00 104.07 ? 61   VAL B CA    1 
ATOM   2205  C  C     . VAL B  1  61   ? 1.223   11.523  137.544 1.00 99.25  ? 61   VAL B C     1 
ATOM   2206  O  O     . VAL B  1  61   ? 1.981   11.823  138.475 1.00 95.41  ? 61   VAL B O     1 
ATOM   2207  C  CB    . VAL B  1  61   ? 1.499   13.386  135.866 1.00 100.17 ? 61   VAL B CB    1 
ATOM   2208  C  CG1   . VAL B  1  61   ? 2.406   12.430  135.120 1.00 111.17 ? 61   VAL B CG1   1 
ATOM   2209  C  CG2   . VAL B  1  61   ? 0.736   14.259  134.892 1.00 95.34  ? 61   VAL B CG2   1 
ATOM   2210  N  N     . LEU B  1  62   ? 0.983   10.266  137.173 1.00 97.30  ? 62   LEU B N     1 
ATOM   2211  C  CA    . LEU B  1  62   ? 1.542   9.136   137.904 1.00 102.74 ? 62   LEU B CA    1 
ATOM   2212  C  C     . LEU B  1  62   ? 2.920   8.726   137.397 1.00 107.93 ? 62   LEU B C     1 
ATOM   2213  O  O     . LEU B  1  62   ? 3.814   8.456   138.206 1.00 109.51 ? 62   LEU B O     1 
ATOM   2214  C  CB    . LEU B  1  62   ? 0.581   7.947   137.840 1.00 103.82 ? 62   LEU B CB    1 
ATOM   2215  C  CG    . LEU B  1  62   ? -0.713  8.148   138.631 1.00 105.40 ? 62   LEU B CG    1 
ATOM   2216  C  CD1   . LEU B  1  62   ? -1.633  6.948   138.491 1.00 100.91 ? 62   LEU B CD1   1 
ATOM   2217  C  CD2   . LEU B  1  62   ? -0.395  8.418   140.095 1.00 103.70 ? 62   LEU B CD2   1 
ATOM   2218  N  N     . HIS B  1  63   ? 3.121   8.671   136.082 1.00 114.99 ? 63   HIS B N     1 
ATOM   2219  C  CA    . HIS B  1  63   ? 4.415   8.282   135.534 1.00 110.86 ? 63   HIS B CA    1 
ATOM   2220  C  C     . HIS B  1  63   ? 4.656   9.017   134.220 1.00 108.87 ? 63   HIS B C     1 
ATOM   2221  O  O     . HIS B  1  63   ? 3.844   9.835   133.777 1.00 107.53 ? 63   HIS B O     1 
ATOM   2222  C  CB    . HIS B  1  63   ? 4.512   6.762   135.357 1.00 109.75 ? 63   HIS B CB    1 
ATOM   2223  C  CG    . HIS B  1  63   ? 3.349   6.154   134.637 1.00 115.00 ? 63   HIS B CG    1 
ATOM   2224  N  ND1   . HIS B  1  63   ? 3.164   6.281   133.278 1.00 111.13 ? 63   HIS B ND1   1 
ATOM   2225  C  CD2   . HIS B  1  63   ? 2.315   5.405   135.089 1.00 121.47 ? 63   HIS B CD2   1 
ATOM   2226  C  CE1   . HIS B  1  63   ? 2.064   5.641   132.924 1.00 117.97 ? 63   HIS B CE1   1 
ATOM   2227  N  NE2   . HIS B  1  63   ? 1.529   5.101   134.004 1.00 124.53 ? 63   HIS B NE2   1 
ATOM   2228  N  N     . GLU B  1  64   ? 5.796   8.707   133.595 1.00 108.41 ? 64   GLU B N     1 
ATOM   2229  C  CA    . GLU B  1  64   ? 6.253   9.453   132.425 1.00 106.01 ? 64   GLU B CA    1 
ATOM   2230  C  C     . GLU B  1  64   ? 5.381   9.200   131.202 1.00 105.11 ? 64   GLU B C     1 
ATOM   2231  O  O     . GLU B  1  64   ? 5.218   10.094  130.364 1.00 102.47 ? 64   GLU B O     1 
ATOM   2232  C  CB    . GLU B  1  64   ? 7.711   9.094   132.124 1.00 107.08 ? 64   GLU B CB    1 
ATOM   2233  C  CG    . GLU B  1  64   ? 8.350   9.878   130.980 1.00 111.14 ? 64   GLU B CG    1 
ATOM   2234  C  CD    . GLU B  1  64   ? 9.835   9.583   130.825 1.00 110.50 ? 64   GLU B CD    1 
ATOM   2235  O  OE1   . GLU B  1  64   ? 10.472  10.169  129.923 1.00 111.63 ? 64   GLU B OE1   1 
ATOM   2236  O  OE2   . GLU B  1  64   ? 10.367  8.765   131.606 1.00 101.86 ? 64   GLU B OE2   1 
ATOM   2237  N  N     . PHE B  1  65   ? 4.813   8.005   131.078 1.00 107.69 ? 65   PHE B N     1 
ATOM   2238  C  CA    . PHE B  1  65   ? 4.041   7.639   129.901 1.00 106.05 ? 65   PHE B CA    1 
ATOM   2239  C  C     . PHE B  1  65   ? 2.547   7.886   130.070 1.00 112.21 ? 65   PHE B C     1 
ATOM   2240  O  O     . PHE B  1  65   ? 1.755   7.385   129.266 1.00 110.25 ? 65   PHE B O     1 
ATOM   2241  C  CB    . PHE B  1  65   ? 4.304   6.176   129.546 1.00 107.03 ? 65   PHE B CB    1 
ATOM   2242  C  CG    . PHE B  1  65   ? 5.758   5.864   129.349 1.00 108.78 ? 65   PHE B CG    1 
ATOM   2243  C  CD1   . PHE B  1  65   ? 6.397   6.207   128.170 1.00 106.74 ? 65   PHE B CD1   1 
ATOM   2244  C  CD2   . PHE B  1  65   ? 6.490   5.248   130.349 1.00 110.80 ? 65   PHE B CD2   1 
ATOM   2245  C  CE1   . PHE B  1  65   ? 7.738   5.932   127.988 1.00 102.35 ? 65   PHE B CE1   1 
ATOM   2246  C  CE2   . PHE B  1  65   ? 7.831   4.969   130.174 1.00 111.24 ? 65   PHE B CE2   1 
ATOM   2247  C  CZ    . PHE B  1  65   ? 8.456   5.311   128.992 1.00 107.40 ? 65   PHE B CZ    1 
ATOM   2248  N  N     . SER B  1  66   ? 2.147   8.641   131.090 1.00 116.51 ? 66   SER B N     1 
ATOM   2249  C  CA    . SER B  1  66   ? 0.750   9.002   131.269 1.00 115.10 ? 66   SER B CA    1 
ATOM   2250  C  C     . SER B  1  66   ? 0.375   10.131  130.309 1.00 115.18 ? 66   SER B C     1 
ATOM   2251  O  O     . SER B  1  66   ? 1.198   10.633  129.539 1.00 110.28 ? 66   SER B O     1 
ATOM   2252  C  CB    . SER B  1  66   ? 0.486   9.403   132.719 1.00 117.00 ? 66   SER B CB    1 
ATOM   2253  O  OG    . SER B  1  66   ? 0.814   8.355   133.615 1.00 118.32 ? 66   SER B OG    1 
ATOM   2254  N  N     . THR B  1  67   ? -0.891  10.537  130.354 1.00 120.78 ? 67   THR B N     1 
ATOM   2255  C  CA    . THR B  1  67   ? -1.380  11.636  129.535 1.00 122.33 ? 67   THR B CA    1 
ATOM   2256  C  C     . THR B  1  67   ? -2.261  12.531  130.392 1.00 118.04 ? 67   THR B C     1 
ATOM   2257  O  O     . THR B  1  67   ? -3.043  12.044  131.213 1.00 110.91 ? 67   THR B O     1 
ATOM   2258  C  CB    . THR B  1  67   ? -2.156  11.129  128.313 1.00 123.73 ? 67   THR B CB    1 
ATOM   2259  O  OG1   . THR B  1  67   ? -2.852  12.221  127.696 1.00 125.15 ? 67   THR B OG1   1 
ATOM   2260  C  CG2   . THR B  1  67   ? -3.148  10.047  128.718 1.00 122.29 ? 67   THR B CG2   1 
ATOM   2261  N  N     . ILE B  1  68   ? -2.125  13.835  130.203 1.00 113.68 ? 68   ILE B N     1 
ATOM   2262  C  CA    . ILE B  1  68   ? -2.766  14.832  131.056 1.00 110.66 ? 68   ILE B CA    1 
ATOM   2263  C  C     . ILE B  1  68   ? -4.079  15.259  130.410 1.00 117.56 ? 68   ILE B C     1 
ATOM   2264  O  O     . ILE B  1  68   ? -4.079  15.625  129.225 1.00 111.00 ? 68   ILE B O     1 
ATOM   2265  C  CB    . ILE B  1  68   ? -1.853  16.048  131.286 1.00 103.96 ? 68   ILE B CB    1 
ATOM   2266  C  CG1   . ILE B  1  68   ? -0.485  15.596  131.793 1.00 101.50 ? 68   ILE B CG1   1 
ATOM   2267  C  CG2   . ILE B  1  68   ? -2.489  17.005  132.278 1.00 113.20 ? 68   ILE B CG2   1 
ATOM   2268  C  CD1   . ILE B  1  68   ? 0.452   16.742  132.123 1.00 104.84 ? 68   ILE B CD1   1 
ATOM   2269  N  N     . PRO B  1  69   ? -5.201  15.216  131.129 1.00 119.23 ? 69   PRO B N     1 
ATOM   2270  C  CA    . PRO B  1  69   ? -6.442  15.782  130.589 1.00 112.97 ? 69   PRO B CA    1 
ATOM   2271  C  C     . PRO B  1  69   ? -6.382  17.302  130.580 1.00 108.69 ? 69   PRO B C     1 
ATOM   2272  O  O     . PRO B  1  69   ? -5.899  17.928  131.526 1.00 106.33 ? 69   PRO B O     1 
ATOM   2273  C  CB    . PRO B  1  69   ? -7.522  15.267  131.551 1.00 109.02 ? 69   PRO B CB    1 
ATOM   2274  C  CG    . PRO B  1  69   ? -6.878  14.141  132.310 1.00 103.99 ? 69   PRO B CG    1 
ATOM   2275  C  CD    . PRO B  1  69   ? -5.428  14.499  132.394 1.00 108.07 ? 69   PRO B CD    1 
ATOM   2276  N  N     . GLY B  1  70   ? -6.867  17.894  129.487 1.00 104.36 ? 70   GLY B N     1 
ATOM   2277  C  CA    . GLY B  1  70   ? -6.866  19.333  129.332 1.00 110.92 ? 70   GLY B CA    1 
ATOM   2278  C  C     . GLY B  1  70   ? -5.571  19.924  128.826 1.00 112.84 ? 70   GLY B C     1 
ATOM   2279  O  O     . GLY B  1  70   ? -5.512  21.138  128.592 1.00 112.55 ? 70   GLY B O     1 
ATOM   2280  N  N     . VAL B  1  71   ? -4.529  19.115  128.657 1.00 114.66 ? 71   VAL B N     1 
ATOM   2281  C  CA    . VAL B  1  71   ? -3.250  19.558  128.122 1.00 108.29 ? 71   VAL B CA    1 
ATOM   2282  C  C     . VAL B  1  71   ? -2.971  18.763  126.854 1.00 105.11 ? 71   VAL B C     1 
ATOM   2283  O  O     . VAL B  1  71   ? -3.136  17.537  126.835 1.00 102.42 ? 71   VAL B O     1 
ATOM   2284  C  CB    . VAL B  1  71   ? -2.115  19.387  129.149 1.00 105.32 ? 71   VAL B CB    1 
ATOM   2285  C  CG1   . VAL B  1  71   ? -0.786  19.828  128.559 1.00 103.53 ? 71   VAL B CG1   1 
ATOM   2286  C  CG2   . VAL B  1  71   ? -2.425  20.178  130.411 1.00 104.18 ? 71   VAL B CG2   1 
ATOM   2287  N  N     . LYS B  1  72   ? -2.556  19.463  125.795 1.00 103.73 ? 72   LYS B N     1 
ATOM   2288  C  CA    . LYS B  1  72   ? -2.346  18.808  124.508 1.00 102.83 ? 72   LYS B CA    1 
ATOM   2289  C  C     . LYS B  1  72   ? -1.110  17.913  124.531 1.00 100.02 ? 72   LYS B C     1 
ATOM   2290  O  O     . LYS B  1  72   ? -1.163  16.757  124.098 1.00 98.42  ? 72   LYS B O     1 
ATOM   2291  C  CB    . LYS B  1  72   ? -2.234  19.860  123.405 1.00 102.35 ? 72   LYS B CB    1 
ATOM   2292  C  CG    . LYS B  1  72   ? -1.894  19.300  122.037 1.00 116.16 ? 72   LYS B CG    1 
ATOM   2293  C  CD    . LYS B  1  72   ? -1.652  20.416  121.036 1.00 116.56 ? 72   LYS B CD    1 
ATOM   2294  C  CE    . LYS B  1  72   ? -1.208  19.865  119.695 1.00 104.68 ? 72   LYS B CE    1 
ATOM   2295  N  NZ    . LYS B  1  72   ? -0.907  20.956  118.731 1.00 117.89 ? 72   LYS B NZ    1 
ATOM   2296  N  N     . GLU B  1  73   ? 0.010   18.429  125.032 1.00 96.51  ? 73   GLU B N     1 
ATOM   2297  C  CA    . GLU B  1  73   ? 1.237   17.645  125.085 1.00 91.41  ? 73   GLU B CA    1 
ATOM   2298  C  C     . GLU B  1  73   ? 1.145   16.563  126.154 1.00 92.89  ? 73   GLU B C     1 
ATOM   2299  O  O     . GLU B  1  73   ? 0.554   16.766  127.218 1.00 100.69 ? 73   GLU B O     1 
ATOM   2300  C  CB    . GLU B  1  73   ? 2.437   18.547  125.376 1.00 87.98  ? 73   GLU B CB    1 
ATOM   2301  C  CG    . GLU B  1  73   ? 2.787   19.529  124.268 1.00 99.52  ? 73   GLU B CG    1 
ATOM   2302  C  CD    . GLU B  1  73   ? 1.966   20.802  124.325 1.00 101.94 ? 73   GLU B CD    1 
ATOM   2303  O  OE1   . GLU B  1  73   ? 1.008   20.856  125.124 1.00 105.55 ? 73   GLU B OE1   1 
ATOM   2304  O  OE2   . GLU B  1  73   ? 2.282   21.750  123.575 1.00 100.04 ? 73   GLU B OE2   1 
ATOM   2305  N  N     . ASP B  1  74   ? 1.734   15.406  125.868 1.00 93.80  ? 74   ASP B N     1 
ATOM   2306  C  CA    . ASP B  1  74   ? 1.854   14.373  126.882 1.00 94.93  ? 74   ASP B CA    1 
ATOM   2307  C  C     . ASP B  1  74   ? 2.997   14.719  127.833 1.00 89.45  ? 74   ASP B C     1 
ATOM   2308  O  O     . ASP B  1  74   ? 3.705   15.715  127.663 1.00 80.34  ? 74   ASP B O     1 
ATOM   2309  C  CB    . ASP B  1  74   ? 2.058   13.000  126.241 1.00 98.83  ? 74   ASP B CB    1 
ATOM   2310  C  CG    . ASP B  1  74   ? 3.136   13.000  125.170 1.00 101.19 ? 74   ASP B CG    1 
ATOM   2311  O  OD1   . ASP B  1  74   ? 4.194   13.636  125.373 1.00 98.23  ? 74   ASP B OD1   1 
ATOM   2312  O  OD2   . ASP B  1  74   ? 2.927   12.346  124.126 1.00 104.41 ? 74   ASP B OD2   1 
ATOM   2313  N  N     . VAL B  1  75   ? 3.176   13.881  128.855 1.00 94.20  ? 75   VAL B N     1 
ATOM   2314  C  CA    . VAL B  1  75   ? 4.236   14.114  129.831 1.00 96.57  ? 75   VAL B CA    1 
ATOM   2315  C  C     . VAL B  1  75   ? 5.600   14.059  129.157 1.00 88.59  ? 75   VAL B C     1 
ATOM   2316  O  O     . VAL B  1  75   ? 6.520   14.811  129.509 1.00 81.54  ? 75   VAL B O     1 
ATOM   2317  C  CB    . VAL B  1  75   ? 4.129   13.093  130.978 1.00 96.61  ? 75   VAL B CB    1 
ATOM   2318  C  CG1   . VAL B  1  75   ? 5.138   13.410  132.068 1.00 97.20  ? 75   VAL B CG1   1 
ATOM   2319  C  CG2   . VAL B  1  75   ? 2.713   13.071  131.528 1.00 91.83  ? 75   VAL B CG2   1 
ATOM   2320  N  N     . VAL B  1  76   ? 5.746   13.173  128.169 1.00 86.35  ? 76   VAL B N     1 
ATOM   2321  C  CA    . VAL B  1  76   ? 7.029   12.991  127.498 1.00 85.60  ? 76   VAL B CA    1 
ATOM   2322  C  C     . VAL B  1  76   ? 7.455   14.279  126.805 1.00 78.75  ? 76   VAL B C     1 
ATOM   2323  O  O     . VAL B  1  76   ? 8.600   14.725  126.936 1.00 70.78  ? 76   VAL B O     1 
ATOM   2324  C  CB    . VAL B  1  76   ? 6.946   11.816  126.509 1.00 88.88  ? 76   VAL B CB    1 
ATOM   2325  C  CG1   . VAL B  1  76   ? 8.282   11.617  125.812 1.00 88.54  ? 76   VAL B CG1   1 
ATOM   2326  C  CG2   . VAL B  1  76   ? 6.518   10.552  127.238 1.00 93.66  ? 76   VAL B CG2   1 
ATOM   2327  N  N     . GLU B  1  77   ? 6.537   14.894  126.056 1.00 78.92  ? 77   GLU B N     1 
ATOM   2328  C  CA    . GLU B  1  77   ? 6.871   16.114  125.330 1.00 76.21  ? 77   GLU B CA    1 
ATOM   2329  C  C     . GLU B  1  77   ? 7.182   17.259  126.288 1.00 74.29  ? 77   GLU B C     1 
ATOM   2330  O  O     . GLU B  1  77   ? 8.066   18.082  126.019 1.00 75.18  ? 77   GLU B O     1 
ATOM   2331  C  CB    . GLU B  1  77   ? 5.724   16.481  124.388 1.00 80.77  ? 77   GLU B CB    1 
ATOM   2332  C  CG    . GLU B  1  77   ? 5.989   17.680  123.490 1.00 87.98  ? 77   GLU B CG    1 
ATOM   2333  C  CD    . GLU B  1  77   ? 7.068   17.423  122.449 1.00 86.93  ? 77   GLU B CD    1 
ATOM   2334  O  OE1   . GLU B  1  77   ? 7.731   18.398  122.032 1.00 76.97  ? 77   GLU B OE1   1 
ATOM   2335  O  OE2   . GLU B  1  77   ? 7.251   16.252  122.047 1.00 83.19  ? 77   GLU B OE2   1 
ATOM   2336  N  N     . ILE B  1  78   ? 6.477   17.321  127.419 1.00 81.38  ? 78   ILE B N     1 
ATOM   2337  C  CA    . ILE B  1  78   ? 6.759   18.362  128.402 1.00 82.53  ? 78   ILE B CA    1 
ATOM   2338  C  C     . ILE B  1  78   ? 8.165   18.190  128.958 1.00 77.51  ? 78   ILE B C     1 
ATOM   2339  O  O     . ILE B  1  78   ? 8.938   19.151  129.048 1.00 74.96  ? 78   ILE B O     1 
ATOM   2340  C  CB    . ILE B  1  78   ? 5.704   18.349  129.522 1.00 81.02  ? 78   ILE B CB    1 
ATOM   2341  C  CG1   . ILE B  1  78   ? 4.308   18.561  128.940 1.00 82.71  ? 78   ILE B CG1   1 
ATOM   2342  C  CG2   . ILE B  1  78   ? 6.009   19.431  130.548 1.00 76.32  ? 78   ILE B CG2   1 
ATOM   2343  C  CD1   . ILE B  1  78   ? 3.209   18.493  129.968 1.00 89.43  ? 78   ILE B CD1   1 
ATOM   2344  N  N     . ILE B  1  79   ? 8.517   16.959  129.337 1.00 78.40  ? 79   ILE B N     1 
ATOM   2345  C  CA    . ILE B  1  79   ? 9.865   16.690  129.832 1.00 76.44  ? 79   ILE B CA    1 
ATOM   2346  C  C     . ILE B  1  79   ? 10.902  17.038  128.772 1.00 72.88  ? 79   ILE B C     1 
ATOM   2347  O  O     . ILE B  1  79   ? 11.962  17.598  129.080 1.00 72.40  ? 79   ILE B O     1 
ATOM   2348  C  CB    . ILE B  1  79   ? 9.982   15.222  130.280 1.00 80.94  ? 79   ILE B CB    1 
ATOM   2349  C  CG1   . ILE B  1  79   ? 9.072   14.962  131.479 1.00 75.02  ? 79   ILE B CG1   1 
ATOM   2350  C  CG2   . ILE B  1  79   ? 11.426  14.871  130.612 1.00 75.48  ? 79   ILE B CG2   1 
ATOM   2351  C  CD1   . ILE B  1  79   ? 9.078   13.525  131.929 1.00 93.90  ? 79   ILE B CD1   1 
ATOM   2352  N  N     . LEU B  1  80   ? 10.613  16.712  127.509 1.00 78.61  ? 80   LEU B N     1 
ATOM   2353  C  CA    . LEU B  1  80   ? 11.519  17.061  126.418 1.00 69.02  ? 80   LEU B CA    1 
ATOM   2354  C  C     . LEU B  1  80   ? 11.758  18.564  126.368 1.00 71.19  ? 80   LEU B C     1 
ATOM   2355  O  O     . LEU B  1  80   ? 12.905  19.022  126.326 1.00 70.51  ? 80   LEU B O     1 
ATOM   2356  C  CB    . LEU B  1  80   ? 10.953  16.557  125.091 1.00 60.94  ? 80   LEU B CB    1 
ATOM   2357  C  CG    . LEU B  1  80   ? 11.598  15.317  124.474 1.00 59.44  ? 80   LEU B CG    1 
ATOM   2358  C  CD1   . LEU B  1  80   ? 12.015  14.322  125.543 1.00 60.76  ? 80   LEU B CD1   1 
ATOM   2359  C  CD2   . LEU B  1  80   ? 10.640  14.674  123.484 1.00 61.55  ? 80   LEU B CD2   1 
ATOM   2360  N  N     . ASN B  1  81   ? 10.679  19.351  126.392 1.00 76.09  ? 81   ASN B N     1 
ATOM   2361  C  CA    . ASN B  1  81   ? 10.832  20.803  126.402 1.00 74.57  ? 81   ASN B CA    1 
ATOM   2362  C  C     . ASN B  1  81   ? 11.603  21.273  127.625 1.00 73.00  ? 81   ASN B C     1 
ATOM   2363  O  O     . ASN B  1  81   ? 12.375  22.236  127.542 1.00 73.64  ? 81   ASN B O     1 
ATOM   2364  C  CB    . ASN B  1  81   ? 9.465   21.477  126.351 1.00 74.76  ? 81   ASN B CB    1 
ATOM   2365  C  CG    . ASN B  1  81   ? 8.731   21.193  125.064 1.00 87.95  ? 81   ASN B CG    1 
ATOM   2366  O  OD1   . ASN B  1  81   ? 7.631   20.639  125.074 1.00 83.77  ? 81   ASN B OD1   1 
ATOM   2367  N  ND2   . ASN B  1  81   ? 9.336   21.572  123.940 1.00 88.97  ? 81   ASN B ND2   1 
ATOM   2368  N  N     . LEU B  1  82   ? 11.418  20.600  128.761 1.00 74.17  ? 82   LEU B N     1 
ATOM   2369  C  CA    . LEU B  1  82   ? 12.144  20.969  129.971 1.00 76.58  ? 82   LEU B CA    1 
ATOM   2370  C  C     . LEU B  1  82   ? 13.629  20.667  129.847 1.00 78.91  ? 82   LEU B C     1 
ATOM   2371  O  O     . LEU B  1  82   ? 14.449  21.339  130.483 1.00 81.10  ? 82   LEU B O     1 
ATOM   2372  C  CB    . LEU B  1  82   ? 11.554  20.245  131.179 1.00 75.41  ? 82   LEU B CB    1 
ATOM   2373  C  CG    . LEU B  1  82   ? 10.137  20.679  131.548 1.00 74.49  ? 82   LEU B CG    1 
ATOM   2374  C  CD1   . LEU B  1  82   ? 9.533   19.721  132.553 1.00 71.68  ? 82   LEU B CD1   1 
ATOM   2375  C  CD2   . LEU B  1  82   ? 10.142  22.103  132.081 1.00 74.48  ? 82   LEU B CD2   1 
ATOM   2376  N  N     . LYS B  1  83   ? 13.994  19.666  129.042 1.00 74.80  ? 83   LYS B N     1 
ATOM   2377  C  CA    . LYS B  1  83   ? 15.408  19.423  128.785 1.00 69.18  ? 83   LYS B CA    1 
ATOM   2378  C  C     . LYS B  1  83   ? 16.054  20.625  128.116 1.00 73.96  ? 83   LYS B C     1 
ATOM   2379  O  O     . LYS B  1  83   ? 17.238  20.902  128.344 1.00 76.81  ? 83   LYS B O     1 
ATOM   2380  C  CB    . LYS B  1  83   ? 15.591  18.178  127.915 1.00 64.62  ? 83   LYS B CB    1 
ATOM   2381  C  CG    . LYS B  1  83   ? 15.176  16.874  128.568 1.00 69.11  ? 83   LYS B CG    1 
ATOM   2382  C  CD    . LYS B  1  83   ? 15.437  15.695  127.640 1.00 65.35  ? 83   LYS B CD    1 
ATOM   2383  C  CE    . LYS B  1  83   ? 15.022  14.382  128.280 1.00 68.86  ? 83   LYS B CE    1 
ATOM   2384  N  NZ    . LYS B  1  83   ? 15.245  13.221  127.377 1.00 68.00  ? 83   LYS B NZ    1 
ATOM   2385  N  N     . GLU B  1  84   ? 15.291  21.360  127.309 1.00 72.68  ? 84   GLU B N     1 
ATOM   2386  C  CA    . GLU B  1  84   ? 15.807  22.494  126.557 1.00 79.33  ? 84   GLU B CA    1 
ATOM   2387  C  C     . GLU B  1  84   ? 15.772  23.793  127.349 1.00 79.14  ? 84   GLU B C     1 
ATOM   2388  O  O     . GLU B  1  84   ? 16.091  24.850  126.795 1.00 83.70  ? 84   GLU B O     1 
ATOM   2389  C  CB    . GLU B  1  84   ? 15.025  22.655  125.251 1.00 81.46  ? 84   GLU B CB    1 
ATOM   2390  C  CG    . GLU B  1  84   ? 15.103  21.427  124.360 1.00 84.02  ? 84   GLU B CG    1 
ATOM   2391  C  CD    . GLU B  1  84   ? 14.423  21.616  123.021 1.00 97.75  ? 84   GLU B CD    1 
ATOM   2392  O  OE1   . GLU B  1  84   ? 13.659  22.594  122.868 1.00 104.43 ? 84   GLU B OE1   1 
ATOM   2393  O  OE2   . GLU B  1  84   ? 14.657  20.781  122.119 1.00 96.02  ? 84   GLU B OE2   1 
ATOM   2394  N  N     . LEU B  1  85   ? 15.398  23.740  128.620 1.00 83.41  ? 85   LEU B N     1 
ATOM   2395  C  CA    . LEU B  1  85   ? 15.458  24.920  129.465 1.00 86.53  ? 85   LEU B CA    1 
ATOM   2396  C  C     . LEU B  1  85   ? 16.913  25.241  129.791 1.00 79.85  ? 85   LEU B C     1 
ATOM   2397  O  O     . LEU B  1  85   ? 17.648  24.385  130.297 1.00 80.46  ? 85   LEU B O     1 
ATOM   2398  C  CB    . LEU B  1  85   ? 14.649  24.688  130.741 1.00 84.15  ? 85   LEU B CB    1 
ATOM   2399  C  CG    . LEU B  1  85   ? 14.458  25.885  131.669 1.00 80.11  ? 85   LEU B CG    1 
ATOM   2400  C  CD1   . LEU B  1  85   ? 13.666  26.980  130.976 1.00 82.81  ? 85   LEU B CD1   1 
ATOM   2401  C  CD2   . LEU B  1  85   ? 13.771  25.452  132.950 1.00 93.31  ? 85   LEU B CD2   1 
ATOM   2402  N  N     . VAL B  1  86   ? 17.336  26.462  129.486 1.00 74.91  ? 86   VAL B N     1 
ATOM   2403  C  CA    . VAL B  1  86   ? 18.692  26.923  129.766 1.00 79.07  ? 86   VAL B CA    1 
ATOM   2404  C  C     . VAL B  1  86   ? 18.625  27.828  130.989 1.00 85.51  ? 86   VAL B C     1 
ATOM   2405  O  O     . VAL B  1  86   ? 18.146  28.964  130.908 1.00 87.84  ? 86   VAL B O     1 
ATOM   2406  C  CB    . VAL B  1  86   ? 19.304  27.650  128.561 1.00 77.68  ? 86   VAL B CB    1 
ATOM   2407  C  CG1   . VAL B  1  86   ? 20.716  28.123  128.881 1.00 77.27  ? 86   VAL B CG1   1 
ATOM   2408  C  CG2   . VAL B  1  86   ? 19.306  26.745  127.338 1.00 81.85  ? 86   VAL B CG2   1 
ATOM   2409  N  N     . VAL B  1  87   ? 19.106  27.329  132.126 1.00 84.98  ? 87   VAL B N     1 
ATOM   2410  C  CA    . VAL B  1  87   ? 19.069  28.047  133.395 1.00 83.64  ? 87   VAL B CA    1 
ATOM   2411  C  C     . VAL B  1  87   ? 20.491  28.440  133.770 1.00 85.20  ? 87   VAL B C     1 
ATOM   2412  O  O     . VAL B  1  87   ? 21.399  27.599  133.762 1.00 87.55  ? 87   VAL B O     1 
ATOM   2413  C  CB    . VAL B  1  87   ? 18.420  27.202  134.505 1.00 83.36  ? 87   VAL B CB    1 
ATOM   2414  C  CG1   . VAL B  1  87   ? 18.482  27.933  135.838 1.00 85.81  ? 87   VAL B CG1   1 
ATOM   2415  C  CG2   . VAL B  1  87   ? 16.979  26.867  134.147 1.00 79.78  ? 87   VAL B CG2   1 
ATOM   2416  N  N     . ARG B  1  88   ? 20.680  29.714  134.101 1.00 84.21  ? 88   ARG B N     1 
ATOM   2417  C  CA    . ARG B  1  88   ? 21.973  30.270  134.472 1.00 85.57  ? 88   ARG B CA    1 
ATOM   2418  C  C     . ARG B  1  88   ? 21.944  30.616  135.955 1.00 92.55  ? 88   ARG B C     1 
ATOM   2419  O  O     . ARG B  1  88   ? 21.116  31.424  136.394 1.00 94.95  ? 88   ARG B O     1 
ATOM   2420  C  CB    . ARG B  1  88   ? 22.280  31.504  133.623 1.00 86.40  ? 88   ARG B CB    1 
ATOM   2421  C  CG    . ARG B  1  88   ? 23.637  32.147  133.848 1.00 90.23  ? 88   ARG B CG    1 
ATOM   2422  C  CD    . ARG B  1  88   ? 23.782  33.341  132.916 1.00 95.01  ? 88   ARG B CD    1 
ATOM   2423  N  NE    . ARG B  1  88   ? 25.096  33.972  132.977 1.00 98.10  ? 88   ARG B NE    1 
ATOM   2424  C  CZ    . ARG B  1  88   ? 25.485  34.944  132.157 1.00 100.69 ? 88   ARG B CZ    1 
ATOM   2425  N  NH1   . ARG B  1  88   ? 24.657  35.387  131.219 1.00 95.01  ? 88   ARG B NH1   1 
ATOM   2426  N  NH2   . ARG B  1  88   ? 26.697  35.471  132.269 1.00 100.76 ? 88   ARG B NH2   1 
ATOM   2427  N  N     . PHE B  1  89   ? 22.829  29.991  136.727 1.00 89.73  ? 89   PHE B N     1 
ATOM   2428  C  CA    . PHE B  1  89   ? 22.954  30.286  138.148 1.00 87.43  ? 89   PHE B CA    1 
ATOM   2429  C  C     . PHE B  1  89   ? 23.886  31.479  138.323 1.00 94.61  ? 89   PHE B C     1 
ATOM   2430  O  O     . PHE B  1  89   ? 25.066  31.409  137.962 1.00 88.23  ? 89   PHE B O     1 
ATOM   2431  C  CB    . PHE B  1  89   ? 23.482  29.076  138.919 1.00 83.78  ? 89   PHE B CB    1 
ATOM   2432  C  CG    . PHE B  1  89   ? 22.456  27.999  139.151 1.00 76.42  ? 89   PHE B CG    1 
ATOM   2433  C  CD1   . PHE B  1  89   ? 21.144  28.166  138.742 1.00 76.18  ? 89   PHE B CD1   1 
ATOM   2434  C  CD2   . PHE B  1  89   ? 22.806  26.819  139.794 1.00 71.99  ? 89   PHE B CD2   1 
ATOM   2435  C  CE1   . PHE B  1  89   ? 20.200  27.174  138.958 1.00 72.41  ? 89   PHE B CE1   1 
ATOM   2436  C  CE2   . PHE B  1  89   ? 21.867  25.824  140.016 1.00 69.58  ? 89   PHE B CE2   1 
ATOM   2437  C  CZ    . PHE B  1  89   ? 20.563  26.002  139.597 1.00 66.67  ? 89   PHE B CZ    1 
ATOM   2438  N  N     . LEU B  1  90   ? 23.355  32.571  138.874 1.00 98.41  ? 90   LEU B N     1 
ATOM   2439  C  CA    . LEU B  1  90   ? 24.189  33.734  139.155 1.00 100.06 ? 90   LEU B CA    1 
ATOM   2440  C  C     . LEU B  1  90   ? 25.003  33.556  140.430 1.00 100.89 ? 90   LEU B C     1 
ATOM   2441  O  O     . LEU B  1  90   ? 26.094  34.124  140.549 1.00 94.85  ? 90   LEU B O     1 
ATOM   2442  C  CB    . LEU B  1  90   ? 23.320  34.987  139.252 1.00 100.87 ? 90   LEU B CB    1 
ATOM   2443  C  CG    . LEU B  1  90   ? 22.617  35.394  137.957 1.00 101.91 ? 90   LEU B CG    1 
ATOM   2444  C  CD1   . LEU B  1  90   ? 21.664  36.553  138.203 1.00 110.23 ? 90   LEU B CD1   1 
ATOM   2445  C  CD2   . LEU B  1  90   ? 23.643  35.752  136.890 1.00 100.13 ? 90   LEU B CD2   1 
ATOM   2446  N  N     . ASN B  1  91   ? 24.498  32.780  141.381 1.00 101.66 ? 91   ASN B N     1 
ATOM   2447  C  CA    . ASN B  1  91   ? 25.220  32.541  142.625 1.00 99.72  ? 91   ASN B CA    1 
ATOM   2448  C  C     . ASN B  1  91   ? 26.228  31.417  142.419 1.00 92.38  ? 91   ASN B C     1 
ATOM   2449  O  O     . ASN B  1  91   ? 25.827  30.293  142.096 1.00 92.59  ? 91   ASN B O     1 
ATOM   2450  C  CB    . ASN B  1  91   ? 24.246  32.185  143.742 1.00 103.64 ? 91   ASN B CB    1 
ATOM   2451  C  CG    . ASN B  1  91   ? 24.900  32.180  145.115 1.00 105.08 ? 91   ASN B CG    1 
ATOM   2452  O  OD1   . ASN B  1  91   ? 26.099  32.428  145.250 1.00 104.44 ? 91   ASN B OD1   1 
ATOM   2453  N  ND2   . ASN B  1  91   ? 24.104  31.912  146.145 1.00 100.41 ? 91   ASN B ND2   1 
ATOM   2454  N  N     . PRO B  1  92   ? 27.530  31.669  142.583 1.00 89.42  ? 92   PRO B N     1 
ATOM   2455  C  CA    . PRO B  1  92   ? 28.516  30.597  142.360 1.00 94.77  ? 92   PRO B CA    1 
ATOM   2456  C  C     . PRO B  1  92   ? 28.382  29.422  143.319 1.00 93.81  ? 92   PRO B C     1 
ATOM   2457  O  O     . PRO B  1  92   ? 28.809  28.314  142.973 1.00 91.11  ? 92   PRO B O     1 
ATOM   2458  C  CB    . PRO B  1  92   ? 29.863  31.314  142.538 1.00 90.03  ? 92   PRO B CB    1 
ATOM   2459  C  CG    . PRO B  1  92   ? 29.567  32.762  142.323 1.00 91.58  ? 92   PRO B CG    1 
ATOM   2460  C  CD    . PRO B  1  92   ? 28.169  32.973  142.825 1.00 89.42  ? 92   PRO B CD    1 
ATOM   2461  N  N     . SER B  1  93   ? 27.803  29.622  144.504 1.00 93.64  ? 93   SER B N     1 
ATOM   2462  C  CA    . SER B  1  93   ? 27.668  28.559  145.494 1.00 91.94  ? 93   SER B CA    1 
ATOM   2463  C  C     . SER B  1  93   ? 26.356  27.793  145.377 1.00 85.65  ? 93   SER B C     1 
ATOM   2464  O  O     . SER B  1  93   ? 26.188  26.772  146.054 1.00 83.12  ? 93   SER B O     1 
ATOM   2465  C  CB    . SER B  1  93   ? 27.793  29.142  146.904 1.00 92.35  ? 93   SER B CB    1 
ATOM   2466  O  OG    . SER B  1  93   ? 28.984  29.899  147.034 1.00 94.99  ? 93   SER B OG    1 
ATOM   2467  N  N     . LEU B  1  94   ? 25.440  28.253  144.530 1.00 79.99  ? 94   LEU B N     1 
ATOM   2468  C  CA    . LEU B  1  94   ? 24.131  27.633  144.374 1.00 76.76  ? 94   LEU B CA    1 
ATOM   2469  C  C     . LEU B  1  94   ? 24.267  26.321  143.607 1.00 76.18  ? 94   LEU B C     1 
ATOM   2470  O  O     . LEU B  1  94   ? 24.692  26.316  142.448 1.00 82.74  ? 94   LEU B O     1 
ATOM   2471  C  CB    . LEU B  1  94   ? 23.197  28.594  143.645 1.00 77.37  ? 94   LEU B CB    1 
ATOM   2472  C  CG    . LEU B  1  94   ? 21.713  28.590  144.005 1.00 76.42  ? 94   LEU B CG    1 
ATOM   2473  C  CD1   . LEU B  1  94   ? 20.940  29.497  143.059 1.00 75.31  ? 94   LEU B CD1   1 
ATOM   2474  C  CD2   . LEU B  1  94   ? 21.160  27.188  143.978 1.00 67.72  ? 94   LEU B CD2   1 
ATOM   2475  N  N     . GLN B  1  95   ? 23.881  25.213  144.240 1.00 74.40  ? 95   GLN B N     1 
ATOM   2476  C  CA    . GLN B  1  95   ? 24.003  23.900  143.626 1.00 72.43  ? 95   GLN B CA    1 
ATOM   2477  C  C     . GLN B  1  95   ? 22.674  23.314  143.158 1.00 72.41  ? 95   GLN B C     1 
ATOM   2478  O  O     . GLN B  1  95   ? 22.689  22.353  142.381 1.00 73.10  ? 95   GLN B O     1 
ATOM   2479  C  CB    . GLN B  1  95   ? 24.677  22.919  144.597 1.00 69.73  ? 95   GLN B CB    1 
ATOM   2480  C  CG    . GLN B  1  95   ? 26.160  23.201  144.863 1.00 81.99  ? 95   GLN B CG    1 
ATOM   2481  C  CD    . GLN B  1  95   ? 27.081  22.767  143.719 1.00 101.57 ? 95   GLN B CD    1 
ATOM   2482  O  OE1   . GLN B  1  95   ? 26.647  22.126  142.759 1.00 103.79 ? 95   GLN B OE1   1 
ATOM   2483  N  NE2   . GLN B  1  95   ? 28.362  23.115  143.825 1.00 102.56 ? 95   GLN B NE2   1 
ATOM   2484  N  N     . THR B  1  96   ? 21.537  23.856  143.597 1.00 70.59  ? 96   THR B N     1 
ATOM   2485  C  CA    . THR B  1  96   ? 20.252  23.299  143.190 1.00 68.72  ? 96   THR B CA    1 
ATOM   2486  C  C     . THR B  1  96   ? 19.122  24.271  143.508 1.00 66.43  ? 96   THR B C     1 
ATOM   2487  O  O     . THR B  1  96   ? 19.150  24.973  144.521 1.00 72.86  ? 96   THR B O     1 
ATOM   2488  C  CB    . THR B  1  96   ? 19.981  21.953  143.871 1.00 71.12  ? 96   THR B CB    1 
ATOM   2489  O  OG1   . THR B  1  96   ? 18.622  21.564  143.636 1.00 68.22  ? 96   THR B OG1   1 
ATOM   2490  C  CG2   . THR B  1  96   ? 20.232  22.044  145.369 1.00 76.13  ? 96   THR B CG2   1 
ATOM   2491  N  N     . VAL B  1  97   ? 18.117  24.279  142.629 1.00 66.58  ? 97   VAL B N     1 
ATOM   2492  C  CA    . VAL B  1  97   ? 16.914  25.093  142.768 1.00 64.44  ? 97   VAL B CA    1 
ATOM   2493  C  C     . VAL B  1  97   ? 15.710  24.226  142.418 1.00 69.21  ? 97   VAL B C     1 
ATOM   2494  O  O     . VAL B  1  97   ? 15.818  23.257  141.661 1.00 67.88  ? 97   VAL B O     1 
ATOM   2495  C  CB    . VAL B  1  97   ? 16.956  26.352  141.865 1.00 63.88  ? 97   VAL B CB    1 
ATOM   2496  C  CG1   . VAL B  1  97   ? 15.741  27.235  142.096 1.00 75.35  ? 97   VAL B CG1   1 
ATOM   2497  C  CG2   . VAL B  1  97   ? 18.222  27.147  142.101 1.00 62.76  ? 97   VAL B CG2   1 
ATOM   2498  N  N     . THR B  1  98   ? 14.556  24.557  142.999 1.00 75.02  ? 98   THR B N     1 
ATOM   2499  C  CA    . THR B  1  98   ? 13.280  23.959  142.616 1.00 78.43  ? 98   THR B CA    1 
ATOM   2500  C  C     . THR B  1  98   ? 12.371  25.070  142.108 1.00 78.18  ? 98   THR B C     1 
ATOM   2501  O  O     . THR B  1  98   ? 11.891  25.895  142.893 1.00 83.01  ? 98   THR B O     1 
ATOM   2502  C  CB    . THR B  1  98   ? 12.630  23.213  143.782 1.00 78.93  ? 98   THR B CB    1 
ATOM   2503  O  OG1   . THR B  1  98   ? 13.484  22.141  144.211 1.00 74.49  ? 98   THR B OG1   1 
ATOM   2504  C  CG2   . THR B  1  98   ? 11.277  22.640  143.360 1.00 80.71  ? 98   THR B CG2   1 
ATOM   2505  N  N     . LEU B  1  99   ? 12.139  25.094  140.798 1.00 82.69  ? 99   LEU B N     1 
ATOM   2506  C  CA    . LEU B  1  99   ? 11.222  26.051  140.196 1.00 82.58  ? 99   LEU B CA    1 
ATOM   2507  C  C     . LEU B  1  99   ? 9.806   25.495  140.242 1.00 87.51  ? 99   LEU B C     1 
ATOM   2508  O  O     . LEU B  1  99   ? 9.595   24.288  140.095 1.00 87.11  ? 99   LEU B O     1 
ATOM   2509  C  CB    . LEU B  1  99   ? 11.615  26.359  138.750 1.00 87.11  ? 99   LEU B CB    1 
ATOM   2510  C  CG    . LEU B  1  99   ? 12.675  27.430  138.479 1.00 85.98  ? 99   LEU B CG    1 
ATOM   2511  C  CD1   . LEU B  1  99   ? 14.037  27.003  138.985 1.00 75.10  ? 99   LEU B CD1   1 
ATOM   2512  C  CD2   . LEU B  1  99   ? 12.736  27.744  136.991 1.00 94.51  ? 99   LEU B CD2   1 
ATOM   2513  N  N     . LEU B  1  100  ? 8.838   26.379  140.457 1.00 91.49  ? 100  LEU B N     1 
ATOM   2514  C  CA    . LEU B  1  100  ? 7.439   25.993  140.566 1.00 90.66  ? 100  LEU B CA    1 
ATOM   2515  C  C     . LEU B  1  100  ? 6.630   26.703  139.492 1.00 86.99  ? 100  LEU B C     1 
ATOM   2516  O  O     . LEU B  1  100  ? 6.891   27.868  139.172 1.00 89.18  ? 100  LEU B O     1 
ATOM   2517  C  CB    . LEU B  1  100  ? 6.874   26.321  141.956 1.00 92.86  ? 100  LEU B CB    1 
ATOM   2518  C  CG    . LEU B  1  100  ? 7.536   25.639  143.159 1.00 88.47  ? 100  LEU B CG    1 
ATOM   2519  C  CD1   . LEU B  1  100  ? 8.554   26.559  143.829 1.00 74.92  ? 100  LEU B CD1   1 
ATOM   2520  C  CD2   . LEU B  1  100  ? 6.490   25.157  144.157 1.00 96.72  ? 100  LEU B CD2   1 
ATOM   2521  N  N     . LEU B  1  101  ? 5.652   25.994  138.930 1.00 80.81  ? 101  LEU B N     1 
ATOM   2522  C  CA    . LEU B  1  101  ? 4.785   26.567  137.913 1.00 92.79  ? 101  LEU B CA    1 
ATOM   2523  C  C     . LEU B  1  101  ? 3.366   26.057  138.105 1.00 96.01  ? 101  LEU B C     1 
ATOM   2524  O  O     . LEU B  1  101  ? 3.131   24.844  138.130 1.00 89.10  ? 101  LEU B O     1 
ATOM   2525  C  CB    . LEU B  1  101  ? 5.282   26.232  136.504 1.00 100.37 ? 101  LEU B CB    1 
ATOM   2526  C  CG    . LEU B  1  101  ? 4.556   26.949  135.366 1.00 96.25  ? 101  LEU B CG    1 
ATOM   2527  C  CD1   . LEU B  1  101  ? 5.567   27.450  134.357 1.00 98.43  ? 101  LEU B CD1   1 
ATOM   2528  C  CD2   . LEU B  1  101  ? 3.528   26.037  134.701 1.00 90.63  ? 101  LEU B CD2   1 
ATOM   2529  N  N     . LYS B  1  102  ? 2.428   26.992  138.231 1.00 100.13 ? 102  LYS B N     1 
ATOM   2530  C  CA    . LYS B  1  102  ? 1.006   26.692  138.327 1.00 95.86  ? 102  LYS B CA    1 
ATOM   2531  C  C     . LYS B  1  102  ? 0.281   27.570  137.321 1.00 93.29  ? 102  LYS B C     1 
ATOM   2532  O  O     . LYS B  1  102  ? 0.376   28.801  137.387 1.00 92.26  ? 102  LYS B O     1 
ATOM   2533  C  CB    . LYS B  1  102  ? 0.478   26.937  139.744 1.00 100.07 ? 102  LYS B CB    1 
ATOM   2534  C  CG    . LYS B  1  102  ? 1.219   26.164  140.821 1.00 100.57 ? 102  LYS B CG    1 
ATOM   2535  C  CD    . LYS B  1  102  ? 0.684   26.469  142.207 1.00 102.79 ? 102  LYS B CD    1 
ATOM   2536  C  CE    . LYS B  1  102  ? 1.386   25.627  143.258 1.00 111.25 ? 102  LYS B CE    1 
ATOM   2537  N  NZ    . LYS B  1  102  ? 0.888   25.929  144.627 1.00 101.60 ? 102  LYS B NZ    1 
ATOM   2538  N  N     . ALA B  1  103  ? -0.420  26.941  136.382 1.00 95.37  ? 103  ALA B N     1 
ATOM   2539  C  CA    . ALA B  1  103  ? -1.176  27.671  135.377 1.00 109.73 ? 103  ALA B CA    1 
ATOM   2540  C  C     . ALA B  1  103  ? -2.393  26.846  134.987 1.00 112.70 ? 103  ALA B C     1 
ATOM   2541  O  O     . ALA B  1  103  ? -2.484  25.651  135.288 1.00 107.71 ? 103  ALA B O     1 
ATOM   2542  C  CB    . ALA B  1  103  ? -0.321  27.994  134.144 1.00 109.86 ? 103  ALA B CB    1 
ATOM   2543  N  N     . GLU B  1  104  ? -3.337  27.501  134.318 1.00 112.33 ? 104  GLU B N     1 
ATOM   2544  C  CA    . GLU B  1  104  ? -4.562  26.836  133.899 1.00 108.89 ? 104  GLU B CA    1 
ATOM   2545  C  C     . GLU B  1  104  ? -5.256  27.701  132.855 1.00 112.36 ? 104  GLU B C     1 
ATOM   2546  O  O     . GLU B  1  104  ? -4.745  28.748  132.444 1.00 108.39 ? 104  GLU B O     1 
ATOM   2547  C  CB    . GLU B  1  104  ? -5.475  26.560  135.097 1.00 117.73 ? 104  GLU B CB    1 
ATOM   2548  C  CG    . GLU B  1  104  ? -5.888  27.801  135.864 1.00 119.70 ? 104  GLU B CG    1 
ATOM   2549  C  CD    . GLU B  1  104  ? -6.903  27.499  136.946 1.00 121.02 ? 104  GLU B CD    1 
ATOM   2550  O  OE1   . GLU B  1  104  ? -7.103  28.361  137.825 1.00 130.17 ? 104  GLU B OE1   1 
ATOM   2551  O  OE2   . GLU B  1  104  ? -7.498  26.400  136.917 1.00 115.71 ? 104  GLU B OE2   1 
ATOM   2552  N  N     . GLY B  1  105  ? -6.433  27.250  132.429 1.00 114.23 ? 105  GLY B N     1 
ATOM   2553  C  CA    . GLY B  1  105  ? -7.212  27.960  131.447 1.00 121.36 ? 105  GLY B CA    1 
ATOM   2554  C  C     . GLY B  1  105  ? -6.617  27.840  130.062 1.00 125.65 ? 105  GLY B C     1 
ATOM   2555  O  O     . GLY B  1  105  ? -5.686  27.066  129.824 1.00 131.68 ? 105  GLY B O     1 
ATOM   2556  N  N     . PRO B  1  106  ? -7.146  28.606  129.117 1.00 128.89 ? 106  PRO B N     1 
ATOM   2557  C  CA    . PRO B  1  106  ? -6.627  28.553  127.744 1.00 130.08 ? 106  PRO B CA    1 
ATOM   2558  C  C     . PRO B  1  106  ? -5.356  29.371  127.576 1.00 128.89 ? 106  PRO B C     1 
ATOM   2559  O  O     . PRO B  1  106  ? -5.417  30.540  127.183 1.00 129.10 ? 106  PRO B O     1 
ATOM   2560  C  CB    . PRO B  1  106  ? -7.786  29.119  126.913 1.00 133.02 ? 106  PRO B CB    1 
ATOM   2561  C  CG    . PRO B  1  106  ? -8.607  29.946  127.882 1.00 135.34 ? 106  PRO B CG    1 
ATOM   2562  C  CD    . PRO B  1  106  ? -8.151  29.669  129.289 1.00 131.72 ? 106  PRO B CD    1 
ATOM   2563  N  N     . LYS B  1  107  ? -4.200  28.775  127.878 1.00 126.98 ? 107  LYS B N     1 
ATOM   2564  C  CA    . LYS B  1  107  ? -2.950  29.525  127.906 1.00 122.51 ? 107  LYS B CA    1 
ATOM   2565  C  C     . LYS B  1  107  ? -1.790  28.648  127.454 1.00 117.32 ? 107  LYS B C     1 
ATOM   2566  O  O     . LYS B  1  107  ? -1.740  27.457  127.770 1.00 110.23 ? 107  LYS B O     1 
ATOM   2567  C  CB    . LYS B  1  107  ? -2.673  30.080  129.310 1.00 119.80 ? 107  LYS B CB    1 
ATOM   2568  C  CG    . LYS B  1  107  ? -1.356  30.834  129.442 1.00 109.48 ? 107  LYS B CG    1 
ATOM   2569  C  CD    . LYS B  1  107  ? -1.184  31.421  130.833 1.00 108.21 ? 107  LYS B CD    1 
ATOM   2570  C  CE    . LYS B  1  107  ? 0.184   32.060  130.997 1.00 95.36  ? 107  LYS B CE    1 
ATOM   2571  N  NZ    . LYS B  1  107  ? 0.334   32.704  132.329 1.00 101.69 ? 107  LYS B NZ    1 
ATOM   2572  N  N     . GLU B  1  108  ? -0.856  29.250  126.712 1.00 120.15 ? 108  GLU B N     1 
ATOM   2573  C  CA    . GLU B  1  108  ? 0.360   28.579  126.258 1.00 115.35 ? 108  GLU B CA    1 
ATOM   2574  C  C     . GLU B  1  108  ? 1.497   28.948  127.206 1.00 108.71 ? 108  GLU B C     1 
ATOM   2575  O  O     . GLU B  1  108  ? 1.964   30.093  127.210 1.00 103.69 ? 108  GLU B O     1 
ATOM   2576  C  CB    . GLU B  1  108  ? 0.698   28.972  124.821 1.00 110.85 ? 108  GLU B CB    1 
ATOM   2577  C  CG    . GLU B  1  108  ? -0.316  28.509  123.790 1.00 113.07 ? 108  GLU B CG    1 
ATOM   2578  C  CD    . GLU B  1  108  ? 0.090   28.871  122.374 1.00 121.30 ? 108  GLU B CD    1 
ATOM   2579  O  OE1   . GLU B  1  108  ? 1.208   29.398  122.191 1.00 118.28 ? 108  GLU B OE1   1 
ATOM   2580  O  OE2   . GLU B  1  108  ? -0.709  28.628  121.445 1.00 123.59 ? 108  GLU B OE2   1 
ATOM   2581  N  N     . VAL B  1  109  ? 1.949   27.979  127.997 1.00 102.66 ? 109  VAL B N     1 
ATOM   2582  C  CA    . VAL B  1  109  ? 2.921   28.240  129.051 1.00 101.34 ? 109  VAL B CA    1 
ATOM   2583  C  C     . VAL B  1  109  ? 4.306   28.402  128.435 1.00 99.82  ? 109  VAL B C     1 
ATOM   2584  O  O     . VAL B  1  109  ? 4.788   27.518  127.718 1.00 95.19  ? 109  VAL B O     1 
ATOM   2585  C  CB    . VAL B  1  109  ? 2.912   27.117  130.095 1.00 103.43 ? 109  VAL B CB    1 
ATOM   2586  C  CG1   . VAL B  1  109  ? 3.934   27.397  131.179 1.00 102.36 ? 109  VAL B CG1   1 
ATOM   2587  C  CG2   . VAL B  1  109  ? 1.521   26.960  130.695 1.00 113.47 ? 109  VAL B CG2   1 
ATOM   2588  N  N     . LYS B  1  110  ? 4.947   29.531  128.716 1.00 100.72 ? 110  LYS B N     1 
ATOM   2589  C  CA    . LYS B  1  110  ? 6.326   29.772  128.327 1.00 95.85  ? 110  LYS B CA    1 
ATOM   2590  C  C     . LYS B  1  110  ? 7.232   29.602  129.544 1.00 95.99  ? 110  LYS B C     1 
ATOM   2591  O  O     . LYS B  1  110  ? 6.779   29.326  130.657 1.00 95.04  ? 110  LYS B O     1 
ATOM   2592  C  CB    . LYS B  1  110  ? 6.473   31.163  127.709 1.00 95.73  ? 110  LYS B CB    1 
ATOM   2593  C  CG    . LYS B  1  110  ? 5.584   31.393  126.500 1.00 94.46  ? 110  LYS B CG    1 
ATOM   2594  C  CD    . LYS B  1  110  ? 5.906   30.405  125.391 1.00 101.42 ? 110  LYS B CD    1 
ATOM   2595  C  CE    . LYS B  1  110  ? 5.043   30.641  124.162 1.00 102.85 ? 110  LYS B CE    1 
ATOM   2596  N  NZ    . LYS B  1  110  ? 5.414   29.735  123.038 1.00 88.43  ? 110  LYS B NZ    1 
ATOM   2597  N  N     . ALA B  1  111  ? 8.539   29.760  129.325 1.00 95.33  ? 111  ALA B N     1 
ATOM   2598  C  CA    . ALA B  1  111  ? 9.485   29.628  130.427 1.00 98.82  ? 111  ALA B CA    1 
ATOM   2599  C  C     . ALA B  1  111  ? 9.411   30.800  131.394 1.00 109.31 ? 111  ALA B C     1 
ATOM   2600  O  O     . ALA B  1  111  ? 9.872   30.676  132.534 1.00 114.88 ? 111  ALA B O     1 
ATOM   2601  C  CB    . ALA B  1  111  ? 10.910  29.483  129.892 1.00 97.73  ? 111  ALA B CB    1 
ATOM   2602  N  N     . ARG B  1  112  ? 8.841   31.931  130.970 1.00 110.98 ? 112  ARG B N     1 
ATOM   2603  C  CA    . ARG B  1  112  ? 8.673   33.064  131.872 1.00 108.70 ? 112  ARG B CA    1 
ATOM   2604  C  C     . ARG B  1  112  ? 7.660   32.780  132.973 1.00 102.67 ? 112  ARG B C     1 
ATOM   2605  O  O     . ARG B  1  112  ? 7.755   33.372  134.053 1.00 99.24  ? 112  ARG B O     1 
ATOM   2606  C  CB    . ARG B  1  112  ? 8.245   34.304  131.086 1.00 107.78 ? 112  ARG B CB    1 
ATOM   2607  C  CG    . ARG B  1  112  ? 6.945   34.126  130.309 1.00 101.76 ? 112  ARG B CG    1 
ATOM   2608  C  CD    . ARG B  1  112  ? 6.612   35.362  129.489 1.00 104.62 ? 112  ARG B CD    1 
ATOM   2609  N  NE    . ARG B  1  112  ? 7.743   36.284  129.409 1.00 112.07 ? 112  ARG B NE    1 
ATOM   2610  C  CZ    . ARG B  1  112  ? 8.609   36.332  128.400 1.00 102.21 ? 112  ARG B CZ    1 
ATOM   2611  N  NH1   . ARG B  1  112  ? 8.481   35.509  127.369 1.00 101.08 ? 112  ARG B NH1   1 
ATOM   2612  N  NH2   . ARG B  1  112  ? 9.605   37.207  128.425 1.00 94.10  ? 112  ARG B NH2   1 
ATOM   2613  N  N     . ASP B  1  113  ? 6.706   31.878  132.732 1.00 100.42 ? 113  ASP B N     1 
ATOM   2614  C  CA    . ASP B  1  113  ? 5.676   31.574  133.716 1.00 101.85 ? 113  ASP B CA    1 
ATOM   2615  C  C     . ASP B  1  113  ? 6.213   30.833  134.933 1.00 101.11 ? 113  ASP B C     1 
ATOM   2616  O  O     . ASP B  1  113  ? 5.449   30.598  135.875 1.00 102.11 ? 113  ASP B O     1 
ATOM   2617  C  CB    . ASP B  1  113  ? 4.555   30.762  133.066 1.00 104.70 ? 113  ASP B CB    1 
ATOM   2618  C  CG    . ASP B  1  113  ? 3.914   31.487  131.900 1.00 109.13 ? 113  ASP B CG    1 
ATOM   2619  O  OD1   . ASP B  1  113  ? 3.996   32.733  131.859 1.00 113.73 ? 113  ASP B OD1   1 
ATOM   2620  O  OD2   . ASP B  1  113  ? 3.329   30.813  131.026 1.00 107.56 ? 113  ASP B OD2   1 
ATOM   2621  N  N     . PHE B  1  114  ? 7.488   30.452  134.940 1.00 102.40 ? 114  PHE B N     1 
ATOM   2622  C  CA    . PHE B  1  114  ? 8.090   29.915  136.151 1.00 107.41 ? 114  PHE B CA    1 
ATOM   2623  C  C     . PHE B  1  114  ? 8.224   31.015  137.195 1.00 105.76 ? 114  PHE B C     1 
ATOM   2624  O  O     . PHE B  1  114  ? 8.636   32.138  136.884 1.00 105.90 ? 114  PHE B O     1 
ATOM   2625  C  CB    . PHE B  1  114  ? 9.461   29.306  135.850 1.00 103.12 ? 114  PHE B CB    1 
ATOM   2626  C  CG    . PHE B  1  114  ? 9.399   27.916  135.285 1.00 101.51 ? 114  PHE B CG    1 
ATOM   2627  C  CD1   . PHE B  1  114  ? 9.051   26.842  136.091 1.00 99.10  ? 114  PHE B CD1   1 
ATOM   2628  C  CD2   . PHE B  1  114  ? 9.697   27.679  133.955 1.00 99.86  ? 114  PHE B CD2   1 
ATOM   2629  C  CE1   . PHE B  1  114  ? 8.992   25.560  135.579 1.00 90.75  ? 114  PHE B CE1   1 
ATOM   2630  C  CE2   . PHE B  1  114  ? 9.640   26.399  133.438 1.00 105.37 ? 114  PHE B CE2   1 
ATOM   2631  C  CZ    . PHE B  1  114  ? 9.287   25.338  134.253 1.00 101.00 ? 114  PHE B CZ    1 
ATOM   2632  N  N     . LEU B  1  115  ? 7.870   30.693  138.433 1.00 96.59  ? 115  LEU B N     1 
ATOM   2633  C  CA    . LEU B  1  115  ? 7.943   31.671  139.508 1.00 93.75  ? 115  LEU B CA    1 
ATOM   2634  C  C     . LEU B  1  115  ? 9.396   32.067  139.742 1.00 91.14  ? 115  LEU B C     1 
ATOM   2635  O  O     . LEU B  1  115  ? 10.224  31.198  140.056 1.00 89.67  ? 115  LEU B O     1 
ATOM   2636  C  CB    . LEU B  1  115  ? 7.322   31.112  140.784 1.00 91.93  ? 115  LEU B CB    1 
ATOM   2637  C  CG    . LEU B  1  115  ? 5.802   30.966  140.700 1.00 84.48  ? 115  LEU B CG    1 
ATOM   2638  C  CD1   . LEU B  1  115  ? 5.236   30.481  142.019 1.00 83.45  ? 115  LEU B CD1   1 
ATOM   2639  C  CD2   . LEU B  1  115  ? 5.165   32.285  140.284 1.00 79.74  ? 115  LEU B CD2   1 
ATOM   2640  N  N     . PRO B  1  116  ? 9.750   33.344  139.589 1.00 86.73  ? 116  PRO B N     1 
ATOM   2641  C  CA    . PRO B  1  116  ? 11.167  33.732  139.605 1.00 82.45  ? 116  PRO B CA    1 
ATOM   2642  C  C     . PRO B  1  116  ? 11.843  33.402  140.927 1.00 81.01  ? 116  PRO B C     1 
ATOM   2643  O  O     . PRO B  1  116  ? 11.220  33.400  141.991 1.00 89.32  ? 116  PRO B O     1 
ATOM   2644  C  CB    . PRO B  1  116  ? 11.124  35.246  139.360 1.00 77.85  ? 116  PRO B CB    1 
ATOM   2645  C  CG    . PRO B  1  116  ? 9.810   35.487  138.687 1.00 87.49  ? 116  PRO B CG    1 
ATOM   2646  C  CD    . PRO B  1  116  ? 8.865   34.478  139.271 1.00 86.28  ? 116  PRO B CD    1 
ATOM   2647  N  N     . VAL B  1  117  ? 13.139  33.101  140.841 1.00 81.07  ? 117  VAL B N     1 
ATOM   2648  C  CA    . VAL B  1  117  ? 13.967  32.773  141.994 1.00 81.08  ? 117  VAL B CA    1 
ATOM   2649  C  C     . VAL B  1  117  ? 15.181  33.692  141.981 1.00 81.25  ? 117  VAL B C     1 
ATOM   2650  O  O     . VAL B  1  117  ? 15.689  34.065  140.919 1.00 83.52  ? 117  VAL B O     1 
ATOM   2651  C  CB    . VAL B  1  117  ? 14.395  31.286  141.996 1.00 78.63  ? 117  VAL B CB    1 
ATOM   2652  C  CG1   . VAL B  1  117  ? 15.171  30.941  143.259 1.00 75.81  ? 117  VAL B CG1   1 
ATOM   2653  C  CG2   . VAL B  1  117  ? 13.176  30.383  141.853 1.00 78.99  ? 117  VAL B CG2   1 
ATOM   2654  N  N     . ALA B  1  118  ? 15.636  34.070  143.174 1.00 89.35  ? 118  ALA B N     1 
ATOM   2655  C  CA    . ALA B  1  118  ? 16.763  34.982  143.294 1.00 98.27  ? 118  ALA B CA    1 
ATOM   2656  C  C     . ALA B  1  118  ? 18.043  34.332  142.781 1.00 93.78  ? 118  ALA B C     1 
ATOM   2657  O  O     . ALA B  1  118  ? 18.312  33.157  143.046 1.00 91.77  ? 118  ALA B O     1 
ATOM   2658  C  CB    . ALA B  1  118  ? 16.937  35.418  144.748 1.00 102.71 ? 118  ALA B CB    1 
ATOM   2659  N  N     . ASP B  1  119  ? 18.828  35.112  142.031 1.00 94.77  ? 119  ASP B N     1 
ATOM   2660  C  CA    . ASP B  1  119  ? 20.108  34.670  141.468 1.00 106.89 ? 119  ASP B CA    1 
ATOM   2661  C  C     . ASP B  1  119  ? 19.940  33.485  140.516 1.00 100.21 ? 119  ASP B C     1 
ATOM   2662  O  O     . ASP B  1  119  ? 20.851  32.667  140.354 1.00 93.07  ? 119  ASP B O     1 
ATOM   2663  C  CB    . ASP B  1  119  ? 21.117  34.338  142.573 1.00 110.61 ? 119  ASP B CB    1 
ATOM   2664  C  CG    . ASP B  1  119  ? 21.498  35.555  143.399 1.00 111.45 ? 119  ASP B CG    1 
ATOM   2665  O  OD1   . ASP B  1  119  ? 20.874  36.621  143.209 1.00 108.33 ? 119  ASP B OD1   1 
ATOM   2666  O  OD2   . ASP B  1  119  ? 22.423  35.449  144.233 1.00 115.01 ? 119  ASP B OD2   1 
ATOM   2667  N  N     . VAL B  1  120  ? 18.778  33.395  139.873 1.00 98.16  ? 120  VAL B N     1 
ATOM   2668  C  CA    . VAL B  1  120  ? 18.464  32.341  138.912 1.00 92.98  ? 120  VAL B CA    1 
ATOM   2669  C  C     . VAL B  1  120  ? 17.906  33.023  137.670 1.00 96.87  ? 120  VAL B C     1 
ATOM   2670  O  O     . VAL B  1  120  ? 16.820  33.616  137.721 1.00 93.95  ? 120  VAL B O     1 
ATOM   2671  C  CB    . VAL B  1  120  ? 17.461  31.322  139.472 1.00 88.05  ? 120  VAL B CB    1 
ATOM   2672  C  CG1   . VAL B  1  120  ? 16.965  30.397  138.373 1.00 89.34  ? 120  VAL B CG1   1 
ATOM   2673  C  CG2   . VAL B  1  120  ? 18.089  30.523  140.603 1.00 86.30  ? 120  VAL B CG2   1 
ATOM   2674  N  N     . GLU B  1  121  ? 18.635  32.937  136.559 1.00 97.26  ? 121  GLU B N     1 
ATOM   2675  C  CA    . GLU B  1  121  ? 18.275  33.609  135.320 1.00 96.25  ? 121  GLU B CA    1 
ATOM   2676  C  C     . GLU B  1  121  ? 17.805  32.580  134.301 1.00 93.58  ? 121  GLU B C     1 
ATOM   2677  O  O     . GLU B  1  121  ? 18.447  31.539  134.121 1.00 94.96  ? 121  GLU B O     1 
ATOM   2678  C  CB    . GLU B  1  121  ? 19.466  34.402  134.775 1.00 92.46  ? 121  GLU B CB    1 
ATOM   2679  C  CG    . GLU B  1  121  ? 19.195  35.142  133.479 1.00 92.41  ? 121  GLU B CG    1 
ATOM   2680  C  CD    . GLU B  1  121  ? 20.414  35.892  132.975 1.00 97.60  ? 121  GLU B CD    1 
ATOM   2681  O  OE1   . GLU B  1  121  ? 20.290  36.614  131.963 1.00 98.05  ? 121  GLU B OE1   1 
ATOM   2682  O  OE2   . GLU B  1  121  ? 21.495  35.761  133.591 1.00 91.96  ? 121  GLU B OE2   1 
ATOM   2683  N  N     . ILE B  1  122  ? 16.679  32.858  133.655 1.00 85.28  ? 122  ILE B N     1 
ATOM   2684  C  CA    . ILE B  1  122  ? 16.169  32.015  132.581 1.00 83.79  ? 122  ILE B CA    1 
ATOM   2685  C  C     . ILE B  1  122  ? 16.622  32.630  131.265 1.00 91.63  ? 122  ILE B C     1 
ATOM   2686  O  O     . ILE B  1  122  ? 16.145  33.700  130.871 1.00 91.17  ? 122  ILE B O     1 
ATOM   2687  C  CB    . ILE B  1  122  ? 14.645  31.871  132.646 1.00 84.32  ? 122  ILE B CB    1 
ATOM   2688  C  CG1   . ILE B  1  122  ? 14.260  31.026  133.860 1.00 87.42  ? 122  ILE B CG1   1 
ATOM   2689  C  CG2   . ILE B  1  122  ? 14.117  31.237  131.370 1.00 88.91  ? 122  ILE B CG2   1 
ATOM   2690  C  CD1   . ILE B  1  122  ? 12.775  30.771  133.981 1.00 94.83  ? 122  ILE B CD1   1 
ATOM   2691  N  N     . MET B  1  123  ? 17.547  31.947  130.585 1.00 94.46  ? 123  MET B N     1 
ATOM   2692  C  CA    . MET B  1  123  ? 18.123  32.477  129.354 1.00 83.01  ? 123  MET B CA    1 
ATOM   2693  C  C     . MET B  1  123  ? 17.118  32.478  128.211 1.00 80.31  ? 123  MET B C     1 
ATOM   2694  O  O     . MET B  1  123  ? 17.141  33.383  127.369 1.00 73.69  ? 123  MET B O     1 
ATOM   2695  C  CB    . MET B  1  123  ? 19.355  31.664  128.962 1.00 78.99  ? 123  MET B CB    1 
ATOM   2696  C  CG    . MET B  1  123  ? 20.399  31.551  130.052 1.00 84.54  ? 123  MET B CG    1 
ATOM   2697  S  SD    . MET B  1  123  ? 21.205  33.120  130.401 1.00 101.56 ? 123  MET B SD    1 
ATOM   2698  C  CE    . MET B  1  123  ? 21.917  33.501  128.805 1.00 90.05  ? 123  MET B CE    1 
ATOM   2699  N  N     . ASN B  1  124  ? 16.236  31.481  128.159 1.00 82.78  ? 124  ASN B N     1 
ATOM   2700  C  CA    . ASN B  1  124  ? 15.269  31.321  127.076 1.00 85.15  ? 124  ASN B CA    1 
ATOM   2701  C  C     . ASN B  1  124  ? 13.855  31.393  127.643 1.00 94.71  ? 124  ASN B C     1 
ATOM   2702  O  O     . ASN B  1  124  ? 13.159  30.372  127.734 1.00 93.67  ? 124  ASN B O     1 
ATOM   2703  C  CB    . ASN B  1  124  ? 15.492  30.001  126.339 1.00 85.26  ? 124  ASN B CB    1 
ATOM   2704  C  CG    . ASN B  1  124  ? 15.798  28.851  127.283 1.00 78.66  ? 124  ASN B CG    1 
ATOM   2705  O  OD1   . ASN B  1  124  ? 16.410  29.043  128.331 1.00 81.70  ? 124  ASN B OD1   1 
ATOM   2706  N  ND2   . ASN B  1  124  ? 15.374  27.648  126.913 1.00 72.78  ? 124  ASN B ND2   1 
ATOM   2707  N  N     . PRO B  1  125  ? 13.391  32.590  128.020 1.00 98.12  ? 125  PRO B N     1 
ATOM   2708  C  CA    . PRO B  1  125  ? 12.064  32.694  128.645 1.00 97.93  ? 125  PRO B CA    1 
ATOM   2709  C  C     . PRO B  1  125  ? 10.913  32.471  127.678 1.00 100.78 ? 125  PRO B C     1 
ATOM   2710  O  O     . PRO B  1  125  ? 9.796   32.189  128.131 1.00 99.42  ? 125  PRO B O     1 
ATOM   2711  C  CB    . PRO B  1  125  ? 12.056  34.121  129.205 1.00 102.37 ? 125  PRO B CB    1 
ATOM   2712  C  CG    . PRO B  1  125  ? 12.947  34.873  128.278 1.00 97.46  ? 125  PRO B CG    1 
ATOM   2713  C  CD    . PRO B  1  125  ? 14.031  33.909  127.864 1.00 95.12  ? 125  PRO B CD    1 
ATOM   2714  N  N     . ASP B  1  126  ? 11.146  32.578  126.369 1.00 101.12 ? 126  ASP B N     1 
ATOM   2715  C  CA    . ASP B  1  126  ? 10.102  32.362  125.375 1.00 102.68 ? 126  ASP B CA    1 
ATOM   2716  C  C     . ASP B  1  126  ? 9.919   30.893  125.019 1.00 98.58  ? 126  ASP B C     1 
ATOM   2717  O  O     . ASP B  1  126  ? 9.072   30.579  124.172 1.00 91.09  ? 126  ASP B O     1 
ATOM   2718  C  CB    . ASP B  1  126  ? 10.408  33.160  124.105 1.00 108.58 ? 126  ASP B CB    1 
ATOM   2719  C  CG    . ASP B  1  126  ? 10.687  34.621  124.391 1.00 117.44 ? 126  ASP B CG    1 
ATOM   2720  O  OD1   . ASP B  1  126  ? 11.822  34.939  124.811 1.00 114.81 ? 126  ASP B OD1   1 
ATOM   2721  O  OD2   . ASP B  1  126  ? 9.772   35.450  124.197 1.00 124.30 ? 126  ASP B OD2   1 
ATOM   2722  N  N     . LEU B  1  127  ? 10.686  29.998  125.641 1.00 95.69  ? 127  LEU B N     1 
ATOM   2723  C  CA    . LEU B  1  127  ? 10.585  28.574  125.348 1.00 93.12  ? 127  LEU B CA    1 
ATOM   2724  C  C     . LEU B  1  127  ? 9.212   28.041  125.734 1.00 88.12  ? 127  LEU B C     1 
ATOM   2725  O  O     . LEU B  1  127  ? 8.756   28.218  126.867 1.00 93.45  ? 127  LEU B O     1 
ATOM   2726  C  CB    . LEU B  1  127  ? 11.684  27.805  126.087 1.00 85.77  ? 127  LEU B CB    1 
ATOM   2727  C  CG    . LEU B  1  127  ? 11.594  26.275  126.098 1.00 86.57  ? 127  LEU B CG    1 
ATOM   2728  C  CD1   . LEU B  1  127  ? 11.564  25.713  124.682 1.00 92.53  ? 127  LEU B CD1   1 
ATOM   2729  C  CD2   . LEU B  1  127  ? 12.744  25.667  126.895 1.00 76.93  ? 127  LEU B CD2   1 
ATOM   2730  N  N     . HIS B  1  128  ? 8.556   27.387  124.783 1.00 82.36  ? 128  HIS B N     1 
ATOM   2731  C  CA    . HIS B  1  128  ? 7.241   26.812  125.015 1.00 84.45  ? 128  HIS B CA    1 
ATOM   2732  C  C     . HIS B  1  128  ? 7.348   25.547  125.858 1.00 87.35  ? 128  HIS B C     1 
ATOM   2733  O  O     . HIS B  1  128  ? 8.263   24.740  125.674 1.00 90.90  ? 128  HIS B O     1 
ATOM   2734  C  CB    . HIS B  1  128  ? 6.570   26.497  123.680 1.00 88.72  ? 128  HIS B CB    1 
ATOM   2735  C  CG    . HIS B  1  128  ? 5.244   25.822  123.818 1.00 88.55  ? 128  HIS B CG    1 
ATOM   2736  N  ND1   . HIS B  1  128  ? 4.115   26.489  124.236 1.00 97.90  ? 128  HIS B ND1   1 
ATOM   2737  C  CD2   . HIS B  1  128  ? 4.867   24.540  123.599 1.00 91.19  ? 128  HIS B CD2   1 
ATOM   2738  C  CE1   . HIS B  1  128  ? 3.098   25.648  124.269 1.00 102.51 ? 128  HIS B CE1   1 
ATOM   2739  N  NE2   . HIS B  1  128  ? 3.526   24.459  123.885 1.00 93.91  ? 128  HIS B NE2   1 
ATOM   2740  N  N     . ILE B  1  129  ? 6.408   25.377  126.789 1.00 90.42  ? 129  ILE B N     1 
ATOM   2741  C  CA    . ILE B  1  129  ? 6.321   24.172  127.616 1.00 88.87  ? 129  ILE B CA    1 
ATOM   2742  C  C     . ILE B  1  129  ? 5.097   23.337  127.249 1.00 95.18  ? 129  ILE B C     1 
ATOM   2743  O  O     . ILE B  1  129  ? 5.225   22.181  126.841 1.00 100.72 ? 129  ILE B O     1 
ATOM   2744  C  CB    . ILE B  1  129  ? 6.335   24.514  129.123 1.00 84.12  ? 129  ILE B CB    1 
ATOM   2745  C  CG1   . ILE B  1  129  ? 7.744   24.890  129.585 1.00 82.34  ? 129  ILE B CG1   1 
ATOM   2746  C  CG2   . ILE B  1  129  ? 5.844   23.330  129.940 1.00 85.89  ? 129  ILE B CG2   1 
ATOM   2747  C  CD1   . ILE B  1  129  ? 8.083   26.345  129.422 1.00 85.31  ? 129  ILE B CD1   1 
ATOM   2748  N  N     . ALA B  1  130  ? 3.900   23.905  127.385 1.00 98.77  ? 130  ALA B N     1 
ATOM   2749  C  CA    . ALA B  1  130  ? 2.690   23.146  127.101 1.00 99.02  ? 130  ALA B CA    1 
ATOM   2750  C  C     . ALA B  1  130  ? 1.541   24.095  126.785 1.00 103.34 ? 130  ALA B C     1 
ATOM   2751  O  O     . ALA B  1  130  ? 1.453   25.195  127.337 1.00 101.44 ? 130  ALA B O     1 
ATOM   2752  C  CB    . ALA B  1  130  ? 2.316   22.234  128.275 1.00 89.14  ? 130  ALA B CB    1 
ATOM   2753  N  N     . THR B  1  131  ? 0.662   23.646  125.891 1.00 108.18 ? 131  THR B N     1 
ATOM   2754  C  CA    . THR B  1  131  ? -0.572  24.354  125.575 1.00 108.68 ? 131  THR B CA    1 
ATOM   2755  C  C     . THR B  1  131  ? -1.688  23.811  126.461 1.00 111.43 ? 131  THR B C     1 
ATOM   2756  O  O     . THR B  1  131  ? -1.972  22.607  126.438 1.00 103.05 ? 131  THR B O     1 
ATOM   2757  C  CB    . THR B  1  131  ? -0.943  24.186  124.100 1.00 115.50 ? 131  THR B CB    1 
ATOM   2758  O  OG1   . THR B  1  131  ? -1.100  22.793  123.802 1.00 121.13 ? 131  THR B OG1   1 
ATOM   2759  C  CG2   . THR B  1  131  ? 0.128   24.770  123.192 1.00 112.68 ? 131  THR B CG2   1 
ATOM   2760  N  N     . LEU B  1  132  ? -2.320  24.690  127.236 1.00 117.56 ? 132  LEU B N     1 
ATOM   2761  C  CA    . LEU B  1  132  ? -3.416  24.325  128.118 1.00 114.22 ? 132  LEU B CA    1 
ATOM   2762  C  C     . LEU B  1  132  ? -4.729  24.848  127.554 1.00 114.34 ? 132  LEU B C     1 
ATOM   2763  O  O     . LEU B  1  132  ? -4.816  26.002  127.118 1.00 111.91 ? 132  LEU B O     1 
ATOM   2764  C  CB    . LEU B  1  132  ? -3.194  24.884  129.524 1.00 113.53 ? 132  LEU B CB    1 
ATOM   2765  C  CG    . LEU B  1  132  ? -2.423  24.009  130.514 1.00 110.06 ? 132  LEU B CG    1 
ATOM   2766  C  CD1   . LEU B  1  132  ? -1.006  23.736  130.040 1.00 111.14 ? 132  LEU B CD1   1 
ATOM   2767  C  CD2   . LEU B  1  132  ? -2.411  24.666  131.881 1.00 117.77 ? 132  LEU B CD2   1 
ATOM   2768  N  N     . GLU B  1  133  ? -5.748  23.996  127.583 1.00 118.05 ? 133  GLU B N     1 
ATOM   2769  C  CA    . GLU B  1  133  ? -7.047  24.280  127.000 1.00 127.57 ? 133  GLU B CA    1 
ATOM   2770  C  C     . GLU B  1  133  ? -8.006  24.805  128.069 1.00 132.43 ? 133  GLU B C     1 
ATOM   2771  O  O     . GLU B  1  133  ? -7.626  25.060  129.217 1.00 128.62 ? 133  GLU B O     1 
ATOM   2772  C  CB    . GLU B  1  133  ? -7.608  23.021  126.336 1.00 124.45 ? 133  GLU B CB    1 
ATOM   2773  C  CG    . GLU B  1  133  ? -6.590  22.180  125.590 1.00 117.72 ? 133  GLU B CG    1 
ATOM   2774  C  CD    . GLU B  1  133  ? -7.167  20.849  125.148 1.00 121.70 ? 133  GLU B CD    1 
ATOM   2775  O  OE1   . GLU B  1  133  ? -8.381  20.639  125.353 1.00 124.94 ? 133  GLU B OE1   1 
ATOM   2776  O  OE2   . GLU B  1  133  ? -6.414  20.014  124.604 1.00 121.93 ? 133  GLU B OE2   1 
ATOM   2777  N  N     . GLU B  1  134  ? -9.270  24.970  127.688 1.00 132.35 ? 134  GLU B N     1 
ATOM   2778  C  CA    . GLU B  1  134  ? -10.312 25.288  128.652 1.00 135.80 ? 134  GLU B CA    1 
ATOM   2779  C  C     . GLU B  1  134  ? -10.466 24.142  129.642 1.00 132.78 ? 134  GLU B C     1 
ATOM   2780  O  O     . GLU B  1  134  ? -10.741 23.004  129.248 1.00 127.20 ? 134  GLU B O     1 
ATOM   2781  C  CB    . GLU B  1  134  ? -11.631 25.550  127.929 1.00 147.13 ? 134  GLU B CB    1 
ATOM   2782  C  CG    . GLU B  1  134  ? -11.594 26.739  126.987 1.00 151.74 ? 134  GLU B CG    1 
ATOM   2783  C  CD    . GLU B  1  134  ? -11.656 28.067  127.717 1.00 155.95 ? 134  GLU B CD    1 
ATOM   2784  O  OE1   . GLU B  1  134  ? -11.552 29.116  127.047 1.00 152.69 ? 134  GLU B OE1   1 
ATOM   2785  O  OE2   . GLU B  1  134  ? -11.818 28.066  128.956 1.00 159.60 ? 134  GLU B OE2   1 
ATOM   2786  N  N     . GLY B  1  135  ? -10.284 24.440  130.925 1.00 128.00 ? 135  GLY B N     1 
ATOM   2787  C  CA    . GLY B  1  135  ? -10.339 23.421  131.949 1.00 124.05 ? 135  GLY B CA    1 
ATOM   2788  C  C     . GLY B  1  135  ? -9.052  22.655  132.163 1.00 120.31 ? 135  GLY B C     1 
ATOM   2789  O  O     . GLY B  1  135  ? -9.021  21.757  133.015 1.00 116.37 ? 135  GLY B O     1 
ATOM   2790  N  N     . GLY B  1  136  ? -7.994  22.967  131.418 1.00 124.33 ? 136  GLY B N     1 
ATOM   2791  C  CA    . GLY B  1  136  ? -6.713  22.315  131.637 1.00 121.04 ? 136  GLY B CA    1 
ATOM   2792  C  C     . GLY B  1  136  ? -5.958  22.961  132.789 1.00 112.06 ? 136  GLY B C     1 
ATOM   2793  O  O     . GLY B  1  136  ? -5.946  24.181  132.947 1.00 105.48 ? 136  GLY B O     1 
ATOM   2794  N  N     . ARG B  1  137  ? -5.319  22.118  133.598 1.00 106.87 ? 137  ARG B N     1 
ATOM   2795  C  CA    . ARG B  1  137  ? -4.646  22.551  134.818 1.00 112.56 ? 137  ARG B CA    1 
ATOM   2796  C  C     . ARG B  1  137  ? -3.262  21.925  134.871 1.00 105.67 ? 137  ARG B C     1 
ATOM   2797  O  O     . ARG B  1  137  ? -3.130  20.700  134.779 1.00 96.11  ? 137  ARG B O     1 
ATOM   2798  C  CB    . ARG B  1  137  ? -5.464  22.166  136.058 1.00 125.18 ? 137  ARG B CB    1 
ATOM   2799  C  CG    . ARG B  1  137  ? -6.834  22.836  136.139 1.00 127.05 ? 137  ARG B CG    1 
ATOM   2800  C  CD    . ARG B  1  137  ? -7.692  22.239  137.247 1.00 134.11 ? 137  ARG B CD    1 
ATOM   2801  N  NE    . ARG B  1  137  ? -6.993  22.224  138.529 1.00 141.65 ? 137  ARG B NE    1 
ATOM   2802  C  CZ    . ARG B  1  137  ? -6.989  23.235  139.391 1.00 138.95 ? 137  ARG B CZ    1 
ATOM   2803  N  NH1   . ARG B  1  137  ? -7.651  24.350  139.112 1.00 140.09 ? 137  ARG B NH1   1 
ATOM   2804  N  NH2   . ARG B  1  137  ? -6.322  23.132  140.533 1.00 131.41 ? 137  ARG B NH2   1 
ATOM   2805  N  N     . LEU B  1  138  ? -2.233  22.763  135.022 1.00 103.06 ? 138  LEU B N     1 
ATOM   2806  C  CA    . LEU B  1  138  ? -0.845  22.315  135.067 1.00 101.88 ? 138  LEU B CA    1 
ATOM   2807  C  C     . LEU B  1  138  ? -0.192  22.855  136.331 1.00 98.60  ? 138  LEU B C     1 
ATOM   2808  O  O     . LEU B  1  138  ? -0.037  24.071  136.484 1.00 98.53  ? 138  LEU B O     1 
ATOM   2809  C  CB    . LEU B  1  138  ? -0.079  22.782  133.827 1.00 107.80 ? 138  LEU B CB    1 
ATOM   2810  C  CG    . LEU B  1  138  ? 1.371   22.318  133.698 1.00 100.88 ? 138  LEU B CG    1 
ATOM   2811  C  CD1   . LEU B  1  138  ? 1.421   20.810  133.518 1.00 88.04  ? 138  LEU B CD1   1 
ATOM   2812  C  CD2   . LEU B  1  138  ? 2.048   23.031  132.542 1.00 91.91  ? 138  LEU B CD2   1 
ATOM   2813  N  N     . ASN B  1  139  ? 0.197   21.951  137.227 1.00 92.93  ? 139  ASN B N     1 
ATOM   2814  C  CA    . ASN B  1  139  ? 0.874   22.297  138.473 1.00 96.97  ? 139  ASN B CA    1 
ATOM   2815  C  C     . ASN B  1  139  ? 2.090   21.389  138.592 1.00 98.34  ? 139  ASN B C     1 
ATOM   2816  O  O     . ASN B  1  139  ? 1.943   20.168  138.723 1.00 98.99  ? 139  ASN B O     1 
ATOM   2817  C  CB    . ASN B  1  139  ? -0.070  22.132  139.669 1.00 102.64 ? 139  ASN B CB    1 
ATOM   2818  C  CG    . ASN B  1  139  ? 0.567   22.530  140.990 1.00 103.05 ? 139  ASN B CG    1 
ATOM   2819  O  OD1   . ASN B  1  139  ? 1.667   23.077  141.030 1.00 105.41 ? 139  ASN B OD1   1 
ATOM   2820  N  ND2   . ASN B  1  139  ? -0.136  22.259  142.085 1.00 97.65  ? 139  ASN B ND2   1 
ATOM   2821  N  N     . MET B  1  140  ? 3.289   21.972  138.538 1.00 93.08  ? 140  MET B N     1 
ATOM   2822  C  CA    . MET B  1  140  ? 4.496   21.160  138.498 1.00 89.09  ? 140  MET B CA    1 
ATOM   2823  C  C     . MET B  1  140  ? 5.658   21.866  139.185 1.00 83.28  ? 140  MET B C     1 
ATOM   2824  O  O     . MET B  1  140  ? 5.722   23.099  139.248 1.00 74.88  ? 140  MET B O     1 
ATOM   2825  C  CB    . MET B  1  140  ? 4.885   20.809  137.057 1.00 97.64  ? 140  MET B CB    1 
ATOM   2826  C  CG    . MET B  1  140  ? 5.127   22.018  136.166 1.00 103.22 ? 140  MET B CG    1 
ATOM   2827  S  SD    . MET B  1  140  ? 6.022   21.603  134.655 1.00 106.07 ? 140  MET B SD    1 
ATOM   2828  C  CE    . MET B  1  140  ? 4.981   20.303  133.999 1.00 102.96 ? 140  MET B CE    1 
ATOM   2829  N  N     . GLU B  1  141  ? 6.577   21.053  139.706 1.00 85.68  ? 141  GLU B N     1 
ATOM   2830  C  CA    . GLU B  1  141  ? 7.831   21.510  140.295 1.00 91.53  ? 141  GLU B CA    1 
ATOM   2831  C  C     . GLU B  1  141  ? 8.976   20.828  139.562 1.00 88.08  ? 141  GLU B C     1 
ATOM   2832  O  O     . GLU B  1  141  ? 9.029   19.594  139.503 1.00 85.69  ? 141  GLU B O     1 
ATOM   2833  C  CB    . GLU B  1  141  ? 7.904   21.185  141.789 1.00 98.92  ? 141  GLU B CB    1 
ATOM   2834  C  CG    . GLU B  1  141  ? 6.817   21.802  142.644 1.00 100.69 ? 141  GLU B CG    1 
ATOM   2835  C  CD    . GLU B  1  141  ? 6.965   21.433  144.107 1.00 108.57 ? 141  GLU B CD    1 
ATOM   2836  O  OE1   . GLU B  1  141  ? 7.897   20.669  144.439 1.00 105.71 ? 141  GLU B OE1   1 
ATOM   2837  O  OE2   . GLU B  1  141  ? 6.149   21.907  144.924 1.00 119.17 ? 141  GLU B OE2   1 
ATOM   2838  N  N     . VAL B  1  142  ? 9.893   21.625  139.020 1.00 88.57  ? 142  VAL B N     1 
ATOM   2839  C  CA    . VAL B  1  142  ? 11.047  21.119  138.287 1.00 82.62  ? 142  VAL B CA    1 
ATOM   2840  C  C     . VAL B  1  142  ? 12.298  21.353  139.125 1.00 80.90  ? 142  VAL B C     1 
ATOM   2841  O  O     . VAL B  1  142  ? 12.412  22.362  139.835 1.00 80.74  ? 142  VAL B O     1 
ATOM   2842  C  CB    . VAL B  1  142  ? 11.169  21.770  136.892 1.00 86.73  ? 142  VAL B CB    1 
ATOM   2843  C  CG1   . VAL B  1  142  ? 9.786   21.974  136.283 1.00 82.50  ? 142  VAL B CG1   1 
ATOM   2844  C  CG2   . VAL B  1  142  ? 11.942  23.082  136.948 1.00 87.61  ? 142  VAL B CG2   1 
ATOM   2845  N  N     . ARG B  1  143  ? 13.223  20.400  139.061 1.00 81.49  ? 143  ARG B N     1 
ATOM   2846  C  CA    . ARG B  1  143  ? 14.445  20.404  139.855 1.00 79.15  ? 143  ARG B CA    1 
ATOM   2847  C  C     . ARG B  1  143  ? 15.620  20.721  138.937 1.00 76.39  ? 143  ARG B C     1 
ATOM   2848  O  O     . ARG B  1  143  ? 15.814  20.045  137.923 1.00 77.42  ? 143  ARG B O     1 
ATOM   2849  C  CB    . ARG B  1  143  ? 14.631  19.050  140.540 1.00 75.50  ? 143  ARG B CB    1 
ATOM   2850  C  CG    . ARG B  1  143  ? 16.014  18.799  141.090 1.00 78.61  ? 143  ARG B CG    1 
ATOM   2851  C  CD    . ARG B  1  143  ? 16.189  19.407  142.463 1.00 82.33  ? 143  ARG B CD    1 
ATOM   2852  N  NE    . ARG B  1  143  ? 17.513  19.118  143.003 1.00 83.81  ? 143  ARG B NE    1 
ATOM   2853  C  CZ    . ARG B  1  143  ? 17.836  17.989  143.624 1.00 81.68  ? 143  ARG B CZ    1 
ATOM   2854  N  NH1   . ARG B  1  143  ? 16.927  17.036  143.786 1.00 76.79  ? 143  ARG B NH1   1 
ATOM   2855  N  NH2   . ARG B  1  143  ? 19.069  17.813  144.082 1.00 79.42  ? 143  ARG B NH2   1 
ATOM   2856  N  N     . VAL B  1  144  ? 16.397  21.744  139.285 1.00 70.37  ? 144  VAL B N     1 
ATOM   2857  C  CA    . VAL B  1  144  ? 17.492  22.229  138.451 1.00 71.21  ? 144  VAL B CA    1 
ATOM   2858  C  C     . VAL B  1  144  ? 18.780  22.135  139.257 1.00 76.17  ? 144  VAL B C     1 
ATOM   2859  O  O     . VAL B  1  144  ? 18.883  22.722  140.340 1.00 77.31  ? 144  VAL B O     1 
ATOM   2860  C  CB    . VAL B  1  144  ? 17.245  23.670  137.978 1.00 68.77  ? 144  VAL B CB    1 
ATOM   2861  C  CG1   . VAL B  1  144  ? 18.492  24.244  137.333 1.00 69.34  ? 144  VAL B CG1   1 
ATOM   2862  C  CG2   . VAL B  1  144  ? 16.070  23.713  137.014 1.00 72.48  ? 144  VAL B CG2   1 
ATOM   2863  N  N     . ASP B  1  145  ? 19.762  21.411  138.726 1.00 76.47  ? 145  ASP B N     1 
ATOM   2864  C  CA    . ASP B  1  145  ? 21.013  21.171  139.428 1.00 74.38  ? 145  ASP B CA    1 
ATOM   2865  C  C     . ASP B  1  145  ? 22.201  21.605  138.583 1.00 74.93  ? 145  ASP B C     1 
ATOM   2866  O  O     . ASP B  1  145  ? 22.117  21.725  137.357 1.00 81.00  ? 145  ASP B O     1 
ATOM   2867  C  CB    . ASP B  1  145  ? 21.169  19.691  139.804 1.00 78.31  ? 145  ASP B CB    1 
ATOM   2868  C  CG    . ASP B  1  145  ? 20.376  19.317  141.039 1.00 86.61  ? 145  ASP B CG    1 
ATOM   2869  O  OD1   . ASP B  1  145  ? 19.152  19.563  141.056 1.00 86.47  ? 145  ASP B OD1   1 
ATOM   2870  O  OD2   . ASP B  1  145  ? 20.978  18.773  141.990 1.00 90.11  ? 145  ASP B OD2   1 
ATOM   2871  N  N     . ARG B  1  146  ? 23.316  21.838  139.267 1.00 73.25  ? 146  ARG B N     1 
ATOM   2872  C  CA    . ARG B  1  146  ? 24.588  22.139  138.629 1.00 73.81  ? 146  ARG B CA    1 
ATOM   2873  C  C     . ARG B  1  146  ? 25.427  20.871  138.558 1.00 80.36  ? 146  ARG B C     1 
ATOM   2874  O  O     . ARG B  1  146  ? 25.654  20.212  139.579 1.00 81.40  ? 146  ARG B O     1 
ATOM   2875  C  CB    . ARG B  1  146  ? 25.337  23.228  139.397 1.00 73.13  ? 146  ARG B CB    1 
ATOM   2876  C  CG    . ARG B  1  146  ? 26.787  23.395  138.980 1.00 82.54  ? 146  ARG B CG    1 
ATOM   2877  C  CD    . ARG B  1  146  ? 27.471  24.440  139.837 1.00 89.13  ? 146  ARG B CD    1 
ATOM   2878  N  NE    . ARG B  1  146  ? 26.883  25.761  139.641 1.00 94.86  ? 146  ARG B NE    1 
ATOM   2879  C  CZ    . ARG B  1  146  ? 26.959  26.750  140.525 1.00 90.26  ? 146  ARG B CZ    1 
ATOM   2880  N  NH1   . ARG B  1  146  ? 27.588  26.562  141.677 1.00 89.07  ? 146  ARG B NH1   1 
ATOM   2881  N  NH2   . ARG B  1  146  ? 26.394  27.922  140.263 1.00 84.90  ? 146  ARG B NH2   1 
ATOM   2882  N  N     . GLY B  1  147  ? 25.885  20.537  137.357 1.00 79.96  ? 147  GLY B N     1 
ATOM   2883  C  CA    . GLY B  1  147  ? 26.680  19.348  137.155 1.00 76.41  ? 147  GLY B CA    1 
ATOM   2884  C  C     . GLY B  1  147  ? 27.506  19.437  135.890 1.00 74.78  ? 147  GLY B C     1 
ATOM   2885  O  O     . GLY B  1  147  ? 27.612  20.492  135.260 1.00 73.74  ? 147  GLY B O     1 
ATOM   2886  N  N     . VAL B  1  148  ? 28.089  18.301  135.517 1.00 77.30  ? 148  VAL B N     1 
ATOM   2887  C  CA    . VAL B  1  148  ? 28.982  18.221  134.367 1.00 74.69  ? 148  VAL B CA    1 
ATOM   2888  C  C     . VAL B  1  148  ? 28.586  17.034  133.501 1.00 75.91  ? 148  VAL B C     1 
ATOM   2889  O  O     . VAL B  1  148  ? 28.210  15.972  134.013 1.00 81.68  ? 148  VAL B O     1 
ATOM   2890  C  CB    . VAL B  1  148  ? 30.460  18.106  134.800 1.00 71.29  ? 148  VAL B CB    1 
ATOM   2891  C  CG1   . VAL B  1  148  ? 30.961  19.435  135.344 1.00 69.52  ? 148  VAL B CG1   1 
ATOM   2892  C  CG2   . VAL B  1  148  ? 30.631  17.003  135.840 1.00 75.87  ? 148  VAL B CG2   1 
ATOM   2893  N  N     . GLY B  1  149  ? 28.675  17.218  132.184 1.00 65.40  ? 149  GLY B N     1 
ATOM   2894  C  CA    . GLY B  1  149  ? 28.480  16.113  131.262 1.00 58.75  ? 149  GLY B CA    1 
ATOM   2895  C  C     . GLY B  1  149  ? 27.018  15.821  130.976 1.00 52.88  ? 149  GLY B C     1 
ATOM   2896  O  O     . GLY B  1  149  ? 26.176  16.717  130.899 1.00 57.56  ? 149  GLY B O     1 
ATOM   2897  N  N     . TYR B  1  150  ? 26.724  14.534  130.806 1.00 46.61  ? 150  TYR B N     1 
ATOM   2898  C  CA    . TYR B  1  150  ? 25.370  14.070  130.505 1.00 52.98  ? 150  TYR B CA    1 
ATOM   2899  C  C     . TYR B  1  150  ? 25.109  12.817  131.330 1.00 62.60  ? 150  TYR B C     1 
ATOM   2900  O  O     . TYR B  1  150  ? 25.762  11.788  131.124 1.00 62.74  ? 150  TYR B O     1 
ATOM   2901  C  CB    . TYR B  1  150  ? 25.203  13.780  129.014 1.00 51.53  ? 150  TYR B CB    1 
ATOM   2902  C  CG    . TYR B  1  150  ? 23.843  13.251  128.600 1.00 51.61  ? 150  TYR B CG    1 
ATOM   2903  C  CD1   . TYR B  1  150  ? 23.557  11.892  128.655 1.00 52.44  ? 150  TYR B CD1   1 
ATOM   2904  C  CD2   . TYR B  1  150  ? 22.858  14.109  128.129 1.00 54.82  ? 150  TYR B CD2   1 
ATOM   2905  C  CE1   . TYR B  1  150  ? 22.323  11.405  128.271 1.00 56.98  ? 150  TYR B CE1   1 
ATOM   2906  C  CE2   . TYR B  1  150  ? 21.617  13.629  127.740 1.00 56.97  ? 150  TYR B CE2   1 
ATOM   2907  C  CZ    . TYR B  1  150  ? 21.355  12.275  127.813 1.00 59.77  ? 150  TYR B CZ    1 
ATOM   2908  O  OH    . TYR B  1  150  ? 20.125  11.786  127.430 1.00 58.02  ? 150  TYR B OH    1 
ATOM   2909  N  N     . VAL B  1  151  ? 24.157  12.902  132.252 1.00 67.46  ? 151  VAL B N     1 
ATOM   2910  C  CA    . VAL B  1  151  ? 23.832  11.789  133.131 1.00 64.43  ? 151  VAL B CA    1 
ATOM   2911  C  C     . VAL B  1  151  ? 22.398  11.345  132.868 1.00 65.25  ? 151  VAL B C     1 
ATOM   2912  O  O     . VAL B  1  151  ? 21.456  12.114  133.122 1.00 60.04  ? 151  VAL B O     1 
ATOM   2913  C  CB    . VAL B  1  151  ? 24.036  12.170  134.605 1.00 60.10  ? 151  VAL B CB    1 
ATOM   2914  C  CG1   . VAL B  1  151  ? 23.814  10.963  135.504 1.00 67.08  ? 151  VAL B CG1   1 
ATOM   2915  C  CG2   . VAL B  1  151  ? 25.433  12.751  134.800 1.00 59.02  ? 151  VAL B CG2   1 
ATOM   2916  N  N     . PRO B  1  152  ? 22.183  10.128  132.353 1.00 68.75  ? 152  PRO B N     1 
ATOM   2917  C  CA    . PRO B  1  152  ? 20.816  9.671   132.077 1.00 68.13  ? 152  PRO B CA    1 
ATOM   2918  C  C     . PRO B  1  152  ? 19.982  9.647   133.346 1.00 71.77  ? 152  PRO B C     1 
ATOM   2919  O  O     . PRO B  1  152  ? 20.501  9.664   134.463 1.00 76.75  ? 152  PRO B O     1 
ATOM   2920  C  CB    . PRO B  1  152  ? 21.012  8.261   131.511 1.00 67.27  ? 152  PRO B CB    1 
ATOM   2921  C  CG    . PRO B  1  152  ? 22.427  8.223   131.054 1.00 63.77  ? 152  PRO B CG    1 
ATOM   2922  C  CD    . PRO B  1  152  ? 23.185  9.121   131.981 1.00 65.77  ? 152  PRO B CD    1 
ATOM   2923  N  N     . ALA B  1  153  ? 18.660  9.603   133.156 1.00 74.37  ? 153  ALA B N     1 
ATOM   2924  C  CA    . ALA B  1  153  ? 17.744  9.632   134.296 1.00 71.69  ? 153  ALA B CA    1 
ATOM   2925  C  C     . ALA B  1  153  ? 17.965  8.438   135.217 1.00 67.52  ? 153  ALA B C     1 
ATOM   2926  O  O     . ALA B  1  153  ? 17.989  8.586   136.443 1.00 63.18  ? 153  ALA B O     1 
ATOM   2927  C  CB    . ALA B  1  153  ? 16.301  9.672   133.800 1.00 75.15  ? 153  ALA B CB    1 
ATOM   2928  N  N     . GLU B  1  154  ? 18.141  7.249   134.641 1.00 69.42  ? 154  GLU B N     1 
ATOM   2929  C  CA    . GLU B  1  154  ? 18.306  6.034   135.426 1.00 68.02  ? 154  GLU B CA    1 
ATOM   2930  C  C     . GLU B  1  154  ? 19.628  5.981   136.183 1.00 70.97  ? 154  GLU B C     1 
ATOM   2931  O  O     . GLU B  1  154  ? 19.799  5.096   137.027 1.00 72.17  ? 154  GLU B O     1 
ATOM   2932  C  CB    . GLU B  1  154  ? 18.184  4.806   134.516 1.00 69.16  ? 154  GLU B CB    1 
ATOM   2933  C  CG    . GLU B  1  154  ? 16.839  4.672   133.795 1.00 78.16  ? 154  GLU B CG    1 
ATOM   2934  C  CD    . GLU B  1  154  ? 16.738  5.532   132.540 1.00 86.51  ? 154  GLU B CD    1 
ATOM   2935  O  OE1   . GLU B  1  154  ? 17.779  6.068   132.096 1.00 84.89  ? 154  GLU B OE1   1 
ATOM   2936  O  OE2   . GLU B  1  154  ? 15.617  5.669   131.997 1.00 76.92  ? 154  GLU B OE2   1 
ATOM   2937  N  N     . LYS B  1  155  ? 20.561  6.894   135.913 1.00 75.26  ? 155  LYS B N     1 
ATOM   2938  C  CA    . LYS B  1  155  ? 21.876  6.830   136.542 1.00 79.25  ? 155  LYS B CA    1 
ATOM   2939  C  C     . LYS B  1  155  ? 21.960  7.650   137.824 1.00 81.47  ? 155  LYS B C     1 
ATOM   2940  O  O     . LYS B  1  155  ? 22.604  7.220   138.786 1.00 89.57  ? 155  LYS B O     1 
ATOM   2941  C  CB    . LYS B  1  155  ? 22.956  7.279   135.555 1.00 77.75  ? 155  LYS B CB    1 
ATOM   2942  C  CG    . LYS B  1  155  ? 23.419  6.171   134.619 1.00 81.95  ? 155  LYS B CG    1 
ATOM   2943  C  CD    . LYS B  1  155  ? 24.072  5.035   135.400 1.00 90.65  ? 155  LYS B CD    1 
ATOM   2944  C  CE    . LYS B  1  155  ? 24.343  3.823   134.521 1.00 94.96  ? 155  LYS B CE    1 
ATOM   2945  N  NZ    . LYS B  1  155  ? 23.080  3.189   134.049 1.00 94.06  ? 155  LYS B NZ    1 
ATOM   2946  N  N     . HIS B  1  156  ? 21.334  8.826   137.863 1.00 79.18  ? 156  HIS B N     1 
ATOM   2947  C  CA    . HIS B  1  156  ? 21.311  9.603   139.098 1.00 80.28  ? 156  HIS B CA    1 
ATOM   2948  C  C     . HIS B  1  156  ? 20.136  9.216   139.992 1.00 83.84  ? 156  HIS B C     1 
ATOM   2949  O  O     . HIS B  1  156  ? 20.299  9.109   141.213 1.00 79.02  ? 156  HIS B O     1 
ATOM   2950  C  CB    . HIS B  1  156  ? 21.277  11.101  138.780 1.00 71.71  ? 156  HIS B CB    1 
ATOM   2951  C  CG    . HIS B  1  156  ? 20.032  11.547  138.079 1.00 68.99  ? 156  HIS B CG    1 
ATOM   2952  N  ND1   . HIS B  1  156  ? 18.859  11.820  138.749 1.00 77.46  ? 156  HIS B ND1   1 
ATOM   2953  C  CD2   . HIS B  1  156  ? 19.775  11.769  136.769 1.00 70.66  ? 156  HIS B CD2   1 
ATOM   2954  C  CE1   . HIS B  1  156  ? 17.934  12.189  137.882 1.00 74.42  ? 156  HIS B CE1   1 
ATOM   2955  N  NE2   . HIS B  1  156  ? 18.464  12.167  136.673 1.00 68.65  ? 156  HIS B NE2   1 
ATOM   2956  N  N     . GLY B  1  157  ? 18.961  8.998   139.404 1.00 83.09  ? 157  GLY B N     1 
ATOM   2957  C  CA    . GLY B  1  157  ? 17.804  8.486   140.130 1.00 84.34  ? 157  GLY B CA    1 
ATOM   2958  C  C     . GLY B  1  157  ? 17.390  9.282   141.349 1.00 95.22  ? 157  GLY B C     1 
ATOM   2959  O  O     . GLY B  1  157  ? 17.043  8.692   142.381 1.00 105.01 ? 157  GLY B O     1 
ATOM   2960  N  N     . ILE B  1  158  ? 17.405  10.610  141.256 1.00 88.32  ? 158  ILE B N     1 
ATOM   2961  C  CA    . ILE B  1  158  ? 17.084  11.456  142.399 1.00 94.96  ? 158  ILE B CA    1 
ATOM   2962  C  C     . ILE B  1  158  ? 15.590  11.755  142.404 1.00 92.32  ? 158  ILE B C     1 
ATOM   2963  O  O     . ILE B  1  158  ? 14.981  12.009  141.356 1.00 82.79  ? 158  ILE B O     1 
ATOM   2964  C  CB    . ILE B  1  158  ? 17.928  12.746  142.389 1.00 83.15  ? 158  ILE B CB    1 
ATOM   2965  C  CG1   . ILE B  1  158  ? 17.529  13.674  141.244 1.00 70.24  ? 158  ILE B CG1   1 
ATOM   2966  C  CG2   . ILE B  1  158  ? 19.411  12.405  142.292 1.00 76.51  ? 158  ILE B CG2   1 
ATOM   2967  C  CD1   . ILE B  1  158  ? 18.279  14.985  141.254 1.00 72.58  ? 158  ILE B CD1   1 
ATOM   2968  N  N     . LYS B  1  159  ? 14.990  11.695  143.593 1.00 94.56  ? 159  LYS B N     1 
ATOM   2969  C  CA    . LYS B  1  159  ? 13.560  11.929  143.765 1.00 92.78  ? 159  LYS B CA    1 
ATOM   2970  C  C     . LYS B  1  159  ? 13.349  12.837  144.965 1.00 86.76  ? 159  LYS B C     1 
ATOM   2971  O  O     . LYS B  1  159  ? 13.692  12.469  146.093 1.00 88.99  ? 159  LYS B O     1 
ATOM   2972  C  CB    . LYS B  1  159  ? 12.797  10.613  143.955 1.00 89.47  ? 159  LYS B CB    1 
ATOM   2973  C  CG    . LYS B  1  159  ? 12.906  9.655   142.781 1.00 102.22 ? 159  LYS B CG    1 
ATOM   2974  C  CD    . LYS B  1  159  ? 12.159  8.357   143.052 1.00 113.51 ? 159  LYS B CD    1 
ATOM   2975  C  CE    . LYS B  1  159  ? 10.716  8.435   142.576 1.00 113.92 ? 159  LYS B CE    1 
ATOM   2976  N  NZ    . LYS B  1  159  ? 10.636  8.570   141.091 1.00 106.79 ? 159  LYS B NZ    1 
ATOM   2977  N  N     . ASP B  1  160  ? 12.789  14.024  144.720 1.00 86.22  ? 160  ASP B N     1 
ATOM   2978  C  CA    . ASP B  1  160  ? 12.394  14.894  145.820 1.00 89.44  ? 160  ASP B CA    1 
ATOM   2979  C  C     . ASP B  1  160  ? 11.192  14.332  146.567 1.00 84.65  ? 160  ASP B C     1 
ATOM   2980  O  O     . ASP B  1  160  ? 11.079  14.510  147.785 1.00 84.78  ? 160  ASP B O     1 
ATOM   2981  C  CB    . ASP B  1  160  ? 12.074  16.294  145.295 1.00 96.47  ? 160  ASP B CB    1 
ATOM   2982  C  CG    . ASP B  1  160  ? 13.312  17.141  145.083 1.00 92.14  ? 160  ASP B CG    1 
ATOM   2983  O  OD1   . ASP B  1  160  ? 14.362  16.827  145.684 1.00 96.20  ? 160  ASP B OD1   1 
ATOM   2984  O  OD2   . ASP B  1  160  ? 13.226  18.132  144.326 1.00 80.14  ? 160  ASP B OD2   1 
ATOM   2985  N  N     . ARG B  1  161  ? 10.292  13.657  145.859 1.00 80.85  ? 161  ARG B N     1 
ATOM   2986  C  CA    . ARG B  1  161  ? 9.093   13.089  146.452 1.00 83.08  ? 161  ARG B CA    1 
ATOM   2987  C  C     . ARG B  1  161  ? 8.671   11.889  145.617 1.00 83.52  ? 161  ARG B C     1 
ATOM   2988  O  O     . ARG B  1  161  ? 9.352   11.500  144.665 1.00 93.31  ? 161  ARG B O     1 
ATOM   2989  C  CB    . ARG B  1  161  ? 7.976   14.131  146.538 1.00 91.98  ? 161  ARG B CB    1 
ATOM   2990  C  CG    . ARG B  1  161  ? 7.520   14.655  145.188 1.00 93.62  ? 161  ARG B CG    1 
ATOM   2991  C  CD    . ARG B  1  161  ? 6.372   15.641  145.334 1.00 99.48  ? 161  ARG B CD    1 
ATOM   2992  N  NE    . ARG B  1  161  ? 6.791   16.882  145.979 1.00 102.50 ? 161  ARG B NE    1 
ATOM   2993  C  CZ    . ARG B  1  161  ? 5.962   17.864  146.317 1.00 102.45 ? 161  ARG B CZ    1 
ATOM   2994  N  NH1   . ARG B  1  161  ? 4.663   17.750  146.074 1.00 98.43  ? 161  ARG B NH1   1 
ATOM   2995  N  NH2   . ARG B  1  161  ? 6.430   18.960  146.901 1.00 101.07 ? 161  ARG B NH2   1 
ATOM   2996  N  N     . ILE B  1  162  ? 7.539   11.293  145.981 1.00 86.05  ? 162  ILE B N     1 
ATOM   2997  C  CA    . ILE B  1  162  ? 6.979   10.227  145.163 1.00 93.08  ? 162  ILE B CA    1 
ATOM   2998  C  C     . ILE B  1  162  ? 6.235   10.837  143.980 1.00 98.55  ? 162  ILE B C     1 
ATOM   2999  O  O     . ILE B  1  162  ? 5.925   12.032  143.953 1.00 95.95  ? 162  ILE B O     1 
ATOM   3000  C  CB    . ILE B  1  162  ? 6.062   9.307   145.986 1.00 96.32  ? 162  ILE B CB    1 
ATOM   3001  C  CG1   . ILE B  1  162  ? 6.036   7.900   145.380 1.00 97.04  ? 162  ILE B CG1   1 
ATOM   3002  C  CG2   . ILE B  1  162  ? 4.658   9.874   146.025 1.00 90.51  ? 162  ILE B CG2   1 
ATOM   3003  C  CD1   . ILE B  1  162  ? 7.411   7.329   145.092 1.00 91.75  ? 162  ILE B CD1   1 
ATOM   3004  N  N     . ASN B  1  163  ? 5.953   9.999   142.984 1.00 100.18 ? 163  ASN B N     1 
ATOM   3005  C  CA    . ASN B  1  163  ? 5.395   10.413  141.701 1.00 98.69  ? 163  ASN B CA    1 
ATOM   3006  C  C     . ASN B  1  163  ? 6.283   11.420  140.982 1.00 101.41 ? 163  ASN B C     1 
ATOM   3007  O  O     . ASN B  1  163  ? 5.837   12.061  140.022 1.00 103.55 ? 163  ASN B O     1 
ATOM   3008  C  CB    . ASN B  1  163  ? 3.976   10.980  141.850 1.00 98.78  ? 163  ASN B CB    1 
ATOM   3009  C  CG    . ASN B  1  163  ? 2.935   9.898   142.065 1.00 101.13 ? 163  ASN B CG    1 
ATOM   3010  O  OD1   . ASN B  1  163  ? 3.136   8.743   141.691 1.00 94.88  ? 163  ASN B OD1   1 
ATOM   3011  N  ND2   . ASN B  1  163  ? 1.810   10.272  142.664 1.00 103.93 ? 163  ASN B ND2   1 
ATOM   3012  N  N     . ALA B  1  164  ? 7.527   11.583  141.426 1.00 96.86  ? 164  ALA B N     1 
ATOM   3013  C  CA    . ALA B  1  164  ? 8.486   12.409  140.715 1.00 89.07  ? 164  ALA B CA    1 
ATOM   3014  C  C     . ALA B  1  164  ? 9.118   11.591  139.598 1.00 91.00  ? 164  ALA B C     1 
ATOM   3015  O  O     . ALA B  1  164  ? 9.501   10.436  139.804 1.00 91.03  ? 164  ALA B O     1 
ATOM   3016  C  CB    . ALA B  1  164  ? 9.558   12.936  141.667 1.00 86.47  ? 164  ALA B CB    1 
ATOM   3017  N  N     . ILE B  1  165  ? 9.205   12.183  138.417 1.00 93.55  ? 165  ILE B N     1 
ATOM   3018  C  CA    . ILE B  1  165  ? 9.793   11.548  137.244 1.00 91.27  ? 165  ILE B CA    1 
ATOM   3019  C  C     . ILE B  1  165  ? 11.230  12.041  137.110 1.00 88.52  ? 165  ILE B C     1 
ATOM   3020  O  O     . ILE B  1  165  ? 11.454  13.264  137.100 1.00 87.49  ? 165  ILE B O     1 
ATOM   3021  C  CB    . ILE B  1  165  ? 8.987   11.860  135.970 1.00 83.88  ? 165  ILE B CB    1 
ATOM   3022  C  CG1   . ILE B  1  165  ? 7.502   11.576  136.203 1.00 96.23  ? 165  ILE B CG1   1 
ATOM   3023  C  CG2   . ILE B  1  165  ? 9.499   11.035  134.807 1.00 92.43  ? 165  ILE B CG2   1 
ATOM   3024  C  CD1   . ILE B  1  165  ? 6.614   11.963  135.045 1.00 93.30  ? 165  ILE B CD1   1 
ATOM   3025  N  N     . PRO B  1  166  ? 12.215  11.149  137.027 1.00 78.87  ? 166  PRO B N     1 
ATOM   3026  C  CA    . PRO B  1  166  ? 13.599  11.594  136.848 1.00 75.27  ? 166  PRO B CA    1 
ATOM   3027  C  C     . PRO B  1  166  ? 13.863  11.926  135.389 1.00 77.04  ? 166  PRO B C     1 
ATOM   3028  O  O     . PRO B  1  166  ? 13.366  11.259  134.479 1.00 77.77  ? 166  PRO B O     1 
ATOM   3029  C  CB    . PRO B  1  166  ? 14.424  10.386  137.314 1.00 76.24  ? 166  PRO B CB    1 
ATOM   3030  C  CG    . PRO B  1  166  ? 13.417  9.266   137.596 1.00 78.00  ? 166  PRO B CG    1 
ATOM   3031  C  CD    . PRO B  1  166  ? 12.113  9.683   137.004 1.00 76.26  ? 166  PRO B CD    1 
ATOM   3032  N  N     . VAL B  1  167  ? 14.656  12.971  135.173 1.00 76.49  ? 167  VAL B N     1 
ATOM   3033  C  CA    . VAL B  1  167  ? 14.888  13.527  133.844 1.00 76.93  ? 167  VAL B CA    1 
ATOM   3034  C  C     . VAL B  1  167  ? 16.336  13.287  133.443 1.00 79.27  ? 167  VAL B C     1 
ATOM   3035  O  O     . VAL B  1  167  ? 17.249  13.402  134.271 1.00 76.89  ? 167  VAL B O     1 
ATOM   3036  C  CB    . VAL B  1  167  ? 14.554  15.031  133.803 1.00 70.70  ? 167  VAL B CB    1 
ATOM   3037  C  CG1   . VAL B  1  167  ? 14.697  15.579  132.391 1.00 65.60  ? 167  VAL B CG1   1 
ATOM   3038  C  CG2   . VAL B  1  167  ? 13.156  15.276  134.339 1.00 78.06  ? 167  VAL B CG2   1 
ATOM   3039  N  N     . ASP B  1  168  ? 16.539  12.948  132.171 1.00 78.38  ? 168  ASP B N     1 
ATOM   3040  C  CA    . ASP B  1  168  ? 17.879  12.899  131.603 1.00 68.13  ? 168  ASP B CA    1 
ATOM   3041  C  C     . ASP B  1  168  ? 18.512  14.282  131.689 1.00 65.30  ? 168  ASP B C     1 
ATOM   3042  O  O     . ASP B  1  168  ? 17.955  15.262  131.183 1.00 64.71  ? 168  ASP B O     1 
ATOM   3043  C  CB    . ASP B  1  168  ? 17.809  12.410  130.158 1.00 67.46  ? 168  ASP B CB    1 
ATOM   3044  C  CG    . ASP B  1  168  ? 17.119  11.055  130.031 1.00 74.37  ? 168  ASP B CG    1 
ATOM   3045  O  OD1   . ASP B  1  168  ? 17.671  10.054  130.541 1.00 76.94  ? 168  ASP B OD1   1 
ATOM   3046  O  OD2   . ASP B  1  168  ? 16.017  10.990  129.439 1.00 66.97  ? 168  ASP B OD2   1 
ATOM   3047  N  N     . ALA B  1  169  ? 19.668  14.362  132.344 1.00 60.57  ? 169  ALA B N     1 
ATOM   3048  C  CA    . ALA B  1  169  ? 20.257  15.632  132.757 1.00 62.83  ? 169  ALA B CA    1 
ATOM   3049  C  C     . ALA B  1  169  ? 21.345  16.052  131.774 1.00 60.42  ? 169  ALA B C     1 
ATOM   3050  O  O     . ALA B  1  169  ? 22.420  15.446  131.729 1.00 55.88  ? 169  ALA B O     1 
ATOM   3051  C  CB    . ALA B  1  169  ? 20.820  15.517  134.171 1.00 64.65  ? 169  ALA B CB    1 
ATOM   3052  N  N     . VAL B  1  170  ? 21.074  17.103  131.007 1.00 60.62  ? 170  VAL B N     1 
ATOM   3053  C  CA    . VAL B  1  170  ? 22.031  17.644  130.044 1.00 59.33  ? 170  VAL B CA    1 
ATOM   3054  C  C     . VAL B  1  170  ? 22.737  18.801  130.742 1.00 60.58  ? 170  VAL B C     1 
ATOM   3055  O  O     . VAL B  1  170  ? 22.344  19.964  130.622 1.00 60.93  ? 170  VAL B O     1 
ATOM   3056  C  CB    . VAL B  1  170  ? 21.351  18.084  128.748 1.00 55.67  ? 170  VAL B CB    1 
ATOM   3057  C  CG1   . VAL B  1  170  ? 22.394  18.513  127.721 1.00 69.90  ? 170  VAL B CG1   1 
ATOM   3058  C  CG2   . VAL B  1  170  ? 20.477  16.971  128.196 1.00 50.59  ? 170  VAL B CG2   1 
ATOM   3059  N  N     . PHE B  1  171  ? 23.810  18.479  131.467 1.00 58.73  ? 171  PHE B N     1 
ATOM   3060  C  CA    . PHE B  1  171  ? 24.523  19.505  132.220 1.00 67.12  ? 171  PHE B CA    1 
ATOM   3061  C  C     . PHE B  1  171  ? 25.346  20.392  131.298 1.00 64.19  ? 171  PHE B C     1 
ATOM   3062  O  O     . PHE B  1  171  ? 25.280  21.625  131.386 1.00 64.09  ? 171  PHE B O     1 
ATOM   3063  C  CB    . PHE B  1  171  ? 25.429  18.866  133.273 1.00 68.10  ? 171  PHE B CB    1 
ATOM   3064  C  CG    . PHE B  1  171  ? 24.685  18.237  134.413 1.00 71.39  ? 171  PHE B CG    1 
ATOM   3065  C  CD1   . PHE B  1  171  ? 23.840  18.994  135.208 1.00 73.10  ? 171  PHE B CD1   1 
ATOM   3066  C  CD2   . PHE B  1  171  ? 24.843  16.893  134.703 1.00 68.76  ? 171  PHE B CD2   1 
ATOM   3067  C  CE1   . PHE B  1  171  ? 23.156  18.416  136.259 1.00 73.04  ? 171  PHE B CE1   1 
ATOM   3068  C  CE2   . PHE B  1  171  ? 24.163  16.311  135.754 1.00 66.99  ? 171  PHE B CE2   1 
ATOM   3069  C  CZ    . PHE B  1  171  ? 23.318  17.073  136.533 1.00 65.37  ? 171  PHE B CZ    1 
ATOM   3070  N  N     . SER B  1  172  ? 26.120  19.778  130.406 1.00 62.69  ? 172  SER B N     1 
ATOM   3071  C  CA    . SER B  1  172  ? 27.111  20.473  129.600 1.00 68.29  ? 172  SER B CA    1 
ATOM   3072  C  C     . SER B  1  172  ? 26.482  21.654  128.863 1.00 62.15  ? 172  SER B C     1 
ATOM   3073  O  O     . SER B  1  172  ? 25.517  21.464  128.103 1.00 54.85  ? 172  SER B O     1 
ATOM   3074  C  CB    . SER B  1  172  ? 27.749  19.512  128.597 1.00 71.82  ? 172  SER B CB    1 
ATOM   3075  O  OG    . SER B  1  172  ? 28.874  20.100  127.953 1.00 62.62  ? 172  SER B OG    1 
ATOM   3076  N  N     . PRO B  1  173  ? 26.985  22.874  129.060 1.00 57.88  ? 173  PRO B N     1 
ATOM   3077  C  CA    . PRO B  1  173  ? 26.494  23.995  128.253 1.00 62.15  ? 173  PRO B CA    1 
ATOM   3078  C  C     . PRO B  1  173  ? 26.917  23.900  126.803 1.00 68.26  ? 173  PRO B C     1 
ATOM   3079  O  O     . PRO B  1  173  ? 26.338  24.592  125.959 1.00 72.68  ? 173  PRO B O     1 
ATOM   3080  C  CB    . PRO B  1  173  ? 27.111  25.217  128.942 1.00 64.43  ? 173  PRO B CB    1 
ATOM   3081  C  CG    . PRO B  1  173  ? 28.374  24.697  129.531 1.00 54.53  ? 173  PRO B CG    1 
ATOM   3082  C  CD    . PRO B  1  173  ? 28.094  23.274  129.946 1.00 52.81  ? 173  PRO B CD    1 
ATOM   3083  N  N     . VAL B  1  174  ? 27.900  23.061  126.491 1.00 68.67  ? 174  VAL B N     1 
ATOM   3084  C  CA    . VAL B  1  174  ? 28.386  22.895  125.126 1.00 61.79  ? 174  VAL B CA    1 
ATOM   3085  C  C     . VAL B  1  174  ? 27.451  21.950  124.379 1.00 62.02  ? 174  VAL B C     1 
ATOM   3086  O  O     . VAL B  1  174  ? 27.298  20.785  124.758 1.00 56.11  ? 174  VAL B O     1 
ATOM   3087  C  CB    . VAL B  1  174  ? 29.825  22.364  125.118 1.00 58.72  ? 174  VAL B CB    1 
ATOM   3088  C  CG1   . VAL B  1  174  ? 30.321  22.228  123.695 1.00 64.14  ? 174  VAL B CG1   1 
ATOM   3089  C  CG2   . VAL B  1  174  ? 30.736  23.275  125.927 1.00 53.85  ? 174  VAL B CG2   1 
ATOM   3090  N  N     . ARG B  1  175  ? 26.828  22.449  123.309 1.00 61.59  ? 175  ARG B N     1 
ATOM   3091  C  CA    . ARG B  1  175  ? 25.927  21.610  122.529 1.00 58.09  ? 175  ARG B CA    1 
ATOM   3092  C  C     . ARG B  1  175  ? 26.669  20.767  121.495 1.00 69.40  ? 175  ARG B C     1 
ATOM   3093  O  O     . ARG B  1  175  ? 26.185  19.690  121.122 1.00 63.09  ? 175  ARG B O     1 
ATOM   3094  C  CB    . ARG B  1  175  ? 24.866  22.469  121.840 1.00 59.29  ? 175  ARG B CB    1 
ATOM   3095  C  CG    . ARG B  1  175  ? 23.992  23.260  122.791 1.00 67.30  ? 175  ARG B CG    1 
ATOM   3096  C  CD    . ARG B  1  175  ? 22.608  23.491  122.204 1.00 80.50  ? 175  ARG B CD    1 
ATOM   3097  N  NE    . ARG B  1  175  ? 21.689  24.077  123.179 1.00 95.27  ? 175  ARG B NE    1 
ATOM   3098  C  CZ    . ARG B  1  175  ? 21.018  23.380  124.093 1.00 94.81  ? 175  ARG B CZ    1 
ATOM   3099  N  NH1   . ARG B  1  175  ? 21.160  22.061  124.168 1.00 85.89  ? 175  ARG B NH1   1 
ATOM   3100  N  NH2   . ARG B  1  175  ? 20.203  24.003  124.937 1.00 90.65  ? 175  ARG B NH2   1 
ATOM   3101  N  N     . ARG B  1  176  ? 27.822  21.234  121.013 1.00 69.25  ? 176  ARG B N     1 
ATOM   3102  C  CA    . ARG B  1  176  ? 28.573  20.458  120.031 1.00 62.03  ? 176  ARG B CA    1 
ATOM   3103  C  C     . ARG B  1  176  ? 30.006  20.963  119.935 1.00 60.46  ? 176  ARG B C     1 
ATOM   3104  O  O     . ARG B  1  176  ? 30.268  22.162  120.051 1.00 62.51  ? 176  ARG B O     1 
ATOM   3105  C  CB    . ARG B  1  176  ? 27.909  20.503  118.646 1.00 65.25  ? 176  ARG B CB    1 
ATOM   3106  C  CG    . ARG B  1  176  ? 28.713  19.808  117.550 1.00 72.10  ? 176  ARG B CG    1 
ATOM   3107  C  CD    . ARG B  1  176  ? 27.822  19.061  116.581 1.00 77.01  ? 176  ARG B CD    1 
ATOM   3108  N  NE    . ARG B  1  176  ? 27.322  19.902  115.497 1.00 72.66  ? 176  ARG B NE    1 
ATOM   3109  C  CZ    . ARG B  1  176  ? 27.835  19.916  114.270 1.00 67.45  ? 176  ARG B CZ    1 
ATOM   3110  N  NH1   . ARG B  1  176  ? 28.866  19.137  113.969 1.00 67.20  ? 176  ARG B NH1   1 
ATOM   3111  N  NH2   . ARG B  1  176  ? 27.315  20.707  113.342 1.00 65.04  ? 176  ARG B NH2   1 
ATOM   3112  N  N     . VAL B  1  177  ? 30.927  20.026  119.712 1.00 59.48  ? 177  VAL B N     1 
ATOM   3113  C  CA    . VAL B  1  177  ? 32.325  20.318  119.420 1.00 56.85  ? 177  VAL B CA    1 
ATOM   3114  C  C     . VAL B  1  177  ? 32.703  19.564  118.154 1.00 63.97  ? 177  VAL B C     1 
ATOM   3115  O  O     . VAL B  1  177  ? 32.360  18.385  118.006 1.00 70.83  ? 177  VAL B O     1 
ATOM   3116  C  CB    . VAL B  1  177  ? 33.256  19.916  120.580 1.00 56.65  ? 177  VAL B CB    1 
ATOM   3117  C  CG1   . VAL B  1  177  ? 34.709  20.165  120.209 1.00 57.94  ? 177  VAL B CG1   1 
ATOM   3118  C  CG2   . VAL B  1  177  ? 32.898  20.675  121.834 1.00 57.65  ? 177  VAL B CG2   1 
ATOM   3119  N  N     . ALA B  1  178  ? 33.393  20.241  117.239 1.00 65.16  ? 178  ALA B N     1 
ATOM   3120  C  CA    . ALA B  1  178  ? 33.899  19.579  116.043 1.00 67.30  ? 178  ALA B CA    1 
ATOM   3121  C  C     . ALA B  1  178  ? 35.193  20.255  115.617 1.00 61.74  ? 178  ALA B C     1 
ATOM   3122  O  O     . ALA B  1  178  ? 35.234  21.479  115.487 1.00 63.93  ? 178  ALA B O     1 
ATOM   3123  C  CB    . ALA B  1  178  ? 32.867  19.623  114.909 1.00 71.10  ? 178  ALA B CB    1 
ATOM   3124  N  N     . PHE B  1  179  ? 36.247  19.469  115.398 1.00 60.11  ? 179  PHE B N     1 
ATOM   3125  C  CA    . PHE B  1  179  ? 37.545  20.039  115.060 1.00 66.87  ? 179  PHE B CA    1 
ATOM   3126  C  C     . PHE B  1  179  ? 38.137  19.356  113.834 1.00 74.47  ? 179  PHE B C     1 
ATOM   3127  O  O     . PHE B  1  179  ? 38.044  18.134  113.674 1.00 72.61  ? 179  PHE B O     1 
ATOM   3128  C  CB    . PHE B  1  179  ? 38.525  19.959  116.250 1.00 62.52  ? 179  PHE B CB    1 
ATOM   3129  C  CG    . PHE B  1  179  ? 39.170  18.614  116.437 1.00 60.44  ? 179  PHE B CG    1 
ATOM   3130  C  CD1   . PHE B  1  179  ? 38.466  17.559  116.995 1.00 60.07  ? 179  PHE B CD1   1 
ATOM   3131  C  CD2   . PHE B  1  179  ? 40.494  18.416  116.080 1.00 59.30  ? 179  PHE B CD2   1 
ATOM   3132  C  CE1   . PHE B  1  179  ? 39.063  16.326  117.178 1.00 56.24  ? 179  PHE B CE1   1 
ATOM   3133  C  CE2   . PHE B  1  179  ? 41.099  17.187  116.260 1.00 59.00  ? 179  PHE B CE2   1 
ATOM   3134  C  CZ    . PHE B  1  179  ? 40.381  16.140  116.811 1.00 61.77  ? 179  PHE B CZ    1 
ATOM   3135  N  N     . GLN B  1  180  ? 38.744  20.171  112.973 1.00 74.03  ? 180  GLN B N     1 
ATOM   3136  C  CA    . GLN B  1  180  ? 39.360  19.733  111.729 1.00 72.31  ? 180  GLN B CA    1 
ATOM   3137  C  C     . GLN B  1  180  ? 40.809  20.200  111.711 1.00 70.53  ? 180  GLN B C     1 
ATOM   3138  O  O     . GLN B  1  180  ? 41.095  21.373  111.976 1.00 75.68  ? 180  GLN B O     1 
ATOM   3139  C  CB    . GLN B  1  180  ? 38.591  20.281  110.520 1.00 76.84  ? 180  GLN B CB    1 
ATOM   3140  C  CG    . GLN B  1  180  ? 38.941  19.628  109.190 1.00 85.22  ? 180  GLN B CG    1 
ATOM   3141  C  CD    . GLN B  1  180  ? 37.917  19.926  108.099 1.00 98.41  ? 180  GLN B CD    1 
ATOM   3142  O  OE1   . GLN B  1  180  ? 36.909  20.597  108.337 1.00 96.69  ? 180  GLN B OE1   1 
ATOM   3143  N  NE2   . GLN B  1  180  ? 38.173  19.420  106.895 1.00 92.27  ? 180  GLN B NE2   1 
ATOM   3144  N  N     . VAL B  1  181  ? 41.720  19.278  111.412 1.00 70.18  ? 181  VAL B N     1 
ATOM   3145  C  CA    . VAL B  1  181  ? 43.152  19.549  111.371 1.00 65.01  ? 181  VAL B CA    1 
ATOM   3146  C  C     . VAL B  1  181  ? 43.608  19.366  109.935 1.00 73.77  ? 181  VAL B C     1 
ATOM   3147  O  O     . VAL B  1  181  ? 43.491  18.265  109.381 1.00 79.05  ? 181  VAL B O     1 
ATOM   3148  C  CB    . VAL B  1  181  ? 43.938  18.621  112.312 1.00 64.21  ? 181  VAL B CB    1 
ATOM   3149  C  CG1   . VAL B  1  181  ? 45.436  18.814  112.134 1.00 60.60  ? 181  VAL B CG1   1 
ATOM   3150  C  CG2   . VAL B  1  181  ? 43.528  18.859  113.757 1.00 73.50  ? 181  VAL B CG2   1 
ATOM   3151  N  N     . GLU B  1  182  ? 44.123  20.432  109.330 1.00 80.74  ? 182  GLU B N     1 
ATOM   3152  C  CA    . GLU B  1  182  ? 44.551  20.359  107.940 1.00 80.76  ? 182  GLU B CA    1 
ATOM   3153  C  C     . GLU B  1  182  ? 46.012  20.766  107.798 1.00 81.50  ? 182  GLU B C     1 
ATOM   3154  O  O     . GLU B  1  182  ? 46.585  21.451  108.651 1.00 80.15  ? 182  GLU B O     1 
ATOM   3155  C  CB    . GLU B  1  182  ? 43.659  21.220  107.028 1.00 83.78  ? 182  GLU B CB    1 
ATOM   3156  C  CG    . GLU B  1  182  ? 43.620  22.705  107.343 1.00 92.58  ? 182  GLU B CG    1 
ATOM   3157  C  CD    . GLU B  1  182  ? 42.552  23.433  106.537 1.00 105.92 ? 182  GLU B CD    1 
ATOM   3158  O  OE1   . GLU B  1  182  ? 41.405  22.931  106.477 1.00 105.67 ? 182  GLU B OE1   1 
ATOM   3159  O  OE2   . GLU B  1  182  ? 42.860  24.497  105.954 1.00 98.20  ? 182  GLU B OE2   1 
ATOM   3160  N  N     . ASP B  1  183  ? 46.622  20.308  106.708 1.00 88.31  ? 183  ASP B N     1 
ATOM   3161  C  CA    . ASP B  1  183  ? 48.018  20.624  106.457 1.00 89.06  ? 183  ASP B CA    1 
ATOM   3162  C  C     . ASP B  1  183  ? 48.177  22.102  106.128 1.00 89.39  ? 183  ASP B C     1 
ATOM   3163  O  O     . ASP B  1  183  ? 47.277  22.746  105.580 1.00 90.46  ? 183  ASP B O     1 
ATOM   3164  C  CB    . ASP B  1  183  ? 48.573  19.764  105.320 1.00 93.83  ? 183  ASP B CB    1 
ATOM   3165  C  CG    . ASP B  1  183  ? 48.989  18.379  105.787 1.00 105.56 ? 183  ASP B CG    1 
ATOM   3166  O  OD1   . ASP B  1  183  ? 49.219  18.203  107.004 1.00 103.40 ? 183  ASP B OD1   1 
ATOM   3167  O  OD2   . ASP B  1  183  ? 49.094  17.468  104.937 1.00 104.48 ? 183  ASP B OD2   1 
ATOM   3168  N  N     . THR B  1  184  ? 49.336  22.641  106.493 1.00 81.57  ? 184  THR B N     1 
ATOM   3169  C  CA    . THR B  1  184  ? 49.659  24.036  106.252 1.00 83.61  ? 184  THR B CA    1 
ATOM   3170  C  C     . THR B  1  184  ? 51.171  24.152  106.150 1.00 88.50  ? 184  THR B C     1 
ATOM   3171  O  O     . THR B  1  184  ? 51.912  23.259  106.579 1.00 91.23  ? 184  THR B O     1 
ATOM   3172  C  CB    . THR B  1  184  ? 49.104  24.947  107.356 1.00 77.82  ? 184  THR B CB    1 
ATOM   3173  O  OG1   . THR B  1  184  ? 48.969  26.282  106.855 1.00 81.88  ? 184  THR B OG1   1 
ATOM   3174  C  CG2   . THR B  1  184  ? 50.031  24.961  108.563 1.00 75.46  ? 184  THR B CG2   1 
ATOM   3175  N  N     . ARG B  1  185  ? 51.627  25.264  105.575 1.00 88.45  ? 185  ARG B N     1 
ATOM   3176  C  CA    . ARG B  1  185  ? 53.035  25.422  105.251 1.00 96.49  ? 185  ARG B CA    1 
ATOM   3177  C  C     . ARG B  1  185  ? 53.559  26.786  105.677 1.00 103.63 ? 185  ARG B C     1 
ATOM   3178  O  O     . ARG B  1  185  ? 52.872  27.804  105.544 1.00 103.23 ? 185  ARG B O     1 
ATOM   3179  C  CB    . ARG B  1  185  ? 53.285  25.203  103.746 1.00 106.18 ? 185  ARG B CB    1 
ATOM   3180  C  CG    . ARG B  1  185  ? 52.744  26.269  102.808 1.00 109.00 ? 185  ARG B CG    1 
ATOM   3181  C  CD    . ARG B  1  185  ? 53.153  25.957  101.372 1.00 102.93 ? 185  ARG B CD    1 
ATOM   3182  N  NE    . ARG B  1  185  ? 53.018  27.115  100.493 1.00 104.19 ? 185  ARG B NE    1 
ATOM   3183  C  CZ    . ARG B  1  185  ? 54.006  27.962  100.215 1.00 107.30 ? 185  ARG B CZ    1 
ATOM   3184  N  NH1   . ARG B  1  185  ? 55.210  27.781  100.744 1.00 105.61 ? 185  ARG B NH1   1 
ATOM   3185  N  NH2   . ARG B  1  185  ? 53.788  28.991  99.406  1.00 97.39  ? 185  ARG B NH2   1 
ATOM   3186  N  N     . LEU B  1  186  ? 54.784  26.786  106.204 1.00 105.44 ? 186  LEU B N     1 
ATOM   3187  C  CA    . LEU B  1  186  ? 55.563  27.991  106.481 1.00 108.48 ? 186  LEU B CA    1 
ATOM   3188  C  C     . LEU B  1  186  ? 56.805  27.899  105.604 1.00 113.96 ? 186  LEU B C     1 
ATOM   3189  O  O     . LEU B  1  186  ? 57.772  27.219  105.963 1.00 113.04 ? 186  LEU B O     1 
ATOM   3190  C  CB    . LEU B  1  186  ? 55.933  28.097  107.961 1.00 110.17 ? 186  LEU B CB    1 
ATOM   3191  C  CG    . LEU B  1  186  ? 56.365  29.427  108.606 1.00 110.41 ? 186  LEU B CG    1 
ATOM   3192  C  CD1   . LEU B  1  186  ? 56.862  29.184  110.026 1.00 93.64  ? 186  LEU B CD1   1 
ATOM   3193  C  CD2   . LEU B  1  186  ? 57.419  30.190  107.807 1.00 122.79 ? 186  LEU B CD2   1 
ATOM   3194  N  N     . GLY B  1  187  ? 56.781  28.589  104.467 1.00 115.45 ? 187  GLY B N     1 
ATOM   3195  C  CA    . GLY B  1  187  ? 57.906  28.572  103.553 1.00 116.54 ? 187  GLY B CA    1 
ATOM   3196  C  C     . GLY B  1  187  ? 58.268  27.177  103.090 1.00 120.28 ? 187  GLY B C     1 
ATOM   3197  O  O     . GLY B  1  187  ? 57.519  26.552  102.332 1.00 115.39 ? 187  GLY B O     1 
ATOM   3198  N  N     . GLN B  1  188  ? 59.416  26.675  103.551 1.00 124.83 ? 188  GLN B N     1 
ATOM   3199  C  CA    . GLN B  1  188  ? 59.897  25.374  103.094 1.00 126.19 ? 188  GLN B CA    1 
ATOM   3200  C  C     . GLN B  1  188  ? 59.101  24.226  103.712 1.00 128.36 ? 188  GLN B C     1 
ATOM   3201  O  O     . GLN B  1  188  ? 58.844  23.216  103.046 1.00 128.33 ? 188  GLN B O     1 
ATOM   3202  C  CB    . GLN B  1  188  ? 61.388  25.224  103.406 1.00 127.31 ? 188  GLN B CB    1 
ATOM   3203  C  CG    . GLN B  1  188  ? 61.759  25.436  104.871 1.00 136.48 ? 188  GLN B CG    1 
ATOM   3204  C  CD    . GLN B  1  188  ? 61.957  26.899  105.226 1.00 142.89 ? 188  GLN B CD    1 
ATOM   3205  O  OE1   . GLN B  1  188  ? 62.309  27.715  104.372 1.00 145.30 ? 188  GLN B OE1   1 
ATOM   3206  N  NE2   . GLN B  1  188  ? 61.726  27.239  106.491 1.00 134.42 ? 188  GLN B NE2   1 
ATOM   3207  N  N     . ARG B  1  189  ? 58.708  24.356  104.980 1.00 127.67 ? 189  ARG B N     1 
ATOM   3208  C  CA    . ARG B  1  189  ? 57.974  23.299  105.667 1.00 116.12 ? 189  ARG B CA    1 
ATOM   3209  C  C     . ARG B  1  189  ? 56.527  23.288  105.193 1.00 109.20 ? 189  ARG B C     1 
ATOM   3210  O  O     . ARG B  1  189  ? 55.813  24.277  105.373 1.00 101.88 ? 189  ARG B O     1 
ATOM   3211  C  CB    . ARG B  1  189  ? 58.012  23.508  107.179 1.00 111.35 ? 189  ARG B CB    1 
ATOM   3212  C  CG    . ARG B  1  189  ? 59.380  23.722  107.792 1.00 115.01 ? 189  ARG B CG    1 
ATOM   3213  C  CD    . ARG B  1  189  ? 59.202  24.262  109.206 1.00 117.13 ? 189  ARG B CD    1 
ATOM   3214  N  NE    . ARG B  1  189  ? 60.459  24.452  109.925 1.00 120.65 ? 189  ARG B NE    1 
ATOM   3215  C  CZ    . ARG B  1  189  ? 60.770  23.841  111.064 1.00 113.05 ? 189  ARG B CZ    1 
ATOM   3216  N  NH1   . ARG B  1  189  ? 61.935  24.081  111.648 1.00 117.72 ? 189  ARG B NH1   1 
ATOM   3217  N  NH2   . ARG B  1  189  ? 59.914  22.997  111.627 1.00 98.79  ? 189  ARG B NH2   1 
ATOM   3218  N  N     . THR B  1  190  ? 56.092  22.173  104.603 1.00 112.09 ? 190  THR B N     1 
ATOM   3219  C  CA    . THR B  1  190  ? 54.701  21.987  104.202 1.00 116.77 ? 190  THR B CA    1 
ATOM   3220  C  C     . THR B  1  190  ? 53.947  21.039  105.130 1.00 105.76 ? 190  THR B C     1 
ATOM   3221  O  O     . THR B  1  190  ? 52.737  20.848  104.962 1.00 97.97  ? 190  THR B O     1 
ATOM   3222  C  CB    . THR B  1  190  ? 54.625  21.466  102.756 1.00 116.44 ? 190  THR B CB    1 
ATOM   3223  O  OG1   . THR B  1  190  ? 55.684  22.040  101.979 1.00 115.32 ? 190  THR B OG1   1 
ATOM   3224  C  CG2   . THR B  1  190  ? 53.288  21.834  102.109 1.00 105.88 ? 190  THR B CG2   1 
ATOM   3225  N  N     . ASP B  1  191  ? 54.629  20.457  106.113 1.00 96.84  ? 191  ASP B N     1 
ATOM   3226  C  CA    . ASP B  1  191  ? 54.054  19.433  106.972 1.00 87.51  ? 191  ASP B CA    1 
ATOM   3227  C  C     . ASP B  1  191  ? 53.462  19.995  108.261 1.00 85.07  ? 191  ASP B C     1 
ATOM   3228  O  O     . ASP B  1  191  ? 53.191  19.225  109.189 1.00 77.38  ? 191  ASP B O     1 
ATOM   3229  C  CB    . ASP B  1  191  ? 55.116  18.384  107.306 1.00 82.56  ? 191  ASP B CB    1 
ATOM   3230  C  CG    . ASP B  1  191  ? 54.548  16.983  107.371 1.00 94.07  ? 191  ASP B CG    1 
ATOM   3231  O  OD1   . ASP B  1  191  ? 53.331  16.844  107.620 1.00 98.42  ? 191  ASP B OD1   1 
ATOM   3232  O  OD2   . ASP B  1  191  ? 55.319  16.019  107.171 1.00 91.63  ? 191  ASP B OD2   1 
ATOM   3233  N  N     . LEU B  1  192  ? 53.252  21.305  108.344 1.00 85.53  ? 192  LEU B N     1 
ATOM   3234  C  CA    . LEU B  1  192  ? 52.768  21.873  109.590 1.00 75.75  ? 192  LEU B CA    1 
ATOM   3235  C  C     . LEU B  1  192  ? 51.261  21.660  109.722 1.00 79.76  ? 192  LEU B C     1 
ATOM   3236  O  O     . LEU B  1  192  ? 50.560  21.379  108.748 1.00 84.46  ? 192  LEU B O     1 
ATOM   3237  C  CB    . LEU B  1  192  ? 53.114  23.359  109.669 1.00 73.81  ? 192  LEU B CB    1 
ATOM   3238  C  CG    . LEU B  1  192  ? 54.597  23.681  109.463 1.00 71.32  ? 192  LEU B CG    1 
ATOM   3239  C  CD1   . LEU B  1  192  ? 54.874  25.155  109.703 1.00 82.95  ? 192  LEU B CD1   1 
ATOM   3240  C  CD2   . LEU B  1  192  ? 55.472  22.811  110.352 1.00 64.70  ? 192  LEU B CD2   1 
ATOM   3241  N  N     . ASP B  1  193  ? 50.765  21.799  110.949 1.00 75.15  ? 193  ASP B N     1 
ATOM   3242  C  CA    . ASP B  1  193  ? 49.363  21.554  111.259 1.00 72.39  ? 193  ASP B CA    1 
ATOM   3243  C  C     . ASP B  1  193  ? 48.627  22.866  111.487 1.00 68.83  ? 193  ASP B C     1 
ATOM   3244  O  O     . ASP B  1  193  ? 49.179  23.808  112.066 1.00 72.07  ? 193  ASP B O     1 
ATOM   3245  C  CB    . ASP B  1  193  ? 49.214  20.662  112.495 1.00 65.03  ? 193  ASP B CB    1 
ATOM   3246  C  CG    . ASP B  1  193  ? 49.484  19.199  112.198 1.00 74.25  ? 193  ASP B CG    1 
ATOM   3247  O  OD1   . ASP B  1  193  ? 50.292  18.913  111.291 1.00 87.03  ? 193  ASP B OD1   1 
ATOM   3248  O  OD2   . ASP B  1  193  ? 48.875  18.333  112.864 1.00 70.54  ? 193  ASP B OD2   1 
ATOM   3249  N  N     . LYS B  1  194  ? 47.379  22.922  111.025 1.00 59.91  ? 194  LYS B N     1 
ATOM   3250  C  CA    . LYS B  1  194  ? 46.468  24.022  111.307 1.00 59.68  ? 194  LYS B CA    1 
ATOM   3251  C  C     . LYS B  1  194  ? 45.226  23.433  111.954 1.00 70.58  ? 194  LYS B C     1 
ATOM   3252  O  O     . LYS B  1  194  ? 44.580  22.550  111.371 1.00 73.34  ? 194  LYS B O     1 
ATOM   3253  C  CB    . LYS B  1  194  ? 46.100  24.788  110.037 1.00 60.13  ? 194  LYS B CB    1 
ATOM   3254  C  CG    . LYS B  1  194  ? 44.933  25.742  110.218 1.00 63.94  ? 194  LYS B CG    1 
ATOM   3255  C  CD    . LYS B  1  194  ? 44.433  26.257  108.883 1.00 71.66  ? 194  LYS B CD    1 
ATOM   3256  C  CE    . LYS B  1  194  ? 43.222  27.154  109.054 1.00 70.37  ? 194  LYS B CE    1 
ATOM   3257  N  NZ    . LYS B  1  194  ? 42.722  27.669  107.751 1.00 70.51  ? 194  LYS B NZ    1 
ATOM   3258  N  N     . LEU B  1  195  ? 44.896  23.921  113.149 1.00 68.87  ? 195  LEU B N     1 
ATOM   3259  C  CA    . LEU B  1  195  ? 43.796  23.399  113.945 1.00 67.29  ? 195  LEU B CA    1 
ATOM   3260  C  C     . LEU B  1  195  ? 42.612  24.354  113.866 1.00 66.73  ? 195  LEU B C     1 
ATOM   3261  O  O     . LEU B  1  195  ? 42.773  25.562  114.063 1.00 69.05  ? 195  LEU B O     1 
ATOM   3262  C  CB    . LEU B  1  195  ? 44.248  23.214  115.395 1.00 67.32  ? 195  LEU B CB    1 
ATOM   3263  C  CG    . LEU B  1  195  ? 43.225  22.865  116.472 1.00 63.99  ? 195  LEU B CG    1 
ATOM   3264  C  CD1   . LEU B  1  195  ? 42.521  21.568  116.131 1.00 67.54  ? 195  LEU B CD1   1 
ATOM   3265  C  CD2   . LEU B  1  195  ? 43.922  22.764  117.817 1.00 52.28  ? 195  LEU B CD2   1 
ATOM   3266  N  N     . THR B  1  196  ? 41.427  23.813  113.574 1.00 66.24  ? 196  THR B N     1 
ATOM   3267  C  CA    . THR B  1  196  ? 40.198  24.598  113.499 1.00 66.22  ? 196  THR B CA    1 
ATOM   3268  C  C     . THR B  1  196  ? 39.158  23.940  114.390 1.00 70.87  ? 196  THR B C     1 
ATOM   3269  O  O     . THR B  1  196  ? 38.724  22.819  114.112 1.00 73.45  ? 196  THR B O     1 
ATOM   3270  C  CB    . THR B  1  196  ? 39.683  24.697  112.062 1.00 71.55  ? 196  THR B CB    1 
ATOM   3271  O  OG1   . THR B  1  196  ? 40.639  25.395  111.254 1.00 78.14  ? 196  THR B OG1   1 
ATOM   3272  C  CG2   . THR B  1  196  ? 38.345  25.430  112.020 1.00 69.57  ? 196  THR B CG2   1 
ATOM   3273  N  N     . LEU B  1  197  ? 38.756  24.641  115.444 1.00 70.07  ? 197  LEU B N     1 
ATOM   3274  C  CA    . LEU B  1  197  ? 37.844  24.130  116.453 1.00 60.93  ? 197  LEU B CA    1 
ATOM   3275  C  C     . LEU B  1  197  ? 36.541  24.914  116.378 1.00 61.90  ? 197  LEU B C     1 
ATOM   3276  O  O     . LEU B  1  197  ? 36.558  26.148  116.344 1.00 70.28  ? 197  LEU B O     1 
ATOM   3277  C  CB    . LEU B  1  197  ? 38.484  24.251  117.839 1.00 55.57  ? 197  LEU B CB    1 
ATOM   3278  C  CG    . LEU B  1  197  ? 37.859  23.572  119.050 1.00 60.21  ? 197  LEU B CG    1 
ATOM   3279  C  CD1   . LEU B  1  197  ? 37.182  22.288  118.637 1.00 65.10  ? 197  LEU B CD1   1 
ATOM   3280  C  CD2   . LEU B  1  197  ? 38.947  23.297  120.075 1.00 53.03  ? 197  LEU B CD2   1 
ATOM   3281  N  N     . ARG B  1  198  ? 35.416  24.202  116.329 1.00 55.97  ? 198  ARG B N     1 
ATOM   3282  C  CA    . ARG B  1  198  ? 34.095  24.803  116.216 1.00 60.98  ? 198  ARG B CA    1 
ATOM   3283  C  C     . ARG B  1  198  ? 33.279  24.365  117.421 1.00 64.58  ? 198  ARG B C     1 
ATOM   3284  O  O     . ARG B  1  198  ? 33.129  23.159  117.663 1.00 68.16  ? 198  ARG B O     1 
ATOM   3285  C  CB    . ARG B  1  198  ? 33.410  24.378  114.915 1.00 67.94  ? 198  ARG B CB    1 
ATOM   3286  C  CG    . ARG B  1  198  ? 34.225  24.646  113.653 1.00 70.38  ? 198  ARG B CG    1 
ATOM   3287  C  CD    . ARG B  1  198  ? 33.844  23.691  112.523 1.00 66.18  ? 198  ARG B CD    1 
ATOM   3288  N  NE    . ARG B  1  198  ? 32.436  23.797  112.155 1.00 65.82  ? 198  ARG B NE    1 
ATOM   3289  C  CZ    . ARG B  1  198  ? 31.816  22.960  111.328 1.00 70.88  ? 198  ARG B CZ    1 
ATOM   3290  N  NH1   . ARG B  1  198  ? 30.529  23.133  111.052 1.00 73.77  ? 198  ARG B NH1   1 
ATOM   3291  N  NH2   . ARG B  1  198  ? 32.479  21.949  110.783 1.00 65.74  ? 198  ARG B NH2   1 
ATOM   3292  N  N     . ILE B  1  199  ? 32.754  25.338  118.169 1.00 66.03  ? 199  ILE B N     1 
ATOM   3293  C  CA    . ILE B  1  199  ? 32.080  25.083  119.440 1.00 62.60  ? 199  ILE B CA    1 
ATOM   3294  C  C     . ILE B  1  199  ? 30.709  25.749  119.425 1.00 64.38  ? 199  ILE B C     1 
ATOM   3295  O  O     . ILE B  1  199  ? 30.608  26.970  119.242 1.00 69.03  ? 199  ILE B O     1 
ATOM   3296  C  CB    . ILE B  1  199  ? 32.902  25.583  120.640 1.00 60.07  ? 199  ILE B CB    1 
ATOM   3297  C  CG1   . ILE B  1  199  ? 34.278  24.917  120.665 1.00 58.90  ? 199  ILE B CG1   1 
ATOM   3298  C  CG2   . ILE B  1  199  ? 32.166  25.308  121.935 1.00 56.03  ? 199  ILE B CG2   1 
ATOM   3299  C  CD1   . ILE B  1  199  ? 35.189  25.456  121.736 1.00 52.74  ? 199  ILE B CD1   1 
ATOM   3300  N  N     . TRP B  1  200  ? 29.665  24.947  119.626 1.00 63.52  ? 200  TRP B N     1 
ATOM   3301  C  CA    . TRP B  1  200  ? 28.301  25.413  119.825 1.00 63.35  ? 200  TRP B CA    1 
ATOM   3302  C  C     . TRP B  1  200  ? 27.916  25.203  121.284 1.00 67.81  ? 200  TRP B C     1 
ATOM   3303  O  O     . TRP B  1  200  ? 28.052  24.086  121.802 1.00 67.62  ? 200  TRP B O     1 
ATOM   3304  C  CB    . TRP B  1  200  ? 27.312  24.646  118.943 1.00 63.42  ? 200  TRP B CB    1 
ATOM   3305  C  CG    . TRP B  1  200  ? 27.482  24.776  117.459 1.00 70.67  ? 200  TRP B CG    1 
ATOM   3306  C  CD1   . TRP B  1  200  ? 26.755  25.570  116.619 1.00 72.91  ? 200  TRP B CD1   1 
ATOM   3307  C  CD2   . TRP B  1  200  ? 28.404  24.057  116.629 1.00 68.44  ? 200  TRP B CD2   1 
ATOM   3308  N  NE1   . TRP B  1  200  ? 27.179  25.405  115.324 1.00 62.84  ? 200  TRP B NE1   1 
ATOM   3309  C  CE2   . TRP B  1  200  ? 28.190  24.480  115.304 1.00 64.42  ? 200  TRP B CE2   1 
ATOM   3310  C  CE3   . TRP B  1  200  ? 29.399  23.108  116.881 1.00 68.86  ? 200  TRP B CE3   1 
ATOM   3311  C  CZ2   . TRP B  1  200  ? 28.932  23.986  114.236 1.00 70.36  ? 200  TRP B CZ2   1 
ATOM   3312  C  CZ3   . TRP B  1  200  ? 30.132  22.616  115.817 1.00 64.18  ? 200  TRP B CZ3   1 
ATOM   3313  C  CH2   . TRP B  1  200  ? 29.896  23.056  114.513 1.00 67.08  ? 200  TRP B CH2   1 
ATOM   3314  N  N     . THR B  1  201  ? 27.407  26.257  121.924 1.00 74.63  ? 201  THR B N     1 
ATOM   3315  C  CA    . THR B  1  201  ? 26.848  26.209  123.273 1.00 73.19  ? 201  THR B CA    1 
ATOM   3316  C  C     . THR B  1  201  ? 25.400  26.704  123.246 1.00 72.31  ? 201  THR B C     1 
ATOM   3317  O  O     . THR B  1  201  ? 24.882  27.118  122.206 1.00 75.47  ? 201  THR B O     1 
ATOM   3318  C  CB    . THR B  1  201  ? 27.681  27.047  124.256 1.00 76.59  ? 201  THR B CB    1 
ATOM   3319  O  OG1   . THR B  1  201  ? 27.494  28.439  123.984 1.00 83.75  ? 201  THR B OG1   1 
ATOM   3320  C  CG2   . THR B  1  201  ? 29.157  26.708  124.140 1.00 73.65  ? 201  THR B CG2   1 
ATOM   3321  N  N     . ASP B  1  202  ? 24.744  26.657  124.408 1.00 77.80  ? 202  ASP B N     1 
ATOM   3322  C  CA    . ASP B  1  202  ? 23.347  27.061  124.542 1.00 87.71  ? 202  ASP B CA    1 
ATOM   3323  C  C     . ASP B  1  202  ? 23.177  28.524  124.941 1.00 89.08  ? 202  ASP B C     1 
ATOM   3324  O  O     . ASP B  1  202  ? 22.040  28.967  125.145 1.00 82.85  ? 202  ASP B O     1 
ATOM   3325  C  CB    . ASP B  1  202  ? 22.621  26.160  125.559 1.00 80.11  ? 202  ASP B CB    1 
ATOM   3326  C  CG    . ASP B  1  202  ? 23.368  26.025  126.879 1.00 76.83  ? 202  ASP B CG    1 
ATOM   3327  O  OD1   . ASP B  1  202  ? 24.242  26.867  127.174 1.00 81.74  ? 202  ASP B OD1   1 
ATOM   3328  O  OD2   . ASP B  1  202  ? 23.080  25.063  127.623 1.00 71.71  ? 202  ASP B OD2   1 
ATOM   3329  N  N     . GLY B  1  203  ? 24.267  29.280  125.059 1.00 83.21  ? 203  GLY B N     1 
ATOM   3330  C  CA    . GLY B  1  203  ? 24.204  30.685  125.377 1.00 83.25  ? 203  GLY B CA    1 
ATOM   3331  C  C     . GLY B  1  203  ? 24.518  31.027  126.819 1.00 87.32  ? 203  GLY B C     1 
ATOM   3332  O  O     . GLY B  1  203  ? 24.907  32.168  127.097 1.00 84.13  ? 203  GLY B O     1 
ATOM   3333  N  N     . SER B  1  204  ? 24.352  30.078  127.745 1.00 89.36  ? 204  SER B N     1 
ATOM   3334  C  CA    . SER B  1  204  ? 24.680  30.348  129.142 1.00 82.29  ? 204  SER B CA    1 
ATOM   3335  C  C     . SER B  1  204  ? 26.177  30.587  129.311 1.00 80.31  ? 204  SER B C     1 
ATOM   3336  O  O     . SER B  1  204  ? 26.596  31.539  129.978 1.00 84.55  ? 204  SER B O     1 
ATOM   3337  C  CB    . SER B  1  204  ? 24.206  29.194  130.026 1.00 74.22  ? 204  SER B CB    1 
ATOM   3338  O  OG    . SER B  1  204  ? 24.811  27.969  129.651 1.00 68.73  ? 204  SER B OG    1 
ATOM   3339  N  N     . VAL B  1  205  ? 26.997  29.730  128.711 1.00 77.86  ? 205  VAL B N     1 
ATOM   3340  C  CA    . VAL B  1  205  ? 28.441  29.911  128.656 1.00 72.53  ? 205  VAL B CA    1 
ATOM   3341  C  C     . VAL B  1  205  ? 28.826  30.165  127.208 1.00 74.07  ? 205  VAL B C     1 
ATOM   3342  O  O     . VAL B  1  205  ? 28.232  29.596  126.288 1.00 74.53  ? 205  VAL B O     1 
ATOM   3343  C  CB    . VAL B  1  205  ? 29.195  28.688  129.223 1.00 67.62  ? 205  VAL B CB    1 
ATOM   3344  C  CG1   . VAL B  1  205  ? 30.666  29.013  129.448 1.00 61.58  ? 205  VAL B CG1   1 
ATOM   3345  C  CG2   . VAL B  1  205  ? 28.551  28.217  130.513 1.00 81.18  ? 205  VAL B CG2   1 
ATOM   3346  N  N     . THR B  1  206  ? 29.792  31.000  127.015 1.00 73.28  ? 206  THR B N     1 
ATOM   3347  C  CA    . THR B  1  206  ? 30.255  31.409  125.701 1.00 68.22  ? 206  THR B CA    1 
ATOM   3348  C  C     . THR B  1  206  ? 31.331  30.453  125.190 1.00 72.88  ? 206  THR B C     1 
ATOM   3349  O  O     . THR B  1  206  ? 32.112  29.910  125.979 1.00 69.52  ? 206  THR B O     1 
ATOM   3350  C  CB    . THR B  1  206  ? 30.787  32.843  125.762 1.00 66.14  ? 206  THR B CB    1 
ATOM   3351  O  OG1   . THR B  1  206  ? 29.834  33.724  125.159 1.00 68.94  ? 206  THR B OG1   1 
ATOM   3352  C  CG2   . THR B  1  206  ? 32.133  32.995  125.066 1.00 69.56  ? 206  THR B CG2   1 
ATOM   3353  N  N     . PRO B  1  207  ? 31.366  30.202  123.870 1.00 74.03  ? 207  PRO B N     1 
ATOM   3354  C  CA    . PRO B  1  207  ? 32.371  29.274  123.321 1.00 64.69  ? 207  PRO B CA    1 
ATOM   3355  C  C     . PRO B  1  207  ? 33.797  29.610  123.720 1.00 61.72  ? 207  PRO B C     1 
ATOM   3356  O  O     . PRO B  1  207  ? 34.570  28.704  124.050 1.00 64.18  ? 207  PRO B O     1 
ATOM   3357  C  CB    . PRO B  1  207  ? 32.158  29.399  121.809 1.00 61.52  ? 207  PRO B CB    1 
ATOM   3358  C  CG    . PRO B  1  207  ? 30.737  29.800  121.670 1.00 68.57  ? 207  PRO B CG    1 
ATOM   3359  C  CD    . PRO B  1  207  ? 30.458  30.708  122.825 1.00 73.09  ? 207  PRO B CD    1 
ATOM   3360  N  N     . LEU B  1  208  ? 34.167  30.890  123.708 1.00 58.38  ? 208  LEU B N     1 
ATOM   3361  C  CA    . LEU B  1  208  ? 35.487  31.267  124.202 1.00 65.95  ? 208  LEU B CA    1 
ATOM   3362  C  C     . LEU B  1  208  ? 35.631  30.942  125.687 1.00 71.02  ? 208  LEU B C     1 
ATOM   3363  O  O     . LEU B  1  208  ? 36.659  30.396  126.112 1.00 66.69  ? 208  LEU B O     1 
ATOM   3364  C  CB    . LEU B  1  208  ? 35.733  32.751  123.935 1.00 65.81  ? 208  LEU B CB    1 
ATOM   3365  C  CG    . LEU B  1  208  ? 37.106  33.317  124.292 1.00 63.82  ? 208  LEU B CG    1 
ATOM   3366  C  CD1   . LEU B  1  208  ? 38.205  32.470  123.680 1.00 63.45  ? 208  LEU B CD1   1 
ATOM   3367  C  CD2   . LEU B  1  208  ? 37.208  34.757  123.816 1.00 69.99  ? 208  LEU B CD2   1 
ATOM   3368  N  N     . GLU B  1  209  ? 34.607  31.261  126.487 1.00 71.13  ? 209  GLU B N     1 
ATOM   3369  C  CA    . GLU B  1  209  ? 34.623  30.907  127.905 1.00 67.26  ? 209  GLU B CA    1 
ATOM   3370  C  C     . GLU B  1  209  ? 34.818  29.408  128.092 1.00 67.43  ? 209  GLU B C     1 
ATOM   3371  O  O     . GLU B  1  209  ? 35.634  28.973  128.913 1.00 69.21  ? 209  GLU B O     1 
ATOM   3372  C  CB    . GLU B  1  209  ? 33.325  31.353  128.580 1.00 68.15  ? 209  GLU B CB    1 
ATOM   3373  C  CG    . GLU B  1  209  ? 33.061  32.848  128.601 1.00 74.99  ? 209  GLU B CG    1 
ATOM   3374  C  CD    . GLU B  1  209  ? 31.712  33.179  129.232 1.00 83.32  ? 209  GLU B CD    1 
ATOM   3375  O  OE1   . GLU B  1  209  ? 31.165  34.271  128.961 1.00 82.38  ? 209  GLU B OE1   1 
ATOM   3376  O  OE2   . GLU B  1  209  ? 31.191  32.337  129.997 1.00 79.61  ? 209  GLU B OE2   1 
ATOM   3377  N  N     . ALA B  1  210  ? 34.062  28.602  127.344 1.00 66.76  ? 210  ALA B N     1 
ATOM   3378  C  CA    . ALA B  1  210  ? 34.154  27.152  127.487 1.00 67.53  ? 210  ALA B CA    1 
ATOM   3379  C  C     . ALA B  1  210  ? 35.535  26.646  127.092 1.00 67.49  ? 210  ALA B C     1 
ATOM   3380  O  O     . ALA B  1  210  ? 36.118  25.805  127.786 1.00 68.25  ? 210  ALA B O     1 
ATOM   3381  C  CB    . ALA B  1  210  ? 33.070  26.470  126.655 1.00 58.53  ? 210  ALA B CB    1 
ATOM   3382  N  N     . LEU B  1  211  ? 36.075  27.148  125.978 1.00 60.24  ? 211  LEU B N     1 
ATOM   3383  C  CA    . LEU B  1  211  ? 37.405  26.734  125.540 1.00 64.25  ? 211  LEU B CA    1 
ATOM   3384  C  C     . LEU B  1  211  ? 38.465  27.093  126.575 1.00 70.83  ? 211  LEU B C     1 
ATOM   3385  O  O     . LEU B  1  211  ? 39.401  26.317  126.820 1.00 66.81  ? 211  LEU B O     1 
ATOM   3386  C  CB    . LEU B  1  211  ? 37.727  27.375  124.190 1.00 68.14  ? 211  LEU B CB    1 
ATOM   3387  C  CG    . LEU B  1  211  ? 39.129  27.201  123.602 1.00 66.49  ? 211  LEU B CG    1 
ATOM   3388  C  CD1   . LEU B  1  211  ? 39.449  25.732  123.391 1.00 57.78  ? 211  LEU B CD1   1 
ATOM   3389  C  CD2   . LEU B  1  211  ? 39.251  27.971  122.293 1.00 68.32  ? 211  LEU B CD2   1 
ATOM   3390  N  N     . ASN B  1  212  ? 38.332  28.267  127.199 1.00 71.74  ? 212  ASN B N     1 
ATOM   3391  C  CA    . ASN B  1  212  ? 39.309  28.669  128.203 1.00 74.23  ? 212  ASN B CA    1 
ATOM   3392  C  C     . ASN B  1  212  ? 39.190  27.820  129.463 1.00 69.55  ? 212  ASN B C     1 
ATOM   3393  O  O     . ASN B  1  212  ? 40.205  27.402  130.034 1.00 63.85  ? 212  ASN B O     1 
ATOM   3394  C  CB    . ASN B  1  212  ? 39.146  30.155  128.516 1.00 75.88  ? 212  ASN B CB    1 
ATOM   3395  C  CG    . ASN B  1  212  ? 39.520  31.031  127.340 1.00 70.26  ? 212  ASN B CG    1 
ATOM   3396  O  OD1   . ASN B  1  212  ? 38.782  31.943  126.971 1.00 71.03  ? 212  ASN B OD1   1 
ATOM   3397  N  ND2   . ASN B  1  212  ? 40.673  30.752  126.738 1.00 64.22  ? 212  ASN B ND2   1 
ATOM   3398  N  N     . GLN B  1  213  ? 37.962  27.537  129.903 1.00 66.84  ? 213  GLN B N     1 
ATOM   3399  C  CA    . GLN B  1  213  ? 37.789  26.609  131.014 1.00 68.64  ? 213  GLN B CA    1 
ATOM   3400  C  C     . GLN B  1  213  ? 38.402  25.254  130.689 1.00 68.64  ? 213  GLN B C     1 
ATOM   3401  O  O     . GLN B  1  213  ? 39.002  24.614  131.557 1.00 68.45  ? 213  GLN B O     1 
ATOM   3402  C  CB    . GLN B  1  213  ? 36.308  26.448  131.355 1.00 71.14  ? 213  GLN B CB    1 
ATOM   3403  C  CG    . GLN B  1  213  ? 35.627  27.702  131.873 1.00 69.63  ? 213  GLN B CG    1 
ATOM   3404  C  CD    . GLN B  1  213  ? 34.175  27.452  132.239 1.00 68.92  ? 213  GLN B CD    1 
ATOM   3405  O  OE1   . GLN B  1  213  ? 33.854  26.465  132.903 1.00 64.91  ? 213  GLN B OE1   1 
ATOM   3406  N  NE2   . GLN B  1  213  ? 33.288  28.337  131.795 1.00 68.79  ? 213  GLN B NE2   1 
ATOM   3407  N  N     . ALA B  1  214  ? 38.282  24.812  129.436 1.00 68.62  ? 214  ALA B N     1 
ATOM   3408  C  CA    . ALA B  1  214  ? 38.783  23.493  129.062 1.00 63.51  ? 214  ALA B CA    1 
ATOM   3409  C  C     . ALA B  1  214  ? 40.305  23.449  129.096 1.00 64.37  ? 214  ALA B C     1 
ATOM   3410  O  O     . ALA B  1  214  ? 40.898  22.517  129.658 1.00 61.50  ? 214  ALA B O     1 
ATOM   3411  C  CB    . ALA B  1  214  ? 38.263  23.108  127.679 1.00 62.00  ? 214  ALA B CB    1 
ATOM   3412  N  N     . VAL B  1  215  ? 40.960  24.440  128.483 1.00 67.71  ? 215  VAL B N     1 
ATOM   3413  C  CA    . VAL B  1  215  ? 42.422  24.471  128.525 1.00 66.59  ? 215  VAL B CA    1 
ATOM   3414  C  C     . VAL B  1  215  ? 42.910  24.657  129.956 1.00 70.95  ? 215  VAL B C     1 
ATOM   3415  O  O     . VAL B  1  215  ? 43.966  24.130  130.337 1.00 63.79  ? 215  VAL B O     1 
ATOM   3416  C  CB    . VAL B  1  215  ? 42.979  25.558  127.581 1.00 65.17  ? 215  VAL B CB    1 
ATOM   3417  C  CG1   . VAL B  1  215  ? 42.593  25.251  126.149 1.00 74.37  ? 215  VAL B CG1   1 
ATOM   3418  C  CG2   . VAL B  1  215  ? 42.488  26.939  127.974 1.00 67.69  ? 215  VAL B CG2   1 
ATOM   3419  N  N     . GLU B  1  216  ? 42.143  25.381  130.778 1.00 71.20  ? 216  GLU B N     1 
ATOM   3420  C  CA    . GLU B  1  216  ? 42.483  25.519  132.186 1.00 65.93  ? 216  GLU B CA    1 
ATOM   3421  C  C     . GLU B  1  216  ? 42.430  24.170  132.891 1.00 68.06  ? 216  GLU B C     1 
ATOM   3422  O  O     . GLU B  1  216  ? 43.348  23.809  133.636 1.00 71.58  ? 216  GLU B O     1 
ATOM   3423  C  CB    . GLU B  1  216  ? 41.534  26.521  132.839 1.00 70.25  ? 216  GLU B CB    1 
ATOM   3424  C  CG    . GLU B  1  216  ? 41.686  26.649  134.338 1.00 81.47  ? 216  GLU B CG    1 
ATOM   3425  C  CD    . GLU B  1  216  ? 43.087  27.055  134.751 1.00 92.68  ? 216  GLU B CD    1 
ATOM   3426  O  OE1   . GLU B  1  216  ? 43.510  26.656  135.855 1.00 98.36  ? 216  GLU B OE1   1 
ATOM   3427  O  OE2   . GLU B  1  216  ? 43.766  27.766  133.976 1.00 95.57  ? 216  GLU B OE2   1 
ATOM   3428  N  N     . ILE B  1  217  ? 41.350  23.415  132.665 1.00 63.63  ? 217  ILE B N     1 
ATOM   3429  C  CA    . ILE B  1  217  ? 41.236  22.063  133.212 1.00 63.97  ? 217  ILE B CA    1 
ATOM   3430  C  C     . ILE B  1  217  ? 42.440  21.228  132.803 1.00 64.80  ? 217  ILE B C     1 
ATOM   3431  O  O     . ILE B  1  217  ? 43.025  20.503  133.616 1.00 61.15  ? 217  ILE B O     1 
ATOM   3432  C  CB    . ILE B  1  217  ? 39.924  21.403  132.747 1.00 57.98  ? 217  ILE B CB    1 
ATOM   3433  C  CG1   . ILE B  1  217  ? 38.708  22.131  133.314 1.00 57.09  ? 217  ILE B CG1   1 
ATOM   3434  C  CG2   . ILE B  1  217  ? 39.886  19.932  133.148 1.00 53.96  ? 217  ILE B CG2   1 
ATOM   3435  C  CD1   . ILE B  1  217  ? 37.398  21.671  132.707 1.00 54.12  ? 217  ILE B CD1   1 
ATOM   3436  N  N     . LEU B  1  218  ? 42.826  21.319  131.528 1.00 68.77  ? 218  LEU B N     1 
ATOM   3437  C  CA    . LEU B  1  218  ? 43.896  20.462  131.025 1.00 67.06  ? 218  LEU B CA    1 
ATOM   3438  C  C     . LEU B  1  218  ? 45.241  20.821  131.650 1.00 69.93  ? 218  LEU B C     1 
ATOM   3439  O  O     . LEU B  1  218  ? 46.014  19.931  132.025 1.00 68.66  ? 218  LEU B O     1 
ATOM   3440  C  CB    . LEU B  1  218  ? 43.964  20.544  129.502 1.00 68.73  ? 218  LEU B CB    1 
ATOM   3441  C  CG    . LEU B  1  218  ? 44.959  19.591  128.834 1.00 67.50  ? 218  LEU B CG    1 
ATOM   3442  C  CD1   . LEU B  1  218  ? 44.713  18.155  129.277 1.00 59.12  ? 218  LEU B CD1   1 
ATOM   3443  C  CD2   . LEU B  1  218  ? 44.873  19.712  127.321 1.00 53.49  ? 218  LEU B CD2   1 
ATOM   3444  N  N     . ARG B  1  219  ? 45.542  22.116  131.769 1.00 68.29  ? 219  ARG B N     1 
ATOM   3445  C  CA    . ARG B  1  219  ? 46.774  22.524  132.439 1.00 70.23  ? 219  ARG B CA    1 
ATOM   3446  C  C     . ARG B  1  219  ? 46.768  22.095  133.903 1.00 75.38  ? 219  ARG B C     1 
ATOM   3447  O  O     . ARG B  1  219  ? 47.780  21.601  134.429 1.00 73.17  ? 219  ARG B O     1 
ATOM   3448  C  CB    . ARG B  1  219  ? 46.949  24.036  132.325 1.00 72.32  ? 219  ARG B CB    1 
ATOM   3449  C  CG    . ARG B  1  219  ? 48.188  24.572  133.014 1.00 80.53  ? 219  ARG B CG    1 
ATOM   3450  C  CD    . ARG B  1  219  ? 48.033  26.050  133.311 1.00 83.08  ? 219  ARG B CD    1 
ATOM   3451  N  NE    . ARG B  1  219  ? 46.886  26.296  134.178 1.00 78.65  ? 219  ARG B NE    1 
ATOM   3452  C  CZ    . ARG B  1  219  ? 46.934  26.243  135.504 1.00 80.57  ? 219  ARG B CZ    1 
ATOM   3453  N  NH1   . ARG B  1  219  ? 48.076  25.956  136.115 1.00 80.13  ? 219  ARG B NH1   1 
ATOM   3454  N  NH2   . ARG B  1  219  ? 45.843  26.477  136.220 1.00 81.59  ? 219  ARG B NH2   1 
ATOM   3455  N  N     . GLU B  1  220  ? 45.629  22.281  134.575 1.00 74.62  ? 220  GLU B N     1 
ATOM   3456  C  CA    . GLU B  1  220  ? 45.488  21.859  135.962 1.00 78.20  ? 220  GLU B CA    1 
ATOM   3457  C  C     . GLU B  1  220  ? 45.739  20.364  136.108 1.00 76.09  ? 220  GLU B C     1 
ATOM   3458  O  O     . GLU B  1  220  ? 46.330  19.918  137.099 1.00 74.05  ? 220  GLU B O     1 
ATOM   3459  C  CB    . GLU B  1  220  ? 44.092  22.241  136.454 1.00 84.89  ? 220  GLU B CB    1 
ATOM   3460  C  CG    . GLU B  1  220  ? 43.750  21.858  137.878 1.00 90.82  ? 220  GLU B CG    1 
ATOM   3461  C  CD    . GLU B  1  220  ? 42.342  22.293  138.252 1.00 102.89 ? 220  GLU B CD    1 
ATOM   3462  O  OE1   . GLU B  1  220  ? 41.782  23.165  137.548 1.00 87.95  ? 220  GLU B OE1   1 
ATOM   3463  O  OE2   . GLU B  1  220  ? 41.793  21.760  139.241 1.00 115.20 ? 220  GLU B OE2   1 
ATOM   3464  N  N     . HIS B  1  221  ? 45.308  19.574  135.122 1.00 72.65  ? 221  HIS B N     1 
ATOM   3465  C  CA    . HIS B  1  221  ? 45.572  18.138  135.156 1.00 69.64  ? 221  HIS B CA    1 
ATOM   3466  C  C     . HIS B  1  221  ? 47.042  17.837  134.899 1.00 73.05  ? 221  HIS B C     1 
ATOM   3467  O  O     . HIS B  1  221  ? 47.604  16.913  135.498 1.00 73.91  ? 221  HIS B O     1 
ATOM   3468  C  CB    . HIS B  1  221  ? 44.698  17.414  134.135 1.00 63.17  ? 221  HIS B CB    1 
ATOM   3469  C  CG    . HIS B  1  221  ? 43.335  17.067  134.642 1.00 65.77  ? 221  HIS B CG    1 
ATOM   3470  N  ND1   . HIS B  1  221  ? 42.319  17.992  134.740 1.00 69.28  ? 221  HIS B ND1   1 
ATOM   3471  C  CD2   . HIS B  1  221  ? 42.819  15.892  135.074 1.00 70.47  ? 221  HIS B CD2   1 
ATOM   3472  C  CE1   . HIS B  1  221  ? 41.235  17.403  135.213 1.00 74.33  ? 221  HIS B CE1   1 
ATOM   3473  N  NE2   . HIS B  1  221  ? 41.511  16.128  135.423 1.00 76.79  ? 221  HIS B NE2   1 
ATOM   3474  N  N     . LEU B  1  222  ? 47.678  18.594  134.000 1.00 75.10  ? 222  LEU B N     1 
ATOM   3475  C  CA    . LEU B  1  222  ? 49.108  18.412  133.768 1.00 68.60  ? 222  LEU B CA    1 
ATOM   3476  C  C     . LEU B  1  222  ? 49.911  18.676  135.033 1.00 73.08  ? 222  LEU B C     1 
ATOM   3477  O  O     . LEU B  1  222  ? 50.983  18.088  135.225 1.00 62.69  ? 222  LEU B O     1 
ATOM   3478  C  CB    . LEU B  1  222  ? 49.583  19.326  132.640 1.00 64.39  ? 222  LEU B CB    1 
ATOM   3479  C  CG    . LEU B  1  222  ? 49.033  19.001  131.251 1.00 62.99  ? 222  LEU B CG    1 
ATOM   3480  C  CD1   . LEU B  1  222  ? 49.575  19.974  130.219 1.00 60.68  ? 222  LEU B CD1   1 
ATOM   3481  C  CD2   . LEU B  1  222  ? 49.361  17.566  130.869 1.00 55.54  ? 222  LEU B CD2   1 
ATOM   3482  N  N     . THR B  1  223  ? 49.407  19.554  135.903 1.00 81.83  ? 223  THR B N     1 
ATOM   3483  C  CA    . THR B  1  223  ? 50.088  19.807  137.172 1.00 77.53  ? 223  THR B CA    1 
ATOM   3484  C  C     . THR B  1  223  ? 50.152  18.572  138.066 1.00 75.37  ? 223  THR B C     1 
ATOM   3485  O  O     . THR B  1  223  ? 50.996  18.520  138.967 1.00 75.49  ? 223  THR B O     1 
ATOM   3486  C  CB    . THR B  1  223  ? 49.398  20.931  137.941 1.00 74.22  ? 223  THR B CB    1 
ATOM   3487  O  OG1   . THR B  1  223  ? 49.444  22.132  137.163 1.00 85.54  ? 223  THR B OG1   1 
ATOM   3488  C  CG2   . THR B  1  223  ? 50.080  21.163  139.277 1.00 79.35  ? 223  THR B CG2   1 
ATOM   3489  N  N     . TYR B  1  224  ? 49.285  17.579  137.842 1.00 75.05  ? 224  TYR B N     1 
ATOM   3490  C  CA    . TYR B  1  224  ? 49.165  16.421  138.725 1.00 70.63  ? 224  TYR B CA    1 
ATOM   3491  C  C     . TYR B  1  224  ? 50.358  15.474  138.670 1.00 71.33  ? 224  TYR B C     1 
ATOM   3492  O  O     . TYR B  1  224  ? 50.351  14.465  139.382 1.00 75.82  ? 224  TYR B O     1 
ATOM   3493  C  CB    . TYR B  1  224  ? 47.895  15.637  138.391 1.00 72.05  ? 224  TYR B CB    1 
ATOM   3494  C  CG    . TYR B  1  224  ? 46.607  16.371  138.691 1.00 80.79  ? 224  TYR B CG    1 
ATOM   3495  C  CD1   . TYR B  1  224  ? 46.560  17.379  139.649 1.00 82.91  ? 224  TYR B CD1   1 
ATOM   3496  C  CD2   . TYR B  1  224  ? 45.434  16.053  138.018 1.00 80.84  ? 224  TYR B CD2   1 
ATOM   3497  C  CE1   . TYR B  1  224  ? 45.377  18.050  139.926 1.00 83.99  ? 224  TYR B CE1   1 
ATOM   3498  C  CE2   . TYR B  1  224  ? 44.249  16.715  138.288 1.00 81.57  ? 224  TYR B CE2   1 
ATOM   3499  C  CZ    . TYR B  1  224  ? 44.225  17.713  139.242 1.00 84.99  ? 224  TYR B CZ    1 
ATOM   3500  O  OH    . TYR B  1  224  ? 43.044  18.372  139.508 1.00 87.28  ? 224  TYR B OH    1 
ATOM   3501  N  N     . PHE B  1  225  ? 51.371  15.748  137.854 1.00 75.51  ? 225  PHE B N     1 
ATOM   3502  C  CA    . PHE B  1  225  ? 52.546  14.894  137.775 1.00 74.19  ? 225  PHE B CA    1 
ATOM   3503  C  C     . PHE B  1  225  ? 53.679  15.370  138.674 1.00 82.68  ? 225  PHE B C     1 
ATOM   3504  O  O     . PHE B  1  225  ? 54.844  15.059  138.403 1.00 83.22  ? 225  PHE B O     1 
ATOM   3505  C  CB    . PHE B  1  225  ? 53.022  14.794  136.324 1.00 70.55  ? 225  PHE B CB    1 
ATOM   3506  C  CG    . PHE B  1  225  ? 52.074  14.050  135.428 1.00 64.84  ? 225  PHE B CG    1 
ATOM   3507  C  CD1   . PHE B  1  225  ? 51.036  14.710  134.789 1.00 63.29  ? 225  PHE B CD1   1 
ATOM   3508  C  CD2   . PHE B  1  225  ? 52.211  12.684  135.237 1.00 59.53  ? 225  PHE B CD2   1 
ATOM   3509  C  CE1   . PHE B  1  225  ? 50.157  14.021  133.971 1.00 57.84  ? 225  PHE B CE1   1 
ATOM   3510  C  CE2   . PHE B  1  225  ? 51.334  11.991  134.421 1.00 51.09  ? 225  PHE B CE2   1 
ATOM   3511  C  CZ    . PHE B  1  225  ? 50.306  12.660  133.788 1.00 50.50  ? 225  PHE B CZ    1 
ATOM   3512  N  N     . SER B  1  226  ? 53.364  16.119  139.733 1.00 87.02  ? 226  SER B N     1 
ATOM   3513  C  CA    . SER B  1  226  ? 54.399  16.762  140.537 1.00 92.03  ? 226  SER B CA    1 
ATOM   3514  C  C     . SER B  1  226  ? 54.973  15.837  141.610 1.00 93.95  ? 226  SER B C     1 
ATOM   3515  O  O     . SER B  1  226  ? 56.164  15.508  141.589 1.00 97.03  ? 226  SER B O     1 
ATOM   3516  C  CB    . SER B  1  226  ? 53.837  18.029  141.183 1.00 90.45  ? 226  SER B CB    1 
ATOM   3517  O  OG    . SER B  1  226  ? 53.380  18.939  140.200 1.00 89.85  ? 226  SER B OG    1 
ATOM   3518  N  N     . ASN B  1  227  ? 54.142  15.410  142.561 1.00 91.31  ? 227  ASN B N     1 
ATOM   3519  C  CA    . ASN B  1  227  ? 54.656  14.809  143.784 1.00 100.73 ? 227  ASN B CA    1 
ATOM   3520  C  C     . ASN B  1  227  ? 54.453  13.304  143.777 1.00 97.37  ? 227  ASN B C     1 
ATOM   3521  O  O     . ASN B  1  227  ? 53.299  12.841  143.757 1.00 96.51  ? 227  ASN B O     1 
ATOM   3522  C  CB    . ASN B  1  227  ? 53.982  15.423  145.005 1.00 110.11 ? 227  ASN B CB    1 
ATOM   3523  C  CG    . ASN B  1  227  ? 54.491  16.822  145.307 1.00 115.88 ? 227  ASN B CG    1 
ATOM   3524  O  OD1   . ASN B  1  227  ? 55.542  17.239  144.816 1.00 108.44 ? 227  ASN B OD1   1 
ATOM   3525  N  ND2   . ASN B  1  227  ? 53.750  17.552  146.134 1.00 126.63 ? 227  ASN B ND2   1 
ATOM   3526  N  N     . PRO B  1  228  ? 55.530  12.505  143.788 1.00 95.22  ? 228  PRO B N     1 
ATOM   3527  C  CA    . PRO B  1  228  ? 55.500  11.046  143.931 1.00 90.26  ? 228  PRO B CA    1 
ATOM   3528  C  C     . PRO B  1  228  ? 55.380  10.613  145.389 1.00 89.32  ? 228  PRO B C     1 
ATOM   3529  O  O     . PRO B  1  228  ? 54.451  9.882   145.734 1.00 90.06  ? 228  PRO B O     1 
ATOM   3530  C  CB    . PRO B  1  228  ? 56.847  10.603  143.342 1.00 95.34  ? 228  PRO B CB    1 
ATOM   3531  C  CG    . PRO B  1  228  ? 57.420  11.834  142.662 1.00 95.88  ? 228  PRO B CG    1 
ATOM   3532  C  CD    . PRO B  1  228  ? 56.873  12.984  143.433 1.00 93.28  ? 228  PRO B CD    1 
ATOM   3533  N  N     . MET C  2  1    ? 66.643  -19.255 114.578 1.00 123.06 ? 1    MET C N     1 
ATOM   3534  C  CA    . MET C  2  1    ? 65.311  -19.379 115.161 1.00 119.99 ? 1    MET C CA    1 
ATOM   3535  C  C     . MET C  2  1    ? 64.644  -20.683 114.728 1.00 115.91 ? 1    MET C C     1 
ATOM   3536  O  O     . MET C  2  1    ? 65.031  -21.285 113.723 1.00 114.68 ? 1    MET C O     1 
ATOM   3537  C  CB    . MET C  2  1    ? 64.442  -18.184 114.766 1.00 112.72 ? 1    MET C CB    1 
ATOM   3538  C  CG    . MET C  2  1    ? 64.104  -18.132 113.283 1.00 105.95 ? 1    MET C CG    1 
ATOM   3539  S  SD    . MET C  2  1    ? 63.732  -16.463 112.714 1.00 118.63 ? 1    MET C SD    1 
ATOM   3540  C  CE    . MET C  2  1    ? 65.351  -15.702 112.833 1.00 99.60  ? 1    MET C CE    1 
ATOM   3541  N  N     . GLU C  2  2    ? 63.645  -21.113 115.495 1.00 97.46  ? 2    GLU C N     1 
ATOM   3542  C  CA    . GLU C  2  2    ? 62.930  -22.343 115.179 1.00 94.96  ? 2    GLU C CA    1 
ATOM   3543  C  C     . GLU C  2  2    ? 62.177  -22.202 113.859 1.00 91.07  ? 2    GLU C C     1 
ATOM   3544  O  O     . GLU C  2  2    ? 61.584  -21.158 113.569 1.00 88.37  ? 2    GLU C O     1 
ATOM   3545  C  CB    . GLU C  2  2    ? 61.964  -22.687 116.315 1.00 91.85  ? 2    GLU C CB    1 
ATOM   3546  C  CG    . GLU C  2  2    ? 61.015  -23.841 116.028 1.00 93.70  ? 2    GLU C CG    1 
ATOM   3547  C  CD    . GLU C  2  2    ? 61.352  -25.087 116.821 1.00 103.33 ? 2    GLU C CD    1 
ATOM   3548  O  OE1   . GLU C  2  2    ? 62.546  -25.304 117.115 1.00 109.09 ? 2    GLU C OE1   1 
ATOM   3549  O  OE2   . GLU C  2  2    ? 60.419  -25.848 117.156 1.00 102.64 ? 2    GLU C OE2   1 
ATOM   3550  N  N     . ILE C  2  3    ? 62.223  -23.256 113.044 1.00 82.64  ? 3    ILE C N     1 
ATOM   3551  C  CA    . ILE C  2  3    ? 61.510  -23.317 111.771 1.00 71.33  ? 3    ILE C CA    1 
ATOM   3552  C  C     . ILE C  2  3    ? 60.632  -24.559 111.803 1.00 68.92  ? 3    ILE C C     1 
ATOM   3553  O  O     . ILE C  2  3    ? 61.130  -25.680 111.636 1.00 75.74  ? 3    ILE C O     1 
ATOM   3554  C  CB    . ILE C  2  3    ? 62.464  -23.360 110.569 1.00 70.75  ? 3    ILE C CB    1 
ATOM   3555  C  CG1   . ILE C  2  3    ? 63.541  -22.277 110.681 1.00 79.61  ? 3    ILE C CG1   1 
ATOM   3556  C  CG2   . ILE C  2  3    ? 61.683  -23.221 109.272 1.00 61.66  ? 3    ILE C CG2   1 
ATOM   3557  C  CD1   . ILE C  2  3    ? 63.031  -20.867 110.503 1.00 78.68  ? 3    ILE C CD1   1 
ATOM   3558  N  N     . LYS C  2  4    ? 59.331  -24.367 111.999 1.00 64.50  ? 4    LYS C N     1 
ATOM   3559  C  CA    . LYS C  2  4    ? 58.378  -25.465 112.096 1.00 62.18  ? 4    LYS C CA    1 
ATOM   3560  C  C     . LYS C  2  4    ? 57.711  -25.681 110.742 1.00 67.76  ? 4    LYS C C     1 
ATOM   3561  O  O     . LYS C  2  4    ? 57.037  -24.784 110.228 1.00 72.77  ? 4    LYS C O     1 
ATOM   3562  C  CB    . LYS C  2  4    ? 57.330  -25.177 113.171 1.00 64.68  ? 4    LYS C CB    1 
ATOM   3563  C  CG    . LYS C  2  4    ? 56.397  -26.347 113.434 1.00 77.01  ? 4    LYS C CG    1 
ATOM   3564  C  CD    . LYS C  2  4    ? 55.338  -26.018 114.474 1.00 73.96  ? 4    LYS C CD    1 
ATOM   3565  C  CE    . LYS C  2  4    ? 54.533  -27.260 114.835 1.00 73.99  ? 4    LYS C CE    1 
ATOM   3566  N  NZ    . LYS C  2  4    ? 53.922  -27.910 113.638 1.00 69.94  ? 4    LYS C NZ    1 
ATOM   3567  N  N     . ARG C  2  5    ? 57.890  -26.869 110.175 1.00 65.50  ? 5    ARG C N     1 
ATOM   3568  C  CA    . ARG C  2  5    ? 57.326  -27.211 108.879 1.00 62.98  ? 5    ARG C CA    1 
ATOM   3569  C  C     . ARG C  2  5    ? 56.124  -28.129 109.051 1.00 65.37  ? 5    ARG C C     1 
ATOM   3570  O  O     . ARG C  2  5    ? 56.052  -28.917 109.998 1.00 73.08  ? 5    ARG C O     1 
ATOM   3571  C  CB    . ARG C  2  5    ? 58.372  -27.886 107.986 1.00 67.17  ? 5    ARG C CB    1 
ATOM   3572  C  CG    . ARG C  2  5    ? 58.911  -29.188 108.544 1.00 76.71  ? 5    ARG C CG    1 
ATOM   3573  C  CD    . ARG C  2  5    ? 60.030  -29.758 107.683 1.00 84.80  ? 5    ARG C CD    1 
ATOM   3574  N  NE    . ARG C  2  5    ? 59.666  -29.818 106.270 1.00 93.35  ? 5    ARG C NE    1 
ATOM   3575  C  CZ    . ARG C  2  5    ? 60.390  -29.291 105.287 1.00 93.34  ? 5    ARG C CZ    1 
ATOM   3576  N  NH1   . ARG C  2  5    ? 61.534  -28.673 105.558 1.00 81.01  ? 5    ARG C NH1   1 
ATOM   3577  N  NH2   . ARG C  2  5    ? 59.977  -29.394 104.030 1.00 92.20  ? 5    ARG C NH2   1 
ATOM   3578  N  N     . PHE C  2  6    ? 55.180  -28.021 108.123 1.00 66.41  ? 6    PHE C N     1 
ATOM   3579  C  CA    . PHE C  2  6    ? 53.952  -28.804 108.120 1.00 70.48  ? 6    PHE C CA    1 
ATOM   3580  C  C     . PHE C  2  6    ? 53.963  -29.777 106.944 1.00 82.96  ? 6    PHE C C     1 
ATOM   3581  O  O     . PHE C  2  6    ? 54.896  -29.807 106.134 1.00 90.25  ? 6    PHE C O     1 
ATOM   3582  C  CB    . PHE C  2  6    ? 52.726  -27.888 108.049 1.00 68.66  ? 6    PHE C CB    1 
ATOM   3583  C  CG    . PHE C  2  6    ? 52.638  -26.894 109.172 1.00 73.77  ? 6    PHE C CG    1 
ATOM   3584  C  CD1   . PHE C  2  6    ? 53.303  -25.679 109.097 1.00 73.04  ? 6    PHE C CD1   1 
ATOM   3585  C  CD2   . PHE C  2  6    ? 51.883  -27.170 110.300 1.00 77.42  ? 6    PHE C CD2   1 
ATOM   3586  C  CE1   . PHE C  2  6    ? 53.220  -24.761 110.129 1.00 70.48  ? 6    PHE C CE1   1 
ATOM   3587  C  CE2   . PHE C  2  6    ? 51.797  -26.256 111.335 1.00 74.98  ? 6    PHE C CE2   1 
ATOM   3588  C  CZ    . PHE C  2  6    ? 52.466  -25.052 111.249 1.00 71.99  ? 6    PHE C CZ    1 
ATOM   3589  N  N     . GLY C  2  7    ? 52.906  -30.581 106.854 1.00 84.97  ? 7    GLY C N     1 
ATOM   3590  C  CA    . GLY C  2  7    ? 52.721  -31.462 105.717 1.00 91.36  ? 7    GLY C CA    1 
ATOM   3591  C  C     . GLY C  2  7    ? 53.221  -32.879 105.913 1.00 102.62 ? 7    GLY C C     1 
ATOM   3592  O  O     . GLY C  2  7    ? 54.287  -33.097 106.498 1.00 100.11 ? 7    GLY C O     1 
ATOM   3593  N  N     . ARG C  2  8    ? 52.459  -33.853 105.413 1.00 108.74 ? 8    ARG C N     1 
ATOM   3594  C  CA    . ARG C  2  8    ? 52.799  -35.264 105.533 1.00 114.69 ? 8    ARG C CA    1 
ATOM   3595  C  C     . ARG C  2  8    ? 53.268  -35.887 104.224 1.00 115.66 ? 8    ARG C C     1 
ATOM   3596  O  O     . ARG C  2  8    ? 53.603  -37.076 104.208 1.00 122.41 ? 8    ARG C O     1 
ATOM   3597  C  CB    . ARG C  2  8    ? 51.597  -36.049 106.076 1.00 116.23 ? 8    ARG C CB    1 
ATOM   3598  C  CG    . ARG C  2  8    ? 50.263  -35.673 105.442 1.00 116.03 ? 8    ARG C CG    1 
ATOM   3599  C  CD    . ARG C  2  8    ? 49.087  -36.313 106.179 1.00 129.67 ? 8    ARG C CD    1 
ATOM   3600  N  NE    . ARG C  2  8    ? 48.556  -37.487 105.487 1.00 140.14 ? 8    ARG C NE    1 
ATOM   3601  C  CZ    . ARG C  2  8    ? 48.877  -38.744 105.780 1.00 137.85 ? 8    ARG C CZ    1 
ATOM   3602  N  NH1   . ARG C  2  8    ? 49.733  -39.004 106.758 1.00 141.81 ? 8    ARG C NH1   1 
ATOM   3603  N  NH2   . ARG C  2  8    ? 48.340  -39.745 105.093 1.00 120.08 ? 8    ARG C NH2   1 
ATOM   3604  N  N     . ILE C  2  9    ? 53.308  -35.126 103.134 1.00 112.61 ? 9    ILE C N     1 
ATOM   3605  C  CA    . ILE C  2  9    ? 53.723  -35.664 101.842 1.00 109.90 ? 9    ILE C CA    1 
ATOM   3606  C  C     . ILE C  2  9    ? 55.245  -35.704 101.775 1.00 111.37 ? 9    ILE C C     1 
ATOM   3607  O  O     . ILE C  2  9    ? 55.921  -34.699 102.030 1.00 106.64 ? 9    ILE C O     1 
ATOM   3608  C  CB    . ILE C  2  9    ? 53.131  -34.835 100.691 1.00 106.34 ? 9    ILE C CB    1 
ATOM   3609  C  CG1   . ILE C  2  9    ? 51.636  -35.131 100.531 1.00 92.36  ? 9    ILE C CG1   1 
ATOM   3610  C  CG2   . ILE C  2  9    ? 53.873  -35.112 99.392  1.00 102.11 ? 9    ILE C CG2   1 
ATOM   3611  C  CD1   . ILE C  2  9    ? 51.015  -34.504 99.296  1.00 80.87  ? 9    ILE C CD1   1 
ATOM   3612  N  N     . ARG C  2  10   ? 55.785  -36.873 101.433 1.00 111.89 ? 10   ARG C N     1 
ATOM   3613  C  CA    . ARG C  2  10   ? 57.222  -37.103 101.327 1.00 113.06 ? 10   ARG C CA    1 
ATOM   3614  C  C     . ARG C  2  10   ? 57.603  -37.171 99.853  1.00 114.07 ? 10   ARG C C     1 
ATOM   3615  O  O     . ARG C  2  10   ? 57.143  -38.065 99.132  1.00 114.65 ? 10   ARG C O     1 
ATOM   3616  C  CB    . ARG C  2  10   ? 57.614  -38.395 102.051 1.00 111.93 ? 10   ARG C CB    1 
ATOM   3617  C  CG    . ARG C  2  10   ? 59.109  -38.709 102.062 1.00 113.04 ? 10   ARG C CG    1 
ATOM   3618  C  CD    . ARG C  2  10   ? 59.510  -39.736 101.001 1.00 112.77 ? 10   ARG C CD    1 
ATOM   3619  N  NE    . ARG C  2  10   ? 58.731  -40.972 101.078 1.00 120.65 ? 10   ARG C NE    1 
ATOM   3620  C  CZ    . ARG C  2  10   ? 59.165  -42.158 100.658 1.00 118.26 ? 10   ARG C CZ    1 
ATOM   3621  N  NH1   . ARG C  2  10   ? 58.389  -43.230 100.761 1.00 112.73 ? 10   ARG C NH1   1 
ATOM   3622  N  NH2   . ARG C  2  10   ? 60.384  -42.275 100.148 1.00 117.48 ? 10   ARG C NH2   1 
ATOM   3623  N  N     . GLU C  2  11   ? 58.436  -36.231 99.408  1.00 110.66 ? 11   GLU C N     1 
ATOM   3624  C  CA    . GLU C  2  11   ? 58.918  -36.228 98.031  1.00 99.82  ? 11   GLU C CA    1 
ATOM   3625  C  C     . GLU C  2  11   ? 60.049  -37.238 97.902  1.00 96.91  ? 11   GLU C C     1 
ATOM   3626  O  O     . GLU C  2  11   ? 61.129  -37.046 98.471  1.00 96.46  ? 11   GLU C O     1 
ATOM   3627  C  CB    . GLU C  2  11   ? 59.390  -34.834 97.616  1.00 97.07  ? 11   GLU C CB    1 
ATOM   3628  C  CG    . GLU C  2  11   ? 59.493  -33.829 98.750  1.00 101.83 ? 11   GLU C CG    1 
ATOM   3629  C  CD    . GLU C  2  11   ? 58.256  -32.954 98.867  1.00 108.57 ? 11   GLU C CD    1 
ATOM   3630  O  OE1   . GLU C  2  11   ? 58.302  -31.956 99.618  1.00 118.30 ? 11   GLU C OE1   1 
ATOM   3631  O  OE2   . GLU C  2  11   ? 57.239  -33.260 98.206  1.00 101.87 ? 11   GLU C OE2   1 
ATOM   3632  N  N     . VAL C  2  12   ? 59.808  -38.308 97.141  1.00 94.15  ? 12   VAL C N     1 
ATOM   3633  C  CA    . VAL C  2  12   ? 60.824  -39.338 96.967  1.00 93.31  ? 12   VAL C CA    1 
ATOM   3634  C  C     . VAL C  2  12   ? 62.027  -38.824 96.194  1.00 90.44  ? 12   VAL C C     1 
ATOM   3635  O  O     . VAL C  2  12   ? 63.121  -39.385 96.318  1.00 100.36 ? 12   VAL C O     1 
ATOM   3636  C  CB    . VAL C  2  12   ? 60.231  -40.568 96.259  1.00 91.91  ? 12   VAL C CB    1 
ATOM   3637  C  CG1   . VAL C  2  12   ? 59.192  -41.231 97.143  1.00 102.43 ? 12   VAL C CG1   1 
ATOM   3638  C  CG2   . VAL C  2  12   ? 59.628  -40.164 94.926  1.00 84.44  ? 12   VAL C CG2   1 
ATOM   3639  N  N     . ILE C  2  13   ? 61.859  -37.774 95.396  1.00 88.45  ? 13   ILE C N     1 
ATOM   3640  C  CA    . ILE C  2  13   ? 62.952  -37.239 94.588  1.00 78.58  ? 13   ILE C CA    1 
ATOM   3641  C  C     . ILE C  2  13   ? 63.005  -35.724 94.754  1.00 73.76  ? 13   ILE C C     1 
ATOM   3642  O  O     . ILE C  2  13   ? 61.960  -35.084 94.930  1.00 78.05  ? 13   ILE C O     1 
ATOM   3643  C  CB    . ILE C  2  13   ? 62.792  -37.627 93.109  1.00 69.35  ? 13   ILE C CB    1 
ATOM   3644  C  CG1   . ILE C  2  13   ? 61.421  -37.201 92.585  1.00 69.30  ? 13   ILE C CG1   1 
ATOM   3645  C  CG2   . ILE C  2  13   ? 62.986  -39.124 92.923  1.00 82.01  ? 13   ILE C CG2   1 
ATOM   3646  C  CD1   . ILE C  2  13   ? 61.212  -37.499 91.112  1.00 72.42  ? 13   ILE C CD1   1 
ATOM   3647  N  N     . PRO C  2  14   ? 64.185  -35.113 94.721  1.00 64.89  ? 14   PRO C N     1 
ATOM   3648  C  CA    . PRO C  2  14   ? 64.266  -33.652 94.768  1.00 61.26  ? 14   PRO C CA    1 
ATOM   3649  C  C     . PRO C  2  14   ? 63.999  -33.048 93.397  1.00 61.18  ? 14   PRO C C     1 
ATOM   3650  O  O     . PRO C  2  14   ? 63.868  -33.744 92.390  1.00 61.95  ? 14   PRO C O     1 
ATOM   3651  C  CB    . PRO C  2  14   ? 65.706  -33.393 95.216  1.00 65.91  ? 14   PRO C CB    1 
ATOM   3652  C  CG    . PRO C  2  14   ? 66.459  -34.562 94.695  1.00 64.14  ? 14   PRO C CG    1 
ATOM   3653  C  CD    . PRO C  2  14   ? 65.517  -35.740 94.769  1.00 66.18  ? 14   PRO C CD    1 
ATOM   3654  N  N     . LEU C  2  15   ? 63.925  -31.723 93.377  1.00 62.39  ? 15   LEU C N     1 
ATOM   3655  C  CA    . LEU C  2  15   ? 63.718  -31.015 92.127  1.00 58.09  ? 15   LEU C CA    1 
ATOM   3656  C  C     . LEU C  2  15   ? 64.934  -31.196 91.222  1.00 62.76  ? 15   LEU C C     1 
ATOM   3657  O  O     . LEU C  2  15   ? 66.067  -31.254 91.710  1.00 64.83  ? 15   LEU C O     1 
ATOM   3658  C  CB    . LEU C  2  15   ? 63.479  -29.528 92.381  1.00 60.20  ? 15   LEU C CB    1 
ATOM   3659  C  CG    . LEU C  2  15   ? 62.051  -29.001 92.245  1.00 57.05  ? 15   LEU C CG    1 
ATOM   3660  C  CD1   . LEU C  2  15   ? 61.083  -29.841 93.038  1.00 54.23  ? 15   LEU C CD1   1 
ATOM   3661  C  CD2   . LEU C  2  15   ? 61.988  -27.560 92.707  1.00 57.03  ? 15   LEU C CD2   1 
ATOM   3662  N  N     . PRO C  2  16   ? 64.734  -31.311 89.911  1.00 64.36  ? 16   PRO C N     1 
ATOM   3663  C  CA    . PRO C  2  16   ? 65.870  -31.390 88.989  1.00 61.87  ? 16   PRO C CA    1 
ATOM   3664  C  C     . PRO C  2  16   ? 66.673  -30.102 89.019  1.00 61.34  ? 16   PRO C C     1 
ATOM   3665  O  O     . PRO C  2  16   ? 66.203  -29.085 89.552  1.00 62.57  ? 16   PRO C O     1 
ATOM   3666  C  CB    . PRO C  2  16   ? 65.203  -31.601 87.620  1.00 61.50  ? 16   PRO C CB    1 
ATOM   3667  C  CG    . PRO C  2  16   ? 63.833  -32.112 87.928  1.00 61.05  ? 16   PRO C CG    1 
ATOM   3668  C  CD    . PRO C  2  16   ? 63.444  -31.454 89.216  1.00 60.79  ? 16   PRO C CD    1 
ATOM   3669  N  N     . PRO C  2  17   ? 67.894  -30.105 88.485  1.00 62.64  ? 17   PRO C N     1 
ATOM   3670  C  CA    . PRO C  2  17   ? 68.627  -28.840 88.326  1.00 62.48  ? 17   PRO C CA    1 
ATOM   3671  C  C     . PRO C  2  17   ? 67.792  -27.863 87.516  1.00 63.75  ? 17   PRO C C     1 
ATOM   3672  O  O     . PRO C  2  17   ? 67.457  -28.118 86.359  1.00 65.93  ? 17   PRO C O     1 
ATOM   3673  C  CB    . PRO C  2  17   ? 69.900  -29.258 87.584  1.00 64.32  ? 17   PRO C CB    1 
ATOM   3674  C  CG    . PRO C  2  17   ? 70.066  -30.705 87.909  1.00 67.22  ? 17   PRO C CG    1 
ATOM   3675  C  CD    . PRO C  2  17   ? 68.680  -31.264 88.028  1.00 64.77  ? 17   PRO C CD    1 
ATOM   3676  N  N     . LEU C  2  18   ? 67.446  -26.735 88.139  1.00 60.38  ? 18   LEU C N     1 
ATOM   3677  C  CA    . LEU C  2  18   ? 66.402  -25.884 87.579  1.00 57.39  ? 18   LEU C CA    1 
ATOM   3678  C  C     . LEU C  2  18   ? 66.832  -25.215 86.276  1.00 56.38  ? 18   LEU C C     1 
ATOM   3679  O  O     . LEU C  2  18   ? 65.983  -24.921 85.428  1.00 53.79  ? 18   LEU C O     1 
ATOM   3680  C  CB    . LEU C  2  18   ? 65.972  -24.844 88.613  1.00 54.49  ? 18   LEU C CB    1 
ATOM   3681  C  CG    . LEU C  2  18   ? 65.267  -25.425 89.845  1.00 50.81  ? 18   LEU C CG    1 
ATOM   3682  C  CD1   . LEU C  2  18   ? 64.928  -24.330 90.838  1.00 50.10  ? 18   LEU C CD1   1 
ATOM   3683  C  CD2   . LEU C  2  18   ? 64.018  -26.216 89.461  1.00 46.12  ? 18   LEU C CD2   1 
ATOM   3684  N  N     . THR C  2  19   ? 68.129  -24.981 86.085  1.00 58.57  ? 19   THR C N     1 
ATOM   3685  C  CA    . THR C  2  19   ? 68.621  -24.386 84.851  1.00 54.00  ? 19   THR C CA    1 
ATOM   3686  C  C     . THR C  2  19   ? 69.079  -25.426 83.832  1.00 54.50  ? 19   THR C C     1 
ATOM   3687  O  O     . THR C  2  19   ? 69.709  -25.059 82.835  1.00 53.35  ? 19   THR C O     1 
ATOM   3688  C  CB    . THR C  2  19   ? 69.765  -23.414 85.149  1.00 51.50  ? 19   THR C CB    1 
ATOM   3689  O  OG1   . THR C  2  19   ? 70.788  -24.090 85.888  1.00 61.11  ? 19   THR C OG1   1 
ATOM   3690  C  CG2   . THR C  2  19   ? 69.261  -22.230 85.958  1.00 49.65  ? 19   THR C CG2   1 
ATOM   3691  N  N     . GLU C  2  20   ? 68.767  -26.709 84.047  1.00 56.17  ? 20   GLU C N     1 
ATOM   3692  C  CA    . GLU C  2  20   ? 69.264  -27.754 83.158  1.00 53.34  ? 20   GLU C CA    1 
ATOM   3693  C  C     . GLU C  2  20   ? 68.660  -27.674 81.761  1.00 53.29  ? 20   GLU C C     1 
ATOM   3694  O  O     . GLU C  2  20   ? 69.285  -28.162 80.812  1.00 54.70  ? 20   GLU C O     1 
ATOM   3695  C  CB    . GLU C  2  20   ? 68.986  -29.138 83.743  1.00 60.35  ? 20   GLU C CB    1 
ATOM   3696  C  CG    . GLU C  2  20   ? 67.539  -29.586 83.622  1.00 65.91  ? 20   GLU C CG    1 
ATOM   3697  C  CD    . GLU C  2  20   ? 67.354  -31.057 83.931  1.00 68.32  ? 20   GLU C CD    1 
ATOM   3698  O  OE1   . GLU C  2  20   ? 68.242  -31.862 83.574  1.00 71.77  ? 20   GLU C OE1   1 
ATOM   3699  O  OE2   . GLU C  2  20   ? 66.319  -31.408 84.532  1.00 71.38  ? 20   GLU C OE2   1 
ATOM   3700  N  N     . ILE C  2  21   ? 67.475  -27.074 81.611  1.00 57.32  ? 21   ILE C N     1 
ATOM   3701  C  CA    . ILE C  2  21   ? 66.873  -26.966 80.286  1.00 58.13  ? 21   ILE C CA    1 
ATOM   3702  C  C     . ILE C  2  21   ? 67.751  -26.127 79.364  1.00 52.79  ? 21   ILE C C     1 
ATOM   3703  O  O     . ILE C  2  21   ? 67.735  -26.309 78.141  1.00 55.11  ? 21   ILE C O     1 
ATOM   3704  C  CB    . ILE C  2  21   ? 65.439  -26.391 80.399  1.00 55.44  ? 21   ILE C CB    1 
ATOM   3705  C  CG1   . ILE C  2  21   ? 64.737  -26.419 79.040  1.00 41.79  ? 21   ILE C CG1   1 
ATOM   3706  C  CG2   . ILE C  2  21   ? 65.462  -24.985 80.958  1.00 49.65  ? 21   ILE C CG2   1 
ATOM   3707  C  CD1   . ILE C  2  21   ? 63.413  -25.705 79.040  1.00 36.80  ? 21   ILE C CD1   1 
ATOM   3708  N  N     . GLN C  2  22   ? 68.543  -25.218 79.930  1.00 48.85  ? 22   GLN C N     1 
ATOM   3709  C  CA    . GLN C  2  22   ? 69.522  -24.445 79.177  1.00 46.59  ? 22   GLN C CA    1 
ATOM   3710  C  C     . GLN C  2  22   ? 70.877  -25.145 79.139  1.00 49.02  ? 22   GLN C C     1 
ATOM   3711  O  O     . GLN C  2  22   ? 71.472  -25.316 78.064  1.00 54.77  ? 22   GLN C O     1 
ATOM   3712  C  CB    . GLN C  2  22   ? 69.672  -23.056 79.805  1.00 47.43  ? 22   GLN C CB    1 
ATOM   3713  C  CG    . GLN C  2  22   ? 68.405  -22.227 79.820  1.00 40.05  ? 22   GLN C CG    1 
ATOM   3714  C  CD    . GLN C  2  22   ? 68.179  -21.502 78.508  1.00 51.65  ? 22   GLN C CD    1 
ATOM   3715  O  OE1   . GLN C  2  22   ? 69.008  -20.691 78.077  1.00 49.06  ? 22   GLN C OE1   1 
ATOM   3716  N  NE2   . GLN C  2  22   ? 67.059  -21.797 77.856  1.00 51.70  ? 22   GLN C NE2   1 
ATOM   3717  N  N     . VAL C  2  23   ? 71.357  -25.550 80.319  1.00 48.29  ? 23   VAL C N     1 
ATOM   3718  C  CA    . VAL C  2  23   ? 72.706  -26.092 80.471  1.00 44.10  ? 23   VAL C CA    1 
ATOM   3719  C  C     . VAL C  2  23   ? 72.885  -27.339 79.617  1.00 47.26  ? 23   VAL C C     1 
ATOM   3720  O  O     . VAL C  2  23   ? 73.780  -27.406 78.767  1.00 49.83  ? 23   VAL C O     1 
ATOM   3721  C  CB    . VAL C  2  23   ? 72.995  -26.390 81.951  1.00 43.99  ? 23   VAL C CB    1 
ATOM   3722  C  CG1   . VAL C  2  23   ? 74.286  -27.175 82.089  1.00 58.02  ? 23   VAL C CG1   1 
ATOM   3723  C  CG2   . VAL C  2  23   ? 73.054  -25.100 82.751  1.00 50.41  ? 23   VAL C CG2   1 
ATOM   3724  N  N     . GLU C  2  24   ? 72.047  -28.354 79.846  1.00 48.98  ? 24   GLU C N     1 
ATOM   3725  C  CA    . GLU C  2  24   ? 72.210  -29.622 79.142  1.00 51.81  ? 24   GLU C CA    1 
ATOM   3726  C  C     . GLU C  2  24   ? 71.953  -29.478 77.650  1.00 48.90  ? 24   GLU C C     1 
ATOM   3727  O  O     . GLU C  2  24   ? 72.619  -30.136 76.844  1.00 55.69  ? 24   GLU C O     1 
ATOM   3728  C  CB    . GLU C  2  24   ? 71.288  -30.677 79.747  1.00 62.87  ? 24   GLU C CB    1 
ATOM   3729  C  CG    . GLU C  2  24   ? 71.866  -31.362 80.977  1.00 67.27  ? 24   GLU C CG    1 
ATOM   3730  C  CD    . GLU C  2  24   ? 73.215  -31.997 80.693  1.00 73.96  ? 24   GLU C CD    1 
ATOM   3731  O  OE1   . GLU C  2  24   ? 74.188  -31.682 81.415  1.00 69.95  ? 24   GLU C OE1   1 
ATOM   3732  O  OE2   . GLU C  2  24   ? 73.303  -32.801 79.736  1.00 73.09  ? 24   GLU C OE2   1 
ATOM   3733  N  N     . SER C  2  25   ? 71.013  -28.613 77.262  1.00 50.98  ? 25   SER C N     1 
ATOM   3734  C  CA    . SER C  2  25   ? 70.766  -28.358 75.846  1.00 50.29  ? 25   SER C CA    1 
ATOM   3735  C  C     . SER C  2  25   ? 72.024  -27.846 75.156  1.00 50.27  ? 25   SER C C     1 
ATOM   3736  O  O     . SER C  2  25   ? 72.488  -28.427 74.166  1.00 54.07  ? 25   SER C O     1 
ATOM   3737  C  CB    . SER C  2  25   ? 69.619  -27.359 75.684  1.00 49.12  ? 25   SER C CB    1 
ATOM   3738  O  OG    . SER C  2  25   ? 69.556  -26.867 74.357  1.00 52.75  ? 25   SER C OG    1 
ATOM   3739  N  N     . TYR C  2  26   ? 72.602  -26.757 75.674  1.00 51.43  ? 26   TYR C N     1 
ATOM   3740  C  CA    . TYR C  2  26   ? 73.780  -26.194 75.022  1.00 44.46  ? 26   TYR C CA    1 
ATOM   3741  C  C     . TYR C  2  26   ? 74.979  -27.131 75.114  1.00 51.77  ? 26   TYR C C     1 
ATOM   3742  O  O     . TYR C  2  26   ? 75.781  -27.206 74.174  1.00 53.81  ? 26   TYR C O     1 
ATOM   3743  C  CB    . TYR C  2  26   ? 74.120  -24.837 75.627  1.00 40.85  ? 26   TYR C CB    1 
ATOM   3744  C  CG    . TYR C  2  26   ? 74.820  -23.901 74.670  1.00 43.91  ? 26   TYR C CG    1 
ATOM   3745  C  CD1   . TYR C  2  26   ? 74.213  -23.515 73.481  1.00 40.87  ? 26   TYR C CD1   1 
ATOM   3746  C  CD2   . TYR C  2  26   ? 76.082  -23.392 74.959  1.00 43.98  ? 26   TYR C CD2   1 
ATOM   3747  C  CE1   . TYR C  2  26   ? 74.839  -22.653 72.603  1.00 35.15  ? 26   TYR C CE1   1 
ATOM   3748  C  CE2   . TYR C  2  26   ? 76.715  -22.528 74.089  1.00 42.53  ? 26   TYR C CE2   1 
ATOM   3749  C  CZ    . TYR C  2  26   ? 76.087  -22.162 72.912  1.00 41.99  ? 26   TYR C CZ    1 
ATOM   3750  O  OH    . TYR C  2  26   ? 76.709  -21.302 72.039  1.00 46.09  ? 26   TYR C OH    1 
ATOM   3751  N  N     . ARG C  2  27   ? 75.117  -27.854 76.227  1.00 56.01  ? 27   ARG C N     1 
ATOM   3752  C  CA    . ARG C  2  27   ? 76.217  -28.802 76.364  1.00 56.45  ? 27   ARG C CA    1 
ATOM   3753  C  C     . ARG C  2  27   ? 76.139  -29.879 75.288  1.00 54.62  ? 27   ARG C C     1 
ATOM   3754  O  O     . ARG C  2  27   ? 77.118  -30.134 74.577  1.00 54.01  ? 27   ARG C O     1 
ATOM   3755  C  CB    . ARG C  2  27   ? 76.192  -29.417 77.763  1.00 50.34  ? 27   ARG C CB    1 
ATOM   3756  C  CG    . ARG C  2  27   ? 77.496  -30.030 78.212  1.00 54.26  ? 27   ARG C CG    1 
ATOM   3757  C  CD    . ARG C  2  27   ? 77.259  -30.918 79.414  1.00 61.99  ? 27   ARG C CD    1 
ATOM   3758  N  NE    . ARG C  2  27   ? 76.173  -31.862 79.161  1.00 70.75  ? 27   ARG C NE    1 
ATOM   3759  C  CZ    . ARG C  2  27   ? 76.323  -33.028 78.539  1.00 75.97  ? 27   ARG C CZ    1 
ATOM   3760  N  NH1   . ARG C  2  27   ? 77.519  -33.403 78.102  1.00 77.75  ? 27   ARG C NH1   1 
ATOM   3761  N  NH2   . ARG C  2  27   ? 75.275  -33.822 78.350  1.00 75.70  ? 27   ARG C NH2   1 
ATOM   3762  N  N     . ARG C  2  28   ? 74.967  -30.509 75.141  1.00 56.49  ? 28   ARG C N     1 
ATOM   3763  C  CA    . ARG C  2  28   ? 74.778  -31.496 74.082  1.00 57.79  ? 28   ARG C CA    1 
ATOM   3764  C  C     . ARG C  2  28   ? 74.960  -30.877 72.702  1.00 53.52  ? 28   ARG C C     1 
ATOM   3765  O  O     . ARG C  2  28   ? 75.382  -31.564 71.766  1.00 58.52  ? 28   ARG C O     1 
ATOM   3766  C  CB    . ARG C  2  28   ? 73.392  -32.139 74.212  1.00 64.59  ? 28   ARG C CB    1 
ATOM   3767  C  CG    . ARG C  2  28   ? 72.965  -33.019 73.040  1.00 74.74  ? 28   ARG C CG    1 
ATOM   3768  C  CD    . ARG C  2  28   ? 71.962  -34.081 73.478  1.00 93.48  ? 28   ARG C CD    1 
ATOM   3769  N  NE    . ARG C  2  28   ? 72.538  -34.975 74.481  1.00 108.40 ? 28   ARG C NE    1 
ATOM   3770  C  CZ    . ARG C  2  28   ? 73.317  -36.016 74.197  1.00 109.04 ? 28   ARG C CZ    1 
ATOM   3771  N  NH1   . ARG C  2  28   ? 73.614  -36.305 72.935  1.00 93.57  ? 28   ARG C NH1   1 
ATOM   3772  N  NH2   . ARG C  2  28   ? 73.801  -36.770 75.176  1.00 101.31 ? 28   ARG C NH2   1 
ATOM   3773  N  N     . ALA C  2  29   ? 74.668  -29.584 72.558  1.00 50.09  ? 29   ALA C N     1 
ATOM   3774  C  CA    . ALA C  2  29   ? 74.835  -28.950 71.255  1.00 51.79  ? 29   ALA C CA    1 
ATOM   3775  C  C     . ALA C  2  29   ? 76.308  -28.783 70.892  1.00 52.48  ? 29   ALA C C     1 
ATOM   3776  O  O     . ALA C  2  29   ? 76.696  -29.009 69.742  1.00 49.76  ? 29   ALA C O     1 
ATOM   3777  C  CB    . ALA C  2  29   ? 74.130  -27.596 71.233  1.00 51.82  ? 29   ALA C CB    1 
ATOM   3778  N  N     . LEU C  2  30   ? 77.139  -28.371 71.850  1.00 53.60  ? 30   LEU C N     1 
ATOM   3779  C  CA    . LEU C  2  30   ? 78.509  -28.012 71.509  1.00 49.33  ? 30   LEU C CA    1 
ATOM   3780  C  C     . LEU C  2  30   ? 79.441  -29.217 71.508  1.00 56.41  ? 30   LEU C C     1 
ATOM   3781  O  O     . LEU C  2  30   ? 80.303  -29.332 70.628  1.00 56.65  ? 30   LEU C O     1 
ATOM   3782  C  CB    . LEU C  2  30   ? 79.032  -26.943 72.470  1.00 47.41  ? 30   LEU C CB    1 
ATOM   3783  C  CG    . LEU C  2  30   ? 78.512  -25.524 72.243  1.00 44.25  ? 30   LEU C CG    1 
ATOM   3784  C  CD1   . LEU C  2  30   ? 79.427  -24.521 72.925  1.00 43.70  ? 30   LEU C CD1   1 
ATOM   3785  C  CD2   . LEU C  2  30   ? 78.390  -25.226 70.760  1.00 47.55  ? 30   LEU C CD2   1 
ATOM   3786  N  N     . GLN C  2  31   ? 79.292  -30.111 72.485  1.00 60.50  ? 31   GLN C N     1 
ATOM   3787  C  CA    . GLN C  2  31   ? 80.134  -31.304 72.608  1.00 56.77  ? 31   GLN C CA    1 
ATOM   3788  C  C     . GLN C  2  31   ? 81.616  -30.935 72.661  1.00 59.45  ? 31   GLN C C     1 
ATOM   3789  O  O     . GLN C  2  31   ? 82.458  -31.560 72.013  1.00 63.03  ? 31   GLN C O     1 
ATOM   3790  C  CB    . GLN C  2  31   ? 79.864  -32.294 71.472  1.00 47.32  ? 31   GLN C CB    1 
ATOM   3791  C  CG    . GLN C  2  31   ? 78.724  -33.259 71.737  1.00 49.42  ? 31   GLN C CG    1 
ATOM   3792  C  CD    . GLN C  2  31   ? 78.510  -34.227 70.592  1.00 51.16  ? 31   GLN C CD    1 
ATOM   3793  O  OE1   . GLN C  2  31   ? 78.307  -35.423 70.803  1.00 51.11  ? 31   GLN C OE1   1 
ATOM   3794  N  NE2   . GLN C  2  31   ? 78.555  -33.713 69.369  1.00 48.07  ? 31   GLN C NE2   1 
ATOM   3795  N  N     . ALA C  2  32   ? 81.941  -29.901 73.444  1.00 59.17  ? 32   ALA C N     1 
ATOM   3796  C  CA    . ALA C  2  32   ? 83.328  -29.471 73.572  1.00 59.33  ? 32   ALA C CA    1 
ATOM   3797  C  C     . ALA C  2  32   ? 84.133  -30.343 74.525  1.00 75.07  ? 32   ALA C C     1 
ATOM   3798  O  O     . ALA C  2  32   ? 85.365  -30.375 74.419  1.00 78.10  ? 32   ALA C O     1 
ATOM   3799  C  CB    . ALA C  2  32   ? 83.398  -28.016 74.037  1.00 53.55  ? 32   ALA C CB    1 
ATOM   3800  N  N     . ASP C  2  33   ? 83.474  -31.043 75.450  1.00 76.65  ? 33   ASP C N     1 
ATOM   3801  C  CA    . ASP C  2  33   ? 84.149  -31.939 76.381  1.00 81.97  ? 33   ASP C CA    1 
ATOM   3802  C  C     . ASP C  2  33   ? 84.260  -33.365 75.859  1.00 80.27  ? 33   ASP C C     1 
ATOM   3803  O  O     . ASP C  2  33   ? 84.769  -34.232 76.575  1.00 84.07  ? 33   ASP C O     1 
ATOM   3804  C  CB    . ASP C  2  33   ? 83.426  -31.947 77.731  1.00 95.06  ? 33   ASP C CB    1 
ATOM   3805  C  CG    . ASP C  2  33   ? 83.746  -30.727 78.571  1.00 109.49 ? 33   ASP C CG    1 
ATOM   3806  O  OD1   . ASP C  2  33   ? 84.473  -29.838 78.073  1.00 103.67 ? 33   ASP C OD1   1 
ATOM   3807  O  OD2   . ASP C  2  33   ? 83.276  -30.661 79.729  1.00 108.83 ? 33   ASP C OD2   1 
ATOM   3808  N  N     . VAL C  2  34   ? 83.804  -33.625 74.643  1.00 76.60  ? 34   VAL C N     1 
ATOM   3809  C  CA    . VAL C  2  34   ? 83.880  -34.948 74.030  1.00 69.08  ? 34   VAL C CA    1 
ATOM   3810  C  C     . VAL C  2  34   ? 85.024  -34.941 73.022  1.00 70.19  ? 34   VAL C C     1 
ATOM   3811  O  O     . VAL C  2  34   ? 85.079  -34.036 72.177  1.00 65.42  ? 34   VAL C O     1 
ATOM   3812  C  CB    . VAL C  2  34   ? 82.555  -35.328 73.347  1.00 61.74  ? 34   VAL C CB    1 
ATOM   3813  C  CG1   . VAL C  2  34   ? 82.685  -36.669 72.654  1.00 59.11  ? 34   VAL C CG1   1 
ATOM   3814  C  CG2   . VAL C  2  34   ? 81.426  -35.355 74.366  1.00 65.42  ? 34   VAL C CG2   1 
ATOM   3815  N  N     . PRO C  2  35   ? 85.953  -35.894 73.089  1.00 71.20  ? 35   PRO C N     1 
ATOM   3816  C  CA    . PRO C  2  35   ? 87.018  -35.977 72.081  1.00 58.81  ? 35   PRO C CA    1 
ATOM   3817  C  C     . PRO C  2  35   ? 86.438  -36.190 70.695  1.00 60.38  ? 35   PRO C C     1 
ATOM   3818  O  O     . PRO C  2  35   ? 85.566  -37.051 70.510  1.00 62.97  ? 35   PRO C O     1 
ATOM   3819  C  CB    . PRO C  2  35   ? 87.846  -37.191 72.537  1.00 58.68  ? 35   PRO C CB    1 
ATOM   3820  C  CG    . PRO C  2  35   ? 86.980  -37.920 73.520  1.00 61.46  ? 35   PRO C CG    1 
ATOM   3821  C  CD    . PRO C  2  35   ? 86.138  -36.877 74.169  1.00 68.14  ? 35   PRO C CD    1 
ATOM   3822  N  N     . PRO C  2  36   ? 86.916  -35.433 69.697  1.00 58.54  ? 36   PRO C N     1 
ATOM   3823  C  CA    . PRO C  2  36   ? 86.228  -35.367 68.392  1.00 59.78  ? 36   PRO C CA    1 
ATOM   3824  C  C     . PRO C  2  36   ? 85.853  -36.701 67.771  1.00 62.11  ? 36   PRO C C     1 
ATOM   3825  O  O     . PRO C  2  36   ? 84.829  -36.778 67.081  1.00 65.54  ? 36   PRO C O     1 
ATOM   3826  C  CB    . PRO C  2  36   ? 87.242  -34.619 67.519  1.00 60.77  ? 36   PRO C CB    1 
ATOM   3827  C  CG    . PRO C  2  36   ? 87.949  -33.730 68.473  1.00 63.27  ? 36   PRO C CG    1 
ATOM   3828  C  CD    . PRO C  2  36   ? 88.061  -34.508 69.759  1.00 68.22  ? 36   PRO C CD    1 
ATOM   3829  N  N     . GLU C  2  37   ? 86.644  -37.753 67.978  1.00 68.64  ? 37   GLU C N     1 
ATOM   3830  C  CA    . GLU C  2  37   ? 86.310  -39.042 67.384  1.00 73.40  ? 37   GLU C CA    1 
ATOM   3831  C  C     . GLU C  2  37   ? 85.099  -39.693 68.045  1.00 73.08  ? 37   GLU C C     1 
ATOM   3832  O  O     . GLU C  2  37   ? 84.446  -40.534 67.415  1.00 73.36  ? 37   GLU C O     1 
ATOM   3833  C  CB    . GLU C  2  37   ? 87.514  -39.984 67.453  1.00 70.06  ? 37   GLU C CB    1 
ATOM   3834  C  CG    . GLU C  2  37   ? 88.030  -40.244 68.863  1.00 75.68  ? 37   GLU C CG    1 
ATOM   3835  C  CD    . GLU C  2  37   ? 89.070  -39.232 69.312  1.00 82.56  ? 37   GLU C CD    1 
ATOM   3836  O  OE1   . GLU C  2  37   ? 89.497  -38.401 68.479  1.00 79.52  ? 37   GLU C OE1   1 
ATOM   3837  O  OE2   . GLU C  2  37   ? 89.462  -39.270 70.501  1.00 79.88  ? 37   GLU C OE2   1 
ATOM   3838  N  N     . LYS C  2  38   ? 84.779  -39.321 69.285  1.00 66.84  ? 38   LYS C N     1 
ATOM   3839  C  CA    . LYS C  2  38   ? 83.675  -39.915 70.028  1.00 68.30  ? 38   LYS C CA    1 
ATOM   3840  C  C     . LYS C  2  38   ? 82.431  -39.027 70.063  1.00 70.27  ? 38   LYS C C     1 
ATOM   3841  O  O     . LYS C  2  38   ? 81.537  -39.259 70.885  1.00 63.98  ? 38   LYS C O     1 
ATOM   3842  C  CB    . LYS C  2  38   ? 84.127  -40.251 71.452  1.00 62.41  ? 38   LYS C CB    1 
ATOM   3843  C  CG    . LYS C  2  38   ? 85.133  -41.390 71.518  1.00 69.74  ? 38   LYS C CG    1 
ATOM   3844  C  CD    . LYS C  2  38   ? 85.912  -41.389 72.824  1.00 69.52  ? 38   LYS C CD    1 
ATOM   3845  C  CE    . LYS C  2  38   ? 85.032  -41.708 74.013  1.00 64.63  ? 38   LYS C CE    1 
ATOM   3846  N  NZ    . LYS C  2  38   ? 85.830  -41.708 75.269  1.00 66.39  ? 38   LYS C NZ    1 
ATOM   3847  N  N     . ARG C  2  39   ? 82.351  -38.024 69.192  1.00 66.48  ? 39   ARG C N     1 
ATOM   3848  C  CA    . ARG C  2  39   ? 81.177  -37.166 69.126  1.00 59.75  ? 39   ARG C CA    1 
ATOM   3849  C  C     . ARG C  2  39   ? 80.057  -37.849 68.352  1.00 69.16  ? 39   ARG C C     1 
ATOM   3850  O  O     . ARG C  2  39   ? 80.290  -38.459 67.303  1.00 67.04  ? 39   ARG C O     1 
ATOM   3851  C  CB    . ARG C  2  39   ? 81.523  -35.831 68.463  1.00 52.88  ? 39   ARG C CB    1 
ATOM   3852  C  CG    . ARG C  2  39   ? 82.456  -34.940 69.263  1.00 52.51  ? 39   ARG C CG    1 
ATOM   3853  C  CD    . ARG C  2  39   ? 82.472  -33.531 68.688  1.00 50.30  ? 39   ARG C CD    1 
ATOM   3854  N  NE    . ARG C  2  39   ? 83.191  -32.587 69.541  1.00 52.32  ? 39   ARG C NE    1 
ATOM   3855  C  CZ    . ARG C  2  39   ? 84.334  -31.997 69.208  1.00 53.94  ? 39   ARG C CZ    1 
ATOM   3856  N  NH1   . ARG C  2  39   ? 84.888  -32.248 68.031  1.00 60.25  ? 39   ARG C NH1   1 
ATOM   3857  N  NH2   . ARG C  2  39   ? 84.920  -31.150 70.046  1.00 50.95  ? 39   ARG C NH2   1 
ATOM   3858  N  N     . GLU C  2  40   ? 78.835  -37.744 68.877  1.00 72.67  ? 40   GLU C N     1 
ATOM   3859  C  CA    . GLU C  2  40   ? 77.662  -38.243 68.176  1.00 67.98  ? 40   GLU C CA    1 
ATOM   3860  C  C     . GLU C  2  40   ? 77.219  -37.245 67.107  1.00 64.90  ? 40   GLU C C     1 
ATOM   3861  O  O     . GLU C  2  40   ? 77.608  -36.074 67.112  1.00 62.81  ? 40   GLU C O     1 
ATOM   3862  C  CB    . GLU C  2  40   ? 76.517  -38.510 69.154  1.00 61.10  ? 40   GLU C CB    1 
ATOM   3863  C  CG    . GLU C  2  40   ? 76.883  -39.416 70.321  1.00 75.75  ? 40   GLU C CG    1 
ATOM   3864  C  CD    . GLU C  2  40   ? 75.717  -39.634 71.275  1.00 98.91  ? 40   GLU C CD    1 
ATOM   3865  O  OE1   . GLU C  2  40   ? 74.554  -39.462 70.849  1.00 101.78 ? 40   GLU C OE1   1 
ATOM   3866  O  OE2   . GLU C  2  40   ? 75.964  -39.971 72.453  1.00 98.10  ? 40   GLU C OE2   1 
ATOM   3867  N  N     . ASN C  2  41   ? 76.391  -37.727 66.177  1.00 68.35  ? 41   ASN C N     1 
ATOM   3868  C  CA    . ASN C  2  41   ? 75.917  -36.917 65.051  1.00 65.80  ? 41   ASN C CA    1 
ATOM   3869  C  C     . ASN C  2  41   ? 74.745  -36.055 65.519  1.00 70.95  ? 41   ASN C C     1 
ATOM   3870  O  O     . ASN C  2  41   ? 73.581  -36.288 65.187  1.00 71.44  ? 41   ASN C O     1 
ATOM   3871  C  CB    . ASN C  2  41   ? 75.527  -37.813 63.878  1.00 68.33  ? 41   ASN C CB    1 
ATOM   3872  C  CG    . ASN C  2  41   ? 75.355  -37.039 62.571  1.00 76.52  ? 41   ASN C CG    1 
ATOM   3873  O  OD1   . ASN C  2  41   ? 74.747  -35.973 62.537  1.00 75.80  ? 41   ASN C OD1   1 
ATOM   3874  N  ND2   . ASN C  2  41   ? 75.897  -37.586 61.484  1.00 83.79  ? 41   ASN C ND2   1 
ATOM   3875  N  N     . VAL C  2  42   ? 75.069  -35.027 66.309  1.00 70.42  ? 42   VAL C N     1 
ATOM   3876  C  CA    . VAL C  2  42   ? 74.078  -34.095 66.841  1.00 60.37  ? 42   VAL C CA    1 
ATOM   3877  C  C     . VAL C  2  42   ? 74.706  -32.709 66.887  1.00 56.77  ? 42   VAL C C     1 
ATOM   3878  O  O     . VAL C  2  42   ? 75.926  -32.554 66.827  1.00 68.75  ? 42   VAL C O     1 
ATOM   3879  C  CB    . VAL C  2  42   ? 73.569  -34.487 68.252  1.00 49.70  ? 42   VAL C CB    1 
ATOM   3880  C  CG1   . VAL C  2  42   ? 72.829  -35.821 68.228  1.00 58.36  ? 42   VAL C CG1   1 
ATOM   3881  C  CG2   . VAL C  2  42   ? 74.720  -34.523 69.240  1.00 54.22  ? 42   VAL C CG2   1 
ATOM   3882  N  N     . GLY C  2  43   ? 73.854  -31.694 66.985  1.00 50.66  ? 43   GLY C N     1 
ATOM   3883  C  CA    . GLY C  2  43   ? 74.329  -30.343 67.223  1.00 49.36  ? 43   GLY C CA    1 
ATOM   3884  C  C     . GLY C  2  43   ? 75.260  -29.846 66.138  1.00 52.16  ? 43   GLY C C     1 
ATOM   3885  O  O     . GLY C  2  43   ? 75.025  -30.039 64.939  1.00 61.16  ? 43   GLY C O     1 
ATOM   3886  N  N     . ILE C  2  44   ? 76.335  -29.182 66.571  1.00 50.86  ? 44   ILE C N     1 
ATOM   3887  C  CA    . ILE C  2  44   ? 77.314  -28.634 65.636  1.00 52.60  ? 44   ILE C CA    1 
ATOM   3888  C  C     . ILE C  2  44   ? 77.926  -29.743 64.793  1.00 55.94  ? 44   ILE C C     1 
ATOM   3889  O  O     . ILE C  2  44   ? 78.195  -29.564 63.596  1.00 55.95  ? 44   ILE C O     1 
ATOM   3890  C  CB    . ILE C  2  44   ? 78.392  -27.848 66.405  1.00 50.45  ? 44   ILE C CB    1 
ATOM   3891  C  CG1   . ILE C  2  44   ? 77.755  -26.691 67.166  1.00 54.10  ? 44   ILE C CG1   1 
ATOM   3892  C  CG2   . ILE C  2  44   ? 79.456  -27.328 65.461  1.00 54.38  ? 44   ILE C CG2   1 
ATOM   3893  C  CD1   . ILE C  2  44   ? 77.102  -25.682 66.268  1.00 54.18  ? 44   ILE C CD1   1 
ATOM   3894  N  N     . GLN C  2  45   ? 78.176  -30.900 65.409  1.00 53.70  ? 45   GLN C N     1 
ATOM   3895  C  CA    . GLN C  2  45   ? 78.689  -32.041 64.663  1.00 57.84  ? 45   GLN C CA    1 
ATOM   3896  C  C     . GLN C  2  45   ? 77.744  -32.410 63.527  1.00 60.43  ? 45   GLN C C     1 
ATOM   3897  O  O     . GLN C  2  45   ? 78.177  -32.614 62.388  1.00 61.53  ? 45   GLN C O     1 
ATOM   3898  C  CB    . GLN C  2  45   ? 78.902  -33.226 65.605  1.00 57.38  ? 45   GLN C CB    1 
ATOM   3899  C  CG    . GLN C  2  45   ? 79.462  -34.469 64.936  1.00 66.17  ? 45   GLN C CG    1 
ATOM   3900  C  CD    . GLN C  2  45   ? 80.923  -34.331 64.549  1.00 64.86  ? 45   GLN C CD    1 
ATOM   3901  O  OE1   . GLN C  2  45   ? 81.641  -33.469 65.058  1.00 56.99  ? 45   GLN C OE1   1 
ATOM   3902  N  NE2   . GLN C  2  45   ? 81.371  -35.191 63.645  1.00 72.61  ? 45   GLN C NE2   1 
ATOM   3903  N  N     . ALA C  2  46   ? 76.442  -32.488 63.822  1.00 63.28  ? 46   ALA C N     1 
ATOM   3904  C  CA    . ALA C  2  46   ? 75.461  -32.795 62.787  1.00 59.95  ? 46   ALA C CA    1 
ATOM   3905  C  C     . ALA C  2  46   ? 75.435  -31.718 61.711  1.00 60.87  ? 46   ALA C C     1 
ATOM   3906  O  O     . ALA C  2  46   ? 75.269  -32.023 60.527  1.00 63.84  ? 46   ALA C O     1 
ATOM   3907  C  CB    . ALA C  2  46   ? 74.076  -32.963 63.407  1.00 57.72  ? 46   ALA C CB    1 
ATOM   3908  N  N     . ALA C  2  47   ? 75.609  -30.454 62.101  1.00 59.81  ? 47   ALA C N     1 
ATOM   3909  C  CA    . ALA C  2  47   ? 75.610  -29.373 61.117  1.00 59.83  ? 47   ALA C CA    1 
ATOM   3910  C  C     . ALA C  2  47   ? 76.769  -29.522 60.142  1.00 65.42  ? 47   ALA C C     1 
ATOM   3911  O  O     . ALA C  2  47   ? 76.592  -29.408 58.922  1.00 70.15  ? 47   ALA C O     1 
ATOM   3912  C  CB    . ALA C  2  47   ? 75.675  -28.020 61.822  1.00 65.15  ? 47   ALA C CB    1 
ATOM   3913  N  N     . PHE C  2  48   ? 77.971  -29.775 60.668  1.00 70.72  ? 48   PHE C N     1 
ATOM   3914  C  CA    . PHE C  2  48   ? 79.133  -29.986 59.805  1.00 60.02  ? 48   PHE C CA    1 
ATOM   3915  C  C     . PHE C  2  48   ? 78.945  -31.210 58.919  1.00 59.59  ? 48   PHE C C     1 
ATOM   3916  O  O     . PHE C  2  48   ? 79.133  -31.142 57.699  1.00 61.18  ? 48   PHE C O     1 
ATOM   3917  C  CB    . PHE C  2  48   ? 80.399  -30.137 60.644  1.00 57.93  ? 48   PHE C CB    1 
ATOM   3918  C  CG    . PHE C  2  48   ? 81.018  -28.838 61.052  1.00 55.74  ? 48   PHE C CG    1 
ATOM   3919  C  CD1   . PHE C  2  48   ? 81.407  -27.910 60.099  1.00 53.84  ? 48   PHE C CD1   1 
ATOM   3920  C  CD2   . PHE C  2  48   ? 81.240  -28.557 62.390  1.00 51.11  ? 48   PHE C CD2   1 
ATOM   3921  C  CE1   . PHE C  2  48   ? 81.990  -26.715 60.475  1.00 52.59  ? 48   PHE C CE1   1 
ATOM   3922  C  CE2   . PHE C  2  48   ? 81.824  -27.370 62.774  1.00 54.07  ? 48   PHE C CE2   1 
ATOM   3923  C  CZ    . PHE C  2  48   ? 82.200  -26.445 61.815  1.00 56.79  ? 48   PHE C CZ    1 
ATOM   3924  N  N     . ARG C  2  49   ? 78.571  -32.343 59.520  1.00 61.02  ? 49   ARG C N     1 
ATOM   3925  C  CA    . ARG C  2  49   ? 78.403  -33.579 58.763  1.00 66.96  ? 49   ARG C CA    1 
ATOM   3926  C  C     . ARG C  2  49   ? 77.307  -33.456 57.712  1.00 74.47  ? 49   ARG C C     1 
ATOM   3927  O  O     . ARG C  2  49   ? 77.323  -34.179 56.708  1.00 86.50  ? 49   ARG C O     1 
ATOM   3928  C  CB    . ARG C  2  49   ? 78.094  -34.731 59.720  1.00 73.03  ? 49   ARG C CB    1 
ATOM   3929  C  CG    . ARG C  2  49   ? 79.205  -35.036 60.714  1.00 77.66  ? 49   ARG C CG    1 
ATOM   3930  C  CD    . ARG C  2  49   ? 80.122  -36.137 60.219  1.00 84.46  ? 49   ARG C CD    1 
ATOM   3931  N  NE    . ARG C  2  49   ? 79.406  -37.400 60.079  1.00 97.87  ? 49   ARG C NE    1 
ATOM   3932  C  CZ    . ARG C  2  49   ? 78.947  -37.873 58.924  1.00 108.39 ? 49   ARG C CZ    1 
ATOM   3933  N  NH1   . ARG C  2  49   ? 79.135  -37.187 57.801  1.00 96.28  ? 49   ARG C NH1   1 
ATOM   3934  N  NH2   . ARG C  2  49   ? 78.303  -39.032 58.892  1.00 112.14 ? 49   ARG C NH2   1 
ATOM   3935  N  N     . GLU C  2  50   ? 76.347  -32.557 57.924  1.00 72.25  ? 50   GLU C N     1 
ATOM   3936  C  CA    . GLU C  2  50   ? 75.289  -32.338 56.949  1.00 74.65  ? 50   GLU C CA    1 
ATOM   3937  C  C     . GLU C  2  50   ? 75.760  -31.429 55.821  1.00 70.15  ? 50   GLU C C     1 
ATOM   3938  O  O     . GLU C  2  50   ? 75.443  -31.670 54.651  1.00 76.35  ? 50   GLU C O     1 
ATOM   3939  C  CB    . GLU C  2  50   ? 74.067  -31.752 57.662  1.00 77.78  ? 50   GLU C CB    1 
ATOM   3940  C  CG    . GLU C  2  50   ? 72.778  -31.734 56.864  1.00 89.04  ? 50   GLU C CG    1 
ATOM   3941  C  CD    . GLU C  2  50   ? 71.572  -31.391 57.729  1.00 102.14 ? 50   GLU C CD    1 
ATOM   3942  O  OE1   . GLU C  2  50   ? 71.659  -31.554 58.967  1.00 98.01  ? 50   GLU C OE1   1 
ATOM   3943  O  OE2   . GLU C  2  50   ? 70.540  -30.958 57.174  1.00 109.17 ? 50   GLU C OE2   1 
ATOM   3944  N  N     . THR C  2  51   ? 76.531  -30.392 56.154  1.00 63.13  ? 51   THR C N     1 
ATOM   3945  C  CA    . THR C  2  51   ? 76.998  -29.459 55.134  1.00 68.83  ? 51   THR C CA    1 
ATOM   3946  C  C     . THR C  2  51   ? 78.053  -30.087 54.227  1.00 78.86  ? 51   THR C C     1 
ATOM   3947  O  O     . THR C  2  51   ? 78.101  -29.781 53.029  1.00 77.83  ? 51   THR C O     1 
ATOM   3948  C  CB    . THR C  2  51   ? 77.548  -28.198 55.802  1.00 68.18  ? 51   THR C CB    1 
ATOM   3949  O  OG1   . THR C  2  51   ? 76.562  -27.664 56.693  1.00 67.59  ? 51   THR C OG1   1 
ATOM   3950  C  CG2   . THR C  2  51   ? 77.900  -27.145 54.762  1.00 68.14  ? 51   THR C CG2   1 
ATOM   3951  N  N     . PHE C  2  52   ? 78.894  -30.974 54.771  1.00 81.65  ? 52   PHE C N     1 
ATOM   3952  C  CA    . PHE C  2  52   ? 80.013  -31.572 54.059  1.00 78.35  ? 52   PHE C CA    1 
ATOM   3953  C  C     . PHE C  2  52   ? 79.748  -33.046 53.753  1.00 79.60  ? 52   PHE C C     1 
ATOM   3954  O  O     . PHE C  2  52   ? 79.003  -33.711 54.479  1.00 76.81  ? 52   PHE C O     1 
ATOM   3955  C  CB    . PHE C  2  52   ? 81.301  -31.452 54.880  1.00 70.62  ? 52   PHE C CB    1 
ATOM   3956  C  CG    . PHE C  2  52   ? 81.808  -30.045 55.020  1.00 68.56  ? 52   PHE C CG    1 
ATOM   3957  C  CD1   . PHE C  2  52   ? 82.619  -29.487 54.048  1.00 70.05  ? 52   PHE C CD1   1 
ATOM   3958  C  CD2   . PHE C  2  52   ? 81.486  -29.286 56.131  1.00 70.61  ? 52   PHE C CD2   1 
ATOM   3959  C  CE1   . PHE C  2  52   ? 83.095  -28.195 54.178  1.00 66.16  ? 52   PHE C CE1   1 
ATOM   3960  C  CE2   . PHE C  2  52   ? 81.960  -27.993 56.265  1.00 70.39  ? 52   PHE C CE2   1 
ATOM   3961  C  CZ    . PHE C  2  52   ? 82.766  -27.448 55.286  1.00 63.28  ? 52   PHE C CZ    1 
ATOM   3962  N  N     . PRO C  2  53   ? 80.366  -33.604 52.694  1.00 82.14  ? 53   PRO C N     1 
ATOM   3963  C  CA    . PRO C  2  53   ? 81.345  -32.971 51.802  1.00 79.18  ? 53   PRO C CA    1 
ATOM   3964  C  C     . PRO C  2  53   ? 80.736  -32.028 50.764  1.00 83.20  ? 53   PRO C C     1 
ATOM   3965  O  O     . PRO C  2  53   ? 79.590  -32.207 50.349  1.00 88.86  ? 53   PRO C O     1 
ATOM   3966  C  CB    . PRO C  2  53   ? 82.005  -34.168 51.118  1.00 80.13  ? 53   PRO C CB    1 
ATOM   3967  C  CG    . PRO C  2  53   ? 80.936  -35.191 51.076  1.00 81.79  ? 53   PRO C CG    1 
ATOM   3968  C  CD    . PRO C  2  53   ? 80.153  -35.021 52.349  1.00 80.41  ? 53   PRO C CD    1 
ATOM   3969  N  N     . ILE C  2  54   ? 81.515  -31.029 50.363  1.00 83.76  ? 54   ILE C N     1 
ATOM   3970  C  CA    . ILE C  2  54   ? 81.111  -30.065 49.344  1.00 90.86  ? 54   ILE C CA    1 
ATOM   3971  C  C     . ILE C  2  54   ? 81.564  -30.608 47.992  1.00 101.15 ? 54   ILE C C     1 
ATOM   3972  O  O     . ILE C  2  54   ? 82.748  -30.545 47.649  1.00 97.57  ? 54   ILE C O     1 
ATOM   3973  C  CB    . ILE C  2  54   ? 81.700  -28.678 49.626  1.00 82.61  ? 54   ILE C CB    1 
ATOM   3974  C  CG1   . ILE C  2  54   ? 81.294  -28.206 51.023  1.00 78.60  ? 54   ILE C CG1   1 
ATOM   3975  C  CG2   . ILE C  2  54   ? 81.235  -27.680 48.594  1.00 85.28  ? 54   ILE C CG2   1 
ATOM   3976  C  CD1   . ILE C  2  54   ? 81.717  -26.792 51.335  1.00 73.93  ? 54   ILE C CD1   1 
ATOM   3977  N  N     . GLU C  2  55   ? 80.614  -31.128 47.214  1.00 105.84 ? 55   GLU C N     1 
ATOM   3978  C  CA    . GLU C  2  55   ? 80.921  -31.993 46.081  1.00 106.40 ? 55   GLU C CA    1 
ATOM   3979  C  C     . GLU C  2  55   ? 81.176  -31.253 44.773  1.00 114.29 ? 55   GLU C C     1 
ATOM   3980  O  O     . GLU C  2  55   ? 81.764  -31.846 43.861  1.00 120.69 ? 55   GLU C O     1 
ATOM   3981  C  CB    . GLU C  2  55   ? 79.774  -32.987 45.863  1.00 111.38 ? 55   GLU C CB    1 
ATOM   3982  C  CG    . GLU C  2  55   ? 79.540  -33.950 47.019  1.00 106.16 ? 55   GLU C CG    1 
ATOM   3983  C  CD    . GLU C  2  55   ? 80.384  -35.206 46.914  1.00 112.50 ? 55   GLU C CD    1 
ATOM   3984  O  OE1   . GLU C  2  55   ? 80.236  -36.097 47.779  1.00 102.73 ? 55   GLU C OE1   1 
ATOM   3985  O  OE2   . GLU C  2  55   ? 81.190  -35.303 45.962  1.00 117.41 ? 55   GLU C OE2   1 
ATOM   3986  N  N     . GLU C  2  56   ? 80.743  -29.997 44.654  1.00 111.80 ? 56   GLU C N     1 
ATOM   3987  C  CA    . GLU C  2  56   ? 80.739  -29.265 43.381  1.00 120.61 ? 56   GLU C CA    1 
ATOM   3988  C  C     . GLU C  2  56   ? 79.769  -29.919 42.395  1.00 120.88 ? 56   GLU C C     1 
ATOM   3989  O  O     . GLU C  2  56   ? 79.119  -29.238 41.600  1.00 120.74 ? 56   GLU C O     1 
ATOM   3990  C  CB    . GLU C  2  56   ? 82.154  -29.177 42.778  1.00 114.50 ? 56   GLU C CB    1 
ATOM   3991  C  CG    . GLU C  2  56   ? 82.217  -29.077 41.253  1.00 116.52 ? 56   GLU C CG    1 
ATOM   3992  C  CD    . GLU C  2  56   ? 82.128  -30.432 40.559  1.00 128.25 ? 56   GLU C CD    1 
ATOM   3993  O  OE1   . GLU C  2  56   ? 81.786  -30.465 39.358  1.00 136.72 ? 56   GLU C OE1   1 
ATOM   3994  O  OE2   . GLU C  2  56   ? 82.386  -31.462 41.217  1.00 123.84 ? 56   GLU C OE2   1 
ATOM   3995  N  N     . LEU C  2  64   ? 87.351  -31.280 42.203  1.00 94.18  ? 64   LEU C N     1 
ATOM   3996  C  CA    . LEU C  2  64   ? 87.566  -30.819 43.571  1.00 95.45  ? 64   LEU C CA    1 
ATOM   3997  C  C     . LEU C  2  64   ? 86.458  -31.285 44.519  1.00 103.56 ? 64   LEU C C     1 
ATOM   3998  O  O     . LEU C  2  64   ? 85.271  -31.188 44.203  1.00 108.70 ? 64   LEU C O     1 
ATOM   3999  C  CB    . LEU C  2  64   ? 87.671  -29.295 43.606  1.00 89.03  ? 64   LEU C CB    1 
ATOM   4000  C  CG    . LEU C  2  64   ? 88.881  -28.684 42.904  1.00 100.21 ? 64   LEU C CG    1 
ATOM   4001  C  CD1   . LEU C  2  64   ? 88.845  -27.172 43.015  1.00 99.54  ? 64   LEU C CD1   1 
ATOM   4002  C  CD2   . LEU C  2  64   ? 90.166  -29.237 43.494  1.00 109.53 ? 64   LEU C CD2   1 
ATOM   4003  N  N     . VAL C  2  65   ? 86.862  -31.790 45.685  1.00 96.31  ? 65   VAL C N     1 
ATOM   4004  C  CA    . VAL C  2  65   ? 85.943  -32.249 46.724  1.00 86.37  ? 65   VAL C CA    1 
ATOM   4005  C  C     . VAL C  2  65   ? 86.524  -31.849 48.074  1.00 91.51  ? 65   VAL C C     1 
ATOM   4006  O  O     . VAL C  2  65   ? 87.616  -32.300 48.440  1.00 95.75  ? 65   VAL C O     1 
ATOM   4007  C  CB    . VAL C  2  65   ? 85.713  -33.771 46.671  1.00 84.45  ? 65   VAL C CB    1 
ATOM   4008  C  CG1   . VAL C  2  65   ? 85.109  -34.268 47.976  1.00 82.66  ? 65   VAL C CG1   1 
ATOM   4009  C  CG2   . VAL C  2  65   ? 84.816  -34.135 45.501  1.00 91.19  ? 65   VAL C CG2   1 
ATOM   4010  N  N     . LEU C  2  66   ? 85.802  -31.008 48.812  1.00 92.41  ? 66   LEU C N     1 
ATOM   4011  C  CA    . LEU C  2  66   ? 86.217  -30.558 50.135  1.00 81.40  ? 66   LEU C CA    1 
ATOM   4012  C  C     . LEU C  2  66   ? 85.416  -31.306 51.193  1.00 72.93  ? 66   LEU C C     1 
ATOM   4013  O  O     . LEU C  2  66   ? 84.182  -31.317 51.150  1.00 81.19  ? 66   LEU C O     1 
ATOM   4014  C  CB    . LEU C  2  66   ? 86.025  -29.049 50.283  1.00 71.86  ? 66   LEU C CB    1 
ATOM   4015  C  CG    . LEU C  2  66   ? 86.424  -28.435 51.622  1.00 63.73  ? 66   LEU C CG    1 
ATOM   4016  C  CD1   . LEU C  2  66   ? 87.806  -28.905 52.031  1.00 72.65  ? 66   LEU C CD1   1 
ATOM   4017  C  CD2   . LEU C  2  66   ? 86.380  -26.920 51.533  1.00 65.05  ? 66   LEU C CD2   1 
ATOM   4018  N  N     . ASP C  2  67   ? 86.116  -31.927 52.137  1.00 69.45  ? 67   ASP C N     1 
ATOM   4019  C  CA    . ASP C  2  67   ? 85.493  -32.823 53.097  1.00 70.89  ? 67   ASP C CA    1 
ATOM   4020  C  C     . ASP C  2  67   ? 85.775  -32.366 54.521  1.00 70.51  ? 67   ASP C C     1 
ATOM   4021  O  O     . ASP C  2  67   ? 86.777  -31.700 54.794  1.00 77.34  ? 67   ASP C O     1 
ATOM   4022  C  CB    . ASP C  2  67   ? 85.988  -34.260 52.904  1.00 80.40  ? 67   ASP C CB    1 
ATOM   4023  C  CG    . ASP C  2  67   ? 85.019  -35.288 53.451  1.00 90.62  ? 67   ASP C CG    1 
ATOM   4024  O  OD1   . ASP C  2  67   ? 84.159  -34.918 54.279  1.00 90.29  ? 67   ASP C OD1   1 
ATOM   4025  O  OD2   . ASP C  2  67   ? 85.117  -36.469 53.053  1.00 106.32 ? 67   ASP C OD2   1 
ATOM   4026  N  N     . PHE C  2  68   ? 84.878  -32.740 55.428  1.00 68.73  ? 68   PHE C N     1 
ATOM   4027  C  CA    . PHE C  2  68   ? 84.968  -32.377 56.836  1.00 67.69  ? 68   PHE C CA    1 
ATOM   4028  C  C     . PHE C  2  68   ? 85.483  -33.559 57.644  1.00 67.66  ? 68   PHE C C     1 
ATOM   4029  O  O     . PHE C  2  68   ? 84.913  -34.654 57.584  1.00 66.99  ? 68   PHE C O     1 
ATOM   4030  C  CB    . PHE C  2  68   ? 83.604  -31.934 57.366  1.00 66.87  ? 68   PHE C CB    1 
ATOM   4031  C  CG    . PHE C  2  68   ? 83.494  -31.947 58.865  1.00 61.62  ? 68   PHE C CG    1 
ATOM   4032  C  CD1   . PHE C  2  68   ? 84.033  -30.921 59.619  1.00 53.75  ? 68   PHE C CD1   1 
ATOM   4033  C  CD2   . PHE C  2  68   ? 82.829  -32.977 59.517  1.00 59.62  ? 68   PHE C CD2   1 
ATOM   4034  C  CE1   . PHE C  2  68   ? 83.927  -30.928 60.991  1.00 54.12  ? 68   PHE C CE1   1 
ATOM   4035  C  CE2   . PHE C  2  68   ? 82.720  -32.988 60.893  1.00 55.37  ? 68   PHE C CE2   1 
ATOM   4036  C  CZ    . PHE C  2  68   ? 83.270  -31.963 61.631  1.00 56.61  ? 68   PHE C CZ    1 
ATOM   4037  N  N     . LEU C  2  69   ? 86.557  -33.332 58.401  1.00 60.29  ? 69   LEU C N     1 
ATOM   4038  C  CA    . LEU C  2  69   ? 87.137  -34.363 59.254  1.00 59.86  ? 69   LEU C CA    1 
ATOM   4039  C  C     . LEU C  2  69   ? 86.645  -34.261 60.694  1.00 61.34  ? 69   LEU C C     1 
ATOM   4040  O  O     . LEU C  2  69   ? 86.053  -35.206 61.224  1.00 64.21  ? 69   LEU C O     1 
ATOM   4041  C  CB    . LEU C  2  69   ? 88.668  -34.276 59.203  1.00 66.25  ? 69   LEU C CB    1 
ATOM   4042  C  CG    . LEU C  2  69   ? 89.338  -34.601 57.867  1.00 72.87  ? 69   LEU C CG    1 
ATOM   4043  C  CD1   . LEU C  2  69   ? 90.847  -34.601 58.026  1.00 78.61  ? 69   LEU C CD1   1 
ATOM   4044  C  CD2   . LEU C  2  69   ? 88.855  -35.937 57.327  1.00 71.66  ? 69   LEU C CD2   1 
ATOM   4045  N  N     . GLU C  2  70   ? 86.884  -33.120 61.335  1.00 63.16  ? 70   GLU C N     1 
ATOM   4046  C  CA    . GLU C  2  70   ? 86.498  -32.900 62.724  1.00 60.89  ? 70   GLU C CA    1 
ATOM   4047  C  C     . GLU C  2  70   ? 86.546  -31.405 63.002  1.00 60.45  ? 70   GLU C C     1 
ATOM   4048  O  O     . GLU C  2  70   ? 86.962  -30.606 62.159  1.00 63.26  ? 70   GLU C O     1 
ATOM   4049  C  CB    . GLU C  2  70   ? 87.416  -33.659 63.689  1.00 60.26  ? 70   GLU C CB    1 
ATOM   4050  C  CG    . GLU C  2  70   ? 88.891  -33.313 63.525  1.00 68.44  ? 70   GLU C CG    1 
ATOM   4051  C  CD    . GLU C  2  70   ? 89.783  -34.002 64.541  1.00 75.43  ? 70   GLU C CD    1 
ATOM   4052  O  OE1   . GLU C  2  70   ? 89.668  -33.691 65.745  1.00 88.03  ? 70   GLU C OE1   1 
ATOM   4053  O  OE2   . GLU C  2  70   ? 90.600  -34.856 64.135  1.00 69.16  ? 70   GLU C OE2   1 
ATOM   4054  N  N     . TYR C  2  71   ? 86.115  -31.033 64.202  1.00 57.63  ? 71   TYR C N     1 
ATOM   4055  C  CA    . TYR C  2  71   ? 86.216  -29.655 64.650  1.00 57.03  ? 71   TYR C CA    1 
ATOM   4056  C  C     . TYR C  2  71   ? 86.710  -29.650 66.086  1.00 52.93  ? 71   TYR C C     1 
ATOM   4057  O  O     . TYR C  2  71   ? 86.806  -30.693 66.740  1.00 55.41  ? 71   TYR C O     1 
ATOM   4058  C  CB    . TYR C  2  71   ? 84.878  -28.908 64.525  1.00 55.56  ? 71   TYR C CB    1 
ATOM   4059  C  CG    . TYR C  2  71   ? 83.844  -29.282 65.565  1.00 56.94  ? 71   TYR C CG    1 
ATOM   4060  C  CD1   . TYR C  2  71   ? 82.955  -30.328 65.347  1.00 55.15  ? 71   TYR C CD1   1 
ATOM   4061  C  CD2   . TYR C  2  71   ? 83.750  -28.582 66.763  1.00 54.13  ? 71   TYR C CD2   1 
ATOM   4062  C  CE1   . TYR C  2  71   ? 82.009  -30.668 66.299  1.00 56.02  ? 71   TYR C CE1   1 
ATOM   4063  C  CE2   . TYR C  2  71   ? 82.809  -28.916 67.717  1.00 50.10  ? 71   TYR C CE2   1 
ATOM   4064  C  CZ    . TYR C  2  71   ? 81.942  -29.958 67.481  1.00 51.30  ? 71   TYR C CZ    1 
ATOM   4065  O  OH    . TYR C  2  71   ? 81.003  -30.289 68.429  1.00 51.61  ? 71   TYR C OH    1 
ATOM   4066  N  N     . ARG C  2  72   ? 87.043  -28.457 66.567  1.00 47.48  ? 72   ARG C N     1 
ATOM   4067  C  CA    . ARG C  2  72   ? 87.456  -28.293 67.948  1.00 58.07  ? 72   ARG C CA    1 
ATOM   4068  C  C     . ARG C  2  72   ? 87.155  -26.872 68.393  1.00 56.71  ? 72   ARG C C     1 
ATOM   4069  O  O     . ARG C  2  72   ? 87.077  -25.945 67.578  1.00 56.67  ? 72   ARG C O     1 
ATOM   4070  C  CB    . ARG C  2  72   ? 88.945  -28.613 68.146  1.00 61.66  ? 72   ARG C CB    1 
ATOM   4071  C  CG    . ARG C  2  72   ? 89.906  -27.561 67.617  1.00 55.33  ? 72   ARG C CG    1 
ATOM   4072  C  CD    . ARG C  2  72   ? 91.340  -27.874 68.038  1.00 56.97  ? 72   ARG C CD    1 
ATOM   4073  N  NE    . ARG C  2  72   ? 92.292  -26.882 67.545  1.00 56.81  ? 72   ARG C NE    1 
ATOM   4074  C  CZ    . ARG C  2  72   ? 92.613  -25.769 68.195  1.00 57.19  ? 72   ARG C CZ    1 
ATOM   4075  N  NH1   . ARG C  2  72   ? 92.056  -25.501 69.367  1.00 60.11  ? 72   ARG C NH1   1 
ATOM   4076  N  NH2   . ARG C  2  72   ? 93.487  -24.920 67.670  1.00 60.44  ? 72   ARG C NH2   1 
ATOM   4077  N  N     . LEU C  2  73   ? 86.974  -26.719 69.700  1.00 48.05  ? 73   LEU C N     1 
ATOM   4078  C  CA    . LEU C  2  73   ? 86.725  -25.431 70.327  1.00 50.56  ? 73   LEU C CA    1 
ATOM   4079  C  C     . LEU C  2  73   ? 87.893  -25.092 71.243  1.00 52.07  ? 73   LEU C C     1 
ATOM   4080  O  O     . LEU C  2  73   ? 88.338  -25.938 72.026  1.00 58.09  ? 73   LEU C O     1 
ATOM   4081  C  CB    . LEU C  2  73   ? 85.414  -25.456 71.115  1.00 57.10  ? 73   LEU C CB    1 
ATOM   4082  C  CG    . LEU C  2  73   ? 84.123  -25.501 70.296  1.00 49.79  ? 73   LEU C CG    1 
ATOM   4083  C  CD1   . LEU C  2  73   ? 82.961  -25.930 71.172  1.00 43.96  ? 73   LEU C CD1   1 
ATOM   4084  C  CD2   . LEU C  2  73   ? 83.847  -24.146 69.664  1.00 47.45  ? 73   LEU C CD2   1 
ATOM   4085  N  N     . GLY C  2  74   ? 88.386  -23.860 71.144  1.00 48.03  ? 74   GLY C N     1 
ATOM   4086  C  CA    . GLY C  2  74   ? 89.497  -23.409 71.952  1.00 57.78  ? 74   GLY C CA    1 
ATOM   4087  C  C     . GLY C  2  74   ? 89.057  -22.901 73.313  1.00 59.77  ? 74   GLY C C     1 
ATOM   4088  O  O     . GLY C  2  74   ? 87.936  -23.129 73.770  1.00 58.31  ? 74   GLY C O     1 
ATOM   4089  N  N     . GLU C  2  75   ? 89.982  -22.195 73.975  1.00 62.28  ? 75   GLU C N     1 
ATOM   4090  C  CA    . GLU C  2  75   ? 89.701  -21.574 75.257  1.00 63.90  ? 75   GLU C CA    1 
ATOM   4091  C  C     . GLU C  2  75   ? 89.264  -20.124 75.063  1.00 66.38  ? 75   GLU C C     1 
ATOM   4092  O  O     . GLU C  2  75   ? 89.645  -19.480 74.079  1.00 61.29  ? 75   GLU C O     1 
ATOM   4093  C  CB    . GLU C  2  75   ? 90.934  -21.625 76.158  1.00 65.64  ? 75   GLU C CB    1 
ATOM   4094  C  CG    . GLU C  2  75   ? 91.335  -23.027 76.600  1.00 73.24  ? 75   GLU C CG    1 
ATOM   4095  C  CD    . GLU C  2  75   ? 90.230  -23.752 77.355  1.00 85.76  ? 75   GLU C CD    1 
ATOM   4096  O  OE1   . GLU C  2  75   ? 89.958  -24.928 77.027  1.00 90.08  ? 75   GLU C OE1   1 
ATOM   4097  O  OE2   . GLU C  2  75   ? 89.632  -23.149 78.274  1.00 84.16  ? 75   GLU C OE2   1 
ATOM   4098  N  N     . PRO C  2  76   ? 88.446  -19.604 75.975  1.00 66.60  ? 76   PRO C N     1 
ATOM   4099  C  CA    . PRO C  2  76   ? 87.988  -18.212 75.867  1.00 62.81  ? 76   PRO C CA    1 
ATOM   4100  C  C     . PRO C  2  76   ? 89.150  -17.238 75.916  1.00 62.40  ? 76   PRO C C     1 
ATOM   4101  O  O     . PRO C  2  76   ? 90.000  -17.315 76.817  1.00 62.29  ? 76   PRO C O     1 
ATOM   4102  C  CB    . PRO C  2  76   ? 87.073  -18.049 77.090  1.00 58.93  ? 76   PRO C CB    1 
ATOM   4103  C  CG    . PRO C  2  76   ? 86.591  -19.432 77.372  1.00 59.08  ? 76   PRO C CG    1 
ATOM   4104  C  CD    . PRO C  2  76   ? 87.738  -20.338 77.040  1.00 59.82  ? 76   PRO C CD    1 
ATOM   4105  N  N     . PRO C  2  77   ? 89.226  -16.308 74.960  1.00 57.47  ? 77   PRO C N     1 
ATOM   4106  C  CA    . PRO C  2  77   ? 90.283  -15.286 75.013  1.00 56.35  ? 77   PRO C CA    1 
ATOM   4107  C  C     . PRO C  2  77   ? 90.184  -14.369 76.216  1.00 63.43  ? 77   PRO C C     1 
ATOM   4108  O  O     . PRO C  2  77   ? 91.186  -13.745 76.583  1.00 68.16  ? 77   PRO C O     1 
ATOM   4109  C  CB    . PRO C  2  77   ? 90.088  -14.507 73.704  1.00 57.24  ? 77   PRO C CB    1 
ATOM   4110  C  CG    . PRO C  2  77   ? 89.337  -15.435 72.812  1.00 63.34  ? 77   PRO C CG    1 
ATOM   4111  C  CD    . PRO C  2  77   ? 88.442  -16.226 73.717  1.00 60.73  ? 77   PRO C CD    1 
ATOM   4112  N  N     . PHE C  2  78   ? 89.014  -14.258 76.839  1.00 69.83  ? 78   PHE C N     1 
ATOM   4113  C  CA    . PHE C  2  78   ? 88.835  -13.362 77.973  1.00 70.30  ? 78   PHE C CA    1 
ATOM   4114  C  C     . PHE C  2  78   ? 87.812  -13.963 78.920  1.00 75.15  ? 78   PHE C C     1 
ATOM   4115  O  O     . PHE C  2  78   ? 86.865  -14.621 78.466  1.00 71.45  ? 78   PHE C O     1 
ATOM   4116  C  CB    . PHE C  2  78   ? 88.383  -11.967 77.520  1.00 70.03  ? 78   PHE C CB    1 
ATOM   4117  C  CG    . PHE C  2  78   ? 89.330  -11.312 76.562  1.00 72.76  ? 78   PHE C CG    1 
ATOM   4118  C  CD1   . PHE C  2  78   ? 90.459  -10.659 77.026  1.00 74.38  ? 78   PHE C CD1   1 
ATOM   4119  C  CD2   . PHE C  2  78   ? 89.103  -11.361 75.198  1.00 62.59  ? 78   PHE C CD2   1 
ATOM   4120  C  CE1   . PHE C  2  78   ? 91.338  -10.061 76.151  1.00 68.48  ? 78   PHE C CE1   1 
ATOM   4121  C  CE2   . PHE C  2  78   ? 89.976  -10.764 74.319  1.00 63.26  ? 78   PHE C CE2   1 
ATOM   4122  C  CZ    . PHE C  2  78   ? 91.096  -10.113 74.796  1.00 66.54  ? 78   PHE C CZ    1 
ATOM   4123  N  N     . PRO C  2  79   ? 87.973  -13.769 80.229  1.00 79.57  ? 79   PRO C N     1 
ATOM   4124  C  CA    . PRO C  2  79   ? 86.991  -14.296 81.184  1.00 76.84  ? 79   PRO C CA    1 
ATOM   4125  C  C     . PRO C  2  79   ? 85.701  -13.486 81.161  1.00 75.78  ? 79   PRO C C     1 
ATOM   4126  O  O     . PRO C  2  79   ? 85.591  -12.447 80.506  1.00 75.09  ? 79   PRO C O     1 
ATOM   4127  C  CB    . PRO C  2  79   ? 87.712  -14.185 82.531  1.00 79.16  ? 79   PRO C CB    1 
ATOM   4128  C  CG    . PRO C  2  79   ? 88.690  -13.079 82.341  1.00 76.54  ? 79   PRO C CG    1 
ATOM   4129  C  CD    . PRO C  2  79   ? 89.132  -13.162 80.906  1.00 74.16  ? 79   PRO C CD    1 
ATOM   4130  N  N     . GLN C  2  80   ? 84.704  -13.991 81.896  1.00 71.50  ? 80   GLN C N     1 
ATOM   4131  C  CA    . GLN C  2  80   ? 83.373  -13.389 81.865  1.00 67.71  ? 80   GLN C CA    1 
ATOM   4132  C  C     . GLN C  2  80   ? 83.405  -11.943 82.351  1.00 70.57  ? 80   GLN C C     1 
ATOM   4133  O  O     . GLN C  2  80   ? 82.824  -11.050 81.720  1.00 67.51  ? 80   GLN C O     1 
ATOM   4134  C  CB    . GLN C  2  80   ? 82.403  -14.214 82.711  1.00 66.20  ? 80   GLN C CB    1 
ATOM   4135  C  CG    . GLN C  2  80   ? 82.208  -15.652 82.257  1.00 63.81  ? 80   GLN C CG    1 
ATOM   4136  C  CD    . GLN C  2  80   ? 81.270  -16.420 83.178  1.00 73.03  ? 80   GLN C CD    1 
ATOM   4137  O  OE1   . GLN C  2  80   ? 80.660  -15.843 84.083  1.00 72.54  ? 80   GLN C OE1   1 
ATOM   4138  N  NE2   . GLN C  2  80   ? 81.156  -17.726 82.955  1.00 68.98  ? 80   GLN C NE2   1 
ATOM   4139  N  N     . ASP C  2  81   ? 84.064  -11.697 83.487  1.00 77.14  ? 81   ASP C N     1 
ATOM   4140  C  CA    . ASP C  2  81   ? 84.136  -10.343 84.028  1.00 80.07  ? 81   ASP C CA    1 
ATOM   4141  C  C     . ASP C  2  81   ? 84.770  -9.386  83.028  1.00 77.62  ? 81   ASP C C     1 
ATOM   4142  O  O     . ASP C  2  81   ? 84.293  -8.259  82.841  1.00 76.02  ? 81   ASP C O     1 
ATOM   4143  C  CB    . ASP C  2  81   ? 84.918  -10.352 85.340  1.00 84.92  ? 81   ASP C CB    1 
ATOM   4144  C  CG    . ASP C  2  81   ? 85.469  -11.725 85.675  1.00 94.74  ? 81   ASP C CG    1 
ATOM   4145  O  OD1   . ASP C  2  81   ? 84.697  -12.578 86.169  1.00 96.72  ? 81   ASP C OD1   1 
ATOM   4146  O  OD2   . ASP C  2  81   ? 86.670  -11.961 85.416  1.00 90.42  ? 81   ASP C OD2   1 
ATOM   4147  N  N     . GLU C  2  82   ? 85.842  -9.824  82.367  1.00 79.00  ? 82   GLU C N     1 
ATOM   4148  C  CA    . GLU C  2  82   ? 86.468  -9.001  81.341  1.00 76.68  ? 82   GLU C CA    1 
ATOM   4149  C  C     . GLU C  2  82   ? 85.503  -8.711  80.196  1.00 77.97  ? 82   GLU C C     1 
ATOM   4150  O  O     . GLU C  2  82   ? 85.460  -7.586  79.680  1.00 82.13  ? 82   GLU C O     1 
ATOM   4151  C  CB    . GLU C  2  82   ? 87.728  -9.693  80.828  1.00 77.67  ? 82   GLU C CB    1 
ATOM   4152  C  CG    . GLU C  2  82   ? 88.362  -9.006  79.647  1.00 84.57  ? 82   GLU C CG    1 
ATOM   4153  C  CD    . GLU C  2  82   ? 89.824  -8.725  79.873  1.00 92.12  ? 82   GLU C CD    1 
ATOM   4154  O  OE1   . GLU C  2  82   ? 90.405  -9.321  80.808  1.00 90.02  ? 82   GLU C OE1   1 
ATOM   4155  O  OE2   . GLU C  2  82   ? 90.387  -7.903  79.121  1.00 96.43  ? 82   GLU C OE2   1 
ATOM   4156  N  N     . CYS C  2  83   ? 84.714  -9.711  79.790  1.00 74.14  ? 83   CYS C N     1 
ATOM   4157  C  CA    . CYS C  2  83   ? 83.753  -9.505  78.709  1.00 72.00  ? 83   CYS C CA    1 
ATOM   4158  C  C     . CYS C  2  83   ? 82.716  -8.456  79.094  1.00 73.94  ? 83   CYS C C     1 
ATOM   4159  O  O     . CYS C  2  83   ? 82.444  -7.527  78.324  1.00 76.47  ? 83   CYS C O     1 
ATOM   4160  C  CB    . CYS C  2  83   ? 83.070  -10.826 78.340  1.00 68.73  ? 83   CYS C CB    1 
ATOM   4161  S  SG    . CYS C  2  83   ? 84.136  -12.082 77.586  1.00 62.61  ? 83   CYS C SG    1 
ATOM   4162  N  N     . ARG C  2  84   ? 82.127  -8.587  80.288  1.00 75.79  ? 84   ARG C N     1 
ATOM   4163  C  CA    . ARG C  2  84   ? 81.153  -7.597  80.744  1.00 74.45  ? 84   ARG C CA    1 
ATOM   4164  C  C     . ARG C  2  84   ? 81.782  -6.211  80.849  1.00 73.69  ? 84   ARG C C     1 
ATOM   4165  O  O     . ARG C  2  84   ? 81.134  -5.199  80.554  1.00 67.42  ? 84   ARG C O     1 
ATOM   4166  C  CB    . ARG C  2  84   ? 80.560  -8.015  82.091  1.00 70.93  ? 84   ARG C CB    1 
ATOM   4167  C  CG    . ARG C  2  84   ? 79.829  -9.344  82.070  1.00 67.43  ? 84   ARG C CG    1 
ATOM   4168  C  CD    . ARG C  2  84   ? 79.197  -9.641  83.420  1.00 64.83  ? 84   ARG C CD    1 
ATOM   4169  N  NE    . ARG C  2  84   ? 78.454  -10.900 83.423  1.00 59.18  ? 84   ARG C NE    1 
ATOM   4170  C  CZ    . ARG C  2  84   ? 78.900  -12.031 83.959  1.00 58.53  ? 84   ARG C CZ    1 
ATOM   4171  N  NH1   . ARG C  2  84   ? 80.093  -12.065 84.543  1.00 52.46  ? 84   ARG C NH1   1 
ATOM   4172  N  NH2   . ARG C  2  84   ? 78.153  -13.127 83.915  1.00 56.09  ? 84   ARG C NH2   1 
ATOM   4173  N  N     . GLU C  2  85   ? 83.048  -6.149  81.260  1.00 74.85  ? 85   GLU C N     1 
ATOM   4174  C  CA    . GLU C  2  85   ? 83.717  -4.864  81.422  1.00 80.14  ? 85   GLU C CA    1 
ATOM   4175  C  C     . GLU C  2  85   ? 83.930  -4.172  80.079  1.00 80.61  ? 85   GLU C C     1 
ATOM   4176  O  O     . GLU C  2  85   ? 83.595  -2.992  79.918  1.00 83.78  ? 85   GLU C O     1 
ATOM   4177  C  CB    . GLU C  2  85   ? 85.047  -5.072  82.149  1.00 81.39  ? 85   GLU C CB    1 
ATOM   4178  C  CG    . GLU C  2  85   ? 86.000  -3.894  82.088  1.00 88.47  ? 85   GLU C CG    1 
ATOM   4179  C  CD    . GLU C  2  85   ? 85.603  -2.767  83.019  1.00 103.82 ? 85   GLU C CD    1 
ATOM   4180  O  OE1   . GLU C  2  85   ? 84.610  -2.921  83.764  1.00 99.01  ? 85   GLU C OE1   1 
ATOM   4181  O  OE2   . GLU C  2  85   ? 86.291  -1.724  83.009  1.00 110.60 ? 85   GLU C OE2   1 
ATOM   4182  N  N     . LYS C  2  86   ? 84.472  -4.892  79.098  1.00 79.10  ? 86   LYS C N     1 
ATOM   4183  C  CA    . LYS C  2  86   ? 84.941  -4.294  77.855  1.00 78.59  ? 86   LYS C CA    1 
ATOM   4184  C  C     . LYS C  2  86   ? 83.939  -4.399  76.707  1.00 76.68  ? 86   LYS C C     1 
ATOM   4185  O  O     . LYS C  2  86   ? 84.304  -4.124  75.559  1.00 79.82  ? 86   LYS C O     1 
ATOM   4186  C  CB    . LYS C  2  86   ? 86.270  -4.931  77.443  1.00 77.13  ? 86   LYS C CB    1 
ATOM   4187  C  CG    . LYS C  2  86   ? 87.401  -4.697  78.434  1.00 80.79  ? 86   LYS C CG    1 
ATOM   4188  C  CD    . LYS C  2  86   ? 88.714  -5.243  77.906  1.00 87.50  ? 86   LYS C CD    1 
ATOM   4189  C  CE    . LYS C  2  86   ? 89.895  -4.716  78.702  1.00 94.88  ? 86   LYS C CE    1 
ATOM   4190  N  NZ    . LYS C  2  86   ? 91.191  -5.078  78.056  1.00 103.89 ? 86   LYS C NZ    1 
ATOM   4191  N  N     . ASP C  2  87   ? 82.692  -4.782  76.989  1.00 70.21  ? 87   ASP C N     1 
ATOM   4192  C  CA    . ASP C  2  87   ? 81.656  -4.951  75.964  1.00 73.00  ? 87   ASP C CA    1 
ATOM   4193  C  C     . ASP C  2  87   ? 82.079  -5.974  74.906  1.00 69.30  ? 87   ASP C C     1 
ATOM   4194  O  O     . ASP C  2  87   ? 81.955  -5.750  73.699  1.00 64.64  ? 87   ASP C O     1 
ATOM   4195  C  CB    . ASP C  2  87   ? 81.284  -3.612  75.319  1.00 80.40  ? 87   ASP C CB    1 
ATOM   4196  C  CG    . ASP C  2  87   ? 80.429  -2.739  76.227  1.00 93.28  ? 87   ASP C CG    1 
ATOM   4197  O  OD1   . ASP C  2  87   ? 79.830  -3.269  77.190  1.00 85.26  ? 87   ASP C OD1   1 
ATOM   4198  O  OD2   . ASP C  2  87   ? 80.349  -1.519  75.969  1.00 102.65 ? 87   ASP C OD2   1 
ATOM   4199  N  N     . LEU C  2  88   ? 82.574  -7.114  75.377  1.00 68.32  ? 88   LEU C N     1 
ATOM   4200  C  CA    . LEU C  2  88   ? 83.000  -8.214  74.527  1.00 65.41  ? 88   LEU C CA    1 
ATOM   4201  C  C     . LEU C  2  88   ? 82.071  -9.407  74.708  1.00 61.68  ? 88   LEU C C     1 
ATOM   4202  O  O     . LEU C  2  88   ? 81.402  -9.554  75.733  1.00 63.68  ? 88   LEU C O     1 
ATOM   4203  C  CB    . LEU C  2  88   ? 84.439  -8.631  74.843  1.00 57.36  ? 88   LEU C CB    1 
ATOM   4204  C  CG    . LEU C  2  88   ? 85.477  -7.511  74.832  1.00 65.24  ? 88   LEU C CG    1 
ATOM   4205  C  CD1   . LEU C  2  88   ? 86.842  -8.053  75.231  1.00 72.18  ? 88   LEU C CD1   1 
ATOM   4206  C  CD2   . LEU C  2  88   ? 85.529  -6.843  73.467  1.00 67.97  ? 88   LEU C CD2   1 
ATOM   4207  N  N     . THR C  2  89   ? 82.044  -10.266 73.695  1.00 54.01  ? 89   THR C N     1 
ATOM   4208  C  CA    . THR C  2  89   ? 81.229  -11.470 73.726  1.00 48.02  ? 89   THR C CA    1 
ATOM   4209  C  C     . THR C  2  89   ? 82.037  -12.631 74.289  1.00 52.96  ? 89   THR C C     1 
ATOM   4210  O  O     . THR C  2  89   ? 83.149  -12.905 73.827  1.00 51.40  ? 89   THR C O     1 
ATOM   4211  C  CB    . THR C  2  89   ? 80.720  -11.807 72.327  1.00 47.65  ? 89   THR C CB    1 
ATOM   4212  O  OG1   . THR C  2  89   ? 79.781  -10.808 71.913  1.00 52.22  ? 89   THR C OG1   1 
ATOM   4213  C  CG2   . THR C  2  89   ? 80.058  -13.179 72.307  1.00 42.11  ? 89   THR C CG2   1 
ATOM   4214  N  N     . TYR C  2  90   ? 81.476  -13.304 75.293  1.00 54.06  ? 90   TYR C N     1 
ATOM   4215  C  CA    . TYR C  2  90   ? 82.099  -14.484 75.885  1.00 49.85  ? 90   TYR C CA    1 
ATOM   4216  C  C     . TYR C  2  90   ? 81.948  -15.654 74.924  1.00 49.43  ? 90   TYR C C     1 
ATOM   4217  O  O     . TYR C  2  90   ? 80.836  -16.145 74.703  1.00 47.68  ? 90   TYR C O     1 
ATOM   4218  C  CB    . TYR C  2  90   ? 81.455  -14.788 77.231  1.00 46.96  ? 90   TYR C CB    1 
ATOM   4219  C  CG    . TYR C  2  90   ? 82.089  -15.925 77.995  1.00 49.71  ? 90   TYR C CG    1 
ATOM   4220  C  CD1   . TYR C  2  90   ? 83.368  -15.806 78.519  1.00 54.16  ? 90   TYR C CD1   1 
ATOM   4221  C  CD2   . TYR C  2  90   ? 81.394  -17.106 78.223  1.00 52.69  ? 90   TYR C CD2   1 
ATOM   4222  C  CE1   . TYR C  2  90   ? 83.946  -16.839 79.229  1.00 57.34  ? 90   TYR C CE1   1 
ATOM   4223  C  CE2   . TYR C  2  90   ? 81.962  -18.142 78.935  1.00 55.97  ? 90   TYR C CE2   1 
ATOM   4224  C  CZ    . TYR C  2  90   ? 83.239  -18.004 79.435  1.00 58.91  ? 90   TYR C CZ    1 
ATOM   4225  O  OH    . TYR C  2  90   ? 83.807  -19.036 80.145  1.00 63.67  ? 90   TYR C OH    1 
ATOM   4226  N  N     . GLN C  2  91   ? 83.064  -16.105 74.357  1.00 49.52  ? 91   GLN C N     1 
ATOM   4227  C  CA    . GLN C  2  91   ? 83.019  -17.030 73.234  1.00 49.54  ? 91   GLN C CA    1 
ATOM   4228  C  C     . GLN C  2  91   ? 84.335  -17.790 73.153  1.00 50.84  ? 91   GLN C C     1 
ATOM   4229  O  O     . GLN C  2  91   ? 85.332  -17.422 73.780  1.00 52.14  ? 91   GLN C O     1 
ATOM   4230  C  CB    . GLN C  2  91   ? 82.739  -16.280 71.929  1.00 51.62  ? 91   GLN C CB    1 
ATOM   4231  C  CG    . GLN C  2  91   ? 83.689  -15.123 71.677  1.00 51.53  ? 91   GLN C CG    1 
ATOM   4232  C  CD    . GLN C  2  91   ? 83.231  -14.246 70.535  1.00 53.52  ? 91   GLN C CD    1 
ATOM   4233  O  OE1   . GLN C  2  91   ? 82.160  -14.464 69.966  1.00 52.92  ? 91   GLN C OE1   1 
ATOM   4234  N  NE2   . GLN C  2  91   ? 84.044  -13.255 70.182  1.00 56.08  ? 91   GLN C NE2   1 
ATOM   4235  N  N     . ALA C  2  92   ? 84.323  -18.859 72.353  1.00 53.07  ? 92   ALA C N     1 
ATOM   4236  C  CA    . ALA C  2  92   ? 85.475  -19.722 72.139  1.00 53.01  ? 92   ALA C CA    1 
ATOM   4237  C  C     . ALA C  2  92   ? 85.782  -19.842 70.653  1.00 49.81  ? 92   ALA C C     1 
ATOM   4238  O  O     . ALA C  2  92   ? 84.859  -19.884 69.828  1.00 50.57  ? 92   ALA C O     1 
ATOM   4239  C  CB    . ALA C  2  92   ? 85.236  -21.122 72.726  1.00 51.12  ? 92   ALA C CB    1 
ATOM   4240  N  N     . PRO C  2  93   ? 87.062  -19.904 70.280  1.00 51.17  ? 93   PRO C N     1 
ATOM   4241  C  CA    . PRO C  2  93   ? 87.415  -20.034 68.860  1.00 51.95  ? 93   PRO C CA    1 
ATOM   4242  C  C     . PRO C  2  93   ? 87.073  -21.421 68.338  1.00 52.33  ? 93   PRO C C     1 
ATOM   4243  O  O     . PRO C  2  93   ? 87.365  -22.430 68.982  1.00 52.96  ? 93   PRO C O     1 
ATOM   4244  C  CB    . PRO C  2  93   ? 88.928  -19.785 68.849  1.00 55.21  ? 93   PRO C CB    1 
ATOM   4245  C  CG    . PRO C  2  93   ? 89.378  -20.220 70.209  1.00 54.29  ? 93   PRO C CG    1 
ATOM   4246  C  CD    . PRO C  2  93   ? 88.257  -19.845 71.143  1.00 56.55  ? 93   PRO C CD    1 
ATOM   4247  N  N     . LEU C  2  94   ? 86.449  -21.463 67.163  1.00 49.15  ? 94   LEU C N     1 
ATOM   4248  C  CA    . LEU C  2  94   ? 86.050  -22.712 66.526  1.00 46.90  ? 94   LEU C CA    1 
ATOM   4249  C  C     . LEU C  2  94   ? 86.969  -22.974 65.344  1.00 51.61  ? 94   LEU C C     1 
ATOM   4250  O  O     . LEU C  2  94   ? 87.039  -22.160 64.417  1.00 54.74  ? 94   LEU C O     1 
ATOM   4251  C  CB    . LEU C  2  94   ? 84.594  -22.668 66.065  1.00 45.99  ? 94   LEU C CB    1 
ATOM   4252  C  CG    . LEU C  2  94   ? 84.131  -23.902 65.282  1.00 45.04  ? 94   LEU C CG    1 
ATOM   4253  C  CD1   . LEU C  2  94   ? 84.201  -25.144 66.149  1.00 46.27  ? 94   LEU C CD1   1 
ATOM   4254  C  CD2   . LEU C  2  94   ? 82.730  -23.721 64.728  1.00 45.14  ? 94   LEU C CD2   1 
ATOM   4255  N  N     . TYR C  2  95   ? 87.664  -24.105 65.377  1.00 52.28  ? 95   TYR C N     1 
ATOM   4256  C  CA    . TYR C  2  95   ? 88.498  -24.544 64.273  1.00 50.81  ? 95   TYR C CA    1 
ATOM   4257  C  C     . TYR C  2  95   ? 87.901  -25.802 63.663  1.00 50.73  ? 95   TYR C C     1 
ATOM   4258  O  O     . TYR C  2  95   ? 87.295  -26.619 64.362  1.00 50.11  ? 95   TYR C O     1 
ATOM   4259  C  CB    . TYR C  2  95   ? 89.928  -24.818 64.741  1.00 53.85  ? 95   TYR C CB    1 
ATOM   4260  C  CG    . TYR C  2  95   ? 90.606  -23.652 65.426  1.00 53.21  ? 95   TYR C CG    1 
ATOM   4261  C  CD1   . TYR C  2  95   ? 91.260  -22.675 64.689  1.00 60.54  ? 95   TYR C CD1   1 
ATOM   4262  C  CD2   . TYR C  2  95   ? 90.610  -23.538 66.811  1.00 50.48  ? 95   TYR C CD2   1 
ATOM   4263  C  CE1   . TYR C  2  95   ? 91.894  -21.611 65.308  1.00 65.31  ? 95   TYR C CE1   1 
ATOM   4264  C  CE2   . TYR C  2  95   ? 91.244  -22.477 67.442  1.00 53.26  ? 95   TYR C CE2   1 
ATOM   4265  C  CZ    . TYR C  2  95   ? 91.883  -21.515 66.684  1.00 62.47  ? 95   TYR C CZ    1 
ATOM   4266  O  OH    . TYR C  2  95   ? 92.516  -20.453 67.293  1.00 61.27  ? 95   TYR C OH    1 
ATOM   4267  N  N     . ALA C  2  96   ? 88.070  -25.952 62.350  1.00 52.97  ? 96   ALA C N     1 
ATOM   4268  C  CA    . ALA C  2  96   ? 87.561  -27.112 61.626  1.00 57.55  ? 96   ALA C CA    1 
ATOM   4269  C  C     . ALA C  2  96   ? 88.646  -27.651 60.706  1.00 70.10  ? 96   ALA C C     1 
ATOM   4270  O  O     . ALA C  2  96   ? 89.221  -26.901 59.910  1.00 67.69  ? 96   ALA C O     1 
ATOM   4271  C  CB    . ALA C  2  96   ? 86.309  -26.759 60.818  1.00 50.96  ? 96   ALA C CB    1 
ATOM   4272  N  N     . ARG C  2  97   ? 88.929  -28.946 60.823  1.00 73.48  ? 97   ARG C N     1 
ATOM   4273  C  CA    . ARG C  2  97   ? 89.922  -29.606 59.983  1.00 71.45  ? 97   ARG C CA    1 
ATOM   4274  C  C     . ARG C  2  97   ? 89.227  -30.127 58.731  1.00 62.81  ? 97   ARG C C     1 
ATOM   4275  O  O     . ARG C  2  97   ? 88.380  -31.024 58.805  1.00 56.76  ? 97   ARG C O     1 
ATOM   4276  C  CB    . ARG C  2  97   ? 90.611  -30.735 60.746  1.00 78.65  ? 97   ARG C CB    1 
ATOM   4277  C  CG    . ARG C  2  97   ? 91.216  -30.310 62.086  1.00 87.41  ? 97   ARG C CG    1 
ATOM   4278  C  CD    . ARG C  2  97   ? 92.551  -31.008 62.366  1.00 99.52  ? 97   ARG C CD    1 
ATOM   4279  N  NE    . ARG C  2  97   ? 92.453  -32.468 62.334  1.00 111.59 ? 97   ARG C NE    1 
ATOM   4280  C  CZ    . ARG C  2  97   ? 92.867  -33.225 61.321  1.00 100.82 ? 97   ARG C CZ    1 
ATOM   4281  N  NH1   . ARG C  2  97   ? 93.412  -32.663 60.251  1.00 93.89  ? 97   ARG C NH1   1 
ATOM   4282  N  NH2   . ARG C  2  97   ? 92.740  -34.545 61.377  1.00 96.80  ? 97   ARG C NH2   1 
ATOM   4283  N  N     . LEU C  2  98   ? 89.582  -29.560 57.585  1.00 67.72  ? 98   LEU C N     1 
ATOM   4284  C  CA    . LEU C  2  98   ? 89.040  -29.961 56.299  1.00 70.81  ? 98   LEU C CA    1 
ATOM   4285  C  C     . LEU C  2  98   ? 90.177  -30.405 55.389  1.00 77.39  ? 98   LEU C C     1 
ATOM   4286  O  O     . LEU C  2  98   ? 91.275  -29.843 55.428  1.00 86.19  ? 98   LEU C O     1 
ATOM   4287  C  CB    . LEU C  2  98   ? 88.277  -28.812 55.638  1.00 64.06  ? 98   LEU C CB    1 
ATOM   4288  C  CG    . LEU C  2  98   ? 87.279  -28.042 56.497  1.00 61.83  ? 98   LEU C CG    1 
ATOM   4289  C  CD1   . LEU C  2  98   ? 86.863  -26.761 55.795  1.00 59.98  ? 98   LEU C CD1   1 
ATOM   4290  C  CD2   . LEU C  2  98   ? 86.069  -28.907 56.794  1.00 64.04  ? 98   LEU C CD2   1 
ATOM   4291  N  N     . GLN C  2  99   ? 89.908  -31.408 54.558  1.00 79.45  ? 99   GLN C N     1 
ATOM   4292  C  CA    . GLN C  2  99   ? 90.868  -31.864 53.564  1.00 82.13  ? 99   GLN C CA    1 
ATOM   4293  C  C     . GLN C  2  99   ? 90.266  -31.687 52.177  1.00 79.19  ? 99   GLN C C     1 
ATOM   4294  O  O     . GLN C  2  99   ? 89.168  -32.182 51.899  1.00 77.05  ? 99   GLN C O     1 
ATOM   4295  C  CB    . GLN C  2  99   ? 91.289  -33.320 53.809  1.00 84.76  ? 99   GLN C CB    1 
ATOM   4296  C  CG    . GLN C  2  99   ? 90.190  -34.366 53.701  1.00 84.88  ? 99   GLN C CG    1 
ATOM   4297  C  CD    . GLN C  2  99   ? 90.719  -35.774 53.894  1.00 85.72  ? 99   GLN C CD    1 
ATOM   4298  O  OE1   . GLN C  2  99   ? 90.297  -36.710 53.215  1.00 88.51  ? 99   GLN C OE1   1 
ATOM   4299  N  NE2   . GLN C  2  99   ? 91.647  -35.931 54.828  1.00 84.13  ? 99   GLN C NE2   1 
ATOM   4300  N  N     . LEU C  2  100  ? 90.973  -30.949 51.323  1.00 87.45  ? 100  LEU C N     1 
ATOM   4301  C  CA    . LEU C  2  100  ? 90.609  -30.784 49.923  1.00 86.33  ? 100  LEU C CA    1 
ATOM   4302  C  C     . LEU C  2  100  ? 91.170  -31.958 49.132  1.00 84.04  ? 100  LEU C C     1 
ATOM   4303  O  O     . LEU C  2  100  ? 92.391  -32.144 49.070  1.00 92.80  ? 100  LEU C O     1 
ATOM   4304  C  CB    . LEU C  2  100  ? 91.148  -29.461 49.383  1.00 83.94  ? 100  LEU C CB    1 
ATOM   4305  C  CG    . LEU C  2  100  ? 90.928  -29.166 47.900  1.00 86.31  ? 100  LEU C CG    1 
ATOM   4306  C  CD1   . LEU C  2  100  ? 89.456  -29.271 47.557  1.00 88.49  ? 100  LEU C CD1   1 
ATOM   4307  C  CD2   . LEU C  2  100  ? 91.460  -27.785 47.556  1.00 94.04  ? 100  LEU C CD2   1 
ATOM   4308  N  N     . ILE C  2  101  ? 90.277  -32.748 48.544  1.00 85.06  ? 101  ILE C N     1 
ATOM   4309  C  CA    . ILE C  2  101  ? 90.632  -33.911 47.742  1.00 90.07  ? 101  ILE C CA    1 
ATOM   4310  C  C     . ILE C  2  101  ? 90.303  -33.605 46.290  1.00 101.20 ? 101  ILE C C     1 
ATOM   4311  O  O     . ILE C  2  101  ? 89.173  -33.218 45.972  1.00 108.39 ? 101  ILE C O     1 
ATOM   4312  C  CB    . ILE C  2  101  ? 89.884  -35.174 48.207  1.00 92.61  ? 101  ILE C CB    1 
ATOM   4313  C  CG1   . ILE C  2  101  ? 90.226  -35.520 49.656  1.00 102.87 ? 101  ILE C CG1   1 
ATOM   4314  C  CG2   . ILE C  2  101  ? 90.192  -36.353 47.291  1.00 98.36  ? 101  ILE C CG2   1 
ATOM   4315  C  CD1   . ILE C  2  101  ? 89.491  -36.747 50.168  1.00 108.02 ? 101  ILE C CD1   1 
ATOM   4316  N  N     . HIS C  2  102  ? 91.291  -33.762 45.412  1.00 108.34 ? 102  HIS C N     1 
ATOM   4317  C  CA    . HIS C  2  102  ? 91.040  -33.804 43.977  1.00 111.88 ? 102  HIS C CA    1 
ATOM   4318  C  C     . HIS C  2  102  ? 90.696  -35.246 43.625  1.00 117.81 ? 102  HIS C C     1 
ATOM   4319  O  O     . HIS C  2  102  ? 91.548  -36.134 43.725  1.00 115.79 ? 102  HIS C O     1 
ATOM   4320  C  CB    . HIS C  2  102  ? 92.246  -33.308 43.184  1.00 109.55 ? 102  HIS C CB    1 
ATOM   4321  C  CG    . HIS C  2  102  ? 91.881  -32.712 41.861  1.00 116.04 ? 102  HIS C CG    1 
ATOM   4322  N  ND1   . HIS C  2  102  ? 91.129  -33.386 40.924  1.00 117.57 ? 102  HIS C ND1   1 
ATOM   4323  C  CD2   . HIS C  2  102  ? 92.146  -31.496 41.327  1.00 119.26 ? 102  HIS C CD2   1 
ATOM   4324  C  CE1   . HIS C  2  102  ? 90.953  -32.615 39.867  1.00 123.68 ? 102  HIS C CE1   1 
ATOM   4325  N  NE2   . HIS C  2  102  ? 91.560  -31.463 40.086  1.00 124.34 ? 102  HIS C NE2   1 
ATOM   4326  N  N     . LYS C  2  103  ? 89.440  -35.483 43.241  1.00 122.55 ? 103  LYS C N     1 
ATOM   4327  C  CA    . LYS C  2  103  ? 88.996  -36.850 42.990  1.00 120.38 ? 103  LYS C CA    1 
ATOM   4328  C  C     . LYS C  2  103  ? 89.746  -37.477 41.821  1.00 126.39 ? 103  LYS C C     1 
ATOM   4329  O  O     . LYS C  2  103  ? 89.985  -38.690 41.813  1.00 127.63 ? 103  LYS C O     1 
ATOM   4330  C  CB    . LYS C  2  103  ? 87.483  -36.881 42.747  1.00 112.91 ? 103  LYS C CB    1 
ATOM   4331  C  CG    . LYS C  2  103  ? 86.824  -35.512 42.562  1.00 107.21 ? 103  LYS C CG    1 
ATOM   4332  C  CD    . LYS C  2  103  ? 86.698  -35.126 41.092  1.00 117.69 ? 103  LYS C CD    1 
ATOM   4333  C  CE    . LYS C  2  103  ? 85.830  -33.887 40.915  1.00 111.89 ? 103  LYS C CE    1 
ATOM   4334  N  NZ    . LYS C  2  103  ? 84.437  -34.105 41.402  1.00 117.14 ? 103  LYS C NZ    1 
ATOM   4335  N  N     . ASP C  2  104  ? 90.140  -36.666 40.838  1.00 126.51 ? 104  ASP C N     1 
ATOM   4336  C  CA    . ASP C  2  104  ? 90.847  -37.182 39.672  1.00 129.31 ? 104  ASP C CA    1 
ATOM   4337  C  C     . ASP C  2  104  ? 92.342  -37.335 39.944  1.00 130.01 ? 104  ASP C C     1 
ATOM   4338  O  O     . ASP C  2  104  ? 92.924  -38.394 39.682  1.00 129.50 ? 104  ASP C O     1 
ATOM   4339  C  CB    . ASP C  2  104  ? 90.593  -36.263 38.475  1.00 125.94 ? 104  ASP C CB    1 
ATOM   4340  C  CG    . ASP C  2  104  ? 91.545  -36.518 37.327  1.00 129.32 ? 104  ASP C CG    1 
ATOM   4341  O  OD1   . ASP C  2  104  ? 91.720  -37.693 36.941  1.00 133.48 ? 104  ASP C OD1   1 
ATOM   4342  O  OD2   . ASP C  2  104  ? 92.106  -35.534 36.800  1.00 129.50 ? 104  ASP C OD2   1 
ATOM   4343  N  N     . THR C  2  105  ? 92.980  -36.288 40.475  1.00 125.89 ? 105  THR C N     1 
ATOM   4344  C  CA    . THR C  2  105  ? 94.410  -36.357 40.761  1.00 111.99 ? 105  THR C CA    1 
ATOM   4345  C  C     . THR C  2  105  ? 94.708  -37.342 41.885  1.00 116.29 ? 105  THR C C     1 
ATOM   4346  O  O     . THR C  2  105  ? 95.692  -38.088 41.821  1.00 119.71 ? 105  THR C O     1 
ATOM   4347  C  CB    . THR C  2  105  ? 94.939  -34.966 41.119  1.00 107.50 ? 105  THR C CB    1 
ATOM   4348  O  OG1   . THR C  2  105  ? 94.764  -34.079 40.008  1.00 99.82  ? 105  THR C OG1   1 
ATOM   4349  C  CG2   . THR C  2  105  ? 96.411  -35.025 41.485  1.00 103.09 ? 105  THR C CG2   1 
ATOM   4350  N  N     . GLY C  2  106  ? 93.857  -37.376 42.911  1.00 127.96 ? 106  GLY C N     1 
ATOM   4351  C  CA    . GLY C  2  106  ? 94.171  -38.034 44.160  1.00 131.15 ? 106  GLY C CA    1 
ATOM   4352  C  C     . GLY C  2  106  ? 94.836  -37.134 45.180  1.00 128.67 ? 106  GLY C C     1 
ATOM   4353  O  O     . GLY C  2  106  ? 94.913  -37.509 46.359  1.00 116.80 ? 106  GLY C O     1 
ATOM   4354  N  N     . LEU C  2  107  ? 95.306  -35.959 44.756  1.00 126.35 ? 107  LEU C N     1 
ATOM   4355  C  CA    . LEU C  2  107  ? 95.952  -34.997 45.641  1.00 118.94 ? 107  LEU C CA    1 
ATOM   4356  C  C     . LEU C  2  107  ? 95.073  -34.680 46.847  1.00 109.69 ? 107  LEU C C     1 
ATOM   4357  O  O     . LEU C  2  107  ? 93.861  -34.490 46.722  1.00 110.11 ? 107  LEU C O     1 
ATOM   4358  C  CB    . LEU C  2  107  ? 96.268  -33.718 44.852  1.00 112.89 ? 107  LEU C CB    1 
ATOM   4359  C  CG    . LEU C  2  107  ? 96.869  -32.456 45.486  1.00 113.94 ? 107  LEU C CG    1 
ATOM   4360  C  CD1   . LEU C  2  107  ? 95.801  -31.554 46.113  1.00 99.38  ? 107  LEU C CD1   1 
ATOM   4361  C  CD2   . LEU C  2  107  ? 97.956  -32.805 46.496  1.00 114.69 ? 107  LEU C CD2   1 
ATOM   4362  N  N     . ILE C  2  108  ? 95.699  -34.627 48.021  1.00 107.08 ? 108  ILE C N     1 
ATOM   4363  C  CA    . ILE C  2  108  ? 95.033  -34.275 49.269  1.00 106.07 ? 108  ILE C CA    1 
ATOM   4364  C  C     . ILE C  2  108  ? 95.806  -33.130 49.909  1.00 102.58 ? 108  ILE C C     1 
ATOM   4365  O  O     . ILE C  2  108  ? 97.011  -33.254 50.161  1.00 106.90 ? 108  ILE C O     1 
ATOM   4366  C  CB    . ILE C  2  108  ? 94.938  -35.470 50.236  1.00 108.18 ? 108  ILE C CB    1 
ATOM   4367  C  CG1   . ILE C  2  108  ? 94.164  -36.626 49.596  1.00 111.62 ? 108  ILE C CG1   1 
ATOM   4368  C  CG2   . ILE C  2  108  ? 94.281  -35.052 51.547  1.00 98.43  ? 108  ILE C CG2   1 
ATOM   4369  C  CD1   . ILE C  2  108  ? 93.929  -37.795 50.536  1.00 115.83 ? 108  ILE C CD1   1 
ATOM   4370  N  N     . LYS C  2  109  ? 95.120  -32.017 50.160  1.00 96.57  ? 109  LYS C N     1 
ATOM   4371  C  CA    . LYS C  2  109  ? 95.680  -30.884 50.894  1.00 91.56  ? 109  LYS C CA    1 
ATOM   4372  C  C     . LYS C  2  109  ? 94.797  -30.645 52.114  1.00 90.41  ? 109  LYS C C     1 
ATOM   4373  O  O     . LYS C  2  109  ? 93.644  -30.226 51.978  1.00 94.91  ? 109  LYS C O     1 
ATOM   4374  C  CB    . LYS C  2  109  ? 95.768  -29.643 50.004  1.00 92.42  ? 109  LYS C CB    1 
ATOM   4375  C  CG    . LYS C  2  109  ? 96.206  -28.380 50.730  1.00 95.20  ? 109  LYS C CG    1 
ATOM   4376  C  CD    . LYS C  2  109  ? 97.542  -28.575 51.424  1.00 93.90  ? 109  LYS C CD    1 
ATOM   4377  C  CE    . LYS C  2  109  ? 97.933  -27.346 52.228  1.00 90.00  ? 109  LYS C CE    1 
ATOM   4378  N  NZ    . LYS C  2  109  ? 96.935  -27.024 53.285  1.00 88.46  ? 109  LYS C NZ    1 
ATOM   4379  N  N     . GLU C  2  110  ? 95.328  -30.919 53.301  1.00 89.10  ? 110  GLU C N     1 
ATOM   4380  C  CA    . GLU C  2  110  ? 94.552  -30.932 54.534  1.00 76.28  ? 110  GLU C CA    1 
ATOM   4381  C  C     . GLU C  2  110  ? 94.994  -29.803 55.456  1.00 77.58  ? 110  GLU C C     1 
ATOM   4382  O  O     . GLU C  2  110  ? 96.194  -29.568 55.634  1.00 84.98  ? 110  GLU C O     1 
ATOM   4383  C  CB    . GLU C  2  110  ? 94.709  -32.281 55.233  1.00 78.10  ? 110  GLU C CB    1 
ATOM   4384  C  CG    . GLU C  2  110  ? 93.934  -32.437 56.513  1.00 85.28  ? 110  GLU C CG    1 
ATOM   4385  C  CD    . GLU C  2  110  ? 94.134  -33.811 57.116  1.00 95.22  ? 110  GLU C CD    1 
ATOM   4386  O  OE1   . GLU C  2  110  ? 94.137  -33.926 58.361  1.00 101.28 ? 110  GLU C OE1   1 
ATOM   4387  O  OE2   . GLU C  2  110  ? 94.299  -34.776 56.338  1.00 86.85  ? 110  GLU C OE2   1 
ATOM   4388  N  N     . ASP C  2  111  ? 94.023  -29.112 56.054  1.00 78.78  ? 111  ASP C N     1 
ATOM   4389  C  CA    . ASP C  2  111  ? 94.318  -27.915 56.829  1.00 83.27  ? 111  ASP C CA    1 
ATOM   4390  C  C     . ASP C  2  111  ? 93.219  -27.686 57.859  1.00 78.68  ? 111  ASP C C     1 
ATOM   4391  O  O     . ASP C  2  111  ? 92.065  -28.073 57.655  1.00 77.26  ? 111  ASP C O     1 
ATOM   4392  C  CB    . ASP C  2  111  ? 94.457  -26.686 55.916  1.00 87.34  ? 111  ASP C CB    1 
ATOM   4393  C  CG    . ASP C  2  111  ? 95.048  -25.478 56.632  1.00 90.95  ? 111  ASP C CG    1 
ATOM   4394  O  OD1   . ASP C  2  111  ? 95.501  -25.623 57.788  1.00 92.42  ? 111  ASP C OD1   1 
ATOM   4395  O  OD2   . ASP C  2  111  ? 95.061  -24.379 56.036  1.00 88.10  ? 111  ASP C OD2   1 
ATOM   4396  N  N     . GLU C  2  112  ? 93.593  -27.034 58.957  1.00 77.93  ? 112  GLU C N     1 
ATOM   4397  C  CA    . GLU C  2  112  ? 92.667  -26.648 60.016  1.00 67.55  ? 112  GLU C CA    1 
ATOM   4398  C  C     . GLU C  2  112  ? 92.381  -25.157 59.876  1.00 72.87  ? 112  GLU C C     1 
ATOM   4399  O  O     . GLU C  2  112  ? 93.249  -24.324 60.161  1.00 75.44  ? 112  GLU C O     1 
ATOM   4400  C  CB    . GLU C  2  112  ? 93.255  -26.967 61.388  1.00 68.89  ? 112  GLU C CB    1 
ATOM   4401  C  CG    . GLU C  2  112  ? 92.326  -26.662 62.552  1.00 75.20  ? 112  GLU C CG    1 
ATOM   4402  C  CD    . GLU C  2  112  ? 93.047  -26.629 63.893  1.00 77.11  ? 112  GLU C CD    1 
ATOM   4403  O  OE1   . GLU C  2  112  ? 94.051  -25.893 64.017  1.00 73.30  ? 112  GLU C OE1   1 
ATOM   4404  O  OE2   . GLU C  2  112  ? 92.608  -27.342 64.823  1.00 69.59  ? 112  GLU C OE2   1 
ATOM   4405  N  N     . VAL C  2  113  ? 91.167  -24.821 59.442  1.00 67.99  ? 113  VAL C N     1 
ATOM   4406  C  CA    . VAL C  2  113  ? 90.787  -23.439 59.177  1.00 62.46  ? 113  VAL C CA    1 
ATOM   4407  C  C     . VAL C  2  113  ? 89.977  -22.899 60.345  1.00 56.40  ? 113  VAL C C     1 
ATOM   4408  O  O     . VAL C  2  113  ? 89.235  -23.627 61.017  1.00 54.78  ? 113  VAL C O     1 
ATOM   4409  C  CB    . VAL C  2  113  ? 90.009  -23.313 57.852  1.00 58.74  ? 113  VAL C CB    1 
ATOM   4410  C  CG1   . VAL C  2  113  ? 90.970  -23.330 56.690  1.00 67.35  ? 113  VAL C CG1   1 
ATOM   4411  C  CG2   . VAL C  2  113  ? 89.015  -24.444 57.718  1.00 62.65  ? 113  VAL C CG2   1 
ATOM   4412  N  N     . PHE C  2  114  ? 90.127  -21.599 60.586  1.00 60.75  ? 114  PHE C N     1 
ATOM   4413  C  CA    . PHE C  2  114  ? 89.466  -20.913 61.689  1.00 55.00  ? 114  PHE C CA    1 
ATOM   4414  C  C     . PHE C  2  114  ? 88.159  -20.305 61.192  1.00 59.62  ? 114  PHE C C     1 
ATOM   4415  O  O     . PHE C  2  114  ? 88.165  -19.474 60.276  1.00 59.67  ? 114  PHE C O     1 
ATOM   4416  C  CB    . PHE C  2  114  ? 90.386  -19.839 62.267  1.00 55.43  ? 114  PHE C CB    1 
ATOM   4417  C  CG    . PHE C  2  114  ? 89.740  -18.971 63.304  1.00 54.39  ? 114  PHE C CG    1 
ATOM   4418  C  CD1   . PHE C  2  114  ? 89.263  -19.515 64.482  1.00 57.96  ? 114  PHE C CD1   1 
ATOM   4419  C  CD2   . PHE C  2  114  ? 89.630  -17.603 63.110  1.00 61.80  ? 114  PHE C CD2   1 
ATOM   4420  C  CE1   . PHE C  2  114  ? 88.672  -18.711 65.443  1.00 60.02  ? 114  PHE C CE1   1 
ATOM   4421  C  CE2   . PHE C  2  114  ? 89.042  -16.794 64.067  1.00 60.94  ? 114  PHE C CE2   1 
ATOM   4422  C  CZ    . PHE C  2  114  ? 88.564  -17.349 65.235  1.00 58.36  ? 114  PHE C CZ    1 
ATOM   4423  N  N     . LEU C  2  115  ? 87.046  -20.714 61.803  1.00 62.81  ? 115  LEU C N     1 
ATOM   4424  C  CA    . LEU C  2  115  ? 85.714  -20.308 61.374  1.00 60.84  ? 115  LEU C CA    1 
ATOM   4425  C  C     . LEU C  2  115  ? 85.122  -19.180 62.208  1.00 61.63  ? 115  LEU C C     1 
ATOM   4426  O  O     . LEU C  2  115  ? 83.951  -18.844 62.015  1.00 68.79  ? 115  LEU C O     1 
ATOM   4427  C  CB    . LEU C  2  115  ? 84.758  -21.503 61.414  1.00 55.73  ? 115  LEU C CB    1 
ATOM   4428  C  CG    . LEU C  2  115  ? 85.038  -22.646 60.445  1.00 54.09  ? 115  LEU C CG    1 
ATOM   4429  C  CD1   . LEU C  2  115  ? 83.931  -23.681 60.520  1.00 48.29  ? 115  LEU C CD1   1 
ATOM   4430  C  CD2   . LEU C  2  115  ? 85.179  -22.101 59.037  1.00 57.54  ? 115  LEU C CD2   1 
ATOM   4431  N  N     . GLY C  2  116  ? 85.879  -18.600 63.125  1.00 57.66  ? 116  GLY C N     1 
ATOM   4432  C  CA    . GLY C  2  116  ? 85.340  -17.589 64.010  1.00 58.07  ? 116  GLY C CA    1 
ATOM   4433  C  C     . GLY C  2  116  ? 85.062  -18.141 65.392  1.00 57.52  ? 116  GLY C C     1 
ATOM   4434  O  O     . GLY C  2  116  ? 85.439  -19.263 65.743  1.00 55.58  ? 116  GLY C O     1 
ATOM   4435  N  N     . HIS C  2  117  ? 84.372  -17.323 66.185  1.00 55.53  ? 117  HIS C N     1 
ATOM   4436  C  CA    . HIS C  2  117  ? 84.092  -17.619 67.584  1.00 50.68  ? 117  HIS C CA    1 
ATOM   4437  C  C     . HIS C  2  117  ? 82.618  -17.955 67.784  1.00 49.02  ? 117  HIS C C     1 
ATOM   4438  O  O     . HIS C  2  117  ? 81.741  -17.361 67.150  1.00 49.29  ? 117  HIS C O     1 
ATOM   4439  C  CB    . HIS C  2  117  ? 84.465  -16.436 68.476  1.00 54.25  ? 117  HIS C CB    1 
ATOM   4440  C  CG    . HIS C  2  117  ? 85.928  -16.130 68.507  1.00 53.79  ? 117  HIS C CG    1 
ATOM   4441  N  ND1   . HIS C  2  117  ? 86.767  -16.612 69.487  1.00 52.46  ? 117  HIS C ND1   1 
ATOM   4442  C  CD2   . HIS C  2  117  ? 86.700  -15.377 67.688  1.00 58.93  ? 117  HIS C CD2   1 
ATOM   4443  C  CE1   . HIS C  2  117  ? 87.995  -16.177 69.266  1.00 58.99  ? 117  HIS C CE1   1 
ATOM   4444  N  NE2   . HIS C  2  117  ? 87.981  -15.425 68.180  1.00 62.74  ? 117  HIS C NE2   1 
ATOM   4445  N  N     . ILE C  2  118  ? 82.358  -18.903 68.672  1.00 48.49  ? 118  ILE C N     1 
ATOM   4446  C  CA    . ILE C  2  118  ? 81.004  -19.315 69.041  1.00 46.92  ? 118  ILE C CA    1 
ATOM   4447  C  C     . ILE C  2  118  ? 80.760  -18.897 70.485  1.00 49.82  ? 118  ILE C C     1 
ATOM   4448  O  O     . ILE C  2  118  ? 81.606  -19.167 71.345  1.00 49.77  ? 118  ILE C O     1 
ATOM   4449  C  CB    . ILE C  2  118  ? 80.799  -20.832 68.871  1.00 45.73  ? 118  ILE C CB    1 
ATOM   4450  C  CG1   . ILE C  2  118  ? 80.372  -21.155 67.442  1.00 47.78  ? 118  ILE C CG1   1 
ATOM   4451  C  CG2   . ILE C  2  118  ? 79.772  -21.360 69.863  1.00 49.21  ? 118  ILE C CG2   1 
ATOM   4452  C  CD1   . ILE C  2  118  ? 80.029  -22.610 67.235  1.00 51.11  ? 118  ILE C CD1   1 
ATOM   4453  N  N     . PRO C  2  119  ? 79.646  -18.230 70.788  1.00 46.27  ? 119  PRO C N     1 
ATOM   4454  C  CA    . PRO C  2  119  ? 79.409  -17.770 72.161  1.00 41.77  ? 119  PRO C CA    1 
ATOM   4455  C  C     . PRO C  2  119  ? 79.217  -18.932 73.120  1.00 43.54  ? 119  PRO C C     1 
ATOM   4456  O  O     . PRO C  2  119  ? 78.677  -19.983 72.765  1.00 41.63  ? 119  PRO C O     1 
ATOM   4457  C  CB    . PRO C  2  119  ? 78.134  -16.931 72.040  1.00 39.07  ? 119  PRO C CB    1 
ATOM   4458  C  CG    . PRO C  2  119  ? 78.050  -16.567 70.598  1.00 39.00  ? 119  PRO C CG    1 
ATOM   4459  C  CD    . PRO C  2  119  ? 78.632  -17.722 69.854  1.00 43.90  ? 119  PRO C CD    1 
ATOM   4460  N  N     . LEU C  2  120  ? 79.674  -18.728 74.353  1.00 47.61  ? 120  LEU C N     1 
ATOM   4461  C  CA    . LEU C  2  120  ? 79.662  -19.752 75.386  1.00 44.65  ? 120  LEU C CA    1 
ATOM   4462  C  C     . LEU C  2  120  ? 78.659  -19.398 76.473  1.00 45.24  ? 120  LEU C C     1 
ATOM   4463  O  O     . LEU C  2  120  ? 78.518  -18.231 76.853  1.00 46.63  ? 120  LEU C O     1 
ATOM   4464  C  CB    . LEU C  2  120  ? 81.044  -19.926 76.021  1.00 45.36  ? 120  LEU C CB    1 
ATOM   4465  C  CG    . LEU C  2  120  ? 82.195  -20.434 75.156  1.00 42.39  ? 120  LEU C CG    1 
ATOM   4466  C  CD1   . LEU C  2  120  ? 83.469  -20.511 75.980  1.00 40.54  ? 120  LEU C CD1   1 
ATOM   4467  C  CD2   . LEU C  2  120  ? 81.860  -21.786 74.544  1.00 38.29  ? 120  LEU C CD2   1 
ATOM   4468  N  N     . MET C  2  121  ? 77.979  -20.422 76.973  1.00 49.21  ? 121  MET C N     1 
ATOM   4469  C  CA    . MET C  2  121  ? 77.031  -20.259 78.062  1.00 46.45  ? 121  MET C CA    1 
ATOM   4470  C  C     . MET C  2  121  ? 77.771  -20.265 79.394  1.00 45.79  ? 121  MET C C     1 
ATOM   4471  O  O     . MET C  2  121  ? 78.716  -21.037 79.588  1.00 45.09  ? 121  MET C O     1 
ATOM   4472  C  CB    . MET C  2  121  ? 75.989  -21.376 78.004  1.00 42.47  ? 121  MET C CB    1 
ATOM   4473  C  CG    . MET C  2  121  ? 75.043  -21.444 79.174  1.00 46.77  ? 121  MET C CG    1 
ATOM   4474  S  SD    . MET C  2  121  ? 73.799  -22.733 78.958  1.00 45.47  ? 121  MET C SD    1 
ATOM   4475  C  CE    . MET C  2  121  ? 72.865  -22.077 77.578  1.00 41.16  ? 121  MET C CE    1 
ATOM   4476  N  N     . THR C  2  122  ? 77.356  -19.382 80.301  1.00 50.01  ? 122  THR C N     1 
ATOM   4477  C  CA    . THR C  2  122  ? 78.005  -19.262 81.601  1.00 56.42  ? 122  THR C CA    1 
ATOM   4478  C  C     . THR C  2  122  ? 77.465  -20.341 82.540  1.00 55.58  ? 122  THR C C     1 
ATOM   4479  O  O     . THR C  2  122  ? 76.690  -21.216 82.144  1.00 57.01  ? 122  THR C O     1 
ATOM   4480  C  CB    . THR C  2  122  ? 77.813  -17.856 82.171  1.00 50.24  ? 122  THR C CB    1 
ATOM   4481  O  OG1   . THR C  2  122  ? 76.442  -17.661 82.523  1.00 56.89  ? 122  THR C OG1   1 
ATOM   4482  C  CG2   . THR C  2  122  ? 78.223  -16.802 81.152  1.00 50.25  ? 122  THR C CG2   1 
ATOM   4483  N  N     . GLU C  2  123  ? 77.882  -20.295 83.808  1.00 51.19  ? 123  GLU C N     1 
ATOM   4484  C  CA    . GLU C  2  123  ? 77.489  -21.346 84.741  1.00 66.08  ? 123  GLU C CA    1 
ATOM   4485  C  C     . GLU C  2  123  ? 75.984  -21.345 84.978  1.00 67.94  ? 123  GLU C C     1 
ATOM   4486  O  O     . GLU C  2  123  ? 75.368  -22.411 85.102  1.00 69.68  ? 123  GLU C O     1 
ATOM   4487  C  CB    . GLU C  2  123  ? 78.239  -21.188 86.063  1.00 81.22  ? 123  GLU C CB    1 
ATOM   4488  C  CG    . GLU C  2  123  ? 79.754  -21.222 85.929  1.00 96.86  ? 123  GLU C CG    1 
ATOM   4489  C  CD    . GLU C  2  123  ? 80.455  -21.266 87.274  1.00 116.03 ? 123  GLU C CD    1 
ATOM   4490  O  OE1   . GLU C  2  123  ? 79.801  -21.634 88.275  1.00 104.77 ? 123  GLU C OE1   1 
ATOM   4491  O  OE2   . GLU C  2  123  ? 81.658  -20.931 87.330  1.00 124.47 ? 123  GLU C OE2   1 
ATOM   4492  N  N     . ASP C  2  124  ? 75.371  -20.162 85.028  1.00 64.67  ? 124  ASP C N     1 
ATOM   4493  C  CA    . ASP C  2  124  ? 73.957  -20.051 85.360  1.00 59.27  ? 124  ASP C CA    1 
ATOM   4494  C  C     . ASP C  2  124  ? 73.031  -20.334 84.183  1.00 58.38  ? 124  ASP C C     1 
ATOM   4495  O  O     . ASP C  2  124  ? 71.811  -20.370 84.375  1.00 64.74  ? 124  ASP C O     1 
ATOM   4496  C  CB    . ASP C  2  124  ? 73.659  -18.658 85.923  1.00 59.35  ? 124  ASP C CB    1 
ATOM   4497  C  CG    . ASP C  2  124  ? 74.087  -17.542 84.986  1.00 63.89  ? 124  ASP C CG    1 
ATOM   4498  O  OD1   . ASP C  2  124  ? 75.262  -17.533 84.560  1.00 67.51  ? 124  ASP C OD1   1 
ATOM   4499  O  OD2   . ASP C  2  124  ? 73.247  -16.672 84.672  1.00 64.17  ? 124  ASP C OD2   1 
ATOM   4500  N  N     . GLY C  2  125  ? 73.563  -20.537 82.984  1.00 51.82  ? 125  GLY C N     1 
ATOM   4501  C  CA    . GLY C  2  125  ? 72.740  -20.815 81.827  1.00 50.94  ? 125  GLY C CA    1 
ATOM   4502  C  C     . GLY C  2  125  ? 72.449  -19.632 80.932  1.00 50.53  ? 125  GLY C C     1 
ATOM   4503  O  O     . GLY C  2  125  ? 71.550  -19.724 80.087  1.00 45.51  ? 125  GLY C O     1 
ATOM   4504  N  N     . SER C  2  126  ? 73.176  -18.532 81.083  1.00 51.18  ? 126  SER C N     1 
ATOM   4505  C  CA    . SER C  2  126  ? 72.992  -17.335 80.279  1.00 46.60  ? 126  SER C CA    1 
ATOM   4506  C  C     . SER C  2  126  ? 74.186  -17.148 79.350  1.00 44.21  ? 126  SER C C     1 
ATOM   4507  O  O     . SER C  2  126  ? 75.141  -17.928 79.359  1.00 45.92  ? 126  SER C O     1 
ATOM   4508  C  CB    . SER C  2  126  ? 72.802  -16.110 81.176  1.00 52.65  ? 126  SER C CB    1 
ATOM   4509  O  OG    . SER C  2  126  ? 73.997  -15.805 81.875  1.00 54.52  ? 126  SER C OG    1 
ATOM   4510  N  N     . PHE C  2  127  ? 74.119  -16.096 78.538  1.00 48.00  ? 127  PHE C N     1 
ATOM   4511  C  CA    . PHE C  2  127  ? 75.199  -15.715 77.641  1.00 48.60  ? 127  PHE C CA    1 
ATOM   4512  C  C     . PHE C  2  127  ? 75.585  -14.269 77.903  1.00 49.67  ? 127  PHE C C     1 
ATOM   4513  O  O     . PHE C  2  127  ? 74.842  -13.513 78.531  1.00 51.32  ? 127  PHE C O     1 
ATOM   4514  C  CB    . PHE C  2  127  ? 74.807  -15.871 76.167  1.00 45.37  ? 127  PHE C CB    1 
ATOM   4515  C  CG    . PHE C  2  127  ? 74.611  -17.291 75.739  1.00 47.10  ? 127  PHE C CG    1 
ATOM   4516  C  CD1   . PHE C  2  127  ? 75.694  -18.073 75.379  1.00 48.53  ? 127  PHE C CD1   1 
ATOM   4517  C  CD2   . PHE C  2  127  ? 73.343  -17.842 75.685  1.00 42.51  ? 127  PHE C CD2   1 
ATOM   4518  C  CE1   . PHE C  2  127  ? 75.514  -19.381 74.982  1.00 46.03  ? 127  PHE C CE1   1 
ATOM   4519  C  CE2   . PHE C  2  127  ? 73.159  -19.147 75.289  1.00 39.62  ? 127  PHE C CE2   1 
ATOM   4520  C  CZ    . PHE C  2  127  ? 74.245  -19.919 74.939  1.00 41.81  ? 127  PHE C CZ    1 
ATOM   4521  N  N     . ILE C  2  128  ? 76.752  -13.886 77.396  1.00 50.75  ? 128  ILE C N     1 
ATOM   4522  C  CA    . ILE C  2  128  ? 77.227  -12.508 77.450  1.00 46.46  ? 128  ILE C CA    1 
ATOM   4523  C  C     . ILE C  2  128  ? 77.460  -12.071 76.014  1.00 47.08  ? 128  ILE C C     1 
ATOM   4524  O  O     . ILE C  2  128  ? 78.402  -12.540 75.365  1.00 56.96  ? 128  ILE C O     1 
ATOM   4525  C  CB    . ILE C  2  128  ? 78.507  -12.366 78.284  1.00 44.71  ? 128  ILE C CB    1 
ATOM   4526  C  CG1   . ILE C  2  128  ? 78.299  -12.941 79.689  1.00 47.25  ? 128  ILE C CG1   1 
ATOM   4527  C  CG2   . ILE C  2  128  ? 78.926  -10.909 78.362  1.00 49.58  ? 128  ILE C CG2   1 
ATOM   4528  C  CD1   . ILE C  2  128  ? 79.574  -13.048 80.505  1.00 48.94  ? 128  ILE C CD1   1 
ATOM   4529  N  N     . ILE C  2  129  ? 76.601  -11.192 75.506  1.00 45.80  ? 129  ILE C N     1 
ATOM   4530  C  CA    . ILE C  2  129  ? 76.704  -10.681 74.145  1.00 48.40  ? 129  ILE C CA    1 
ATOM   4531  C  C     . ILE C  2  129  ? 77.015  -9.193  74.236  1.00 57.37  ? 129  ILE C C     1 
ATOM   4532  O  O     . ILE C  2  129  ? 76.211  -8.416  74.767  1.00 65.16  ? 129  ILE C O     1 
ATOM   4533  C  CB    . ILE C  2  129  ? 75.418  -10.936 73.344  1.00 46.02  ? 129  ILE C CB    1 
ATOM   4534  C  CG1   . ILE C  2  129  ? 75.014  -12.411 73.426  1.00 43.46  ? 129  ILE C CG1   1 
ATOM   4535  C  CG2   . ILE C  2  129  ? 75.596  -10.530 71.897  1.00 49.06  ? 129  ILE C CG2   1 
ATOM   4536  C  CD1   . ILE C  2  129  ? 76.031  -13.364 72.852  1.00 38.01  ? 129  ILE C CD1   1 
ATOM   4537  N  N     . ASN C  2  130  ? 78.190  -8.803  73.739  1.00 60.43  ? 130  ASN C N     1 
ATOM   4538  C  CA    . ASN C  2  130  ? 78.631  -7.405  73.747  1.00 65.48  ? 130  ASN C CA    1 
ATOM   4539  C  C     . ASN C  2  130  ? 78.527  -6.794  75.142  1.00 63.66  ? 130  ASN C C     1 
ATOM   4540  O  O     . ASN C  2  130  ? 78.125  -5.641  75.311  1.00 62.96  ? 130  ASN C O     1 
ATOM   4541  C  CB    . ASN C  2  130  ? 77.851  -6.579  72.728  1.00 61.37  ? 130  ASN C CB    1 
ATOM   4542  C  CG    . ASN C  2  130  ? 78.174  -6.972  71.308  1.00 74.15  ? 130  ASN C CG    1 
ATOM   4543  O  OD1   . ASN C  2  130  ? 77.287  -7.331  70.533  1.00 82.15  ? 130  ASN C OD1   1 
ATOM   4544  N  ND2   . ASN C  2  130  ? 79.457  -6.924  70.959  1.00 72.98  ? 130  ASN C ND2   1 
ATOM   4545  N  N     . GLY C  2  131  ? 78.884  -7.586  76.151  1.00 56.42  ? 131  GLY C N     1 
ATOM   4546  C  CA    . GLY C  2  131  ? 78.884  -7.127  77.520  1.00 59.06  ? 131  GLY C CA    1 
ATOM   4547  C  C     . GLY C  2  131  ? 77.540  -7.138  78.206  1.00 67.84  ? 131  GLY C C     1 
ATOM   4548  O  O     . GLY C  2  131  ? 77.473  -6.817  79.400  1.00 81.32  ? 131  GLY C O     1 
ATOM   4549  N  N     . ALA C  2  132  ? 76.467  -7.486  77.503  1.00 61.45  ? 132  ALA C N     1 
ATOM   4550  C  CA    . ALA C  2  132  ? 75.129  -7.527  78.076  1.00 59.06  ? 132  ALA C CA    1 
ATOM   4551  C  C     . ALA C  2  132  ? 74.706  -8.977  78.257  1.00 54.85  ? 132  ALA C C     1 
ATOM   4552  O  O     . ALA C  2  132  ? 74.867  -9.789  77.342  1.00 56.54  ? 132  ALA C O     1 
ATOM   4553  C  CB    . ALA C  2  132  ? 74.130  -6.786  77.187  1.00 59.50  ? 132  ALA C CB    1 
ATOM   4554  N  N     . ASP C  2  133  ? 74.180  -9.301  79.435  1.00 54.63  ? 133  ASP C N     1 
ATOM   4555  C  CA    . ASP C  2  133  ? 73.736  -10.664 79.699  1.00 54.28  ? 133  ASP C CA    1 
ATOM   4556  C  C     . ASP C  2  133  ? 72.415  -10.940 78.987  1.00 48.06  ? 133  ASP C C     1 
ATOM   4557  O  O     . ASP C  2  133  ? 71.485  -10.130 79.037  1.00 47.70  ? 133  ASP C O     1 
ATOM   4558  C  CB    . ASP C  2  133  ? 73.597  -10.901 81.203  1.00 58.40  ? 133  ASP C CB    1 
ATOM   4559  C  CG    . ASP C  2  133  ? 74.910  -11.315 81.852  1.00 66.66  ? 133  ASP C CG    1 
ATOM   4560  O  OD1   . ASP C  2  133  ? 75.897  -10.550 81.754  1.00 69.04  ? 133  ASP C OD1   1 
ATOM   4561  O  OD2   . ASP C  2  133  ? 74.952  -12.406 82.464  1.00 65.82  ? 133  ASP C OD2   1 
ATOM   4562  N  N     . ARG C  2  134  ? 72.339  -12.086 78.317  1.00 47.75  ? 134  ARG C N     1 
ATOM   4563  C  CA    . ARG C  2  134  ? 71.175  -12.445 77.525  1.00 46.72  ? 134  ARG C CA    1 
ATOM   4564  C  C     . ARG C  2  134  ? 70.794  -13.895 77.791  1.00 48.69  ? 134  ARG C C     1 
ATOM   4565  O  O     . ARG C  2  134  ? 71.595  -14.697 78.276  1.00 50.59  ? 134  ARG C O     1 
ATOM   4566  C  CB    . ARG C  2  134  ? 71.425  -12.219 76.028  1.00 46.99  ? 134  ARG C CB    1 
ATOM   4567  C  CG    . ARG C  2  134  ? 71.476  -10.752 75.645  1.00 49.99  ? 134  ARG C CG    1 
ATOM   4568  C  CD    . ARG C  2  134  ? 71.482  -10.553 74.143  1.00 47.91  ? 134  ARG C CD    1 
ATOM   4569  N  NE    . ARG C  2  134  ? 70.900  -9.263  73.794  1.00 49.56  ? 134  ARG C NE    1 
ATOM   4570  C  CZ    . ARG C  2  134  ? 69.666  -9.107  73.325  1.00 57.56  ? 134  ARG C CZ    1 
ATOM   4571  N  NH1   . ARG C  2  134  ? 68.895  -10.167 73.135  1.00 50.16  ? 134  ARG C NH1   1 
ATOM   4572  N  NH2   . ARG C  2  134  ? 69.205  -7.895  73.038  1.00 70.39  ? 134  ARG C NH2   1 
ATOM   4573  N  N     . VAL C  2  135  ? 69.542  -14.213 77.470  1.00 49.09  ? 135  VAL C N     1 
ATOM   4574  C  CA    . VAL C  2  135  ? 68.957  -15.532 77.684  1.00 43.42  ? 135  VAL C CA    1 
ATOM   4575  C  C     . VAL C  2  135  ? 68.280  -15.950 76.390  1.00 44.62  ? 135  VAL C C     1 
ATOM   4576  O  O     . VAL C  2  135  ? 67.559  -15.153 75.778  1.00 47.35  ? 135  VAL C O     1 
ATOM   4577  C  CB    . VAL C  2  135  ? 67.942  -15.526 78.848  1.00 44.55  ? 135  VAL C CB    1 
ATOM   4578  C  CG1   . VAL C  2  135  ? 67.065  -16.766 78.813  1.00 42.32  ? 135  VAL C CG1   1 
ATOM   4579  C  CG2   . VAL C  2  135  ? 68.656  -15.417 80.191  1.00 50.00  ? 135  VAL C CG2   1 
ATOM   4580  N  N     . ILE C  2  136  ? 68.531  -17.182 75.961  1.00 43.25  ? 136  ILE C N     1 
ATOM   4581  C  CA    . ILE C  2  136  ? 67.840  -17.754 74.810  1.00 43.86  ? 136  ILE C CA    1 
ATOM   4582  C  C     . ILE C  2  136  ? 66.631  -18.505 75.354  1.00 47.48  ? 136  ILE C C     1 
ATOM   4583  O  O     . ILE C  2  136  ? 66.779  -19.489 76.086  1.00 50.14  ? 136  ILE C O     1 
ATOM   4584  C  CB    . ILE C  2  136  ? 68.758  -18.672 73.993  1.00 44.93  ? 136  ILE C CB    1 
ATOM   4585  C  CG1   . ILE C  2  136  ? 70.041  -17.938 73.596  1.00 42.64  ? 136  ILE C CG1   1 
ATOM   4586  C  CG2   . ILE C  2  136  ? 68.048  -19.185 72.744  1.00 45.65  ? 136  ILE C CG2   1 
ATOM   4587  C  CD1   . ILE C  2  136  ? 69.807  -16.733 72.738  1.00 38.62  ? 136  ILE C CD1   1 
ATOM   4588  N  N     . VAL C  2  137  ? 65.441  -18.032 75.018  1.00 47.62  ? 137  VAL C N     1 
ATOM   4589  C  CA    . VAL C  2  137  ? 64.205  -18.596 75.546  1.00 45.33  ? 137  VAL C CA    1 
ATOM   4590  C  C     . VAL C  2  137  ? 63.766  -19.751 74.659  1.00 41.99  ? 137  VAL C C     1 
ATOM   4591  O  O     . VAL C  2  137  ? 63.725  -19.619 73.430  1.00 42.58  ? 137  VAL C O     1 
ATOM   4592  C  CB    . VAL C  2  137  ? 63.108  -17.524 75.637  1.00 44.35  ? 137  VAL C CB    1 
ATOM   4593  C  CG1   . VAL C  2  137  ? 61.794  -18.147 76.074  1.00 46.45  ? 137  VAL C CG1   1 
ATOM   4594  C  CG2   . VAL C  2  137  ? 63.525  -16.428 76.601  1.00 43.64  ? 137  VAL C CG2   1 
ATOM   4595  N  N     . SER C  2  138  ? 63.439  -20.881 75.280  1.00 43.05  ? 138  SER C N     1 
ATOM   4596  C  CA    . SER C  2  138  ? 62.968  -22.043 74.540  1.00 41.90  ? 138  SER C CA    1 
ATOM   4597  C  C     . SER C  2  138  ? 61.716  -21.696 73.744  1.00 39.05  ? 138  SER C C     1 
ATOM   4598  O  O     . SER C  2  138  ? 60.976  -20.771 74.084  1.00 45.41  ? 138  SER C O     1 
ATOM   4599  C  CB    . SER C  2  138  ? 62.676  -23.189 75.501  1.00 39.13  ? 138  SER C CB    1 
ATOM   4600  O  OG    . SER C  2  138  ? 63.551  -23.135 76.612  1.00 47.49  ? 138  SER C OG    1 
ATOM   4601  N  N     . GLN C  2  139  ? 61.481  -22.440 72.667  1.00 40.01  ? 139  GLN C N     1 
ATOM   4602  C  CA    . GLN C  2  139  ? 60.371  -22.144 71.769  1.00 45.67  ? 139  GLN C CA    1 
ATOM   4603  C  C     . GLN C  2  139  ? 59.528  -23.391 71.560  1.00 51.07  ? 139  GLN C C     1 
ATOM   4604  O  O     . GLN C  2  139  ? 60.024  -24.398 71.052  1.00 53.16  ? 139  GLN C O     1 
ATOM   4605  C  CB    . GLN C  2  139  ? 60.869  -21.613 70.425  1.00 41.81  ? 139  GLN C CB    1 
ATOM   4606  C  CG    . GLN C  2  139  ? 59.763  -21.439 69.411  1.00 42.12  ? 139  GLN C CG    1 
ATOM   4607  C  CD    . GLN C  2  139  ? 60.257  -20.841 68.116  1.00 66.94  ? 139  GLN C CD    1 
ATOM   4608  O  OE1   . GLN C  2  139  ? 61.271  -21.273 67.566  1.00 76.83  ? 139  GLN C OE1   1 
ATOM   4609  N  NE2   . GLN C  2  139  ? 59.547  -19.832 67.621  1.00 75.80  ? 139  GLN C NE2   1 
ATOM   4610  N  N     . ILE C  2  140  ? 58.255  -23.322 71.932  1.00 49.58  ? 140  ILE C N     1 
ATOM   4611  C  CA    . ILE C  2  140  ? 57.341  -24.435 71.700  1.00 46.23  ? 140  ILE C CA    1 
ATOM   4612  C  C     . ILE C  2  140  ? 56.793  -24.343 70.282  1.00 45.21  ? 140  ILE C C     1 
ATOM   4613  O  O     . ILE C  2  140  ? 56.583  -23.246 69.747  1.00 48.95  ? 140  ILE C O     1 
ATOM   4614  C  CB    . ILE C  2  140  ? 56.218  -24.437 72.753  1.00 45.82  ? 140  ILE C CB    1 
ATOM   4615  C  CG1   . ILE C  2  140  ? 55.344  -25.687 72.618  1.00 44.91  ? 140  ILE C CG1   1 
ATOM   4616  C  CG2   . ILE C  2  140  ? 55.387  -23.167 72.659  1.00 46.69  ? 140  ILE C CG2   1 
ATOM   4617  C  CD1   . ILE C  2  140  ? 54.548  -26.009 73.864  1.00 40.17  ? 140  ILE C CD1   1 
ATOM   4618  N  N     . HIS C  2  141  ? 56.586  -25.495 69.652  1.00 41.98  ? 141  HIS C N     1 
ATOM   4619  C  CA    . HIS C  2  141  ? 55.998  -25.514 68.320  1.00 47.67  ? 141  HIS C CA    1 
ATOM   4620  C  C     . HIS C  2  141  ? 55.406  -26.890 68.059  1.00 49.95  ? 141  HIS C C     1 
ATOM   4621  O  O     . HIS C  2  141  ? 55.538  -27.815 68.865  1.00 45.67  ? 141  HIS C O     1 
ATOM   4622  C  CB    . HIS C  2  141  ? 57.020  -25.148 67.240  1.00 51.89  ? 141  HIS C CB    1 
ATOM   4623  C  CG    . HIS C  2  141  ? 57.988  -26.245 66.917  1.00 53.88  ? 141  HIS C CG    1 
ATOM   4624  N  ND1   . HIS C  2  141  ? 58.471  -26.455 65.643  1.00 57.00  ? 141  HIS C ND1   1 
ATOM   4625  C  CD2   . HIS C  2  141  ? 58.572  -27.182 67.699  1.00 52.14  ? 141  HIS C CD2   1 
ATOM   4626  C  CE1   . HIS C  2  141  ? 59.304  -27.480 65.653  1.00 55.43  ? 141  HIS C CE1   1 
ATOM   4627  N  NE2   . HIS C  2  141  ? 59.384  -27.939 66.888  1.00 56.56  ? 141  HIS C NE2   1 
ATOM   4628  N  N     . ARG C  2  142  ? 54.735  -27.005 66.918  1.00 53.44  ? 142  ARG C N     1 
ATOM   4629  C  CA    . ARG C  2  142  ? 54.173  -28.281 66.512  1.00 53.85  ? 142  ARG C CA    1 
ATOM   4630  C  C     . ARG C  2  142  ? 55.298  -29.257 66.214  1.00 58.99  ? 142  ARG C C     1 
ATOM   4631  O  O     . ARG C  2  142  ? 56.239  -28.931 65.483  1.00 65.17  ? 142  ARG C O     1 
ATOM   4632  C  CB    . ARG C  2  142  ? 53.286  -28.115 65.280  1.00 61.59  ? 142  ARG C CB    1 
ATOM   4633  C  CG    . ARG C  2  142  ? 52.102  -27.187 65.466  1.00 71.52  ? 142  ARG C CG    1 
ATOM   4634  C  CD    . ARG C  2  142  ? 51.214  -27.211 64.229  1.00 82.85  ? 142  ARG C CD    1 
ATOM   4635  N  NE    . ARG C  2  142  ? 50.581  -28.514 64.041  1.00 87.03  ? 142  ARG C NE    1 
ATOM   4636  C  CZ    . ARG C  2  142  ? 49.867  -28.855 62.972  1.00 77.86  ? 142  ARG C CZ    1 
ATOM   4637  N  NH1   . ARG C  2  142  ? 49.698  -27.990 61.980  1.00 76.60  ? 142  ARG C NH1   1 
ATOM   4638  N  NH2   . ARG C  2  142  ? 49.328  -30.064 62.891  1.00 68.93  ? 142  ARG C NH2   1 
ATOM   4639  N  N     . SER C  2  143  ? 55.215  -30.445 66.794  1.00 57.67  ? 143  SER C N     1 
ATOM   4640  C  CA    . SER C  2  143  ? 56.203  -31.464 66.494  1.00 57.58  ? 143  SER C CA    1 
ATOM   4641  C  C     . SER C  2  143  ? 56.067  -31.899 65.037  1.00 60.74  ? 143  SER C C     1 
ATOM   4642  O  O     . SER C  2  143  ? 54.948  -32.028 64.529  1.00 62.61  ? 143  SER C O     1 
ATOM   4643  C  CB    . SER C  2  143  ? 56.033  -32.669 67.417  1.00 58.69  ? 143  SER C CB    1 
ATOM   4644  O  OG    . SER C  2  143  ? 56.742  -33.791 66.925  1.00 55.70  ? 143  SER C OG    1 
ATOM   4645  N  N     . PRO C  2  144  ? 57.178  -32.094 64.331  1.00 65.21  ? 144  PRO C N     1 
ATOM   4646  C  CA    . PRO C  2  144  ? 57.103  -32.700 62.999  1.00 67.02  ? 144  PRO C CA    1 
ATOM   4647  C  C     . PRO C  2  144  ? 56.455  -34.076 63.062  1.00 69.32  ? 144  PRO C C     1 
ATOM   4648  O  O     . PRO C  2  144  ? 56.382  -34.715 64.114  1.00 67.56  ? 144  PRO C O     1 
ATOM   4649  C  CB    . PRO C  2  144  ? 58.571  -32.794 62.568  1.00 64.25  ? 144  PRO C CB    1 
ATOM   4650  C  CG    . PRO C  2  144  ? 59.251  -31.715 63.331  1.00 61.92  ? 144  PRO C CG    1 
ATOM   4651  C  CD    . PRO C  2  144  ? 58.536  -31.619 64.649  1.00 64.54  ? 144  PRO C CD    1 
ATOM   4652  N  N     . GLY C  2  145  ? 55.970  -34.523 61.917  1.00 66.85  ? 145  GLY C N     1 
ATOM   4653  C  CA    . GLY C  2  145  ? 55.386  -35.840 61.824  1.00 66.56  ? 145  GLY C CA    1 
ATOM   4654  C  C     . GLY C  2  145  ? 54.238  -35.855 60.836  1.00 62.72  ? 145  GLY C C     1 
ATOM   4655  O  O     . GLY C  2  145  ? 54.167  -35.033 59.924  1.00 61.56  ? 145  GLY C O     1 
ATOM   4656  N  N     . VAL C  2  146  ? 53.355  -36.829 61.040  1.00 66.75  ? 146  VAL C N     1 
ATOM   4657  C  CA    . VAL C  2  146  ? 52.196  -37.051 60.185  1.00 74.86  ? 146  VAL C CA    1 
ATOM   4658  C  C     . VAL C  2  146  ? 50.954  -36.990 61.058  1.00 74.34  ? 146  VAL C C     1 
ATOM   4659  O  O     . VAL C  2  146  ? 50.768  -37.833 61.944  1.00 74.59  ? 146  VAL C O     1 
ATOM   4660  C  CB    . VAL C  2  146  ? 52.277  -38.396 59.445  1.00 77.88  ? 146  VAL C CB    1 
ATOM   4661  C  CG1   . VAL C  2  146  ? 50.982  -38.666 58.706  1.00 76.75  ? 146  VAL C CG1   1 
ATOM   4662  C  CG2   . VAL C  2  146  ? 53.453  -38.404 58.481  1.00 74.45  ? 146  VAL C CG2   1 
ATOM   4663  N  N     . TYR C  2  147  ? 50.105  -36.000 60.800  1.00 70.83  ? 147  TYR C N     1 
ATOM   4664  C  CA    . TYR C  2  147  ? 48.889  -35.769 61.558  1.00 72.22  ? 147  TYR C CA    1 
ATOM   4665  C  C     . TYR C  2  147  ? 47.680  -35.940 60.651  1.00 74.64  ? 147  TYR C C     1 
ATOM   4666  O  O     . TYR C  2  147  ? 47.784  -35.878 59.426  1.00 77.87  ? 147  TYR C O     1 
ATOM   4667  C  CB    . TYR C  2  147  ? 48.884  -34.369 62.177  1.00 74.77  ? 147  TYR C CB    1 
ATOM   4668  C  CG    . TYR C  2  147  ? 50.055  -34.115 63.092  1.00 75.91  ? 147  TYR C CG    1 
ATOM   4669  C  CD1   . TYR C  2  147  ? 51.252  -33.613 62.597  1.00 67.88  ? 147  TYR C CD1   1 
ATOM   4670  C  CD2   . TYR C  2  147  ? 49.966  -34.384 64.452  1.00 74.59  ? 147  TYR C CD2   1 
ATOM   4671  C  CE1   . TYR C  2  147  ? 52.325  -33.383 63.433  1.00 71.45  ? 147  TYR C CE1   1 
ATOM   4672  C  CE2   . TYR C  2  147  ? 51.032  -34.158 65.296  1.00 66.62  ? 147  TYR C CE2   1 
ATOM   4673  C  CZ    . TYR C  2  147  ? 52.208  -33.658 64.783  1.00 71.34  ? 147  TYR C CZ    1 
ATOM   4674  O  OH    . TYR C  2  147  ? 53.270  -33.433 65.627  1.00 75.83  ? 147  TYR C OH    1 
ATOM   4675  N  N     . PHE C  2  148  ? 46.524  -36.155 61.272  1.00 74.17  ? 148  PHE C N     1 
ATOM   4676  C  CA    . PHE C  2  148  ? 45.266  -36.334 60.557  1.00 77.98  ? 148  PHE C CA    1 
ATOM   4677  C  C     . PHE C  2  148  ? 44.207  -35.505 61.269  1.00 85.40  ? 148  PHE C C     1 
ATOM   4678  O  O     . PHE C  2  148  ? 43.853  -35.796 62.416  1.00 87.50  ? 148  PHE C O     1 
ATOM   4679  C  CB    . PHE C  2  148  ? 44.868  -37.808 60.493  1.00 77.75  ? 148  PHE C CB    1 
ATOM   4680  C  CG    . PHE C  2  148  ? 45.892  -38.681 59.825  1.00 77.71  ? 148  PHE C CG    1 
ATOM   4681  C  CD1   . PHE C  2  148  ? 46.923  -39.249 60.557  1.00 80.86  ? 148  PHE C CD1   1 
ATOM   4682  C  CD2   . PHE C  2  148  ? 45.829  -38.930 58.465  1.00 82.09  ? 148  PHE C CD2   1 
ATOM   4683  C  CE1   . PHE C  2  148  ? 47.870  -40.049 59.946  1.00 77.28  ? 148  PHE C CE1   1 
ATOM   4684  C  CE2   . PHE C  2  148  ? 46.773  -39.731 57.847  1.00 83.29  ? 148  PHE C CE2   1 
ATOM   4685  C  CZ    . PHE C  2  148  ? 47.794  -40.291 58.590  1.00 80.82  ? 148  PHE C CZ    1 
ATOM   4686  N  N     . THR C  2  149  ? 43.711  -34.471 60.592  1.00 87.53  ? 149  THR C N     1 
ATOM   4687  C  CA    . THR C  2  149  ? 42.796  -33.538 61.219  1.00 91.01  ? 149  THR C CA    1 
ATOM   4688  C  C     . THR C  2  149  ? 41.486  -33.468 60.442  1.00 94.44  ? 149  THR C C     1 
ATOM   4689  O  O     . THR C  2  149  ? 41.492  -33.554 59.209  1.00 96.55  ? 149  THR C O     1 
ATOM   4690  C  CB    . THR C  2  149  ? 43.430  -32.138 61.306  1.00 91.87  ? 149  THR C CB    1 
ATOM   4691  O  OG1   . THR C  2  149  ? 42.444  -31.184 61.717  1.00 107.11 ? 149  THR C OG1   1 
ATOM   4692  C  CG2   . THR C  2  149  ? 44.017  -31.726 59.964  1.00 85.65  ? 149  THR C CG2   1 
ATOM   4693  N  N     . PRO C  2  150  ? 40.351  -33.331 61.129  1.00 96.17  ? 150  PRO C N     1 
ATOM   4694  C  CA    . PRO C  2  150  ? 39.062  -33.282 60.424  1.00 90.58  ? 150  PRO C CA    1 
ATOM   4695  C  C     . PRO C  2  150  ? 39.004  -32.123 59.440  1.00 100.93 ? 150  PRO C C     1 
ATOM   4696  O  O     . PRO C  2  150  ? 39.375  -30.992 59.763  1.00 97.60  ? 150  PRO C O     1 
ATOM   4697  C  CB    . PRO C  2  150  ? 38.046  -33.112 61.558  1.00 90.04  ? 150  PRO C CB    1 
ATOM   4698  C  CG    . PRO C  2  150  ? 38.733  -33.658 62.768  1.00 94.99  ? 150  PRO C CG    1 
ATOM   4699  C  CD    . PRO C  2  150  ? 40.184  -33.332 62.593  1.00 95.54  ? 150  PRO C CD    1 
ATOM   4700  N  N     . ASP C  2  151  ? 38.543  -32.419 58.228  1.00 109.09 ? 151  ASP C N     1 
ATOM   4701  C  CA    . ASP C  2  151  ? 38.381  -31.400 57.192  1.00 104.92 ? 151  ASP C CA    1 
ATOM   4702  C  C     . ASP C  2  151  ? 37.296  -30.423 57.621  1.00 110.58 ? 151  ASP C C     1 
ATOM   4703  O  O     . ASP C  2  151  ? 36.141  -30.834 57.793  1.00 114.64 ? 151  ASP C O     1 
ATOM   4704  C  CB    . ASP C  2  151  ? 38.023  -32.054 55.856  1.00 101.80 ? 151  ASP C CB    1 
ATOM   4705  C  CG    . ASP C  2  151  ? 38.072  -31.081 54.683  1.00 108.58 ? 151  ASP C CG    1 
ATOM   4706  O  OD1   . ASP C  2  151  ? 38.207  -29.860 54.903  1.00 110.46 ? 151  ASP C OD1   1 
ATOM   4707  O  OD2   . ASP C  2  151  ? 37.981  -31.546 53.526  1.00 109.23 ? 151  ASP C OD2   1 
ATOM   4708  N  N     . PRO C  2  152  ? 37.612  -29.139 57.817  1.00 109.31 ? 152  PRO C N     1 
ATOM   4709  C  CA    . PRO C  2  152  ? 36.579  -28.194 58.272  1.00 112.42 ? 152  PRO C CA    1 
ATOM   4710  C  C     . PRO C  2  152  ? 35.386  -28.102 57.337  1.00 115.53 ? 152  PRO C C     1 
ATOM   4711  O  O     . PRO C  2  152  ? 34.269  -27.830 57.797  1.00 114.81 ? 152  PRO C O     1 
ATOM   4712  C  CB    . PRO C  2  152  ? 37.339  -26.862 58.361  1.00 112.74 ? 152  PRO C CB    1 
ATOM   4713  C  CG    . PRO C  2  152  ? 38.555  -27.047 57.499  1.00 107.58 ? 152  PRO C CG    1 
ATOM   4714  C  CD    . PRO C  2  152  ? 38.922  -28.488 57.650  1.00 103.52 ? 152  PRO C CD    1 
ATOM   4715  N  N     . ALA C  2  153  ? 35.585  -28.331 56.037  1.00 116.17 ? 153  ALA C N     1 
ATOM   4716  C  CA    . ALA C  2  153  ? 34.482  -28.253 55.086  1.00 114.37 ? 153  ALA C CA    1 
ATOM   4717  C  C     . ALA C  2  153  ? 33.586  -29.484 55.167  1.00 114.92 ? 153  ALA C C     1 
ATOM   4718  O  O     . ALA C  2  153  ? 32.400  -29.383 55.500  1.00 114.23 ? 153  ALA C O     1 
ATOM   4719  C  CB    . ALA C  2  153  ? 35.024  -28.080 53.664  1.00 108.99 ? 153  ALA C CB    1 
ATOM   4720  N  N     . ARG C  2  154  ? 34.143  -30.659 54.879  1.00 115.80 ? 154  ARG C N     1 
ATOM   4721  C  CA    . ARG C  2  154  ? 33.353  -31.877 54.772  1.00 114.36 ? 154  ARG C CA    1 
ATOM   4722  C  C     . ARG C  2  154  ? 33.459  -32.674 56.061  1.00 112.70 ? 154  ARG C C     1 
ATOM   4723  O  O     . ARG C  2  154  ? 34.575  -33.045 56.459  1.00 116.06 ? 154  ARG C O     1 
ATOM   4724  C  CB    . ARG C  2  154  ? 33.827  -32.708 53.587  1.00 119.98 ? 154  ARG C CB    1 
ATOM   4725  C  CG    . ARG C  2  154  ? 33.598  -32.017 52.248  1.00 121.25 ? 154  ARG C CG    1 
ATOM   4726  C  CD    . ARG C  2  154  ? 34.873  -31.916 51.425  1.00 116.88 ? 154  ARG C CD    1 
ATOM   4727  N  NE    . ARG C  2  154  ? 35.392  -33.230 51.058  1.00 123.67 ? 154  ARG C NE    1 
ATOM   4728  C  CZ    . ARG C  2  154  ? 34.895  -33.981 50.081  1.00 127.51 ? 154  ARG C CZ    1 
ATOM   4729  N  NH1   . ARG C  2  154  ? 33.858  -33.551 49.376  1.00 127.01 ? 154  ARG C NH1   1 
ATOM   4730  N  NH2   . ARG C  2  154  ? 35.430  -35.165 49.813  1.00 126.13 ? 154  ARG C NH2   1 
ATOM   4731  N  N     . PRO C  2  155  ? 32.344  -32.959 56.742  1.00 115.33 ? 155  PRO C N     1 
ATOM   4732  C  CA    . PRO C  2  155  ? 32.445  -33.587 58.072  1.00 121.84 ? 155  PRO C CA    1 
ATOM   4733  C  C     . PRO C  2  155  ? 32.948  -35.021 58.040  1.00 121.88 ? 155  PRO C C     1 
ATOM   4734  O  O     . PRO C  2  155  ? 33.683  -35.431 58.949  1.00 118.08 ? 155  PRO C O     1 
ATOM   4735  C  CB    . PRO C  2  155  ? 31.007  -33.501 58.610  1.00 112.94 ? 155  PRO C CB    1 
ATOM   4736  C  CG    . PRO C  2  155  ? 30.335  -32.457 57.773  1.00 117.24 ? 155  PRO C CG    1 
ATOM   4737  C  CD    . PRO C  2  155  ? 30.967  -32.555 56.422  1.00 118.60 ? 155  PRO C CD    1 
ATOM   4738  N  N     . GLY C  2  156  ? 32.574  -35.799 57.030  1.00 119.97 ? 156  GLY C N     1 
ATOM   4739  C  CA    . GLY C  2  156  ? 32.994  -37.181 56.931  1.00 121.10 ? 156  GLY C CA    1 
ATOM   4740  C  C     . GLY C  2  156  ? 34.338  -37.407 56.273  1.00 121.56 ? 156  GLY C C     1 
ATOM   4741  O  O     . GLY C  2  156  ? 34.711  -38.562 56.042  1.00 121.73 ? 156  GLY C O     1 
ATOM   4742  N  N     . ARG C  2  157  ? 35.077  -36.344 55.964  1.00 115.69 ? 157  ARG C N     1 
ATOM   4743  C  CA    . ARG C  2  157  ? 36.375  -36.431 55.313  1.00 107.76 ? 157  ARG C CA    1 
ATOM   4744  C  C     . ARG C  2  157  ? 37.430  -35.750 56.178  1.00 105.12 ? 157  ARG C C     1 
ATOM   4745  O  O     . ARG C  2  157  ? 37.117  -35.004 57.109  1.00 106.33 ? 157  ARG C O     1 
ATOM   4746  C  CB    . ARG C  2  157  ? 36.329  -35.808 53.911  1.00 108.92 ? 157  ARG C CB    1 
ATOM   4747  C  CG    . ARG C  2  157  ? 35.290  -36.438 52.991  1.00 110.09 ? 157  ARG C CG    1 
ATOM   4748  C  CD    . ARG C  2  157  ? 35.508  -37.939 52.855  1.00 110.67 ? 157  ARG C CD    1 
ATOM   4749  N  NE    . ARG C  2  157  ? 34.523  -38.568 51.978  1.00 118.32 ? 157  ARG C NE    1 
ATOM   4750  C  CZ    . ARG C  2  157  ? 34.661  -38.686 50.660  1.00 124.44 ? 157  ARG C CZ    1 
ATOM   4751  N  NH1   . ARG C  2  157  ? 35.744  -38.213 50.060  1.00 121.44 ? 157  ARG C NH1   1 
ATOM   4752  N  NH2   . ARG C  2  157  ? 33.716  -39.274 49.939  1.00 129.10 ? 157  ARG C NH2   1 
ATOM   4753  N  N     . TYR C  2  158  ? 38.699  -36.018 55.861  1.00 98.75  ? 158  TYR C N     1 
ATOM   4754  C  CA    . TYR C  2  158  ? 39.814  -35.610 56.703  1.00 93.13  ? 158  TYR C CA    1 
ATOM   4755  C  C     . TYR C  2  158  ? 40.953  -35.087 55.836  1.00 95.90  ? 158  TYR C C     1 
ATOM   4756  O  O     . TYR C  2  158  ? 40.966  -35.261 54.614  1.00 104.31 ? 158  TYR C O     1 
ATOM   4757  C  CB    . TYR C  2  158  ? 40.296  -36.771 57.585  1.00 95.84  ? 158  TYR C CB    1 
ATOM   4758  C  CG    . TYR C  2  158  ? 39.220  -37.342 58.488  1.00 104.49 ? 158  TYR C CG    1 
ATOM   4759  C  CD1   . TYR C  2  158  ? 38.993  -36.811 59.751  1.00 100.63 ? 158  TYR C CD1   1 
ATOM   4760  C  CD2   . TYR C  2  158  ? 38.428  -38.407 58.074  1.00 101.16 ? 158  TYR C CD2   1 
ATOM   4761  C  CE1   . TYR C  2  158  ? 38.009  -37.325 60.577  1.00 100.87 ? 158  TYR C CE1   1 
ATOM   4762  C  CE2   . TYR C  2  158  ? 37.440  -38.926 58.894  1.00 96.14  ? 158  TYR C CE2   1 
ATOM   4763  C  CZ    . TYR C  2  158  ? 37.237  -38.382 60.144  1.00 100.92 ? 158  TYR C CZ    1 
ATOM   4764  O  OH    . TYR C  2  158  ? 36.257  -38.896 60.964  1.00 111.24 ? 158  TYR C OH    1 
ATOM   4765  N  N     . ILE C  2  159  ? 41.918  -34.435 56.487  1.00 89.70  ? 159  ILE C N     1 
ATOM   4766  C  CA    . ILE C  2  159  ? 43.112  -33.904 55.840  1.00 83.98  ? 159  ILE C CA    1 
ATOM   4767  C  C     . ILE C  2  159  ? 44.326  -34.508 56.528  1.00 81.54  ? 159  ILE C C     1 
ATOM   4768  O  O     . ILE C  2  159  ? 44.439  -34.451 57.758  1.00 84.97  ? 159  ILE C O     1 
ATOM   4769  C  CB    . ILE C  2  159  ? 43.170  -32.367 55.915  1.00 86.73  ? 159  ILE C CB    1 
ATOM   4770  C  CG1   . ILE C  2  159  ? 41.817  -31.749 55.562  1.00 97.64  ? 159  ILE C CG1   1 
ATOM   4771  C  CG2   . ILE C  2  159  ? 44.265  -31.829 55.002  1.00 86.30  ? 159  ILE C CG2   1 
ATOM   4772  C  CD1   . ILE C  2  159  ? 41.495  -31.783 54.093  1.00 103.78 ? 159  ILE C CD1   1 
ATOM   4773  N  N     . ALA C  2  160  ? 45.236  -35.072 55.739  1.00 82.23  ? 160  ALA C N     1 
ATOM   4774  C  CA    . ALA C  2  160  ? 46.472  -35.638 56.261  1.00 78.90  ? 160  ALA C CA    1 
ATOM   4775  C  C     . ALA C  2  160  ? 47.598  -34.632 56.051  1.00 83.37  ? 160  ALA C C     1 
ATOM   4776  O  O     . ALA C  2  160  ? 47.891  -34.249 54.915  1.00 81.06  ? 160  ALA C O     1 
ATOM   4777  C  CB    . ALA C  2  160  ? 46.794  -36.968 55.582  1.00 77.05  ? 160  ALA C CB    1 
ATOM   4778  N  N     . SER C  2  161  ? 48.217  -34.201 57.144  1.00 82.64  ? 161  SER C N     1 
ATOM   4779  C  CA    . SER C  2  161  ? 49.274  -33.202 57.112  1.00 80.37  ? 161  SER C CA    1 
ATOM   4780  C  C     . SER C  2  161  ? 50.615  -33.869 57.390  1.00 78.10  ? 161  SER C C     1 
ATOM   4781  O  O     . SER C  2  161  ? 50.760  -34.588 58.384  1.00 75.34  ? 161  SER C O     1 
ATOM   4782  C  CB    . SER C  2  161  ? 49.004  -32.099 58.139  1.00 82.64  ? 161  SER C CB    1 
ATOM   4783  O  OG    . SER C  2  161  ? 47.659  -31.653 58.071  1.00 84.81  ? 161  SER C OG    1 
ATOM   4784  N  N     . ILE C  2  162  ? 51.585  -33.641 56.506  1.00 81.14  ? 162  ILE C N     1 
ATOM   4785  C  CA    . ILE C  2  162  ? 52.966  -34.072 56.689  1.00 76.75  ? 162  ILE C CA    1 
ATOM   4786  C  C     . ILE C  2  162  ? 53.791  -32.817 56.935  1.00 71.74  ? 162  ILE C C     1 
ATOM   4787  O  O     . ILE C  2  162  ? 53.922  -31.962 56.045  1.00 79.84  ? 162  ILE C O     1 
ATOM   4788  C  CB    . ILE C  2  162  ? 53.493  -34.859 55.482  1.00 78.29  ? 162  ILE C CB    1 
ATOM   4789  C  CG1   . ILE C  2  162  ? 52.693  -36.151 55.293  1.00 74.51  ? 162  ILE C CG1   1 
ATOM   4790  C  CG2   . ILE C  2  162  ? 54.973  -35.165 55.654  1.00 76.42  ? 162  ILE C CG2   1 
ATOM   4791  C  CD1   . ILE C  2  162  ? 53.155  -36.995 54.120  1.00 69.90  ? 162  ILE C CD1   1 
ATOM   4792  N  N     . ILE C  2  163  ? 54.341  -32.710 58.142  1.00 63.88  ? 163  ILE C N     1 
ATOM   4793  C  CA    . ILE C  2  163  ? 54.967  -31.494 58.641  1.00 75.91  ? 163  ILE C CA    1 
ATOM   4794  C  C     . ILE C  2  163  ? 56.423  -31.795 58.979  1.00 75.78  ? 163  ILE C C     1 
ATOM   4795  O  O     . ILE C  2  163  ? 56.695  -32.580 59.892  1.00 71.70  ? 163  ILE C O     1 
ATOM   4796  C  CB    . ILE C  2  163  ? 54.234  -30.947 59.876  1.00 85.49  ? 163  ILE C CB    1 
ATOM   4797  C  CG1   . ILE C  2  163  ? 52.774  -30.643 59.544  1.00 80.42  ? 163  ILE C CG1   1 
ATOM   4798  C  CG2   . ILE C  2  163  ? 54.944  -29.716 60.422  1.00 95.78  ? 163  ILE C CG2   1 
ATOM   4799  C  CD1   . ILE C  2  163  ? 51.897  -30.523 60.767  1.00 71.54  ? 163  ILE C CD1   1 
ATOM   4800  N  N     . PRO C  2  164  ? 57.385  -31.207 58.275  1.00 76.39  ? 164  PRO C N     1 
ATOM   4801  C  CA    . PRO C  2  164  ? 58.795  -31.365 58.652  1.00 73.11  ? 164  PRO C CA    1 
ATOM   4802  C  C     . PRO C  2  164  ? 59.252  -30.300 59.638  1.00 78.39  ? 164  PRO C C     1 
ATOM   4803  O  O     . PRO C  2  164  ? 58.438  -29.506 60.121  1.00 83.26  ? 164  PRO C O     1 
ATOM   4804  C  CB    . PRO C  2  164  ? 59.515  -31.237 57.311  1.00 80.16  ? 164  PRO C CB    1 
ATOM   4805  C  CG    . PRO C  2  164  ? 58.666  -30.249 56.566  1.00 84.27  ? 164  PRO C CG    1 
ATOM   4806  C  CD    . PRO C  2  164  ? 57.237  -30.516 56.983  1.00 83.61  ? 164  PRO C CD    1 
ATOM   4807  N  N     . LEU C  2  165  ? 60.547  -30.285 59.953  1.00 75.03  ? 165  LEU C N     1 
ATOM   4808  C  CA    . LEU C  2  165  ? 61.096  -29.264 60.832  1.00 73.48  ? 165  LEU C CA    1 
ATOM   4809  C  C     . LEU C  2  165  ? 61.000  -27.884 60.178  1.00 79.17  ? 165  LEU C C     1 
ATOM   4810  O  O     . LEU C  2  165  ? 60.954  -27.773 58.949  1.00 75.93  ? 165  LEU C O     1 
ATOM   4811  C  CB    . LEU C  2  165  ? 62.553  -29.573 61.171  1.00 73.54  ? 165  LEU C CB    1 
ATOM   4812  C  CG    . LEU C  2  165  ? 62.870  -30.666 62.196  1.00 70.89  ? 165  LEU C CG    1 
ATOM   4813  C  CD1   . LEU C  2  165  ? 64.343  -31.015 62.147  1.00 81.52  ? 165  LEU C CD1   1 
ATOM   4814  C  CD2   . LEU C  2  165  ? 62.494  -30.229 63.598  1.00 68.39  ? 165  LEU C CD2   1 
ATOM   4815  N  N     . PRO C  2  166  ? 60.933  -26.819 60.981  1.00 84.98  ? 166  PRO C N     1 
ATOM   4816  C  CA    . PRO C  2  166  ? 60.913  -25.464 60.416  1.00 86.41  ? 166  PRO C CA    1 
ATOM   4817  C  C     . PRO C  2  166  ? 62.091  -25.225 59.483  1.00 83.46  ? 166  PRO C C     1 
ATOM   4818  O  O     . PRO C  2  166  ? 63.224  -25.616 59.768  1.00 85.48  ? 166  PRO C O     1 
ATOM   4819  C  CB    . PRO C  2  166  ? 60.990  -24.558 61.651  1.00 84.16  ? 166  PRO C CB    1 
ATOM   4820  C  CG    . PRO C  2  166  ? 60.606  -25.406 62.819  1.00 83.05  ? 166  PRO C CG    1 
ATOM   4821  C  CD    . PRO C  2  166  ? 60.497  -26.842 62.387  1.00 87.47  ? 166  PRO C CD    1 
ATOM   4822  N  N     . LYS C  2  167  ? 61.805  -24.584 58.349  1.00 84.46  ? 167  LYS C N     1 
ATOM   4823  C  CA    . LYS C  2  167  ? 62.811  -24.183 57.366  1.00 99.32  ? 167  LYS C CA    1 
ATOM   4824  C  C     . LYS C  2  167  ? 63.535  -25.377 56.736  1.00 98.59  ? 167  LYS C C     1 
ATOM   4825  O  O     . LYS C  2  167  ? 64.585  -25.203 56.107  1.00 97.00  ? 167  LYS C O     1 
ATOM   4826  C  CB    . LYS C  2  167  ? 63.827  -23.208 57.979  1.00 100.21 ? 167  LYS C CB    1 
ATOM   4827  C  CG    . LYS C  2  167  ? 63.272  -21.817 58.309  1.00 94.04  ? 167  LYS C CG    1 
ATOM   4828  C  CD    . LYS C  2  167  ? 63.348  -20.891 57.101  1.00 100.87 ? 167  LYS C CD    1 
ATOM   4829  C  CE    . LYS C  2  167  ? 62.776  -19.512 57.389  1.00 97.74  ? 167  LYS C CE    1 
ATOM   4830  N  NZ    . LYS C  2  167  ? 62.890  -18.624 56.193  1.00 85.00  ? 167  LYS C NZ    1 
ATOM   4831  N  N     . ARG C  2  168  ? 62.999  -26.592 56.891  1.00 96.67  ? 168  ARG C N     1 
ATOM   4832  C  CA    . ARG C  2  168  ? 63.525  -27.796 56.240  1.00 92.69  ? 168  ARG C CA    1 
ATOM   4833  C  C     . ARG C  2  168  ? 62.370  -28.478 55.510  1.00 90.53  ? 168  ARG C C     1 
ATOM   4834  O  O     . ARG C  2  168  ? 61.714  -29.363 56.065  1.00 87.73  ? 168  ARG C O     1 
ATOM   4835  C  CB    . ARG C  2  168  ? 64.179  -28.760 57.242  1.00 88.65  ? 168  ARG C CB    1 
ATOM   4836  C  CG    . ARG C  2  168  ? 64.785  -28.134 58.495  1.00 93.71  ? 168  ARG C CG    1 
ATOM   4837  C  CD    . ARG C  2  168  ? 66.134  -27.458 58.248  1.00 108.04 ? 168  ARG C CD    1 
ATOM   4838  N  NE    . ARG C  2  168  ? 66.677  -27.719 56.917  1.00 105.65 ? 168  ARG C NE    1 
ATOM   4839  C  CZ    . ARG C  2  168  ? 67.671  -28.562 56.660  1.00 101.08 ? 168  ARG C CZ    1 
ATOM   4840  N  NH1   . ARG C  2  168  ? 68.251  -29.234 57.644  1.00 98.24  ? 168  ARG C NH1   1 
ATOM   4841  N  NH2   . ARG C  2  168  ? 68.089  -28.726 55.413  1.00 102.05 ? 168  ARG C NH2   1 
ATOM   4842  N  N     . GLY C  2  169  ? 62.129  -28.080 54.264  1.00 92.79  ? 169  GLY C N     1 
ATOM   4843  C  CA    . GLY C  2  169  ? 61.145  -28.739 53.439  1.00 95.96  ? 169  GLY C CA    1 
ATOM   4844  C  C     . GLY C  2  169  ? 59.738  -28.214 53.635  1.00 92.84  ? 169  GLY C C     1 
ATOM   4845  O  O     . GLY C  2  169  ? 59.418  -27.575 54.643  1.00 96.74  ? 169  GLY C O     1 
ATOM   4846  N  N     . PRO C  2  170  ? 58.865  -28.483 52.671  1.00 88.13  ? 170  PRO C N     1 
ATOM   4847  C  CA    . PRO C  2  170  ? 57.513  -27.926 52.704  1.00 93.48  ? 170  PRO C CA    1 
ATOM   4848  C  C     . PRO C  2  170  ? 56.546  -28.809 53.485  1.00 97.08  ? 170  PRO C C     1 
ATOM   4849  O  O     . PRO C  2  170  ? 56.834  -29.962 53.813  1.00 94.52  ? 170  PRO C O     1 
ATOM   4850  C  CB    . PRO C  2  170  ? 57.132  -27.893 51.223  1.00 91.12  ? 170  PRO C CB    1 
ATOM   4851  C  CG    . PRO C  2  170  ? 57.786  -29.120 50.687  1.00 89.63  ? 170  PRO C CG    1 
ATOM   4852  C  CD    . PRO C  2  170  ? 59.098  -29.258 51.440  1.00 92.07  ? 170  PRO C CD    1 
ATOM   4853  N  N     . TRP C  2  171  ? 55.384  -28.232 53.778  1.00 94.50  ? 171  TRP C N     1 
ATOM   4854  C  CA    . TRP C  2  171  ? 54.266  -29.000 54.304  1.00 89.89  ? 171  TRP C CA    1 
ATOM   4855  C  C     . TRP C  2  171  ? 53.536  -29.669 53.152  1.00 87.01  ? 171  TRP C C     1 
ATOM   4856  O  O     . TRP C  2  171  ? 53.391  -29.088 52.072  1.00 85.66  ? 171  TRP C O     1 
ATOM   4857  C  CB    . TRP C  2  171  ? 53.295  -28.104 55.075  1.00 96.81  ? 171  TRP C CB    1 
ATOM   4858  C  CG    . TRP C  2  171  ? 53.814  -27.604 56.384  1.00 100.50 ? 171  TRP C CG    1 
ATOM   4859  C  CD1   . TRP C  2  171  ? 55.116  -27.375 56.720  1.00 105.38 ? 171  TRP C CD1   1 
ATOM   4860  C  CD2   . TRP C  2  171  ? 53.039  -27.276 57.544  1.00 96.32  ? 171  TRP C CD2   1 
ATOM   4861  N  NE1   . TRP C  2  171  ? 55.200  -26.920 58.013  1.00 104.85 ? 171  TRP C NE1   1 
ATOM   4862  C  CE2   . TRP C  2  171  ? 53.939  -26.852 58.542  1.00 98.89  ? 171  TRP C CE2   1 
ATOM   4863  C  CE3   . TRP C  2  171  ? 51.671  -27.299 57.835  1.00 95.37  ? 171  TRP C CE3   1 
ATOM   4864  C  CZ2   . TRP C  2  171  ? 53.517  -26.455 59.809  1.00 102.68 ? 171  TRP C CZ2   1 
ATOM   4865  C  CZ3   . TRP C  2  171  ? 51.254  -26.904 59.095  1.00 100.50 ? 171  TRP C CZ3   1 
ATOM   4866  C  CH2   . TRP C  2  171  ? 52.174  -26.489 60.066  1.00 104.87 ? 171  TRP C CH2   1 
ATOM   4867  N  N     . ILE C  2  172  ? 53.073  -30.895 53.381  1.00 84.49  ? 172  ILE C N     1 
ATOM   4868  C  CA    . ILE C  2  172  ? 52.346  -31.646 52.364  1.00 82.28  ? 172  ILE C CA    1 
ATOM   4869  C  C     . ILE C  2  172  ? 50.954  -31.955 52.894  1.00 80.51  ? 172  ILE C C     1 
ATOM   4870  O  O     . ILE C  2  172  ? 50.807  -32.441 54.020  1.00 77.39  ? 172  ILE C O     1 
ATOM   4871  C  CB    . ILE C  2  172  ? 53.087  -32.935 51.962  1.00 83.15  ? 172  ILE C CB    1 
ATOM   4872  C  CG1   . ILE C  2  172  ? 54.387  -32.605 51.220  1.00 84.86  ? 172  ILE C CG1   1 
ATOM   4873  C  CG2   . ILE C  2  172  ? 52.206  -33.799 51.086  1.00 82.64  ? 172  ILE C CG2   1 
ATOM   4874  C  CD1   . ILE C  2  172  ? 55.598  -32.448 52.117  1.00 88.33  ? 172  ILE C CD1   1 
ATOM   4875  N  N     . ASP C  2  173  ? 49.932  -31.666 52.090  1.00 88.33  ? 173  ASP C N     1 
ATOM   4876  C  CA    . ASP C  2  173  ? 48.549  -31.921 52.483  1.00 85.51  ? 173  ASP C CA    1 
ATOM   4877  C  C     . ASP C  2  173  ? 47.915  -32.931 51.539  1.00 88.36  ? 173  ASP C C     1 
ATOM   4878  O  O     . ASP C  2  173  ? 47.807  -32.679 50.336  1.00 88.39  ? 173  ASP C O     1 
ATOM   4879  C  CB    . ASP C  2  173  ? 47.732  -30.629 52.510  1.00 95.99  ? 173  ASP C CB    1 
ATOM   4880  C  CG    . ASP C  2  173  ? 47.587  -30.067 53.909  1.00 101.50 ? 173  ASP C CG    1 
ATOM   4881  O  OD1   . ASP C  2  173  ? 48.346  -30.509 54.800  1.00 94.57  ? 173  ASP C OD1   1 
ATOM   4882  O  OD2   . ASP C  2  173  ? 46.711  -29.200 54.123  1.00 104.27 ? 173  ASP C OD2   1 
ATOM   4883  N  N     . LEU C  2  174  ? 47.489  -34.064 52.091  1.00 85.41  ? 174  LEU C N     1 
ATOM   4884  C  CA    . LEU C  2  174  ? 46.761  -35.093 51.359  1.00 86.71  ? 174  LEU C CA    1 
ATOM   4885  C  C     . LEU C  2  174  ? 45.275  -34.955 51.661  1.00 93.66  ? 174  LEU C C     1 
ATOM   4886  O  O     . LEU C  2  174  ? 44.873  -34.932 52.830  1.00 95.87  ? 174  LEU C O     1 
ATOM   4887  C  CB    . LEU C  2  174  ? 47.250  -36.489 51.740  1.00 81.99  ? 174  LEU C CB    1 
ATOM   4888  C  CG    . LEU C  2  174  ? 48.383  -37.122 50.932  1.00 84.11  ? 174  LEU C CG    1 
ATOM   4889  C  CD1   . LEU C  2  174  ? 49.538  -36.157 50.721  1.00 82.54  ? 174  LEU C CD1   1 
ATOM   4890  C  CD2   . LEU C  2  174  ? 48.868  -38.390 51.621  1.00 79.53  ? 174  LEU C CD2   1 
ATOM   4891  N  N     . GLU C  2  175  ? 44.466  -34.867 50.607  1.00 103.04 ? 175  GLU C N     1 
ATOM   4892  C  CA    . GLU C  2  175  ? 43.044  -34.595 50.756  1.00 106.64 ? 175  GLU C CA    1 
ATOM   4893  C  C     . GLU C  2  175  ? 42.259  -35.362 49.703  1.00 111.19 ? 175  GLU C C     1 
ATOM   4894  O  O     . GLU C  2  175  ? 42.678  -35.447 48.547  1.00 113.34 ? 175  GLU C O     1 
ATOM   4895  C  CB    . GLU C  2  175  ? 42.765  -33.088 50.637  1.00 112.33 ? 175  GLU C CB    1 
ATOM   4896  C  CG    . GLU C  2  175  ? 41.294  -32.698 50.675  1.00 118.65 ? 175  GLU C CG    1 
ATOM   4897  C  CD    . GLU C  2  175  ? 41.086  -31.193 50.599  1.00 115.84 ? 175  GLU C CD    1 
ATOM   4898  O  OE1   . GLU C  2  175  ? 42.083  -30.462 50.408  1.00 109.43 ? 175  GLU C OE1   1 
ATOM   4899  O  OE2   . GLU C  2  175  ? 39.927  -30.741 50.730  1.00 115.20 ? 175  GLU C OE2   1 
ATOM   4900  N  N     . VAL C  2  176  ? 41.114  -35.912 50.096  1.00 120.04 ? 176  VAL C N     1 
ATOM   4901  C  CA    . VAL C  2  176  ? 40.234  -36.604 49.161  1.00 123.01 ? 176  VAL C CA    1 
ATOM   4902  C  C     . VAL C  2  176  ? 39.206  -35.598 48.653  1.00 124.73 ? 176  VAL C C     1 
ATOM   4903  O  O     . VAL C  2  176  ? 38.300  -35.192 49.387  1.00 118.35 ? 176  VAL C O     1 
ATOM   4904  C  CB    . VAL C  2  176  ? 39.561  -37.820 49.806  1.00 120.92 ? 176  VAL C CB    1 
ATOM   4905  C  CG1   . VAL C  2  176  ? 38.738  -38.571 48.772  1.00 121.64 ? 176  VAL C CG1   1 
ATOM   4906  C  CG2   . VAL C  2  176  ? 40.605  -38.735 50.421  1.00 115.62 ? 176  VAL C CG2   1 
ATOM   4907  N  N     . GLU C  2  177  ? 39.352  -35.197 47.392  1.00 125.26 ? 177  GLU C N     1 
ATOM   4908  C  CA    . GLU C  2  177  ? 38.477  -34.208 46.794  1.00 123.18 ? 177  GLU C CA    1 
ATOM   4909  C  C     . GLU C  2  177  ? 37.071  -34.778 46.616  1.00 126.09 ? 177  GLU C C     1 
ATOM   4910  O  O     . GLU C  2  177  ? 36.883  -35.997 46.607  1.00 131.93 ? 177  GLU C O     1 
ATOM   4911  C  CB    . GLU C  2  177  ? 39.044  -33.761 45.449  1.00 121.74 ? 177  GLU C CB    1 
ATOM   4912  C  CG    . GLU C  2  177  ? 39.338  -32.274 45.345  1.00 123.04 ? 177  GLU C CG    1 
ATOM   4913  C  CD    . GLU C  2  177  ? 40.191  -31.763 46.486  1.00 121.34 ? 177  GLU C CD    1 
ATOM   4914  O  OE1   . GLU C  2  177  ? 39.765  -30.800 47.159  1.00 117.83 ? 177  GLU C OE1   1 
ATOM   4915  O  OE2   . GLU C  2  177  ? 41.284  -32.327 46.713  1.00 119.76 ? 177  GLU C OE2   1 
ATOM   4916  N  N     . PRO C  2  178  ? 36.061  -33.913 46.485  1.00 122.13 ? 178  PRO C N     1 
ATOM   4917  C  CA    . PRO C  2  178  ? 34.702  -34.422 46.235  1.00 121.92 ? 178  PRO C CA    1 
ATOM   4918  C  C     . PRO C  2  178  ? 34.578  -35.244 44.961  1.00 126.21 ? 178  PRO C C     1 
ATOM   4919  O  O     . PRO C  2  178  ? 33.735  -36.148 44.911  1.00 127.32 ? 178  PRO C O     1 
ATOM   4920  C  CB    . PRO C  2  178  ? 33.853  -33.142 46.173  1.00 122.99 ? 178  PRO C CB    1 
ATOM   4921  C  CG    . PRO C  2  178  ? 34.831  -32.022 45.976  1.00 119.13 ? 178  PRO C CG    1 
ATOM   4922  C  CD    . PRO C  2  178  ? 36.068  -32.455 46.689  1.00 119.56 ? 178  PRO C CD    1 
ATOM   4923  N  N     . ASN C  2  179  ? 35.396  -34.975 43.936  1.00 128.83 ? 179  ASN C N     1 
ATOM   4924  C  CA    . ASN C  2  179  ? 35.303  -35.727 42.685  1.00 129.65 ? 179  ASN C CA    1 
ATOM   4925  C  C     . ASN C  2  179  ? 35.842  -37.149 42.800  1.00 130.97 ? 179  ASN C C     1 
ATOM   4926  O  O     . ASN C  2  179  ? 35.682  -37.929 41.856  1.00 131.10 ? 179  ASN C O     1 
ATOM   4927  C  CB    . ASN C  2  179  ? 36.033  -34.989 41.553  1.00 125.41 ? 179  ASN C CB    1 
ATOM   4928  C  CG    . ASN C  2  179  ? 37.505  -34.756 41.847  1.00 123.81 ? 179  ASN C CG    1 
ATOM   4929  O  OD1   . ASN C  2  179  ? 38.038  -35.243 42.842  1.00 130.13 ? 179  ASN C OD1   1 
ATOM   4930  N  ND2   . ASN C  2  179  ? 38.172  -34.008 40.973  1.00 108.45 ? 179  ASN C ND2   1 
ATOM   4931  N  N     . GLY C  2  180  ? 36.480  -37.501 43.916  1.00 129.08 ? 180  GLY C N     1 
ATOM   4932  C  CA    . GLY C  2  180  ? 36.927  -38.853 44.172  1.00 130.72 ? 180  GLY C CA    1 
ATOM   4933  C  C     . GLY C  2  180  ? 38.424  -39.058 44.084  1.00 131.97 ? 180  GLY C C     1 
ATOM   4934  O  O     . GLY C  2  180  ? 38.936  -40.013 44.681  1.00 134.57 ? 180  GLY C O     1 
ATOM   4935  N  N     . VAL C  2  181  ? 39.142  -38.200 43.361  1.00 132.49 ? 181  VAL C N     1 
ATOM   4936  C  CA    . VAL C  2  181  ? 40.581  -38.373 43.192  1.00 133.25 ? 181  VAL C CA    1 
ATOM   4937  C  C     . VAL C  2  181  ? 41.310  -37.775 44.390  1.00 130.36 ? 181  VAL C C     1 
ATOM   4938  O  O     . VAL C  2  181  ? 40.896  -36.751 44.951  1.00 124.32 ? 181  VAL C O     1 
ATOM   4939  C  CB    . VAL C  2  181  ? 41.050  -37.753 41.860  1.00 121.97 ? 181  VAL C CB    1 
ATOM   4940  C  CG1   . VAL C  2  181  ? 40.849  -36.245 41.850  1.00 107.80 ? 181  VAL C CG1   1 
ATOM   4941  C  CG2   . VAL C  2  181  ? 42.506  -38.117 41.572  1.00 119.49 ? 181  VAL C CG2   1 
ATOM   4942  N  N     . VAL C  2  182  ? 42.391  -38.433 44.803  1.00 129.72 ? 182  VAL C N     1 
ATOM   4943  C  CA    . VAL C  2  182  ? 43.184  -38.008 45.952  1.00 118.28 ? 182  VAL C CA    1 
ATOM   4944  C  C     . VAL C  2  182  ? 44.205  -36.973 45.494  1.00 117.51 ? 182  VAL C C     1 
ATOM   4945  O  O     . VAL C  2  182  ? 44.879  -37.156 44.471  1.00 115.82 ? 182  VAL C O     1 
ATOM   4946  C  CB    . VAL C  2  182  ? 43.868  -39.214 46.618  1.00 114.86 ? 182  VAL C CB    1 
ATOM   4947  C  CG1   . VAL C  2  182  ? 44.526  -40.099 45.569  1.00 125.15 ? 182  VAL C CG1   1 
ATOM   4948  C  CG2   . VAL C  2  182  ? 44.883  -38.756 47.651  1.00 109.63 ? 182  VAL C CG2   1 
ATOM   4949  N  N     . SER C  2  183  ? 44.324  -35.885 46.254  1.00 113.70 ? 183  SER C N     1 
ATOM   4950  C  CA    . SER C  2  183  ? 45.117  -34.729 45.878  1.00 108.19 ? 183  SER C CA    1 
ATOM   4951  C  C     . SER C  2  183  ? 46.213  -34.471 46.901  1.00 101.43 ? 183  SER C C     1 
ATOM   4952  O  O     . SER C  2  183  ? 46.035  -34.683 48.107  1.00 105.27 ? 183  SER C O     1 
ATOM   4953  C  CB    . SER C  2  183  ? 44.242  -33.475 45.751  1.00 109.79 ? 183  SER C CB    1 
ATOM   4954  O  OG    . SER C  2  183  ? 43.721  -33.087 47.012  1.00 100.40 ? 183  SER C OG    1 
ATOM   4955  N  N     . MET C  2  184  ? 47.340  -33.987 46.393  1.00 99.38  ? 184  MET C N     1 
ATOM   4956  C  CA    . MET C  2  184  ? 48.492  -33.593 47.185  1.00 96.63  ? 184  MET C CA    1 
ATOM   4957  C  C     . MET C  2  184  ? 48.750  -32.110 46.956  1.00 103.13 ? 184  MET C C     1 
ATOM   4958  O  O     . MET C  2  184  ? 48.759  -31.646 45.806  1.00 100.39 ? 184  MET C O     1 
ATOM   4959  C  CB    . MET C  2  184  ? 49.714  -34.429 46.807  1.00 91.36  ? 184  MET C CB    1 
ATOM   4960  C  CG    . MET C  2  184  ? 50.993  -34.067 47.529  1.00 88.50  ? 184  MET C CG    1 
ATOM   4961  S  SD    . MET C  2  184  ? 52.260  -35.296 47.174  1.00 86.19  ? 184  MET C SD    1 
ATOM   4962  C  CE    . MET C  2  184  ? 53.730  -34.501 47.811  1.00 89.11  ? 184  MET C CE    1 
ATOM   4963  N  N     . LYS C  2  185  ? 48.941  -31.378 48.056  1.00 104.70 ? 185  LYS C N     1 
ATOM   4964  C  CA    . LYS C  2  185  ? 49.151  -29.934 48.059  1.00 98.99  ? 185  LYS C CA    1 
ATOM   4965  C  C     . LYS C  2  185  ? 50.529  -29.640 48.633  1.00 93.49  ? 185  LYS C C     1 
ATOM   4966  O  O     . LYS C  2  185  ? 50.806  -29.977 49.792  1.00 90.15  ? 185  LYS C O     1 
ATOM   4967  C  CB    . LYS C  2  185  ? 48.070  -29.224 48.877  1.00 97.00  ? 185  LYS C CB    1 
ATOM   4968  C  CG    . LYS C  2  185  ? 48.223  -27.710 48.934  1.00 101.67 ? 185  LYS C CG    1 
ATOM   4969  C  CD    . LYS C  2  185  ? 47.372  -27.111 50.044  1.00 100.30 ? 185  LYS C CD    1 
ATOM   4970  C  CE    . LYS C  2  185  ? 45.918  -27.536 49.921  1.00 106.39 ? 185  LYS C CE    1 
ATOM   4971  N  NZ    . LYS C  2  185  ? 45.102  -27.061 51.073  1.00 109.04 ? 185  LYS C NZ    1 
ATOM   4972  N  N     . VAL C  2  186  ? 51.383  -29.027 47.811  1.00 97.34  ? 186  VAL C N     1 
ATOM   4973  C  CA    . VAL C  2  186  ? 52.746  -28.639 48.160  1.00 99.59  ? 186  VAL C CA    1 
ATOM   4974  C  C     . VAL C  2  186  ? 53.015  -27.265 47.562  1.00 106.90 ? 186  VAL C C     1 
ATOM   4975  O  O     . VAL C  2  186  ? 52.773  -27.048 46.369  1.00 107.67 ? 186  VAL C O     1 
ATOM   4976  C  CB    . VAL C  2  186  ? 53.789  -29.646 47.636  1.00 91.01  ? 186  VAL C CB    1 
ATOM   4977  C  CG1   . VAL C  2  186  ? 55.183  -29.246 48.083  1.00 99.07  ? 186  VAL C CG1   1 
ATOM   4978  C  CG2   . VAL C  2  186  ? 53.464  -31.039 48.099  1.00 93.16  ? 186  VAL C CG2   1 
ATOM   4979  N  N     . ASN C  2  187  ? 53.528  -26.348 48.385  1.00 106.88 ? 187  ASN C N     1 
ATOM   4980  C  CA    . ASN C  2  187  ? 53.865  -24.988 47.957  1.00 105.25 ? 187  ASN C CA    1 
ATOM   4981  C  C     . ASN C  2  187  ? 52.693  -24.338 47.228  1.00 108.38 ? 187  ASN C C     1 
ATOM   4982  O  O     . ASN C  2  187  ? 52.838  -23.743 46.157  1.00 100.92 ? 187  ASN C O     1 
ATOM   4983  C  CB    . ASN C  2  187  ? 55.126  -24.979 47.095  1.00 106.43 ? 187  ASN C CB    1 
ATOM   4984  C  CG    . ASN C  2  187  ? 56.378  -25.290 47.894  1.00 106.83 ? 187  ASN C CG    1 
ATOM   4985  O  OD1   . ASN C  2  187  ? 57.190  -26.129 47.503  1.00 96.58  ? 187  ASN C OD1   1 
ATOM   4986  N  ND2   . ASN C  2  187  ? 56.535  -24.615 49.029  1.00 105.20 ? 187  ASN C ND2   1 
ATOM   4987  N  N     . LYS C  2  188  ? 51.507  -24.487 47.819  1.00 115.24 ? 188  LYS C N     1 
ATOM   4988  C  CA    . LYS C  2  188  ? 50.243  -23.921 47.359  1.00 118.79 ? 188  LYS C CA    1 
ATOM   4989  C  C     . LYS C  2  188  ? 49.758  -24.540 46.051  1.00 117.22 ? 188  LYS C C     1 
ATOM   4990  O  O     . LYS C  2  188  ? 48.662  -24.194 45.590  1.00 120.07 ? 188  LYS C O     1 
ATOM   4991  C  CB    . LYS C  2  188  ? 50.324  -22.396 47.205  1.00 127.16 ? 188  LYS C CB    1 
ATOM   4992  C  CG    . LYS C  2  188  ? 50.855  -21.677 48.444  1.00 129.70 ? 188  LYS C CG    1 
ATOM   4993  C  CD    . LYS C  2  188  ? 51.222  -20.233 48.135  1.00 132.20 ? 188  LYS C CD    1 
ATOM   4994  C  CE    . LYS C  2  188  ? 51.955  -19.577 49.296  1.00 128.55 ? 188  LYS C CE    1 
ATOM   4995  N  NZ    . LYS C  2  188  ? 53.263  -20.235 49.571  1.00 122.47 ? 188  LYS C NZ    1 
ATOM   4996  N  N     . ARG C  2  189  ? 50.518  -25.454 45.449  1.00 112.20 ? 189  ARG C N     1 
ATOM   4997  C  CA    . ARG C  2  189  ? 50.114  -26.138 44.229  1.00 110.32 ? 189  ARG C CA    1 
ATOM   4998  C  C     . ARG C  2  189  ? 49.527  -27.502 44.566  1.00 106.99 ? 189  ARG C C     1 
ATOM   4999  O  O     . ARG C  2  189  ? 50.015  -28.196 45.459  1.00 101.85 ? 189  ARG C O     1 
ATOM   5000  C  CB    . ARG C  2  189  ? 51.294  -26.313 43.274  1.00 113.13 ? 189  ARG C CB    1 
ATOM   5001  C  CG    . ARG C  2  189  ? 51.796  -25.033 42.637  1.00 114.01 ? 189  ARG C CG    1 
ATOM   5002  C  CD    . ARG C  2  189  ? 52.883  -25.339 41.620  1.00 115.45 ? 189  ARG C CD    1 
ATOM   5003  N  NE    . ARG C  2  189  ? 53.435  -24.127 41.025  1.00 117.93 ? 189  ARG C NE    1 
ATOM   5004  C  CZ    . ARG C  2  189  ? 53.023  -23.604 39.876  1.00 116.67 ? 189  ARG C CZ    1 
ATOM   5005  N  NH1   . ARG C  2  189  ? 52.053  -24.192 39.189  1.00 114.97 ? 189  ARG C NH1   1 
ATOM   5006  N  NH2   . ARG C  2  189  ? 53.583  -22.495 39.412  1.00 117.08 ? 189  ARG C NH2   1 
ATOM   5007  N  N     . LYS C  2  190  ? 48.489  -27.893 43.835  1.00 111.89 ? 190  LYS C N     1 
ATOM   5008  C  CA    . LYS C  2  190  ? 47.822  -29.166 44.065  1.00 111.38 ? 190  LYS C CA    1 
ATOM   5009  C  C     . LYS C  2  190  ? 47.848  -30.005 42.797  1.00 105.78 ? 190  LYS C C     1 
ATOM   5010  O  O     . LYS C  2  190  ? 47.875  -29.476 41.681  1.00 103.39 ? 190  LYS C O     1 
ATOM   5011  C  CB    . LYS C  2  190  ? 46.375  -28.961 44.533  1.00 102.97 ? 190  LYS C CB    1 
ATOM   5012  C  CG    . LYS C  2  190  ? 46.257  -28.158 45.818  1.00 108.00 ? 190  LYS C CG    1 
ATOM   5013  C  CD    . LYS C  2  190  ? 44.813  -28.039 46.279  1.00 120.69 ? 190  LYS C CD    1 
ATOM   5014  C  CE    . LYS C  2  190  ? 44.242  -29.388 46.689  1.00 117.64 ? 190  LYS C CE    1 
ATOM   5015  N  NZ    . LYS C  2  190  ? 42.864  -29.257 47.241  1.00 105.67 ? 190  LYS C NZ    1 
ATOM   5016  N  N     . PHE C  2  191  ? 47.850  -31.320 42.981  1.00 102.67 ? 191  PHE C N     1 
ATOM   5017  C  CA    . PHE C  2  191  ? 47.876  -32.241 41.851  1.00 100.62 ? 191  PHE C CA    1 
ATOM   5018  C  C     . PHE C  2  191  ? 47.382  -33.600 42.330  1.00 111.06 ? 191  PHE C C     1 
ATOM   5019  O  O     . PHE C  2  191  ? 47.189  -33.809 43.534  1.00 117.49 ? 191  PHE C O     1 
ATOM   5020  C  CB    . PHE C  2  191  ? 49.287  -32.339 41.241  1.00 100.20 ? 191  PHE C CB    1 
ATOM   5021  C  CG    . PHE C  2  191  ? 50.334  -32.796 42.205  1.00 101.29 ? 191  PHE C CG    1 
ATOM   5022  C  CD1   . PHE C  2  191  ? 50.988  -31.888 43.018  1.00 106.81 ? 191  PHE C CD1   1 
ATOM   5023  C  CD2   . PHE C  2  191  ? 50.677  -34.133 42.289  1.00 100.60 ? 191  PHE C CD2   1 
ATOM   5024  C  CE1   . PHE C  2  191  ? 51.957  -32.308 43.905  1.00 106.89 ? 191  PHE C CE1   1 
ATOM   5025  C  CE2   . PHE C  2  191  ? 51.643  -34.560 43.172  1.00 101.49 ? 191  PHE C CE2   1 
ATOM   5026  C  CZ    . PHE C  2  191  ? 52.286  -33.647 43.982  1.00 105.96 ? 191  PHE C CZ    1 
ATOM   5027  N  N     . PRO C  2  192  ? 47.121  -34.535 41.414  1.00 113.04 ? 192  PRO C N     1 
ATOM   5028  C  CA    . PRO C  2  192  ? 46.734  -35.886 41.847  1.00 115.46 ? 192  PRO C CA    1 
ATOM   5029  C  C     . PRO C  2  192  ? 47.912  -36.630 42.459  1.00 112.79 ? 192  PRO C C     1 
ATOM   5030  O  O     . PRO C  2  192  ? 49.016  -36.634 41.910  1.00 110.65 ? 192  PRO C O     1 
ATOM   5031  C  CB    . PRO C  2  192  ? 46.256  -36.554 40.551  1.00 119.47 ? 192  PRO C CB    1 
ATOM   5032  C  CG    . PRO C  2  192  ? 46.898  -35.761 39.455  1.00 114.77 ? 192  PRO C CG    1 
ATOM   5033  C  CD    . PRO C  2  192  ? 46.935  -34.355 39.962  1.00 110.51 ? 192  PRO C CD    1 
ATOM   5034  N  N     . LEU C  2  193  ? 47.662  -37.275 43.602  1.00 110.81 ? 193  LEU C N     1 
ATOM   5035  C  CA    . LEU C  2  193  ? 48.695  -38.062 44.268  1.00 110.08 ? 193  LEU C CA    1 
ATOM   5036  C  C     . LEU C  2  193  ? 49.128  -39.267 43.439  1.00 111.78 ? 193  LEU C C     1 
ATOM   5037  O  O     . LEU C  2  193  ? 50.238  -39.777 43.638  1.00 104.05 ? 193  LEU C O     1 
ATOM   5038  C  CB    . LEU C  2  193  ? 48.187  -38.514 45.641  1.00 105.47 ? 193  LEU C CB    1 
ATOM   5039  C  CG    . LEU C  2  193  ? 49.154  -39.208 46.603  1.00 98.94  ? 193  LEU C CG    1 
ATOM   5040  C  CD1   . LEU C  2  193  ? 50.267  -38.268 47.029  1.00 89.54  ? 193  LEU C CD1   1 
ATOM   5041  C  CD2   . LEU C  2  193  ? 48.405  -39.738 47.814  1.00 94.12  ? 193  LEU C CD2   1 
ATOM   5042  N  N     . VAL C  2  194  ? 48.278  -39.719 42.511  1.00 117.89 ? 194  VAL C N     1 
ATOM   5043  C  CA    . VAL C  2  194  ? 48.600  -40.872 41.673  1.00 112.02 ? 194  VAL C CA    1 
ATOM   5044  C  C     . VAL C  2  194  ? 49.870  -40.617 40.873  1.00 109.82 ? 194  VAL C C     1 
ATOM   5045  O  O     . VAL C  2  194  ? 50.668  -41.531 40.642  1.00 111.66 ? 194  VAL C O     1 
ATOM   5046  C  CB    . VAL C  2  194  ? 47.412  -41.201 40.751  1.00 114.92 ? 194  VAL C CB    1 
ATOM   5047  C  CG1   . VAL C  2  194  ? 47.246  -42.709 40.597  1.00 120.86 ? 194  VAL C CG1   1 
ATOM   5048  C  CG2   . VAL C  2  194  ? 46.141  -40.552 41.278  1.00 121.23 ? 194  VAL C CG2   1 
ATOM   5049  N  N     . LEU C  2  195  ? 50.077  -39.373 40.439  1.00 108.68 ? 195  LEU C N     1 
ATOM   5050  C  CA    . LEU C  2  195  ? 51.263  -39.044 39.652  1.00 107.43 ? 195  LEU C CA    1 
ATOM   5051  C  C     . LEU C  2  195  ? 52.534  -39.226 40.473  1.00 109.04 ? 195  LEU C C     1 
ATOM   5052  O  O     . LEU C  2  195  ? 53.508  -39.842 40.016  1.00 109.32 ? 195  LEU C O     1 
ATOM   5053  C  CB    . LEU C  2  195  ? 51.149  -37.611 39.137  1.00 108.93 ? 195  LEU C CB    1 
ATOM   5054  C  CG    . LEU C  2  195  ? 52.218  -37.107 38.176  1.00 118.47 ? 195  LEU C CG    1 
ATOM   5055  C  CD1   . LEU C  2  195  ? 52.235  -37.954 36.919  1.00 119.06 ? 195  LEU C CD1   1 
ATOM   5056  C  CD2   . LEU C  2  195  ? 51.940  -35.657 37.845  1.00 119.87 ? 195  LEU C CD2   1 
ATOM   5057  N  N     . LEU C  2  196  ? 52.539  -38.696 41.698  1.00 113.98 ? 196  LEU C N     1 
ATOM   5058  C  CA    . LEU C  2  196  ? 53.692  -38.864 42.575  1.00 110.04 ? 196  LEU C CA    1 
ATOM   5059  C  C     . LEU C  2  196  ? 53.897  -40.332 42.931  1.00 107.72 ? 196  LEU C C     1 
ATOM   5060  O  O     . LEU C  2  196  ? 55.038  -40.795 43.047  1.00 108.17 ? 196  LEU C O     1 
ATOM   5061  C  CB    . LEU C  2  196  ? 53.518  -38.011 43.832  1.00 103.61 ? 196  LEU C CB    1 
ATOM   5062  C  CG    . LEU C  2  196  ? 54.732  -37.785 44.739  1.00 100.20 ? 196  LEU C CG    1 
ATOM   5063  C  CD1   . LEU C  2  196  ? 54.801  -38.825 45.846  1.00 102.42 ? 196  LEU C CD1   1 
ATOM   5064  C  CD2   . LEU C  2  196  ? 56.017  -37.782 43.925  1.00 103.72 ? 196  LEU C CD2   1 
ATOM   5065  N  N     . LEU C  2  197  ? 52.805  -41.080 43.108  1.00 108.74 ? 197  LEU C N     1 
ATOM   5066  C  CA    . LEU C  2  197  ? 52.937  -42.516 43.341  1.00 108.00 ? 197  LEU C CA    1 
ATOM   5067  C  C     . LEU C  2  197  ? 53.582  -43.207 42.145  1.00 109.13 ? 197  LEU C C     1 
ATOM   5068  O  O     . LEU C  2  197  ? 54.391  -44.128 42.311  1.00 110.46 ? 197  LEU C O     1 
ATOM   5069  C  CB    . LEU C  2  197  ? 51.570  -43.128 43.647  1.00 109.95 ? 197  LEU C CB    1 
ATOM   5070  C  CG    . LEU C  2  197  ? 50.906  -42.706 44.958  1.00 101.82 ? 197  LEU C CG    1 
ATOM   5071  C  CD1   . LEU C  2  197  ? 49.499  -43.268 45.036  1.00 107.64 ? 197  LEU C CD1   1 
ATOM   5072  C  CD2   . LEU C  2  197  ? 51.731  -43.162 46.150  1.00 100.21 ? 197  LEU C CD2   1 
ATOM   5073  N  N     . ARG C  2  198  ? 53.246  -42.765 40.931  1.00 108.65 ? 198  ARG C N     1 
ATOM   5074  C  CA    . ARG C  2  198  ? 53.830  -43.362 39.734  1.00 111.00 ? 198  ARG C CA    1 
ATOM   5075  C  C     . ARG C  2  198  ? 55.306  -43.013 39.599  1.00 111.00 ? 198  ARG C C     1 
ATOM   5076  O  O     . ARG C  2  198  ? 56.091  -43.830 39.105  1.00 116.38 ? 198  ARG C O     1 
ATOM   5077  C  CB    . ARG C  2  198  ? 53.056  -42.918 38.494  1.00 112.81 ? 198  ARG C CB    1 
ATOM   5078  C  CG    . ARG C  2  198  ? 53.398  -43.703 37.239  1.00 126.41 ? 198  ARG C CG    1 
ATOM   5079  C  CD    . ARG C  2  198  ? 53.379  -45.200 37.512  1.00 131.57 ? 198  ARG C CD    1 
ATOM   5080  N  NE    . ARG C  2  198  ? 53.657  -45.987 36.314  1.00 138.46 ? 198  ARG C NE    1 
ATOM   5081  C  CZ    . ARG C  2  198  ? 53.989  -47.274 36.329  1.00 137.37 ? 198  ARG C CZ    1 
ATOM   5082  N  NH1   . ARG C  2  198  ? 54.223  -47.916 35.192  1.00 135.08 ? 198  ARG C NH1   1 
ATOM   5083  N  NH2   . ARG C  2  198  ? 54.096  -47.918 37.484  1.00 135.45 ? 198  ARG C NH2   1 
ATOM   5084  N  N     . VAL C  2  199  ? 55.704  -41.814 40.030  1.00 109.76 ? 199  VAL C N     1 
ATOM   5085  C  CA    . VAL C  2  199  ? 57.130  -41.493 40.057  1.00 104.23 ? 199  VAL C CA    1 
ATOM   5086  C  C     . VAL C  2  199  ? 57.863  -42.382 41.057  1.00 104.73 ? 199  VAL C C     1 
ATOM   5087  O  O     . VAL C  2  199  ? 59.020  -42.757 40.832  1.00 104.03 ? 199  VAL C O     1 
ATOM   5088  C  CB    . VAL C  2  199  ? 57.334  -39.998 40.369  1.00 99.44  ? 199  VAL C CB    1 
ATOM   5089  C  CG1   . VAL C  2  199  ? 58.815  -39.647 40.380  1.00 96.32  ? 199  VAL C CG1   1 
ATOM   5090  C  CG2   . VAL C  2  199  ? 56.589  -39.143 39.361  1.00 105.83 ? 199  VAL C CG2   1 
ATOM   5091  N  N     . LEU C  2  200  ? 57.206  -42.748 42.162  1.00 110.19 ? 200  LEU C N     1 
ATOM   5092  C  CA    . LEU C  2  200  ? 57.826  -43.582 43.187  1.00 110.25 ? 200  LEU C CA    1 
ATOM   5093  C  C     . LEU C  2  200  ? 57.969  -45.039 42.768  1.00 109.54 ? 200  LEU C C     1 
ATOM   5094  O  O     . LEU C  2  200  ? 58.600  -45.813 43.496  1.00 107.75 ? 200  LEU C O     1 
ATOM   5095  C  CB    . LEU C  2  200  ? 57.019  -43.505 44.487  1.00 108.01 ? 200  LEU C CB    1 
ATOM   5096  C  CG    . LEU C  2  200  ? 57.023  -42.174 45.241  1.00 101.75 ? 200  LEU C CG    1 
ATOM   5097  C  CD1   . LEU C  2  200  ? 56.044  -42.210 46.403  1.00 104.59 ? 200  LEU C CD1   1 
ATOM   5098  C  CD2   . LEU C  2  200  ? 58.421  -41.844 45.731  1.00 104.66 ? 200  LEU C CD2   1 
ATOM   5099  N  N     . GLY C  2  201  ? 57.392  -45.434 41.635  1.00 111.47 ? 201  GLY C N     1 
ATOM   5100  C  CA    . GLY C  2  201  ? 57.490  -46.794 41.152  1.00 116.96 ? 201  GLY C CA    1 
ATOM   5101  C  C     . GLY C  2  201  ? 56.265  -47.654 41.377  1.00 113.60 ? 201  GLY C C     1 
ATOM   5102  O  O     . GLY C  2  201  ? 56.280  -48.830 40.995  1.00 107.09 ? 201  GLY C O     1 
ATOM   5103  N  N     . TYR C  2  202  ? 55.209  -47.113 41.979  1.00 116.33 ? 202  TYR C N     1 
ATOM   5104  C  CA    . TYR C  2  202  ? 54.013  -47.904 42.226  1.00 117.26 ? 202  TYR C CA    1 
ATOM   5105  C  C     . TYR C  2  202  ? 53.290  -48.214 40.921  1.00 116.83 ? 202  TYR C C     1 
ATOM   5106  O  O     . TYR C  2  202  ? 53.319  -47.437 39.963  1.00 116.84 ? 202  TYR C O     1 
ATOM   5107  C  CB    . TYR C  2  202  ? 53.065  -47.173 43.179  1.00 117.95 ? 202  TYR C CB    1 
ATOM   5108  C  CG    . TYR C  2  202  ? 53.508  -47.191 44.624  1.00 110.58 ? 202  TYR C CG    1 
ATOM   5109  C  CD1   . TYR C  2  202  ? 53.396  -48.344 45.388  1.00 114.36 ? 202  TYR C CD1   1 
ATOM   5110  C  CD2   . TYR C  2  202  ? 54.029  -46.054 45.226  1.00 108.12 ? 202  TYR C CD2   1 
ATOM   5111  C  CE1   . TYR C  2  202  ? 53.799  -48.368 46.708  1.00 108.55 ? 202  TYR C CE1   1 
ATOM   5112  C  CE2   . TYR C  2  202  ? 54.434  -46.068 46.547  1.00 109.05 ? 202  TYR C CE2   1 
ATOM   5113  C  CZ    . TYR C  2  202  ? 54.316  -47.228 47.283  1.00 104.37 ? 202  TYR C CZ    1 
ATOM   5114  O  OH    . TYR C  2  202  ? 54.719  -47.251 48.598  1.00 99.95  ? 202  TYR C OH    1 
ATOM   5115  N  N     . ASP C  2  203  ? 52.638  -49.370 40.893  1.00 121.35 ? 203  ASP C N     1 
ATOM   5116  C  CA    . ASP C  2  203  ? 51.810  -49.778 39.773  1.00 127.88 ? 203  ASP C CA    1 
ATOM   5117  C  C     . ASP C  2  203  ? 50.398  -50.045 40.275  1.00 134.45 ? 203  ASP C C     1 
ATOM   5118  O  O     . ASP C  2  203  ? 50.163  -50.179 41.479  1.00 138.25 ? 203  ASP C O     1 
ATOM   5119  C  CB    . ASP C  2  203  ? 52.377  -51.023 39.080  1.00 133.40 ? 203  ASP C CB    1 
ATOM   5120  C  CG    . ASP C  2  203  ? 51.924  -51.144 37.639  1.00 140.97 ? 203  ASP C CG    1 
ATOM   5121  O  OD1   . ASP C  2  203  ? 50.723  -50.929 37.371  1.00 141.93 ? 203  ASP C OD1   1 
ATOM   5122  O  OD2   . ASP C  2  203  ? 52.773  -51.441 36.771  1.00 143.25 ? 203  ASP C OD2   1 
ATOM   5123  N  N     . GLN C  2  204  ? 49.455  -50.115 39.332  1.00 137.22 ? 204  GLN C N     1 
ATOM   5124  C  CA    . GLN C  2  204  ? 48.057  -50.324 39.694  1.00 137.43 ? 204  GLN C CA    1 
ATOM   5125  C  C     . GLN C  2  204  ? 47.866  -51.610 40.492  1.00 141.99 ? 204  GLN C C     1 
ATOM   5126  O  O     . GLN C  2  204  ? 46.975  -51.684 41.345  1.00 138.86 ? 204  GLN C O     1 
ATOM   5127  C  CB    . GLN C  2  204  ? 47.195  -50.334 38.431  1.00 136.97 ? 204  GLN C CB    1 
ATOM   5128  C  CG    . GLN C  2  204  ? 45.701  -50.369 38.685  1.00 135.23 ? 204  GLN C CG    1 
ATOM   5129  C  CD    . GLN C  2  204  ? 44.895  -50.141 37.423  1.00 137.40 ? 204  GLN C CD    1 
ATOM   5130  O  OE1   . GLN C  2  204  ? 45.452  -49.994 36.334  1.00 137.31 ? 204  GLN C OE1   1 
ATOM   5131  N  NE2   . GLN C  2  204  ? 43.575  -50.106 37.562  1.00 141.60 ? 204  GLN C NE2   1 
ATOM   5132  N  N     . GLU C  2  205  ? 48.708  -52.618 40.248  1.00 145.22 ? 205  GLU C N     1 
ATOM   5133  C  CA    . GLU C  2  205  ? 48.609  -53.881 40.974  1.00 145.06 ? 205  GLU C CA    1 
ATOM   5134  C  C     . GLU C  2  205  ? 48.930  -53.695 42.454  1.00 139.45 ? 205  GLU C C     1 
ATOM   5135  O  O     . GLU C  2  205  ? 48.179  -54.150 43.328  1.00 142.66 ? 205  GLU C O     1 
ATOM   5136  C  CB    . GLU C  2  205  ? 49.552  -54.909 40.348  1.00 149.92 ? 205  GLU C CB    1 
ATOM   5137  C  CG    . GLU C  2  205  ? 49.206  -56.357 40.650  1.00 159.03 ? 205  GLU C CG    1 
ATOM   5138  C  CD    . GLU C  2  205  ? 48.542  -57.051 39.473  1.00 161.27 ? 205  GLU C CD    1 
ATOM   5139  O  OE1   . GLU C  2  205  ? 48.387  -56.410 38.412  1.00 150.50 ? 205  GLU C OE1   1 
ATOM   5140  O  OE2   . GLU C  2  205  ? 48.177  -58.239 39.609  1.00 166.89 ? 205  GLU C OE2   1 
ATOM   5141  N  N     . THR C  2  206  ? 50.056  -53.038 42.749  1.00 136.81 ? 206  THR C N     1 
ATOM   5142  C  CA    . THR C  2  206  ? 50.478  -52.863 44.135  1.00 135.94 ? 206  THR C CA    1 
ATOM   5143  C  C     . THR C  2  206  ? 49.488  -51.999 44.908  1.00 138.03 ? 206  THR C C     1 
ATOM   5144  O  O     . THR C  2  206  ? 49.219  -52.253 46.089  1.00 134.73 ? 206  THR C O     1 
ATOM   5145  C  CB    . THR C  2  206  ? 51.878  -52.254 44.180  1.00 128.11 ? 206  THR C CB    1 
ATOM   5146  O  OG1   . THR C  2  206  ? 52.649  -52.751 43.080  1.00 122.09 ? 206  THR C OG1   1 
ATOM   5147  C  CG2   . THR C  2  206  ? 52.579  -52.629 45.475  1.00 127.56 ? 206  THR C CG2   1 
ATOM   5148  N  N     . LEU C  2  207  ? 48.926  -50.978 44.256  1.00 138.71 ? 207  LEU C N     1 
ATOM   5149  C  CA    . LEU C  2  207  ? 47.940  -50.134 44.923  1.00 140.40 ? 207  LEU C CA    1 
ATOM   5150  C  C     . LEU C  2  207  ? 46.620  -50.872 45.118  1.00 137.53 ? 207  LEU C C     1 
ATOM   5151  O  O     . LEU C  2  207  ? 45.953  -50.701 46.145  1.00 136.93 ? 207  LEU C O     1 
ATOM   5152  C  CB    . LEU C  2  207  ? 47.725  -48.846 44.129  1.00 136.15 ? 207  LEU C CB    1 
ATOM   5153  C  CG    . LEU C  2  207  ? 48.954  -47.955 43.924  1.00 126.70 ? 207  LEU C CG    1 
ATOM   5154  C  CD1   . LEU C  2  207  ? 48.568  -46.669 43.211  1.00 124.91 ? 207  LEU C CD1   1 
ATOM   5155  C  CD2   . LEU C  2  207  ? 49.640  -47.654 45.248  1.00 122.52 ? 207  LEU C CD2   1 
ATOM   5156  N  N     . ALA C  2  208  ? 46.227  -51.697 44.143  1.00 139.51 ? 208  ALA C N     1 
ATOM   5157  C  CA    . ALA C  2  208  ? 44.983  -52.446 44.267  1.00 139.42 ? 208  ALA C CA    1 
ATOM   5158  C  C     . ALA C  2  208  ? 45.062  -53.491 45.371  1.00 135.36 ? 208  ALA C C     1 
ATOM   5159  O  O     . ALA C  2  208  ? 44.057  -53.762 46.038  1.00 127.83 ? 208  ALA C O     1 
ATOM   5160  C  CB    . ALA C  2  208  ? 44.630  -53.104 42.932  1.00 140.61 ? 208  ALA C CB    1 
ATOM   5161  N  N     . ARG C  2  209  ? 46.235  -54.093 45.578  1.00 135.71 ? 209  ARG C N     1 
ATOM   5162  C  CA    . ARG C  2  209  ? 46.358  -55.051 46.674  1.00 131.77 ? 209  ARG C CA    1 
ATOM   5163  C  C     . ARG C  2  209  ? 46.543  -54.350 48.018  1.00 139.54 ? 209  ARG C C     1 
ATOM   5164  O  O     . ARG C  2  209  ? 45.948  -54.763 49.019  1.00 148.05 ? 209  ARG C O     1 
ATOM   5165  C  CB    . ARG C  2  209  ? 47.508  -56.026 46.412  1.00 132.52 ? 209  ARG C CB    1 
ATOM   5166  C  CG    . ARG C  2  209  ? 48.843  -55.365 46.136  1.00 142.13 ? 209  ARG C CG    1 
ATOM   5167  C  CD    . ARG C  2  209  ? 49.954  -56.377 45.929  1.00 140.52 ? 209  ARG C CD    1 
ATOM   5168  N  NE    . ARG C  2  209  ? 50.298  -57.061 47.171  1.00 145.73 ? 209  ARG C NE    1 
ATOM   5169  C  CZ    . ARG C  2  209  ? 51.101  -56.557 48.103  1.00 143.22 ? 209  ARG C CZ    1 
ATOM   5170  N  NH1   . ARG C  2  209  ? 51.643  -55.358 47.940  1.00 139.13 ? 209  ARG C NH1   1 
ATOM   5171  N  NH2   . ARG C  2  209  ? 51.359  -57.252 49.203  1.00 142.13 ? 209  ARG C NH2   1 
ATOM   5172  N  N     . GLU C  2  210  ? 47.343  -53.281 48.059  1.00 136.89 ? 210  GLU C N     1 
ATOM   5173  C  CA    . GLU C  2  210  ? 47.678  -52.653 49.335  1.00 136.81 ? 210  GLU C CA    1 
ATOM   5174  C  C     . GLU C  2  210  ? 46.485  -51.904 49.921  1.00 133.39 ? 210  GLU C C     1 
ATOM   5175  O  O     . GLU C  2  210  ? 46.182  -52.036 51.113  1.00 130.74 ? 210  GLU C O     1 
ATOM   5176  C  CB    . GLU C  2  210  ? 48.868  -51.713 49.155  1.00 134.03 ? 210  GLU C CB    1 
ATOM   5177  C  CG    . GLU C  2  210  ? 49.658  -51.463 50.427  1.00 139.01 ? 210  GLU C CG    1 
ATOM   5178  C  CD    . GLU C  2  210  ? 50.579  -52.617 50.773  1.00 143.38 ? 210  GLU C CD    1 
ATOM   5179  O  OE1   . GLU C  2  210  ? 50.813  -53.478 49.897  1.00 135.51 ? 210  GLU C OE1   1 
ATOM   5180  O  OE2   . GLU C  2  210  ? 51.069  -52.659 51.921  1.00 144.83 ? 210  GLU C OE2   1 
ATOM   5181  N  N     . LEU C  2  211  ? 45.803  -51.106 49.103  1.00 131.21 ? 211  LEU C N     1 
ATOM   5182  C  CA    . LEU C  2  211  ? 44.702  -50.271 49.565  1.00 131.00 ? 211  LEU C CA    1 
ATOM   5183  C  C     . LEU C  2  211  ? 43.332  -50.850 49.239  1.00 130.61 ? 211  LEU C C     1 
ATOM   5184  O  O     . LEU C  2  211  ? 42.321  -50.281 49.661  1.00 126.88 ? 211  LEU C O     1 
ATOM   5185  C  CB    . LEU C  2  211  ? 44.817  -48.865 48.965  1.00 123.27 ? 211  LEU C CB    1 
ATOM   5186  C  CG    . LEU C  2  211  ? 46.124  -48.109 49.216  1.00 119.15 ? 211  LEU C CG    1 
ATOM   5187  C  CD1   . LEU C  2  211  ? 47.107  -48.318 48.075  1.00 131.59 ? 211  LEU C CD1   1 
ATOM   5188  C  CD2   . LEU C  2  211  ? 45.846  -46.636 49.421  1.00 107.76 ? 211  LEU C CD2   1 
ATOM   5189  N  N     . GLY C  2  212  ? 43.273  -51.974 48.523  1.00 134.27 ? 212  GLY C N     1 
ATOM   5190  C  CA    . GLY C  2  212  ? 42.013  -52.522 48.047  1.00 136.55 ? 212  GLY C CA    1 
ATOM   5191  C  C     . GLY C  2  212  ? 41.024  -52.896 49.133  1.00 134.92 ? 212  GLY C C     1 
ATOM   5192  O  O     . GLY C  2  212  ? 39.845  -53.102 48.821  1.00 133.35 ? 212  GLY C O     1 
ATOM   5193  N  N     . ALA C  2  213  ? 41.463  -52.986 50.391  1.00 131.14 ? 213  ALA C N     1 
ATOM   5194  C  CA    . ALA C  2  213  ? 40.537  -53.320 51.472  1.00 134.37 ? 213  ALA C CA    1 
ATOM   5195  C  C     . ALA C  2  213  ? 39.410  -52.299 51.586  1.00 135.03 ? 213  ALA C C     1 
ATOM   5196  O  O     . ALA C  2  213  ? 38.311  -52.637 52.038  1.00 132.41 ? 213  ALA C O     1 
ATOM   5197  C  CB    . ALA C  2  213  ? 41.294  -53.431 52.795  1.00 125.60 ? 213  ALA C CB    1 
ATOM   5198  N  N     . TYR C  2  214  ? 39.662  -51.054 51.183  1.00 135.69 ? 214  TYR C N     1 
ATOM   5199  C  CA    . TYR C  2  214  ? 38.664  -49.990 51.218  1.00 132.13 ? 214  TYR C CA    1 
ATOM   5200  C  C     . TYR C  2  214  ? 38.188  -49.746 49.790  1.00 134.84 ? 214  TYR C C     1 
ATOM   5201  O  O     . TYR C  2  214  ? 38.933  -49.212 48.962  1.00 137.58 ? 214  TYR C O     1 
ATOM   5202  C  CB    . TYR C  2  214  ? 39.256  -48.730 51.844  1.00 119.91 ? 214  TYR C CB    1 
ATOM   5203  C  CG    . TYR C  2  214  ? 40.283  -49.049 52.908  1.00 118.49 ? 214  TYR C CG    1 
ATOM   5204  C  CD1   . TYR C  2  214  ? 39.893  -49.500 54.164  1.00 116.55 ? 214  TYR C CD1   1 
ATOM   5205  C  CD2   . TYR C  2  214  ? 41.642  -48.922 52.650  1.00 117.55 ? 214  TYR C CD2   1 
ATOM   5206  C  CE1   . TYR C  2  214  ? 40.829  -49.805 55.138  1.00 115.54 ? 214  TYR C CE1   1 
ATOM   5207  C  CE2   . TYR C  2  214  ? 42.587  -49.225 53.617  1.00 116.57 ? 214  TYR C CE2   1 
ATOM   5208  C  CZ    . TYR C  2  214  ? 42.174  -49.665 54.860  1.00 117.73 ? 214  TYR C CZ    1 
ATOM   5209  O  OH    . TYR C  2  214  ? 43.109  -49.967 55.826  1.00 111.44 ? 214  TYR C OH    1 
ATOM   5210  N  N     . GLY C  2  215  ? 36.947  -50.134 49.508  1.00 132.26 ? 215  GLY C N     1 
ATOM   5211  C  CA    . GLY C  2  215  ? 36.450  -50.208 48.148  1.00 134.03 ? 215  GLY C CA    1 
ATOM   5212  C  C     . GLY C  2  215  ? 36.325  -48.902 47.388  1.00 138.33 ? 215  GLY C C     1 
ATOM   5213  O  O     . GLY C  2  215  ? 36.936  -48.740 46.328  1.00 141.01 ? 215  GLY C O     1 
ATOM   5214  N  N     . GLU C  2  216  ? 35.540  -47.962 47.915  1.00 134.44 ? 216  GLU C N     1 
ATOM   5215  C  CA    . GLU C  2  216  ? 35.141  -46.798 47.128  1.00 134.09 ? 216  GLU C CA    1 
ATOM   5216  C  C     . GLU C  2  216  ? 36.273  -45.803 46.901  1.00 134.94 ? 216  GLU C C     1 
ATOM   5217  O  O     . GLU C  2  216  ? 36.191  -44.999 45.966  1.00 136.34 ? 216  GLU C O     1 
ATOM   5218  C  CB    . GLU C  2  216  ? 33.965  -46.095 47.804  1.00 132.49 ? 216  GLU C CB    1 
ATOM   5219  C  CG    . GLU C  2  216  ? 32.599  -46.520 47.285  1.00 139.58 ? 216  GLU C CG    1 
ATOM   5220  C  CD    . GLU C  2  216  ? 32.515  -48.006 46.980  1.00 143.53 ? 216  GLU C CD    1 
ATOM   5221  O  OE1   . GLU C  2  216  ? 32.195  -48.358 45.825  1.00 146.26 ? 216  GLU C OE1   1 
ATOM   5222  O  OE2   . GLU C  2  216  ? 32.771  -48.823 47.890  1.00 139.96 ? 216  GLU C OE2   1 
ATOM   5223  N  N     . LEU C  2  217  ? 37.323  -45.834 47.720  1.00 133.08 ? 217  LEU C N     1 
ATOM   5224  C  CA    . LEU C  2  217  ? 38.353  -44.804 47.632  1.00 125.29 ? 217  LEU C CA    1 
ATOM   5225  C  C     . LEU C  2  217  ? 39.402  -45.133 46.573  1.00 128.46 ? 217  LEU C C     1 
ATOM   5226  O  O     . LEU C  2  217  ? 39.858  -44.242 45.843  1.00 132.35 ? 217  LEU C O     1 
ATOM   5227  C  CB    . LEU C  2  217  ? 39.006  -44.621 49.001  1.00 122.76 ? 217  LEU C CB    1 
ATOM   5228  C  CG    . LEU C  2  217  ? 38.015  -44.468 50.161  1.00 119.35 ? 217  LEU C CG    1 
ATOM   5229  C  CD1   . LEU C  2  217  ? 38.729  -44.509 51.500  1.00 107.40 ? 217  LEU C CD1   1 
ATOM   5230  C  CD2   . LEU C  2  217  ? 37.211  -43.183 50.022  1.00 114.99 ? 217  LEU C CD2   1 
ATOM   5231  N  N     . VAL C  2  218  ? 39.790  -46.407 46.468  1.00 130.37 ? 218  VAL C N     1 
ATOM   5232  C  CA    . VAL C  2  218  ? 40.862  -46.781 45.549  1.00 132.47 ? 218  VAL C CA    1 
ATOM   5233  C  C     . VAL C  2  218  ? 40.440  -46.545 44.104  1.00 134.90 ? 218  VAL C C     1 
ATOM   5234  O  O     . VAL C  2  218  ? 41.261  -46.171 43.258  1.00 135.58 ? 218  VAL C O     1 
ATOM   5235  C  CB    . VAL C  2  218  ? 41.285  -48.241 45.788  1.00 135.25 ? 218  VAL C CB    1 
ATOM   5236  C  CG1   . VAL C  2  218  ? 42.509  -48.587 44.950  1.00 132.68 ? 218  VAL C CG1   1 
ATOM   5237  C  CG2   . VAL C  2  218  ? 41.566  -48.462 47.259  1.00 132.13 ? 218  VAL C CG2   1 
ATOM   5238  N  N     . GLN C  2  219  ? 39.156  -46.751 43.795  1.00 139.12 ? 219  GLN C N     1 
ATOM   5239  C  CA    . GLN C  2  219  ? 38.679  -46.491 42.439  1.00 142.97 ? 219  GLN C CA    1 
ATOM   5240  C  C     . GLN C  2  219  ? 38.827  -45.018 42.079  1.00 139.94 ? 219  GLN C C     1 
ATOM   5241  O  O     . GLN C  2  219  ? 39.160  -44.681 40.936  1.00 141.89 ? 219  GLN C O     1 
ATOM   5242  C  CB    . GLN C  2  219  ? 37.228  -46.944 42.289  1.00 146.54 ? 219  GLN C CB    1 
ATOM   5243  C  CG    . GLN C  2  219  ? 37.076  -48.325 41.658  1.00 153.73 ? 219  GLN C CG    1 
ATOM   5244  C  CD    . GLN C  2  219  ? 37.628  -49.436 42.532  1.00 155.65 ? 219  GLN C CD    1 
ATOM   5245  O  OE1   . GLN C  2  219  ? 37.206  -49.608 43.676  1.00 151.42 ? 219  GLN C OE1   1 
ATOM   5246  N  NE2   . GLN C  2  219  ? 38.578  -50.196 41.997  1.00 148.22 ? 219  GLN C NE2   1 
ATOM   5247  N  N     . GLY C  2  220  ? 38.592  -44.125 43.043  1.00 135.04 ? 220  GLY C N     1 
ATOM   5248  C  CA    . GLY C  2  220  ? 38.913  -42.726 42.830  1.00 132.89 ? 220  GLY C CA    1 
ATOM   5249  C  C     . GLY C  2  220  ? 40.402  -42.485 42.699  1.00 133.63 ? 220  GLY C C     1 
ATOM   5250  O  O     . GLY C  2  220  ? 40.827  -41.563 41.996  1.00 133.58 ? 220  GLY C O     1 
ATOM   5251  N  N     . LEU C  2  221  ? 41.216  -43.306 43.370  1.00 133.77 ? 221  LEU C N     1 
ATOM   5252  C  CA    . LEU C  2  221  ? 42.666  -43.177 43.237  1.00 126.24 ? 221  LEU C CA    1 
ATOM   5253  C  C     . LEU C  2  221  ? 43.126  -43.512 41.820  1.00 132.21 ? 221  LEU C C     1 
ATOM   5254  O  O     . LEU C  2  221  ? 44.063  -42.891 41.306  1.00 135.56 ? 221  LEU C O     1 
ATOM   5255  C  CB    . LEU C  2  221  ? 43.365  -44.077 44.259  1.00 120.49 ? 221  LEU C CB    1 
ATOM   5256  C  CG    . LEU C  2  221  ? 44.805  -43.814 44.714  1.00 114.72 ? 221  LEU C CG    1 
ATOM   5257  C  CD1   . LEU C  2  221  ? 45.100  -44.629 45.962  1.00 111.44 ? 221  LEU C CD1   1 
ATOM   5258  C  CD2   . LEU C  2  221  ? 45.822  -44.144 43.637  1.00 122.94 ? 221  LEU C CD2   1 
ATOM   5259  N  N     . MET C  2  222  ? 42.473  -44.477 41.173  1.00 136.27 ? 222  MET C N     1 
ATOM   5260  C  CA    . MET C  2  222  ? 42.945  -44.995 39.894  1.00 133.31 ? 222  MET C CA    1 
ATOM   5261  C  C     . MET C  2  222  ? 42.848  -43.943 38.795  1.00 137.01 ? 222  MET C C     1 
ATOM   5262  O  O     . MET C  2  222  ? 41.795  -43.329 38.595  1.00 135.57 ? 222  MET C O     1 
ATOM   5263  C  CB    . MET C  2  222  ? 42.139  -46.230 39.491  1.00 131.27 ? 222  MET C CB    1 
ATOM   5264  C  CG    . MET C  2  222  ? 42.181  -47.384 40.482  1.00 138.67 ? 222  MET C CG    1 
ATOM   5265  S  SD    . MET C  2  222  ? 43.803  -48.146 40.668  1.00 144.53 ? 222  MET C SD    1 
ATOM   5266  C  CE    . MET C  2  222  ? 43.359  -49.665 41.510  1.00 135.01 ? 222  MET C CE    1 
ATOM   5267  N  N     . ASP C  2  223  ? 43.951  -43.746 38.073  1.00 139.50 ? 223  ASP C N     1 
ATOM   5268  C  CA    . ASP C  2  223  ? 43.979  -42.911 36.877  1.00 139.48 ? 223  ASP C CA    1 
ATOM   5269  C  C     . ASP C  2  223  ? 44.726  -43.670 35.790  1.00 140.85 ? 223  ASP C C     1 
ATOM   5270  O  O     . ASP C  2  223  ? 45.928  -43.925 35.922  1.00 139.51 ? 223  ASP C O     1 
ATOM   5271  C  CB    . ASP C  2  223  ? 44.636  -41.555 37.155  1.00 135.50 ? 223  ASP C CB    1 
ATOM   5272  C  CG    . ASP C  2  223  ? 44.454  -40.572 36.011  1.00 134.98 ? 223  ASP C CG    1 
ATOM   5273  O  OD1   . ASP C  2  223  ? 45.135  -40.719 34.974  1.00 135.34 ? 223  ASP C OD1   1 
ATOM   5274  O  OD2   . ASP C  2  223  ? 43.612  -39.659 36.143  1.00 133.26 ? 223  ASP C OD2   1 
ATOM   5275  N  N     . GLU C  2  224  ? 44.012  -44.021 34.718  1.00 142.62 ? 224  GLU C N     1 
ATOM   5276  C  CA    . GLU C  2  224  ? 44.564  -44.917 33.705  1.00 139.83 ? 224  GLU C CA    1 
ATOM   5277  C  C     . GLU C  2  224  ? 45.752  -44.292 32.979  1.00 140.89 ? 224  GLU C C     1 
ATOM   5278  O  O     . GLU C  2  224  ? 46.762  -44.965 32.735  1.00 139.83 ? 224  GLU C O     1 
ATOM   5279  C  CB    . GLU C  2  224  ? 43.471  -45.312 32.710  1.00 143.80 ? 224  GLU C CB    1 
ATOM   5280  C  CG    . GLU C  2  224  ? 42.585  -44.156 32.253  1.00 146.35 ? 224  GLU C CG    1 
ATOM   5281  C  CD    . GLU C  2  224  ? 41.436  -43.876 33.209  1.00 148.35 ? 224  GLU C CD    1 
ATOM   5282  O  OE1   . GLU C  2  224  ? 40.307  -44.332 32.934  1.00 147.50 ? 224  GLU C OE1   1 
ATOM   5283  O  OE2   . GLU C  2  224  ? 41.667  -43.209 34.240  1.00 145.24 ? 224  GLU C OE2   1 
ATOM   5284  N  N     . SER C  2  225  ? 45.648  -43.010 32.616  1.00 140.68 ? 225  SER C N     1 
ATOM   5285  C  CA    . SER C  2  225  ? 46.729  -42.362 31.880  1.00 136.03 ? 225  SER C CA    1 
ATOM   5286  C  C     . SER C  2  225  ? 48.010  -42.298 32.702  1.00 136.39 ? 225  SER C C     1 
ATOM   5287  O  O     . SER C  2  225  ? 49.110  -42.285 32.137  1.00 132.18 ? 225  SER C O     1 
ATOM   5288  C  CB    . SER C  2  225  ? 46.305  -40.958 31.454  1.00 131.72 ? 225  SER C CB    1 
ATOM   5289  O  OG    . SER C  2  225  ? 45.984  -40.164 32.581  1.00 129.57 ? 225  SER C OG    1 
ATOM   5290  N  N     . VAL C  2  226  ? 47.891  -42.256 34.031  1.00 142.48 ? 226  VAL C N     1 
ATOM   5291  C  CA    . VAL C  2  226  ? 49.075  -42.191 34.881  1.00 139.65 ? 226  VAL C CA    1 
ATOM   5292  C  C     . VAL C  2  226  ? 49.795  -43.535 34.895  1.00 138.84 ? 226  VAL C C     1 
ATOM   5293  O  O     . VAL C  2  226  ? 51.023  -43.600 34.771  1.00 142.70 ? 226  VAL C O     1 
ATOM   5294  C  CB    . VAL C  2  226  ? 48.692  -41.738 36.301  1.00 132.67 ? 226  VAL C CB    1 
ATOM   5295  C  CG1   . VAL C  2  226  ? 49.914  -41.735 37.201  1.00 126.92 ? 226  VAL C CG1   1 
ATOM   5296  C  CG2   . VAL C  2  226  ? 48.054  -40.359 36.261  1.00 128.33 ? 226  VAL C CG2   1 
ATOM   5297  N  N     . PHE C  2  227  ? 49.043  -44.628 35.049  1.00 138.49 ? 227  PHE C N     1 
ATOM   5298  C  CA    . PHE C  2  227  ? 49.656  -45.951 35.020  1.00 140.19 ? 227  PHE C CA    1 
ATOM   5299  C  C     . PHE C  2  227  ? 50.136  -46.333 33.627  1.00 137.60 ? 227  PHE C C     1 
ATOM   5300  O  O     . PHE C  2  227  ? 51.015  -47.193 33.503  1.00 132.92 ? 227  PHE C O     1 
ATOM   5301  C  CB    . PHE C  2  227  ? 48.675  -47.003 35.539  1.00 139.59 ? 227  PHE C CB    1 
ATOM   5302  C  CG    . PHE C  2  227  ? 48.297  -46.819 36.980  1.00 138.13 ? 227  PHE C CG    1 
ATOM   5303  C  CD1   . PHE C  2  227  ? 49.229  -47.018 37.985  1.00 133.41 ? 227  PHE C CD1   1 
ATOM   5304  C  CD2   . PHE C  2  227  ? 47.007  -46.457 37.331  1.00 140.15 ? 227  PHE C CD2   1 
ATOM   5305  C  CE1   . PHE C  2  227  ? 48.884  -46.851 39.312  1.00 133.62 ? 227  PHE C CE1   1 
ATOM   5306  C  CE2   . PHE C  2  227  ? 46.654  -46.288 38.657  1.00 138.61 ? 227  PHE C CE2   1 
ATOM   5307  C  CZ    . PHE C  2  227  ? 47.593  -46.486 39.648  1.00 138.13 ? 227  PHE C CZ    1 
ATOM   5308  N  N     . ALA C  2  228  ? 49.580  -45.718 32.580  1.00 137.31 ? 228  ALA C N     1 
ATOM   5309  C  CA    . ALA C  2  228  ? 50.027  -46.023 31.225  1.00 137.54 ? 228  ALA C CA    1 
ATOM   5310  C  C     . ALA C  2  228  ? 51.472  -45.588 31.007  1.00 137.47 ? 228  ALA C C     1 
ATOM   5311  O  O     . ALA C  2  228  ? 52.241  -46.282 30.332  1.00 138.33 ? 228  ALA C O     1 
ATOM   5312  C  CB    . ALA C  2  228  ? 49.104  -45.356 30.206  1.00 135.09 ? 228  ALA C CB    1 
ATOM   5313  N  N     . MET C  2  229  ? 51.860  -44.447 31.570  1.00 137.45 ? 229  MET C N     1 
ATOM   5314  C  CA    . MET C  2  229  ? 53.204  -43.914 31.388  1.00 138.13 ? 229  MET C CA    1 
ATOM   5315  C  C     . MET C  2  229  ? 54.151  -44.434 32.463  1.00 137.14 ? 229  MET C C     1 
ATOM   5316  O  O     . MET C  2  229  ? 53.767  -44.599 33.625  1.00 130.15 ? 229  MET C O     1 
ATOM   5317  C  CB    . MET C  2  229  ? 53.182  -42.385 31.401  1.00 141.42 ? 229  MET C CB    1 
ATOM   5318  C  CG    . MET C  2  229  ? 52.420  -41.770 32.562  1.00 140.68 ? 229  MET C CG    1 
ATOM   5319  S  SD    . MET C  2  229  ? 52.452  -39.968 32.507  1.00 138.64 ? 229  MET C SD    1 
ATOM   5320  C  CE    . MET C  2  229  ? 51.283  -39.557 33.796  1.00 135.81 ? 229  MET C CE    1 
ATOM   5321  N  N     . ARG C  2  230  ? 55.395  -44.691 32.061  1.00 141.23 ? 230  ARG C N     1 
ATOM   5322  C  CA    . ARG C  2  230  ? 56.406  -45.189 32.978  1.00 142.06 ? 230  ARG C CA    1 
ATOM   5323  C  C     . ARG C  2  230  ? 56.873  -44.078 33.919  1.00 136.40 ? 230  ARG C C     1 
ATOM   5324  O  O     . ARG C  2  230  ? 56.646  -42.894 33.656  1.00 135.12 ? 230  ARG C O     1 
ATOM   5325  C  CB    . ARG C  2  230  ? 57.587  -45.768 32.197  1.00 138.83 ? 230  ARG C CB    1 
ATOM   5326  C  CG    . ARG C  2  230  ? 57.904  -45.050 30.898  1.00 135.41 ? 230  ARG C CG    1 
ATOM   5327  C  CD    . ARG C  2  230  ? 59.084  -45.704 30.199  1.00 137.94 ? 230  ARG C CD    1 
ATOM   5328  N  NE    . ARG C  2  230  ? 59.258  -45.205 28.838  1.00 141.67 ? 230  ARG C NE    1 
ATOM   5329  C  CZ    . ARG C  2  230  ? 59.989  -44.144 28.518  1.00 140.21 ? 230  ARG C CZ    1 
ATOM   5330  N  NH1   . ARG C  2  230  ? 60.088  -43.763 27.251  1.00 140.68 ? 230  ARG C NH1   1 
ATOM   5331  N  NH2   . ARG C  2  230  ? 60.622  -43.462 29.461  1.00 133.99 ? 230  ARG C NH2   1 
ATOM   5332  N  N     . PRO C  2  231  ? 57.510  -44.444 35.039  1.00 131.66 ? 231  PRO C N     1 
ATOM   5333  C  CA    . PRO C  2  231  ? 57.950  -43.428 36.013  1.00 128.11 ? 231  PRO C CA    1 
ATOM   5334  C  C     . PRO C  2  231  ? 58.722  -42.249 35.429  1.00 130.81 ? 231  PRO C C     1 
ATOM   5335  O  O     . PRO C  2  231  ? 58.656  -41.154 35.999  1.00 131.26 ? 231  PRO C O     1 
ATOM   5336  C  CB    . PRO C  2  231  ? 58.822  -44.237 36.989  1.00 125.53 ? 231  PRO C CB    1 
ATOM   5337  C  CG    . PRO C  2  231  ? 58.696  -45.699 36.573  1.00 126.35 ? 231  PRO C CG    1 
ATOM   5338  C  CD    . PRO C  2  231  ? 57.551  -45.793 35.624  1.00 131.53 ? 231  PRO C CD    1 
ATOM   5339  N  N     . GLU C  2  232  ? 59.442  -42.418 34.318  1.00 130.13 ? 232  GLU C N     1 
ATOM   5340  C  CA    . GLU C  2  232  ? 60.182  -41.292 33.751  1.00 126.61 ? 232  GLU C CA    1 
ATOM   5341  C  C     . GLU C  2  232  ? 59.232  -40.242 33.186  1.00 125.35 ? 232  GLU C C     1 
ATOM   5342  O  O     . GLU C  2  232  ? 59.396  -39.036 33.426  1.00 126.55 ? 232  GLU C O     1 
ATOM   5343  C  CB    . GLU C  2  232  ? 61.144  -41.783 32.668  1.00 134.83 ? 232  GLU C CB    1 
ATOM   5344  C  CG    . GLU C  2  232  ? 61.345  -43.295 32.624  1.00 139.40 ? 232  GLU C CG    1 
ATOM   5345  C  CD    . GLU C  2  232  ? 62.107  -43.832 33.822  1.00 139.51 ? 232  GLU C CD    1 
ATOM   5346  O  OE1   . GLU C  2  232  ? 61.684  -44.868 34.381  1.00 136.35 ? 232  GLU C OE1   1 
ATOM   5347  O  OE2   . GLU C  2  232  ? 63.125  -43.217 34.204  1.00 139.25 ? 232  GLU C OE2   1 
ATOM   5348  N  N     . GLU C  2  233  ? 58.225  -40.686 32.431  1.00 128.07 ? 233  GLU C N     1 
ATOM   5349  C  CA    . GLU C  2  233  ? 57.245  -39.757 31.882  1.00 130.52 ? 233  GLU C CA    1 
ATOM   5350  C  C     . GLU C  2  233  ? 56.416  -39.116 32.988  1.00 130.97 ? 233  GLU C C     1 
ATOM   5351  O  O     . GLU C  2  233  ? 56.087  -37.927 32.912  1.00 132.74 ? 233  GLU C O     1 
ATOM   5352  C  CB    . GLU C  2  233  ? 56.347  -40.479 30.878  1.00 135.20 ? 233  GLU C CB    1 
ATOM   5353  C  CG    . GLU C  2  233  ? 57.113  -41.277 29.832  1.00 140.92 ? 233  GLU C CG    1 
ATOM   5354  C  CD    . GLU C  2  233  ? 56.199  -42.042 28.895  1.00 140.03 ? 233  GLU C CD    1 
ATOM   5355  O  OE1   . GLU C  2  233  ? 55.000  -41.699 28.822  1.00 138.27 ? 233  GLU C OE1   1 
ATOM   5356  O  OE2   . GLU C  2  233  ? 56.677  -42.988 28.235  1.00 139.65 ? 233  GLU C OE2   1 
ATOM   5357  N  N     . ALA C  2  234  ? 56.081  -39.881 34.031  1.00 132.20 ? 234  ALA C N     1 
ATOM   5358  C  CA    . ALA C  2  234  ? 55.367  -39.302 35.165  1.00 128.02 ? 234  ALA C CA    1 
ATOM   5359  C  C     . ALA C  2  234  ? 56.222  -38.271 35.890  1.00 124.31 ? 234  ALA C C     1 
ATOM   5360  O  O     . ALA C  2  234  ? 55.700  -37.262 36.374  1.00 122.63 ? 234  ALA C O     1 
ATOM   5361  C  CB    . ALA C  2  234  ? 54.919  -40.402 36.128  1.00 121.67 ? 234  ALA C CB    1 
ATOM   5362  N  N     . LEU C  2  235  ? 57.536  -38.495 35.955  1.00 124.97 ? 235  LEU C N     1 
ATOM   5363  C  CA    . LEU C  2  235  ? 58.434  -37.527 36.576  1.00 122.17 ? 235  LEU C CA    1 
ATOM   5364  C  C     . LEU C  2  235  ? 58.483  -36.231 35.775  1.00 121.57 ? 235  LEU C C     1 
ATOM   5365  O  O     . LEU C  2  235  ? 58.401  -35.133 36.343  1.00 120.71 ? 235  LEU C O     1 
ATOM   5366  C  CB    . LEU C  2  235  ? 59.829  -38.136 36.711  1.00 120.35 ? 235  LEU C CB    1 
ATOM   5367  C  CG    . LEU C  2  235  ? 60.942  -37.269 37.293  1.00 113.52 ? 235  LEU C CG    1 
ATOM   5368  C  CD1   . LEU C  2  235  ? 60.615  -36.876 38.717  1.00 115.50 ? 235  LEU C CD1   1 
ATOM   5369  C  CD2   . LEU C  2  235  ? 62.254  -38.023 37.236  1.00 117.82 ? 235  LEU C CD2   1 
ATOM   5370  N  N     . ILE C  2  236  ? 58.620  -36.340 34.450  1.00 124.26 ? 236  ILE C N     1 
ATOM   5371  C  CA    . ILE C  2  236  ? 58.617  -35.146 33.602  1.00 120.97 ? 236  ILE C CA    1 
ATOM   5372  C  C     . ILE C  2  236  ? 57.283  -34.408 33.717  1.00 121.46 ? 236  ILE C C     1 
ATOM   5373  O  O     . ILE C  2  236  ? 57.241  -33.173 33.806  1.00 120.51 ? 236  ILE C O     1 
ATOM   5374  C  CB    . ILE C  2  236  ? 58.942  -35.525 32.145  1.00 113.55 ? 236  ILE C CB    1 
ATOM   5375  C  CG1   . ILE C  2  236  ? 60.402  -35.971 32.022  1.00 109.21 ? 236  ILE C CG1   1 
ATOM   5376  C  CG2   . ILE C  2  236  ? 58.664  -34.363 31.204  1.00 114.67 ? 236  ILE C CG2   1 
ATOM   5377  C  CD1   . ILE C  2  236  ? 60.813  -36.342 30.614  1.00 117.65 ? 236  ILE C CD1   1 
ATOM   5378  N  N     . ARG C  2  237  ? 56.174  -35.155 33.738  1.00 122.38 ? 237  ARG C N     1 
ATOM   5379  C  CA    . ARG C  2  237  ? 54.850  -34.549 33.870  1.00 123.75 ? 237  ARG C CA    1 
ATOM   5380  C  C     . ARG C  2  237  ? 54.697  -33.824 35.204  1.00 123.91 ? 237  ARG C C     1 
ATOM   5381  O  O     . ARG C  2  237  ? 54.160  -32.709 35.260  1.00 125.06 ? 237  ARG C O     1 
ATOM   5382  C  CB    . ARG C  2  237  ? 53.782  -35.629 33.710  1.00 122.33 ? 237  ARG C CB    1 
ATOM   5383  C  CG    . ARG C  2  237  ? 52.417  -35.280 34.272  1.00 126.40 ? 237  ARG C CG    1 
ATOM   5384  C  CD    . ARG C  2  237  ? 51.637  -34.363 33.350  1.00 131.20 ? 237  ARG C CD    1 
ATOM   5385  N  NE    . ARG C  2  237  ? 50.262  -34.191 33.813  1.00 136.92 ? 237  ARG C NE    1 
ATOM   5386  C  CZ    . ARG C  2  237  ? 49.328  -33.520 33.148  1.00 133.91 ? 237  ARG C CZ    1 
ATOM   5387  N  NH1   . ARG C  2  237  ? 48.103  -33.417 33.646  1.00 125.34 ? 237  ARG C NH1   1 
ATOM   5388  N  NH2   . ARG C  2  237  ? 49.617  -32.953 31.985  1.00 134.91 ? 237  ARG C NH2   1 
ATOM   5389  N  N     . LEU C  2  238  ? 55.160  -34.439 36.293  1.00 121.02 ? 238  LEU C N     1 
ATOM   5390  C  CA    . LEU C  2  238  ? 55.072  -33.791 37.596  1.00 118.91 ? 238  LEU C CA    1 
ATOM   5391  C  C     . LEU C  2  238  ? 55.936  -32.537 37.644  1.00 118.29 ? 238  LEU C C     1 
ATOM   5392  O  O     . LEU C  2  238  ? 55.541  -31.526 38.237  1.00 120.06 ? 238  LEU C O     1 
ATOM   5393  C  CB    . LEU C  2  238  ? 55.470  -34.773 38.696  1.00 118.05 ? 238  LEU C CB    1 
ATOM   5394  C  CG    . LEU C  2  238  ? 55.316  -34.297 40.140  1.00 117.11 ? 238  LEU C CG    1 
ATOM   5395  C  CD1   . LEU C  2  238  ? 53.896  -33.816 40.410  1.00 108.08 ? 238  LEU C CD1   1 
ATOM   5396  C  CD2   . LEU C  2  238  ? 55.695  -35.416 41.091  1.00 111.36 ? 238  LEU C CD2   1 
ATOM   5397  N  N     . PHE C  2  239  ? 57.117  -32.578 37.019  1.00 117.84 ? 239  PHE C N     1 
ATOM   5398  C  CA    . PHE C  2  239  ? 57.962  -31.388 36.981  1.00 112.96 ? 239  PHE C CA    1 
ATOM   5399  C  C     . PHE C  2  239  ? 57.298  -30.270 36.187  1.00 112.90 ? 239  PHE C C     1 
ATOM   5400  O  O     . PHE C  2  239  ? 57.443  -29.089 36.524  1.00 110.95 ? 239  PHE C O     1 
ATOM   5401  C  CB    . PHE C  2  239  ? 59.330  -31.723 36.391  1.00 110.57 ? 239  PHE C CB    1 
ATOM   5402  C  CG    . PHE C  2  239  ? 60.279  -30.557 36.364  1.00 111.71 ? 239  PHE C CG    1 
ATOM   5403  C  CD1   . PHE C  2  239  ? 61.048  -30.247 37.473  1.00 109.64 ? 239  PHE C CD1   1 
ATOM   5404  C  CD2   . PHE C  2  239  ? 60.403  -29.772 35.228  1.00 122.05 ? 239  PHE C CD2   1 
ATOM   5405  C  CE1   . PHE C  2  239  ? 61.924  -29.177 37.451  1.00 109.44 ? 239  PHE C CE1   1 
ATOM   5406  C  CE2   . PHE C  2  239  ? 61.276  -28.700 35.200  1.00 123.05 ? 239  PHE C CE2   1 
ATOM   5407  C  CZ    . PHE C  2  239  ? 62.038  -28.402 36.314  1.00 116.88 ? 239  PHE C CZ    1 
ATOM   5408  N  N     . THR C  2  240  ? 56.571  -30.622 35.124  1.00 119.49 ? 240  THR C N     1 
ATOM   5409  C  CA    . THR C  2  240  ? 55.821  -29.606 34.389  1.00 120.30 ? 240  THR C CA    1 
ATOM   5410  C  C     . THR C  2  240  ? 54.664  -29.056 35.216  1.00 119.02 ? 240  THR C C     1 
ATOM   5411  O  O     . THR C  2  240  ? 54.312  -27.878 35.083  1.00 116.96 ? 240  THR C O     1 
ATOM   5412  C  CB    . THR C  2  240  ? 55.292  -30.173 33.071  1.00 122.41 ? 240  THR C CB    1 
ATOM   5413  O  OG1   . THR C  2  240  ? 54.459  -31.308 33.333  1.00 122.43 ? 240  THR C OG1   1 
ATOM   5414  C  CG2   . THR C  2  240  ? 56.438  -30.587 32.172  1.00 120.27 ? 240  THR C CG2   1 
ATOM   5415  N  N     . LEU C  2  241  ? 54.059  -29.890 36.064  1.00 120.30 ? 241  LEU C N     1 
ATOM   5416  C  CA    . LEU C  2  241  ? 52.972  -29.407 36.912  1.00 117.93 ? 241  LEU C CA    1 
ATOM   5417  C  C     . LEU C  2  241  ? 53.481  -28.503 38.029  1.00 118.77 ? 241  LEU C C     1 
ATOM   5418  O  O     . LEU C  2  241  ? 52.784  -27.563 38.428  1.00 118.78 ? 241  LEU C O     1 
ATOM   5419  C  CB    . LEU C  2  241  ? 52.192  -30.582 37.502  1.00 117.24 ? 241  LEU C CB    1 
ATOM   5420  C  CG    . LEU C  2  241  ? 51.249  -31.337 36.565  1.00 119.54 ? 241  LEU C CG    1 
ATOM   5421  C  CD1   . LEU C  2  241  ? 50.455  -32.379 37.334  1.00 117.38 ? 241  LEU C CD1   1 
ATOM   5422  C  CD2   . LEU C  2  241  ? 50.314  -30.375 35.849  1.00 123.03 ? 241  LEU C CD2   1 
ATOM   5423  N  N     . LEU C  2  242  ? 54.681  -28.764 38.546  1.00 118.62 ? 242  LEU C N     1 
ATOM   5424  C  CA    . LEU C  2  242  ? 55.190  -28.006 39.683  1.00 117.76 ? 242  LEU C CA    1 
ATOM   5425  C  C     . LEU C  2  242  ? 55.939  -26.743 39.281  1.00 114.96 ? 242  LEU C C     1 
ATOM   5426  O  O     . LEU C  2  242  ? 55.930  -25.761 40.034  1.00 113.29 ? 242  LEU C O     1 
ATOM   5427  C  CB    . LEU C  2  242  ? 56.109  -28.883 40.538  1.00 119.04 ? 242  LEU C CB    1 
ATOM   5428  C  CG    . LEU C  2  242  ? 55.438  -29.935 41.421  1.00 116.92 ? 242  LEU C CG    1 
ATOM   5429  C  CD1   . LEU C  2  242  ? 56.465  -30.581 42.338  1.00 109.02 ? 242  LEU C CD1   1 
ATOM   5430  C  CD2   . LEU C  2  242  ? 54.302  -29.317 42.225  1.00 113.64 ? 242  LEU C CD2   1 
ATOM   5431  N  N     . ARG C  2  243  ? 56.592  -26.742 38.122  1.00 117.96 ? 243  ARG C N     1 
ATOM   5432  C  CA    . ARG C  2  243  ? 57.422  -25.622 37.681  1.00 116.74 ? 243  ARG C CA    1 
ATOM   5433  C  C     . ARG C  2  243  ? 57.069  -25.277 36.240  1.00 114.09 ? 243  ARG C C     1 
ATOM   5434  O  O     . ARG C  2  243  ? 57.765  -25.689 35.301  1.00 115.39 ? 243  ARG C O     1 
ATOM   5435  C  CB    . ARG C  2  243  ? 58.908  -25.956 37.822  1.00 117.59 ? 243  ARG C CB    1 
ATOM   5436  C  CG    . ARG C  2  243  ? 59.347  -26.298 39.243  1.00 112.51 ? 243  ARG C CG    1 
ATOM   5437  C  CD    . ARG C  2  243  ? 59.991  -25.104 39.931  1.00 114.31 ? 243  ARG C CD    1 
ATOM   5438  N  NE    . ARG C  2  243  ? 61.100  -24.567 39.146  1.00 116.62 ? 243  ARG C NE    1 
ATOM   5439  C  CZ    . ARG C  2  243  ? 61.901  -23.591 39.556  1.00 111.27 ? 243  ARG C CZ    1 
ATOM   5440  N  NH1   . ARG C  2  243  ? 62.883  -23.161 38.774  1.00 99.01  ? 243  ARG C NH1   1 
ATOM   5441  N  NH2   . ARG C  2  243  ? 61.719  -23.040 40.749  1.00 113.31 ? 243  ARG C NH2   1 
ATOM   5442  N  N     . PRO C  2  244  ? 55.985  -24.533 36.025  1.00 113.55 ? 244  PRO C N     1 
ATOM   5443  C  CA    . PRO C  2  244  ? 55.645  -24.106 34.664  1.00 114.50 ? 244  PRO C CA    1 
ATOM   5444  C  C     . PRO C  2  244  ? 56.674  -23.127 34.121  1.00 115.93 ? 244  PRO C C     1 
ATOM   5445  O  O     . PRO C  2  244  ? 57.289  -22.358 34.863  1.00 116.63 ? 244  PRO C O     1 
ATOM   5446  C  CB    . PRO C  2  244  ? 54.273  -23.440 34.828  1.00 113.70 ? 244  PRO C CB    1 
ATOM   5447  C  CG    . PRO C  2  244  ? 53.738  -23.959 36.125  1.00 111.59 ? 244  PRO C CG    1 
ATOM   5448  C  CD    . PRO C  2  244  ? 54.939  -24.167 36.994  1.00 113.28 ? 244  PRO C CD    1 
ATOM   5449  N  N     . GLY C  2  245  ? 56.860  -23.171 32.801  1.00 120.01 ? 245  GLY C N     1 
ATOM   5450  C  CA    . GLY C  2  245  ? 57.829  -22.333 32.128  1.00 128.44 ? 245  GLY C CA    1 
ATOM   5451  C  C     . GLY C  2  245  ? 59.246  -22.862 32.121  1.00 125.45 ? 245  GLY C C     1 
ATOM   5452  O  O     . GLY C  2  245  ? 60.049  -22.432 31.281  1.00 118.99 ? 245  GLY C O     1 
ATOM   5453  N  N     . ASP C  2  246  ? 59.583  -23.781 33.024  1.00 122.90 ? 246  ASP C N     1 
ATOM   5454  C  CA    . ASP C  2  246  ? 60.917  -24.363 33.075  1.00 122.47 ? 246  ASP C CA    1 
ATOM   5455  C  C     . ASP C  2  246  ? 60.972  -25.566 32.143  1.00 127.81 ? 246  ASP C C     1 
ATOM   5456  O  O     . ASP C  2  246  ? 60.164  -26.493 32.303  1.00 127.51 ? 246  ASP C O     1 
ATOM   5457  C  CB    . ASP C  2  246  ? 61.261  -24.783 34.497  1.00 119.67 ? 246  ASP C CB    1 
ATOM   5458  C  CG    . ASP C  2  246  ? 62.760  -24.883 34.737  1.00 123.01 ? 246  ASP C CG    1 
ATOM   5459  O  OD1   . ASP C  2  246  ? 63.512  -25.159 33.779  1.00 125.14 ? 246  ASP C OD1   1 
ATOM   5460  O  OD2   . ASP C  2  246  ? 63.186  -24.687 35.895  1.00 122.66 ? 246  ASP C OD2   1 
ATOM   5461  N  N     . PRO C  2  247  ? 61.868  -25.585 31.157  1.00 126.58 ? 247  PRO C N     1 
ATOM   5462  C  CA    . PRO C  2  247  ? 61.942  -26.719 30.222  1.00 123.35 ? 247  PRO C CA    1 
ATOM   5463  C  C     . PRO C  2  247  ? 62.141  -28.033 30.953  1.00 123.35 ? 247  PRO C C     1 
ATOM   5464  O  O     . PRO C  2  247  ? 63.011  -28.147 31.830  1.00 124.38 ? 247  PRO C O     1 
ATOM   5465  C  CB    . PRO C  2  247  ? 63.160  -26.374 29.352  1.00 116.73 ? 247  PRO C CB    1 
ATOM   5466  C  CG    . PRO C  2  247  ? 63.192  -24.883 29.360  1.00 107.19 ? 247  PRO C CG    1 
ATOM   5467  C  CD    . PRO C  2  247  ? 62.733  -24.468 30.737  1.00 113.30 ? 247  PRO C CD    1 
ATOM   5468  N  N     . PRO C  2  248  ? 61.348  -29.052 30.623  1.00 124.09 ? 248  PRO C N     1 
ATOM   5469  C  CA    . PRO C  2  248  ? 61.431  -30.324 31.354  1.00 124.53 ? 248  PRO C CA    1 
ATOM   5470  C  C     . PRO C  2  248  ? 62.675  -31.136 31.029  1.00 125.48 ? 248  PRO C C     1 
ATOM   5471  O  O     . PRO C  2  248  ? 62.580  -32.193 30.397  1.00 126.64 ? 248  PRO C O     1 
ATOM   5472  C  CB    . PRO C  2  248  ? 60.160  -31.067 30.915  1.00 125.35 ? 248  PRO C CB    1 
ATOM   5473  C  CG    . PRO C  2  248  ? 59.289  -30.030 30.268  1.00 124.04 ? 248  PRO C CG    1 
ATOM   5474  C  CD    . PRO C  2  248  ? 60.209  -29.014 29.693  1.00 129.40 ? 248  PRO C CD    1 
ATOM   5475  N  N     . LYS C  2  249  ? 63.845  -30.661 31.451  1.00 124.36 ? 249  LYS C N     1 
ATOM   5476  C  CA    . LYS C  2  249  ? 65.059  -31.463 31.356  1.00 127.66 ? 249  LYS C CA    1 
ATOM   5477  C  C     . LYS C  2  249  ? 65.046  -32.508 32.467  1.00 128.93 ? 249  LYS C C     1 
ATOM   5478  O  O     . LYS C  2  249  ? 64.851  -32.171 33.638  1.00 131.61 ? 249  LYS C O     1 
ATOM   5479  C  CB    . LYS C  2  249  ? 66.303  -30.582 31.453  1.00 127.30 ? 249  LYS C CB    1 
ATOM   5480  C  CG    . LYS C  2  249  ? 67.314  -30.842 30.348  1.00 128.57 ? 249  LYS C CG    1 
ATOM   5481  C  CD    . LYS C  2  249  ? 68.573  -30.015 30.525  1.00 125.02 ? 249  LYS C CD    1 
ATOM   5482  C  CE    . LYS C  2  249  ? 69.760  -30.698 29.865  1.00 128.21 ? 249  LYS C CE    1 
ATOM   5483  N  NZ    . LYS C  2  249  ? 69.484  -31.050 28.445  1.00 119.31 ? 249  LYS C NZ    1 
ATOM   5484  N  N     . ARG C  2  250  ? 65.245  -33.777 32.093  1.00 129.19 ? 250  ARG C N     1 
ATOM   5485  C  CA    . ARG C  2  250  ? 65.063  -34.870 33.045  1.00 124.73 ? 250  ARG C CA    1 
ATOM   5486  C  C     . ARG C  2  250  ? 66.038  -34.775 34.212  1.00 129.25 ? 250  ARG C C     1 
ATOM   5487  O  O     . ARG C  2  250  ? 65.681  -35.096 35.352  1.00 133.29 ? 250  ARG C O     1 
ATOM   5488  C  CB    . ARG C  2  250  ? 65.213  -36.219 32.344  1.00 123.81 ? 250  ARG C CB    1 
ATOM   5489  C  CG    . ARG C  2  250  ? 65.026  -37.415 33.270  1.00 119.60 ? 250  ARG C CG    1 
ATOM   5490  C  CD    . ARG C  2  250  ? 66.102  -38.466 33.034  1.00 122.43 ? 250  ARG C CD    1 
ATOM   5491  N  NE    . ARG C  2  250  ? 65.822  -39.718 33.734  1.00 125.09 ? 250  ARG C NE    1 
ATOM   5492  C  CZ    . ARG C  2  250  ? 66.633  -40.283 34.624  1.00 123.66 ? 250  ARG C CZ    1 
ATOM   5493  N  NH1   . ARG C  2  250  ? 67.794  -39.717 34.926  1.00 114.66 ? 250  ARG C NH1   1 
ATOM   5494  N  NH2   . ARG C  2  250  ? 66.288  -41.425 35.205  1.00 118.07 ? 250  ARG C NH2   1 
ATOM   5495  N  N     . ASP C  2  251  ? 67.278  -34.354 33.953  1.00 129.89 ? 251  ASP C N     1 
ATOM   5496  C  CA    . ASP C  2  251  ? 68.213  -34.137 35.053  1.00 129.63 ? 251  ASP C CA    1 
ATOM   5497  C  C     . ASP C  2  251  ? 67.708  -33.045 35.991  1.00 130.65 ? 251  ASP C C     1 
ATOM   5498  O  O     . ASP C  2  251  ? 67.783  -33.186 37.219  1.00 125.20 ? 251  ASP C O     1 
ATOM   5499  C  CB    . ASP C  2  251  ? 69.601  -33.795 34.508  1.00 131.29 ? 251  ASP C CB    1 
ATOM   5500  C  CG    . ASP C  2  251  ? 69.543  -33.006 33.215  1.00 131.60 ? 251  ASP C CG    1 
ATOM   5501  O  OD1   . ASP C  2  251  ? 69.029  -33.542 32.210  1.00 127.10 ? 251  ASP C OD1   1 
ATOM   5502  O  OD2   . ASP C  2  251  ? 70.002  -31.844 33.207  1.00 130.60 ? 251  ASP C OD2   1 
ATOM   5503  N  N     . LYS C  2  252  ? 67.158  -31.962 35.429  1.00 131.50 ? 252  LYS C N     1 
ATOM   5504  C  CA    . LYS C  2  252  ? 66.573  -30.909 36.256  1.00 120.52 ? 252  LYS C CA    1 
ATOM   5505  C  C     . LYS C  2  252  ? 65.369  -31.419 37.041  1.00 116.53 ? 252  LYS C C     1 
ATOM   5506  O  O     . LYS C  2  252  ? 65.168  -31.031 38.196  1.00 119.33 ? 252  LYS C O     1 
ATOM   5507  C  CB    . LYS C  2  252  ? 66.176  -29.712 35.391  1.00 118.15 ? 252  LYS C CB    1 
ATOM   5508  C  CG    . LYS C  2  252  ? 67.164  -28.559 35.426  1.00 121.92 ? 252  LYS C CG    1 
ATOM   5509  C  CD    . LYS C  2  252  ? 66.521  -27.278 34.922  1.00 120.82 ? 252  LYS C CD    1 
ATOM   5510  C  CE    . LYS C  2  252  ? 67.433  -26.083 35.144  1.00 119.50 ? 252  LYS C CE    1 
ATOM   5511  N  NZ    . LYS C  2  252  ? 66.764  -24.795 34.812  1.00 117.85 ? 252  LYS C NZ    1 
ATOM   5512  N  N     . ALA C  2  253  ? 64.559  -32.296 36.438  1.00 118.74 ? 253  ALA C N     1 
ATOM   5513  C  CA    . ALA C  2  253  ? 63.390  -32.827 37.138  1.00 116.01 ? 253  ALA C CA    1 
ATOM   5514  C  C     . ALA C  2  253  ? 63.799  -33.733 38.293  1.00 118.99 ? 253  ALA C C     1 
ATOM   5515  O  O     . ALA C  2  253  ? 63.225  -33.652 39.388  1.00 120.70 ? 253  ALA C O     1 
ATOM   5516  C  CB    . ALA C  2  253  ? 62.485  -33.581 36.166  1.00 116.32 ? 253  ALA C CB    1 
ATOM   5517  N  N     . VAL C  2  254  ? 64.777  -34.615 38.061  1.00 118.92 ? 254  VAL C N     1 
ATOM   5518  C  CA    . VAL C  2  254  ? 65.309  -35.439 39.143  1.00 119.04 ? 254  VAL C CA    1 
ATOM   5519  C  C     . VAL C  2  254  ? 65.862  -34.555 40.251  1.00 118.14 ? 254  VAL C C     1 
ATOM   5520  O  O     . VAL C  2  254  ? 65.576  -34.765 41.434  1.00 113.09 ? 254  VAL C O     1 
ATOM   5521  C  CB    . VAL C  2  254  ? 66.378  -36.412 38.611  1.00 118.71 ? 254  VAL C CB    1 
ATOM   5522  C  CG1   . VAL C  2  254  ? 67.029  -37.172 39.762  1.00 114.08 ? 254  VAL C CG1   1 
ATOM   5523  C  CG2   . VAL C  2  254  ? 65.767  -37.382 37.617  1.00 117.39 ? 254  VAL C CG2   1 
ATOM   5524  N  N     . ALA C  2  255  ? 66.648  -33.538 39.880  1.00 118.50 ? 255  ALA C N     1 
ATOM   5525  C  CA    . ALA C  2  255  ? 67.214  -32.634 40.877  1.00 115.73 ? 255  ALA C CA    1 
ATOM   5526  C  C     . ALA C  2  255  ? 66.121  -31.972 41.709  1.00 109.07 ? 255  ALA C C     1 
ATOM   5527  O  O     . ALA C  2  255  ? 66.195  -31.949 42.942  1.00 105.49 ? 255  ALA C O     1 
ATOM   5528  C  CB    . ALA C  2  255  ? 68.087  -31.581 40.193  1.00 115.75 ? 255  ALA C CB    1 
ATOM   5529  N  N     . TYR C  2  256  ? 65.082  -31.449 41.052  1.00 110.31 ? 256  TYR C N     1 
ATOM   5530  C  CA    . TYR C  2  256  ? 64.040  -30.726 41.774  1.00 104.30 ? 256  TYR C CA    1 
ATOM   5531  C  C     . TYR C  2  256  ? 63.250  -31.653 42.689  1.00 104.66 ? 256  TYR C C     1 
ATOM   5532  O  O     . TYR C  2  256  ? 63.051  -31.347 43.871  1.00 110.47 ? 256  TYR C O     1 
ATOM   5533  C  CB    . TYR C  2  256  ? 63.103  -30.023 40.794  1.00 104.01 ? 256  TYR C CB    1 
ATOM   5534  C  CG    . TYR C  2  256  ? 62.007  -29.244 41.482  1.00 109.03 ? 256  TYR C CG    1 
ATOM   5535  C  CD1   . TYR C  2  256  ? 62.248  -27.973 41.989  1.00 115.44 ? 256  TYR C CD1   1 
ATOM   5536  C  CD2   . TYR C  2  256  ? 60.734  -29.780 41.634  1.00 107.84 ? 256  TYR C CD2   1 
ATOM   5537  C  CE1   . TYR C  2  256  ? 61.253  -27.257 42.622  1.00 117.87 ? 256  TYR C CE1   1 
ATOM   5538  C  CE2   . TYR C  2  256  ? 59.732  -29.071 42.265  1.00 107.39 ? 256  TYR C CE2   1 
ATOM   5539  C  CZ    . TYR C  2  256  ? 59.997  -27.809 42.758  1.00 116.59 ? 256  TYR C CZ    1 
ATOM   5540  O  OH    . TYR C  2  256  ? 59.004  -27.096 43.389  1.00 113.94 ? 256  TYR C OH    1 
ATOM   5541  N  N     . VAL C  2  257  ? 62.778  -32.787 42.162  1.00 102.80 ? 257  VAL C N     1 
ATOM   5542  C  CA    . VAL C  2  257  ? 61.963  -33.683 42.979  1.00 102.87 ? 257  VAL C CA    1 
ATOM   5543  C  C     . VAL C  2  257  ? 62.787  -34.258 44.125  1.00 101.76 ? 257  VAL C C     1 
ATOM   5544  O  O     . VAL C  2  257  ? 62.287  -34.422 45.245  1.00 100.74 ? 257  VAL C O     1 
ATOM   5545  C  CB    . VAL C  2  257  ? 61.339  -34.789 42.110  1.00 101.63 ? 257  VAL C CB    1 
ATOM   5546  C  CG1   . VAL C  2  257  ? 60.696  -35.856 42.979  1.00 92.00  ? 257  VAL C CG1   1 
ATOM   5547  C  CG2   . VAL C  2  257  ? 60.306  -34.187 41.178  1.00 108.77 ? 257  VAL C CG2   1 
ATOM   5548  N  N     . TYR C  2  258  ? 64.067  -34.547 43.877  1.00 109.25 ? 258  TYR C N     1 
ATOM   5549  C  CA    . TYR C  2  258  ? 64.939  -35.055 44.929  1.00 107.25 ? 258  TYR C CA    1 
ATOM   5550  C  C     . TYR C  2  258  ? 65.149  -34.008 46.018  1.00 106.37 ? 258  TYR C C     1 
ATOM   5551  O  O     . TYR C  2  258  ? 64.963  -34.289 47.208  1.00 100.22 ? 258  TYR C O     1 
ATOM   5552  C  CB    . TYR C  2  258  ? 66.268  -35.500 44.310  1.00 101.20 ? 258  TYR C CB    1 
ATOM   5553  C  CG    . TYR C  2  258  ? 67.336  -35.915 45.299  1.00 100.73 ? 258  TYR C CG    1 
ATOM   5554  C  CD1   . TYR C  2  258  ? 67.341  -37.188 45.860  1.00 97.93  ? 258  TYR C CD1   1 
ATOM   5555  C  CD2   . TYR C  2  258  ? 68.353  -35.039 45.654  1.00 101.44 ? 258  TYR C CD2   1 
ATOM   5556  C  CE1   . TYR C  2  258  ? 68.324  -37.568 46.761  1.00 96.00  ? 258  TYR C CE1   1 
ATOM   5557  C  CE2   . TYR C  2  258  ? 69.338  -35.408 46.552  1.00 94.75  ? 258  TYR C CE2   1 
ATOM   5558  C  CZ    . TYR C  2  258  ? 69.321  -36.673 47.102  1.00 94.88  ? 258  TYR C CZ    1 
ATOM   5559  O  OH    . TYR C  2  258  ? 70.304  -37.039 47.994  1.00 92.79  ? 258  TYR C OH    1 
ATOM   5560  N  N     . GLY C  2  259  ? 65.521  -32.784 45.630  1.00 112.21 ? 259  GLY C N     1 
ATOM   5561  C  CA    . GLY C  2  259  ? 65.678  -31.710 46.597  1.00 112.10 ? 259  GLY C CA    1 
ATOM   5562  C  C     . GLY C  2  259  ? 64.400  -31.349 47.321  1.00 107.44 ? 259  GLY C C     1 
ATOM   5563  O  O     . GLY C  2  259  ? 64.453  -30.733 48.391  1.00 106.89 ? 259  GLY C O     1 
ATOM   5564  N  N     . LEU C  2  260  ? 63.249  -31.715 46.761  1.00 103.53 ? 260  LEU C N     1 
ATOM   5565  C  CA    . LEU C  2  260  ? 61.989  -31.394 47.412  1.00 102.73 ? 260  LEU C CA    1 
ATOM   5566  C  C     . LEU C  2  260  ? 61.601  -32.445 48.448  1.00 98.90  ? 260  LEU C C     1 
ATOM   5567  O  O     . LEU C  2  260  ? 61.065  -32.102 49.506  1.00 99.68  ? 260  LEU C O     1 
ATOM   5568  C  CB    . LEU C  2  260  ? 60.887  -31.244 46.363  1.00 102.17 ? 260  LEU C CB    1 
ATOM   5569  C  CG    . LEU C  2  260  ? 59.572  -30.616 46.827  1.00 105.60 ? 260  LEU C CG    1 
ATOM   5570  C  CD1   . LEU C  2  260  ? 59.774  -29.155 47.210  1.00 110.57 ? 260  LEU C CD1   1 
ATOM   5571  C  CD2   . LEU C  2  260  ? 58.504  -30.753 45.753  1.00 103.06 ? 260  LEU C CD2   1 
ATOM   5572  N  N     . ILE C  2  261  ? 61.861  -33.726 48.178  1.00 96.08  ? 261  ILE C N     1 
ATOM   5573  C  CA    . ILE C  2  261  ? 61.339  -34.817 48.993  1.00 93.80  ? 261  ILE C CA    1 
ATOM   5574  C  C     . ILE C  2  261  ? 62.457  -35.648 49.614  1.00 97.03  ? 261  ILE C C     1 
ATOM   5575  O  O     . ILE C  2  261  ? 62.457  -35.903 50.823  1.00 92.86  ? 261  ILE C O     1 
ATOM   5576  C  CB    . ILE C  2  261  ? 60.368  -35.710 48.185  1.00 84.63  ? 261  ILE C CB    1 
ATOM   5577  C  CG1   . ILE C  2  261  ? 58.921  -35.328 48.489  1.00 88.02  ? 261  ILE C CG1   1 
ATOM   5578  C  CG2   . ILE C  2  261  ? 60.556  -37.180 48.517  1.00 85.62  ? 261  ILE C CG2   1 
ATOM   5579  C  CD1   . ILE C  2  261  ? 58.577  -33.892 48.191  1.00 97.60  ? 261  ILE C CD1   1 
ATOM   5580  N  N     . ALA C  2  262  ? 63.420  -36.085 48.801  1.00 97.22  ? 262  ALA C N     1 
ATOM   5581  C  CA    . ALA C  2  262  ? 64.374  -37.102 49.221  1.00 94.61  ? 262  ALA C CA    1 
ATOM   5582  C  C     . ALA C  2  262  ? 65.711  -36.540 49.686  1.00 93.29  ? 262  ALA C C     1 
ATOM   5583  O  O     . ALA C  2  262  ? 66.497  -37.282 50.283  1.00 88.85  ? 262  ALA C O     1 
ATOM   5584  C  CB    . ALA C  2  262  ? 64.611  -38.100 48.081  1.00 97.94  ? 262  ALA C CB    1 
ATOM   5585  N  N     . ASP C  2  263  ? 65.989  -35.269 49.434  1.00 93.41  ? 263  ASP C N     1 
ATOM   5586  C  CA    . ASP C  2  263  ? 67.271  -34.682 49.816  1.00 95.06  ? 263  ASP C CA    1 
ATOM   5587  C  C     . ASP C  2  263  ? 67.323  -34.478 51.325  1.00 95.87  ? 263  ASP C C     1 
ATOM   5588  O  O     . ASP C  2  263  ? 66.559  -33.655 51.848  1.00 98.66  ? 263  ASP C O     1 
ATOM   5589  C  CB    . ASP C  2  263  ? 67.479  -33.350 49.090  1.00 95.80  ? 263  ASP C CB    1 
ATOM   5590  C  CG    . ASP C  2  263  ? 68.942  -32.923 49.040  1.00 97.10  ? 263  ASP C CG    1 
ATOM   5591  O  OD1   . ASP C  2  263  ? 69.776  -33.538 49.736  1.00 97.18  ? 263  ASP C OD1   1 
ATOM   5592  O  OD2   . ASP C  2  263  ? 69.259  -31.971 48.293  1.00 94.35  ? 263  ASP C OD2   1 
ATOM   5593  N  N     . PRO C  2  264  ? 68.185  -35.187 52.061  1.00 92.54  ? 264  PRO C N     1 
ATOM   5594  C  CA    . PRO C  2  264  ? 68.292  -34.924 53.503  1.00 91.84  ? 264  PRO C CA    1 
ATOM   5595  C  C     . PRO C  2  264  ? 68.900  -33.570 53.816  1.00 95.52  ? 264  PRO C C     1 
ATOM   5596  O  O     . PRO C  2  264  ? 68.760  -33.097 54.951  1.00 96.24  ? 264  PRO C O     1 
ATOM   5597  C  CB    . PRO C  2  264  ? 69.178  -36.070 54.004  1.00 84.51  ? 264  PRO C CB    1 
ATOM   5598  C  CG    . PRO C  2  264  ? 70.011  -36.419 52.829  1.00 90.08  ? 264  PRO C CG    1 
ATOM   5599  C  CD    . PRO C  2  264  ? 69.133  -36.225 51.622  1.00 91.23  ? 264  PRO C CD    1 
ATOM   5600  N  N     . ARG C  2  265  ? 69.560  -32.932 52.846  1.00 92.91  ? 265  ARG C N     1 
ATOM   5601  C  CA    . ARG C  2  265  ? 70.112  -31.597 53.051  1.00 94.36  ? 265  ARG C CA    1 
ATOM   5602  C  C     . ARG C  2  265  ? 69.054  -30.508 52.927  1.00 97.35  ? 265  ARG C C     1 
ATOM   5603  O  O     . ARG C  2  265  ? 69.164  -29.472 53.590  1.00 103.30 ? 265  ARG C O     1 
ATOM   5604  C  CB    . ARG C  2  265  ? 71.244  -31.341 52.054  1.00 93.42  ? 265  ARG C CB    1 
ATOM   5605  C  CG    . ARG C  2  265  ? 72.398  -32.325 52.178  1.00 95.97  ? 265  ARG C CG    1 
ATOM   5606  C  CD    . ARG C  2  265  ? 73.204  -32.432 50.889  1.00 99.65  ? 265  ARG C CD    1 
ATOM   5607  N  NE    . ARG C  2  265  ? 74.363  -31.541 50.859  1.00 99.05  ? 265  ARG C NE    1 
ATOM   5608  C  CZ    . ARG C  2  265  ? 75.583  -31.880 51.271  1.00 92.42  ? 265  ARG C CZ    1 
ATOM   5609  N  NH1   . ARG C  2  265  ? 75.812  -33.093 51.758  1.00 83.15  ? 265  ARG C NH1   1 
ATOM   5610  N  NH2   . ARG C  2  265  ? 76.576  -31.003 51.198  1.00 89.49  ? 265  ARG C NH2   1 
ATOM   5611  N  N     . ARG C  2  266  ? 68.035  -30.710 52.087  1.00 95.30  ? 266  ARG C N     1 
ATOM   5612  C  CA    . ARG C  2  266  ? 66.981  -29.718 51.909  1.00 100.47 ? 266  ARG C CA    1 
ATOM   5613  C  C     . ARG C  2  266  ? 65.665  -30.095 52.579  1.00 95.43  ? 266  ARG C C     1 
ATOM   5614  O  O     . ARG C  2  266  ? 64.802  -29.225 52.739  1.00 88.65  ? 266  ARG C O     1 
ATOM   5615  C  CB    . ARG C  2  266  ? 66.721  -29.473 50.417  1.00 106.74 ? 266  ARG C CB    1 
ATOM   5616  C  CG    . ARG C  2  266  ? 67.907  -28.917 49.642  1.00 115.90 ? 266  ARG C CG    1 
ATOM   5617  C  CD    . ARG C  2  266  ? 67.459  -28.413 48.277  1.00 127.38 ? 266  ARG C CD    1 
ATOM   5618  N  NE    . ARG C  2  266  ? 66.623  -27.220 48.396  1.00 130.68 ? 266  ARG C NE    1 
ATOM   5619  C  CZ    . ARG C  2  266  ? 65.660  -26.889 47.542  1.00 126.25 ? 266  ARG C CZ    1 
ATOM   5620  N  NH1   . ARG C  2  266  ? 64.956  -25.781 47.736  1.00 118.61 ? 266  ARG C NH1   1 
ATOM   5621  N  NH2   . ARG C  2  266  ? 65.390  -27.668 46.503  1.00 124.07 ? 266  ARG C NH2   1 
ATOM   5622  N  N     . TYR C  2  267  ? 65.483  -31.359 52.958  1.00 94.89  ? 267  TYR C N     1 
ATOM   5623  C  CA    . TYR C  2  267  ? 64.265  -31.812 53.619  1.00 89.23  ? 267  TYR C CA    1 
ATOM   5624  C  C     . TYR C  2  267  ? 64.654  -32.613 54.851  1.00 89.40  ? 267  TYR C C     1 
ATOM   5625  O  O     . TYR C  2  267  ? 65.261  -33.684 54.734  1.00 88.28  ? 267  TYR C O     1 
ATOM   5626  C  CB    . TYR C  2  267  ? 63.397  -32.659 52.688  1.00 89.35  ? 267  TYR C CB    1 
ATOM   5627  C  CG    . TYR C  2  267  ? 62.069  -33.047 53.300  1.00 87.42  ? 267  TYR C CG    1 
ATOM   5628  C  CD1   . TYR C  2  267  ? 61.939  -34.202 54.061  1.00 84.48  ? 267  TYR C CD1   1 
ATOM   5629  C  CD2   . TYR C  2  267  ? 60.947  -32.250 53.125  1.00 85.94  ? 267  TYR C CD2   1 
ATOM   5630  C  CE1   . TYR C  2  267  ? 60.726  -34.552 54.629  1.00 82.22  ? 267  TYR C CE1   1 
ATOM   5631  C  CE2   . TYR C  2  267  ? 59.734  -32.591 53.684  1.00 83.25  ? 267  TYR C CE2   1 
ATOM   5632  C  CZ    . TYR C  2  267  ? 59.626  -33.741 54.435  1.00 81.87  ? 267  TYR C CZ    1 
ATOM   5633  O  OH    . TYR C  2  267  ? 58.411  -34.073 54.991  1.00 77.89  ? 267  TYR C OH    1 
ATOM   5634  N  N     . ASP C  2  268  ? 64.294  -32.108 56.027  1.00 87.92  ? 268  ASP C N     1 
ATOM   5635  C  CA    . ASP C  2  268  ? 64.647  -32.750 57.288  1.00 86.35  ? 268  ASP C CA    1 
ATOM   5636  C  C     . ASP C  2  268  ? 63.400  -32.866 58.155  1.00 87.30  ? 268  ASP C C     1 
ATOM   5637  O  O     . ASP C  2  268  ? 62.957  -31.880 58.750  1.00 90.16  ? 268  ASP C O     1 
ATOM   5638  C  CB    . ASP C  2  268  ? 65.743  -31.971 58.013  1.00 93.49  ? 268  ASP C CB    1 
ATOM   5639  C  CG    . ASP C  2  268  ? 66.615  -32.862 58.883  1.00 94.71  ? 268  ASP C CG    1 
ATOM   5640  O  OD1   . ASP C  2  268  ? 66.212  -34.011 59.157  1.00 83.34  ? 268  ASP C OD1   1 
ATOM   5641  O  OD2   . ASP C  2  268  ? 67.709  -32.412 59.290  1.00 99.16  ? 268  ASP C OD2   1 
ATOM   5642  N  N     . LEU C  2  269  ? 62.832  -34.067 58.215  1.00 88.52  ? 269  LEU C N     1 
ATOM   5643  C  CA    . LEU C  2  269  ? 61.957  -34.412 59.323  1.00 74.34  ? 269  LEU C CA    1 
ATOM   5644  C  C     . LEU C  2  269  ? 62.774  -34.398 60.604  1.00 75.28  ? 269  LEU C C     1 
ATOM   5645  O  O     . LEU C  2  269  ? 63.991  -34.589 60.588  1.00 87.84  ? 269  LEU C O     1 
ATOM   5646  C  CB    . LEU C  2  269  ? 61.346  -35.797 59.118  1.00 72.35  ? 269  LEU C CB    1 
ATOM   5647  C  CG    . LEU C  2  269  ? 59.831  -35.984 59.125  1.00 68.85  ? 269  LEU C CG    1 
ATOM   5648  C  CD1   . LEU C  2  269  ? 59.203  -35.327 57.910  1.00 70.80  ? 269  LEU C CD1   1 
ATOM   5649  C  CD2   . LEU C  2  269  ? 59.488  -37.462 59.170  1.00 61.40  ? 269  LEU C CD2   1 
ATOM   5650  N  N     . GLY C  2  270  ? 62.110  -34.162 61.722  1.00 71.52  ? 270  GLY C N     1 
ATOM   5651  C  CA    . GLY C  2  270  ? 62.795  -34.290 62.985  1.00 78.71  ? 270  GLY C CA    1 
ATOM   5652  C  C     . GLY C  2  270  ? 63.184  -35.729 63.257  1.00 79.32  ? 270  GLY C C     1 
ATOM   5653  O  O     . GLY C  2  270  ? 62.615  -36.674 62.707  1.00 77.53  ? 270  GLY C O     1 
ATOM   5654  N  N     . GLU C  2  271  ? 64.205  -35.903 64.096  1.00 75.35  ? 271  GLU C N     1 
ATOM   5655  C  CA    . GLU C  2  271  ? 64.362  -37.198 64.741  1.00 78.72  ? 271  GLU C CA    1 
ATOM   5656  C  C     . GLU C  2  271  ? 63.113  -37.513 65.547  1.00 82.08  ? 271  GLU C C     1 
ATOM   5657  O  O     . GLU C  2  271  ? 62.611  -38.646 65.533  1.00 81.88  ? 271  GLU C O     1 
ATOM   5658  C  CB    . GLU C  2  271  ? 65.607  -37.205 65.627  1.00 87.56  ? 271  GLU C CB    1 
ATOM   5659  C  CG    . GLU C  2  271  ? 66.047  -38.596 66.064  1.00 102.97 ? 271  GLU C CG    1 
ATOM   5660  C  CD    . GLU C  2  271  ? 66.621  -39.424 64.919  1.00 115.53 ? 271  GLU C CD    1 
ATOM   5661  O  OE1   . GLU C  2  271  ? 67.141  -38.836 63.945  1.00 103.84 ? 271  GLU C OE1   1 
ATOM   5662  O  OE2   . GLU C  2  271  ? 66.551  -40.670 64.996  1.00 119.65 ? 271  GLU C OE2   1 
ATOM   5663  N  N     . ALA C  2  272  ? 62.571  -36.491 66.215  1.00 77.60  ? 272  ALA C N     1 
ATOM   5664  C  CA    . ALA C  2  272  ? 61.240  -36.587 66.798  1.00 70.16  ? 272  ALA C CA    1 
ATOM   5665  C  C     . ALA C  2  272  ? 60.182  -36.810 65.727  1.00 68.33  ? 272  ALA C C     1 
ATOM   5666  O  O     . ALA C  2  272  ? 59.274  -37.626 65.910  1.00 73.23  ? 272  ALA C O     1 
ATOM   5667  C  CB    . ALA C  2  272  ? 60.931  -35.324 67.600  1.00 69.87  ? 272  ALA C CB    1 
ATOM   5668  N  N     . GLY C  2  273  ? 60.271  -36.089 64.607  1.00 68.81  ? 273  GLY C N     1 
ATOM   5669  C  CA    . GLY C  2  273  ? 59.319  -36.306 63.527  1.00 74.10  ? 273  GLY C CA    1 
ATOM   5670  C  C     . GLY C  2  273  ? 59.386  -37.712 62.958  1.00 81.58  ? 273  GLY C C     1 
ATOM   5671  O  O     . GLY C  2  273  ? 58.354  -38.334 62.684  1.00 76.00  ? 273  GLY C O     1 
ATOM   5672  N  N     . ARG C  2  274  ? 60.603  -38.227 62.767  1.00 85.34  ? 274  ARG C N     1 
ATOM   5673  C  CA    . ARG C  2  274  ? 60.778  -39.606 62.325  1.00 80.52  ? 274  ARG C CA    1 
ATOM   5674  C  C     . ARG C  2  274  ? 60.137  -40.580 63.304  1.00 83.60  ? 274  ARG C C     1 
ATOM   5675  O  O     . ARG C  2  274  ? 59.379  -41.474 62.905  1.00 83.68  ? 274  ARG C O     1 
ATOM   5676  C  CB    . ARG C  2  274  ? 62.266  -39.911 62.164  1.00 85.56  ? 274  ARG C CB    1 
ATOM   5677  C  CG    . ARG C  2  274  ? 62.600  -41.388 62.032  1.00 92.39  ? 274  ARG C CG    1 
ATOM   5678  C  CD    . ARG C  2  274  ? 64.046  -41.635 62.417  1.00 90.32  ? 274  ARG C CD    1 
ATOM   5679  N  NE    . ARG C  2  274  ? 64.659  -42.682 61.611  1.00 101.82 ? 274  ARG C NE    1 
ATOM   5680  C  CZ    . ARG C  2  274  ? 65.965  -42.917 61.569  1.00 114.22 ? 274  ARG C CZ    1 
ATOM   5681  N  NH1   . ARG C  2  274  ? 66.795  -42.174 62.290  1.00 120.07 ? 274  ARG C NH1   1 
ATOM   5682  N  NH2   . ARG C  2  274  ? 66.444  -43.889 60.803  1.00 109.81 ? 274  ARG C NH2   1 
ATOM   5683  N  N     . TYR C  2  275  ? 60.444  -40.429 64.596  1.00 83.95  ? 275  TYR C N     1 
ATOM   5684  C  CA    . TYR C  2  275  ? 59.863  -41.321 65.593  1.00 89.57  ? 275  TYR C CA    1 
ATOM   5685  C  C     . TYR C  2  275  ? 58.341  -41.229 65.596  1.00 89.44  ? 275  TYR C C     1 
ATOM   5686  O  O     . TYR C  2  275  ? 57.653  -42.247 65.724  1.00 90.91  ? 275  TYR C O     1 
ATOM   5687  C  CB    . TYR C  2  275  ? 60.427  -41.004 66.979  1.00 94.94  ? 275  TYR C CB    1 
ATOM   5688  C  CG    . TYR C  2  275  ? 59.707  -41.724 68.101  1.00 106.56 ? 275  TYR C CG    1 
ATOM   5689  C  CD1   . TYR C  2  275  ? 60.001  -43.047 68.404  1.00 110.54 ? 275  TYR C CD1   1 
ATOM   5690  C  CD2   . TYR C  2  275  ? 58.727  -41.080 68.852  1.00 103.41 ? 275  TYR C CD2   1 
ATOM   5691  C  CE1   . TYR C  2  275  ? 59.341  -43.710 69.423  1.00 112.74 ? 275  TYR C CE1   1 
ATOM   5692  C  CE2   . TYR C  2  275  ? 58.062  -41.736 69.872  1.00 107.30 ? 275  TYR C CE2   1 
ATOM   5693  C  CZ    . TYR C  2  275  ? 58.374  -43.051 70.153  1.00 110.02 ? 275  TYR C CZ    1 
ATOM   5694  O  OH    . TYR C  2  275  ? 57.720  -43.713 71.166  1.00 106.02 ? 275  TYR C OH    1 
ATOM   5695  N  N     . LYS C  2  276  ? 57.797  -40.021 65.441  1.00 85.92  ? 276  LYS C N     1 
ATOM   5696  C  CA    . LYS C  2  276  ? 56.348  -39.851 65.487  1.00 84.12  ? 276  LYS C CA    1 
ATOM   5697  C  C     . LYS C  2  276  ? 55.680  -40.476 64.271  1.00 82.88  ? 276  LYS C C     1 
ATOM   5698  O  O     . LYS C  2  276  ? 54.611  -41.080 64.392  1.00 82.79  ? 276  LYS C O     1 
ATOM   5699  C  CB    . LYS C  2  276  ? 55.993  -38.369 65.595  1.00 86.91  ? 276  LYS C CB    1 
ATOM   5700  C  CG    . LYS C  2  276  ? 56.195  -37.780 66.986  1.00 84.74  ? 276  LYS C CG    1 
ATOM   5701  C  CD    . LYS C  2  276  ? 55.128  -38.265 67.955  1.00 82.58  ? 276  LYS C CD    1 
ATOM   5702  C  CE    . LYS C  2  276  ? 53.743  -37.841 67.496  1.00 72.31  ? 276  LYS C CE    1 
ATOM   5703  N  NZ    . LYS C  2  276  ? 53.658  -36.367 67.304  1.00 62.83  ? 276  LYS C NZ    1 
ATOM   5704  N  N     . ALA C  2  277  ? 56.291  -40.348 63.092  1.00 86.70  ? 277  ALA C N     1 
ATOM   5705  C  CA    . ALA C  2  277  ? 55.744  -41.009 61.912  1.00 86.97  ? 277  ALA C CA    1 
ATOM   5706  C  C     . ALA C  2  277  ? 55.792  -42.524 62.070  1.00 86.97  ? 277  ALA C C     1 
ATOM   5707  O  O     . ALA C  2  277  ? 54.813  -43.225 61.778  1.00 81.34  ? 277  ALA C O     1 
ATOM   5708  C  CB    . ALA C  2  277  ? 56.500  -40.567 60.659  1.00 77.31  ? 277  ALA C CB    1 
ATOM   5709  N  N     . GLU C  2  278  ? 56.927  -43.047 62.551  1.00 87.85  ? 278  GLU C N     1 
ATOM   5710  C  CA    . GLU C  2  278  ? 57.052  -44.485 62.771  1.00 86.27  ? 278  GLU C CA    1 
ATOM   5711  C  C     . GLU C  2  278  ? 56.026  -44.986 63.780  1.00 93.27  ? 278  GLU C C     1 
ATOM   5712  O  O     . GLU C  2  278  ? 55.489  -46.091 63.636  1.00 96.51  ? 278  GLU C O     1 
ATOM   5713  C  CB    . GLU C  2  278  ? 58.467  -44.824 63.240  1.00 82.61  ? 278  GLU C CB    1 
ATOM   5714  C  CG    . GLU C  2  278  ? 59.554  -44.588 62.205  1.00 93.92  ? 278  GLU C CG    1 
ATOM   5715  C  CD    . GLU C  2  278  ? 60.946  -44.877 62.746  1.00 104.34 ? 278  GLU C CD    1 
ATOM   5716  O  OE1   . GLU C  2  278  ? 61.056  -45.281 63.925  1.00 105.74 ? 278  GLU C OE1   1 
ATOM   5717  O  OE2   . GLU C  2  278  ? 61.931  -44.701 61.994  1.00 97.92  ? 278  GLU C OE2   1 
ATOM   5718  N  N     . GLU C  2  279  ? 55.738  -44.183 64.807  1.00 94.30  ? 279  GLU C N     1 
ATOM   5719  C  CA    . GLU C  2  279  ? 54.819  -44.590 65.865  1.00 89.10  ? 279  GLU C CA    1 
ATOM   5720  C  C     . GLU C  2  279  ? 53.361  -44.461 65.442  1.00 88.82  ? 279  GLU C C     1 
ATOM   5721  O  O     . GLU C  2  279  ? 52.524  -45.271 65.856  1.00 86.09  ? 279  GLU C O     1 
ATOM   5722  C  CB    . GLU C  2  279  ? 55.083  -43.754 67.118  1.00 91.85  ? 279  GLU C CB    1 
ATOM   5723  C  CG    . GLU C  2  279  ? 54.339  -44.211 68.357  1.00 106.33 ? 279  GLU C CG    1 
ATOM   5724  C  CD    . GLU C  2  279  ? 54.747  -45.602 68.800  1.00 111.64 ? 279  GLU C CD    1 
ATOM   5725  O  OE1   . GLU C  2  279  ? 53.848  -46.414 69.106  1.00 110.30 ? 279  GLU C OE1   1 
ATOM   5726  O  OE2   . GLU C  2  279  ? 55.966  -45.883 68.840  1.00 106.53 ? 279  GLU C OE2   1 
ATOM   5727  N  N     . LYS C  2  280  ? 53.041  -43.460 64.621  1.00 89.26  ? 280  LYS C N     1 
ATOM   5728  C  CA    . LYS C  2  280  ? 51.667  -43.232 64.192  1.00 87.51  ? 280  LYS C CA    1 
ATOM   5729  C  C     . LYS C  2  280  ? 51.263  -44.196 63.085  1.00 87.62  ? 280  LYS C C     1 
ATOM   5730  O  O     . LYS C  2  280  ? 50.197  -44.816 63.150  1.00 81.73  ? 280  LYS C O     1 
ATOM   5731  C  CB    . LYS C  2  280  ? 51.505  -41.783 63.727  1.00 85.21  ? 280  LYS C CB    1 
ATOM   5732  C  CG    . LYS C  2  280  ? 50.149  -41.456 63.127  1.00 82.30  ? 280  LYS C CG    1 
ATOM   5733  C  CD    . LYS C  2  280  ? 49.074  -41.409 64.192  1.00 80.97  ? 280  LYS C CD    1 
ATOM   5734  C  CE    . LYS C  2  280  ? 47.781  -40.839 63.643  1.00 79.90  ? 280  LYS C CE    1 
ATOM   5735  N  NZ    . LYS C  2  280  ? 46.699  -40.825 64.668  1.00 88.42  ? 280  LYS C NZ    1 
ATOM   5736  N  N     . LEU C  2  281  ? 52.101  -44.330 62.057  1.00 94.68  ? 281  LEU C N     1 
ATOM   5737  C  CA    . LEU C  2  281  ? 51.762  -45.178 60.924  1.00 93.80  ? 281  LEU C CA    1 
ATOM   5738  C  C     . LEU C  2  281  ? 52.115  -46.643 61.143  1.00 94.43  ? 281  LEU C C     1 
ATOM   5739  O  O     . LEU C  2  281  ? 51.667  -47.490 60.362  1.00 98.56  ? 281  LEU C O     1 
ATOM   5740  C  CB    . LEU C  2  281  ? 52.472  -44.666 59.672  1.00 89.89  ? 281  LEU C CB    1 
ATOM   5741  C  CG    . LEU C  2  281  ? 52.291  -43.172 59.425  1.00 83.09  ? 281  LEU C CG    1 
ATOM   5742  C  CD1   . LEU C  2  281  ? 53.349  -42.666 58.459  1.00 89.12  ? 281  LEU C CD1   1 
ATOM   5743  C  CD2   . LEU C  2  281  ? 50.893  -42.902 58.898  1.00 77.69  ? 281  LEU C CD2   1 
ATOM   5744  N  N     . GLY C  2  282  ? 52.898  -46.959 62.168  1.00 88.64  ? 282  GLY C N     1 
ATOM   5745  C  CA    . GLY C  2  282  ? 53.344  -48.325 62.371  1.00 91.66  ? 282  GLY C CA    1 
ATOM   5746  C  C     . GLY C  2  282  ? 54.337  -48.795 61.330  1.00 90.84  ? 282  GLY C C     1 
ATOM   5747  O  O     . GLY C  2  282  ? 54.222  -49.923 60.833  1.00 89.75  ? 282  GLY C O     1 
ATOM   5748  N  N     . ILE C  2  283  ? 55.305  -47.951 60.975  1.00 86.43  ? 283  ILE C N     1 
ATOM   5749  C  CA    . ILE C  2  283  ? 56.313  -48.265 59.977  1.00 87.59  ? 283  ILE C CA    1 
ATOM   5750  C  C     . ILE C  2  283  ? 57.687  -47.933 60.551  1.00 90.45  ? 283  ILE C C     1 
ATOM   5751  O  O     . ILE C  2  283  ? 57.814  -47.474 61.685  1.00 92.79  ? 283  ILE C O     1 
ATOM   5752  C  CB    . ILE C  2  283  ? 56.075  -47.516 58.649  1.00 91.36  ? 283  ILE C CB    1 
ATOM   5753  C  CG1   . ILE C  2  283  ? 56.387  -46.024 58.802  1.00 87.18  ? 283  ILE C CG1   1 
ATOM   5754  C  CG2   . ILE C  2  283  ? 54.643  -47.714 58.176  1.00 89.42  ? 283  ILE C CG2   1 
ATOM   5755  C  CD1   . ILE C  2  283  ? 56.177  -45.219 57.533  1.00 74.49  ? 283  ILE C CD1   1 
ATOM   5756  N  N     . ARG C  2  284  ? 58.722  -48.182 59.752  1.00 92.42  ? 284  ARG C N     1 
ATOM   5757  C  CA    . ARG C  2  284  ? 60.095  -47.866 60.120  1.00 96.28  ? 284  ARG C CA    1 
ATOM   5758  C  C     . ARG C  2  284  ? 60.724  -47.029 59.019  1.00 97.96  ? 284  ARG C C     1 
ATOM   5759  O  O     . ARG C  2  284  ? 60.660  -47.397 57.841  1.00 93.51  ? 284  ARG C O     1 
ATOM   5760  C  CB    . ARG C  2  284  ? 60.919  -49.133 60.363  1.00 92.28  ? 284  ARG C CB    1 
ATOM   5761  C  CG    . ARG C  2  284  ? 61.101  -49.470 61.830  1.00 104.96 ? 284  ARG C CG    1 
ATOM   5762  C  CD    . ARG C  2  284  ? 62.549  -49.825 62.133  1.00 115.99 ? 284  ARG C CD    1 
ATOM   5763  N  NE    . ARG C  2  284  ? 63.472  -48.747 61.779  1.00 118.75 ? 284  ARG C NE    1 
ATOM   5764  C  CZ    . ARG C  2  284  ? 63.870  -47.792 62.616  1.00 125.05 ? 284  ARG C CZ    1 
ATOM   5765  N  NH1   . ARG C  2  284  ? 64.716  -46.855 62.204  1.00 117.68 ? 284  ARG C NH1   1 
ATOM   5766  N  NH2   . ARG C  2  284  ? 63.425  -47.771 63.867  1.00 130.34 ? 284  ARG C NH2   1 
ATOM   5767  N  N     . LEU C  2  285  ? 61.324  -45.909 59.404  1.00 98.46  ? 285  LEU C N     1 
ATOM   5768  C  CA    . LEU C  2  285  ? 61.957  -44.994 58.466  1.00 100.24 ? 285  LEU C CA    1 
ATOM   5769  C  C     . LEU C  2  285  ? 63.450  -45.283 58.385  1.00 102.48 ? 285  LEU C C     1 
ATOM   5770  O  O     . LEU C  2  285  ? 64.116  -45.427 59.415  1.00 106.61 ? 285  LEU C O     1 
ATOM   5771  C  CB    . LEU C  2  285  ? 61.722  -43.542 58.886  1.00 100.23 ? 285  LEU C CB    1 
ATOM   5772  C  CG    . LEU C  2  285  ? 60.569  -42.793 58.214  1.00 95.56  ? 285  LEU C CG    1 
ATOM   5773  C  CD1   . LEU C  2  285  ? 60.859  -42.598 56.733  1.00 98.59  ? 285  LEU C CD1   1 
ATOM   5774  C  CD2   . LEU C  2  285  ? 59.256  -43.528 58.417  1.00 88.41  ? 285  LEU C CD2   1 
ATOM   5775  N  N     . SER C  2  286  ? 63.969  -45.366 57.159  1.00 97.30  ? 286  SER C N     1 
ATOM   5776  C  CA    . SER C  2  286  ? 65.406  -45.498 56.955  1.00 100.62 ? 286  SER C CA    1 
ATOM   5777  C  C     . SER C  2  286  ? 66.148  -44.194 57.202  1.00 102.70 ? 286  SER C C     1 
ATOM   5778  O  O     . SER C  2  286  ? 67.367  -44.212 57.396  1.00 109.66 ? 286  SER C O     1 
ATOM   5779  C  CB    . SER C  2  286  ? 65.695  -45.988 55.534  1.00 107.99 ? 286  SER C CB    1 
ATOM   5780  O  OG    . SER C  2  286  ? 65.215  -45.066 54.570  1.00 107.34 ? 286  SER C OG    1 
ATOM   5781  N  N     . GLY C  2  287  ? 65.446  -43.077 57.193  1.00 97.84  ? 287  GLY C N     1 
ATOM   5782  C  CA    . GLY C  2  287  ? 66.056  -41.796 57.443  1.00 93.57  ? 287  GLY C CA    1 
ATOM   5783  C  C     . GLY C  2  287  ? 64.998  -40.780 57.787  1.00 91.66  ? 287  GLY C C     1 
ATOM   5784  O  O     . GLY C  2  287  ? 63.896  -41.126 58.211  1.00 93.37  ? 287  GLY C O     1 
ATOM   5785  N  N     . ARG C  2  288  ? 65.339  -39.510 57.586  1.00 93.44  ? 288  ARG C N     1 
ATOM   5786  C  CA    . ARG C  2  288  ? 64.451  -38.407 57.920  1.00 84.64  ? 288  ARG C CA    1 
ATOM   5787  C  C     . ARG C  2  288  ? 63.842  -37.750 56.685  1.00 84.23  ? 288  ARG C C     1 
ATOM   5788  O  O     . ARG C  2  288  ? 63.552  -36.548 56.699  1.00 84.01  ? 288  ARG C O     1 
ATOM   5789  C  CB    . ARG C  2  288  ? 65.197  -37.380 58.769  1.00 84.79  ? 288  ARG C CB    1 
ATOM   5790  C  CG    . ARG C  2  288  ? 65.768  -37.965 60.054  1.00 83.36  ? 288  ARG C CG    1 
ATOM   5791  C  CD    . ARG C  2  288  ? 66.105  -36.878 61.054  1.00 87.94  ? 288  ARG C CD    1 
ATOM   5792  N  NE    . ARG C  2  288  ? 67.271  -36.102 60.649  1.00 86.28  ? 288  ARG C NE    1 
ATOM   5793  C  CZ    . ARG C  2  288  ? 68.487  -36.284 61.148  1.00 93.70  ? 288  ARG C CZ    1 
ATOM   5794  N  NH1   . ARG C  2  288  ? 68.688  -37.211 62.075  1.00 93.52  ? 288  ARG C NH1   1 
ATOM   5795  N  NH2   . ARG C  2  288  ? 69.500  -35.539 60.726  1.00 101.65 ? 288  ARG C NH2   1 
ATOM   5796  N  N     . THR C  2  289  ? 63.644  -38.510 55.612  1.00 87.40  ? 289  THR C N     1 
ATOM   5797  C  CA    . THR C  2  289  ? 63.052  -37.994 54.388  1.00 88.90  ? 289  THR C CA    1 
ATOM   5798  C  C     . THR C  2  289  ? 61.822  -38.811 54.015  1.00 84.28  ? 289  THR C C     1 
ATOM   5799  O  O     . THR C  2  289  ? 61.626  -39.935 54.486  1.00 81.28  ? 289  THR C O     1 
ATOM   5800  C  CB    . THR C  2  289  ? 64.061  -38.007 53.233  1.00 92.81  ? 289  THR C CB    1 
ATOM   5801  O  OG1   . THR C  2  289  ? 64.708  -39.284 53.174  1.00 91.25  ? 289  THR C OG1   1 
ATOM   5802  C  CG2   . THR C  2  289  ? 65.107  -36.921 53.432  1.00 94.85  ? 289  THR C CG2   1 
ATOM   5803  N  N     . LEU C  2  290  ? 60.990  -38.226 53.152  1.00 83.94  ? 290  LEU C N     1 
ATOM   5804  C  CA    . LEU C  2  290  ? 59.755  -38.872 52.723  1.00 89.50  ? 290  LEU C CA    1 
ATOM   5805  C  C     . LEU C  2  290  ? 59.986  -39.994 51.721  1.00 95.55  ? 290  LEU C C     1 
ATOM   5806  O  O     . LEU C  2  290  ? 59.124  -40.869 51.584  1.00 92.29  ? 290  LEU C O     1 
ATOM   5807  C  CB    . LEU C  2  290  ? 58.805  -37.844 52.109  1.00 88.28  ? 290  LEU C CB    1 
ATOM   5808  C  CG    . LEU C  2  290  ? 58.332  -36.717 53.023  1.00 81.58  ? 290  LEU C CG    1 
ATOM   5809  C  CD1   . LEU C  2  290  ? 57.360  -35.807 52.292  1.00 81.02  ? 290  LEU C CD1   1 
ATOM   5810  C  CD2   . LEU C  2  290  ? 57.699  -37.289 54.275  1.00 84.31  ? 290  LEU C CD2   1 
ATOM   5811  N  N     . ALA C  2  291  ? 61.106  -39.975 51.006  1.00 99.27  ? 291  ALA C N     1 
ATOM   5812  C  CA    . ALA C  2  291  ? 61.434  -41.019 50.045  1.00 96.60  ? 291  ALA C CA    1 
ATOM   5813  C  C     . ALA C  2  291  ? 62.949  -41.050 49.888  1.00 100.79 ? 291  ALA C C     1 
ATOM   5814  O  O     . ALA C  2  291  ? 63.672  -40.271 50.516  1.00 96.32  ? 291  ALA C O     1 
ATOM   5815  C  CB    . ALA C  2  291  ? 60.723  -40.788 48.709  1.00 88.85  ? 291  ALA C CB    1 
ATOM   5816  N  N     . ARG C  2  292  ? 63.430  -41.964 49.046  1.00 112.45 ? 292  ARG C N     1 
ATOM   5817  C  CA    . ARG C  2  292  ? 64.855  -42.117 48.796  1.00 107.19 ? 292  ARG C CA    1 
ATOM   5818  C  C     . ARG C  2  292  ? 65.132  -42.123 47.301  1.00 106.42 ? 292  ARG C C     1 
ATOM   5819  O  O     . ARG C  2  292  ? 64.269  -42.473 46.492  1.00 102.94 ? 292  ARG C O     1 
ATOM   5820  C  CB    . ARG C  2  292  ? 65.405  -43.410 49.398  1.00 104.25 ? 292  ARG C CB    1 
ATOM   5821  C  CG    . ARG C  2  292  ? 65.282  -43.522 50.896  1.00 110.41 ? 292  ARG C CG    1 
ATOM   5822  C  CD    . ARG C  2  292  ? 65.675  -44.917 51.316  1.00 114.14 ? 292  ARG C CD    1 
ATOM   5823  N  NE    . ARG C  2  292  ? 64.903  -45.915 50.585  1.00 117.90 ? 292  ARG C NE    1 
ATOM   5824  C  CZ    . ARG C  2  292  ? 65.148  -47.220 50.617  1.00 124.20 ? 292  ARG C CZ    1 
ATOM   5825  N  NH1   . ARG C  2  292  ? 66.154  -47.688 51.345  1.00 122.13 ? 292  ARG C NH1   1 
ATOM   5826  N  NH2   . ARG C  2  292  ? 64.390  -48.056 49.920  1.00 127.02 ? 292  ARG C NH2   1 
ATOM   5827  N  N     . PHE C  2  293  ? 66.355  -41.739 46.945  1.00 112.98 ? 293  PHE C N     1 
ATOM   5828  C  CA    . PHE C  2  293  ? 66.886  -41.915 45.597  1.00 115.87 ? 293  PHE C CA    1 
ATOM   5829  C  C     . PHE C  2  293  ? 67.894  -43.055 45.680  1.00 114.88 ? 293  PHE C C     1 
ATOM   5830  O  O     . PHE C  2  293  ? 69.013  -42.872 46.165  1.00 111.73 ? 293  PHE C O     1 
ATOM   5831  C  CB    . PHE C  2  293  ? 67.527  -40.636 45.068  1.00 113.72 ? 293  PHE C CB    1 
ATOM   5832  C  CG    . PHE C  2  293  ? 67.922  -40.710 43.617  1.00 120.51 ? 293  PHE C CG    1 
ATOM   5833  C  CD1   . PHE C  2  293  ? 66.990  -40.463 42.620  1.00 117.96 ? 293  PHE C CD1   1 
ATOM   5834  C  CD2   . PHE C  2  293  ? 69.222  -41.026 43.249  1.00 118.75 ? 293  PHE C CD2   1 
ATOM   5835  C  CE1   . PHE C  2  293  ? 67.346  -40.530 41.287  1.00 114.56 ? 293  PHE C CE1   1 
ATOM   5836  C  CE2   . PHE C  2  293  ? 69.583  -41.095 41.917  1.00 114.41 ? 293  PHE C CE2   1 
ATOM   5837  C  CZ    . PHE C  2  293  ? 68.643  -40.846 40.936  1.00 118.97 ? 293  PHE C CZ    1 
ATOM   5838  N  N     . GLU C  2  294  ? 67.491  -44.232 45.217  1.00 117.27 ? 294  GLU C N     1 
ATOM   5839  C  CA    . GLU C  2  294  ? 68.327  -45.417 45.309  1.00 125.11 ? 294  GLU C CA    1 
ATOM   5840  C  C     . GLU C  2  294  ? 68.430  -46.060 43.935  1.00 138.76 ? 294  GLU C C     1 
ATOM   5841  O  O     . GLU C  2  294  ? 67.429  -46.151 43.214  1.00 142.86 ? 294  GLU C O     1 
ATOM   5842  C  CB    . GLU C  2  294  ? 67.764  -46.410 46.330  1.00 121.23 ? 294  GLU C CB    1 
ATOM   5843  C  CG    . GLU C  2  294  ? 68.739  -47.499 46.737  1.00 127.96 ? 294  GLU C CG    1 
ATOM   5844  C  CD    . GLU C  2  294  ? 68.221  -48.356 47.878  1.00 131.44 ? 294  GLU C CD    1 
ATOM   5845  O  OE1   . GLU C  2  294  ? 67.458  -49.310 47.616  1.00 128.44 ? 294  GLU C OE1   1 
ATOM   5846  O  OE2   . GLU C  2  294  ? 68.577  -48.072 49.041  1.00 129.76 ? 294  GLU C OE2   1 
ATOM   5847  N  N     . ASP C  2  295  ? 69.649  -46.468 43.567  1.00 135.24 ? 295  ASP C N     1 
ATOM   5848  C  CA    . ASP C  2  295  ? 69.917  -47.191 42.320  1.00 132.93 ? 295  ASP C CA    1 
ATOM   5849  C  C     . ASP C  2  295  ? 69.330  -46.474 41.107  1.00 127.97 ? 295  ASP C C     1 
ATOM   5850  O  O     . ASP C  2  295  ? 68.903  -47.106 40.137  1.00 131.30 ? 295  ASP C O     1 
ATOM   5851  C  CB    . ASP C  2  295  ? 69.405  -48.630 42.401  1.00 135.56 ? 295  ASP C CB    1 
ATOM   5852  C  CG    . ASP C  2  295  ? 70.030  -49.401 43.547  1.00 137.21 ? 295  ASP C CG    1 
ATOM   5853  O  OD1   . ASP C  2  295  ? 71.205  -49.127 43.877  1.00 136.53 ? 295  ASP C OD1   1 
ATOM   5854  O  OD2   . ASP C  2  295  ? 69.347  -50.273 44.122  1.00 133.70 ? 295  ASP C OD2   1 
ATOM   5855  N  N     . GLY C  2  296  ? 69.297  -45.143 41.159  1.00 121.28 ? 296  GLY C N     1 
ATOM   5856  C  CA    . GLY C  2  296  ? 68.835  -44.339 40.056  1.00 124.78 ? 296  GLY C CA    1 
ATOM   5857  C  C     . GLY C  2  296  ? 67.363  -43.983 40.076  1.00 124.20 ? 296  GLY C C     1 
ATOM   5858  O  O     . GLY C  2  296  ? 66.958  -43.065 39.357  1.00 125.80 ? 296  GLY C O     1 
ATOM   5859  N  N     . GLU C  2  297  ? 66.545  -44.671 40.862  1.00 122.59 ? 297  GLU C N     1 
ATOM   5860  C  CA    . GLU C  2  297  ? 65.115  -44.391 40.865  1.00 125.05 ? 297  GLU C CA    1 
ATOM   5861  C  C     . GLU C  2  297  ? 64.671  -43.910 42.246  1.00 123.70 ? 297  GLU C C     1 
ATOM   5862  O  O     . GLU C  2  297  ? 65.466  -43.800 43.184  1.00 121.39 ? 297  GLU C O     1 
ATOM   5863  C  CB    . GLU C  2  297  ? 64.316  -45.618 40.415  1.00 125.51 ? 297  GLU C CB    1 
ATOM   5864  C  CG    . GLU C  2  297  ? 64.463  -46.831 41.309  1.00 126.82 ? 297  GLU C CG    1 
ATOM   5865  C  CD    . GLU C  2  297  ? 63.462  -47.922 40.976  1.00 126.81 ? 297  GLU C CD    1 
ATOM   5866  O  OE1   . GLU C  2  297  ? 63.399  -48.915 41.729  1.00 128.27 ? 297  GLU C OE1   1 
ATOM   5867  O  OE2   . GLU C  2  297  ? 62.734  -47.785 39.968  1.00 124.00 ? 297  GLU C OE2   1 
ATOM   5868  N  N     . PHE C  2  298  ? 63.383  -43.597 42.355  1.00 120.61 ? 298  PHE C N     1 
ATOM   5869  C  CA    . PHE C  2  298  ? 62.793  -43.114 43.596  1.00 115.88 ? 298  PHE C CA    1 
ATOM   5870  C  C     . PHE C  2  298  ? 62.063  -44.253 44.293  1.00 111.06 ? 298  PHE C C     1 
ATOM   5871  O  O     . PHE C  2  298  ? 61.297  -44.987 43.661  1.00 113.01 ? 298  PHE C O     1 
ATOM   5872  C  CB    . PHE C  2  298  ? 61.835  -41.951 43.336  1.00 111.19 ? 298  PHE C CB    1 
ATOM   5873  C  CG    . PHE C  2  298  ? 62.527  -40.647 43.058  1.00 113.91 ? 298  PHE C CG    1 
ATOM   5874  C  CD1   . PHE C  2  298  ? 63.020  -39.873 44.096  1.00 112.14 ? 298  PHE C CD1   1 
ATOM   5875  C  CD2   . PHE C  2  298  ? 62.683  -40.193 41.759  1.00 114.26 ? 298  PHE C CD2   1 
ATOM   5876  C  CE1   . PHE C  2  298  ? 63.657  -38.672 43.845  1.00 107.36 ? 298  PHE C CE1   1 
ATOM   5877  C  CE2   . PHE C  2  298  ? 63.320  -38.992 41.502  1.00 114.93 ? 298  PHE C CE2   1 
ATOM   5878  C  CZ    . PHE C  2  298  ? 63.807  -38.231 42.546  1.00 107.98 ? 298  PHE C CZ    1 
ATOM   5879  N  N     . LYS C  2  299  ? 62.304  -44.393 45.594  1.00 109.27 ? 299  LYS C N     1 
ATOM   5880  C  CA    . LYS C  2  299  ? 61.714  -45.447 46.409  1.00 110.27 ? 299  LYS C CA    1 
ATOM   5881  C  C     . LYS C  2  299  ? 60.929  -44.809 47.547  1.00 110.16 ? 299  LYS C C     1 
ATOM   5882  O  O     . LYS C  2  299  ? 61.479  -44.008 48.312  1.00 109.45 ? 299  LYS C O     1 
ATOM   5883  C  CB    . LYS C  2  299  ? 62.794  -46.386 46.949  1.00 112.70 ? 299  LYS C CB    1 
ATOM   5884  C  CG    . LYS C  2  299  ? 63.482  -47.205 45.870  1.00 119.58 ? 299  LYS C CG    1 
ATOM   5885  C  CD    . LYS C  2  299  ? 64.581  -48.078 46.445  1.00 124.30 ? 299  LYS C CD    1 
ATOM   5886  C  CE    . LYS C  2  299  ? 65.150  -49.008 45.386  1.00 122.78 ? 299  LYS C CE    1 
ATOM   5887  N  NZ    . LYS C  2  299  ? 64.149  -50.019 44.942  1.00 117.81 ? 299  LYS C NZ    1 
ATOM   5888  N  N     . ASP C  2  300  ? 59.653  -45.170 47.658  1.00 107.28 ? 300  ASP C N     1 
ATOM   5889  C  CA    . ASP C  2  300  ? 58.768  -44.562 48.642  1.00 103.26 ? 300  ASP C CA    1 
ATOM   5890  C  C     . ASP C  2  300  ? 59.143  -44.977 50.062  1.00 106.34 ? 300  ASP C C     1 
ATOM   5891  O  O     . ASP C  2  300  ? 59.571  -46.106 50.313  1.00 108.33 ? 300  ASP C O     1 
ATOM   5892  C  CB    . ASP C  2  300  ? 57.318  -44.956 48.364  1.00 100.23 ? 300  ASP C CB    1 
ATOM   5893  C  CG    . ASP C  2  300  ? 56.339  -44.312 49.331  1.00 97.01  ? 300  ASP C CG    1 
ATOM   5894  O  OD1   . ASP C  2  300  ? 56.627  -43.200 49.822  1.00 95.27  ? 300  ASP C OD1   1 
ATOM   5895  O  OD2   . ASP C  2  300  ? 55.285  -44.921 49.609  1.00 99.96  ? 300  ASP C OD2   1 
ATOM   5896  N  N     . GLU C  2  301  ? 58.982  -44.039 50.995  1.00 104.89 ? 301  GLU C N     1 
ATOM   5897  C  CA    . GLU C  2  301  ? 59.118  -44.308 52.422  1.00 101.19 ? 301  GLU C CA    1 
ATOM   5898  C  C     . GLU C  2  301  ? 57.844  -44.024 53.199  1.00 98.89  ? 301  GLU C C     1 
ATOM   5899  O  O     . GLU C  2  301  ? 57.390  -44.873 53.978  1.00 92.71  ? 301  GLU C O     1 
ATOM   5900  C  CB    . GLU C  2  301  ? 60.272  -43.484 53.010  1.00 99.31  ? 301  GLU C CB    1 
ATOM   5901  C  CG    . GLU C  2  301  ? 61.651  -44.004 52.665  1.00 107.74 ? 301  GLU C CG    1 
ATOM   5902  C  CD    . GLU C  2  301  ? 62.092  -45.119 53.588  1.00 111.01 ? 301  GLU C CD    1 
ATOM   5903  O  OE1   . GLU C  2  301  ? 61.366  -45.402 54.565  1.00 109.32 ? 301  GLU C OE1   1 
ATOM   5904  O  OE2   . GLU C  2  301  ? 63.165  -45.708 53.340  1.00 110.61 ? 301  GLU C OE2   1 
ATOM   5905  N  N     . VAL C  2  302  ? 57.254  -42.847 53.013  1.00 98.42  ? 302  VAL C N     1 
ATOM   5906  C  CA    . VAL C  2  302  ? 56.236  -42.326 53.911  1.00 86.17  ? 302  VAL C CA    1 
ATOM   5907  C  C     . VAL C  2  302  ? 54.851  -42.332 53.274  1.00 84.40  ? 302  VAL C C     1 
ATOM   5908  O  O     . VAL C  2  302  ? 53.857  -42.582 53.958  1.00 87.09  ? 302  VAL C O     1 
ATOM   5909  C  CB    . VAL C  2  302  ? 56.624  -40.902 54.376  1.00 82.64  ? 302  VAL C CB    1 
ATOM   5910  C  CG1   . VAL C  2  302  ? 55.506  -40.258 55.170  1.00 82.72  ? 302  VAL C CG1   1 
ATOM   5911  C  CG2   . VAL C  2  302  ? 57.899  -40.938 55.202  1.00 83.69  ? 302  VAL C CG2   1 
ATOM   5912  N  N     . PHE C  2  303  ? 54.767  -42.071 51.968  1.00 86.66  ? 303  PHE C N     1 
ATOM   5913  C  CA    . PHE C  2  303  ? 53.501  -41.660 51.359  1.00 86.42  ? 303  PHE C CA    1 
ATOM   5914  C  C     . PHE C  2  303  ? 52.437  -42.749 51.443  1.00 88.70  ? 303  PHE C C     1 
ATOM   5915  O  O     . PHE C  2  303  ? 51.273  -42.470 51.754  1.00 89.14  ? 303  PHE C O     1 
ATOM   5916  C  CB    . PHE C  2  303  ? 53.728  -41.248 49.908  1.00 83.38  ? 303  PHE C CB    1 
ATOM   5917  C  CG    . PHE C  2  303  ? 54.350  -39.898 49.767  1.00 82.26  ? 303  PHE C CG    1 
ATOM   5918  C  CD1   . PHE C  2  303  ? 55.723  -39.749 49.817  1.00 88.39  ? 303  PHE C CD1   1 
ATOM   5919  C  CD2   . PHE C  2  303  ? 53.562  -38.774 49.601  1.00 79.31  ? 303  PHE C CD2   1 
ATOM   5920  C  CE1   . PHE C  2  303  ? 56.302  -38.504 49.695  1.00 89.09  ? 303  PHE C CE1   1 
ATOM   5921  C  CE2   . PHE C  2  303  ? 54.134  -37.527 49.479  1.00 83.86  ? 303  PHE C CE2   1 
ATOM   5922  C  CZ    . PHE C  2  303  ? 55.507  -37.390 49.525  1.00 86.98  ? 303  PHE C CZ    1 
ATOM   5923  N  N     . LEU C  2  304  ? 52.803  -43.988 51.137  1.00 90.59  ? 304  LEU C N     1 
ATOM   5924  C  CA    . LEU C  2  304  ? 51.796  -45.041 51.099  1.00 94.09  ? 304  LEU C CA    1 
ATOM   5925  C  C     . LEU C  2  304  ? 51.228  -45.346 52.487  1.00 92.31  ? 304  LEU C C     1 
ATOM   5926  O  O     . LEU C  2  304  ? 50.010  -45.521 52.608  1.00 90.57  ? 304  LEU C O     1 
ATOM   5927  C  CB    . LEU C  2  304  ? 52.359  -46.309 50.454  1.00 98.84  ? 304  LEU C CB    1 
ATOM   5928  C  CG    . LEU C  2  304  ? 51.333  -47.429 50.265  1.00 97.99  ? 304  LEU C CG    1 
ATOM   5929  C  CD1   . LEU C  2  304  ? 50.220  -46.972 49.337  1.00 96.45  ? 304  LEU C CD1   1 
ATOM   5930  C  CD2   . LEU C  2  304  ? 51.989  -48.696 49.743  1.00 107.50 ? 304  LEU C CD2   1 
ATOM   5931  N  N     . PRO C  2  305  ? 52.045  -45.438 53.550  1.00 89.70  ? 305  PRO C N     1 
ATOM   5932  C  CA    . PRO C  2  305  ? 51.444  -45.599 54.888  1.00 90.21  ? 305  PRO C CA    1 
ATOM   5933  C  C     . PRO C  2  305  ? 50.530  -44.452 55.293  1.00 90.11  ? 305  PRO C C     1 
ATOM   5934  O  O     . PRO C  2  305  ? 49.486  -44.696 55.911  1.00 87.69  ? 305  PRO C O     1 
ATOM   5935  C  CB    . PRO C  2  305  ? 52.667  -45.708 55.807  1.00 90.24  ? 305  PRO C CB    1 
ATOM   5936  C  CG    . PRO C  2  305  ? 53.716  -46.284 54.948  1.00 83.29  ? 305  PRO C CG    1 
ATOM   5937  C  CD    . PRO C  2  305  ? 53.500  -45.684 53.589  1.00 89.34  ? 305  PRO C CD    1 
ATOM   5938  N  N     . THR C  2  306  ? 50.885  -43.207 54.964  1.00 89.70  ? 306  THR C N     1 
ATOM   5939  C  CA    . THR C  2  306  ? 50.018  -42.083 55.308  1.00 88.14  ? 306  THR C CA    1 
ATOM   5940  C  C     . THR C  2  306  ? 48.708  -42.139 54.533  1.00 88.26  ? 306  THR C C     1 
ATOM   5941  O  O     . THR C  2  306  ? 47.637  -41.875 55.092  1.00 89.85  ? 306  THR C O     1 
ATOM   5942  C  CB    . THR C  2  306  ? 50.729  -40.759 55.044  1.00 80.54  ? 306  THR C CB    1 
ATOM   5943  O  OG1   . THR C  2  306  ? 51.024  -40.651 53.648  1.00 89.02  ? 306  THR C OG1   1 
ATOM   5944  C  CG2   . THR C  2  306  ? 52.019  -40.692 55.826  1.00 77.17  ? 306  THR C CG2   1 
ATOM   5945  N  N     . LEU C  2  307  ? 48.774  -42.484 53.246  1.00 92.95  ? 307  LEU C N     1 
ATOM   5946  C  CA    . LEU C  2  307  ? 47.556  -42.622 52.454  1.00 95.63  ? 307  LEU C CA    1 
ATOM   5947  C  C     . LEU C  2  307  ? 46.684  -43.756 52.980  1.00 91.78  ? 307  LEU C C     1 
ATOM   5948  O  O     . LEU C  2  307  ? 45.453  -43.633 53.035  1.00 88.28  ? 307  LEU C O     1 
ATOM   5949  C  CB    . LEU C  2  307  ? 47.920  -42.848 50.987  1.00 92.08  ? 307  LEU C CB    1 
ATOM   5950  C  CG    . LEU C  2  307  ? 46.788  -43.144 50.007  1.00 93.05  ? 307  LEU C CG    1 
ATOM   5951  C  CD1   . LEU C  2  307  ? 45.762  -42.025 50.006  1.00 90.73  ? 307  LEU C CD1   1 
ATOM   5952  C  CD2   . LEU C  2  307  ? 47.362  -43.357 48.617  1.00 104.18 ? 307  LEU C CD2   1 
ATOM   5953  N  N     . ARG C  2  308  ? 47.306  -44.866 53.383  1.00 92.38  ? 308  ARG C N     1 
ATOM   5954  C  CA    . ARG C  2  308  ? 46.549  -45.986 53.931  1.00 92.91  ? 308  ARG C CA    1 
ATOM   5955  C  C     . ARG C  2  308  ? 45.878  -45.597 55.242  1.00 93.36  ? 308  ARG C C     1 
ATOM   5956  O  O     . ARG C  2  308  ? 44.710  -45.929 55.472  1.00 96.19  ? 308  ARG C O     1 
ATOM   5957  C  CB    . ARG C  2  308  ? 47.476  -47.193 54.111  1.00 91.95  ? 308  ARG C CB    1 
ATOM   5958  C  CG    . ARG C  2  308  ? 46.788  -48.520 54.420  1.00 95.57  ? 308  ARG C CG    1 
ATOM   5959  C  CD    . ARG C  2  308  ? 46.659  -48.733 55.918  1.00 101.79 ? 308  ARG C CD    1 
ATOM   5960  N  NE    . ARG C  2  308  ? 47.887  -48.360 56.617  1.00 113.75 ? 308  ARG C NE    1 
ATOM   5961  C  CZ    . ARG C  2  308  ? 47.973  -48.182 57.932  1.00 113.57 ? 308  ARG C CZ    1 
ATOM   5962  N  NH1   . ARG C  2  308  ? 46.899  -48.341 58.694  1.00 107.51 ? 308  ARG C NH1   1 
ATOM   5963  N  NH2   . ARG C  2  308  ? 49.132  -47.838 58.484  1.00 108.13 ? 308  ARG C NH2   1 
ATOM   5964  N  N     . TYR C  2  309  ? 46.599  -44.882 56.111  1.00 93.99  ? 309  TYR C N     1 
ATOM   5965  C  CA    . TYR C  2  309  ? 46.003  -44.418 57.359  1.00 86.52  ? 309  TYR C CA    1 
ATOM   5966  C  C     . TYR C  2  309  ? 44.859  -43.450 57.089  1.00 84.96  ? 309  TYR C C     1 
ATOM   5967  O  O     . TYR C  2  309  ? 43.829  -43.494 57.768  1.00 88.00  ? 309  TYR C O     1 
ATOM   5968  C  CB    . TYR C  2  309  ? 47.068  -43.762 58.238  1.00 86.10  ? 309  TYR C CB    1 
ATOM   5969  C  CG    . TYR C  2  309  ? 46.706  -43.675 59.707  1.00 84.24  ? 309  TYR C CG    1 
ATOM   5970  C  CD1   . TYR C  2  309  ? 45.749  -42.773 60.159  1.00 83.43  ? 309  TYR C CD1   1 
ATOM   5971  C  CD2   . TYR C  2  309  ? 47.335  -44.482 60.644  1.00 86.51  ? 309  TYR C CD2   1 
ATOM   5972  C  CE1   . TYR C  2  309  ? 45.420  -42.688 61.498  1.00 80.37  ? 309  TYR C CE1   1 
ATOM   5973  C  CE2   . TYR C  2  309  ? 47.014  -44.403 61.986  1.00 89.66  ? 309  TYR C CE2   1 
ATOM   5974  C  CZ    . TYR C  2  309  ? 46.055  -43.505 62.408  1.00 85.29  ? 309  TYR C CZ    1 
ATOM   5975  O  OH    . TYR C  2  309  ? 45.734  -43.425 63.744  1.00 83.81  ? 309  TYR C OH    1 
ATOM   5976  N  N     . LEU C  2  310  ? 45.018  -42.574 56.094  1.00 84.86  ? 310  LEU C N     1 
ATOM   5977  C  CA    . LEU C  2  310  ? 43.954  -41.634 55.755  1.00 84.69  ? 310  LEU C CA    1 
ATOM   5978  C  C     . LEU C  2  310  ? 42.705  -42.367 55.280  1.00 87.78  ? 310  LEU C C     1 
ATOM   5979  O  O     . LEU C  2  310  ? 41.587  -42.055 55.708  1.00 87.28  ? 310  LEU C O     1 
ATOM   5980  C  CB    . LEU C  2  310  ? 44.443  -40.654 54.690  1.00 84.39  ? 310  LEU C CB    1 
ATOM   5981  C  CG    . LEU C  2  310  ? 43.370  -39.768 54.057  1.00 86.79  ? 310  LEU C CG    1 
ATOM   5982  C  CD1   . LEU C  2  310  ? 42.707  -38.894 55.110  1.00 89.72  ? 310  LEU C CD1   1 
ATOM   5983  C  CD2   . LEU C  2  310  ? 43.960  -38.921 52.940  1.00 85.30  ? 310  LEU C CD2   1 
ATOM   5984  N  N     . PHE C  2  311  ? 42.878  -43.346 54.386  1.00 93.49  ? 311  PHE C N     1 
ATOM   5985  C  CA    . PHE C  2  311  ? 41.731  -44.113 53.906  1.00 94.89  ? 311  PHE C CA    1 
ATOM   5986  C  C     . PHE C  2  311  ? 41.064  -44.877 55.044  1.00 99.39  ? 311  PHE C C     1 
ATOM   5987  O  O     . PHE C  2  311  ? 39.830  -44.901 55.148  1.00 101.02 ? 311  PHE C O     1 
ATOM   5988  C  CB    . PHE C  2  311  ? 42.159  -45.076 52.795  1.00 101.87 ? 311  PHE C CB    1 
ATOM   5989  C  CG    . PHE C  2  311  ? 42.312  -44.429 51.442  1.00 107.54 ? 311  PHE C CG    1 
ATOM   5990  C  CD1   . PHE C  2  311  ? 41.964  -43.103 51.241  1.00 107.92 ? 311  PHE C CD1   1 
ATOM   5991  C  CD2   . PHE C  2  311  ? 42.795  -45.158 50.367  1.00 108.33 ? 311  PHE C CD2   1 
ATOM   5992  C  CE1   . PHE C  2  311  ? 42.105  -42.515 49.994  1.00 110.16 ? 311  PHE C CE1   1 
ATOM   5993  C  CE2   . PHE C  2  311  ? 42.938  -44.577 49.121  1.00 106.94 ? 311  PHE C CE2   1 
ATOM   5994  C  CZ    . PHE C  2  311  ? 42.592  -43.255 48.934  1.00 108.29 ? 311  PHE C CZ    1 
ATOM   5995  N  N     . ALA C  2  312  ? 41.864  -45.504 55.913  1.00 100.32 ? 312  ALA C N     1 
ATOM   5996  C  CA    . ALA C  2  312  ? 41.302  -46.274 57.019  1.00 95.05  ? 312  ALA C CA    1 
ATOM   5997  C  C     . ALA C  2  312  ? 40.564  -45.373 58.000  1.00 92.67  ? 312  ALA C C     1 
ATOM   5998  O  O     . ALA C  2  312  ? 39.541  -45.770 58.570  1.00 93.75  ? 312  ALA C O     1 
ATOM   5999  C  CB    . ALA C  2  312  ? 42.406  -47.055 57.729  1.00 96.42  ? 312  ALA C CB    1 
ATOM   6000  N  N     . LEU C  2  313  ? 41.064  -44.155 58.209  1.00 91.85  ? 313  LEU C N     1 
ATOM   6001  C  CA    . LEU C  2  313  ? 40.360  -43.207 59.062  1.00 91.95  ? 313  LEU C CA    1 
ATOM   6002  C  C     . LEU C  2  313  ? 39.058  -42.755 58.414  1.00 95.31  ? 313  LEU C C     1 
ATOM   6003  O  O     . LEU C  2  313  ? 38.038  -42.605 59.096  1.00 101.97 ? 313  LEU C O     1 
ATOM   6004  C  CB    . LEU C  2  313  ? 41.263  -42.011 59.364  1.00 91.00  ? 313  LEU C CB    1 
ATOM   6005  C  CG    . LEU C  2  313  ? 40.730  -40.924 60.299  1.00 93.74  ? 313  LEU C CG    1 
ATOM   6006  C  CD1   . LEU C  2  313  ? 40.476  -41.482 61.692  1.00 91.89  ? 313  LEU C CD1   1 
ATOM   6007  C  CD2   . LEU C  2  313  ? 41.701  -39.756 60.352  1.00 88.47  ? 313  LEU C CD2   1 
ATOM   6008  N  N     . THR C  2  314  ? 39.072  -42.545 57.094  1.00 93.04  ? 314  THR C N     1 
ATOM   6009  C  CA    . THR C  2  314  ? 37.862  -42.113 56.400  1.00 95.82  ? 314  THR C CA    1 
ATOM   6010  C  C     . THR C  2  314  ? 36.785  -43.190 56.439  1.00 101.24 ? 314  THR C C     1 
ATOM   6011  O  O     . THR C  2  314  ? 35.597  -42.884 56.607  1.00 97.82  ? 314  THR C O     1 
ATOM   6012  C  CB    . THR C  2  314  ? 38.195  -41.737 54.957  1.00 88.73  ? 314  THR C CB    1 
ATOM   6013  O  OG1   . THR C  2  314  ? 39.254  -40.773 54.951  1.00 84.22  ? 314  THR C OG1   1 
ATOM   6014  C  CG2   . THR C  2  314  ? 36.976  -41.145 54.263  1.00 97.97  ? 314  THR C CG2   1 
ATOM   6015  N  N     . ALA C  2  315  ? 37.178  -44.458 56.298  1.00 101.06 ? 315  ALA C N     1 
ATOM   6016  C  CA    . ALA C  2  315  ? 36.201  -45.542 56.312  1.00 103.00 ? 315  ALA C CA    1 
ATOM   6017  C  C     . ALA C  2  315  ? 35.633  -45.806 57.702  1.00 103.25 ? 315  ALA C C     1 
ATOM   6018  O  O     . ALA C  2  315  ? 34.564  -46.417 57.813  1.00 99.67  ? 315  ALA C O     1 
ATOM   6019  C  CB    . ALA C  2  315  ? 36.829  -46.822 55.757  1.00 96.86  ? 315  ALA C CB    1 
ATOM   6020  N  N     . GLY C  2  316  ? 36.310  -45.360 58.758  1.00 105.58 ? 316  GLY C N     1 
ATOM   6021  C  CA    . GLY C  2  316  ? 35.894  -45.678 60.108  1.00 101.57 ? 316  GLY C CA    1 
ATOM   6022  C  C     . GLY C  2  316  ? 36.520  -46.929 60.678  1.00 96.93  ? 316  GLY C C     1 
ATOM   6023  O  O     . GLY C  2  316  ? 35.931  -47.553 61.569  1.00 96.64  ? 316  GLY C O     1 
ATOM   6024  N  N     . VAL C  2  317  ? 37.696  -47.314 60.193  1.00 93.51  ? 317  VAL C N     1 
ATOM   6025  C  CA    . VAL C  2  317  ? 38.352  -48.550 60.636  1.00 95.58  ? 317  VAL C CA    1 
ATOM   6026  C  C     . VAL C  2  317  ? 38.852  -48.372 62.064  1.00 102.07 ? 317  VAL C C     1 
ATOM   6027  O  O     . VAL C  2  317  ? 39.543  -47.381 62.358  1.00 100.62 ? 317  VAL C O     1 
ATOM   6028  C  CB    . VAL C  2  317  ? 39.497  -48.916 59.690  1.00 95.99  ? 317  VAL C CB    1 
ATOM   6029  C  CG1   . VAL C  2  317  ? 40.330  -50.053 60.273  1.00 97.55  ? 317  VAL C CG1   1 
ATOM   6030  C  CG2   . VAL C  2  317  ? 38.949  -49.308 58.330  1.00 99.49  ? 317  VAL C CG2   1 
ATOM   6031  N  N     . PRO C  2  318  ? 38.535  -49.294 62.973  1.00 101.55 ? 318  PRO C N     1 
ATOM   6032  C  CA    . PRO C  2  318  ? 38.944  -49.129 64.373  1.00 104.28 ? 318  PRO C CA    1 
ATOM   6033  C  C     . PRO C  2  318  ? 40.459  -49.094 64.524  1.00 96.05  ? 318  PRO C C     1 
ATOM   6034  O  O     . PRO C  2  318  ? 41.192  -49.776 63.804  1.00 92.28  ? 318  PRO C O     1 
ATOM   6035  C  CB    . PRO C  2  318  ? 38.336  -50.357 65.063  1.00 106.39 ? 318  PRO C CB    1 
ATOM   6036  C  CG    . PRO C  2  318  ? 37.221  -50.790 64.161  1.00 101.92 ? 318  PRO C CG    1 
ATOM   6037  C  CD    . PRO C  2  318  ? 37.670  -50.469 62.776  1.00 95.50  ? 318  PRO C CD    1 
ATOM   6038  N  N     . GLY C  2  319  ? 40.924  -48.279 65.472  1.00 95.20  ? 319  GLY C N     1 
ATOM   6039  C  CA    . GLY C  2  319  ? 42.340  -48.111 65.727  1.00 96.06  ? 319  GLY C CA    1 
ATOM   6040  C  C     . GLY C  2  319  ? 42.970  -46.908 65.062  1.00 96.90  ? 319  GLY C C     1 
ATOM   6041  O  O     . GLY C  2  319  ? 44.187  -46.720 65.186  1.00 91.43  ? 319  GLY C O     1 
ATOM   6042  N  N     . HIS C  2  320  ? 42.184  -46.092 64.363  1.00 100.44 ? 320  HIS C N     1 
ATOM   6043  C  CA    . HIS C  2  320  ? 42.673  -44.917 63.656  1.00 93.49  ? 320  HIS C CA    1 
ATOM   6044  C  C     . HIS C  2  320  ? 41.990  -43.682 64.222  1.00 94.82  ? 320  HIS C C     1 
ATOM   6045  O  O     . HIS C  2  320  ? 40.757  -43.624 64.283  1.00 99.52  ? 320  HIS C O     1 
ATOM   6046  C  CB    . HIS C  2  320  ? 42.412  -45.037 62.153  1.00 89.66  ? 320  HIS C CB    1 
ATOM   6047  C  CG    . HIS C  2  320  ? 43.038  -46.245 61.528  1.00 90.94  ? 320  HIS C CG    1 
ATOM   6048  N  ND1   . HIS C  2  320  ? 42.565  -47.522 61.740  1.00 91.83  ? 320  HIS C ND1   1 
ATOM   6049  C  CD2   . HIS C  2  320  ? 44.104  -46.371 60.703  1.00 91.28  ? 320  HIS C CD2   1 
ATOM   6050  C  CE1   . HIS C  2  320  ? 43.312  -48.383 61.071  1.00 91.26  ? 320  HIS C CE1   1 
ATOM   6051  N  NE2   . HIS C  2  320  ? 44.253  -47.710 60.434  1.00 86.30  ? 320  HIS C NE2   1 
ATOM   6052  N  N     . GLU C  2  321  ? 42.789  -42.697 64.629  1.00 98.02  ? 321  GLU C N     1 
ATOM   6053  C  CA    . GLU C  2  321  ? 42.290  -41.532 65.345  1.00 100.14 ? 321  GLU C CA    1 
ATOM   6054  C  C     . GLU C  2  321  ? 42.757  -40.245 64.682  1.00 95.82  ? 321  GLU C C     1 
ATOM   6055  O  O     . GLU C  2  321  ? 43.830  -40.188 64.075  1.00 89.90  ? 321  GLU C O     1 
ATOM   6056  C  CB    . GLU C  2  321  ? 42.760  -41.518 66.806  1.00 99.04  ? 321  GLU C CB    1 
ATOM   6057  C  CG    . GLU C  2  321  ? 42.243  -42.651 67.663  1.00 104.38 ? 321  GLU C CG    1 
ATOM   6058  C  CD    . GLU C  2  321  ? 42.743  -42.555 69.091  1.00 113.92 ? 321  GLU C CD    1 
ATOM   6059  O  OE1   . GLU C  2  321  ? 43.708  -41.799 69.332  1.00 101.16 ? 321  GLU C OE1   1 
ATOM   6060  O  OE2   . GLU C  2  321  ? 42.168  -43.230 69.972  1.00 129.83 ? 321  GLU C OE2   1 
ATOM   6061  N  N     . VAL C  2  322  ? 41.931  -39.204 64.818  1.00 95.24  ? 322  VAL C N     1 
ATOM   6062  C  CA    . VAL C  2  322  ? 42.405  -37.856 64.550  1.00 88.58  ? 322  VAL C CA    1 
ATOM   6063  C  C     . VAL C  2  322  ? 43.348  -37.428 65.668  1.00 86.74  ? 322  VAL C C     1 
ATOM   6064  O  O     . VAL C  2  322  ? 43.374  -38.008 66.760  1.00 87.15  ? 322  VAL C O     1 
ATOM   6065  C  CB    . VAL C  2  322  ? 41.235  -36.872 64.399  1.00 88.23  ? 322  VAL C CB    1 
ATOM   6066  C  CG1   . VAL C  2  322  ? 40.578  -37.038 63.043  1.00 90.45  ? 322  VAL C CG1   1 
ATOM   6067  C  CG2   . VAL C  2  322  ? 40.220  -37.086 65.512  1.00 95.42  ? 322  VAL C CG2   1 
ATOM   6068  N  N     . ASP C  2  323  ? 44.140  -36.401 65.387  1.00 78.95  ? 323  ASP C N     1 
ATOM   6069  C  CA    . ASP C  2  323  ? 45.204  -35.978 66.283  1.00 79.20  ? 323  ASP C CA    1 
ATOM   6070  C  C     . ASP C  2  323  ? 44.861  -34.642 66.924  1.00 76.91  ? 323  ASP C C     1 
ATOM   6071  O  O     . ASP C  2  323  ? 44.457  -33.699 66.236  1.00 78.83  ? 323  ASP C O     1 
ATOM   6072  C  CB    . ASP C  2  323  ? 46.532  -35.888 65.532  1.00 80.33  ? 323  ASP C CB    1 
ATOM   6073  C  CG    . ASP C  2  323  ? 47.053  -37.248 65.123  1.00 83.91  ? 323  ASP C CG    1 
ATOM   6074  O  OD1   . ASP C  2  323  ? 47.343  -38.067 66.021  1.00 87.18  ? 323  ASP C OD1   1 
ATOM   6075  O  OD2   . ASP C  2  323  ? 47.150  -37.505 63.905  1.00 83.64  ? 323  ASP C OD2   1 
ATOM   6076  N  N     . ASP C  2  324  ? 45.014  -34.577 68.244  1.00 70.43  ? 324  ASP C N     1 
ATOM   6077  C  CA    . ASP C  2  324  ? 44.940  -33.322 68.985  1.00 66.16  ? 324  ASP C CA    1 
ATOM   6078  C  C     . ASP C  2  324  ? 46.265  -32.591 68.798  1.00 66.40  ? 324  ASP C C     1 
ATOM   6079  O  O     . ASP C  2  324  ? 47.296  -33.026 69.321  1.00 62.64  ? 324  ASP C O     1 
ATOM   6080  C  CB    . ASP C  2  324  ? 44.660  -33.608 70.458  1.00 60.73  ? 324  ASP C CB    1 
ATOM   6081  C  CG    . ASP C  2  324  ? 44.225  -32.374 71.234  1.00 63.97  ? 324  ASP C CG    1 
ATOM   6082  O  OD1   . ASP C  2  324  ? 44.529  -31.241 70.805  1.00 73.39  ? 324  ASP C OD1   1 
ATOM   6083  O  OD2   . ASP C  2  324  ? 43.580  -32.542 72.290  1.00 61.37  ? 324  ASP C OD2   1 
ATOM   6084  N  N     . ILE C  2  325  ? 46.252  -31.484 68.049  1.00 60.36  ? 325  ILE C N     1 
ATOM   6085  C  CA    . ILE C  2  325  ? 47.507  -30.801 67.738  1.00 59.29  ? 325  ILE C CA    1 
ATOM   6086  C  C     . ILE C  2  325  ? 47.983  -29.902 68.865  1.00 58.83  ? 325  ILE C C     1 
ATOM   6087  O  O     . ILE C  2  325  ? 49.098  -29.367 68.789  1.00 66.25  ? 325  ILE C O     1 
ATOM   6088  C  CB    . ILE C  2  325  ? 47.402  -29.974 66.442  1.00 62.76  ? 325  ILE C CB    1 
ATOM   6089  C  CG1   . ILE C  2  325  ? 46.610  -28.693 66.679  1.00 63.08  ? 325  ILE C CG1   1 
ATOM   6090  C  CG2   . ILE C  2  325  ? 46.766  -30.798 65.330  1.00 62.15  ? 325  ILE C CG2   1 
ATOM   6091  C  CD1   . ILE C  2  325  ? 46.691  -27.721 65.528  1.00 63.84  ? 325  ILE C CD1   1 
ATOM   6092  N  N     . ASP C  2  326  ? 47.178  -29.716 69.907  1.00 54.01  ? 326  ASP C N     1 
ATOM   6093  C  CA    . ASP C  2  326  ? 47.606  -29.019 71.110  1.00 57.39  ? 326  ASP C CA    1 
ATOM   6094  C  C     . ASP C  2  326  ? 47.992  -29.977 72.224  1.00 56.31  ? 326  ASP C C     1 
ATOM   6095  O  O     . ASP C  2  326  ? 48.378  -29.527 73.308  1.00 57.71  ? 326  ASP C O     1 
ATOM   6096  C  CB    . ASP C  2  326  ? 46.503  -28.075 71.590  1.00 71.02  ? 326  ASP C CB    1 
ATOM   6097  C  CG    . ASP C  2  326  ? 46.177  -27.008 70.572  1.00 79.62  ? 326  ASP C CG    1 
ATOM   6098  O  OD1   . ASP C  2  326  ? 47.124  -26.324 70.113  1.00 73.13  ? 326  ASP C OD1   1 
ATOM   6099  O  OD2   . ASP C  2  326  ? 44.984  -26.871 70.217  1.00 73.67  ? 326  ASP C OD2   1 
ATOM   6100  N  N     . HIS C  2  327  ? 47.880  -31.281 71.984  1.00 54.89  ? 327  HIS C N     1 
ATOM   6101  C  CA    . HIS C  2  327  ? 48.389  -32.276 72.917  1.00 52.68  ? 327  HIS C CA    1 
ATOM   6102  C  C     . HIS C  2  327  ? 49.883  -32.068 73.113  1.00 48.75  ? 327  HIS C C     1 
ATOM   6103  O  O     . HIS C  2  327  ? 50.624  -31.879 72.145  1.00 52.98  ? 327  HIS C O     1 
ATOM   6104  C  CB    . HIS C  2  327  ? 48.110  -33.678 72.370  1.00 52.69  ? 327  HIS C CB    1 
ATOM   6105  C  CG    . HIS C  2  327  ? 48.112  -34.758 73.407  1.00 51.76  ? 327  HIS C CG    1 
ATOM   6106  N  ND1   . HIS C  2  327  ? 49.256  -35.426 73.787  1.00 55.43  ? 327  HIS C ND1   1 
ATOM   6107  C  CD2   . HIS C  2  327  ? 47.102  -35.308 74.122  1.00 51.23  ? 327  HIS C CD2   1 
ATOM   6108  C  CE1   . HIS C  2  327  ? 48.953  -36.330 74.701  1.00 53.71  ? 327  HIS C CE1   1 
ATOM   6109  N  NE2   . HIS C  2  327  ? 47.653  -36.278 74.924  1.00 50.53  ? 327  HIS C NE2   1 
ATOM   6110  N  N     . LEU C  2  328  ? 50.332  -32.097 74.365  1.00 46.64  ? 328  LEU C N     1 
ATOM   6111  C  CA    . LEU C  2  328  ? 51.755  -31.890 74.602  1.00 48.60  ? 328  LEU C CA    1 
ATOM   6112  C  C     . LEU C  2  328  ? 52.616  -33.056 74.126  1.00 51.86  ? 328  LEU C C     1 
ATOM   6113  O  O     . LEU C  2  328  ? 53.839  -33.012 74.311  1.00 50.59  ? 328  LEU C O     1 
ATOM   6114  C  CB    . LEU C  2  328  ? 52.010  -31.616 76.083  1.00 43.77  ? 328  LEU C CB    1 
ATOM   6115  C  CG    . LEU C  2  328  ? 51.797  -30.161 76.497  1.00 40.48  ? 328  LEU C CG    1 
ATOM   6116  C  CD1   . LEU C  2  328  ? 52.360  -29.932 77.883  1.00 45.38  ? 328  LEU C CD1   1 
ATOM   6117  C  CD2   . LEU C  2  328  ? 52.433  -29.212 75.493  1.00 39.93  ? 328  LEU C CD2   1 
ATOM   6118  N  N     . GLY C  2  329  ? 52.018  -34.083 73.526  1.00 50.48  ? 329  GLY C N     1 
ATOM   6119  C  CA    . GLY C  2  329  ? 52.767  -35.118 72.843  1.00 54.37  ? 329  GLY C CA    1 
ATOM   6120  C  C     . GLY C  2  329  ? 52.971  -34.803 71.372  1.00 56.80  ? 329  GLY C C     1 
ATOM   6121  O  O     . GLY C  2  329  ? 53.833  -35.394 70.716  1.00 64.91  ? 329  GLY C O     1 
ATOM   6122  N  N     . ASN C  2  330  ? 52.171  -33.880 70.839  1.00 52.01  ? 330  ASN C N     1 
ATOM   6123  C  CA    . ASN C  2  330  ? 52.332  -33.387 69.478  1.00 50.10  ? 330  ASN C CA    1 
ATOM   6124  C  C     . ASN C  2  330  ? 52.931  -31.988 69.433  1.00 49.78  ? 330  ASN C C     1 
ATOM   6125  O  O     . ASN C  2  330  ? 53.032  -31.403 68.352  1.00 51.87  ? 330  ASN C O     1 
ATOM   6126  C  CB    . ASN C  2  330  ? 50.984  -33.394 68.749  1.00 55.13  ? 330  ASN C CB    1 
ATOM   6127  C  CG    . ASN C  2  330  ? 50.309  -34.754 68.779  1.00 59.76  ? 330  ASN C CG    1 
ATOM   6128  O  OD1   . ASN C  2  330  ? 50.966  -35.782 68.939  1.00 61.57  ? 330  ASN C OD1   1 
ATOM   6129  N  ND2   . ASN C  2  330  ? 48.990  -34.766 68.620  1.00 64.45  ? 330  ASN C ND2   1 
ATOM   6130  N  N     . ARG C  2  331  ? 53.315  -31.440 70.582  1.00 50.69  ? 331  ARG C N     1 
ATOM   6131  C  CA    . ARG C  2  331  ? 53.950  -30.135 70.690  1.00 50.51  ? 331  ARG C CA    1 
ATOM   6132  C  C     . ARG C  2  331  ? 55.265  -30.309 71.435  1.00 48.94  ? 331  ARG C C     1 
ATOM   6133  O  O     . ARG C  2  331  ? 55.297  -30.931 72.502  1.00 53.69  ? 331  ARG C O     1 
ATOM   6134  C  CB    . ARG C  2  331  ? 53.037  -29.138 71.421  1.00 50.64  ? 331  ARG C CB    1 
ATOM   6135  C  CG    . ARG C  2  331  ? 52.381  -28.102 70.513  1.00 53.94  ? 331  ARG C CG    1 
ATOM   6136  C  CD    . ARG C  2  331  ? 51.111  -27.506 71.119  1.00 53.51  ? 331  ARG C CD    1 
ATOM   6137  N  NE    . ARG C  2  331  ? 51.354  -26.551 72.202  1.00 58.24  ? 331  ARG C NE    1 
ATOM   6138  C  CZ    . ARG C  2  331  ? 51.526  -25.241 72.030  1.00 54.89  ? 331  ARG C CZ    1 
ATOM   6139  N  NH1   . ARG C  2  331  ? 51.725  -24.448 73.075  1.00 45.15  ? 331  ARG C NH1   1 
ATOM   6140  N  NH2   . ARG C  2  331  ? 51.504  -24.721 70.811  1.00 58.93  ? 331  ARG C NH2   1 
ATOM   6141  N  N     . ARG C  2  332  ? 56.344  -29.769 70.875  1.00 44.04  ? 332  ARG C N     1 
ATOM   6142  C  CA    . ARG C  2  332  ? 57.676  -29.985 71.423  1.00 43.53  ? 332  ARG C CA    1 
ATOM   6143  C  C     . ARG C  2  332  ? 58.401  -28.658 71.599  1.00 44.95  ? 332  ARG C C     1 
ATOM   6144  O  O     . ARG C  2  332  ? 58.017  -27.629 71.035  1.00 50.01  ? 332  ARG C O     1 
ATOM   6145  C  CB    . ARG C  2  332  ? 58.509  -30.920 70.534  1.00 47.02  ? 332  ARG C CB    1 
ATOM   6146  C  CG    . ARG C  2  332  ? 58.812  -30.360 69.154  1.00 50.96  ? 332  ARG C CG    1 
ATOM   6147  C  CD    . ARG C  2  332  ? 59.600  -31.346 68.308  1.00 46.95  ? 332  ARG C CD    1 
ATOM   6148  N  NE    . ARG C  2  332  ? 60.904  -31.648 68.889  1.00 49.07  ? 332  ARG C NE    1 
ATOM   6149  C  CZ    . ARG C  2  332  ? 62.003  -30.935 68.669  1.00 47.86  ? 332  ARG C CZ    1 
ATOM   6150  N  NH1   . ARG C  2  332  ? 61.956  -29.871 67.880  1.00 48.80  ? 332  ARG C NH1   1 
ATOM   6151  N  NH2   . ARG C  2  332  ? 63.149  -31.282 69.240  1.00 47.48  ? 332  ARG C NH2   1 
ATOM   6152  N  N     . ILE C  2  333  ? 59.477  -28.709 72.379  1.00 43.38  ? 333  ILE C N     1 
ATOM   6153  C  CA    . ILE C  2  333  ? 60.262  -27.538 72.756  1.00 46.51  ? 333  ILE C CA    1 
ATOM   6154  C  C     . ILE C  2  333  ? 61.572  -27.564 71.980  1.00 47.42  ? 333  ILE C C     1 
ATOM   6155  O  O     . ILE C  2  333  ? 62.232  -28.606 71.902  1.00 55.88  ? 333  ILE C O     1 
ATOM   6156  C  CB    . ILE C  2  333  ? 60.535  -27.508 74.271  1.00 48.72  ? 333  ILE C CB    1 
ATOM   6157  C  CG1   . ILE C  2  333  ? 59.244  -27.682 75.075  1.00 42.22  ? 333  ILE C CG1   1 
ATOM   6158  C  CG2   . ILE C  2  333  ? 61.212  -26.217 74.661  1.00 47.31  ? 333  ILE C CG2   1 
ATOM   6159  C  CD1   . ILE C  2  333  ? 58.361  -26.462 75.090  1.00 42.85  ? 333  ILE C CD1   1 
ATOM   6160  N  N     . ARG C  2  334  ? 61.948  -26.420 71.413  1.00 44.54  ? 334  ARG C N     1 
ATOM   6161  C  CA    . ARG C  2  334  ? 63.244  -26.219 70.774  1.00 47.15  ? 334  ARG C CA    1 
ATOM   6162  C  C     . ARG C  2  334  ? 64.055  -25.307 71.685  1.00 49.00  ? 334  ARG C C     1 
ATOM   6163  O  O     . ARG C  2  334  ? 63.756  -24.112 71.798  1.00 52.03  ? 334  ARG C O     1 
ATOM   6164  C  CB    . ARG C  2  334  ? 63.089  -25.602 69.388  1.00 46.70  ? 334  ARG C CB    1 
ATOM   6165  C  CG    . ARG C  2  334  ? 62.056  -26.264 68.504  1.00 50.66  ? 334  ARG C CG    1 
ATOM   6166  C  CD    . ARG C  2  334  ? 61.867  -25.459 67.233  1.00 54.19  ? 334  ARG C CD    1 
ATOM   6167  N  NE    . ARG C  2  334  ? 63.086  -25.421 66.431  1.00 61.00  ? 334  ARG C NE    1 
ATOM   6168  C  CZ    . ARG C  2  334  ? 63.317  -24.542 65.461  1.00 75.51  ? 334  ARG C CZ    1 
ATOM   6169  N  NH1   . ARG C  2  334  ? 62.416  -23.610 65.175  1.00 78.67  ? 334  ARG C NH1   1 
ATOM   6170  N  NH2   . ARG C  2  334  ? 64.455  -24.590 64.779  1.00 76.81  ? 334  ARG C NH2   1 
ATOM   6171  N  N     . THR C  2  335  ? 65.073  -25.873 72.333  1.00 50.60  ? 335  THR C N     1 
ATOM   6172  C  CA    . THR C  2  335  ? 65.854  -25.171 73.340  1.00 51.39  ? 335  THR C CA    1 
ATOM   6173  C  C     . THR C  2  335  ? 67.023  -24.436 72.686  1.00 46.58  ? 335  THR C C     1 
ATOM   6174  O  O     . THR C  2  335  ? 67.126  -24.361 71.460  1.00 48.80  ? 335  THR C O     1 
ATOM   6175  C  CB    . THR C  2  335  ? 66.331  -26.151 74.409  1.00 52.22  ? 335  THR C CB    1 
ATOM   6176  O  OG1   . THR C  2  335  ? 66.716  -27.385 73.791  1.00 53.24  ? 335  THR C OG1   1 
ATOM   6177  C  CG2   . THR C  2  335  ? 65.226  -26.418 75.412  1.00 50.30  ? 335  THR C CG2   1 
ATOM   6178  N  N     . VAL C  2  336  ? 67.916  -23.887 73.516  1.00 48.56  ? 336  VAL C N     1 
ATOM   6179  C  CA    . VAL C  2  336  ? 69.048  -23.102 73.022  1.00 42.14  ? 336  VAL C CA    1 
ATOM   6180  C  C     . VAL C  2  336  ? 69.826  -23.880 71.974  1.00 49.36  ? 336  VAL C C     1 
ATOM   6181  O  O     . VAL C  2  336  ? 70.170  -23.355 70.907  1.00 49.53  ? 336  VAL C O     1 
ATOM   6182  C  CB    . VAL C  2  336  ? 69.966  -22.698 74.185  1.00 38.83  ? 336  VAL C CB    1 
ATOM   6183  C  CG1   . VAL C  2  336  ? 70.821  -21.520 73.782  1.00 37.97  ? 336  VAL C CG1   1 
ATOM   6184  C  CG2   . VAL C  2  336  ? 69.152  -22.394 75.413  1.00 52.02  ? 336  VAL C CG2   1 
ATOM   6185  N  N     . GLY C  2  337  ? 70.137  -25.139 72.282  1.00 50.76  ? 337  GLY C N     1 
ATOM   6186  C  CA    . GLY C  2  337  ? 70.956  -25.931 71.383  1.00 50.56  ? 337  GLY C CA    1 
ATOM   6187  C  C     . GLY C  2  337  ? 70.355  -26.040 69.998  1.00 49.54  ? 337  GLY C C     1 
ATOM   6188  O  O     . GLY C  2  337  ? 71.041  -25.848 68.997  1.00 54.34  ? 337  GLY C O     1 
ATOM   6189  N  N     . GLU C  2  338  ? 69.051  -26.308 69.926  1.00 44.97  ? 338  GLU C N     1 
ATOM   6190  C  CA    . GLU C  2  338  ? 68.415  -26.546 68.637  1.00 41.29  ? 338  GLU C CA    1 
ATOM   6191  C  C     . GLU C  2  338  ? 68.366  -25.275 67.792  1.00 48.00  ? 338  GLU C C     1 
ATOM   6192  O  O     . GLU C  2  338  ? 68.667  -25.310 66.593  1.00 53.14  ? 338  GLU C O     1 
ATOM   6193  C  CB    . GLU C  2  338  ? 67.022  -27.119 68.870  1.00 41.83  ? 338  GLU C CB    1 
ATOM   6194  C  CG    . GLU C  2  338  ? 66.331  -27.653 67.643  1.00 53.18  ? 338  GLU C CG    1 
ATOM   6195  C  CD    . GLU C  2  338  ? 65.116  -28.490 68.001  1.00 60.24  ? 338  GLU C CD    1 
ATOM   6196  O  OE1   . GLU C  2  338  ? 65.128  -29.125 69.080  1.00 57.21  ? 338  GLU C OE1   1 
ATOM   6197  O  OE2   . GLU C  2  338  ? 64.149  -28.507 67.211  1.00 65.47  ? 338  GLU C OE2   1 
ATOM   6198  N  N     . LEU C  2  339  ? 68.031  -24.136 68.404  1.00 45.12  ? 339  LEU C N     1 
ATOM   6199  C  CA    . LEU C  2  339  ? 67.936  -22.884 67.654  1.00 44.60  ? 339  LEU C CA    1 
ATOM   6200  C  C     . LEU C  2  339  ? 69.315  -22.389 67.229  1.00 50.55  ? 339  LEU C C     1 
ATOM   6201  O  O     . LEU C  2  339  ? 69.510  -21.956 66.079  1.00 61.09  ? 339  LEU C O     1 
ATOM   6202  C  CB    . LEU C  2  339  ? 67.218  -21.830 68.496  1.00 48.96  ? 339  LEU C CB    1 
ATOM   6203  C  CG    . LEU C  2  339  ? 66.013  -22.322 69.311  1.00 47.40  ? 339  LEU C CG    1 
ATOM   6204  C  CD1   . LEU C  2  339  ? 65.619  -21.320 70.391  1.00 37.99  ? 339  LEU C CD1   1 
ATOM   6205  C  CD2   . LEU C  2  339  ? 64.826  -22.647 68.414  1.00 45.68  ? 339  LEU C CD2   1 
ATOM   6206  N  N     . MET C  2  340  ? 70.283  -22.440 68.146  1.00 48.33  ? 340  MET C N     1 
ATOM   6207  C  CA    . MET C  2  340  ? 71.650  -22.080 67.788  1.00 55.63  ? 340  MET C CA    1 
ATOM   6208  C  C     . MET C  2  340  ? 72.191  -22.998 66.693  1.00 51.52  ? 340  MET C C     1 
ATOM   6209  O  O     . MET C  2  340  ? 72.895  -22.543 65.786  1.00 45.67  ? 340  MET C O     1 
ATOM   6210  C  CB    . MET C  2  340  ? 72.535  -22.114 69.034  1.00 49.32  ? 340  MET C CB    1 
ATOM   6211  C  CG    . MET C  2  340  ? 73.953  -21.623 68.813  1.00 53.03  ? 340  MET C CG    1 
ATOM   6212  S  SD    . MET C  2  340  ? 75.042  -22.927 68.201  1.00 62.04  ? 340  MET C SD    1 
ATOM   6213  C  CE    . MET C  2  340  ? 76.534  -21.990 67.881  1.00 57.24  ? 340  MET C CE    1 
ATOM   6214  N  N     . THR C  2  341  ? 71.855  -24.291 66.751  1.00 50.04  ? 341  THR C N     1 
ATOM   6215  C  CA    . THR C  2  341  ? 72.281  -25.225 65.717  1.00 46.42  ? 341  THR C CA    1 
ATOM   6216  C  C     . THR C  2  341  ? 71.640  -24.895 64.380  1.00 55.83  ? 341  THR C C     1 
ATOM   6217  O  O     . THR C  2  341  ? 72.281  -25.020 63.334  1.00 64.95  ? 341  THR C O     1 
ATOM   6218  C  CB    . THR C  2  341  ? 71.943  -26.656 66.137  1.00 47.21  ? 341  THR C CB    1 
ATOM   6219  O  OG1   . THR C  2  341  ? 72.681  -26.993 67.316  1.00 51.98  ? 341  THR C OG1   1 
ATOM   6220  C  CG2   . THR C  2  341  ? 72.281  -27.650 65.032  1.00 49.51  ? 341  THR C CG2   1 
ATOM   6221  N  N     . ASP C  2  342  ? 70.373  -24.477 64.387  1.00 52.80  ? 342  ASP C N     1 
ATOM   6222  C  CA    . ASP C  2  342  ? 69.728  -24.075 63.139  1.00 55.77  ? 342  ASP C CA    1 
ATOM   6223  C  C     . ASP C  2  342  ? 70.455  -22.899 62.500  1.00 55.63  ? 342  ASP C C     1 
ATOM   6224  O  O     . ASP C  2  342  ? 70.758  -22.914 61.297  1.00 56.56  ? 342  ASP C O     1 
ATOM   6225  C  CB    . ASP C  2  342  ? 68.262  -23.726 63.384  1.00 66.76  ? 342  ASP C CB    1 
ATOM   6226  C  CG    . ASP C  2  342  ? 67.331  -24.880 63.084  1.00 85.59  ? 342  ASP C CG    1 
ATOM   6227  O  OD1   . ASP C  2  342  ? 67.783  -26.043 63.170  1.00 93.30  ? 342  ASP C OD1   1 
ATOM   6228  O  OD2   . ASP C  2  342  ? 66.155  -24.623 62.745  1.00 89.39  ? 342  ASP C OD2   1 
ATOM   6229  N  N     . GLN C  2  343  ? 70.739  -21.860 63.288  1.00 53.27  ? 343  GLN C N     1 
ATOM   6230  C  CA    . GLN C  2  343  ? 71.421  -20.705 62.706  1.00 56.44  ? 343  GLN C CA    1 
ATOM   6231  C  C     . GLN C  2  343  ? 72.847  -21.044 62.287  1.00 59.47  ? 343  GLN C C     1 
ATOM   6232  O  O     . GLN C  2  343  ? 73.340  -20.534 61.268  1.00 62.16  ? 343  GLN C O     1 
ATOM   6233  C  CB    . GLN C  2  343  ? 71.400  -19.533 63.677  1.00 54.14  ? 343  GLN C CB    1 
ATOM   6234  C  CG    . GLN C  2  343  ? 70.057  -18.837 63.691  1.00 60.79  ? 343  GLN C CG    1 
ATOM   6235  C  CD    . GLN C  2  343  ? 69.597  -18.432 62.302  1.00 62.37  ? 343  GLN C CD    1 
ATOM   6236  O  OE1   . GLN C  2  343  ? 70.181  -17.545 61.674  1.00 64.84  ? 343  GLN C OE1   1 
ATOM   6237  N  NE2   . GLN C  2  343  ? 68.543  -19.084 61.815  1.00 49.59  ? 343  GLN C NE2   1 
ATOM   6238  N  N     . PHE C  2  344  ? 73.514  -21.913 63.046  1.00 57.21  ? 344  PHE C N     1 
ATOM   6239  C  CA    . PHE C  2  344  ? 74.815  -22.421 62.632  1.00 56.07  ? 344  PHE C CA    1 
ATOM   6240  C  C     . PHE C  2  344  ? 74.716  -23.139 61.292  1.00 54.40  ? 344  PHE C C     1 
ATOM   6241  O  O     . PHE C  2  344  ? 75.564  -22.947 60.415  1.00 59.88  ? 344  PHE C O     1 
ATOM   6242  C  CB    . PHE C  2  344  ? 75.365  -23.352 63.712  1.00 52.89  ? 344  PHE C CB    1 
ATOM   6243  C  CG    . PHE C  2  344  ? 76.790  -23.769 63.496  1.00 55.02  ? 344  PHE C CG    1 
ATOM   6244  C  CD1   . PHE C  2  344  ? 77.830  -23.023 64.024  1.00 57.55  ? 344  PHE C CD1   1 
ATOM   6245  C  CD2   . PHE C  2  344  ? 77.090  -24.917 62.783  1.00 58.96  ? 344  PHE C CD2   1 
ATOM   6246  C  CE1   . PHE C  2  344  ? 79.141  -23.409 63.835  1.00 53.67  ? 344  PHE C CE1   1 
ATOM   6247  C  CE2   . PHE C  2  344  ? 78.397  -25.306 62.590  1.00 55.44  ? 344  PHE C CE2   1 
ATOM   6248  C  CZ    . PHE C  2  344  ? 79.424  -24.551 63.118  1.00 54.18  ? 344  PHE C CZ    1 
ATOM   6249  N  N     . ARG C  2  345  ? 73.682  -23.967 61.116  1.00 50.71  ? 345  ARG C N     1 
ATOM   6250  C  CA    . ARG C  2  345  ? 73.518  -24.712 59.873  1.00 53.26  ? 345  ARG C CA    1 
ATOM   6251  C  C     . ARG C  2  345  ? 73.280  -23.770 58.701  1.00 58.18  ? 345  ARG C C     1 
ATOM   6252  O  O     . ARG C  2  345  ? 73.780  -24.001 57.593  1.00 64.07  ? 345  ARG C O     1 
ATOM   6253  C  CB    . ARG C  2  345  ? 72.368  -25.710 60.014  1.00 51.74  ? 345  ARG C CB    1 
ATOM   6254  C  CG    . ARG C  2  345  ? 72.093  -26.534 58.769  1.00 64.08  ? 345  ARG C CG    1 
ATOM   6255  C  CD    . ARG C  2  345  ? 70.954  -27.530 58.978  1.00 84.23  ? 345  ARG C CD    1 
ATOM   6256  N  NE    . ARG C  2  345  ? 71.328  -28.649 59.844  1.00 87.35  ? 345  ARG C NE    1 
ATOM   6257  C  CZ    . ARG C  2  345  ? 70.871  -28.828 61.081  1.00 86.99  ? 345  ARG C CZ    1 
ATOM   6258  N  NH1   . ARG C  2  345  ? 70.013  -27.962 61.605  1.00 88.87  ? 345  ARG C NH1   1 
ATOM   6259  N  NH2   . ARG C  2  345  ? 71.266  -29.877 61.795  1.00 73.94  ? 345  ARG C NH2   1 
ATOM   6260  N  N     . VAL C  2  346  ? 72.539  -22.687 58.933  1.00 58.31  ? 346  VAL C N     1 
ATOM   6261  C  CA    . VAL C  2  346  ? 72.319  -21.702 57.874  1.00 58.18  ? 346  VAL C CA    1 
ATOM   6262  C  C     . VAL C  2  346  ? 73.635  -21.033 57.477  1.00 59.07  ? 346  VAL C C     1 
ATOM   6263  O  O     . VAL C  2  346  ? 73.973  -20.935 56.285  1.00 58.79  ? 346  VAL C O     1 
ATOM   6264  C  CB    . VAL C  2  346  ? 71.266  -20.673 58.318  1.00 54.35  ? 346  VAL C CB    1 
ATOM   6265  C  CG1   . VAL C  2  346  ? 71.287  -19.471 57.400  1.00 59.72  ? 346  VAL C CG1   1 
ATOM   6266  C  CG2   . VAL C  2  346  ? 69.897  -21.315 58.314  1.00 55.82  ? 346  VAL C CG2   1 
ATOM   6267  N  N     . GLY C  2  347  ? 74.390  -20.545 58.470  1.00 58.90  ? 347  GLY C N     1 
ATOM   6268  C  CA    . GLY C  2  347  ? 75.680  -19.935 58.170  1.00 58.02  ? 347  GLY C CA    1 
ATOM   6269  C  C     . GLY C  2  347  ? 76.626  -20.890 57.463  1.00 61.02  ? 347  GLY C C     1 
ATOM   6270  O  O     . GLY C  2  347  ? 77.378  -20.493 56.566  1.00 65.25  ? 347  GLY C O     1 
ATOM   6271  N  N     . LEU C  2  348  ? 76.576  -22.170 57.838  1.00 59.81  ? 348  LEU C N     1 
ATOM   6272  C  CA    . LEU C  2  348  ? 77.421  -23.181 57.214  1.00 59.49  ? 348  LEU C CA    1 
ATOM   6273  C  C     . LEU C  2  348  ? 77.017  -23.424 55.765  1.00 63.19  ? 348  LEU C C     1 
ATOM   6274  O  O     . LEU C  2  348  ? 77.878  -23.619 54.900  1.00 65.72  ? 348  LEU C O     1 
ATOM   6275  C  CB    . LEU C  2  348  ? 77.340  -24.479 58.016  1.00 57.92  ? 348  LEU C CB    1 
ATOM   6276  C  CG    . LEU C  2  348  ? 78.602  -25.308 58.230  1.00 62.40  ? 348  LEU C CG    1 
ATOM   6277  C  CD1   . LEU C  2  348  ? 79.718  -24.435 58.785  1.00 58.48  ? 348  LEU C CD1   1 
ATOM   6278  C  CD2   . LEU C  2  348  ? 78.292  -26.457 59.178  1.00 60.96  ? 348  LEU C CD2   1 
ATOM   6279  N  N     . ALA C  2  349  ? 75.713  -23.418 55.478  1.00 62.14  ? 349  ALA C N     1 
ATOM   6280  C  CA    . ALA C  2  349  ? 75.269  -23.601 54.099  1.00 63.30  ? 349  ALA C CA    1 
ATOM   6281  C  C     . ALA C  2  349  ? 75.677  -22.419 53.226  1.00 63.78  ? 349  ALA C C     1 
ATOM   6282  O  O     . ALA C  2  349  ? 76.031  -22.596 52.053  1.00 63.50  ? 349  ALA C O     1 
ATOM   6283  C  CB    . ALA C  2  349  ? 73.757  -23.813 54.055  1.00 59.95  ? 349  ALA C CB    1 
ATOM   6284  N  N     . ARG C  2  350  ? 75.638  -21.203 53.777  1.00 61.05  ? 350  ARG C N     1 
ATOM   6285  C  CA    . ARG C  2  350  ? 76.123  -20.055 53.011  1.00 62.14  ? 350  ARG C CA    1 
ATOM   6286  C  C     . ARG C  2  350  ? 77.628  -20.144 52.770  1.00 73.58  ? 350  ARG C C     1 
ATOM   6287  O  O     . ARG C  2  350  ? 78.114  -19.832 51.671  1.00 81.07  ? 350  ARG C O     1 
ATOM   6288  C  CB    . ARG C  2  350  ? 75.777  -18.757 53.730  1.00 60.72  ? 350  ARG C CB    1 
ATOM   6289  C  CG    . ARG C  2  350  ? 74.302  -18.560 53.963  1.00 65.05  ? 350  ARG C CG    1 
ATOM   6290  C  CD    . ARG C  2  350  ? 74.095  -17.439 54.951  1.00 75.19  ? 350  ARG C CD    1 
ATOM   6291  N  NE    . ARG C  2  350  ? 72.688  -17.223 55.259  1.00 70.14  ? 350  ARG C NE    1 
ATOM   6292  C  CZ    . ARG C  2  350  ? 72.260  -16.361 56.172  1.00 65.66  ? 350  ARG C CZ    1 
ATOM   6293  N  NH1   . ARG C  2  350  ? 73.138  -15.645 56.865  1.00 60.17  ? 350  ARG C NH1   1 
ATOM   6294  N  NH2   . ARG C  2  350  ? 70.961  -16.219 56.393  1.00 69.30  ? 350  ARG C NH2   1 
ATOM   6295  N  N     . LEU C  2  351  ? 78.383  -20.554 53.792  1.00 72.29  ? 351  LEU C N     1 
ATOM   6296  C  CA    . LEU C  2  351  ? 79.810  -20.797 53.605  1.00 68.36  ? 351  LEU C CA    1 
ATOM   6297  C  C     . LEU C  2  351  ? 80.052  -21.839 52.517  1.00 70.27  ? 351  LEU C C     1 
ATOM   6298  O  O     . LEU C  2  351  ? 80.992  -21.713 51.724  1.00 70.53  ? 351  LEU C O     1 
ATOM   6299  C  CB    . LEU C  2  351  ? 80.428  -21.226 54.934  1.00 65.76  ? 351  LEU C CB    1 
ATOM   6300  C  CG    . LEU C  2  351  ? 81.894  -21.642 55.009  1.00 70.29  ? 351  LEU C CG    1 
ATOM   6301  C  CD1   . LEU C  2  351  ? 82.484  -21.140 56.314  1.00 71.71  ? 351  LEU C CD1   1 
ATOM   6302  C  CD2   . LEU C  2  351  ? 82.019  -23.155 54.923  1.00 63.23  ? 351  LEU C CD2   1 
ATOM   6303  N  N     . ALA C  2  352  ? 79.203  -22.870 52.456  1.00 74.22  ? 352  ALA C N     1 
ATOM   6304  C  CA    . ALA C  2  352  ? 79.350  -23.909 51.438  1.00 73.19  ? 352  ALA C CA    1 
ATOM   6305  C  C     . ALA C  2  352  ? 79.028  -23.379 50.045  1.00 77.43  ? 352  ALA C C     1 
ATOM   6306  O  O     . ALA C  2  352  ? 79.645  -23.798 49.060  1.00 89.22  ? 352  ALA C O     1 
ATOM   6307  C  CB    . ALA C  2  352  ? 78.461  -25.107 51.770  1.00 72.43  ? 352  ALA C CB    1 
ATOM   6308  N  N     . ARG C  2  353  ? 78.050  -22.477 49.935  1.00 79.45  ? 353  ARG C N     1 
ATOM   6309  C  CA    . ARG C  2  353  ? 77.814  -21.826 48.648  1.00 77.89  ? 353  ARG C CA    1 
ATOM   6310  C  C     . ARG C  2  353  ? 79.036  -21.022 48.219  1.00 80.59  ? 353  ARG C C     1 
ATOM   6311  O  O     . ARG C  2  353  ? 79.438  -21.061 47.048  1.00 90.67  ? 353  ARG C O     1 
ATOM   6312  C  CB    . ARG C  2  353  ? 76.578  -20.927 48.710  1.00 82.14  ? 353  ARG C CB    1 
ATOM   6313  C  CG    . ARG C  2  353  ? 76.203  -20.322 47.357  1.00 92.97  ? 353  ARG C CG    1 
ATOM   6314  C  CD    . ARG C  2  353  ? 76.014  -18.807 47.427  1.00 108.73 ? 353  ARG C CD    1 
ATOM   6315  N  NE    . ARG C  2  353  ? 75.997  -18.196 46.096  1.00 114.57 ? 353  ARG C NE    1 
ATOM   6316  C  CZ    . ARG C  2  353  ? 75.857  -16.892 45.864  1.00 108.46 ? 353  ARG C CZ    1 
ATOM   6317  N  NH1   . ARG C  2  353  ? 75.715  -16.045 46.875  1.00 106.97 ? 353  ARG C NH1   1 
ATOM   6318  N  NH2   . ARG C  2  353  ? 75.857  -16.434 44.619  1.00 96.02  ? 353  ARG C NH2   1 
ATOM   6319  N  N     . GLY C  2  354  ? 79.648  -20.297 49.160  1.00 76.53  ? 354  GLY C N     1 
ATOM   6320  C  CA    . GLY C  2  354  ? 80.878  -19.580 48.843  1.00 82.91  ? 354  GLY C CA    1 
ATOM   6321  C  C     . GLY C  2  354  ? 82.004  -20.502 48.406  1.00 85.96  ? 354  GLY C C     1 
ATOM   6322  O  O     . GLY C  2  354  ? 82.780  -20.173 47.504  1.00 83.02  ? 354  GLY C O     1 
ATOM   6323  N  N     . VAL C  2  355  ? 82.110  -21.670 49.045  1.00 88.54  ? 355  VAL C N     1 
ATOM   6324  C  CA    . VAL C  2  355  ? 83.129  -22.649 48.668  1.00 78.97  ? 355  VAL C CA    1 
ATOM   6325  C  C     . VAL C  2  355  ? 82.889  -23.151 47.250  1.00 81.13  ? 355  VAL C C     1 
ATOM   6326  O  O     . VAL C  2  355  ? 83.795  -23.141 46.409  1.00 95.74  ? 355  VAL C O     1 
ATOM   6327  C  CB    . VAL C  2  355  ? 83.160  -23.813 49.675  1.00 75.26  ? 355  VAL C CB    1 
ATOM   6328  C  CG1   . VAL C  2  355  ? 83.908  -24.998 49.088  1.00 74.62  ? 355  VAL C CG1   1 
ATOM   6329  C  CG2   . VAL C  2  355  ? 83.802  -23.369 50.976  1.00 76.98  ? 355  VAL C CG2   1 
ATOM   6330  N  N     . ARG C  2  356  ? 81.665  -23.611 46.966  1.00 82.61  ? 356  ARG C N     1 
ATOM   6331  C  CA    . ARG C  2  356  ? 81.338  -24.078 45.619  1.00 89.35  ? 356  ARG C CA    1 
ATOM   6332  C  C     . ARG C  2  356  ? 81.584  -22.998 44.574  1.00 94.20  ? 356  ARG C C     1 
ATOM   6333  O  O     . ARG C  2  356  ? 81.968  -23.308 43.440  1.00 94.94  ? 356  ARG C O     1 
ATOM   6334  C  CB    . ARG C  2  356  ? 79.884  -24.554 45.554  1.00 90.47  ? 356  ARG C CB    1 
ATOM   6335  C  CG    . ARG C  2  356  ? 79.689  -26.010 45.945  1.00 91.75  ? 356  ARG C CG    1 
ATOM   6336  C  CD    . ARG C  2  356  ? 78.222  -26.417 45.926  1.00 99.54  ? 356  ARG C CD    1 
ATOM   6337  N  NE    . ARG C  2  356  ? 78.020  -27.748 46.498  1.00 107.16 ? 356  ARG C NE    1 
ATOM   6338  C  CZ    . ARG C  2  356  ? 77.642  -27.977 47.754  1.00 101.81 ? 356  ARG C CZ    1 
ATOM   6339  N  NH1   . ARG C  2  356  ? 77.417  -26.962 48.579  1.00 95.35  ? 356  ARG C NH1   1 
ATOM   6340  N  NH2   . ARG C  2  356  ? 77.486  -29.224 48.187  1.00 89.04  ? 356  ARG C NH2   1 
ATOM   6341  N  N     . GLU C  2  357  ? 81.374  -21.730 44.935  1.00 95.36  ? 357  GLU C N     1 
ATOM   6342  C  CA    . GLU C  2  357  ? 81.685  -20.642 44.016  1.00 97.38  ? 357  GLU C CA    1 
ATOM   6343  C  C     . GLU C  2  357  ? 83.188  -20.465 43.839  1.00 102.32 ? 357  GLU C C     1 
ATOM   6344  O  O     . GLU C  2  357  ? 83.645  -20.101 42.749  1.00 106.53 ? 357  GLU C O     1 
ATOM   6345  C  CB    . GLU C  2  357  ? 81.049  -19.347 44.518  1.00 103.85 ? 357  GLU C CB    1 
ATOM   6346  C  CG    . GLU C  2  357  ? 81.228  -18.160 43.597  1.00 116.57 ? 357  GLU C CG    1 
ATOM   6347  C  CD    . GLU C  2  357  ? 80.448  -16.947 44.061  1.00 120.15 ? 357  GLU C CD    1 
ATOM   6348  O  OE1   . GLU C  2  357  ? 79.577  -17.095 44.947  1.00 116.26 ? 357  GLU C OE1   1 
ATOM   6349  O  OE2   . GLU C  2  357  ? 80.707  -15.843 43.540  1.00 130.01 ? 357  GLU C OE2   1 
ATOM   6350  N  N     . ARG C  2  358  ? 83.970  -20.714 44.892  1.00 103.74 ? 358  ARG C N     1 
ATOM   6351  C  CA    . ARG C  2  358  ? 85.422  -20.623 44.787  1.00 99.19  ? 358  ARG C CA    1 
ATOM   6352  C  C     . ARG C  2  358  ? 86.038  -21.807 44.051  1.00 96.45  ? 358  ARG C C     1 
ATOM   6353  O  O     . ARG C  2  358  ? 87.146  -21.677 43.522  1.00 98.06  ? 358  ARG C O     1 
ATOM   6354  C  CB    . ARG C  2  358  ? 86.049  -20.513 46.178  1.00 93.96  ? 358  ARG C CB    1 
ATOM   6355  C  CG    . ARG C  2  358  ? 86.847  -19.241 46.405  1.00 97.44  ? 358  ARG C CG    1 
ATOM   6356  C  CD    . ARG C  2  358  ? 85.954  -18.105 46.866  1.00 94.42  ? 358  ARG C CD    1 
ATOM   6357  N  NE    . ARG C  2  358  ? 85.148  -18.496 48.018  1.00 94.46  ? 358  ARG C NE    1 
ATOM   6358  C  CZ    . ARG C  2  358  ? 84.480  -17.642 48.786  1.00 94.50  ? 358  ARG C CZ    1 
ATOM   6359  N  NH1   . ARG C  2  358  ? 84.529  -16.342 48.529  1.00 99.91  ? 358  ARG C NH1   1 
ATOM   6360  N  NH2   . ARG C  2  358  ? 83.769  -18.086 49.812  1.00 90.41  ? 358  ARG C NH2   1 
ATOM   6361  N  N     . MET C  2  359  ? 85.353  -22.951 44.006  1.00 97.42  ? 359  MET C N     1 
ATOM   6362  C  CA    . MET C  2  359  ? 85.880  -24.143 43.354  1.00 100.27 ? 359  MET C CA    1 
ATOM   6363  C  C     . MET C  2  359  ? 85.802  -24.080 41.836  1.00 111.65 ? 359  MET C C     1 
ATOM   6364  O  O     . MET C  2  359  ? 86.113  -25.076 41.175  1.00 120.68 ? 359  MET C O     1 
ATOM   6365  C  CB    . MET C  2  359  ? 85.144  -25.391 43.850  1.00 96.59  ? 359  MET C CB    1 
ATOM   6366  C  CG    . MET C  2  359  ? 85.602  -25.867 45.216  1.00 95.62  ? 359  MET C CG    1 
ATOM   6367  S  SD    . MET C  2  359  ? 85.044  -27.538 45.595  1.00 100.20 ? 359  MET C SD    1 
ATOM   6368  C  CE    . MET C  2  359  ? 83.271  -27.302 45.619  1.00 110.01 ? 359  MET C CE    1 
ATOM   6369  N  N     . LEU C  2  360  ? 85.386  -22.950 41.270  1.00 111.58 ? 360  LEU C N     1 
ATOM   6370  C  CA    . LEU C  2  360  ? 85.389  -22.738 39.829  1.00 111.01 ? 360  LEU C CA    1 
ATOM   6371  C  C     . LEU C  2  360  ? 86.407  -21.691 39.409  1.00 114.39 ? 360  LEU C C     1 
ATOM   6372  O  O     . LEU C  2  360  ? 87.200  -21.926 38.492  1.00 116.36 ? 360  LEU C O     1 
ATOM   6373  C  CB    . LEU C  2  360  ? 83.986  -22.328 39.350  1.00 109.54 ? 360  LEU C CB    1 
ATOM   6374  C  CG    . LEU C  2  360  ? 82.947  -23.409 39.022  1.00 103.78 ? 360  LEU C CG    1 
ATOM   6375  C  CD1   . LEU C  2  360  ? 82.734  -24.382 40.175  1.00 105.34 ? 360  LEU C CD1   1 
ATOM   6376  C  CD2   . LEU C  2  360  ? 81.626  -22.762 38.625  1.00 94.22  ? 360  LEU C CD2   1 
ATOM   6377  N  N     . MET C  2  361  ? 86.417  -20.541 40.080  1.00 120.42 ? 361  MET C N     1 
ATOM   6378  C  CA    . MET C  2  361  ? 87.331  -19.460 39.750  1.00 125.69 ? 361  MET C CA    1 
ATOM   6379  C  C     . MET C  2  361  ? 88.760  -19.828 40.150  1.00 129.61 ? 361  MET C C     1 
ATOM   6380  O  O     . MET C  2  361  ? 89.035  -20.912 40.675  1.00 128.09 ? 361  MET C O     1 
ATOM   6381  C  CB    . MET C  2  361  ? 86.889  -18.173 40.441  1.00 125.03 ? 361  MET C CB    1 
ATOM   6382  C  CG    . MET C  2  361  ? 85.385  -17.980 40.467  1.00 119.86 ? 361  MET C CG    1 
ATOM   6383  S  SD    . MET C  2  361  ? 84.674  -18.035 38.814  1.00 110.85 ? 361  MET C SD    1 
ATOM   6384  C  CE    . MET C  2  361  ? 85.505  -16.644 38.046  1.00 96.32  ? 361  MET C CE    1 
ATOM   6385  N  N     . GLY C  2  362  ? 89.682  -18.901 39.895  1.00 136.83 ? 362  GLY C N     1 
ATOM   6386  C  CA    . GLY C  2  362  ? 91.077  -19.084 40.241  1.00 143.49 ? 362  GLY C CA    1 
ATOM   6387  C  C     . GLY C  2  362  ? 91.713  -20.261 39.512  1.00 150.74 ? 362  GLY C C     1 
ATOM   6388  O  O     . GLY C  2  362  ? 91.180  -20.816 38.553  1.00 152.41 ? 362  GLY C O     1 
ATOM   6389  N  N     . SER C  2  363  ? 92.893  -20.631 40.002  1.00 153.31 ? 363  SER C N     1 
ATOM   6390  C  CA    . SER C  2  363  ? 93.597  -21.789 39.471  1.00 151.77 ? 363  SER C CA    1 
ATOM   6391  C  C     . SER C  2  363  ? 92.957  -23.065 40.005  1.00 152.73 ? 363  SER C C     1 
ATOM   6392  O  O     . SER C  2  363  ? 92.794  -23.228 41.219  1.00 145.29 ? 363  SER C O     1 
ATOM   6393  C  CB    . SER C  2  363  ? 95.081  -21.732 39.839  1.00 138.38 ? 363  SER C CB    1 
ATOM   6394  O  OG    . SER C  2  363  ? 95.268  -21.626 41.239  1.00 134.00 ? 363  SER C OG    1 
ATOM   6395  N  N     . GLU C  2  364  ? 92.582  -23.966 39.092  1.00 158.71 ? 364  GLU C N     1 
ATOM   6396  C  CA    . GLU C  2  364  ? 91.929  -25.215 39.472  1.00 159.82 ? 364  GLU C CA    1 
ATOM   6397  C  C     . GLU C  2  364  ? 92.871  -26.200 40.152  1.00 154.46 ? 364  GLU C C     1 
ATOM   6398  O  O     . GLU C  2  364  ? 92.404  -27.231 40.649  1.00 143.30 ? 364  GLU C O     1 
ATOM   6399  C  CB    . GLU C  2  364  ? 91.304  -25.880 38.242  1.00 156.92 ? 364  GLU C CB    1 
ATOM   6400  C  CG    . GLU C  2  364  ? 89.958  -25.310 37.825  1.00 156.99 ? 364  GLU C CG    1 
ATOM   6401  C  CD    . GLU C  2  364  ? 88.883  -25.530 38.873  1.00 146.65 ? 364  GLU C CD    1 
ATOM   6402  O  OE1   . GLU C  2  364  ? 88.694  -24.638 39.727  1.00 142.03 ? 364  GLU C OE1   1 
ATOM   6403  O  OE2   . GLU C  2  364  ? 88.236  -26.600 38.847  1.00 134.73 ? 364  GLU C OE2   1 
ATOM   6404  N  N     . ASP C  2  365  ? 94.174  -25.918 40.182  1.00 154.34 ? 365  ASP C N     1 
ATOM   6405  C  CA    . ASP C  2  365  ? 95.156  -26.830 40.758  1.00 150.76 ? 365  ASP C CA    1 
ATOM   6406  C  C     . ASP C  2  365  ? 95.598  -26.402 42.154  1.00 144.92 ? 365  ASP C C     1 
ATOM   6407  O  O     . ASP C  2  365  ? 95.472  -27.171 43.112  1.00 142.13 ? 365  ASP C O     1 
ATOM   6408  C  CB    . ASP C  2  365  ? 96.371  -26.940 39.828  1.00 146.44 ? 365  ASP C CB    1 
ATOM   6409  C  CG    . ASP C  2  365  ? 97.363  -27.983 40.293  1.00 140.01 ? 365  ASP C CG    1 
ATOM   6410  O  OD1   . ASP C  2  365  ? 96.941  -28.946 40.970  1.00 134.33 ? 365  ASP C OD1   1 
ATOM   6411  O  OD2   . ASP C  2  365  ? 98.566  -27.832 39.991  1.00 137.00 ? 365  ASP C OD2   1 
ATOM   6412  N  N     . SER C  2  366  ? 96.116  -25.181 42.287  1.00 142.21 ? 366  SER C N     1 
ATOM   6413  C  CA    . SER C  2  366  ? 96.691  -24.703 43.544  1.00 132.26 ? 366  SER C CA    1 
ATOM   6414  C  C     . SER C  2  366  ? 95.582  -24.109 44.401  1.00 129.95 ? 366  SER C C     1 
ATOM   6415  O  O     . SER C  2  366  ? 95.244  -22.929 44.273  1.00 131.65 ? 366  SER C O     1 
ATOM   6416  C  CB    . SER C  2  366  ? 97.791  -23.682 43.279  1.00 129.11 ? 366  SER C CB    1 
ATOM   6417  O  OG    . SER C  2  366  ? 98.356  -23.213 44.491  1.00 132.81 ? 366  SER C OG    1 
ATOM   6418  N  N     . LEU C  2  367  ? 95.024  -24.926 45.291  1.00 125.37 ? 367  LEU C N     1 
ATOM   6419  C  CA    . LEU C  2  367  ? 93.999  -24.483 46.223  1.00 115.74 ? 367  LEU C CA    1 
ATOM   6420  C  C     . LEU C  2  367  ? 94.179  -25.224 47.538  1.00 113.72 ? 367  LEU C C     1 
ATOM   6421  O  O     . LEU C  2  367  ? 94.414  -26.436 47.551  1.00 114.51 ? 367  LEU C O     1 
ATOM   6422  C  CB    . LEU C  2  367  ? 92.587  -24.725 45.676  1.00 107.45 ? 367  LEU C CB    1 
ATOM   6423  C  CG    . LEU C  2  367  ? 92.077  -23.816 44.558  1.00 108.27 ? 367  LEU C CG    1 
ATOM   6424  C  CD1   . LEU C  2  367  ? 90.703  -24.270 44.102  1.00 105.87 ? 367  LEU C CD1   1 
ATOM   6425  C  CD2   . LEU C  2  367  ? 92.038  -22.366 45.014  1.00 98.31  ? 367  LEU C CD2   1 
ATOM   6426  N  N     . THR C  2  368  ? 94.075  -24.488 48.635  1.00 106.35 ? 368  THR C N     1 
ATOM   6427  C  CA    . THR C  2  368  ? 94.114  -25.031 49.980  1.00 98.88  ? 368  THR C CA    1 
ATOM   6428  C  C     . THR C  2  368  ? 92.766  -24.800 50.650  1.00 100.29 ? 368  THR C C     1 
ATOM   6429  O  O     . THR C  2  368  ? 91.994  -23.934 50.219  1.00 98.96  ? 368  THR C O     1 
ATOM   6430  C  CB    . THR C  2  368  ? 95.232  -24.375 50.807  1.00 98.08  ? 368  THR C CB    1 
ATOM   6431  O  OG1   . THR C  2  368  ? 95.004  -22.963 50.894  1.00 95.38  ? 368  THR C OG1   1 
ATOM   6432  C  CG2   . THR C  2  368  ? 96.588  -24.621 50.163  1.00 98.92  ? 368  THR C CG2   1 
ATOM   6433  N  N     . PRO C  2  369  ? 92.434  -25.572 51.690  1.00 96.69  ? 369  PRO C N     1 
ATOM   6434  C  CA    . PRO C  2  369  ? 91.209  -25.276 52.451  1.00 84.79  ? 369  PRO C CA    1 
ATOM   6435  C  C     . PRO C  2  369  ? 91.176  -23.868 53.021  1.00 81.10  ? 369  PRO C C     1 
ATOM   6436  O  O     . PRO C  2  369  ? 90.084  -23.337 53.253  1.00 84.89  ? 369  PRO C O     1 
ATOM   6437  C  CB    . PRO C  2  369  ? 91.223  -26.335 53.562  1.00 79.16  ? 369  PRO C CB    1 
ATOM   6438  C  CG    . PRO C  2  369  ? 91.968  -27.475 52.966  1.00 80.30  ? 369  PRO C CG    1 
ATOM   6439  C  CD    . PRO C  2  369  ? 93.039  -26.851 52.105  1.00 91.63  ? 369  PRO C CD    1 
ATOM   6440  N  N     . ALA C  2  370  ? 92.333  -23.239 53.241  1.00 84.74  ? 370  ALA C N     1 
ATOM   6441  C  CA    . ALA C  2  370  ? 92.348  -21.856 53.709  1.00 85.47  ? 370  ALA C CA    1 
ATOM   6442  C  C     . ALA C  2  370  ? 91.911  -20.884 52.620  1.00 86.87  ? 370  ALA C C     1 
ATOM   6443  O  O     . ALA C  2  370  ? 91.302  -19.852 52.923  1.00 81.88  ? 370  ALA C O     1 
ATOM   6444  C  CB    . ALA C  2  370  ? 93.742  -21.489 54.219  1.00 91.09  ? 370  ALA C CB    1 
ATOM   6445  N  N     . LYS C  2  371  ? 92.217  -21.190 51.356  1.00 93.85  ? 371  LYS C N     1 
ATOM   6446  C  CA    . LYS C  2  371  ? 91.825  -20.334 50.242  1.00 92.48  ? 371  LYS C CA    1 
ATOM   6447  C  C     . LYS C  2  371  ? 90.371  -20.526 49.829  1.00 86.55  ? 371  LYS C C     1 
ATOM   6448  O  O     . LYS C  2  371  ? 89.802  -19.642 49.179  1.00 80.70  ? 371  LYS C O     1 
ATOM   6449  C  CB    . LYS C  2  371  ? 92.722  -20.599 49.029  1.00 96.90  ? 371  LYS C CB    1 
ATOM   6450  C  CG    . LYS C  2  371  ? 94.203  -20.319 49.233  1.00 93.88  ? 371  LYS C CG    1 
ATOM   6451  C  CD    . LYS C  2  371  ? 95.011  -20.830 48.044  1.00 102.38 ? 371  LYS C CD    1 
ATOM   6452  C  CE    . LYS C  2  371  ? 96.472  -20.430 48.145  1.00 107.86 ? 371  LYS C CE    1 
ATOM   6453  N  NZ    . LYS C  2  371  ? 96.635  -18.953 48.059  1.00 110.52 ? 371  LYS C NZ    1 
ATOM   6454  N  N     . LEU C  2  372  ? 89.764  -21.659 50.181  1.00 86.62  ? 372  LEU C N     1 
ATOM   6455  C  CA    . LEU C  2  372  ? 88.428  -22.009 49.715  1.00 85.74  ? 372  LEU C CA    1 
ATOM   6456  C  C     . LEU C  2  372  ? 87.320  -21.545 50.656  1.00 86.50  ? 372  LEU C C     1 
ATOM   6457  O  O     . LEU C  2  372  ? 86.197  -21.294 50.203  1.00 88.59  ? 372  LEU C O     1 
ATOM   6458  C  CB    . LEU C  2  372  ? 88.337  -23.527 49.523  1.00 81.15  ? 372  LEU C CB    1 
ATOM   6459  C  CG    . LEU C  2  372  ? 87.763  -24.086 48.218  1.00 79.18  ? 372  LEU C CG    1 
ATOM   6460  C  CD1   . LEU C  2  372  ? 88.415  -23.426 47.021  1.00 92.64  ? 372  LEU C CD1   1 
ATOM   6461  C  CD2   . LEU C  2  372  ? 87.948  -25.598 48.159  1.00 74.79  ? 372  LEU C CD2   1 
ATOM   6462  N  N     . VAL C  2  373  ? 87.612  -21.415 51.950  1.00 82.72  ? 373  VAL C N     1 
ATOM   6463  C  CA    . VAL C  2  373  ? 86.600  -21.194 52.978  1.00 73.17  ? 373  VAL C CA    1 
ATOM   6464  C  C     . VAL C  2  373  ? 86.575  -19.718 53.358  1.00 72.88  ? 373  VAL C C     1 
ATOM   6465  O  O     . VAL C  2  373  ? 87.622  -19.118 53.634  1.00 74.71  ? 373  VAL C O     1 
ATOM   6466  C  CB    . VAL C  2  373  ? 86.870  -22.079 54.209  1.00 69.88  ? 373  VAL C CB    1 
ATOM   6467  C  CG1   . VAL C  2  373  ? 86.189  -21.519 55.439  1.00 74.53  ? 373  VAL C CG1   1 
ATOM   6468  C  CG2   . VAL C  2  373  ? 86.400  -23.505 53.950  1.00 62.87  ? 373  VAL C CG2   1 
ATOM   6469  N  N     . ASN C  2  374  ? 85.378  -19.134 53.369  1.00 77.33  ? 374  ASN C N     1 
ATOM   6470  C  CA    . ASN C  2  374  ? 85.144  -17.792 53.893  1.00 76.19  ? 374  ASN C CA    1 
ATOM   6471  C  C     . ASN C  2  374  ? 84.152  -17.897 55.044  1.00 77.43  ? 374  ASN C C     1 
ATOM   6472  O  O     . ASN C  2  374  ? 83.002  -18.303 54.840  1.00 76.98  ? 374  ASN C O     1 
ATOM   6473  C  CB    . ASN C  2  374  ? 84.612  -16.857 52.807  1.00 75.99  ? 374  ASN C CB    1 
ATOM   6474  C  CG    . ASN C  2  374  ? 84.357  -15.458 53.322  1.00 73.14  ? 374  ASN C CG    1 
ATOM   6475  O  OD1   . ASN C  2  374  ? 84.856  -15.075 54.378  1.00 71.23  ? 374  ASN C OD1   1 
ATOM   6476  N  ND2   . ASN C  2  374  ? 83.577  -14.686 52.577  1.00 78.08  ? 374  ASN C ND2   1 
ATOM   6477  N  N     . SER C  2  375  ? 84.593  -17.527 56.246  1.00 77.31  ? 375  SER C N     1 
ATOM   6478  C  CA    . SER C  2  375  ? 83.794  -17.703 57.453  1.00 72.25  ? 375  SER C CA    1 
ATOM   6479  C  C     . SER C  2  375  ? 82.858  -16.535 57.744  1.00 74.87  ? 375  SER C C     1 
ATOM   6480  O  O     . SER C  2  375  ? 82.087  -16.611 58.708  1.00 77.11  ? 375  SER C O     1 
ATOM   6481  C  CB    . SER C  2  375  ? 84.709  -17.929 58.663  1.00 71.88  ? 375  SER C CB    1 
ATOM   6482  O  OG    . SER C  2  375  ? 85.518  -16.792 58.917  1.00 81.51  ? 375  SER C OG    1 
ATOM   6483  N  N     . ARG C  2  376  ? 82.907  -15.463 56.952  1.00 75.51  ? 376  ARG C N     1 
ATOM   6484  C  CA    . ARG C  2  376  ? 82.041  -14.316 57.213  1.00 73.40  ? 376  ARG C CA    1 
ATOM   6485  C  C     . ARG C  2  376  ? 80.553  -14.658 57.201  1.00 67.84  ? 376  ARG C C     1 
ATOM   6486  O  O     . ARG C  2  376  ? 79.826  -14.116 58.051  1.00 68.53  ? 376  ARG C O     1 
ATOM   6487  C  CB    . ARG C  2  376  ? 82.353  -13.190 56.219  1.00 78.59  ? 376  ARG C CB    1 
ATOM   6488  C  CG    . ARG C  2  376  ? 83.777  -12.651 56.320  1.00 79.14  ? 376  ARG C CG    1 
ATOM   6489  C  CD    . ARG C  2  376  ? 84.189  -12.446 57.772  1.00 75.78  ? 376  ARG C CD    1 
ATOM   6490  N  NE    . ARG C  2  376  ? 85.432  -11.691 57.903  1.00 75.75  ? 376  ARG C NE    1 
ATOM   6491  C  CZ    . ARG C  2  376  ? 86.058  -11.478 59.056  1.00 80.86  ? 376  ARG C CZ    1 
ATOM   6492  N  NH1   . ARG C  2  376  ? 85.562  -11.970 60.182  1.00 88.18  ? 376  ARG C NH1   1 
ATOM   6493  N  NH2   . ARG C  2  376  ? 87.182  -10.775 59.087  1.00 78.27  ? 376  ARG C NH2   1 
ATOM   6494  N  N     . PRO C  2  377  ? 80.033  -15.502 56.296  1.00 61.27  ? 377  PRO C N     1 
ATOM   6495  C  CA    . PRO C  2  377  ? 78.624  -15.911 56.430  1.00 65.37  ? 377  PRO C CA    1 
ATOM   6496  C  C     . PRO C  2  377  ? 78.300  -16.572 57.760  1.00 65.56  ? 377  PRO C C     1 
ATOM   6497  O  O     . PRO C  2  377  ? 77.272  -16.251 58.368  1.00 69.35  ? 377  PRO C O     1 
ATOM   6498  C  CB    . PRO C  2  377  ? 78.434  -16.875 55.253  1.00 56.86  ? 377  PRO C CB    1 
ATOM   6499  C  CG    . PRO C  2  377  ? 79.382  -16.399 54.241  1.00 56.66  ? 377  PRO C CG    1 
ATOM   6500  C  CD    . PRO C  2  377  ? 80.590  -15.932 55.001  1.00 64.97  ? 377  PRO C CD    1 
ATOM   6501  N  N     . LEU C  2  378  ? 79.146  -17.490 58.230  1.00 61.30  ? 378  LEU C N     1 
ATOM   6502  C  CA    . LEU C  2  378  ? 78.870  -18.182 59.486  1.00 60.61  ? 378  LEU C CA    1 
ATOM   6503  C  C     . LEU C  2  378  ? 78.951  -17.228 60.674  1.00 63.91  ? 378  LEU C C     1 
ATOM   6504  O  O     . LEU C  2  378  ? 78.090  -17.250 61.567  1.00 66.83  ? 378  LEU C O     1 
ATOM   6505  C  CB    . LEU C  2  378  ? 79.847  -19.344 59.660  1.00 63.57  ? 378  LEU C CB    1 
ATOM   6506  C  CG    . LEU C  2  378  ? 79.716  -20.188 60.927  1.00 65.97  ? 378  LEU C CG    1 
ATOM   6507  C  CD1   . LEU C  2  378  ? 78.427  -20.988 60.901  1.00 60.56  ? 378  LEU C CD1   1 
ATOM   6508  C  CD2   . LEU C  2  378  ? 80.916  -21.105 61.073  1.00 64.50  ? 378  LEU C CD2   1 
ATOM   6509  N  N     . GLU C  2  379  ? 79.999  -16.399 60.712  1.00 64.60  ? 379  GLU C N     1 
ATOM   6510  C  CA    . GLU C  2  379  ? 80.116  -15.398 61.765  1.00 67.73  ? 379  GLU C CA    1 
ATOM   6511  C  C     . GLU C  2  379  ? 78.906  -14.474 61.771  1.00 71.12  ? 379  GLU C C     1 
ATOM   6512  O  O     . GLU C  2  379  ? 78.359  -14.162 62.835  1.00 69.03  ? 379  GLU C O     1 
ATOM   6513  C  CB    . GLU C  2  379  ? 81.408  -14.596 61.586  1.00 78.34  ? 379  GLU C CB    1 
ATOM   6514  C  CG    . GLU C  2  379  ? 82.686  -15.419 61.764  1.00 86.74  ? 379  GLU C CG    1 
ATOM   6515  C  CD    . GLU C  2  379  ? 83.962  -14.621 61.503  1.00 89.62  ? 379  GLU C CD    1 
ATOM   6516  O  OE1   . GLU C  2  379  ? 84.646  -14.896 60.492  1.00 81.94  ? 379  GLU C OE1   1 
ATOM   6517  O  OE2   . GLU C  2  379  ? 84.284  -13.721 62.310  1.00 96.45  ? 379  GLU C OE2   1 
ATOM   6518  N  N     . ALA C  2  380  ? 78.453  -14.056 60.584  1.00 71.69  ? 380  ALA C N     1 
ATOM   6519  C  CA    . ALA C  2  380  ? 77.291  -13.180 60.489  1.00 70.17  ? 380  ALA C CA    1 
ATOM   6520  C  C     . ALA C  2  380  ? 76.023  -13.868 60.986  1.00 65.60  ? 380  ALA C C     1 
ATOM   6521  O  O     . ALA C  2  380  ? 75.225  -13.256 61.699  1.00 64.26  ? 380  ALA C O     1 
ATOM   6522  C  CB    . ALA C  2  380  ? 77.111  -12.699 59.050  1.00 63.39  ? 380  ALA C CB    1 
ATOM   6523  N  N     . ALA C  2  381  ? 75.818  -15.139 60.626  1.00 63.11  ? 381  ALA C N     1 
ATOM   6524  C  CA    . ALA C  2  381  ? 74.608  -15.839 61.054  1.00 56.45  ? 381  ALA C CA    1 
ATOM   6525  C  C     . ALA C  2  381  ? 74.572  -16.018 62.568  1.00 59.03  ? 381  ALA C C     1 
ATOM   6526  O  O     . ALA C  2  381  ? 73.530  -15.799 63.204  1.00 66.02  ? 381  ALA C O     1 
ATOM   6527  C  CB    . ALA C  2  381  ? 74.499  -17.190 60.352  1.00 57.11  ? 381  ALA C CB    1 
ATOM   6528  N  N     . ILE C  2  382  ? 75.696  -16.419 63.168  1.00 61.11  ? 382  ILE C N     1 
ATOM   6529  C  CA    . ILE C  2  382  ? 75.720  -16.589 64.620  1.00 57.72  ? 382  ILE C CA    1 
ATOM   6530  C  C     . ILE C  2  382  ? 75.557  -15.245 65.320  1.00 57.06  ? 382  ILE C C     1 
ATOM   6531  O  O     . ILE C  2  382  ? 74.825  -15.127 66.317  1.00 57.75  ? 382  ILE C O     1 
ATOM   6532  C  CB    . ILE C  2  382  ? 77.013  -17.297 65.059  1.00 59.81  ? 382  ILE C CB    1 
ATOM   6533  C  CG1   . ILE C  2  382  ? 77.171  -18.636 64.341  1.00 64.36  ? 382  ILE C CG1   1 
ATOM   6534  C  CG2   . ILE C  2  382  ? 77.005  -17.517 66.558  1.00 54.72  ? 382  ILE C CG2   1 
ATOM   6535  C  CD1   . ILE C  2  382  ? 78.520  -19.285 64.580  1.00 67.09  ? 382  ILE C CD1   1 
ATOM   6536  N  N     . ARG C  2  383  ? 76.248  -14.214 64.821  1.00 60.04  ? 383  ARG C N     1 
ATOM   6537  C  CA    . ARG C  2  383  ? 76.106  -12.874 65.376  1.00 63.80  ? 383  ARG C CA    1 
ATOM   6538  C  C     . ARG C  2  383  ? 74.657  -12.411 65.315  1.00 65.55  ? 383  ARG C C     1 
ATOM   6539  O  O     . ARG C  2  383  ? 74.132  -11.860 66.289  1.00 62.71  ? 383  ARG C O     1 
ATOM   6540  C  CB    . ARG C  2  383  ? 77.032  -11.921 64.617  1.00 66.35  ? 383  ARG C CB    1 
ATOM   6541  C  CG    . ARG C  2  383  ? 76.934  -10.461 65.006  1.00 75.27  ? 383  ARG C CG    1 
ATOM   6542  C  CD    . ARG C  2  383  ? 78.132  -9.671  64.481  1.00 79.89  ? 383  ARG C CD    1 
ATOM   6543  N  NE    . ARG C  2  383  ? 78.420  -9.943  63.073  1.00 87.89  ? 383  ARG C NE    1 
ATOM   6544  C  CZ    . ARG C  2  383  ? 79.480  -10.623 62.640  1.00 86.71  ? 383  ARG C CZ    1 
ATOM   6545  N  NH1   . ARG C  2  383  ? 80.363  -11.102 63.509  1.00 83.91  ? 383  ARG C NH1   1 
ATOM   6546  N  NH2   . ARG C  2  383  ? 79.663  -10.823 61.340  1.00 76.17  ? 383  ARG C NH2   1 
ATOM   6547  N  N     . GLU C  2  384  ? 73.986  -12.664 64.189  1.00 69.17  ? 384  GLU C N     1 
ATOM   6548  C  CA    . GLU C  2  384  ? 72.582  -12.303 64.036  1.00 67.19  ? 384  GLU C CA    1 
ATOM   6549  C  C     . GLU C  2  384  ? 71.717  -13.006 65.077  1.00 57.87  ? 384  GLU C C     1 
ATOM   6550  O  O     . GLU C  2  384  ? 70.962  -12.356 65.813  1.00 56.91  ? 384  GLU C O     1 
ATOM   6551  C  CB    . GLU C  2  384  ? 72.122  -12.657 62.620  1.00 67.19  ? 384  GLU C CB    1 
ATOM   6552  C  CG    . GLU C  2  384  ? 70.769  -12.101 62.232  1.00 81.79  ? 384  GLU C CG    1 
ATOM   6553  C  CD    . GLU C  2  384  ? 70.830  -10.635 61.849  1.00 95.46  ? 384  GLU C CD    1 
ATOM   6554  O  OE1   . GLU C  2  384  ? 71.953  -10.098 61.718  1.00 95.82  ? 384  GLU C OE1   1 
ATOM   6555  O  OE2   . GLU C  2  384  ? 69.753  -10.023 61.678  1.00 95.39  ? 384  GLU C OE2   1 
ATOM   6556  N  N     . PHE C  2  385  ? 71.826  -14.337 65.157  1.00 55.72  ? 385  PHE C N     1 
ATOM   6557  C  CA    . PHE C  2  385  ? 71.005  -15.096 66.098  1.00 47.77  ? 385  PHE C CA    1 
ATOM   6558  C  C     . PHE C  2  385  ? 71.168  -14.582 67.519  1.00 48.33  ? 385  PHE C C     1 
ATOM   6559  O  O     . PHE C  2  385  ? 70.181  -14.359 68.226  1.00 51.16  ? 385  PHE C O     1 
ATOM   6560  C  CB    . PHE C  2  385  ? 71.351  -16.582 66.043  1.00 47.44  ? 385  PHE C CB    1 
ATOM   6561  C  CG    . PHE C  2  385  ? 70.662  -17.402 67.103  1.00 49.18  ? 385  PHE C CG    1 
ATOM   6562  C  CD1   . PHE C  2  385  ? 69.361  -17.844 66.921  1.00 56.58  ? 385  PHE C CD1   1 
ATOM   6563  C  CD2   . PHE C  2  385  ? 71.314  -17.735 68.281  1.00 50.86  ? 385  PHE C CD2   1 
ATOM   6564  C  CE1   . PHE C  2  385  ? 68.725  -18.600 67.891  1.00 55.60  ? 385  PHE C CE1   1 
ATOM   6565  C  CE2   . PHE C  2  385  ? 70.680  -18.490 69.258  1.00 45.43  ? 385  PHE C CE2   1 
ATOM   6566  C  CZ    . PHE C  2  385  ? 69.388  -18.923 69.061  1.00 45.86  ? 385  PHE C CZ    1 
ATOM   6567  N  N     . PHE C  2  386  ? 72.408  -14.391 67.964  1.00 50.80  ? 386  PHE C N     1 
ATOM   6568  C  CA    . PHE C  2  386  ? 72.583  -14.012 69.364  1.00 46.97  ? 386  PHE C CA    1 
ATOM   6569  C  C     . PHE C  2  386  ? 72.260  -12.546 69.630  1.00 54.86  ? 386  PHE C C     1 
ATOM   6570  O  O     . PHE C  2  386  ? 71.766  -12.222 70.717  1.00 56.18  ? 386  PHE C O     1 
ATOM   6571  C  CB    . PHE C  2  386  ? 73.998  -14.336 69.828  1.00 45.68  ? 386  PHE C CB    1 
ATOM   6572  C  CG    . PHE C  2  386  ? 74.158  -15.738 70.329  1.00 45.55  ? 386  PHE C CG    1 
ATOM   6573  C  CD1   . PHE C  2  386  ? 74.499  -16.762 69.461  1.00 46.97  ? 386  PHE C CD1   1 
ATOM   6574  C  CD2   . PHE C  2  386  ? 73.954  -16.036 71.668  1.00 41.53  ? 386  PHE C CD2   1 
ATOM   6575  C  CE1   . PHE C  2  386  ? 74.642  -18.059 69.917  1.00 47.82  ? 386  PHE C CE1   1 
ATOM   6576  C  CE2   . PHE C  2  386  ? 74.095  -17.330 72.133  1.00 42.03  ? 386  PHE C CE2   1 
ATOM   6577  C  CZ    . PHE C  2  386  ? 74.441  -18.345 71.255  1.00 45.97  ? 386  PHE C CZ    1 
ATOM   6578  N  N     . SER C  2  387  ? 72.503  -11.650 68.671  1.00 59.23  ? 387  SER C N     1 
ATOM   6579  C  CA    . SER C  2  387  ? 72.355  -10.221 68.929  1.00 54.84  ? 387  SER C CA    1 
ATOM   6580  C  C     . SER C  2  387  ? 70.940  -9.714  68.679  1.00 61.84  ? 387  SER C C     1 
ATOM   6581  O  O     . SER C  2  387  ? 70.386  -8.998  69.517  1.00 67.16  ? 387  SER C O     1 
ATOM   6582  C  CB    . SER C  2  387  ? 73.346  -9.435  68.069  1.00 61.32  ? 387  SER C CB    1 
ATOM   6583  O  OG    . SER C  2  387  ? 74.680  -9.771  68.403  1.00 67.41  ? 387  SER C OG    1 
ATOM   6584  N  N     . ARG C  2  388  ? 70.342  -10.061 67.537  1.00 62.85  ? 388  ARG C N     1 
ATOM   6585  C  CA    . ARG C  2  388  ? 69.131  -9.388  67.087  1.00 61.36  ? 388  ARG C CA    1 
ATOM   6586  C  C     . ARG C  2  388  ? 67.907  -10.293 67.018  1.00 62.77  ? 388  ARG C C     1 
ATOM   6587  O  O     . ARG C  2  388  ? 66.873  -9.865  66.497  1.00 72.43  ? 388  ARG C O     1 
ATOM   6588  C  CB    . ARG C  2  388  ? 69.373  -8.741  65.724  1.00 67.64  ? 388  ARG C CB    1 
ATOM   6589  C  CG    . ARG C  2  388  ? 70.110  -7.418  65.802  1.00 73.62  ? 388  ARG C CG    1 
ATOM   6590  C  CD    . ARG C  2  388  ? 70.608  -6.972  64.434  1.00 87.05  ? 388  ARG C CD    1 
ATOM   6591  N  NE    . ARG C  2  388  ? 71.681  -7.826  63.923  1.00 97.66  ? 388  ARG C NE    1 
ATOM   6592  C  CZ    . ARG C  2  388  ? 72.959  -7.725  64.287  1.00 99.65  ? 388  ARG C CZ    1 
ATOM   6593  N  NH1   . ARG C  2  388  ? 73.328  -6.812  65.176  1.00 101.67 ? 388  ARG C NH1   1 
ATOM   6594  N  NH2   . ARG C  2  388  ? 73.871  -8.542  63.767  1.00 87.09  ? 388  ARG C NH2   1 
ATOM   6595  N  N     . SER C  2  389  ? 67.979  -11.515 67.539  1.00 59.03  ? 389  SER C N     1 
ATOM   6596  C  CA    . SER C  2  389  ? 66.818  -12.388 67.456  1.00 58.15  ? 389  SER C CA    1 
ATOM   6597  C  C     . SER C  2  389  ? 65.762  -12.016 68.493  1.00 63.24  ? 389  SER C C     1 
ATOM   6598  O  O     . SER C  2  389  ? 66.026  -11.333 69.489  1.00 62.17  ? 389  SER C O     1 
ATOM   6599  C  CB    . SER C  2  389  ? 67.206  -13.850 67.646  1.00 53.83  ? 389  SER C CB    1 
ATOM   6600  O  OG    . SER C  2  389  ? 66.044  -14.661 67.688  1.00 52.30  ? 389  SER C OG    1 
ATOM   6601  N  N     . GLN C  2  390  ? 64.544  -12.492 68.239  1.00 62.95  ? 390  GLN C N     1 
ATOM   6602  C  CA    . GLN C  2  390  ? 63.450  -12.295 69.180  1.00 70.39  ? 390  GLN C CA    1 
ATOM   6603  C  C     . GLN C  2  390  ? 63.556  -13.254 70.360  1.00 63.55  ? 390  GLN C C     1 
ATOM   6604  O  O     . GLN C  2  390  ? 63.224  -12.886 71.493  1.00 65.77  ? 390  GLN C O     1 
ATOM   6605  C  CB    . GLN C  2  390  ? 62.110  -12.467 68.464  1.00 76.89  ? 390  GLN C CB    1 
ATOM   6606  C  CG    . GLN C  2  390  ? 60.895  -12.362 69.370  1.00 77.86  ? 390  GLN C CG    1 
ATOM   6607  C  CD    . GLN C  2  390  ? 59.591  -12.469 68.606  1.00 87.32  ? 390  GLN C CD    1 
ATOM   6608  O  OE1   . GLN C  2  390  ? 59.586  -12.702 67.396  1.00 94.83  ? 390  GLN C OE1   1 
ATOM   6609  N  NE2   . GLN C  2  390  ? 58.475  -12.294 69.309  1.00 76.91  ? 390  GLN C NE2   1 
ATOM   6610  N  N     . LEU C  2  391  ? 64.016  -14.483 70.116  1.00 57.30  ? 391  LEU C N     1 
ATOM   6611  C  CA    . LEU C  2  391  ? 64.182  -15.447 71.196  1.00 52.24  ? 391  LEU C CA    1 
ATOM   6612  C  C     . LEU C  2  391  ? 65.419  -15.173 72.038  1.00 53.68  ? 391  LEU C C     1 
ATOM   6613  O  O     . LEU C  2  391  ? 65.530  -15.718 73.142  1.00 53.58  ? 391  LEU C O     1 
ATOM   6614  C  CB    . LEU C  2  391  ? 64.235  -16.872 70.635  1.00 47.43  ? 391  LEU C CB    1 
ATOM   6615  C  CG    . LEU C  2  391  ? 62.881  -17.472 70.240  1.00 55.39  ? 391  LEU C CG    1 
ATOM   6616  C  CD1   . LEU C  2  391  ? 63.042  -18.786 69.491  1.00 50.32  ? 391  LEU C CD1   1 
ATOM   6617  C  CD2   . LEU C  2  391  ? 62.010  -17.667 71.471  1.00 54.04  ? 391  LEU C CD2   1 
ATOM   6618  N  N     . SER C  2  392  ? 66.345  -14.349 71.548  1.00 51.15  ? 392  SER C N     1 
ATOM   6619  C  CA    . SER C  2  392  ? 67.489  -13.900 72.334  1.00 47.20  ? 392  SER C CA    1 
ATOM   6620  C  C     . SER C  2  392  ? 67.099  -12.608 73.031  1.00 50.73  ? 392  SER C C     1 
ATOM   6621  O  O     . SER C  2  392  ? 66.980  -11.561 72.384  1.00 53.32  ? 392  SER C O     1 
ATOM   6622  C  CB    . SER C  2  392  ? 68.717  -13.682 71.457  1.00 49.28  ? 392  SER C CB    1 
ATOM   6623  O  OG    . SER C  2  392  ? 69.779  -13.137 72.224  1.00 46.22  ? 392  SER C OG    1 
ATOM   6624  N  N     . GLN C  2  393  ? 66.916  -12.673 74.348  1.00 48.94  ? 393  GLN C N     1 
ATOM   6625  C  CA    . GLN C  2  393  ? 66.370  -11.561 75.107  1.00 52.23  ? 393  GLN C CA    1 
ATOM   6626  C  C     . GLN C  2  393  ? 67.379  -11.050 76.122  1.00 50.63  ? 393  GLN C C     1 
ATOM   6627  O  O     . GLN C  2  393  ? 68.142  -11.826 76.704  1.00 46.82  ? 393  GLN C O     1 
ATOM   6628  C  CB    . GLN C  2  393  ? 65.089  -11.976 75.827  1.00 52.96  ? 393  GLN C CB    1 
ATOM   6629  C  CG    . GLN C  2  393  ? 63.989  -12.428 74.894  1.00 51.67  ? 393  GLN C CG    1 
ATOM   6630  C  CD    . GLN C  2  393  ? 62.813  -13.006 75.639  1.00 56.69  ? 393  GLN C CD    1 
ATOM   6631  O  OE1   . GLN C  2  393  ? 62.759  -12.966 76.870  1.00 52.21  ? 393  GLN C OE1   1 
ATOM   6632  N  NE2   . GLN C  2  393  ? 61.860  -13.555 74.898  1.00 65.96  ? 393  GLN C NE2   1 
ATOM   6633  N  N     . PHE C  2  394  ? 67.374  -9.735  76.320  1.00 50.04  ? 394  PHE C N     1 
ATOM   6634  C  CA    . PHE C  2  394  ? 68.095  -9.110  77.420  1.00 45.39  ? 394  PHE C CA    1 
ATOM   6635  C  C     . PHE C  2  394  ? 67.699  -9.767  78.738  1.00 49.64  ? 394  PHE C C     1 
ATOM   6636  O  O     . PHE C  2  394  ? 66.517  -9.804  79.093  1.00 55.28  ? 394  PHE C O     1 
ATOM   6637  C  CB    . PHE C  2  394  ? 67.772  -7.614  77.428  1.00 46.76  ? 394  PHE C CB    1 
ATOM   6638  C  CG    . PHE C  2  394  ? 68.761  -6.772  78.172  1.00 47.86  ? 394  PHE C CG    1 
ATOM   6639  C  CD1   . PHE C  2  394  ? 70.041  -6.588  77.685  1.00 56.19  ? 394  PHE C CD1   1 
ATOM   6640  C  CD2   . PHE C  2  394  ? 68.396  -6.128  79.340  1.00 52.75  ? 394  PHE C CD2   1 
ATOM   6641  C  CE1   . PHE C  2  394  ? 70.946  -5.799  78.369  1.00 63.24  ? 394  PHE C CE1   1 
ATOM   6642  C  CE2   . PHE C  2  394  ? 69.291  -5.340  80.025  1.00 52.90  ? 394  PHE C CE2   1 
ATOM   6643  C  CZ    . PHE C  2  394  ? 70.567  -5.174  79.542  1.00 62.30  ? 394  PHE C CZ    1 
ATOM   6644  N  N     . LYS C  2  395  ? 68.687  -10.311 79.449  1.00 49.06  ? 395  LYS C N     1 
ATOM   6645  C  CA    . LYS C  2  395  ? 68.405  -11.115 80.635  1.00 47.67  ? 395  LYS C CA    1 
ATOM   6646  C  C     . LYS C  2  395  ? 67.742  -10.280 81.724  1.00 50.37  ? 395  LYS C C     1 
ATOM   6647  O  O     . LYS C  2  395  ? 68.153  -9.150  82.004  1.00 51.09  ? 395  LYS C O     1 
ATOM   6648  C  CB    . LYS C  2  395  ? 69.697  -11.734 81.170  1.00 54.54  ? 395  LYS C CB    1 
ATOM   6649  C  CG    . LYS C  2  395  ? 69.529  -12.637 82.387  1.00 46.28  ? 395  LYS C CG    1 
ATOM   6650  C  CD    . LYS C  2  395  ? 70.868  -12.839 83.077  1.00 49.75  ? 395  LYS C CD    1 
ATOM   6651  C  CE    . LYS C  2  395  ? 70.917  -14.132 83.856  1.00 53.48  ? 395  LYS C CE    1 
ATOM   6652  N  NZ    . LYS C  2  395  ? 72.175  -14.232 84.639  1.00 64.85  ? 395  LYS C NZ    1 
ATOM   6653  N  N     . ASP C  2  396  ? 66.706  -10.847 82.338  1.00 51.76  ? 396  ASP C N     1 
ATOM   6654  C  CA    . ASP C  2  396  ? 66.018  -10.219 83.466  1.00 48.47  ? 396  ASP C CA    1 
ATOM   6655  C  C     . ASP C  2  396  ? 66.682  -10.700 84.750  1.00 45.51  ? 396  ASP C C     1 
ATOM   6656  O  O     . ASP C  2  396  ? 66.357  -11.770 85.261  1.00 43.04  ? 396  ASP C O     1 
ATOM   6657  C  CB    . ASP C  2  396  ? 64.533  -10.562 83.451  1.00 48.06  ? 396  ASP C CB    1 
ATOM   6658  C  CG    . ASP C  2  396  ? 63.782  -9.981  84.643  1.00 55.31  ? 396  ASP C CG    1 
ATOM   6659  O  OD1   . ASP C  2  396  ? 64.339  -9.106  85.342  1.00 54.20  ? 396  ASP C OD1   1 
ATOM   6660  O  OD2   . ASP C  2  396  ? 62.625  -10.402 84.879  1.00 59.43  ? 396  ASP C OD2   1 
ATOM   6661  N  N     . GLU C  2  397  ? 67.610  -9.906  85.282  1.00 46.16  ? 397  GLU C N     1 
ATOM   6662  C  CA    . GLU C  2  397  ? 68.293  -10.249 86.521  1.00 49.60  ? 397  GLU C CA    1 
ATOM   6663  C  C     . GLU C  2  397  ? 68.001  -9.234  87.626  1.00 53.83  ? 397  GLU C C     1 
ATOM   6664  O  O     . GLU C  2  397  ? 68.891  -8.880  88.405  1.00 55.87  ? 397  GLU C O     1 
ATOM   6665  C  CB    . GLU C  2  397  ? 69.799  -10.394 86.294  1.00 48.73  ? 397  GLU C CB    1 
ATOM   6666  C  CG    . GLU C  2  397  ? 70.476  -9.220  85.598  1.00 55.11  ? 397  GLU C CG    1 
ATOM   6667  C  CD    . GLU C  2  397  ? 71.983  -9.424  85.451  1.00 70.98  ? 397  GLU C CD    1 
ATOM   6668  O  OE1   . GLU C  2  397  ? 72.472  -10.528 85.785  1.00 70.92  ? 397  GLU C OE1   1 
ATOM   6669  O  OE2   . GLU C  2  397  ? 72.681  -8.483  85.006  1.00 71.01  ? 397  GLU C OE2   1 
ATOM   6670  N  N     . THR C  2  398  ? 66.755  -8.750  87.701  1.00 52.37  ? 398  THR C N     1 
ATOM   6671  C  CA    . THR C  2  398  ? 66.352  -7.859  88.787  1.00 48.24  ? 398  THR C CA    1 
ATOM   6672  C  C     . THR C  2  398  ? 66.721  -8.453  90.137  1.00 50.81  ? 398  THR C C     1 
ATOM   6673  O  O     . THR C  2  398  ? 67.377  -7.805  90.961  1.00 54.66  ? 398  THR C O     1 
ATOM   6674  C  CB    . THR C  2  398  ? 64.847  -7.597  88.724  1.00 42.18  ? 398  THR C CB    1 
ATOM   6675  O  OG1   . THR C  2  398  ? 64.490  -7.141  87.416  1.00 46.86  ? 398  THR C OG1   1 
ATOM   6676  C  CG2   . THR C  2  398  ? 64.466  -6.547  89.741  1.00 43.53  ? 398  THR C CG2   1 
ATOM   6677  N  N     . ASN C  2  399  ? 66.294  -9.685  90.372  1.00 47.95  ? 399  ASN C N     1 
ATOM   6678  C  CA    . ASN C  2  399  ? 66.717  -10.518 91.487  1.00 47.61  ? 399  ASN C CA    1 
ATOM   6679  C  C     . ASN C  2  399  ? 67.041  -11.892 90.926  1.00 50.64  ? 399  ASN C C     1 
ATOM   6680  O  O     . ASN C  2  399  ? 66.738  -12.178 89.762  1.00 45.81  ? 399  ASN C O     1 
ATOM   6681  C  CB    . ASN C  2  399  ? 65.637  -10.598 92.572  1.00 42.21  ? 399  ASN C CB    1 
ATOM   6682  C  CG    . ASN C  2  399  ? 64.331  -11.179 92.067  1.00 42.96  ? 399  ASN C CG    1 
ATOM   6683  O  OD1   . ASN C  2  399  ? 64.188  -12.392 91.907  1.00 43.74  ? 399  ASN C OD1   1 
ATOM   6684  N  ND2   . ASN C  2  399  ? 63.365  -10.311 91.835  1.00 42.40  ? 399  ASN C ND2   1 
ATOM   6685  N  N     . PRO C  2  400  ? 67.694  -12.762 91.712  1.00 52.82  ? 400  PRO C N     1 
ATOM   6686  C  CA    . PRO C  2  400  ? 68.060  -14.089 91.186  1.00 53.55  ? 400  PRO C CA    1 
ATOM   6687  C  C     . PRO C  2  400  ? 66.893  -14.874 90.608  1.00 51.23  ? 400  PRO C C     1 
ATOM   6688  O  O     . PRO C  2  400  ? 67.041  -15.544 89.570  1.00 47.81  ? 400  PRO C O     1 
ATOM   6689  C  CB    . PRO C  2  400  ? 68.652  -14.785 92.423  1.00 58.73  ? 400  PRO C CB    1 
ATOM   6690  C  CG    . PRO C  2  400  ? 69.195  -13.667 93.240  1.00 60.08  ? 400  PRO C CG    1 
ATOM   6691  C  CD    . PRO C  2  400  ? 68.290  -12.501 93.035  1.00 51.96  ? 400  PRO C CD    1 
ATOM   6692  N  N     . LEU C  2  401  ? 65.725  -14.796 91.252  1.00 47.59  ? 401  LEU C N     1 
ATOM   6693  C  CA    . LEU C  2  401  ? 64.555  -15.508 90.757  1.00 42.51  ? 401  LEU C CA    1 
ATOM   6694  C  C     . LEU C  2  401  ? 64.122  -14.993 89.392  1.00 46.15  ? 401  LEU C C     1 
ATOM   6695  O  O     . LEU C  2  401  ? 63.618  -15.770 88.576  1.00 48.47  ? 401  LEU C O     1 
ATOM   6696  C  CB    . LEU C  2  401  ? 63.410  -15.398 91.760  1.00 42.01  ? 401  LEU C CB    1 
ATOM   6697  C  CG    . LEU C  2  401  ? 62.093  -16.073 91.381  1.00 48.60  ? 401  LEU C CG    1 
ATOM   6698  C  CD1   . LEU C  2  401  ? 62.280  -17.578 91.215  1.00 44.30  ? 401  LEU C CD1   1 
ATOM   6699  C  CD2   . LEU C  2  401  ? 61.033  -15.762 92.422  1.00 45.21  ? 401  LEU C CD2   1 
ATOM   6700  N  N     . SER C  2  402  ? 64.325  -13.701 89.115  1.00 43.78  ? 402  SER C N     1 
ATOM   6701  C  CA    . SER C  2  402  ? 63.962  -13.163 87.807  1.00 43.74  ? 402  SER C CA    1 
ATOM   6702  C  C     . SER C  2  402  ? 64.651  -13.939 86.691  1.00 46.36  ? 402  SER C C     1 
ATOM   6703  O  O     . SER C  2  402  ? 63.996  -14.438 85.770  1.00 44.66  ? 402  SER C O     1 
ATOM   6704  C  CB    . SER C  2  402  ? 64.315  -11.677 87.732  1.00 46.12  ? 402  SER C CB    1 
ATOM   6705  O  OG    . SER C  2  402  ? 64.757  -11.188 88.985  1.00 44.93  ? 402  SER C OG    1 
ATOM   6706  N  N     . SER C  2  403  ? 65.974  -14.088 86.784  1.00 49.56  ? 403  SER C N     1 
ATOM   6707  C  CA    . SER C  2  403  ? 66.724  -14.805 85.759  1.00 43.79  ? 403  SER C CA    1 
ATOM   6708  C  C     . SER C  2  403  ? 66.429  -16.300 85.790  1.00 45.93  ? 403  SER C C     1 
ATOM   6709  O  O     . SER C  2  403  ? 66.247  -16.925 84.737  1.00 50.55  ? 403  SER C O     1 
ATOM   6710  C  CB    . SER C  2  403  ? 68.216  -14.546 85.939  1.00 44.87  ? 403  SER C CB    1 
ATOM   6711  O  OG    . SER C  2  403  ? 68.572  -14.589 87.306  1.00 48.05  ? 403  SER C OG    1 
ATOM   6712  N  N     . LEU C  2  404  ? 66.408  -16.900 86.985  1.00 45.95  ? 404  LEU C N     1 
ATOM   6713  C  CA    . LEU C  2  404  ? 66.115  -18.329 87.069  1.00 46.98  ? 404  LEU C CA    1 
ATOM   6714  C  C     . LEU C  2  404  ? 64.786  -18.664 86.399  1.00 46.21  ? 404  LEU C C     1 
ATOM   6715  O  O     . LEU C  2  404  ? 64.668  -19.686 85.713  1.00 48.08  ? 404  LEU C O     1 
ATOM   6716  C  CB    . LEU C  2  404  ? 66.116  -18.785 88.529  1.00 51.75  ? 404  LEU C CB    1 
ATOM   6717  C  CG    . LEU C  2  404  ? 65.581  -20.196 88.796  1.00 45.35  ? 404  LEU C CG    1 
ATOM   6718  C  CD1   . LEU C  2  404  ? 66.467  -21.245 88.151  1.00 52.58  ? 404  LEU C CD1   1 
ATOM   6719  C  CD2   . LEU C  2  404  ? 65.445  -20.450 90.287  1.00 50.95  ? 404  LEU C CD2   1 
ATOM   6720  N  N     . ARG C  2  405  ? 63.780  -17.805 86.567  1.00 46.24  ? 405  ARG C N     1 
ATOM   6721  C  CA    . ARG C  2  405  ? 62.505  -18.005 85.887  1.00 49.56  ? 405  ARG C CA    1 
ATOM   6722  C  C     . ARG C  2  405  ? 62.601  -17.663 84.405  1.00 52.71  ? 405  ARG C C     1 
ATOM   6723  O  O     . ARG C  2  405  ? 61.924  -18.289 83.580  1.00 53.44  ? 405  ARG C O     1 
ATOM   6724  C  CB    . ARG C  2  405  ? 61.427  -17.156 86.553  1.00 48.01  ? 405  ARG C CB    1 
ATOM   6725  C  CG    . ARG C  2  405  ? 60.084  -17.225 85.869  1.00 55.18  ? 405  ARG C CG    1 
ATOM   6726  C  CD    . ARG C  2  405  ? 59.302  -15.948 86.078  1.00 55.78  ? 405  ARG C CD    1 
ATOM   6727  N  NE    . ARG C  2  405  ? 59.504  -15.004 84.985  1.00 57.89  ? 405  ARG C NE    1 
ATOM   6728  C  CZ    . ARG C  2  405  ? 58.623  -14.070 84.645  1.00 62.59  ? 405  ARG C CZ    1 
ATOM   6729  N  NH1   . ARG C  2  405  ? 57.476  -13.966 85.307  1.00 52.39  ? 405  ARG C NH1   1 
ATOM   6730  N  NH2   . ARG C  2  405  ? 58.884  -13.246 83.638  1.00 67.20  ? 405  ARG C NH2   1 
ATOM   6731  N  N     . HIS C  2  406  ? 63.426  -16.672 84.056  1.00 46.12  ? 406  HIS C N     1 
ATOM   6732  C  CA    . HIS C  2  406  ? 63.591  -16.289 82.661  1.00 39.08  ? 406  HIS C CA    1 
ATOM   6733  C  C     . HIS C  2  406  ? 64.090  -17.462 81.837  1.00 39.64  ? 406  HIS C C     1 
ATOM   6734  O  O     . HIS C  2  406  ? 63.574  -17.736 80.749  1.00 41.97  ? 406  HIS C O     1 
ATOM   6735  C  CB    . HIS C  2  406  ? 64.563  -15.113 82.561  1.00 39.14  ? 406  HIS C CB    1 
ATOM   6736  C  CG    . HIS C  2  406  ? 64.532  -14.408 81.243  1.00 38.27  ? 406  HIS C CG    1 
ATOM   6737  N  ND1   . HIS C  2  406  ? 65.251  -13.258 81.001  1.00 41.37  ? 406  HIS C ND1   1 
ATOM   6738  C  CD2   . HIS C  2  406  ? 63.864  -14.683 80.098  1.00 38.58  ? 406  HIS C CD2   1 
ATOM   6739  C  CE1   . HIS C  2  406  ? 65.030  -12.856 79.763  1.00 44.94  ? 406  HIS C CE1   1 
ATOM   6740  N  NE2   . HIS C  2  406  ? 64.191  -13.703 79.193  1.00 40.64  ? 406  HIS C NE2   1 
ATOM   6741  N  N     . LYS C  2  407  ? 65.090  -18.176 82.351  1.00 43.90  ? 407  LYS C N     1 
ATOM   6742  C  CA    . LYS C  2  407  ? 65.679  -19.265 81.583  1.00 46.70  ? 407  LYS C CA    1 
ATOM   6743  C  C     . LYS C  2  407  ? 64.687  -20.399 81.360  1.00 48.97  ? 407  LYS C C     1 
ATOM   6744  O  O     . LYS C  2  407  ? 64.790  -21.120 80.358  1.00 47.95  ? 407  LYS C O     1 
ATOM   6745  C  CB    . LYS C  2  407  ? 66.945  -19.765 82.281  1.00 45.42  ? 407  LYS C CB    1 
ATOM   6746  C  CG    . LYS C  2  407  ? 68.025  -18.698 82.389  1.00 43.48  ? 407  LYS C CG    1 
ATOM   6747  C  CD    . LYS C  2  407  ? 68.889  -18.889 83.622  1.00 49.16  ? 407  LYS C CD    1 
ATOM   6748  C  CE    . LYS C  2  407  ? 69.858  -17.732 83.792  1.00 51.44  ? 407  LYS C CE    1 
ATOM   6749  N  NZ    . LYS C  2  407  ? 70.444  -17.699 85.162  1.00 56.19  ? 407  LYS C NZ    1 
ATOM   6750  N  N     . ARG C  2  408  ? 63.712  -20.559 82.260  1.00 45.68  ? 408  ARG C N     1 
ATOM   6751  C  CA    . ARG C  2  408  ? 62.691  -21.594 82.143  1.00 42.14  ? 408  ARG C CA    1 
ATOM   6752  C  C     . ARG C  2  408  ? 61.440  -21.104 81.423  1.00 40.48  ? 408  ARG C C     1 
ATOM   6753  O  O     . ARG C  2  408  ? 60.386  -21.739 81.535  1.00 36.35  ? 408  ARG C O     1 
ATOM   6754  C  CB    . ARG C  2  408  ? 62.325  -22.132 83.527  1.00 38.25  ? 408  ARG C CB    1 
ATOM   6755  C  CG    . ARG C  2  408  ? 63.532  -22.372 84.413  1.00 40.69  ? 408  ARG C CG    1 
ATOM   6756  C  CD    . ARG C  2  408  ? 63.143  -22.859 85.795  1.00 39.97  ? 408  ARG C CD    1 
ATOM   6757  N  NE    . ARG C  2  408  ? 63.083  -24.313 85.864  1.00 35.83  ? 408  ARG C NE    1 
ATOM   6758  C  CZ    . ARG C  2  408  ? 61.960  -25.007 85.997  1.00 42.04  ? 408  ARG C CZ    1 
ATOM   6759  N  NH1   . ARG C  2  408  ? 60.799  -24.373 86.086  1.00 46.91  ? 408  ARG C NH1   1 
ATOM   6760  N  NH2   . ARG C  2  408  ? 62.001  -26.332 86.052  1.00 44.26  ? 408  ARG C NH2   1 
ATOM   6761  N  N     . ARG C  2  409  ? 61.533  -19.985 80.707  1.00 46.44  ? 409  ARG C N     1 
ATOM   6762  C  CA    . ARG C  2  409  ? 60.416  -19.479 79.922  1.00 48.60  ? 409  ARG C CA    1 
ATOM   6763  C  C     . ARG C  2  409  ? 60.250  -20.281 78.636  1.00 41.60  ? 409  ARG C C     1 
ATOM   6764  O  O     . ARG C  2  409  ? 61.217  -20.791 78.063  1.00 43.18  ? 409  ARG C O     1 
ATOM   6765  C  CB    . ARG C  2  409  ? 60.615  -17.996 79.592  1.00 44.51  ? 409  ARG C CB    1 
ATOM   6766  C  CG    . ARG C  2  409  ? 60.098  -17.050 80.661  1.00 50.76  ? 409  ARG C CG    1 
ATOM   6767  C  CD    . ARG C  2  409  ? 58.597  -17.193 80.797  1.00 58.01  ? 409  ARG C CD    1 
ATOM   6768  N  NE    . ARG C  2  409  ? 58.048  -16.414 81.902  1.00 65.23  ? 409  ARG C NE    1 
ATOM   6769  C  CZ    . ARG C  2  409  ? 56.745  -16.252 82.119  1.00 64.64  ? 409  ARG C CZ    1 
ATOM   6770  N  NH1   . ARG C  2  409  ? 56.322  -15.526 83.146  1.00 63.02  ? 409  ARG C NH1   1 
ATOM   6771  N  NH2   . ARG C  2  409  ? 55.860  -16.813 81.302  1.00 59.68  ? 409  ARG C NH2   1 
ATOM   6772  N  N     . ILE C  2  410  ? 59.005  -20.389 78.187  1.00 36.94  ? 410  ILE C N     1 
ATOM   6773  C  CA    . ILE C  2  410  ? 58.655  -21.089 76.960  1.00 32.16  ? 410  ILE C CA    1 
ATOM   6774  C  C     . ILE C  2  410  ? 57.849  -20.129 76.105  1.00 37.22  ? 410  ILE C C     1 
ATOM   6775  O  O     . ILE C  2  410  ? 56.742  -19.735 76.487  1.00 48.10  ? 410  ILE C O     1 
ATOM   6776  C  CB    . ILE C  2  410  ? 57.849  -22.368 77.231  1.00 38.58  ? 410  ILE C CB    1 
ATOM   6777  C  CG1   . ILE C  2  410  ? 58.668  -23.354 78.065  1.00 42.56  ? 410  ILE C CG1   1 
ATOM   6778  C  CG2   . ILE C  2  410  ? 57.399  -23.000 75.925  1.00 39.64  ? 410  ILE C CG2   1 
ATOM   6779  C  CD1   . ILE C  2  410  ? 57.867  -24.547 78.552  1.00 48.91  ? 410  ILE C CD1   1 
ATOM   6780  N  N     . SER C  2  411  ? 58.396  -19.750 74.961  1.00 36.37  ? 411  SER C N     1 
ATOM   6781  C  CA    . SER C  2  411  ? 57.746  -18.818 74.054  1.00 37.31  ? 411  SER C CA    1 
ATOM   6782  C  C     . SER C  2  411  ? 57.136  -19.581 72.886  1.00 43.01  ? 411  SER C C     1 
ATOM   6783  O  O     . SER C  2  411  ? 57.759  -20.488 72.331  1.00 44.02  ? 411  SER C O     1 
ATOM   6784  C  CB    . SER C  2  411  ? 58.748  -17.777 73.545  1.00 37.00  ? 411  SER C CB    1 
ATOM   6785  O  OG    . SER C  2  411  ? 58.152  -16.834 72.673  1.00 38.94  ? 411  SER C OG    1 
ATOM   6786  N  N     . ALA C  2  412  ? 55.905  -19.228 72.532  1.00 46.85  ? 412  ALA C N     1 
ATOM   6787  C  CA    . ALA C  2  412  ? 55.306  -19.710 71.297  1.00 47.77  ? 412  ALA C CA    1 
ATOM   6788  C  C     . ALA C  2  412  ? 55.529  -18.746 70.142  1.00 52.66  ? 412  ALA C C     1 
ATOM   6789  O  O     . ALA C  2  412  ? 55.125  -19.047 69.014  1.00 58.54  ? 412  ALA C O     1 
ATOM   6790  C  CB    . ALA C  2  412  ? 53.808  -19.956 71.490  1.00 43.21  ? 412  ALA C CB    1 
ATOM   6791  N  N     . LEU C  2  413  ? 56.166  -17.606 70.402  1.00 50.59  ? 413  LEU C N     1 
ATOM   6792  C  CA    . LEU C  2  413  ? 56.439  -16.589 69.399  1.00 58.85  ? 413  LEU C CA    1 
ATOM   6793  C  C     . LEU C  2  413  ? 57.846  -16.780 68.836  1.00 65.95  ? 413  LEU C C     1 
ATOM   6794  O  O     . LEU C  2  413  ? 58.524  -17.771 69.117  1.00 60.94  ? 413  LEU C O     1 
ATOM   6795  C  CB    . LEU C  2  413  ? 56.269  -15.199 70.004  1.00 55.99  ? 413  LEU C CB    1 
ATOM   6796  C  CG    . LEU C  2  413  ? 54.924  -14.913 70.659  1.00 51.21  ? 413  LEU C CG    1 
ATOM   6797  C  CD1   . LEU C  2  413  ? 54.931  -13.541 71.303  1.00 57.87  ? 413  LEU C CD1   1 
ATOM   6798  C  CD2   . LEU C  2  413  ? 53.820  -15.019 69.626  1.00 64.97  ? 413  LEU C CD2   1 
ATOM   6799  N  N     . GLY C  2  414  ? 58.307  -15.819 68.038  1.00 73.65  ? 414  GLY C N     1 
ATOM   6800  C  CA    . GLY C  2  414  ? 59.636  -15.870 67.477  1.00 75.26  ? 414  GLY C CA    1 
ATOM   6801  C  C     . GLY C  2  414  ? 59.638  -16.356 66.043  1.00 81.08  ? 414  GLY C C     1 
ATOM   6802  O  O     . GLY C  2  414  ? 58.597  -16.731 65.491  1.00 83.77  ? 414  GLY C O     1 
ATOM   6803  N  N     . PRO C  2  415  ? 60.810  -16.344 65.407  1.00 81.56  ? 415  PRO C N     1 
ATOM   6804  C  CA    . PRO C  2  415  ? 60.907  -16.838 64.027  1.00 80.06  ? 415  PRO C CA    1 
ATOM   6805  C  C     . PRO C  2  415  ? 60.596  -18.325 63.960  1.00 73.29  ? 415  PRO C C     1 
ATOM   6806  O  O     . PRO C  2  415  ? 60.990  -19.100 64.834  1.00 76.70  ? 415  PRO C O     1 
ATOM   6807  C  CB    . PRO C  2  415  ? 62.362  -16.544 63.641  1.00 81.52  ? 415  PRO C CB    1 
ATOM   6808  C  CG    . PRO C  2  415  ? 62.812  -15.486 64.605  1.00 84.09  ? 415  PRO C CG    1 
ATOM   6809  C  CD    . PRO C  2  415  ? 62.077  -15.762 65.880  1.00 79.81  ? 415  PRO C CD    1 
ATOM   6810  N  N     . GLY C  2  416  ? 59.873  -18.717 62.913  1.00 71.01  ? 416  GLY C N     1 
ATOM   6811  C  CA    . GLY C  2  416  ? 59.397  -20.082 62.819  1.00 77.21  ? 416  GLY C CA    1 
ATOM   6812  C  C     . GLY C  2  416  ? 58.276  -20.408 63.776  1.00 85.54  ? 416  GLY C C     1 
ATOM   6813  O  O     . GLY C  2  416  ? 58.069  -21.579 64.106  1.00 80.38  ? 416  GLY C O     1 
ATOM   6814  N  N     . GLY C  2  417  ? 57.548  -19.398 64.239  1.00 84.01  ? 417  GLY C N     1 
ATOM   6815  C  CA    . GLY C  2  417  ? 56.468  -19.601 65.177  1.00 74.28  ? 417  GLY C CA    1 
ATOM   6816  C  C     . GLY C  2  417  ? 55.350  -18.605 64.967  1.00 84.11  ? 417  GLY C C     1 
ATOM   6817  O  O     . GLY C  2  417  ? 55.309  -17.915 63.944  1.00 95.45  ? 417  GLY C O     1 
ATOM   6818  N  N     . LEU C  2  418  ? 54.447  -18.512 65.937  1.00 82.95  ? 418  LEU C N     1 
ATOM   6819  C  CA    . LEU C  2  418  ? 53.253  -17.695 65.783  1.00 85.28  ? 418  LEU C CA    1 
ATOM   6820  C  C     . LEU C  2  418  ? 53.572  -16.204 65.822  1.00 92.31  ? 418  LEU C C     1 
ATOM   6821  O  O     . LEU C  2  418  ? 54.502  -15.755 66.498  1.00 90.18  ? 418  LEU C O     1 
ATOM   6822  C  CB    . LEU C  2  418  ? 52.240  -18.018 66.884  1.00 82.45  ? 418  LEU C CB    1 
ATOM   6823  C  CG    . LEU C  2  418  ? 51.262  -19.175 66.667  1.00 80.78  ? 418  LEU C CG    1 
ATOM   6824  C  CD1   . LEU C  2  418  ? 51.317  -19.649 65.228  1.00 87.57  ? 418  LEU C CD1   1 
ATOM   6825  C  CD2   . LEU C  2  418  ? 51.517  -20.321 67.639  1.00 68.15  ? 418  LEU C CD2   1 
ATOM   6826  N  N     . THR C  2  419  ? 52.787  -15.438 65.070  1.00 96.30  ? 419  THR C N     1 
ATOM   6827  C  CA    . THR C  2  419  ? 52.623  -14.016 65.316  1.00 98.05  ? 419  THR C CA    1 
ATOM   6828  C  C     . THR C  2  419  ? 51.432  -13.828 66.255  1.00 100.51 ? 419  THR C C     1 
ATOM   6829  O  O     . THR C  2  419  ? 50.727  -14.782 66.592  1.00 98.27  ? 419  THR C O     1 
ATOM   6830  C  CB    . THR C  2  419  ? 52.426  -13.255 64.004  1.00 100.38 ? 419  THR C CB    1 
ATOM   6831  O  OG1   . THR C  2  419  ? 53.104  -13.944 62.946  1.00 95.34  ? 419  THR C OG1   1 
ATOM   6832  C  CG2   . THR C  2  419  ? 52.997  -11.846 64.114  1.00 100.73 ? 419  THR C CG2   1 
ATOM   6833  N  N     . ARG C  2  420  ? 51.205  -12.588 66.690  1.00 96.87  ? 420  ARG C N     1 
ATOM   6834  C  CA    . ARG C  2  420  ? 50.156  -12.373 67.682  1.00 93.29  ? 420  ARG C CA    1 
ATOM   6835  C  C     . ARG C  2  420  ? 48.764  -12.518 67.078  1.00 99.68  ? 420  ARG C C     1 
ATOM   6836  O  O     . ARG C  2  420  ? 47.840  -12.976 67.761  1.00 93.91  ? 420  ARG C O     1 
ATOM   6837  C  CB    . ARG C  2  420  ? 50.318  -11.007 68.344  1.00 95.67  ? 420  ARG C CB    1 
ATOM   6838  C  CG    . ARG C  2  420  ? 49.517  -10.875 69.628  1.00 91.80  ? 420  ARG C CG    1 
ATOM   6839  C  CD    . ARG C  2  420  ? 50.130  -9.864  70.576  1.00 85.07  ? 420  ARG C CD    1 
ATOM   6840  N  NE    . ARG C  2  420  ? 51.485  -10.232 70.980  1.00 77.36  ? 420  ARG C NE    1 
ATOM   6841  C  CZ    . ARG C  2  420  ? 52.587  -9.652  70.514  1.00 89.69  ? 420  ARG C CZ    1 
ATOM   6842  N  NH1   . ARG C  2  420  ? 52.498  -8.671  69.625  1.00 97.90  ? 420  ARG C NH1   1 
ATOM   6843  N  NH2   . ARG C  2  420  ? 53.779  -10.049 70.940  1.00 84.22  ? 420  ARG C NH2   1 
ATOM   6844  N  N     . GLU C  2  421  ? 48.590  -12.152 65.806  1.00 103.99 ? 421  GLU C N     1 
ATOM   6845  C  CA    . GLU C  2  421  ? 47.299  -12.333 65.155  1.00 105.74 ? 421  GLU C CA    1 
ATOM   6846  C  C     . GLU C  2  421  ? 47.034  -13.783 64.768  1.00 105.27 ? 421  GLU C C     1 
ATOM   6847  O  O     . GLU C  2  421  ? 45.868  -14.178 64.662  1.00 106.88 ? 421  GLU C O     1 
ATOM   6848  C  CB    . GLU C  2  421  ? 47.197  -11.443 63.911  1.00 105.63 ? 421  GLU C CB    1 
ATOM   6849  C  CG    . GLU C  2  421  ? 48.129  -11.833 62.769  1.00 102.60 ? 421  GLU C CG    1 
ATOM   6850  C  CD    . GLU C  2  421  ? 49.479  -11.145 62.849  1.00 109.06 ? 421  GLU C CD    1 
ATOM   6851  O  OE1   . GLU C  2  421  ? 50.146  -11.018 61.799  1.00 100.47 ? 421  GLU C OE1   1 
ATOM   6852  O  OE2   . GLU C  2  421  ? 49.870  -10.722 63.958  1.00 113.05 ? 421  GLU C OE2   1 
ATOM   6853  N  N     . ARG C  2  422  ? 48.084  -14.583 64.562  1.00 103.30 ? 422  ARG C N     1 
ATOM   6854  C  CA    . ARG C  2  422  ? 47.922  -15.982 64.183  1.00 101.88 ? 422  ARG C CA    1 
ATOM   6855  C  C     . ARG C  2  422  ? 47.466  -16.865 65.340  1.00 104.77 ? 422  ARG C C     1 
ATOM   6856  O  O     . ARG C  2  422  ? 47.043  -18.001 65.097  1.00 106.25 ? 422  ARG C O     1 
ATOM   6857  C  CB    . ARG C  2  422  ? 49.238  -16.524 63.609  1.00 103.78 ? 422  ARG C CB    1 
ATOM   6858  C  CG    . ARG C  2  422  ? 49.592  -16.003 62.214  1.00 110.34 ? 422  ARG C CG    1 
ATOM   6859  C  CD    . ARG C  2  422  ? 51.053  -16.274 61.850  1.00 108.27 ? 422  ARG C CD    1 
ATOM   6860  N  NE    . ARG C  2  422  ? 51.418  -17.685 61.969  1.00 116.02 ? 422  ARG C NE    1 
ATOM   6861  C  CZ    . ARG C  2  422  ? 51.439  -18.545 60.955  1.00 122.10 ? 422  ARG C CZ    1 
ATOM   6862  N  NH1   . ARG C  2  422  ? 51.787  -19.810 61.161  1.00 114.40 ? 422  ARG C NH1   1 
ATOM   6863  N  NH2   . ARG C  2  422  ? 51.114  -18.142 59.734  1.00 124.93 ? 422  ARG C NH2   1 
ATOM   6864  N  N     . ALA C  2  423  ? 47.530  -16.379 66.578  1.00 101.93 ? 423  ALA C N     1 
ATOM   6865  C  CA    . ALA C  2  423  ? 47.214  -17.178 67.755  1.00 88.12  ? 423  ALA C CA    1 
ATOM   6866  C  C     . ALA C  2  423  ? 45.772  -16.925 68.177  1.00 92.18  ? 423  ALA C C     1 
ATOM   6867  O  O     . ALA C  2  423  ? 45.402  -15.789 68.494  1.00 92.85  ? 423  ALA C O     1 
ATOM   6868  C  CB    . ALA C  2  423  ? 48.168  -16.858 68.904  1.00 75.30  ? 423  ALA C CB    1 
ATOM   6869  N  N     . GLY C  2  424  ? 44.969  -17.980 68.184  1.00 90.86  ? 424  GLY C N     1 
ATOM   6870  C  CA    . GLY C  2  424  ? 43.591  -17.932 68.621  1.00 89.51  ? 424  GLY C CA    1 
ATOM   6871  C  C     . GLY C  2  424  ? 43.428  -18.389 70.054  1.00 84.80  ? 424  GLY C C     1 
ATOM   6872  O  O     . GLY C  2  424  ? 44.312  -18.196 70.898  1.00 75.33  ? 424  GLY C O     1 
ATOM   6873  N  N     . PHE C  2  425  ? 42.278  -19.003 70.338  1.00 90.73  ? 425  PHE C N     1 
ATOM   6874  C  CA    . PHE C  2  425  ? 42.033  -19.552 71.667  1.00 84.86  ? 425  PHE C CA    1 
ATOM   6875  C  C     . PHE C  2  425  ? 42.711  -20.902 71.865  1.00 79.55  ? 425  PHE C C     1 
ATOM   6876  O  O     . PHE C  2  425  ? 43.090  -21.239 72.993  1.00 79.33  ? 425  PHE C O     1 
ATOM   6877  C  CB    . PHE C  2  425  ? 40.530  -19.692 71.917  1.00 88.52  ? 425  PHE C CB    1 
ATOM   6878  C  CG    . PHE C  2  425  ? 39.852  -18.407 72.299  1.00 92.92  ? 425  PHE C CG    1 
ATOM   6879  C  CD1   . PHE C  2  425  ? 39.490  -17.483 71.332  1.00 92.86  ? 425  PHE C CD1   1 
ATOM   6880  C  CD2   . PHE C  2  425  ? 39.568  -18.127 73.628  1.00 87.57  ? 425  PHE C CD2   1 
ATOM   6881  C  CE1   . PHE C  2  425  ? 38.862  -16.300 71.683  1.00 92.58  ? 425  PHE C CE1   1 
ATOM   6882  C  CE2   . PHE C  2  425  ? 38.941  -16.945 73.986  1.00 81.88  ? 425  PHE C CE2   1 
ATOM   6883  C  CZ    . PHE C  2  425  ? 38.588  -16.031 73.013  1.00 83.79  ? 425  PHE C CZ    1 
ATOM   6884  N  N     . ASP C  2  426  ? 42.869  -21.681 70.792  1.00 78.07  ? 426  ASP C N     1 
ATOM   6885  C  CA    . ASP C  2  426  ? 43.373  -23.044 70.931  1.00 72.90  ? 426  ASP C CA    1 
ATOM   6886  C  C     . ASP C  2  426  ? 44.806  -23.059 71.451  1.00 64.69  ? 426  ASP C C     1 
ATOM   6887  O  O     . ASP C  2  426  ? 45.174  -23.923 72.256  1.00 58.42  ? 426  ASP C O     1 
ATOM   6888  C  CB    . ASP C  2  426  ? 43.276  -23.772 69.590  1.00 82.72  ? 426  ASP C CB    1 
ATOM   6889  C  CG    . ASP C  2  426  ? 41.846  -23.850 69.069  1.00 91.32  ? 426  ASP C CG    1 
ATOM   6890  O  OD1   . ASP C  2  426  ? 40.918  -24.008 69.891  1.00 88.09  ? 426  ASP C OD1   1 
ATOM   6891  O  OD2   . ASP C  2  426  ? 41.650  -23.750 67.837  1.00 95.11  ? 426  ASP C OD2   1 
ATOM   6892  N  N     . VAL C  2  427  ? 45.623  -22.107 71.011  1.00 63.51  ? 427  VAL C N     1 
ATOM   6893  C  CA    . VAL C  2  427  ? 47.022  -22.076 71.420  1.00 59.45  ? 427  VAL C CA    1 
ATOM   6894  C  C     . VAL C  2  427  ? 47.156  -21.573 72.850  1.00 61.14  ? 427  VAL C C     1 
ATOM   6895  O  O     . VAL C  2  427  ? 47.895  -22.145 73.659  1.00 61.47  ? 427  VAL C O     1 
ATOM   6896  C  CB    . VAL C  2  427  ? 47.838  -21.214 70.444  1.00 59.02  ? 427  VAL C CB    1 
ATOM   6897  C  CG1   . VAL C  2  427  ? 49.041  -21.986 69.950  1.00 69.16  ? 427  VAL C CG1   1 
ATOM   6898  C  CG2   . VAL C  2  427  ? 46.964  -20.769 69.284  1.00 70.20  ? 427  VAL C CG2   1 
ATOM   6899  N  N     . ARG C  2  428  ? 46.444  -20.492 73.179  1.00 61.14  ? 428  ARG C N     1 
ATOM   6900  C  CA    . ARG C  2  428  ? 46.542  -19.873 74.494  1.00 49.33  ? 428  ARG C CA    1 
ATOM   6901  C  C     . ARG C  2  428  ? 45.904  -20.709 75.592  1.00 49.54  ? 428  ARG C C     1 
ATOM   6902  O  O     . ARG C  2  428  ? 46.157  -20.441 76.770  1.00 49.19  ? 428  ARG C O     1 
ATOM   6903  C  CB    . ARG C  2  428  ? 45.896  -18.489 74.467  1.00 43.17  ? 428  ARG C CB    1 
ATOM   6904  C  CG    . ARG C  2  428  ? 46.467  -17.552 73.415  1.00 49.33  ? 428  ARG C CG    1 
ATOM   6905  C  CD    . ARG C  2  428  ? 45.738  -16.221 73.432  1.00 45.11  ? 428  ARG C CD    1 
ATOM   6906  N  NE    . ARG C  2  428  ? 46.641  -15.086 73.265  1.00 39.73  ? 428  ARG C NE    1 
ATOM   6907  C  CZ    . ARG C  2  428  ? 46.705  -14.336 72.172  1.00 45.71  ? 428  ARG C CZ    1 
ATOM   6908  N  NH1   . ARG C  2  428  ? 45.914  -14.596 71.139  1.00 53.73  ? 428  ARG C NH1   1 
ATOM   6909  N  NH2   . ARG C  2  428  ? 47.555  -13.322 72.113  1.00 48.73  ? 428  ARG C NH2   1 
ATOM   6910  N  N     . ASP C  2  429  ? 45.096  -21.704 75.239  1.00 52.24  ? 429  ASP C N     1 
ATOM   6911  C  CA    . ASP C  2  429  ? 44.384  -22.503 76.225  1.00 51.29  ? 429  ASP C CA    1 
ATOM   6912  C  C     . ASP C  2  429  ? 45.351  -23.298 77.099  1.00 49.95  ? 429  ASP C C     1 
ATOM   6913  O  O     . ASP C  2  429  ? 46.501  -23.559 76.736  1.00 52.82  ? 429  ASP C O     1 
ATOM   6914  C  CB    . ASP C  2  429  ? 43.417  -23.463 75.532  1.00 60.16  ? 429  ASP C CB    1 
ATOM   6915  C  CG    . ASP C  2  429  ? 41.962  -23.159 75.844  1.00 79.52  ? 429  ASP C CG    1 
ATOM   6916  O  OD1   . ASP C  2  429  ? 41.647  -22.858 77.017  1.00 79.49  ? 429  ASP C OD1   1 
ATOM   6917  O  OD2   . ASP C  2  429  ? 41.130  -23.225 74.911  1.00 83.01  ? 429  ASP C OD2   1 
ATOM   6918  N  N     . VAL C  2  430  ? 44.861  -23.685 78.271  1.00 52.45  ? 430  VAL C N     1 
ATOM   6919  C  CA    . VAL C  2  430  ? 45.558  -24.624 79.142  1.00 52.37  ? 430  VAL C CA    1 
ATOM   6920  C  C     . VAL C  2  430  ? 45.100  -26.022 78.750  1.00 56.03  ? 430  VAL C C     1 
ATOM   6921  O  O     . VAL C  2  430  ? 43.947  -26.390 78.982  1.00 62.13  ? 430  VAL C O     1 
ATOM   6922  C  CB    . VAL C  2  430  ? 45.272  -24.342 80.621  1.00 46.96  ? 430  VAL C CB    1 
ATOM   6923  C  CG1   . VAL C  2  430  ? 45.703  -25.518 81.477  1.00 42.57  ? 430  VAL C CG1   1 
ATOM   6924  C  CG2   . VAL C  2  430  ? 45.982  -23.079 81.062  1.00 51.98  ? 430  VAL C CG2   1 
ATOM   6925  N  N     . HIS C  2  431  ? 45.992  -26.796 78.140  1.00 53.18  ? 431  HIS C N     1 
ATOM   6926  C  CA    . HIS C  2  431  ? 45.644  -28.150 77.740  1.00 51.54  ? 431  HIS C CA    1 
ATOM   6927  C  C     . HIS C  2  431  ? 45.685  -29.075 78.948  1.00 53.23  ? 431  HIS C C     1 
ATOM   6928  O  O     . HIS C  2  431  ? 46.427  -28.844 79.906  1.00 56.04  ? 431  HIS C O     1 
ATOM   6929  C  CB    . HIS C  2  431  ? 46.597  -28.661 76.659  1.00 54.45  ? 431  HIS C CB    1 
ATOM   6930  C  CG    . HIS C  2  431  ? 46.051  -29.806 75.862  1.00 56.21  ? 431  HIS C CG    1 
ATOM   6931  N  ND1   . HIS C  2  431  ? 46.125  -31.114 76.289  1.00 52.79  ? 431  HIS C ND1   1 
ATOM   6932  C  CD2   . HIS C  2  431  ? 45.427  -29.837 74.661  1.00 57.82  ? 431  HIS C CD2   1 
ATOM   6933  C  CE1   . HIS C  2  431  ? 45.567  -31.902 75.387  1.00 52.51  ? 431  HIS C CE1   1 
ATOM   6934  N  NE2   . HIS C  2  431  ? 45.135  -31.152 74.389  1.00 54.97  ? 431  HIS C NE2   1 
ATOM   6935  N  N     . ARG C  2  432  ? 44.865  -30.129 78.900  1.00 52.49  ? 432  ARG C N     1 
ATOM   6936  C  CA    . ARG C  2  432  ? 44.858  -31.101 79.987  1.00 49.59  ? 432  ARG C CA    1 
ATOM   6937  C  C     . ARG C  2  432  ? 46.221  -31.746 80.182  1.00 51.61  ? 432  ARG C C     1 
ATOM   6938  O  O     . ARG C  2  432  ? 46.508  -32.246 81.274  1.00 55.79  ? 432  ARG C O     1 
ATOM   6939  C  CB    . ARG C  2  432  ? 43.807  -32.179 79.728  1.00 51.40  ? 432  ARG C CB    1 
ATOM   6940  C  CG    . ARG C  2  432  ? 44.100  -33.052 78.525  1.00 49.72  ? 432  ARG C CG    1 
ATOM   6941  C  CD    . ARG C  2  432  ? 43.157  -34.235 78.473  1.00 51.48  ? 432  ARG C CD    1 
ATOM   6942  N  NE    . ARG C  2  432  ? 43.422  -35.103 77.331  1.00 51.36  ? 432  ARG C NE    1 
ATOM   6943  C  CZ    . ARG C  2  432  ? 44.346  -36.058 77.320  1.00 53.28  ? 432  ARG C CZ    1 
ATOM   6944  N  NH1   . ARG C  2  432  ? 45.104  -36.267 78.390  1.00 52.38  ? 432  ARG C NH1   1 
ATOM   6945  N  NH2   . ARG C  2  432  ? 44.513  -36.803 76.237  1.00 53.05  ? 432  ARG C NH2   1 
ATOM   6946  N  N     . THR C  2  433  ? 47.067  -31.732 79.154  1.00 53.88  ? 433  THR C N     1 
ATOM   6947  C  CA    . THR C  2  433  ? 48.404  -32.303 79.214  1.00 46.02  ? 433  THR C CA    1 
ATOM   6948  C  C     . THR C  2  433  ? 49.444  -31.325 79.748  1.00 45.33  ? 433  THR C C     1 
ATOM   6949  O  O     . THR C  2  433  ? 50.609  -31.705 79.891  1.00 49.08  ? 433  THR C O     1 
ATOM   6950  C  CB    . THR C  2  433  ? 48.821  -32.802 77.826  1.00 47.27  ? 433  THR C CB    1 
ATOM   6951  O  OG1   . THR C  2  433  ? 48.817  -31.709 76.900  1.00 53.06  ? 433  THR C OG1   1 
ATOM   6952  C  CG2   . THR C  2  433  ? 47.856  -33.869 77.332  1.00 44.27  ? 433  THR C CG2   1 
ATOM   6953  N  N     . HIS C  2  434  ? 49.062  -30.079 80.042  1.00 44.90  ? 434  HIS C N     1 
ATOM   6954  C  CA    . HIS C  2  434  ? 49.963  -29.184 80.760  1.00 46.05  ? 434  HIS C CA    1 
ATOM   6955  C  C     . HIS C  2  434  ? 50.179  -29.625 82.201  1.00 51.06  ? 434  HIS C C     1 
ATOM   6956  O  O     . HIS C  2  434  ? 51.066  -29.083 82.870  1.00 54.25  ? 434  HIS C O     1 
ATOM   6957  C  CB    . HIS C  2  434  ? 49.430  -27.747 80.757  1.00 48.77  ? 434  HIS C CB    1 
ATOM   6958  C  CG    . HIS C  2  434  ? 49.379  -27.109 79.405  1.00 43.41  ? 434  HIS C CG    1 
ATOM   6959  N  ND1   . HIS C  2  434  ? 49.630  -27.802 78.241  1.00 46.40  ? 434  HIS C ND1   1 
ATOM   6960  C  CD2   . HIS C  2  434  ? 49.101  -25.838 79.033  1.00 45.36  ? 434  HIS C CD2   1 
ATOM   6961  C  CE1   . HIS C  2  434  ? 49.513  -26.985 77.210  1.00 46.82  ? 434  HIS C CE1   1 
ATOM   6962  N  NE2   . HIS C  2  434  ? 49.191  -25.787 77.663  1.00 49.04  ? 434  HIS C NE2   1 
ATOM   6963  N  N     . TYR C  2  435  ? 49.379  -30.568 82.694  1.00 48.55  ? 435  TYR C N     1 
ATOM   6964  C  CA    . TYR C  2  435  ? 49.531  -31.074 84.051  1.00 45.30  ? 435  TYR C CA    1 
ATOM   6965  C  C     . TYR C  2  435  ? 50.938  -31.614 84.250  1.00 47.54  ? 435  TYR C C     1 
ATOM   6966  O  O     . TYR C  2  435  ? 51.328  -32.598 83.616  1.00 52.90  ? 435  TYR C O     1 
ATOM   6967  C  CB    . TYR C  2  435  ? 48.496  -32.169 84.314  1.00 49.67  ? 435  TYR C CB    1 
ATOM   6968  C  CG    . TYR C  2  435  ? 48.414  -32.630 85.755  1.00 54.86  ? 435  TYR C CG    1 
ATOM   6969  C  CD1   . TYR C  2  435  ? 49.302  -33.576 86.257  1.00 57.68  ? 435  TYR C CD1   1 
ATOM   6970  C  CD2   . TYR C  2  435  ? 47.440  -32.128 86.611  1.00 56.51  ? 435  TYR C CD2   1 
ATOM   6971  C  CE1   . TYR C  2  435  ? 49.231  -33.998 87.570  1.00 55.96  ? 435  TYR C CE1   1 
ATOM   6972  C  CE2   . TYR C  2  435  ? 47.359  -32.547 87.927  1.00 56.11  ? 435  TYR C CE2   1 
ATOM   6973  C  CZ    . TYR C  2  435  ? 48.258  -33.482 88.401  1.00 62.87  ? 435  TYR C CZ    1 
ATOM   6974  O  OH    . TYR C  2  435  ? 48.183  -33.903 89.710  1.00 76.43  ? 435  TYR C OH    1 
ATOM   6975  N  N     . GLY C  2  436  ? 51.701  -30.971 85.129  1.00 49.39  ? 436  GLY C N     1 
ATOM   6976  C  CA    . GLY C  2  436  ? 53.050  -31.409 85.418  1.00 53.27  ? 436  GLY C CA    1 
ATOM   6977  C  C     . GLY C  2  436  ? 54.109  -30.995 84.417  1.00 47.69  ? 436  GLY C C     1 
ATOM   6978  O  O     . GLY C  2  436  ? 55.294  -31.261 84.655  1.00 42.41  ? 436  GLY C O     1 
ATOM   6979  N  N     . ARG C  2  437  ? 53.731  -30.363 83.305  1.00 46.26  ? 437  ARG C N     1 
ATOM   6980  C  CA    . ARG C  2  437  ? 54.693  -29.944 82.291  1.00 44.45  ? 437  ARG C CA    1 
ATOM   6981  C  C     . ARG C  2  437  ? 54.762  -28.430 82.145  1.00 48.61  ? 437  ARG C C     1 
ATOM   6982  O  O     . ARG C  2  437  ? 55.844  -27.853 82.296  1.00 52.60  ? 437  ARG C O     1 
ATOM   6983  C  CB    . ARG C  2  437  ? 54.343  -30.606 80.954  1.00 44.62  ? 437  ARG C CB    1 
ATOM   6984  C  CG    . ARG C  2  437  ? 54.385  -32.115 81.019  1.00 43.40  ? 437  ARG C CG    1 
ATOM   6985  C  CD    . ARG C  2  437  ? 53.722  -32.764 79.825  1.00 41.62  ? 437  ARG C CD    1 
ATOM   6986  N  NE    . ARG C  2  437  ? 53.805  -34.218 79.920  1.00 49.13  ? 437  ARG C NE    1 
ATOM   6987  C  CZ    . ARG C  2  437  ? 52.934  -34.976 80.578  1.00 48.30  ? 437  ARG C CZ    1 
ATOM   6988  N  NH1   . ARG C  2  437  ? 51.904  -34.423 81.197  1.00 54.60  ? 437  ARG C NH1   1 
ATOM   6989  N  NH2   . ARG C  2  437  ? 53.092  -36.290 80.620  1.00 52.27  ? 437  ARG C NH2   1 
ATOM   6990  N  N     . ILE C  2  438  ? 53.645  -27.762 81.862  1.00 46.93  ? 438  ILE C N     1 
ATOM   6991  C  CA    . ILE C  2  438  ? 53.610  -26.318 81.661  1.00 44.31  ? 438  ILE C CA    1 
ATOM   6992  C  C     . ILE C  2  438  ? 52.707  -25.714 82.726  1.00 47.60  ? 438  ILE C C     1 
ATOM   6993  O  O     . ILE C  2  438  ? 51.598  -26.207 82.955  1.00 52.28  ? 438  ILE C O     1 
ATOM   6994  C  CB    . ILE C  2  438  ? 53.116  -25.956 80.250  1.00 41.98  ? 438  ILE C CB    1 
ATOM   6995  C  CG1   . ILE C  2  438  ? 53.958  -26.665 79.196  1.00 47.13  ? 438  ILE C CG1   1 
ATOM   6996  C  CG2   . ILE C  2  438  ? 53.193  -24.466 80.029  1.00 46.06  ? 438  ILE C CG2   1 
ATOM   6997  C  CD1   . ILE C  2  438  ? 53.571  -26.301 77.783  1.00 52.49  ? 438  ILE C CD1   1 
ATOM   6998  N  N     . CYS C  2  439  ? 53.175  -24.651 83.368  1.00 45.55  ? 439  CYS C N     1 
ATOM   6999  C  CA    . CYS C  2  439  ? 52.448  -24.104 84.508  1.00 45.38  ? 439  CYS C CA    1 
ATOM   7000  C  C     . CYS C  2  439  ? 51.141  -23.466 84.051  1.00 48.46  ? 439  CYS C C     1 
ATOM   7001  O  O     . CYS C  2  439  ? 51.150  -22.632 83.138  1.00 52.08  ? 439  CYS C O     1 
ATOM   7002  C  CB    . CYS C  2  439  ? 53.289  -23.077 85.251  1.00 47.09  ? 439  CYS C CB    1 
ATOM   7003  S  SG    . CYS C  2  439  ? 52.490  -22.484 86.765  1.00 46.23  ? 439  CYS C SG    1 
ATOM   7004  N  N     . PRO C  2  440  ? 50.004  -23.824 84.656  1.00 48.19  ? 440  PRO C N     1 
ATOM   7005  C  CA    . PRO C  2  440  ? 48.732  -23.203 84.268  1.00 47.41  ? 440  PRO C CA    1 
ATOM   7006  C  C     . PRO C  2  440  ? 48.521  -21.827 84.868  1.00 46.87  ? 440  PRO C C     1 
ATOM   7007  O  O     . PRO C  2  440  ? 47.522  -21.171 84.541  1.00 52.43  ? 440  PRO C O     1 
ATOM   7008  C  CB    . PRO C  2  440  ? 47.692  -24.196 84.795  1.00 40.08  ? 440  PRO C CB    1 
ATOM   7009  C  CG    . PRO C  2  440  ? 48.329  -24.752 86.017  1.00 44.41  ? 440  PRO C CG    1 
ATOM   7010  C  CD    . PRO C  2  440  ? 49.818  -24.823 85.724  1.00 50.89  ? 440  PRO C CD    1 
ATOM   7011  N  N     . VAL C  2  441  ? 49.419  -21.372 85.736  1.00 45.26  ? 441  VAL C N     1 
ATOM   7012  C  CA    . VAL C  2  441  ? 49.246  -20.099 86.420  1.00 43.84  ? 441  VAL C CA    1 
ATOM   7013  C  C     . VAL C  2  441  ? 50.117  -19.044 85.756  1.00 45.97  ? 441  VAL C C     1 
ATOM   7014  O  O     . VAL C  2  441  ? 49.611  -18.070 85.188  1.00 44.61  ? 441  VAL C O     1 
ATOM   7015  C  CB    . VAL C  2  441  ? 49.587  -20.227 87.917  1.00 38.80  ? 441  VAL C CB    1 
ATOM   7016  C  CG1   . VAL C  2  441  ? 49.635  -18.861 88.574  1.00 37.09  ? 441  VAL C CG1   1 
ATOM   7017  C  CG2   . VAL C  2  441  ? 48.581  -21.118 88.617  1.00 37.54  ? 441  VAL C CG2   1 
ATOM   7018  N  N     . GLU C  2  442  ? 51.430  -19.250 85.799  1.00 49.58  ? 442  GLU C N     1 
ATOM   7019  C  CA    . GLU C  2  442  ? 52.382  -18.197 85.472  1.00 43.96  ? 442  GLU C CA    1 
ATOM   7020  C  C     . GLU C  2  442  ? 52.419  -17.975 83.967  1.00 54.11  ? 442  GLU C C     1 
ATOM   7021  O  O     . GLU C  2  442  ? 52.959  -18.795 83.216  1.00 57.77  ? 442  GLU C O     1 
ATOM   7022  C  CB    . GLU C  2  442  ? 53.763  -18.547 86.005  1.00 41.05  ? 442  GLU C CB    1 
ATOM   7023  C  CG    . GLU C  2  442  ? 54.718  -17.384 85.949  1.00 48.76  ? 442  GLU C CG    1 
ATOM   7024  C  CD    . GLU C  2  442  ? 56.159  -17.822 85.886  1.00 53.99  ? 442  GLU C CD    1 
ATOM   7025  O  OE1   . GLU C  2  442  ? 56.577  -18.652 86.723  1.00 51.70  ? 442  GLU C OE1   1 
ATOM   7026  O  OE2   . GLU C  2  442  ? 56.869  -17.343 84.983  1.00 62.85  ? 442  GLU C OE2   1 
ATOM   7027  N  N     . THR C  2  443  ? 51.840  -16.861 83.533  1.00 54.19  ? 443  THR C N     1 
ATOM   7028  C  CA    . THR C  2  443  ? 51.825  -16.417 82.150  1.00 52.49  ? 443  THR C CA    1 
ATOM   7029  C  C     . THR C  2  443  ? 51.676  -14.907 82.191  1.00 50.23  ? 443  THR C C     1 
ATOM   7030  O  O     . THR C  2  443  ? 51.134  -14.375 83.166  1.00 54.28  ? 443  THR C O     1 
ATOM   7031  C  CB    . THR C  2  443  ? 50.677  -17.070 81.355  1.00 47.29  ? 443  THR C CB    1 
ATOM   7032  O  OG1   . THR C  2  443  ? 50.636  -16.546 80.023  1.00 54.74  ? 443  THR C OG1   1 
ATOM   7033  C  CG2   . THR C  2  443  ? 49.339  -16.829 82.024  1.00 44.97  ? 443  THR C CG2   1 
ATOM   7034  N  N     . PRO C  2  444  ? 52.182  -14.188 81.195  1.00 49.66  ? 444  PRO C N     1 
ATOM   7035  C  CA    . PRO C  2  444  ? 51.987  -12.737 81.183  1.00 51.95  ? 444  PRO C CA    1 
ATOM   7036  C  C     . PRO C  2  444  ? 50.509  -12.392 81.141  1.00 57.76  ? 444  PRO C C     1 
ATOM   7037  O  O     . PRO C  2  444  ? 49.690  -13.125 80.582  1.00 57.18  ? 444  PRO C O     1 
ATOM   7038  C  CB    . PRO C  2  444  ? 52.702  -12.290 79.905  1.00 60.47  ? 444  PRO C CB    1 
ATOM   7039  C  CG    . PRO C  2  444  ? 53.689  -13.358 79.638  1.00 60.23  ? 444  PRO C CG    1 
ATOM   7040  C  CD    . PRO C  2  444  ? 53.054  -14.631 80.096  1.00 51.83  ? 444  PRO C CD    1 
ATOM   7041  N  N     . GLU C  2  445  ? 50.174  -11.267 81.764  1.00 65.86  ? 445  GLU C N     1 
ATOM   7042  C  CA    . GLU C  2  445  ? 48.817  -10.732 81.765  1.00 61.21  ? 445  GLU C CA    1 
ATOM   7043  C  C     . GLU C  2  445  ? 48.744  -9.662  80.682  1.00 68.43  ? 445  GLU C C     1 
ATOM   7044  O  O     . GLU C  2  445  ? 49.413  -8.628  80.778  1.00 75.35  ? 445  GLU C O     1 
ATOM   7045  C  CB    . GLU C  2  445  ? 48.467  -10.169 83.140  1.00 61.56  ? 445  GLU C CB    1 
ATOM   7046  C  CG    . GLU C  2  445  ? 47.140  -9.436  83.211  1.00 79.01  ? 445  GLU C CG    1 
ATOM   7047  C  CD    . GLU C  2  445  ? 46.918  -8.769  84.559  1.00 83.49  ? 445  GLU C CD    1 
ATOM   7048  O  OE1   . GLU C  2  445  ? 45.763  -8.387  84.854  1.00 88.06  ? 445  GLU C OE1   1 
ATOM   7049  O  OE2   . GLU C  2  445  ? 47.900  -8.629  85.323  1.00 73.24  ? 445  GLU C OE2   1 
ATOM   7050  N  N     . GLY C  2  446  ? 47.955  -9.915  79.655  1.00 58.80  ? 446  GLY C N     1 
ATOM   7051  C  CA    . GLY C  2  446  ? 47.866  -9.006  78.530  1.00 55.27  ? 446  GLY C CA    1 
ATOM   7052  C  C     . GLY C  2  446  ? 47.678  -9.782  77.237  1.00 55.13  ? 446  GLY C C     1 
ATOM   7053  O  O     . GLY C  2  446  ? 47.119  -10.877 77.237  1.00 57.49  ? 446  GLY C O     1 
ATOM   7054  N  N     . ALA C  2  447  ? 48.157  -9.187  76.141  1.00 51.95  ? 447  ALA C N     1 
ATOM   7055  C  CA    . ALA C  2  447  ? 47.986  -9.797  74.827  1.00 48.75  ? 447  ALA C CA    1 
ATOM   7056  C  C     . ALA C  2  447  ? 48.835  -11.049 74.648  1.00 51.06  ? 447  ALA C C     1 
ATOM   7057  O  O     . ALA C  2  447  ? 48.531  -11.870 73.776  1.00 51.16  ? 447  ALA C O     1 
ATOM   7058  C  CB    . ALA C  2  447  ? 48.312  -8.786  73.730  1.00 47.37  ? 447  ALA C CB    1 
ATOM   7059  N  N     . ASN C  2  448  ? 49.884  -11.212 75.446  1.00 50.24  ? 448  ASN C N     1 
ATOM   7060  C  CA    . ASN C  2  448  ? 50.751  -12.378 75.375  1.00 53.28  ? 448  ASN C CA    1 
ATOM   7061  C  C     . ASN C  2  448  ? 50.269  -13.535 76.241  1.00 53.39  ? 448  ASN C C     1 
ATOM   7062  O  O     . ASN C  2  448  ? 51.013  -14.505 76.417  1.00 53.14  ? 448  ASN C O     1 
ATOM   7063  C  CB    . ASN C  2  448  ? 52.176  -12.002 75.784  1.00 56.59  ? 448  ASN C CB    1 
ATOM   7064  C  CG    . ASN C  2  448  ? 52.900  -11.215 74.718  1.00 63.51  ? 448  ASN C CG    1 
ATOM   7065  O  OD1   . ASN C  2  448  ? 52.751  -11.479 73.523  1.00 61.96  ? 448  ASN C OD1   1 
ATOM   7066  N  ND2   . ASN C  2  448  ? 53.692  -10.237 75.143  1.00 75.15  ? 448  ASN C ND2   1 
ATOM   7067  N  N     . ILE C  2  449  ? 49.057  -13.459 76.796  1.00 49.96  ? 449  ILE C N     1 
ATOM   7068  C  CA    . ILE C  2  449  ? 48.599  -14.524 77.676  1.00 48.71  ? 449  ILE C CA    1 
ATOM   7069  C  C     . ILE C  2  449  ? 48.444  -15.808 76.875  1.00 47.07  ? 449  ILE C C     1 
ATOM   7070  O  O     . ILE C  2  449  ? 47.957  -15.803 75.737  1.00 52.68  ? 449  ILE C O     1 
ATOM   7071  C  CB    . ILE C  2  449  ? 47.291  -14.131 78.384  1.00 47.30  ? 449  ILE C CB    1 
ATOM   7072  C  CG1   . ILE C  2  449  ? 46.917  -15.191 79.423  1.00 46.68  ? 449  ILE C CG1   1 
ATOM   7073  C  CG2   . ILE C  2  449  ? 46.163  -13.938 77.382  1.00 42.60  ? 449  ILE C CG2   1 
ATOM   7074  C  CD1   . ILE C  2  449  ? 45.780  -14.797 80.316  1.00 39.43  ? 449  ILE C CD1   1 
ATOM   7075  N  N     . GLY C  2  450  ? 48.897  -16.918 77.456  1.00 43.50  ? 450  GLY C N     1 
ATOM   7076  C  CA    . GLY C  2  450  ? 48.839  -18.202 76.794  1.00 48.96  ? 450  GLY C CA    1 
ATOM   7077  C  C     . GLY C  2  450  ? 49.934  -18.463 75.782  1.00 53.43  ? 450  GLY C C     1 
ATOM   7078  O  O     . GLY C  2  450  ? 50.079  -19.610 75.338  1.00 57.24  ? 450  GLY C O     1 
ATOM   7079  N  N     . LEU C  2  451  ? 50.703  -17.446 75.390  1.00 49.18  ? 451  LEU C N     1 
ATOM   7080  C  CA    . LEU C  2  451  ? 51.811  -17.631 74.458  1.00 48.36  ? 451  LEU C CA    1 
ATOM   7081  C  C     . LEU C  2  451  ? 53.121  -17.860 75.207  1.00 50.93  ? 451  LEU C C     1 
ATOM   7082  O  O     . LEU C  2  451  ? 53.773  -18.896 75.034  1.00 51.97  ? 451  LEU C O     1 
ATOM   7083  C  CB    . LEU C  2  451  ? 51.925  -16.421 73.525  1.00 48.38  ? 451  LEU C CB    1 
ATOM   7084  C  CG    . LEU C  2  451  ? 50.651  -16.013 72.783  1.00 46.30  ? 451  LEU C CG    1 
ATOM   7085  C  CD1   . LEU C  2  451  ? 50.936  -14.889 71.798  1.00 47.65  ? 451  LEU C CD1   1 
ATOM   7086  C  CD2   . LEU C  2  451  ? 50.023  -17.207 72.082  1.00 43.19  ? 451  LEU C CD2   1 
ATOM   7087  N  N     . ILE C  2  452  ? 53.514  -16.901 76.040  1.00 51.58  ? 452  ILE C N     1 
ATOM   7088  C  CA    . ILE C  2  452  ? 54.651  -17.078 76.934  1.00 44.64  ? 452  ILE C CA    1 
ATOM   7089  C  C     . ILE C  2  452  ? 54.179  -17.856 78.152  1.00 43.82  ? 452  ILE C C     1 
ATOM   7090  O  O     . ILE C  2  452  ? 53.193  -17.481 78.796  1.00 47.87  ? 452  ILE C O     1 
ATOM   7091  C  CB    . ILE C  2  452  ? 55.242  -15.720 77.345  1.00 40.38  ? 452  ILE C CB    1 
ATOM   7092  C  CG1   . ILE C  2  452  ? 55.323  -14.771 76.142  1.00 35.08  ? 452  ILE C CG1   1 
ATOM   7093  C  CG2   . ILE C  2  452  ? 56.585  -15.908 78.035  1.00 36.96  ? 452  ILE C CG2   1 
ATOM   7094  C  CD1   . ILE C  2  452  ? 56.092  -15.309 74.963  1.00 43.47  ? 452  ILE C CD1   1 
ATOM   7095  N  N     . THR C  2  453  ? 54.861  -18.955 78.456  1.00 41.74  ? 453  THR C N     1 
ATOM   7096  C  CA    . THR C  2  453  ? 54.534  -19.769 79.618  1.00 49.73  ? 453  THR C CA    1 
ATOM   7097  C  C     . THR C  2  453  ? 55.833  -20.162 80.303  1.00 48.18  ? 453  THR C C     1 
ATOM   7098  O  O     . THR C  2  453  ? 56.924  -19.759 79.889  1.00 50.72  ? 453  THR C O     1 
ATOM   7099  C  CB    . THR C  2  453  ? 53.708  -21.003 79.232  1.00 50.31  ? 453  THR C CB    1 
ATOM   7100  O  OG1   . THR C  2  453  ? 54.222  -21.567 78.019  1.00 50.44  ? 453  THR C OG1   1 
ATOM   7101  C  CG2   . THR C  2  453  ? 52.236  -20.636 79.050  1.00 46.61  ? 453  THR C CG2   1 
ATOM   7102  N  N     . SER C  2  454  ? 55.718  -20.956 81.363  1.00 46.61  ? 454  SER C N     1 
ATOM   7103  C  CA    . SER C  2  454  ? 56.877  -21.346 82.147  1.00 44.07  ? 454  SER C CA    1 
ATOM   7104  C  C     . SER C  2  454  ? 56.851  -22.843 82.418  1.00 45.58  ? 454  SER C C     1 
ATOM   7105  O  O     . SER C  2  454  ? 55.789  -23.470 82.469  1.00 47.49  ? 454  SER C O     1 
ATOM   7106  C  CB    . SER C  2  454  ? 56.947  -20.575 83.467  1.00 45.43  ? 454  SER C CB    1 
ATOM   7107  O  OG    . SER C  2  454  ? 58.244  -20.029 83.648  1.00 48.71  ? 454  SER C OG    1 
ATOM   7108  N  N     . LEU C  2  455  ? 58.047  -23.399 82.587  1.00 45.67  ? 455  LEU C N     1 
ATOM   7109  C  CA    . LEU C  2  455  ? 58.219  -24.830 82.778  1.00 38.16  ? 455  LEU C CA    1 
ATOM   7110  C  C     . LEU C  2  455  ? 57.835  -25.235 84.194  1.00 37.63  ? 455  LEU C C     1 
ATOM   7111  O  O     . LEU C  2  455  ? 58.089  -24.504 85.157  1.00 39.54  ? 455  LEU C O     1 
ATOM   7112  C  CB    . LEU C  2  455  ? 59.672  -25.211 82.499  1.00 37.95  ? 455  LEU C CB    1 
ATOM   7113  C  CG    . LEU C  2  455  ? 60.074  -26.682 82.503  1.00 40.55  ? 455  LEU C CG    1 
ATOM   7114  C  CD1   . LEU C  2  455  ? 59.535  -27.396 81.271  1.00 40.65  ? 455  LEU C CD1   1 
ATOM   7115  C  CD2   . LEU C  2  455  ? 61.584  -26.804 82.585  1.00 39.06  ? 455  LEU C CD2   1 
ATOM   7116  N  N     . ALA C  2  456  ? 57.226  -26.410 84.319  1.00 36.61  ? 456  ALA C N     1 
ATOM   7117  C  CA    . ALA C  2  456  ? 56.869  -26.928 85.629  1.00 43.44  ? 456  ALA C CA    1 
ATOM   7118  C  C     . ALA C  2  456  ? 58.129  -27.273 86.421  1.00 47.68  ? 456  ALA C C     1 
ATOM   7119  O  O     . ALA C  2  456  ? 59.241  -27.326 85.888  1.00 56.26  ? 456  ALA C O     1 
ATOM   7120  C  CB    . ALA C  2  456  ? 55.963  -28.150 85.495  1.00 46.00  ? 456  ALA C CB    1 
ATOM   7121  N  N     . ALA C  2  457  ? 57.942  -27.519 87.719  1.00 41.74  ? 457  ALA C N     1 
ATOM   7122  C  CA    . ALA C  2  457  ? 59.081  -27.665 88.620  1.00 48.01  ? 457  ALA C CA    1 
ATOM   7123  C  C     . ALA C  2  457  ? 59.800  -28.993 88.405  1.00 56.36  ? 457  ALA C C     1 
ATOM   7124  O  O     . ALA C  2  457  ? 61.010  -29.027 88.150  1.00 52.52  ? 457  ALA C O     1 
ATOM   7125  C  CB    . ALA C  2  457  ? 58.617  -27.526 90.070  1.00 51.80  ? 457  ALA C CB    1 
ATOM   7126  N  N     . TYR C  2  458  ? 59.071  -30.103 88.516  1.00 57.06  ? 458  TYR C N     1 
ATOM   7127  C  CA    . TYR C  2  458  ? 59.663  -31.420 88.320  1.00 54.45  ? 458  TYR C CA    1 
ATOM   7128  C  C     . TYR C  2  458  ? 59.788  -31.803 86.852  1.00 56.05  ? 458  TYR C C     1 
ATOM   7129  O  O     . TYR C  2  458  ? 60.256  -32.909 86.557  1.00 55.96  ? 458  TYR C O     1 
ATOM   7130  C  CB    . TYR C  2  458  ? 58.842  -32.487 89.048  1.00 55.67  ? 458  TYR C CB    1 
ATOM   7131  C  CG    . TYR C  2  458  ? 59.091  -32.585 90.538  1.00 55.08  ? 458  TYR C CG    1 
ATOM   7132  C  CD1   . TYR C  2  458  ? 60.196  -33.261 91.033  1.00 57.74  ? 458  TYR C CD1   1 
ATOM   7133  C  CD2   . TYR C  2  458  ? 58.207  -32.026 91.449  1.00 56.08  ? 458  TYR C CD2   1 
ATOM   7134  C  CE1   . TYR C  2  458  ? 60.420  -33.364 92.394  1.00 61.48  ? 458  TYR C CE1   1 
ATOM   7135  C  CE2   . TYR C  2  458  ? 58.419  -32.126 92.810  1.00 57.80  ? 458  TYR C CE2   1 
ATOM   7136  C  CZ    . TYR C  2  458  ? 59.527  -32.796 93.279  1.00 61.52  ? 458  TYR C CZ    1 
ATOM   7137  O  OH    . TYR C  2  458  ? 59.744  -32.891 94.635  1.00 64.69  ? 458  TYR C OH    1 
ATOM   7138  N  N     . ALA C  2  459  ? 59.386  -30.928 85.933  1.00 54.38  ? 459  ALA C N     1 
ATOM   7139  C  CA    . ALA C  2  459  ? 59.397  -31.255 84.516  1.00 48.58  ? 459  ALA C CA    1 
ATOM   7140  C  C     . ALA C  2  459  ? 60.787  -31.075 83.924  1.00 51.03  ? 459  ALA C C     1 
ATOM   7141  O  O     . ALA C  2  459  ? 61.572  -30.225 84.358  1.00 48.52  ? 459  ALA C O     1 
ATOM   7142  C  CB    . ALA C  2  459  ? 58.401  -30.386 83.749  1.00 44.61  ? 459  ALA C CB    1 
ATOM   7143  N  N     . ARG C  2  460  ? 61.081  -31.896 82.920  1.00 51.32  ? 460  ARG C N     1 
ATOM   7144  C  CA    . ARG C  2  460  ? 62.317  -31.793 82.164  1.00 52.98  ? 460  ARG C CA    1 
ATOM   7145  C  C     . ARG C  2  460  ? 62.040  -32.210 80.729  1.00 54.41  ? 460  ARG C C     1 
ATOM   7146  O  O     . ARG C  2  460  ? 61.211  -33.088 80.472  1.00 50.54  ? 460  ARG C O     1 
ATOM   7147  C  CB    . ARG C  2  460  ? 63.428  -32.655 82.771  1.00 56.33  ? 460  ARG C CB    1 
ATOM   7148  C  CG    . ARG C  2  460  ? 62.971  -34.032 83.210  1.00 56.02  ? 460  ARG C CG    1 
ATOM   7149  C  CD    . ARG C  2  460  ? 64.098  -35.063 83.128  1.00 71.90  ? 460  ARG C CD    1 
ATOM   7150  N  NE    . ARG C  2  460  ? 65.348  -34.590 83.719  1.00 74.85  ? 460  ARG C NE    1 
ATOM   7151  C  CZ    . ARG C  2  460  ? 65.613  -34.599 85.022  1.00 74.16  ? 460  ARG C CZ    1 
ATOM   7152  N  NH1   . ARG C  2  460  ? 64.710  -35.048 85.884  1.00 68.63  ? 460  ARG C NH1   1 
ATOM   7153  N  NH2   . ARG C  2  460  ? 66.781  -34.151 85.466  1.00 76.28  ? 460  ARG C NH2   1 
ATOM   7154  N  N     . VAL C  2  461  ? 62.730  -31.561 79.796  1.00 49.41  ? 461  VAL C N     1 
ATOM   7155  C  CA    . VAL C  2  461  ? 62.585  -31.854 78.376  1.00 51.60  ? 461  VAL C CA    1 
ATOM   7156  C  C     . VAL C  2  461  ? 63.593  -32.932 78.001  1.00 62.43  ? 461  VAL C C     1 
ATOM   7157  O  O     . VAL C  2  461  ? 64.779  -32.829 78.337  1.00 67.89  ? 461  VAL C O     1 
ATOM   7158  C  CB    . VAL C  2  461  ? 62.787  -30.586 77.531  1.00 52.81  ? 461  VAL C CB    1 
ATOM   7159  C  CG1   . VAL C  2  461  ? 62.410  -30.848 76.080  1.00 53.73  ? 461  VAL C CG1   1 
ATOM   7160  C  CG2   . VAL C  2  461  ? 61.979  -29.437 78.101  1.00 51.39  ? 461  VAL C CG2   1 
ATOM   7161  N  N     . ASP C  2  462  ? 63.124  -33.970 77.310  1.00 57.18  ? 462  ASP C N     1 
ATOM   7162  C  CA    . ASP C  2  462  ? 63.981  -35.090 76.946  1.00 61.43  ? 462  ASP C CA    1 
ATOM   7163  C  C     . ASP C  2  462  ? 64.755  -34.761 75.667  1.00 67.68  ? 462  ASP C C     1 
ATOM   7164  O  O     . ASP C  2  462  ? 64.738  -33.632 75.169  1.00 64.80  ? 462  ASP C O     1 
ATOM   7165  C  CB    . ASP C  2  462  ? 63.155  -36.370 76.821  1.00 58.38  ? 462  ASP C CB    1 
ATOM   7166  C  CG    . ASP C  2  462  ? 62.016  -36.249 75.824  1.00 63.06  ? 462  ASP C CG    1 
ATOM   7167  O  OD1   . ASP C  2  462  ? 62.126  -35.456 74.867  1.00 67.32  ? 462  ASP C OD1   1 
ATOM   7168  O  OD2   . ASP C  2  462  ? 60.998  -36.953 76.000  1.00 69.32  ? 462  ASP C OD2   1 
ATOM   7169  N  N     . GLU C  2  463  ? 65.440  -35.768 75.116  1.00 75.18  ? 463  GLU C N     1 
ATOM   7170  C  CA    . GLU C  2  463  ? 66.294  -35.549 73.952  1.00 82.68  ? 463  GLU C CA    1 
ATOM   7171  C  C     . GLU C  2  463  ? 65.484  -35.283 72.691  1.00 71.09  ? 463  GLU C C     1 
ATOM   7172  O  O     . GLU C  2  463  ? 65.983  -34.638 71.759  1.00 65.54  ? 463  GLU C O     1 
ATOM   7173  C  CB    . GLU C  2  463  ? 67.207  -36.757 73.744  1.00 98.61  ? 463  GLU C CB    1 
ATOM   7174  C  CG    . GLU C  2  463  ? 67.999  -37.157 74.980  1.00 109.91 ? 463  GLU C CG    1 
ATOM   7175  C  CD    . GLU C  2  463  ? 68.767  -38.451 74.786  1.00 127.75 ? 463  GLU C CD    1 
ATOM   7176  O  OE1   . GLU C  2  463  ? 68.842  -39.249 75.746  1.00 125.54 ? 463  GLU C OE1   1 
ATOM   7177  O  OE2   . GLU C  2  463  ? 69.290  -38.672 73.671  1.00 123.97 ? 463  GLU C OE2   1 
ATOM   7178  N  N     . LEU C  2  464  ? 64.246  -35.772 72.637  1.00 68.24  ? 464  LEU C N     1 
ATOM   7179  C  CA    . LEU C  2  464  ? 63.397  -35.582 71.470  1.00 67.82  ? 464  LEU C CA    1 
ATOM   7180  C  C     . LEU C  2  464  ? 62.639  -34.262 71.493  1.00 60.99  ? 464  LEU C C     1 
ATOM   7181  O  O     . LEU C  2  464  ? 62.048  -33.889 70.474  1.00 59.04  ? 464  LEU C O     1 
ATOM   7182  C  CB    . LEU C  2  464  ? 62.409  -36.745 71.349  1.00 66.03  ? 464  LEU C CB    1 
ATOM   7183  C  CG    . LEU C  2  464  ? 62.520  -37.576 70.070  1.00 63.33  ? 464  LEU C CG    1 
ATOM   7184  C  CD1   . LEU C  2  464  ? 63.977  -37.817 69.714  1.00 69.75  ? 464  LEU C CD1   1 
ATOM   7185  C  CD2   . LEU C  2  464  ? 61.775  -38.892 70.222  1.00 66.59  ? 464  LEU C CD2   1 
ATOM   7186  N  N     . GLY C  2  465  ? 62.634  -33.553 72.619  1.00 64.58  ? 465  GLY C N     1 
ATOM   7187  C  CA    . GLY C  2  465  ? 62.024  -32.243 72.700  1.00 61.78  ? 465  GLY C CA    1 
ATOM   7188  C  C     . GLY C  2  465  ? 60.682  -32.188 73.395  1.00 50.54  ? 465  GLY C C     1 
ATOM   7189  O  O     . GLY C  2  465  ? 60.109  -31.099 73.499  1.00 44.05  ? 465  GLY C O     1 
ATOM   7190  N  N     . PHE C  2  466  ? 60.167  -33.319 73.870  1.00 55.48  ? 466  PHE C N     1 
ATOM   7191  C  CA    . PHE C  2  466  ? 58.892  -33.362 74.571  1.00 49.87  ? 466  PHE C CA    1 
ATOM   7192  C  C     . PHE C  2  466  ? 59.118  -33.232 76.071  1.00 53.53  ? 466  PHE C C     1 
ATOM   7193  O  O     . PHE C  2  466  ? 60.094  -33.760 76.613  1.00 55.50  ? 466  PHE C O     1 
ATOM   7194  C  CB    . PHE C  2  466  ? 58.152  -34.663 74.260  1.00 49.45  ? 466  PHE C CB    1 
ATOM   7195  C  CG    . PHE C  2  466  ? 57.966  -34.914 72.792  1.00 54.69  ? 466  PHE C CG    1 
ATOM   7196  C  CD1   . PHE C  2  466  ? 56.951  -34.283 72.091  1.00 51.82  ? 466  PHE C CD1   1 
ATOM   7197  C  CD2   . PHE C  2  466  ? 58.807  -35.778 72.109  1.00 63.89  ? 466  PHE C CD2   1 
ATOM   7198  C  CE1   . PHE C  2  466  ? 56.779  -34.509 70.738  1.00 56.99  ? 466  PHE C CE1   1 
ATOM   7199  C  CE2   . PHE C  2  466  ? 58.639  -36.011 70.755  1.00 61.63  ? 466  PHE C CE2   1 
ATOM   7200  C  CZ    . PHE C  2  466  ? 57.623  -35.377 70.069  1.00 59.60  ? 466  PHE C CZ    1 
ATOM   7201  N  N     . ILE C  2  467  ? 58.216  -32.517 76.739  1.00 53.14  ? 467  ILE C N     1 
ATOM   7202  C  CA    . ILE C  2  467  ? 58.336  -32.301 78.177  1.00 54.10  ? 467  ILE C CA    1 
ATOM   7203  C  C     . ILE C  2  467  ? 57.825  -33.535 78.910  1.00 50.32  ? 467  ILE C C     1 
ATOM   7204  O  O     . ILE C  2  467  ? 56.750  -34.061 78.594  1.00 46.10  ? 467  ILE C O     1 
ATOM   7205  C  CB    . ILE C  2  467  ? 57.573  -31.039 78.609  1.00 52.74  ? 467  ILE C CB    1 
ATOM   7206  C  CG1   . ILE C  2  467  ? 57.963  -29.848 77.735  1.00 44.59  ? 467  ILE C CG1   1 
ATOM   7207  C  CG2   . ILE C  2  467  ? 57.867  -30.716 80.065  1.00 49.65  ? 467  ILE C CG2   1 
ATOM   7208  C  CD1   . ILE C  2  467  ? 57.228  -28.579 78.096  1.00 47.61  ? 467  ILE C CD1   1 
ATOM   7209  N  N     . ARG C  2  468  ? 58.601  -34.004 79.886  1.00 48.37  ? 468  ARG C N     1 
ATOM   7210  C  CA    . ARG C  2  468  ? 58.265  -35.185 80.663  1.00 49.53  ? 468  ARG C CA    1 
ATOM   7211  C  C     . ARG C  2  468  ? 58.047  -34.810 82.120  1.00 50.61  ? 468  ARG C C     1 
ATOM   7212  O  O     . ARG C  2  468  ? 58.652  -33.863 82.635  1.00 49.59  ? 468  ARG C O     1 
ATOM   7213  C  CB    . ARG C  2  468  ? 59.361  -36.248 80.576  1.00 47.84  ? 468  ARG C CB    1 
ATOM   7214  C  CG    . ARG C  2  468  ? 59.691  -36.687 79.171  1.00 54.59  ? 468  ARG C CG    1 
ATOM   7215  C  CD    . ARG C  2  468  ? 60.752  -37.772 79.190  1.00 63.48  ? 468  ARG C CD    1 
ATOM   7216  N  NE    . ARG C  2  468  ? 60.166  -39.106 79.155  1.00 66.96  ? 468  ARG C NE    1 
ATOM   7217  C  CZ    . ARG C  2  468  ? 60.136  -39.877 78.073  1.00 70.81  ? 468  ARG C CZ    1 
ATOM   7218  N  NH1   . ARG C  2  468  ? 60.670  -39.448 76.937  1.00 63.79  ? 468  ARG C NH1   1 
ATOM   7219  N  NH2   . ARG C  2  468  ? 59.575  -41.079 78.129  1.00 80.20  ? 468  ARG C NH2   1 
ATOM   7220  N  N     . THR C  2  469  ? 57.184  -35.571 82.783  1.00 48.22  ? 469  THR C N     1 
ATOM   7221  C  CA    . THR C  2  469  ? 56.918  -35.382 84.198  1.00 48.04  ? 469  THR C CA    1 
ATOM   7222  C  C     . THR C  2  469  ? 57.064  -36.710 84.927  1.00 52.29  ? 469  THR C C     1 
ATOM   7223  O  O     . THR C  2  469  ? 56.775  -37.769 84.358  1.00 55.63  ? 469  THR C O     1 
ATOM   7224  C  CB    . THR C  2  469  ? 55.510  -34.811 84.423  1.00 55.40  ? 469  THR C CB    1 
ATOM   7225  O  OG1   . THR C  2  469  ? 55.209  -34.804 85.823  1.00 59.24  ? 469  THR C OG1   1 
ATOM   7226  C  CG2   . THR C  2  469  ? 54.466  -35.634 83.680  1.00 57.18  ? 469  THR C CG2   1 
ATOM   7227  N  N     . PRO C  2  470  ? 57.546  -36.689 86.169  1.00 50.46  ? 470  PRO C N     1 
ATOM   7228  C  CA    . PRO C  2  470  ? 57.775  -37.940 86.897  1.00 53.80  ? 470  PRO C CA    1 
ATOM   7229  C  C     . PRO C  2  470  ? 56.520  -38.465 87.575  1.00 54.33  ? 470  PRO C C     1 
ATOM   7230  O  O     . PRO C  2  470  ? 55.632  -37.711 87.977  1.00 59.18  ? 470  PRO C O     1 
ATOM   7231  C  CB    . PRO C  2  470  ? 58.830  -37.547 87.937  1.00 53.08  ? 470  PRO C CB    1 
ATOM   7232  C  CG    . PRO C  2  470  ? 58.544  -36.123 88.208  1.00 52.27  ? 470  PRO C CG    1 
ATOM   7233  C  CD    . PRO C  2  470  ? 58.088  -35.529 86.897  1.00 55.47  ? 470  PRO C CD    1 
ATOM   7234  N  N     . TYR C  2  471  ? 56.458  -39.790 87.691  1.00 55.38  ? 471  TYR C N     1 
ATOM   7235  C  CA    . TYR C  2  471  ? 55.389  -40.462 88.413  1.00 57.21  ? 471  TYR C CA    1 
ATOM   7236  C  C     . TYR C  2  471  ? 55.955  -41.671 89.134  1.00 64.37  ? 471  TYR C C     1 
ATOM   7237  O  O     . TYR C  2  471  ? 56.808  -42.378 88.597  1.00 65.61  ? 471  TYR C O     1 
ATOM   7238  C  CB    . TYR C  2  471  ? 54.262  -40.912 87.478  1.00 57.05  ? 471  TYR C CB    1 
ATOM   7239  C  CG    . TYR C  2  471  ? 53.468  -39.774 86.887  1.00 63.77  ? 471  TYR C CG    1 
ATOM   7240  C  CD1   . TYR C  2  471  ? 52.662  -38.976 87.690  1.00 64.70  ? 471  TYR C CD1   1 
ATOM   7241  C  CD2   . TYR C  2  471  ? 53.515  -39.500 85.525  1.00 64.29  ? 471  TYR C CD2   1 
ATOM   7242  C  CE1   . TYR C  2  471  ? 51.928  -37.932 87.154  1.00 67.14  ? 471  TYR C CE1   1 
ATOM   7243  C  CE2   . TYR C  2  471  ? 52.783  -38.459 84.978  1.00 64.11  ? 471  TYR C CE2   1 
ATOM   7244  C  CZ    . TYR C  2  471  ? 51.992  -37.677 85.798  1.00 67.88  ? 471  TYR C CZ    1 
ATOM   7245  O  OH    . TYR C  2  471  ? 51.261  -36.639 85.262  1.00 66.49  ? 471  TYR C OH    1 
ATOM   7246  N  N     . ARG C  2  472  ? 55.475  -41.911 90.347  1.00 67.01  ? 472  ARG C N     1 
ATOM   7247  C  CA    . ARG C  2  472  ? 55.885  -43.096 91.081  1.00 65.25  ? 472  ARG C CA    1 
ATOM   7248  C  C     . ARG C  2  472  ? 55.100  -44.308 90.608  1.00 66.17  ? 472  ARG C C     1 
ATOM   7249  O  O     . ARG C  2  472  ? 53.895  -44.226 90.353  1.00 67.15  ? 472  ARG C O     1 
ATOM   7250  C  CB    . ARG C  2  472  ? 55.686  -42.896 92.580  1.00 68.86  ? 472  ARG C CB    1 
ATOM   7251  C  CG    . ARG C  2  472  ? 56.748  -42.034 93.217  1.00 74.22  ? 472  ARG C CG    1 
ATOM   7252  C  CD    . ARG C  2  472  ? 56.753  -42.226 94.712  1.00 78.40  ? 472  ARG C CD    1 
ATOM   7253  N  NE    . ARG C  2  472  ? 55.586  -41.626 95.343  1.00 83.73  ? 472  ARG C NE    1 
ATOM   7254  C  CZ    . ARG C  2  472  ? 55.309  -41.733 96.637  1.00 94.21  ? 472  ARG C CZ    1 
ATOM   7255  N  NH1   . ARG C  2  472  ? 56.116  -42.424 97.433  1.00 97.80  ? 472  ARG C NH1   1 
ATOM   7256  N  NH2   . ARG C  2  472  ? 54.227  -41.152 97.135  1.00 100.73 ? 472  ARG C NH2   1 
ATOM   7257  N  N     . ARG C  2  473  ? 55.796  -45.433 90.481  1.00 69.62  ? 473  ARG C N     1 
ATOM   7258  C  CA    . ARG C  2  473  ? 55.144  -46.683 90.122  1.00 69.05  ? 473  ARG C CA    1 
ATOM   7259  C  C     . ARG C  2  473  ? 54.381  -47.241 91.317  1.00 68.59  ? 473  ARG C C     1 
ATOM   7260  O  O     . ARG C  2  473  ? 54.869  -47.223 92.451  1.00 71.89  ? 473  ARG C O     1 
ATOM   7261  C  CB    . ARG C  2  473  ? 56.179  -47.698 89.639  1.00 69.19  ? 473  ARG C CB    1 
ATOM   7262  C  CG    . ARG C  2  473  ? 55.610  -49.063 89.285  1.00 69.11  ? 473  ARG C CG    1 
ATOM   7263  C  CD    . ARG C  2  473  ? 55.494  -49.250 87.779  1.00 70.31  ? 473  ARG C CD    1 
ATOM   7264  N  NE    . ARG C  2  473  ? 56.787  -49.103 87.115  1.00 73.14  ? 473  ARG C NE    1 
ATOM   7265  C  CZ    . ARG C  2  473  ? 56.968  -49.190 85.801  1.00 76.49  ? 473  ARG C CZ    1 
ATOM   7266  N  NH1   . ARG C  2  473  ? 55.937  -49.426 85.000  1.00 75.89  ? 473  ARG C NH1   1 
ATOM   7267  N  NH2   . ARG C  2  473  ? 58.182  -49.037 85.287  1.00 75.09  ? 473  ARG C NH2   1 
ATOM   7268  N  N     . VAL C  2  474  ? 53.172  -47.728 91.060  1.00 64.39  ? 474  VAL C N     1 
ATOM   7269  C  CA    . VAL C  2  474  ? 52.342  -48.370 92.073  1.00 70.54  ? 474  VAL C CA    1 
ATOM   7270  C  C     . VAL C  2  474  ? 52.054  -49.784 91.591  1.00 74.59  ? 474  VAL C C     1 
ATOM   7271  O  O     . VAL C  2  474  ? 51.332  -49.976 90.603  1.00 79.49  ? 474  VAL C O     1 
ATOM   7272  C  CB    . VAL C  2  474  ? 51.042  -47.596 92.335  1.00 70.87  ? 474  VAL C CB    1 
ATOM   7273  C  CG1   . VAL C  2  474  ? 50.168  -48.342 93.330  1.00 68.21  ? 474  VAL C CG1   1 
ATOM   7274  C  CG2   . VAL C  2  474  ? 51.352  -46.201 92.848  1.00 73.21  ? 474  VAL C CG2   1 
ATOM   7275  N  N     . VAL C  2  475  ? 52.625  -50.774 92.274  1.00 78.86  ? 475  VAL C N     1 
ATOM   7276  C  CA    . VAL C  2  475  ? 52.409  -52.186 91.964  1.00 79.34  ? 475  VAL C CA    1 
ATOM   7277  C  C     . VAL C  2  475  ? 51.482  -52.761 93.029  1.00 76.67  ? 475  VAL C C     1 
ATOM   7278  O  O     . VAL C  2  475  ? 51.790  -52.701 94.227  1.00 72.27  ? 475  VAL C O     1 
ATOM   7279  C  CB    . VAL C  2  475  ? 53.737  -52.963 91.900  1.00 78.26  ? 475  VAL C CB    1 
ATOM   7280  C  CG1   . VAL C  2  475  ? 53.486  -54.397 91.459  1.00 84.82  ? 475  VAL C CG1   1 
ATOM   7281  C  CG2   . VAL C  2  475  ? 54.717  -52.277 90.958  1.00 68.88  ? 475  VAL C CG2   1 
ATOM   7282  N  N     . GLY C  2  476  ? 50.357  -53.320 92.592  1.00 70.98  ? 476  GLY C N     1 
ATOM   7283  C  CA    . GLY C  2  476  ? 49.316  -53.747 93.504  1.00 78.27  ? 476  GLY C CA    1 
ATOM   7284  C  C     . GLY C  2  476  ? 48.734  -52.567 94.251  1.00 85.30  ? 476  GLY C C     1 
ATOM   7285  O  O     . GLY C  2  476  ? 48.196  -51.639 93.638  1.00 87.96  ? 476  GLY C O     1 
ATOM   7286  N  N     . GLY C  2  477  ? 48.849  -52.581 95.576  1.00 78.29  ? 477  GLY C N     1 
ATOM   7287  C  CA    . GLY C  2  477  ? 48.556  -51.421 96.381  1.00 79.18  ? 477  GLY C CA    1 
ATOM   7288  C  C     . GLY C  2  477  ? 49.771  -50.710 96.931  1.00 86.55  ? 477  GLY C C     1 
ATOM   7289  O  O     . GLY C  2  477  ? 49.612  -49.775 97.727  1.00 90.04  ? 477  GLY C O     1 
ATOM   7290  N  N     . VAL C  2  478  ? 50.982  -51.102 96.531  1.00 84.50  ? 478  VAL C N     1 
ATOM   7291  C  CA    . VAL C  2  478  ? 52.218  -50.581 97.106  1.00 79.15  ? 478  VAL C CA    1 
ATOM   7292  C  C     . VAL C  2  478  ? 52.799  -49.530 96.170  1.00 77.83  ? 478  VAL C C     1 
ATOM   7293  O  O     . VAL C  2  478  ? 52.969  -49.780 94.971  1.00 72.82  ? 478  VAL C O     1 
ATOM   7294  C  CB    . VAL C  2  478  ? 53.229  -51.712 97.357  1.00 79.48  ? 478  VAL C CB    1 
ATOM   7295  C  CG1   . VAL C  2  478  ? 54.548  -51.154 97.882  1.00 84.32  ? 478  VAL C CG1   1 
ATOM   7296  C  CG2   . VAL C  2  478  ? 52.652  -52.726 98.330  1.00 85.45  ? 478  VAL C CG2   1 
ATOM   7297  N  N     . VAL C  2  479  ? 53.118  -48.362 96.718  1.00 80.23  ? 479  VAL C N     1 
ATOM   7298  C  CA    . VAL C  2  479  ? 53.749  -47.290 95.960  1.00 74.82  ? 479  VAL C CA    1 
ATOM   7299  C  C     . VAL C  2  479  ? 55.258  -47.445 96.072  1.00 74.64  ? 479  VAL C C     1 
ATOM   7300  O  O     . VAL C  2  479  ? 55.827  -47.311 97.160  1.00 72.05  ? 479  VAL C O     1 
ATOM   7301  C  CB    . VAL C  2  479  ? 53.302  -45.910 96.461  1.00 76.04  ? 479  VAL C CB    1 
ATOM   7302  C  CG1   . VAL C  2  479  ? 53.912  -44.811 95.597  1.00 74.92  ? 479  VAL C CG1   1 
ATOM   7303  C  CG2   . VAL C  2  479  ? 51.790  -45.818 96.471  1.00 77.84  ? 479  VAL C CG2   1 
ATOM   7304  N  N     . THR C  2  480  ? 55.909  -47.727 94.949  1.00 75.70  ? 480  THR C N     1 
ATOM   7305  C  CA    . THR C  2  480  ? 57.356  -47.833 94.946  1.00 79.21  ? 480  THR C CA    1 
ATOM   7306  C  C     . THR C  2  480  ? 57.978  -46.446 95.077  1.00 83.26  ? 480  THR C C     1 
ATOM   7307  O  O     . THR C  2  480  ? 57.302  -45.417 95.003  1.00 83.69  ? 480  THR C O     1 
ATOM   7308  C  CB    . THR C  2  480  ? 57.843  -48.510 93.667  1.00 80.30  ? 480  THR C CB    1 
ATOM   7309  O  OG1   . THR C  2  480  ? 56.826  -49.391 93.174  1.00 77.66  ? 480  THR C OG1   1 
ATOM   7310  C  CG2   . THR C  2  480  ? 59.109  -49.316 93.938  1.00 86.65  ? 480  THR C CG2   1 
ATOM   7311  N  N     . ASP C  2  481  ? 59.292  -46.427 95.284  1.00 87.58  ? 481  ASP C N     1 
ATOM   7312  C  CA    . ASP C  2  481  ? 60.056  -45.191 95.280  1.00 84.88  ? 481  ASP C CA    1 
ATOM   7313  C  C     . ASP C  2  481  ? 60.727  -44.932 93.942  1.00 82.85  ? 481  ASP C C     1 
ATOM   7314  O  O     . ASP C  2  481  ? 61.433  -43.928 93.802  1.00 88.20  ? 481  ASP C O     1 
ATOM   7315  C  CB    . ASP C  2  481  ? 61.106  -45.208 96.395  1.00 94.04  ? 481  ASP C CB    1 
ATOM   7316  C  CG    . ASP C  2  481  ? 60.496  -45.019 97.772  1.00 105.98 ? 481  ASP C CG    1 
ATOM   7317  O  OD1   . ASP C  2  481  ? 59.288  -44.703 97.853  1.00 103.20 ? 481  ASP C OD1   1 
ATOM   7318  O  OD2   . ASP C  2  481  ? 61.223  -45.187 98.773  1.00 109.22 ? 481  ASP C OD2   1 
ATOM   7319  N  N     . GLU C  2  482  ? 60.523  -45.807 92.960  1.00 81.62  ? 482  GLU C N     1 
ATOM   7320  C  CA    . GLU C  2  482  ? 61.067  -45.589 91.628  1.00 82.45  ? 482  GLU C CA    1 
ATOM   7321  C  C     . GLU C  2  482  ? 60.170  -44.641 90.841  1.00 82.90  ? 482  GLU C C     1 
ATOM   7322  O  O     . GLU C  2  482  ? 58.940  -44.751 90.873  1.00 78.81  ? 482  GLU C O     1 
ATOM   7323  C  CB    . GLU C  2  482  ? 61.220  -46.915 90.881  1.00 79.39  ? 482  GLU C CB    1 
ATOM   7324  C  CG    . GLU C  2  482  ? 59.915  -47.627 90.569  1.00 80.08  ? 482  GLU C CG    1 
ATOM   7325  C  CD    . GLU C  2  482  ? 59.905  -48.237 89.179  1.00 90.04  ? 482  GLU C CD    1 
ATOM   7326  O  OE1   . GLU C  2  482  ? 60.795  -47.896 88.371  1.00 91.79  ? 482  GLU C OE1   1 
ATOM   7327  O  OE2   . GLU C  2  482  ? 59.009  -49.058 88.891  1.00 92.94  ? 482  GLU C OE2   1 
ATOM   7328  N  N     . VAL C  2  483  ? 60.795  -43.702 90.133  1.00 81.24  ? 483  VAL C N     1 
ATOM   7329  C  CA    . VAL C  2  483  ? 60.085  -42.666 89.394  1.00 74.76  ? 483  VAL C CA    1 
ATOM   7330  C  C     . VAL C  2  483  ? 60.304  -42.872 87.900  1.00 66.34  ? 483  VAL C C     1 
ATOM   7331  O  O     . VAL C  2  483  ? 61.426  -43.131 87.451  1.00 71.64  ? 483  VAL C O     1 
ATOM   7332  C  CB    . VAL C  2  483  ? 60.530  -41.259 89.838  1.00 71.40  ? 483  VAL C CB    1 
ATOM   7333  C  CG1   . VAL C  2  483  ? 60.015  -40.971 91.235  1.00 61.76  ? 483  VAL C CG1   1 
ATOM   7334  C  CG2   . VAL C  2  483  ? 62.048  -41.140 89.800  1.00 78.56  ? 483  VAL C CG2   1 
ATOM   7335  N  N     . VAL C  2  484  ? 59.221  -42.758 87.136  1.00 63.01  ? 484  VAL C N     1 
ATOM   7336  C  CA    . VAL C  2  484  ? 59.216  -42.923 85.687  1.00 63.75  ? 484  VAL C CA    1 
ATOM   7337  C  C     . VAL C  2  484  ? 58.837  -41.581 85.079  1.00 63.81  ? 484  VAL C C     1 
ATOM   7338  O  O     . VAL C  2  484  ? 57.774  -41.033 85.397  1.00 74.02  ? 484  VAL C O     1 
ATOM   7339  C  CB    . VAL C  2  484  ? 58.233  -44.020 85.247  1.00 59.12  ? 484  VAL C CB    1 
ATOM   7340  C  CG1   . VAL C  2  484  ? 58.105  -44.060 83.731  1.00 61.55  ? 484  VAL C CG1   1 
ATOM   7341  C  CG2   . VAL C  2  484  ? 58.661  -45.372 85.792  1.00 66.20  ? 484  VAL C CG2   1 
ATOM   7342  N  N     . TYR C  2  485  ? 59.710  -41.038 84.236  1.00 53.74  ? 485  TYR C N     1 
ATOM   7343  C  CA    . TYR C  2  485  ? 59.439  -39.778 83.557  1.00 53.65  ? 485  TYR C CA    1 
ATOM   7344  C  C     . TYR C  2  485  ? 58.686  -40.062 82.263  1.00 61.01  ? 485  TYR C C     1 
ATOM   7345  O  O     . TYR C  2  485  ? 59.201  -40.755 81.379  1.00 70.23  ? 485  TYR C O     1 
ATOM   7346  C  CB    . TYR C  2  485  ? 60.737  -39.023 83.281  1.00 51.86  ? 485  TYR C CB    1 
ATOM   7347  C  CG    . TYR C  2  485  ? 61.159  -38.131 84.421  1.00 50.33  ? 485  TYR C CG    1 
ATOM   7348  C  CD1   . TYR C  2  485  ? 61.902  -38.628 85.480  1.00 55.76  ? 485  TYR C CD1   1 
ATOM   7349  C  CD2   . TYR C  2  485  ? 60.804  -36.791 84.441  1.00 55.29  ? 485  TYR C CD2   1 
ATOM   7350  C  CE1   . TYR C  2  485  ? 62.286  -37.809 86.527  1.00 63.01  ? 485  TYR C CE1   1 
ATOM   7351  C  CE2   . TYR C  2  485  ? 61.180  -35.965 85.481  1.00 56.11  ? 485  TYR C CE2   1 
ATOM   7352  C  CZ    . TYR C  2  485  ? 61.920  -36.476 86.520  1.00 62.01  ? 485  TYR C CZ    1 
ATOM   7353  O  OH    . TYR C  2  485  ? 62.293  -35.647 87.555  1.00 63.89  ? 485  TYR C OH    1 
ATOM   7354  N  N     . MET C  2  486  ? 57.472  -39.532 82.150  1.00 59.81  ? 486  MET C N     1 
ATOM   7355  C  CA    . MET C  2  486  ? 56.612  -39.816 81.011  1.00 63.58  ? 486  MET C CA    1 
ATOM   7356  C  C     . MET C  2  486  ? 56.361  -38.564 80.182  1.00 60.93  ? 486  MET C C     1 
ATOM   7357  O  O     . MET C  2  486  ? 56.272  -37.454 80.720  1.00 61.34  ? 486  MET C O     1 
ATOM   7358  C  CB    . MET C  2  486  ? 55.269  -40.395 81.465  1.00 63.75  ? 486  MET C CB    1 
ATOM   7359  C  CG    . MET C  2  486  ? 55.387  -41.629 82.335  1.00 66.50  ? 486  MET C CG    1 
ATOM   7360  S  SD    . MET C  2  486  ? 53.793  -42.407 82.648  1.00 65.04  ? 486  MET C SD    1 
ATOM   7361  C  CE    . MET C  2  486  ? 54.090  -43.051 84.284  1.00 66.54  ? 486  MET C CE    1 
ATOM   7362  N  N     . THR C  2  487  ? 56.265  -38.759 78.866  1.00 60.45  ? 487  THR C N     1 
ATOM   7363  C  CA    . THR C  2  487  ? 55.669  -37.779 77.975  1.00 53.12  ? 487  THR C CA    1 
ATOM   7364  C  C     . THR C  2  487  ? 54.156  -37.837 78.129  1.00 54.67  ? 487  THR C C     1 
ATOM   7365  O  O     . THR C  2  487  ? 53.616  -38.666 78.865  1.00 62.33  ? 487  THR C O     1 
ATOM   7366  C  CB    . THR C  2  487  ? 56.068  -38.048 76.528  1.00 55.25  ? 487  THR C CB    1 
ATOM   7367  O  OG1   . THR C  2  487  ? 55.470  -39.274 76.092  1.00 51.61  ? 487  THR C OG1   1 
ATOM   7368  C  CG2   . THR C  2  487  ? 57.581  -38.144 76.401  1.00 55.51  ? 487  THR C CG2   1 
ATOM   7369  N  N     . ALA C  2  488  ? 53.452  -36.955 77.422  1.00 56.68  ? 488  ALA C N     1 
ATOM   7370  C  CA    . ALA C  2  488  ? 51.997  -36.919 77.553  1.00 60.68  ? 488  ALA C CA    1 
ATOM   7371  C  C     . ALA C  2  488  ? 51.354  -38.157 76.939  1.00 59.52  ? 488  ALA C C     1 
ATOM   7372  O  O     . ALA C  2  488  ? 50.399  -38.716 77.499  1.00 60.00  ? 488  ALA C O     1 
ATOM   7373  C  CB    . ALA C  2  488  ? 51.444  -35.648 76.914  1.00 59.39  ? 488  ALA C CB    1 
ATOM   7374  N  N     . THR C  2  489  ? 51.874  -38.604 75.793  1.00 60.42  ? 489  THR C N     1 
ATOM   7375  C  CA    . THR C  2  489  ? 51.285  -39.747 75.105  1.00 59.16  ? 489  THR C CA    1 
ATOM   7376  C  C     . THR C  2  489  ? 51.397  -41.013 75.944  1.00 64.01  ? 489  THR C C     1 
ATOM   7377  O  O     . THR C  2  489  ? 50.455  -41.812 76.001  1.00 67.31  ? 489  THR C O     1 
ATOM   7378  C  CB    . THR C  2  489  ? 51.954  -39.941 73.748  1.00 59.06  ? 489  THR C CB    1 
ATOM   7379  O  OG1   . THR C  2  489  ? 52.069  -38.673 73.091  1.00 65.04  ? 489  THR C OG1   1 
ATOM   7380  C  CG2   . THR C  2  489  ? 51.118  -40.868 72.884  1.00 64.72  ? 489  THR C CG2   1 
ATOM   7381  N  N     . GLU C  2  490  ? 52.539  -41.215 76.604  1.00 66.24  ? 490  GLU C N     1 
ATOM   7382  C  CA    . GLU C  2  490  ? 52.667  -42.378 77.472  1.00 67.59  ? 490  GLU C CA    1 
ATOM   7383  C  C     . GLU C  2  490  ? 51.825  -42.217 78.730  1.00 65.07  ? 490  GLU C C     1 
ATOM   7384  O  O     . GLU C  2  490  ? 51.264  -43.195 79.236  1.00 73.74  ? 490  GLU C O     1 
ATOM   7385  C  CB    . GLU C  2  490  ? 54.135  -42.619 77.832  1.00 69.80  ? 490  GLU C CB    1 
ATOM   7386  C  CG    . GLU C  2  490  ? 54.360  -43.904 78.616  1.00 72.57  ? 490  GLU C CG    1 
ATOM   7387  C  CD    . GLU C  2  490  ? 55.790  -44.061 79.101  1.00 89.87  ? 490  GLU C CD    1 
ATOM   7388  O  OE1   . GLU C  2  490  ? 56.651  -43.224 78.739  1.00 90.45  ? 490  GLU C OE1   1 
ATOM   7389  O  OE2   . GLU C  2  490  ? 56.050  -45.028 79.849  1.00 90.04  ? 490  GLU C OE2   1 
ATOM   7390  N  N     . GLU C  2  491  ? 51.715  -40.987 79.242  1.00 61.21  ? 491  GLU C N     1 
ATOM   7391  C  CA    . GLU C  2  491  ? 50.883  -40.740 80.416  1.00 61.38  ? 491  GLU C CA    1 
ATOM   7392  C  C     . GLU C  2  491  ? 49.425  -41.101 80.158  1.00 68.42  ? 491  GLU C C     1 
ATOM   7393  O  O     . GLU C  2  491  ? 48.738  -41.586 81.067  1.00 68.31  ? 491  GLU C O     1 
ATOM   7394  C  CB    . GLU C  2  491  ? 50.998  -39.276 80.840  1.00 62.94  ? 491  GLU C CB    1 
ATOM   7395  C  CG    . GLU C  2  491  ? 50.116  -38.895 82.022  1.00 69.20  ? 491  GLU C CG    1 
ATOM   7396  C  CD    . GLU C  2  491  ? 50.123  -37.403 82.311  1.00 73.67  ? 491  GLU C CD    1 
ATOM   7397  O  OE1   . GLU C  2  491  ? 49.028  -36.815 82.467  1.00 72.64  ? 491  GLU C OE1   1 
ATOM   7398  O  OE2   . GLU C  2  491  ? 51.226  -36.818 82.375  1.00 70.16  ? 491  GLU C OE2   1 
ATOM   7399  N  N     . ASP C  2  492  ? 48.939  -40.886 78.928  1.00 66.92  ? 492  ASP C N     1 
ATOM   7400  C  CA    . ASP C  2  492  ? 47.542  -41.177 78.602  1.00 59.16  ? 492  ASP C CA    1 
ATOM   7401  C  C     . ASP C  2  492  ? 47.176  -42.651 78.728  1.00 61.74  ? 492  ASP C C     1 
ATOM   7402  O  O     . ASP C  2  492  ? 45.986  -42.979 78.653  1.00 66.10  ? 492  ASP C O     1 
ATOM   7403  C  CB    . ASP C  2  492  ? 47.215  -40.706 77.182  1.00 55.75  ? 492  ASP C CB    1 
ATOM   7404  C  CG    . ASP C  2  492  ? 46.859  -39.235 77.118  1.00 60.71  ? 492  ASP C CG    1 
ATOM   7405  O  OD1   . ASP C  2  492  ? 46.381  -38.689 78.137  1.00 60.17  ? 492  ASP C OD1   1 
ATOM   7406  O  OD2   . ASP C  2  492  ? 47.050  -38.624 76.046  1.00 62.81  ? 492  ASP C OD2   1 
ATOM   7407  N  N     . ARG C  2  493  ? 48.146  -43.545 78.911  1.00 69.46  ? 493  ARG C N     1 
ATOM   7408  C  CA    . ARG C  2  493  ? 47.857  -44.975 78.979  1.00 69.13  ? 493  ARG C CA    1 
ATOM   7409  C  C     . ARG C  2  493  ? 47.473  -45.445 80.379  1.00 70.59  ? 493  ARG C C     1 
ATOM   7410  O  O     . ARG C  2  493  ? 46.684  -46.387 80.509  1.00 71.98  ? 493  ARG C O     1 
ATOM   7411  C  CB    . ARG C  2  493  ? 49.066  -45.778 78.488  1.00 71.06  ? 493  ARG C CB    1 
ATOM   7412  C  CG    . ARG C  2  493  ? 49.573  -45.355 77.112  1.00 76.27  ? 493  ARG C CG    1 
ATOM   7413  C  CD    . ARG C  2  493  ? 50.811  -46.133 76.674  1.00 80.43  ? 493  ARG C CD    1 
ATOM   7414  N  NE    . ARG C  2  493  ? 50.489  -47.453 76.134  1.00 80.29  ? 493  ARG C NE    1 
ATOM   7415  C  CZ    . ARG C  2  493  ? 50.805  -48.603 76.722  1.00 73.25  ? 493  ARG C CZ    1 
ATOM   7416  N  NH1   . ARG C  2  493  ? 51.461  -48.603 77.875  1.00 75.17  ? 493  ARG C NH1   1 
ATOM   7417  N  NH2   . ARG C  2  493  ? 50.472  -49.753 76.151  1.00 64.95  ? 493  ARG C NH2   1 
ATOM   7418  N  N     . TYR C  2  494  ? 47.998  -44.809 81.424  1.00 69.73  ? 494  TYR C N     1 
ATOM   7419  C  CA    . TYR C  2  494  ? 47.865  -45.308 82.785  1.00 67.13  ? 494  TYR C CA    1 
ATOM   7420  C  C     . TYR C  2  494  ? 46.813  -44.533 83.575  1.00 66.78  ? 494  TYR C C     1 
ATOM   7421  O  O     . TYR C  2  494  ? 46.267  -43.520 83.130  1.00 69.47  ? 494  TYR C O     1 
ATOM   7422  C  CB    . TYR C  2  494  ? 49.215  -45.246 83.510  1.00 65.80  ? 494  TYR C CB    1 
ATOM   7423  C  CG    . TYR C  2  494  ? 50.359  -45.855 82.734  1.00 70.68  ? 494  TYR C CG    1 
ATOM   7424  C  CD1   . TYR C  2  494  ? 50.456  -47.231 82.563  1.00 73.05  ? 494  TYR C CD1   1 
ATOM   7425  C  CD2   . TYR C  2  494  ? 51.347  -45.056 82.175  1.00 74.84  ? 494  TYR C CD2   1 
ATOM   7426  C  CE1   . TYR C  2  494  ? 51.503  -47.794 81.850  1.00 77.30  ? 494  TYR C CE1   1 
ATOM   7427  C  CE2   . TYR C  2  494  ? 52.400  -45.610 81.462  1.00 80.96  ? 494  TYR C CE2   1 
ATOM   7428  C  CZ    . TYR C  2  494  ? 52.472  -46.980 81.303  1.00 80.75  ? 494  TYR C CZ    1 
ATOM   7429  O  OH    . TYR C  2  494  ? 53.514  -47.536 80.596  1.00 87.46  ? 494  TYR C OH    1 
ATOM   7430  N  N     . THR C  2  495  ? 46.539  -45.038 84.776  1.00 64.50  ? 495  THR C N     1 
ATOM   7431  C  CA    . THR C  2  495  ? 45.630  -44.426 85.738  1.00 63.27  ? 495  THR C CA    1 
ATOM   7432  C  C     . THR C  2  495  ? 46.478  -43.899 86.890  1.00 62.68  ? 495  THR C C     1 
ATOM   7433  O  O     . THR C  2  495  ? 47.053  -44.683 87.653  1.00 57.85  ? 495  THR C O     1 
ATOM   7434  C  CB    . THR C  2  495  ? 44.597  -45.439 86.226  1.00 67.34  ? 495  THR C CB    1 
ATOM   7435  O  OG1   . THR C  2  495  ? 43.867  -45.953 85.105  1.00 68.65  ? 495  THR C OG1   1 
ATOM   7436  C  CG2   . THR C  2  495  ? 43.632  -44.799 87.209  1.00 64.69  ? 495  THR C CG2   1 
ATOM   7437  N  N     . ILE C  2  496  ? 46.557  -42.577 87.016  1.00 66.32  ? 496  ILE C N     1 
ATOM   7438  C  CA    . ILE C  2  496  ? 47.549  -41.930 87.872  1.00 65.25  ? 496  ILE C CA    1 
ATOM   7439  C  C     . ILE C  2  496  ? 46.834  -41.281 89.053  1.00 66.58  ? 496  ILE C C     1 
ATOM   7440  O  O     . ILE C  2  496  ? 46.054  -40.340 88.877  1.00 67.09  ? 496  ILE C O     1 
ATOM   7441  C  CB    . ILE C  2  496  ? 48.373  -40.905 87.085  1.00 56.04  ? 496  ILE C CB    1 
ATOM   7442  C  CG1   . ILE C  2  496  ? 48.936  -41.558 85.825  1.00 53.16  ? 496  ILE C CG1   1 
ATOM   7443  C  CG2   . ILE C  2  496  ? 49.489  -40.346 87.941  1.00 55.88  ? 496  ILE C CG2   1 
ATOM   7444  C  CD1   . ILE C  2  496  ? 49.805  -40.646 85.023  1.00 65.90  ? 496  ILE C CD1   1 
ATOM   7445  N  N     . ALA C  2  497  ? 47.106  -41.772 90.261  1.00 60.85  ? 497  ALA C N     1 
ATOM   7446  C  CA    . ALA C  2  497  ? 46.463  -41.248 91.458  1.00 62.52  ? 497  ALA C CA    1 
ATOM   7447  C  C     . ALA C  2  497  ? 47.122  -39.943 91.897  1.00 63.23  ? 497  ALA C C     1 
ATOM   7448  O  O     . ALA C  2  497  ? 48.199  -39.569 91.428  1.00 61.05  ? 497  ALA C O     1 
ATOM   7449  C  CB    . ALA C  2  497  ? 46.512  -42.275 92.588  1.00 70.23  ? 497  ALA C CB    1 
ATOM   7450  N  N     . GLN C  2  498  ? 46.457  -39.245 92.817  1.00 68.00  ? 498  GLN C N     1 
ATOM   7451  C  CA    . GLN C  2  498  ? 46.945  -37.956 93.289  1.00 68.45  ? 498  GLN C CA    1 
ATOM   7452  C  C     . GLN C  2  498  ? 47.982  -38.132 94.393  1.00 66.46  ? 498  GLN C C     1 
ATOM   7453  O  O     . GLN C  2  498  ? 47.976  -39.122 95.129  1.00 69.22  ? 498  GLN C O     1 
ATOM   7454  C  CB    . GLN C  2  498  ? 45.787  -37.091 93.789  1.00 65.06  ? 498  GLN C CB    1 
ATOM   7455  C  CG    . GLN C  2  498  ? 44.945  -36.480 92.674  1.00 64.94  ? 498  GLN C CG    1 
ATOM   7456  C  CD    . GLN C  2  498  ? 45.737  -35.523 91.792  1.00 67.21  ? 498  GLN C CD    1 
ATOM   7457  O  OE1   . GLN C  2  498  ? 46.701  -34.895 92.235  1.00 65.76  ? 498  GLN C OE1   1 
ATOM   7458  N  NE2   . GLN C  2  498  ? 45.332  -35.414 90.532  1.00 64.36  ? 498  GLN C NE2   1 
ATOM   7459  N  N     . ALA C  2  499  ? 48.878  -37.145 94.504  1.00 65.07  ? 499  ALA C N     1 
ATOM   7460  C  CA    . ALA C  2  499  ? 50.018  -37.252 95.409  1.00 64.08  ? 499  ALA C CA    1 
ATOM   7461  C  C     . ALA C  2  499  ? 49.615  -37.247 96.874  1.00 68.47  ? 499  ALA C C     1 
ATOM   7462  O  O     . ALA C  2  499  ? 50.398  -37.693 97.719  1.00 71.46  ? 499  ALA C O     1 
ATOM   7463  C  CB    . ALA C  2  499  ? 51.004  -36.113 95.157  1.00 65.21  ? 499  ALA C CB    1 
ATOM   7464  N  N     . ASN C  2  500  ? 48.427  -36.749 97.201  1.00 70.75  ? 500  ASN C N     1 
ATOM   7465  C  CA    . ASN C  2  500  ? 47.990  -36.669 98.585  1.00 72.27  ? 500  ASN C CA    1 
ATOM   7466  C  C     . ASN C  2  500  ? 47.142  -37.860 99.014  1.00 76.16  ? 500  ASN C C     1 
ATOM   7467  O  O     . ASN C  2  500  ? 46.564  -37.824 100.105 1.00 84.81  ? 500  ASN C O     1 
ATOM   7468  C  CB    . ASN C  2  500  ? 47.222  -35.365 98.826  1.00 74.42  ? 500  ASN C CB    1 
ATOM   7469  C  CG    . ASN C  2  500  ? 45.919  -35.285 98.042  1.00 73.92  ? 500  ASN C CG    1 
ATOM   7470  O  OD1   . ASN C  2  500  ? 45.480  -36.257 97.424  1.00 69.15  ? 500  ASN C OD1   1 
ATOM   7471  N  ND2   . ASN C  2  500  ? 45.291  -34.117 98.074  1.00 77.60  ? 500  ASN C ND2   1 
ATOM   7472  N  N     . THR C  2  501  ? 47.036  -38.899 98.187  1.00 73.77  ? 501  THR C N     1 
ATOM   7473  C  CA    . THR C  2  501  ? 46.219  -40.047 98.559  1.00 74.50  ? 501  THR C CA    1 
ATOM   7474  C  C     . THR C  2  501  ? 46.804  -40.711 99.804  1.00 80.91  ? 501  THR C C     1 
ATOM   7475  O  O     . THR C  2  501  ? 48.030  -40.839 99.921  1.00 79.86  ? 501  THR C O     1 
ATOM   7476  C  CB    . THR C  2  501  ? 46.123  -41.056 97.410  1.00 71.19  ? 501  THR C CB    1 
ATOM   7477  O  OG1   . THR C  2  501  ? 47.427  -41.311 96.874  1.00 74.02  ? 501  THR C OG1   1 
ATOM   7478  C  CG2   . THR C  2  501  ? 45.205  -40.532 96.308  1.00 69.06  ? 501  THR C CG2   1 
ATOM   7479  N  N     . PRO C  2  502  ? 45.965  -41.120 100.760 1.00 86.10  ? 502  PRO C N     1 
ATOM   7480  C  CA    . PRO C  2  502  ? 46.483  -41.593 102.052 1.00 87.04  ? 502  PRO C CA    1 
ATOM   7481  C  C     . PRO C  2  502  ? 47.370  -42.823 101.907 1.00 90.32  ? 502  PRO C C     1 
ATOM   7482  O  O     . PRO C  2  502  ? 47.100  -43.720 101.106 1.00 88.31  ? 502  PRO C O     1 
ATOM   7483  C  CB    . PRO C  2  502  ? 45.211  -41.908 102.849 1.00 82.92  ? 502  PRO C CB    1 
ATOM   7484  C  CG    . PRO C  2  502  ? 44.138  -41.094 102.199 1.00 82.08  ? 502  PRO C CG    1 
ATOM   7485  C  CD    . PRO C  2  502  ? 44.493  -41.055 100.744 1.00 82.69  ? 502  PRO C CD    1 
ATOM   7486  N  N     . LEU C  2  503  ? 48.439  -42.853 102.702 1.00 93.19  ? 503  LEU C N     1 
ATOM   7487  C  CA    . LEU C  2  503  ? 49.399  -43.947 102.686 1.00 96.33  ? 503  LEU C CA    1 
ATOM   7488  C  C     . LEU C  2  503  ? 49.753  -44.332 104.114 1.00 103.63 ? 503  LEU C C     1 
ATOM   7489  O  O     . LEU C  2  503  ? 49.998  -43.459 104.953 1.00 107.07 ? 503  LEU C O     1 
ATOM   7490  C  CB    . LEU C  2  503  ? 50.679  -43.565 101.927 1.00 82.55  ? 503  LEU C CB    1 
ATOM   7491  C  CG    . LEU C  2  503  ? 50.599  -43.253 100.433 1.00 78.67  ? 503  LEU C CG    1 
ATOM   7492  C  CD1   . LEU C  2  503  ? 51.934  -42.726 99.947  1.00 83.04  ? 503  LEU C CD1   1 
ATOM   7493  C  CD2   . LEU C  2  503  ? 50.194  -44.480 99.638  1.00 80.96  ? 503  LEU C CD2   1 
ATOM   7494  N  N     . GLU C  2  504  ? 49.769  -45.634 104.384 1.00 102.81 ? 504  GLU C N     1 
ATOM   7495  C  CA    . GLU C  2  504  ? 50.403  -46.193 105.573 1.00 103.68 ? 504  GLU C CA    1 
ATOM   7496  C  C     . GLU C  2  504  ? 51.594  -47.015 105.093 1.00 98.64  ? 504  GLU C C     1 
ATOM   7497  O  O     . GLU C  2  504  ? 51.420  -48.113 104.553 1.00 100.85 ? 504  GLU C O     1 
ATOM   7498  C  CB    . GLU C  2  504  ? 49.424  -47.032 106.393 1.00 104.61 ? 504  GLU C CB    1 
ATOM   7499  C  CG    . GLU C  2  504  ? 48.491  -47.920 105.580 1.00 111.92 ? 504  GLU C CG    1 
ATOM   7500  C  CD    . GLU C  2  504  ? 47.536  -48.712 106.457 1.00 124.69 ? 504  GLU C CD    1 
ATOM   7501  O  OE1   . GLU C  2  504  ? 47.683  -48.654 107.696 1.00 123.21 ? 504  GLU C OE1   1 
ATOM   7502  O  OE2   . GLU C  2  504  ? 46.639  -49.390 105.910 1.00 123.92 ? 504  GLU C OE2   1 
ATOM   7503  N  N     . GLY C  2  505  ? 52.796  -46.481 105.278 1.00 94.48  ? 505  GLY C N     1 
ATOM   7504  C  CA    . GLY C  2  505  ? 53.958  -47.105 104.665 1.00 96.36  ? 505  GLY C CA    1 
ATOM   7505  C  C     . GLY C  2  505  ? 53.979  -46.779 103.186 1.00 90.88  ? 505  GLY C C     1 
ATOM   7506  O  O     . GLY C  2  505  ? 53.755  -45.633 102.783 1.00 96.19  ? 505  GLY C O     1 
ATOM   7507  N  N     . ASN C  2  506  ? 54.240  -47.788 102.357 1.00 88.09  ? 506  ASN C N     1 
ATOM   7508  C  CA    . ASN C  2  506  ? 54.196  -47.633 100.910 1.00 87.80  ? 506  ASN C CA    1 
ATOM   7509  C  C     . ASN C  2  506  ? 52.875  -48.092 100.310 1.00 84.16  ? 506  ASN C C     1 
ATOM   7510  O  O     . ASN C  2  506  ? 52.732  -48.101 99.084  1.00 79.75  ? 506  ASN C O     1 
ATOM   7511  C  CB    . ASN C  2  506  ? 55.354  -48.393 100.261 1.00 88.00  ? 506  ASN C CB    1 
ATOM   7512  C  CG    . ASN C  2  506  ? 56.683  -47.695 100.449 1.00 103.83 ? 506  ASN C CG    1 
ATOM   7513  O  OD1   . ASN C  2  506  ? 56.866  -46.931 101.399 1.00 105.60 ? 506  ASN C OD1   1 
ATOM   7514  N  ND2   . ASN C  2  506  ? 57.619  -47.947 99.539  1.00 101.16 ? 506  ASN C ND2   1 
ATOM   7515  N  N     . ARG C  2  507  ? 51.907  -48.459 101.142 1.00 87.68  ? 507  ARG C N     1 
ATOM   7516  C  CA    . ARG C  2  507  ? 50.640  -49.014 100.688 1.00 89.79  ? 507  ARG C CA    1 
ATOM   7517  C  C     . ARG C  2  507  ? 49.553  -47.949 100.712 1.00 85.47  ? 507  ARG C C     1 
ATOM   7518  O  O     . ARG C  2  507  ? 49.514  -47.105 101.612 1.00 90.41  ? 507  ARG C O     1 
ATOM   7519  C  CB    . ARG C  2  507  ? 50.227  -50.202 101.563 1.00 101.65 ? 507  ARG C CB    1 
ATOM   7520  C  CG    . ARG C  2  507  ? 48.841  -50.770 101.267 1.00 103.80 ? 507  ARG C CG    1 
ATOM   7521  C  CD    . ARG C  2  507  ? 48.650  -52.137 101.909 1.00 108.89 ? 507  ARG C CD    1 
ATOM   7522  N  NE    . ARG C  2  507  ? 49.612  -53.108 101.394 1.00 118.41 ? 507  ARG C NE    1 
ATOM   7523  C  CZ    . ARG C  2  507  ? 49.448  -53.798 100.268 1.00 113.42 ? 507  ARG C CZ    1 
ATOM   7524  N  NH1   . ARG C  2  507  ? 48.354  -53.628 99.536  1.00 103.31 ? 507  ARG C NH1   1 
ATOM   7525  N  NH2   . ARG C  2  507  ? 50.378  -54.658 99.873  1.00 113.18 ? 507  ARG C NH2   1 
ATOM   7526  N  N     . ILE C  2  508  ? 48.668  -47.997 99.715  1.00 82.21  ? 508  ILE C N     1 
ATOM   7527  C  CA    . ILE C  2  508  ? 47.551  -47.066 99.652  1.00 87.12  ? 508  ILE C CA    1 
ATOM   7528  C  C     . ILE C  2  508  ? 46.553  -47.398 100.752 1.00 86.90  ? 508  ILE C C     1 
ATOM   7529  O  O     . ILE C  2  508  ? 46.074  -48.534 100.858 1.00 85.14  ? 508  ILE C O     1 
ATOM   7530  C  CB    . ILE C  2  508  ? 46.895  -47.107 98.265  1.00 83.98  ? 508  ILE C CB    1 
ATOM   7531  C  CG1   . ILE C  2  508  ? 47.874  -46.604 97.206  1.00 79.06  ? 508  ILE C CG1   1 
ATOM   7532  C  CG2   . ILE C  2  508  ? 45.626  -46.274 98.250  1.00 82.02  ? 508  ILE C CG2   1 
ATOM   7533  C  CD1   . ILE C  2  508  ? 47.318  -46.642 95.804  1.00 87.53  ? 508  ILE C CD1   1 
ATOM   7534  N  N     . ALA C  2  509  ? 46.227  -46.399 101.574 1.00 90.06  ? 509  ALA C N     1 
ATOM   7535  C  CA    . ALA C  2  509  ? 45.409  -46.583 102.764 1.00 89.68  ? 509  ALA C CA    1 
ATOM   7536  C  C     . ALA C  2  509  ? 43.948  -46.201 102.567 1.00 81.71  ? 509  ALA C C     1 
ATOM   7537  O  O     . ALA C  2  509  ? 43.177  -46.251 103.530 1.00 86.84  ? 509  ALA C O     1 
ATOM   7538  C  CB    . ALA C  2  509  ? 45.995  -45.776 103.927 1.00 96.32  ? 509  ALA C CB    1 
ATOM   7539  N  N     . ALA C  2  510  ? 43.543  -45.823 101.361 1.00 86.39  ? 510  ALA C N     1 
ATOM   7540  C  CA    . ALA C  2  510  ? 42.168  -45.430 101.093 1.00 83.37  ? 510  ALA C CA    1 
ATOM   7541  C  C     . ALA C  2  510  ? 41.435  -46.533 100.343 1.00 88.76  ? 510  ALA C C     1 
ATOM   7542  O  O     . ALA C  2  510  ? 42.026  -47.258 99.537  1.00 89.29  ? 510  ALA C O     1 
ATOM   7543  C  CB    . ALA C  2  510  ? 42.116  -44.131 100.282 1.00 86.98  ? 510  ALA C CB    1 
ATOM   7544  N  N     . GLU C  2  511  ? 40.133  -46.653 100.617 1.00 96.19  ? 511  GLU C N     1 
ATOM   7545  C  CA    . GLU C  2  511  ? 39.291  -47.583 99.868  1.00 97.80  ? 511  GLU C CA    1 
ATOM   7546  C  C     . GLU C  2  511  ? 38.985  -47.067 98.466  1.00 92.68  ? 511  GLU C C     1 
ATOM   7547  O  O     . GLU C  2  511  ? 38.874  -47.861 97.525  1.00 88.86  ? 511  GLU C O     1 
ATOM   7548  C  CB    . GLU C  2  511  ? 37.986  -47.838 100.622 1.00 102.43 ? 511  GLU C CB    1 
ATOM   7549  C  CG    . GLU C  2  511  ? 37.093  -48.882 99.967  1.00 112.83 ? 511  GLU C CG    1 
ATOM   7550  C  CD    . GLU C  2  511  ? 35.633  -48.474 99.934  1.00 118.19 ? 511  GLU C CD    1 
ATOM   7551  O  OE1   . GLU C  2  511  ? 35.267  -47.516 100.647 1.00 110.48 ? 511  GLU C OE1   1 
ATOM   7552  O  OE2   . GLU C  2  511  ? 34.853  -49.107 99.189  1.00 119.02 ? 511  GLU C OE2   1 
ATOM   7553  N  N     . ARG C  2  512  ? 38.842  -45.752 98.314  1.00 91.76  ? 512  ARG C N     1 
ATOM   7554  C  CA    . ARG C  2  512  ? 38.646  -45.108 97.022  1.00 91.70  ? 512  ARG C CA    1 
ATOM   7555  C  C     . ARG C  2  512  ? 39.662  -43.983 96.884  1.00 88.72  ? 512  ARG C C     1 
ATOM   7556  O  O     . ARG C  2  512  ? 39.806  -43.159 97.794  1.00 79.81  ? 512  ARG C O     1 
ATOM   7557  C  CB    . ARG C  2  512  ? 37.218  -44.567 96.883  1.00 93.29  ? 512  ARG C CB    1 
ATOM   7558  C  CG    . ARG C  2  512  ? 36.587  -44.134 98.196  1.00 99.38  ? 512  ARG C CG    1 
ATOM   7559  C  CD    . ARG C  2  512  ? 35.495  -43.103 97.974  1.00 104.62 ? 512  ARG C CD    1 
ATOM   7560  N  NE    . ARG C  2  512  ? 34.518  -43.546 96.986  1.00 112.37 ? 512  ARG C NE    1 
ATOM   7561  C  CZ    . ARG C  2  512  ? 33.644  -42.742 96.388  1.00 110.06 ? 512  ARG C CZ    1 
ATOM   7562  N  NH1   . ARG C  2  512  ? 33.627  -41.447 96.674  1.00 107.95 ? 512  ARG C NH1   1 
ATOM   7563  N  NH2   . ARG C  2  512  ? 32.791  -43.232 95.499  1.00 101.07 ? 512  ARG C NH2   1 
ATOM   7564  N  N     . VAL C  2  513  ? 40.369  -43.953 95.755  1.00 84.68  ? 513  VAL C N     1 
ATOM   7565  C  CA    . VAL C  2  513  ? 41.396  -42.951 95.505  1.00 80.59  ? 513  VAL C CA    1 
ATOM   7566  C  C     . VAL C  2  513  ? 40.976  -42.091 94.321  1.00 74.81  ? 513  VAL C C     1 
ATOM   7567  O  O     . VAL C  2  513  ? 40.208  -42.516 93.450  1.00 69.90  ? 513  VAL C O     1 
ATOM   7568  C  CB    . VAL C  2  513  ? 42.784  -43.580 95.248  1.00 79.95  ? 513  VAL C CB    1 
ATOM   7569  C  CG1   . VAL C  2  513  ? 43.031  -44.742 96.198  1.00 79.70  ? 513  VAL C CG1   1 
ATOM   7570  C  CG2   . VAL C  2  513  ? 42.917  -44.024 93.800  1.00 76.14  ? 513  VAL C CG2   1 
ATOM   7571  N  N     . VAL C  2  514  ? 41.487  -40.865 94.304  1.00 72.60  ? 514  VAL C N     1 
ATOM   7572  C  CA    . VAL C  2  514  ? 41.253  -39.935 93.206  1.00 69.61  ? 514  VAL C CA    1 
ATOM   7573  C  C     . VAL C  2  514  ? 42.395  -40.090 92.217  1.00 69.70  ? 514  VAL C C     1 
ATOM   7574  O  O     . VAL C  2  514  ? 43.567  -39.970 92.592  1.00 64.57  ? 514  VAL C O     1 
ATOM   7575  C  CB    . VAL C  2  514  ? 41.155  -38.490 93.713  1.00 62.22  ? 514  VAL C CB    1 
ATOM   7576  C  CG1   . VAL C  2  514  ? 40.859  -37.542 92.564  1.00 63.86  ? 514  VAL C CG1   1 
ATOM   7577  C  CG2   . VAL C  2  514  ? 40.094  -38.382 94.789  1.00 64.48  ? 514  VAL C CG2   1 
ATOM   7578  N  N     . ALA C  2  515  ? 42.062  -40.357 90.955  1.00 67.11  ? 515  ALA C N     1 
ATOM   7579  C  CA    . ALA C  2  515  ? 43.068  -40.605 89.940  1.00 64.73  ? 515  ALA C CA    1 
ATOM   7580  C  C     . ALA C  2  515  ? 42.650  -39.915 88.650  1.00 62.52  ? 515  ALA C C     1 
ATOM   7581  O  O     . ALA C  2  515  ? 41.570  -39.326 88.552  1.00 61.94  ? 515  ALA C O     1 
ATOM   7582  C  CB    . ALA C  2  515  ? 43.276  -42.109 89.732  1.00 69.67  ? 515  ALA C CB    1 
ATOM   7583  N  N     . ARG C  2  516  ? 43.528  -39.996 87.655  1.00 63.21  ? 516  ARG C N     1 
ATOM   7584  C  CA    . ARG C  2  516  ? 43.312  -39.416 86.339  1.00 67.52  ? 516  ARG C CA    1 
ATOM   7585  C  C     . ARG C  2  516  ? 43.528  -40.488 85.285  1.00 69.30  ? 516  ARG C C     1 
ATOM   7586  O  O     . ARG C  2  516  ? 44.537  -41.204 85.319  1.00 73.85  ? 516  ARG C O     1 
ATOM   7587  C  CB    . ARG C  2  516  ? 44.258  -38.238 86.082  1.00 64.51  ? 516  ARG C CB    1 
ATOM   7588  C  CG    . ARG C  2  516  ? 44.100  -37.105 87.064  1.00 62.08  ? 516  ARG C CG    1 
ATOM   7589  C  CD    . ARG C  2  516  ? 45.134  -36.025 86.838  1.00 60.09  ? 516  ARG C CD    1 
ATOM   7590  N  NE    . ARG C  2  516  ? 46.499  -36.522 86.980  1.00 62.09  ? 516  ARG C NE    1 
ATOM   7591  C  CZ    . ARG C  2  516  ? 47.386  -36.554 85.992  1.00 62.78  ? 516  ARG C CZ    1 
ATOM   7592  N  NH1   . ARG C  2  516  ? 47.052  -36.111 84.787  1.00 64.72  ? 516  ARG C NH1   1 
ATOM   7593  N  NH2   . ARG C  2  516  ? 48.609  -37.017 86.208  1.00 58.92  ? 516  ARG C NH2   1 
ATOM   7594  N  N     . ARG C  2  517  ? 42.565  -40.604 84.371  1.00 69.82  ? 517  ARG C N     1 
ATOM   7595  C  CA    . ARG C  2  517  ? 42.696  -41.388 83.146  1.00 66.60  ? 517  ARG C CA    1 
ATOM   7596  C  C     . ARG C  2  517  ? 42.537  -40.422 81.983  1.00 68.66  ? 517  ARG C C     1 
ATOM   7597  O  O     . ARG C  2  517  ? 41.447  -39.874 81.776  1.00 69.20  ? 517  ARG C O     1 
ATOM   7598  C  CB    . ARG C  2  517  ? 41.653  -42.502 83.071  1.00 66.89  ? 517  ARG C CB    1 
ATOM   7599  C  CG    . ARG C  2  517  ? 41.938  -43.710 83.948  1.00 72.56  ? 517  ARG C CG    1 
ATOM   7600  C  CD    . ARG C  2  517  ? 40.708  -44.608 84.040  1.00 83.67  ? 517  ARG C CD    1 
ATOM   7601  N  NE    . ARG C  2  517  ? 40.926  -45.801 84.855  1.00 85.72  ? 517  ARG C NE    1 
ATOM   7602  C  CZ    . ARG C  2  517  ? 39.948  -46.584 85.304  1.00 87.62  ? 517  ARG C CZ    1 
ATOM   7603  N  NH1   . ARG C  2  517  ? 38.682  -46.294 85.026  1.00 86.94  ? 517  ARG C NH1   1 
ATOM   7604  N  NH2   . ARG C  2  517  ? 40.232  -47.653 86.038  1.00 84.51  ? 517  ARG C NH2   1 
ATOM   7605  N  N     . LYS C  2  518  ? 43.617  -40.212 81.229  1.00 65.06  ? 518  LYS C N     1 
ATOM   7606  C  CA    . LYS C  2  518  ? 43.648  -39.211 80.163  1.00 68.01  ? 518  LYS C CA    1 
ATOM   7607  C  C     . LYS C  2  518  ? 43.170  -37.861 80.691  1.00 68.03  ? 518  LYS C C     1 
ATOM   7608  O  O     . LYS C  2  518  ? 42.275  -37.221 80.132  1.00 62.05  ? 518  LYS C O     1 
ATOM   7609  C  CB    . LYS C  2  518  ? 42.818  -39.653 78.953  1.00 60.83  ? 518  LYS C CB    1 
ATOM   7610  C  CG    . LYS C  2  518  ? 43.424  -40.794 78.145  1.00 57.54  ? 518  LYS C CG    1 
ATOM   7611  C  CD    . LYS C  2  518  ? 42.674  -40.990 76.835  1.00 64.18  ? 518  LYS C CD    1 
ATOM   7612  C  CE    . LYS C  2  518  ? 43.232  -42.150 76.026  1.00 65.43  ? 518  LYS C CE    1 
ATOM   7613  N  NZ    . LYS C  2  518  ? 42.980  -43.461 76.685  1.00 73.85  ? 518  LYS C NZ    1 
ATOM   7614  N  N     . GLY C  2  519  ? 43.748  -37.451 81.821  1.00 66.35  ? 519  GLY C N     1 
ATOM   7615  C  CA    . GLY C  2  519  ? 43.367  -36.217 82.469  1.00 66.86  ? 519  GLY C CA    1 
ATOM   7616  C  C     . GLY C  2  519  ? 41.976  -36.192 83.056  1.00 69.20  ? 519  GLY C C     1 
ATOM   7617  O  O     . GLY C  2  519  ? 41.663  -35.270 83.819  1.00 72.73  ? 519  GLY C O     1 
ATOM   7618  N  N     . GLU C  2  520  ? 41.129  -37.155 82.731  1.00 68.08  ? 520  GLU C N     1 
ATOM   7619  C  CA    . GLU C  2  520  ? 39.790  -37.183 83.299  1.00 69.87  ? 520  GLU C CA    1 
ATOM   7620  C  C     . GLU C  2  520  ? 39.873  -37.611 84.760  1.00 70.94  ? 520  GLU C C     1 
ATOM   7621  O  O     . GLU C  2  520  ? 40.486  -38.644 85.063  1.00 69.87  ? 520  GLU C O     1 
ATOM   7622  C  CB    . GLU C  2  520  ? 38.896  -38.135 82.505  1.00 71.78  ? 520  GLU C CB    1 
ATOM   7623  C  CG    . GLU C  2  520  ? 37.400  -37.875 82.648  1.00 81.16  ? 520  GLU C CG    1 
ATOM   7624  C  CD    . GLU C  2  520  ? 36.968  -36.537 82.065  1.00 95.57  ? 520  GLU C CD    1 
ATOM   7625  O  OE1   . GLU C  2  520  ? 35.932  -36.002 82.519  1.00 97.41  ? 520  GLU C OE1   1 
ATOM   7626  O  OE2   . GLU C  2  520  ? 37.661  -36.022 81.157  1.00 87.92  ? 520  GLU C OE2   1 
ATOM   7627  N  N     . PRO C  2  521  ? 39.309  -36.838 85.689  1.00 70.32  ? 521  PRO C N     1 
ATOM   7628  C  CA    . PRO C  2  521  ? 39.308  -37.259 87.095  1.00 67.84  ? 521  PRO C CA    1 
ATOM   7629  C  C     . PRO C  2  521  ? 38.308  -38.381 87.323  1.00 64.22  ? 521  PRO C C     1 
ATOM   7630  O  O     . PRO C  2  521  ? 37.207  -38.375 86.769  1.00 62.09  ? 521  PRO C O     1 
ATOM   7631  C  CB    . PRO C  2  521  ? 38.904  -35.985 87.844  1.00 64.05  ? 521  PRO C CB    1 
ATOM   7632  C  CG    . PRO C  2  521  ? 38.099  -35.217 86.850  1.00 63.55  ? 521  PRO C CG    1 
ATOM   7633  C  CD    . PRO C  2  521  ? 38.712  -35.504 85.508  1.00 67.06  ? 521  PRO C CD    1 
ATOM   7634  N  N     . VAL C  2  522  ? 38.701  -39.352 88.147  1.00 67.14  ? 522  VAL C N     1 
ATOM   7635  C  CA    . VAL C  2  522  ? 37.886  -40.540 88.350  1.00 69.62  ? 522  VAL C CA    1 
ATOM   7636  C  C     . VAL C  2  522  ? 38.204  -41.133 89.717  1.00 71.82  ? 522  VAL C C     1 
ATOM   7637  O  O     . VAL C  2  522  ? 39.343  -41.074 90.192  1.00 71.45  ? 522  VAL C O     1 
ATOM   7638  C  CB    . VAL C  2  522  ? 38.108  -41.560 87.204  1.00 64.32  ? 522  VAL C CB    1 
ATOM   7639  C  CG1   . VAL C  2  522  ? 39.530  -42.083 87.222  1.00 67.02  ? 522  VAL C CG1   1 
ATOM   7640  C  CG2   . VAL C  2  522  ? 37.106  -42.699 87.285  1.00 80.42  ? 522  VAL C CG2   1 
ATOM   7641  N  N     . ILE C  2  523  ? 37.177  -41.691 90.361  1.00 69.77  ? 523  ILE C N     1 
ATOM   7642  C  CA    . ILE C  2  523  ? 37.330  -42.415 91.619  1.00 73.42  ? 523  ILE C CA    1 
ATOM   7643  C  C     . ILE C  2  523  ? 37.596  -43.881 91.301  1.00 72.08  ? 523  ILE C C     1 
ATOM   7644  O  O     . ILE C  2  523  ? 36.840  -44.509 90.549  1.00 67.64  ? 523  ILE C O     1 
ATOM   7645  C  CB    . ILE C  2  523  ? 36.082  -42.255 92.501  1.00 75.06  ? 523  ILE C CB    1 
ATOM   7646  C  CG1   . ILE C  2  523  ? 35.775  -40.774 92.713  1.00 72.16  ? 523  ILE C CG1   1 
ATOM   7647  C  CG2   . ILE C  2  523  ? 36.276  -42.950 93.836  1.00 79.46  ? 523  ILE C CG2   1 
ATOM   7648  C  CD1   . ILE C  2  523  ? 36.918  -40.006 93.327  1.00 68.26  ? 523  ILE C CD1   1 
ATOM   7649  N  N     . VAL C  2  524  ? 38.662  -44.434 91.886  1.00 73.03  ? 524  VAL C N     1 
ATOM   7650  C  CA    . VAL C  2  524  ? 39.203  -45.714 91.448  1.00 71.19  ? 524  VAL C CA    1 
ATOM   7651  C  C     . VAL C  2  524  ? 39.706  -46.505 92.652  1.00 74.05  ? 524  VAL C C     1 
ATOM   7652  O  O     . VAL C  2  524  ? 40.104  -45.933 93.671  1.00 79.38  ? 524  VAL C O     1 
ATOM   7653  C  CB    . VAL C  2  524  ? 40.320  -45.485 90.401  1.00 69.98  ? 524  VAL C CB    1 
ATOM   7654  C  CG1   . VAL C  2  524  ? 41.661  -46.040 90.869  1.00 67.94  ? 524  VAL C CG1   1 
ATOM   7655  C  CG2   . VAL C  2  524  ? 39.912  -46.059 89.053  1.00 75.05  ? 524  VAL C CG2   1 
ATOM   7656  N  N     . SER C  2  525  ? 39.671  -47.848 92.531  1.00 68.16  ? 525  SER C N     1 
ATOM   7657  C  CA    . SER C  2  525  ? 40.145  -48.731 93.590  1.00 73.62  ? 525  SER C CA    1 
ATOM   7658  C  C     . SER C  2  525  ? 41.671  -48.846 93.570  1.00 75.76  ? 525  SER C C     1 
ATOM   7659  O  O     . SER C  2  525  ? 42.293  -48.754 92.508  1.00 76.20  ? 525  SER C O     1 
ATOM   7660  C  CB    . SER C  2  525  ? 39.526  -50.119 93.444  1.00 79.42  ? 525  SER C CB    1 
ATOM   7661  O  OG    . SER C  2  525  ? 38.184  -50.133 93.900  1.00 99.95  ? 525  SER C OG    1 
ATOM   7662  N  N     . PRO C  2  526  ? 42.294  -49.054 94.737  1.00 74.41  ? 526  PRO C N     1 
ATOM   7663  C  CA    . PRO C  2  526  ? 43.768  -49.104 94.794  1.00 76.00  ? 526  PRO C CA    1 
ATOM   7664  C  C     . PRO C  2  526  ? 44.394  -50.175 93.917  1.00 79.19  ? 526  PRO C C     1 
ATOM   7665  O  O     . PRO C  2  526  ? 45.590  -50.079 93.608  1.00 75.07  ? 526  PRO C O     1 
ATOM   7666  C  CB    . PRO C  2  526  ? 44.051  -49.367 96.278  1.00 71.69  ? 526  PRO C CB    1 
ATOM   7667  C  CG    . PRO C  2  526  ? 42.865  -48.824 96.977  1.00 73.36  ? 526  PRO C CG    1 
ATOM   7668  C  CD    . PRO C  2  526  ? 41.692  -49.086 96.079  1.00 70.79  ? 526  PRO C CD    1 
ATOM   7669  N  N     . GLU C  2  527  ? 43.633  -51.193 93.512  1.00 86.20  ? 527  GLU C N     1 
ATOM   7670  C  CA    . GLU C  2  527  ? 44.138  -52.177 92.564  1.00 81.20  ? 527  GLU C CA    1 
ATOM   7671  C  C     . GLU C  2  527  ? 44.211  -51.632 91.146  1.00 79.02  ? 527  GLU C C     1 
ATOM   7672  O  O     . GLU C  2  527  ? 45.004  -52.136 90.345  1.00 90.68  ? 527  GLU C O     1 
ATOM   7673  C  CB    . GLU C  2  527  ? 43.267  -53.434 92.578  1.00 81.42  ? 527  GLU C CB    1 
ATOM   7674  C  CG    . GLU C  2  527  ? 43.416  -54.288 93.827  1.00 90.12  ? 527  GLU C CG    1 
ATOM   7675  C  CD    . GLU C  2  527  ? 42.570  -53.789 94.983  1.00 92.37  ? 527  GLU C CD    1 
ATOM   7676  O  OE1   . GLU C  2  527  ? 41.546  -53.118 94.731  1.00 93.25  ? 527  GLU C OE1   1 
ATOM   7677  O  OE2   . GLU C  2  527  ? 42.930  -54.068 96.146  1.00 92.77  ? 527  GLU C OE2   1 
ATOM   7678  N  N     . GLU C  2  528  ? 43.408  -50.618 90.821  1.00 70.74  ? 528  GLU C N     1 
ATOM   7679  C  CA    . GLU C  2  528  ? 43.420  -49.993 89.504  1.00 70.37  ? 528  GLU C CA    1 
ATOM   7680  C  C     . GLU C  2  528  ? 44.466  -48.893 89.380  1.00 64.93  ? 528  GLU C C     1 
ATOM   7681  O  O     . GLU C  2  528  ? 44.531  -48.238 88.336  1.00 64.87  ? 528  GLU C O     1 
ATOM   7682  C  CB    . GLU C  2  528  ? 42.036  -49.416 89.183  1.00 69.05  ? 528  GLU C CB    1 
ATOM   7683  C  CG    . GLU C  2  528  ? 40.889  -50.383 89.426  1.00 76.75  ? 528  GLU C CG    1 
ATOM   7684  C  CD    . GLU C  2  528  ? 39.526  -49.754 89.197  1.00 81.61  ? 528  GLU C CD    1 
ATOM   7685  O  OE1   . GLU C  2  528  ? 38.757  -49.622 90.174  1.00 79.09  ? 528  GLU C OE1   1 
ATOM   7686  O  OE2   . GLU C  2  528  ? 39.224  -49.393 88.039  1.00 84.27  ? 528  GLU C OE2   1 
ATOM   7687  N  N     . VAL C  2  529  ? 45.280  -48.677 90.409  1.00 63.15  ? 529  VAL C N     1 
ATOM   7688  C  CA    . VAL C  2  529  ? 46.228  -47.570 90.445  1.00 59.41  ? 529  VAL C CA    1 
ATOM   7689  C  C     . VAL C  2  529  ? 47.549  -48.045 89.853  1.00 62.92  ? 529  VAL C C     1 
ATOM   7690  O  O     . VAL C  2  529  ? 48.234  -48.888 90.435  1.00 68.37  ? 529  VAL C O     1 
ATOM   7691  C  CB    . VAL C  2  529  ? 46.417  -47.046 91.873  1.00 67.33  ? 529  VAL C CB    1 
ATOM   7692  C  CG1   . VAL C  2  529  ? 47.553  -46.040 91.923  1.00 68.94  ? 529  VAL C CG1   1 
ATOM   7693  C  CG2   . VAL C  2  529  ? 45.130  -46.422 92.381  1.00 68.85  ? 529  VAL C CG2   1 
ATOM   7694  N  N     . GLU C  2  530  ? 47.916  -47.488 88.701  1.00 62.19  ? 530  GLU C N     1 
ATOM   7695  C  CA    . GLU C  2  530  ? 49.147  -47.861 88.010  1.00 62.65  ? 530  GLU C CA    1 
ATOM   7696  C  C     . GLU C  2  530  ? 50.319  -46.942 88.328  1.00 66.14  ? 530  GLU C C     1 
ATOM   7697  O  O     . GLU C  2  530  ? 51.462  -47.406 88.368  1.00 66.13  ? 530  GLU C O     1 
ATOM   7698  C  CB    . GLU C  2  530  ? 48.905  -47.878 86.503  1.00 66.30  ? 530  GLU C CB    1 
ATOM   7699  C  CG    . GLU C  2  530  ? 47.665  -48.672 86.117  1.00 70.42  ? 530  GLU C CG    1 
ATOM   7700  C  CD    . GLU C  2  530  ? 47.434  -48.737 84.622  1.00 78.53  ? 530  GLU C CD    1 
ATOM   7701  O  OE1   . GLU C  2  530  ? 46.338  -48.333 84.175  1.00 72.75  ? 530  GLU C OE1   1 
ATOM   7702  O  OE2   . GLU C  2  530  ? 48.343  -49.199 83.898  1.00 84.47  ? 530  GLU C OE2   1 
ATOM   7703  N  N     . PHE C  2  531  ? 50.062  -45.653 88.549  1.00 66.79  ? 531  PHE C N     1 
ATOM   7704  C  CA    . PHE C  2  531  ? 51.095  -44.697 88.926  1.00 63.81  ? 531  PHE C CA    1 
ATOM   7705  C  C     . PHE C  2  531  ? 50.511  -43.698 89.917  1.00 64.87  ? 531  PHE C C     1 
ATOM   7706  O  O     . PHE C  2  531  ? 49.318  -43.729 90.235  1.00 62.54  ? 531  PHE C O     1 
ATOM   7707  C  CB    . PHE C  2  531  ? 51.666  -43.975 87.704  1.00 58.11  ? 531  PHE C CB    1 
ATOM   7708  C  CG    . PHE C  2  531  ? 52.552  -44.831 86.861  1.00 64.30  ? 531  PHE C CG    1 
ATOM   7709  C  CD1   . PHE C  2  531  ? 53.889  -44.986 87.183  1.00 66.77  ? 531  PHE C CD1   1 
ATOM   7710  C  CD2   . PHE C  2  531  ? 52.053  -45.483 85.747  1.00 66.82  ? 531  PHE C CD2   1 
ATOM   7711  C  CE1   . PHE C  2  531  ? 54.713  -45.775 86.406  1.00 67.71  ? 531  PHE C CE1   1 
ATOM   7712  C  CE2   . PHE C  2  531  ? 52.873  -46.274 84.967  1.00 64.30  ? 531  PHE C CE2   1 
ATOM   7713  C  CZ    . PHE C  2  531  ? 54.203  -46.420 85.296  1.00 64.72  ? 531  PHE C CZ    1 
ATOM   7714  N  N     . MET C  2  532  ? 51.367  -42.801 90.405  1.00 65.47  ? 532  MET C N     1 
ATOM   7715  C  CA    . MET C  2  532  ? 50.955  -41.797 91.378  1.00 63.60  ? 532  MET C CA    1 
ATOM   7716  C  C     . MET C  2  532  ? 51.779  -40.531 91.178  1.00 63.52  ? 532  MET C C     1 
ATOM   7717  O  O     . MET C  2  532  ? 52.934  -40.589 90.748  1.00 66.32  ? 532  MET C O     1 
ATOM   7718  C  CB    . MET C  2  532  ? 51.104  -42.325 92.812  1.00 63.02  ? 532  MET C CB    1 
ATOM   7719  C  CG    . MET C  2  532  ? 50.830  -41.305 93.905  1.00 67.39  ? 532  MET C CG    1 
ATOM   7720  S  SD    . MET C  2  532  ? 50.665  -42.071 95.525  1.00 77.63  ? 532  MET C SD    1 
ATOM   7721  C  CE    . MET C  2  532  ? 50.948  -40.666 96.597  1.00 80.31  ? 532  MET C CE    1 
ATOM   7722  N  N     . ASP C  2  533  ? 51.166  -39.384 91.476  1.00 64.58  ? 533  ASP C N     1 
ATOM   7723  C  CA    . ASP C  2  533  ? 51.877  -38.114 91.419  1.00 64.01  ? 533  ASP C CA    1 
ATOM   7724  C  C     . ASP C  2  533  ? 53.053  -38.114 92.389  1.00 64.56  ? 533  ASP C C     1 
ATOM   7725  O  O     . ASP C  2  533  ? 53.023  -38.758 93.443  1.00 64.69  ? 533  ASP C O     1 
ATOM   7726  C  CB    . ASP C  2  533  ? 50.943  -36.948 91.761  1.00 67.28  ? 533  ASP C CB    1 
ATOM   7727  C  CG    . ASP C  2  533  ? 49.860  -36.726 90.724  1.00 69.63  ? 533  ASP C CG    1 
ATOM   7728  O  OD1   . ASP C  2  533  ? 49.663  -37.600 89.851  1.00 73.06  ? 533  ASP C OD1   1 
ATOM   7729  O  OD2   . ASP C  2  533  ? 49.204  -35.664 90.789  1.00 67.85  ? 533  ASP C OD2   1 
ATOM   7730  N  N     . VAL C  2  534  ? 54.099  -37.373 92.024  1.00 57.17  ? 534  VAL C N     1 
ATOM   7731  C  CA    . VAL C  2  534  ? 55.262  -37.253 92.895  1.00 61.19  ? 534  VAL C CA    1 
ATOM   7732  C  C     . VAL C  2  534  ? 54.985  -36.278 94.030  1.00 61.75  ? 534  VAL C C     1 
ATOM   7733  O  O     . VAL C  2  534  ? 55.262  -36.569 95.199  1.00 68.99  ? 534  VAL C O     1 
ATOM   7734  C  CB    . VAL C  2  534  ? 56.497  -36.833 92.081  1.00 57.82  ? 534  VAL C CB    1 
ATOM   7735  C  CG1   . VAL C  2  534  ? 57.673  -36.581 93.010  1.00 57.07  ? 534  VAL C CG1   1 
ATOM   7736  C  CG2   . VAL C  2  534  ? 56.836  -37.902 91.057  1.00 62.84  ? 534  VAL C CG2   1 
ATOM   7737  N  N     . SER C  2  535  ? 54.427  -35.117 93.701  1.00 58.14  ? 535  SER C N     1 
ATOM   7738  C  CA    . SER C  2  535  ? 54.143  -34.056 94.659  1.00 63.88  ? 535  SER C CA    1 
ATOM   7739  C  C     . SER C  2  535  ? 53.240  -33.023 93.998  1.00 57.45  ? 535  SER C C     1 
ATOM   7740  O  O     . SER C  2  535  ? 53.232  -32.919 92.768  1.00 60.54  ? 535  SER C O     1 
ATOM   7741  C  CB    . SER C  2  535  ? 55.442  -33.406 95.143  1.00 65.56  ? 535  SER C CB    1 
ATOM   7742  O  OG    . SER C  2  535  ? 55.190  -32.315 96.012  1.00 64.48  ? 535  SER C OG    1 
ATOM   7743  N  N     . PRO C  2  536  ? 52.452  -32.258 94.758  1.00 58.11  ? 536  PRO C N     1 
ATOM   7744  C  CA    . PRO C  2  536  ? 51.720  -31.147 94.129  1.00 55.00  ? 536  PRO C CA    1 
ATOM   7745  C  C     . PRO C  2  536  ? 52.642  -30.134 93.471  1.00 54.90  ? 536  PRO C C     1 
ATOM   7746  O  O     . PRO C  2  536  ? 52.267  -29.535 92.451  1.00 50.55  ? 536  PRO C O     1 
ATOM   7747  C  CB    . PRO C  2  536  ? 50.937  -30.534 95.299  1.00 52.73  ? 536  PRO C CB    1 
ATOM   7748  C  CG    . PRO C  2  536  ? 50.816  -31.637 96.298  1.00 59.09  ? 536  PRO C CG    1 
ATOM   7749  C  CD    . PRO C  2  536  ? 52.077  -32.444 96.170  1.00 61.47  ? 536  PRO C CD    1 
ATOM   7750  N  N     . LYS C  2  537  ? 53.856  -29.957 94.006  1.00 51.35  ? 537  LYS C N     1 
ATOM   7751  C  CA    . LYS C  2  537  ? 54.805  -29.006 93.437  1.00 46.00  ? 537  LYS C CA    1 
ATOM   7752  C  C     . LYS C  2  537  ? 54.975  -29.187 91.934  1.00 46.04  ? 537  LYS C C     1 
ATOM   7753  O  O     . LYS C  2  537  ? 55.220  -28.209 91.220  1.00 48.08  ? 537  LYS C O     1 
ATOM   7754  C  CB    . LYS C  2  537  ? 56.167  -29.142 94.118  1.00 48.18  ? 537  LYS C CB    1 
ATOM   7755  C  CG    . LYS C  2  537  ? 56.133  -29.203 95.631  1.00 59.23  ? 537  LYS C CG    1 
ATOM   7756  C  CD    . LYS C  2  537  ? 57.552  -29.290 96.180  1.00 59.21  ? 537  LYS C CD    1 
ATOM   7757  C  CE    . LYS C  2  537  ? 57.564  -29.462 97.688  1.00 73.12  ? 537  LYS C CE    1 
ATOM   7758  N  NZ    . LYS C  2  537  ? 56.877  -28.338 98.384  1.00 75.67  ? 537  LYS C NZ    1 
ATOM   7759  N  N     . GLN C  2  538  ? 54.839  -30.419 91.432  1.00 49.21  ? 538  GLN C N     1 
ATOM   7760  C  CA    . GLN C  2  538  ? 55.121  -30.694 90.026  1.00 54.70  ? 538  GLN C CA    1 
ATOM   7761  C  C     . GLN C  2  538  ? 54.099  -30.085 89.075  1.00 53.60  ? 538  GLN C C     1 
ATOM   7762  O  O     . GLN C  2  538  ? 54.358  -30.047 87.867  1.00 54.27  ? 538  GLN C O     1 
ATOM   7763  C  CB    . GLN C  2  538  ? 55.207  -32.207 89.773  1.00 55.38  ? 538  GLN C CB    1 
ATOM   7764  C  CG    . GLN C  2  538  ? 53.876  -32.952 89.737  1.00 50.32  ? 538  GLN C CG    1 
ATOM   7765  C  CD    . GLN C  2  538  ? 54.052  -34.436 89.453  1.00 52.22  ? 538  GLN C CD    1 
ATOM   7766  O  OE1   . GLN C  2  538  ? 53.351  -35.282 90.010  1.00 53.69  ? 538  GLN C OE1   1 
ATOM   7767  N  NE2   . GLN C  2  538  ? 54.993  -34.757 88.577  1.00 59.00  ? 538  GLN C NE2   1 
ATOM   7768  N  N     . VAL C  2  539  ? 52.960  -29.603 89.578  1.00 48.56  ? 539  VAL C N     1 
ATOM   7769  C  CA    . VAL C  2  539  ? 51.940  -29.070 88.680  1.00 43.33  ? 539  VAL C CA    1 
ATOM   7770  C  C     . VAL C  2  539  ? 52.192  -27.609 88.318  1.00 41.86  ? 539  VAL C C     1 
ATOM   7771  O  O     . VAL C  2  539  ? 51.705  -27.143 87.280  1.00 41.31  ? 539  VAL C O     1 
ATOM   7772  C  CB    . VAL C  2  539  ? 50.554  -29.260 89.320  1.00 42.24  ? 539  VAL C CB    1 
ATOM   7773  C  CG1   . VAL C  2  539  ? 49.448  -28.810 88.383  1.00 46.71  ? 539  VAL C CG1   1 
ATOM   7774  C  CG2   . VAL C  2  539  ? 50.360  -30.716 89.703  1.00 45.92  ? 539  VAL C CG2   1 
ATOM   7775  N  N     . PHE C  2  540  ? 52.968  -26.884 89.118  1.00 40.56  ? 540  PHE C N     1 
ATOM   7776  C  CA    . PHE C  2  540  ? 53.122  -25.444 88.974  1.00 39.29  ? 540  PHE C CA    1 
ATOM   7777  C  C     . PHE C  2  540  ? 54.580  -25.077 88.732  1.00 42.17  ? 540  PHE C C     1 
ATOM   7778  O  O     . PHE C  2  540  ? 55.490  -25.894 88.894  1.00 44.39  ? 540  PHE C O     1 
ATOM   7779  C  CB    . PHE C  2  540  ? 52.591  -24.718 90.217  1.00 40.93  ? 540  PHE C CB    1 
ATOM   7780  C  CG    . PHE C  2  540  ? 51.181  -25.085 90.568  1.00 41.39  ? 540  PHE C CG    1 
ATOM   7781  C  CD1   . PHE C  2  540  ? 50.115  -24.484 89.922  1.00 42.67  ? 540  PHE C CD1   1 
ATOM   7782  C  CD2   . PHE C  2  540  ? 50.921  -26.044 91.530  1.00 42.47  ? 540  PHE C CD2   1 
ATOM   7783  C  CE1   . PHE C  2  540  ? 48.818  -24.828 90.235  1.00 43.13  ? 540  PHE C CE1   1 
ATOM   7784  C  CE2   . PHE C  2  540  ? 49.626  -26.392 91.847  1.00 42.58  ? 540  PHE C CE2   1 
ATOM   7785  C  CZ    . PHE C  2  540  ? 48.573  -25.782 91.200  1.00 44.99  ? 540  PHE C CZ    1 
ATOM   7786  N  N     . SER C  2  541  ? 54.789  -23.819 88.342  1.00 41.72  ? 541  SER C N     1 
ATOM   7787  C  CA    . SER C  2  541  ? 56.122  -23.302 88.066  1.00 39.86  ? 541  SER C CA    1 
ATOM   7788  C  C     . SER C  2  541  ? 56.879  -23.057 89.370  1.00 41.77  ? 541  SER C C     1 
ATOM   7789  O  O     . SER C  2  541  ? 56.416  -23.379 90.468  1.00 45.12  ? 541  SER C O     1 
ATOM   7790  C  CB    . SER C  2  541  ? 56.040  -22.018 87.245  1.00 39.80  ? 541  SER C CB    1 
ATOM   7791  O  OG    . SER C  2  541  ? 55.423  -20.980 87.984  1.00 39.18  ? 541  SER C OG    1 
ATOM   7792  N  N     . VAL C  2  542  ? 58.071  -22.476 89.238  1.00 43.38  ? 542  VAL C N     1 
ATOM   7793  C  CA    . VAL C  2  542  ? 58.895  -22.198 90.410  1.00 42.82  ? 542  VAL C CA    1 
ATOM   7794  C  C     . VAL C  2  542  ? 58.328  -21.019 91.192  1.00 45.73  ? 542  VAL C C     1 
ATOM   7795  O  O     . VAL C  2  542  ? 58.203  -21.069 92.421  1.00 44.98  ? 542  VAL C O     1 
ATOM   7796  C  CB    . VAL C  2  542  ? 60.355  -21.956 89.988  1.00 45.14  ? 542  VAL C CB    1 
ATOM   7797  C  CG1   . VAL C  2  542  ? 61.172  -21.443 91.161  1.00 45.24  ? 542  VAL C CG1   1 
ATOM   7798  C  CG2   . VAL C  2  542  ? 60.957  -23.240 89.437  1.00 44.87  ? 542  VAL C CG2   1 
ATOM   7799  N  N     . ASN C  2  543  ? 57.967  -19.942 90.492  1.00 45.11  ? 543  ASN C N     1 
ATOM   7800  C  CA    . ASN C  2  543  ? 57.402  -18.784 91.178  1.00 44.92  ? 543  ASN C CA    1 
ATOM   7801  C  C     . ASN C  2  543  ? 56.064  -19.124 91.815  1.00 41.54  ? 543  ASN C C     1 
ATOM   7802  O  O     . ASN C  2  543  ? 55.787  -18.715 92.947  1.00 42.47  ? 543  ASN C O     1 
ATOM   7803  C  CB    . ASN C  2  543  ? 57.255  -17.622 90.203  1.00 43.49  ? 543  ASN C CB    1 
ATOM   7804  C  CG    . ASN C  2  543  ? 58.539  -17.320 89.485  1.00 49.08  ? 543  ASN C CG    1 
ATOM   7805  O  OD1   . ASN C  2  543  ? 59.058  -18.158 88.745  1.00 49.23  ? 543  ASN C OD1   1 
ATOM   7806  N  ND2   . ASN C  2  543  ? 59.070  -16.123 89.702  1.00 45.97  ? 543  ASN C ND2   1 
ATOM   7807  N  N     . THR C  2  544  ? 55.223  -19.879 91.103  1.00 40.70  ? 544  THR C N     1 
ATOM   7808  C  CA    . THR C  2  544  ? 53.944  -20.298 91.664  1.00 39.32  ? 544  THR C CA    1 
ATOM   7809  C  C     . THR C  2  544  ? 54.139  -21.172 92.898  1.00 45.51  ? 544  THR C C     1 
ATOM   7810  O  O     . THR C  2  544  ? 53.299  -21.158 93.806  1.00 51.72  ? 544  THR C O     1 
ATOM   7811  C  CB    . THR C  2  544  ? 53.122  -21.035 90.604  1.00 41.13  ? 544  THR C CB    1 
ATOM   7812  O  OG1   . THR C  2  544  ? 53.113  -20.275 89.388  1.00 41.85  ? 544  THR C OG1   1 
ATOM   7813  C  CG2   . THR C  2  544  ? 51.691  -21.227 91.071  1.00 37.96  ? 544  THR C CG2   1 
ATOM   7814  N  N     . ASN C  2  545  ? 55.247  -21.916 92.964  1.00 44.24  ? 545  ASN C N     1 
ATOM   7815  C  CA    . ASN C  2  545  ? 55.542  -22.737 94.134  1.00 48.25  ? 545  ASN C CA    1 
ATOM   7816  C  C     . ASN C  2  545  ? 56.014  -21.923 95.331  1.00 48.34  ? 545  ASN C C     1 
ATOM   7817  O  O     . ASN C  2  545  ? 56.171  -22.492 96.417  1.00 47.52  ? 545  ASN C O     1 
ATOM   7818  C  CB    . ASN C  2  545  ? 56.601  -23.786 93.798  1.00 43.21  ? 545  ASN C CB    1 
ATOM   7819  C  CG    . ASN C  2  545  ? 56.001  -25.130 93.458  1.00 47.66  ? 545  ASN C CG    1 
ATOM   7820  O  OD1   . ASN C  2  545  ? 55.684  -25.921 94.346  1.00 58.19  ? 545  ASN C OD1   1 
ATOM   7821  N  ND2   . ASN C  2  545  ? 55.845  -25.400 92.167  1.00 42.61  ? 545  ASN C ND2   1 
ATOM   7822  N  N     . LEU C  2  546  ? 56.257  -20.627 95.164  1.00 47.63  ? 546  LEU C N     1 
ATOM   7823  C  CA    . LEU C  2  546  ? 56.702  -19.771 96.251  1.00 44.59  ? 546  LEU C CA    1 
ATOM   7824  C  C     . LEU C  2  546  ? 55.546  -19.073 96.955  1.00 49.61  ? 546  LEU C C     1 
ATOM   7825  O  O     . LEU C  2  546  ? 55.787  -18.202 97.799  1.00 52.30  ? 546  LEU C O     1 
ATOM   7826  C  CB    . LEU C  2  546  ? 57.701  -18.737 95.725  1.00 40.73  ? 546  LEU C CB    1 
ATOM   7827  C  CG    . LEU C  2  546  ? 58.996  -19.325 95.166  1.00 38.64  ? 546  LEU C CG    1 
ATOM   7828  C  CD1   . LEU C  2  546  ? 59.945  -18.232 94.730  1.00 39.13  ? 546  LEU C CD1   1 
ATOM   7829  C  CD2   . LEU C  2  546  ? 59.654  -20.211 96.203  1.00 44.59  ? 546  LEU C CD2   1 
ATOM   7830  N  N     . ILE C  2  547  ? 54.307  -19.443 96.641  1.00 45.81  ? 547  ILE C N     1 
ATOM   7831  C  CA    . ILE C  2  547  ? 53.121  -18.805 97.204  1.00 51.19  ? 547  ILE C CA    1 
ATOM   7832  C  C     . ILE C  2  547  ? 52.564  -19.718 98.297  1.00 53.21  ? 547  ILE C C     1 
ATOM   7833  O  O     . ILE C  2  547  ? 51.929  -20.733 97.970  1.00 55.71  ? 547  ILE C O     1 
ATOM   7834  C  CB    . ILE C  2  547  ? 52.059  -18.541 96.132  1.00 45.45  ? 547  ILE C CB    1 
ATOM   7835  C  CG1   . ILE C  2  547  ? 52.620  -17.681 95.005  1.00 39.80  ? 547  ILE C CG1   1 
ATOM   7836  C  CG2   . ILE C  2  547  ? 50.832  -17.891 96.759  1.00 50.93  ? 547  ILE C CG2   1 
ATOM   7837  C  CD1   . ILE C  2  547  ? 51.603  -17.402 93.917  1.00 38.43  ? 547  ILE C CD1   1 
ATOM   7838  N  N     . PRO C  2  548  ? 52.738  -19.391 99.573  1.00 48.58  ? 548  PRO C N     1 
ATOM   7839  C  CA    . PRO C  2  548  ? 52.093  -20.191 100.617 1.00 48.87  ? 548  PRO C CA    1 
ATOM   7840  C  C     . PRO C  2  548  ? 50.582  -20.058 100.533 1.00 50.39  ? 548  PRO C C     1 
ATOM   7841  O  O     . PRO C  2  548  ? 50.052  -19.064 100.033 1.00 51.36  ? 548  PRO C O     1 
ATOM   7842  C  CB    . PRO C  2  548  ? 52.638  -19.592 101.917 1.00 47.14  ? 548  PRO C CB    1 
ATOM   7843  C  CG    . PRO C  2  548  ? 53.014  -18.198 101.553 1.00 48.94  ? 548  PRO C CG    1 
ATOM   7844  C  CD    . PRO C  2  548  ? 53.471  -18.241 100.125 1.00 48.46  ? 548  PRO C CD    1 
ATOM   7845  N  N     . PHE C  2  549  ? 49.890  -21.096 101.011 1.00 52.47  ? 549  PHE C N     1 
ATOM   7846  C  CA    . PHE C  2  549  ? 48.424  -21.134 101.033 1.00 49.92  ? 549  PHE C CA    1 
ATOM   7847  C  C     . PHE C  2  549  ? 47.832  -20.910 99.643  1.00 46.15  ? 549  PHE C C     1 
ATOM   7848  O  O     . PHE C  2  549  ? 46.758  -20.321 99.493  1.00 43.62  ? 549  PHE C O     1 
ATOM   7849  C  CB    . PHE C  2  549  ? 47.866  -20.117 102.029 1.00 49.57  ? 549  PHE C CB    1 
ATOM   7850  C  CG    . PHE C  2  549  ? 48.409  -20.279 103.420 1.00 49.22  ? 549  PHE C CG    1 
ATOM   7851  C  CD1   . PHE C  2  549  ? 47.965  -21.310 104.234 1.00 46.89  ? 549  PHE C CD1   1 
ATOM   7852  C  CD2   . PHE C  2  549  ? 49.362  -19.402 103.913 1.00 45.56  ? 549  PHE C CD2   1 
ATOM   7853  C  CE1   . PHE C  2  549  ? 48.459  -21.466 105.511 1.00 43.41  ? 549  PHE C CE1   1 
ATOM   7854  C  CE2   . PHE C  2  549  ? 49.857  -19.551 105.193 1.00 46.69  ? 549  PHE C CE2   1 
ATOM   7855  C  CZ    . PHE C  2  549  ? 49.405  -20.586 105.992 1.00 46.73  ? 549  PHE C CZ    1 
ATOM   7856  N  N     . LEU C  2  550  ? 48.535  -21.401 98.620  1.00 46.72  ? 550  LEU C N     1 
ATOM   7857  C  CA    . LEU C  2  550  ? 48.105  -21.201 97.241  1.00 43.54  ? 550  LEU C CA    1 
ATOM   7858  C  C     . LEU C  2  550  ? 46.729  -21.803 96.978  1.00 46.49  ? 550  LEU C C     1 
ATOM   7859  O  O     . LEU C  2  550  ? 45.995  -21.308 96.116  1.00 47.35  ? 550  LEU C O     1 
ATOM   7860  C  CB    . LEU C  2  550  ? 49.140  -21.798 96.292  1.00 45.13  ? 550  LEU C CB    1 
ATOM   7861  C  CG    . LEU C  2  550  ? 48.771  -21.835 94.812  1.00 47.06  ? 550  LEU C CG    1 
ATOM   7862  C  CD1   . LEU C  2  550  ? 48.714  -20.426 94.250  1.00 46.69  ? 550  LEU C CD1   1 
ATOM   7863  C  CD2   . LEU C  2  550  ? 49.752  -22.698 94.042  1.00 49.11  ? 550  LEU C CD2   1 
ATOM   7864  N  N     . GLU C  2  551  ? 46.353  -22.859 97.709  1.00 48.59  ? 551  GLU C N     1 
ATOM   7865  C  CA    . GLU C  2  551  ? 45.036  -23.463 97.524  1.00 48.61  ? 551  GLU C CA    1 
ATOM   7866  C  C     . GLU C  2  551  ? 43.900  -22.540 97.951  1.00 50.32  ? 551  GLU C C     1 
ATOM   7867  O  O     . GLU C  2  551  ? 42.743  -22.812 97.613  1.00 47.37  ? 551  GLU C O     1 
ATOM   7868  C  CB    . GLU C  2  551  ? 44.940  -24.790 98.286  1.00 43.50  ? 551  GLU C CB    1 
ATOM   7869  C  CG    . GLU C  2  551  ? 45.162  -24.693 99.792  1.00 50.40  ? 551  GLU C CG    1 
ATOM   7870  C  CD    . GLU C  2  551  ? 46.631  -24.752 100.182 1.00 51.59  ? 551  GLU C CD    1 
ATOM   7871  O  OE1   . GLU C  2  551  ? 46.934  -25.130 101.334 1.00 57.08  ? 551  GLU C OE1   1 
ATOM   7872  O  OE2   . GLU C  2  551  ? 47.484  -24.423 99.336  1.00 46.83  ? 551  GLU C OE2   1 
ATOM   7873  N  N     . HIS C  2  552  ? 44.203  -21.460 98.669  1.00 48.29  ? 552  HIS C N     1 
ATOM   7874  C  CA    . HIS C  2  552  ? 43.208  -20.498 99.113  1.00 48.66  ? 552  HIS C CA    1 
ATOM   7875  C  C     . HIS C  2  552  ? 43.214  -19.224 98.278  1.00 51.71  ? 552  HIS C C     1 
ATOM   7876  O  O     . HIS C  2  552  ? 42.569  -18.243 98.662  1.00 55.47  ? 552  HIS C O     1 
ATOM   7877  C  CB    . HIS C  2  552  ? 43.429  -20.160 100.592 1.00 48.79  ? 552  HIS C CB    1 
ATOM   7878  C  CG    . HIS C  2  552  ? 43.473  -21.360 101.490 1.00 52.01  ? 552  HIS C CG    1 
ATOM   7879  N  ND1   . HIS C  2  552  ? 42.337  -21.941 102.014 1.00 48.76  ? 552  HIS C ND1   1 
ATOM   7880  C  CD2   . HIS C  2  552  ? 44.516  -22.087 101.956 1.00 48.82  ? 552  HIS C CD2   1 
ATOM   7881  C  CE1   . HIS C  2  552  ? 42.680  -22.974 102.762 1.00 52.63  ? 552  HIS C CE1   1 
ATOM   7882  N  NE2   . HIS C  2  552  ? 43.996  -23.084 102.745 1.00 49.77  ? 552  HIS C NE2   1 
ATOM   7883  N  N     . ASP C  2  553  ? 43.929  -19.213 97.153  1.00 46.56  ? 553  ASP C N     1 
ATOM   7884  C  CA    . ASP C  2  553  ? 44.021  -18.053 96.274  1.00 44.63  ? 553  ASP C CA    1 
ATOM   7885  C  C     . ASP C  2  553  ? 43.420  -18.381 94.916  1.00 48.48  ? 553  ASP C C     1 
ATOM   7886  O  O     . ASP C  2  553  ? 43.766  -19.401 94.312  1.00 52.27  ? 553  ASP C O     1 
ATOM   7887  C  CB    . ASP C  2  553  ? 45.474  -17.607 96.088  1.00 41.53  ? 553  ASP C CB    1 
ATOM   7888  C  CG    . ASP C  2  553  ? 46.059  -16.983 97.334  1.00 46.45  ? 553  ASP C CG    1 
ATOM   7889  O  OD1   . ASP C  2  553  ? 45.280  -16.452 98.153  1.00 51.17  ? 553  ASP C OD1   1 
ATOM   7890  O  OD2   . ASP C  2  553  ? 47.299  -17.014 97.489  1.00 39.95  ? 553  ASP C OD2   1 
ATOM   7891  N  N     . ASP C  2  554  ? 42.539  -17.507 94.431  1.00 46.64  ? 554  ASP C N     1 
ATOM   7892  C  CA    . ASP C  2  554  ? 42.045  -17.627 93.067  1.00 44.94  ? 554  ASP C CA    1 
ATOM   7893  C  C     . ASP C  2  554  ? 43.204  -17.499 92.082  1.00 52.06  ? 554  ASP C C     1 
ATOM   7894  O  O     . ASP C  2  554  ? 44.196  -16.810 92.340  1.00 51.07  ? 554  ASP C O     1 
ATOM   7895  C  CB    . ASP C  2  554  ? 40.984  -16.560 92.789  1.00 50.21  ? 554  ASP C CB    1 
ATOM   7896  C  CG    . ASP C  2  554  ? 40.419  -16.642 91.377  1.00 59.04  ? 554  ASP C CG    1 
ATOM   7897  O  OD1   . ASP C  2  554  ? 39.566  -17.522 91.124  1.00 60.46  ? 554  ASP C OD1   1 
ATOM   7898  O  OD2   . ASP C  2  554  ? 40.825  -15.823 90.522  1.00 58.15  ? 554  ASP C OD2   1 
ATOM   7899  N  N     . ALA C  2  555  ? 43.067  -18.178 90.938  1.00 55.05  ? 555  ALA C N     1 
ATOM   7900  C  CA    . ALA C  2  555  ? 44.185  -18.311 90.008  1.00 46.76  ? 555  ALA C CA    1 
ATOM   7901  C  C     . ALA C  2  555  ? 44.599  -16.967 89.421  1.00 46.21  ? 555  ALA C C     1 
ATOM   7902  O  O     . ALA C  2  555  ? 45.791  -16.725 89.195  1.00 46.00  ? 555  ALA C O     1 
ATOM   7903  C  CB    . ALA C  2  555  ? 43.826  -19.292 88.895  1.00 40.36  ? 555  ALA C CB    1 
ATOM   7904  N  N     . ASN C  2  556  ? 43.634  -16.081 89.161  1.00 45.88  ? 556  ASN C N     1 
ATOM   7905  C  CA    . ASN C  2  556  ? 43.958  -14.811 88.518  1.00 46.33  ? 556  ASN C CA    1 
ATOM   7906  C  C     . ASN C  2  556  ? 44.850  -13.944 89.396  1.00 42.40  ? 556  ASN C C     1 
ATOM   7907  O  O     . ASN C  2  556  ? 45.637  -13.143 88.880  1.00 40.46  ? 556  ASN C O     1 
ATOM   7908  C  CB    . ASN C  2  556  ? 42.680  -14.058 88.155  1.00 45.82  ? 556  ASN C CB    1 
ATOM   7909  C  CG    . ASN C  2  556  ? 41.817  -14.818 87.173  1.00 54.61  ? 556  ASN C CG    1 
ATOM   7910  O  OD1   . ASN C  2  556  ? 41.925  -14.633 85.962  1.00 57.63  ? 556  ASN C OD1   1 
ATOM   7911  N  ND2   . ASN C  2  556  ? 40.954  -15.686 87.691  1.00 61.42  ? 556  ASN C ND2   1 
ATOM   7912  N  N     . ARG C  2  557  ? 44.739  -14.076 90.715  1.00 37.59  ? 557  ARG C N     1 
ATOM   7913  C  CA    . ARG C  2  557  ? 45.583  -13.306 91.616  1.00 39.53  ? 557  ARG C CA    1 
ATOM   7914  C  C     . ARG C  2  557  ? 46.896  -14.015 91.918  1.00 45.85  ? 557  ARG C C     1 
ATOM   7915  O  O     . ARG C  2  557  ? 47.927  -13.354 92.122  1.00 44.56  ? 557  ARG C O     1 
ATOM   7916  C  CB    . ARG C  2  557  ? 44.826  -13.010 92.914  1.00 48.54  ? 557  ARG C CB    1 
ATOM   7917  C  CG    . ARG C  2  557  ? 44.976  -11.575 93.408  1.00 48.57  ? 557  ARG C CG    1 
ATOM   7918  C  CD    . ARG C  2  557  ? 44.308  -10.579 92.470  1.00 43.88  ? 557  ARG C CD    1 
ATOM   7919  N  NE    . ARG C  2  557  ? 44.790  -9.217  92.691  1.00 39.58  ? 557  ARG C NE    1 
ATOM   7920  C  CZ    . ARG C  2  557  ? 44.298  -8.143  92.083  1.00 39.09  ? 557  ARG C CZ    1 
ATOM   7921  N  NH1   . ARG C  2  557  ? 43.298  -8.269  91.217  1.00 35.12  ? 557  ARG C NH1   1 
ATOM   7922  N  NH2   . ARG C  2  557  ? 44.801  -6.943  92.343  1.00 39.16  ? 557  ARG C NH2   1 
ATOM   7923  N  N     . ALA C  2  558  ? 46.882  -15.352 91.937  1.00 46.25  ? 558  ALA C N     1 
ATOM   7924  C  CA    . ALA C  2  558  ? 48.129  -16.104 92.032  1.00 39.17  ? 558  ALA C CA    1 
ATOM   7925  C  C     . ALA C  2  558  ? 49.029  -15.824 90.840  1.00 39.30  ? 558  ALA C C     1 
ATOM   7926  O  O     . ALA C  2  558  ? 50.258  -15.802 90.981  1.00 41.93  ? 558  ALA C O     1 
ATOM   7927  C  CB    . ALA C  2  558  ? 47.836  -17.599 92.136  1.00 37.78  ? 558  ALA C CB    1 
ATOM   7928  N  N     . LEU C  2  559  ? 48.436  -15.619 89.662  1.00 39.78  ? 559  LEU C N     1 
ATOM   7929  C  CA    . LEU C  2  559  ? 49.208  -15.220 88.490  1.00 41.51  ? 559  LEU C CA    1 
ATOM   7930  C  C     . LEU C  2  559  ? 50.014  -13.962 88.776  1.00 41.46  ? 559  LEU C C     1 
ATOM   7931  O  O     . LEU C  2  559  ? 51.208  -13.887 88.466  1.00 46.36  ? 559  LEU C O     1 
ATOM   7932  C  CB    . LEU C  2  559  ? 48.270  -15.004 87.304  1.00 39.26  ? 559  LEU C CB    1 
ATOM   7933  C  CG    . LEU C  2  559  ? 48.821  -14.425 86.002  1.00 40.51  ? 559  LEU C CG    1 
ATOM   7934  C  CD1   . LEU C  2  559  ? 48.022  -15.006 84.861  1.00 37.26  ? 559  LEU C CD1   1 
ATOM   7935  C  CD2   . LEU C  2  559  ? 48.730  -12.901 85.983  1.00 44.36  ? 559  LEU C CD2   1 
ATOM   7936  N  N     . MET C  2  560  ? 49.367  -12.957 89.362  1.00 36.36  ? 560  MET C N     1 
ATOM   7937  C  CA    . MET C  2  560  ? 50.062  -11.712 89.656  1.00 37.51  ? 560  MET C CA    1 
ATOM   7938  C  C     . MET C  2  560  ? 51.097  -11.906 90.750  1.00 40.38  ? 560  MET C C     1 
ATOM   7939  O  O     . MET C  2  560  ? 52.175  -11.312 90.693  1.00 44.11  ? 560  MET C O     1 
ATOM   7940  C  CB    . MET C  2  560  ? 49.057  -10.634 90.045  1.00 45.52  ? 560  MET C CB    1 
ATOM   7941  C  CG    . MET C  2  560  ? 47.892  -10.544 89.083  1.00 49.66  ? 560  MET C CG    1 
ATOM   7942  S  SD    . MET C  2  560  ? 46.791  -9.169  89.426  1.00 46.38  ? 560  MET C SD    1 
ATOM   7943  C  CE    . MET C  2  560  ? 45.526  -9.433  88.181  1.00 51.72  ? 560  MET C CE    1 
ATOM   7944  N  N     . GLY C  2  561  ? 50.794  -12.735 91.750  1.00 37.86  ? 561  GLY C N     1 
ATOM   7945  C  CA    . GLY C  2  561  ? 51.793  -13.030 92.772  1.00 38.64  ? 561  GLY C CA    1 
ATOM   7946  C  C     . GLY C  2  561  ? 53.067  -13.604 92.177  1.00 39.98  ? 561  GLY C C     1 
ATOM   7947  O  O     . GLY C  2  561  ? 54.177  -13.119 92.445  1.00 42.47  ? 561  GLY C O     1 
ATOM   7948  N  N     . SER C  2  562  ? 52.920  -14.640 91.346  1.00 37.61  ? 562  SER C N     1 
ATOM   7949  C  CA    . SER C  2  562  ? 54.052  -15.191 90.608  1.00 39.98  ? 562  SER C CA    1 
ATOM   7950  C  C     . SER C  2  562  ? 54.777  -14.102 89.830  1.00 42.77  ? 562  SER C C     1 
ATOM   7951  O  O     . SER C  2  562  ? 55.947  -13.803 90.093  1.00 44.82  ? 562  SER C O     1 
ATOM   7952  C  CB    . SER C  2  562  ? 53.584  -16.293 89.652  1.00 40.24  ? 562  SER C CB    1 
ATOM   7953  O  OG    . SER C  2  562  ? 53.192  -17.458 90.347  1.00 42.30  ? 562  SER C OG    1 
ATOM   7954  N  N     . ASN C  2  563  ? 54.076  -13.473 88.881  1.00 38.60  ? 563  ASN C N     1 
ATOM   7955  C  CA    . ASN C  2  563  ? 54.721  -12.537 87.967  1.00 41.12  ? 563  ASN C CA    1 
ATOM   7956  C  C     . ASN C  2  563  ? 55.356  -11.356 88.684  1.00 41.14  ? 563  ASN C C     1 
ATOM   7957  O  O     . ASN C  2  563  ? 56.285  -10.749 88.142  1.00 50.09  ? 563  ASN C O     1 
ATOM   7958  C  CB    . ASN C  2  563  ? 53.712  -12.033 86.934  1.00 46.97  ? 563  ASN C CB    1 
ATOM   7959  C  CG    . ASN C  2  563  ? 53.297  -13.109 85.943  1.00 54.29  ? 563  ASN C CG    1 
ATOM   7960  O  OD1   . ASN C  2  563  ? 54.113  -13.933 85.518  1.00 55.14  ? 563  ASN C OD1   1 
ATOM   7961  N  ND2   . ASN C  2  563  ? 52.023  -13.104 85.568  1.00 54.39  ? 563  ASN C ND2   1 
ATOM   7962  N  N     . MET C  2  564  ? 54.892  -11.017 89.882  1.00 36.64  ? 564  MET C N     1 
ATOM   7963  C  CA    . MET C  2  564  ? 55.458  -9.891  90.602  1.00 42.09  ? 564  MET C CA    1 
ATOM   7964  C  C     . MET C  2  564  ? 56.632  -10.280 91.478  1.00 45.94  ? 564  MET C C     1 
ATOM   7965  O  O     . MET C  2  564  ? 57.479  -9.425  91.761  1.00 45.41  ? 564  MET C O     1 
ATOM   7966  C  CB    . MET C  2  564  ? 54.379  -9.209  91.445  1.00 39.11  ? 564  MET C CB    1 
ATOM   7967  C  CG    . MET C  2  564  ? 53.407  -8.433  90.591  1.00 45.39  ? 564  MET C CG    1 
ATOM   7968  S  SD    . MET C  2  564  ? 52.241  -7.466  91.542  1.00 60.65  ? 564  MET C SD    1 
ATOM   7969  C  CE    . MET C  2  564  ? 51.408  -8.756  92.457  1.00 46.97  ? 564  MET C CE    1 
ATOM   7970  N  N     . GLN C  2  565  ? 56.717  -11.542 91.910  1.00 45.62  ? 565  GLN C N     1 
ATOM   7971  C  CA    . GLN C  2  565  ? 57.960  -11.973 92.545  1.00 41.65  ? 565  GLN C CA    1 
ATOM   7972  C  C     . GLN C  2  565  ? 59.152  -11.787 91.607  1.00 44.35  ? 565  GLN C C     1 
ATOM   7973  O  O     . GLN C  2  565  ? 60.270  -11.526 92.062  1.00 45.48  ? 565  GLN C O     1 
ATOM   7974  C  CB    . GLN C  2  565  ? 57.850  -13.425 93.002  1.00 38.88  ? 565  GLN C CB    1 
ATOM   7975  C  CG    . GLN C  2  565  ? 56.983  -13.611 94.224  1.00 40.33  ? 565  GLN C CG    1 
ATOM   7976  C  CD    . GLN C  2  565  ? 57.106  -15.000 94.802  1.00 46.44  ? 565  GLN C CD    1 
ATOM   7977  O  OE1   . GLN C  2  565  ? 56.474  -15.943 94.321  1.00 46.24  ? 565  GLN C OE1   1 
ATOM   7978  N  NE2   . GLN C  2  565  ? 57.930  -15.139 95.837  1.00 42.13  ? 565  GLN C NE2   1 
ATOM   7979  N  N     . THR C  2  566  ? 58.927  -11.893 90.296  1.00 44.65  ? 566  THR C N     1 
ATOM   7980  C  CA    . THR C  2  566  ? 59.963  -11.588 89.317  1.00 41.28  ? 566  THR C CA    1 
ATOM   7981  C  C     . THR C  2  566  ? 60.425  -10.139 89.404  1.00 41.80  ? 566  THR C C     1 
ATOM   7982  O  O     . THR C  2  566  ? 61.541  -9.824  88.978  1.00 43.34  ? 566  THR C O     1 
ATOM   7983  C  CB    . THR C  2  566  ? 59.433  -11.888 87.911  1.00 42.23  ? 566  THR C CB    1 
ATOM   7984  O  OG1   . THR C  2  566  ? 58.932  -13.229 87.869  1.00 41.75  ? 566  THR C OG1   1 
ATOM   7985  C  CG2   . THR C  2  566  ? 60.519  -11.727 86.858  1.00 51.79  ? 566  THR C CG2   1 
ATOM   7986  N  N     . GLN C  2  567  ? 59.599  -9.257  89.959  1.00 40.68  ? 567  GLN C N     1 
ATOM   7987  C  CA    . GLN C  2  567  ? 59.853  -7.826  89.944  1.00 37.10  ? 567  GLN C CA    1 
ATOM   7988  C  C     . GLN C  2  567  ? 60.357  -7.296  91.278  1.00 34.90  ? 567  GLN C C     1 
ATOM   7989  O  O     . GLN C  2  567  ? 60.582  -6.089  91.400  1.00 36.24  ? 567  GLN C O     1 
ATOM   7990  C  CB    . GLN C  2  567  ? 58.578  -7.085  89.541  1.00 38.30  ? 567  GLN C CB    1 
ATOM   7991  C  CG    . GLN C  2  567  ? 57.973  -7.621  88.258  1.00 44.91  ? 567  GLN C CG    1 
ATOM   7992  C  CD    . GLN C  2  567  ? 56.568  -7.129  88.028  1.00 47.61  ? 567  GLN C CD    1 
ATOM   7993  O  OE1   . GLN C  2  567  ? 56.148  -6.128  88.605  1.00 50.56  ? 567  GLN C OE1   1 
ATOM   7994  N  NE2   . GLN C  2  567  ? 55.826  -7.837  87.184  1.00 54.54  ? 567  GLN C NE2   1 
ATOM   7995  N  N     . ALA C  2  568  ? 60.546  -8.160  92.269  1.00 34.97  ? 568  ALA C N     1 
ATOM   7996  C  CA    . ALA C  2  568  ? 61.011  -7.708  93.569  1.00 36.42  ? 568  ALA C CA    1 
ATOM   7997  C  C     . ALA C  2  568  ? 62.425  -7.148  93.468  1.00 44.26  ? 568  ALA C C     1 
ATOM   7998  O  O     . ALA C  2  568  ? 63.265  -7.658  92.722  1.00 51.00  ? 568  ALA C O     1 
ATOM   7999  C  CB    . ALA C  2  568  ? 60.965  -8.850  94.584  1.00 35.13  ? 568  ALA C CB    1 
ATOM   8000  N  N     . VAL C  2  569  ? 62.678  -6.086  94.217  1.00 43.16  ? 569  VAL C N     1 
ATOM   8001  C  CA    . VAL C  2  569  ? 63.985  -5.433  94.260  1.00 39.46  ? 569  VAL C CA    1 
ATOM   8002  C  C     . VAL C  2  569  ? 64.757  -5.983  95.454  1.00 49.15  ? 569  VAL C C     1 
ATOM   8003  O  O     . VAL C  2  569  ? 64.199  -6.040  96.561  1.00 53.23  ? 569  VAL C O     1 
ATOM   8004  C  CB    . VAL C  2  569  ? 63.848  -3.903  94.360  1.00 35.51  ? 569  VAL C CB    1 
ATOM   8005  C  CG1   . VAL C  2  569  ? 65.196  -3.274  94.591  1.00 41.48  ? 569  VAL C CG1   1 
ATOM   8006  C  CG2   . VAL C  2  569  ? 63.228  -3.350  93.096  1.00 39.72  ? 569  VAL C CG2   1 
ATOM   8007  N  N     . PRO C  2  570  ? 66.009  -6.404  95.279  1.00 50.97  ? 570  PRO C N     1 
ATOM   8008  C  CA    . PRO C  2  570  ? 66.827  -6.825  96.429  1.00 50.36  ? 570  PRO C CA    1 
ATOM   8009  C  C     . PRO C  2  570  ? 67.092  -5.668  97.380  1.00 55.56  ? 570  PRO C C     1 
ATOM   8010  O  O     . PRO C  2  570  ? 67.647  -4.636  96.993  1.00 50.23  ? 570  PRO C O     1 
ATOM   8011  C  CB    . PRO C  2  570  ? 68.117  -7.328  95.772  1.00 45.02  ? 570  PRO C CB    1 
ATOM   8012  C  CG    . PRO C  2  570  ? 67.701  -7.722  94.388  1.00 50.19  ? 570  PRO C CG    1 
ATOM   8013  C  CD    . PRO C  2  570  ? 66.644  -6.735  93.993  1.00 50.46  ? 570  PRO C CD    1 
ATOM   8014  N  N     . LEU C  2  571  ? 66.709  -5.863  98.639  1.00 53.07  ? 571  LEU C N     1 
ATOM   8015  C  CA    . LEU C  2  571  ? 66.786  -4.836  99.667  1.00 49.59  ? 571  LEU C CA    1 
ATOM   8016  C  C     . LEU C  2  571  ? 68.029  -5.046  100.524 1.00 51.21  ? 571  LEU C C     1 
ATOM   8017  O  O     . LEU C  2  571  ? 68.531  -6.165  100.651 1.00 56.25  ? 571  LEU C O     1 
ATOM   8018  C  CB    . LEU C  2  571  ? 65.528  -4.863  100.536 1.00 49.27  ? 571  LEU C CB    1 
ATOM   8019  C  CG    . LEU C  2  571  ? 64.242  -5.041  99.721  1.00 46.80  ? 571  LEU C CG    1 
ATOM   8020  C  CD1   . LEU C  2  571  ? 63.056  -5.355  100.607 1.00 42.73  ? 571  LEU C CD1   1 
ATOM   8021  C  CD2   . LEU C  2  571  ? 63.972  -3.802  98.889  1.00 47.78  ? 571  LEU C CD2   1 
ATOM   8022  N  N     . ILE C  2  572  ? 68.532  -3.951  101.106 1.00 45.98  ? 572  ILE C N     1 
ATOM   8023  C  CA    . ILE C  2  572  ? 69.780  -4.041  101.859 1.00 41.27  ? 572  ILE C CA    1 
ATOM   8024  C  C     . ILE C  2  572  ? 69.587  -4.830  103.147 1.00 46.52  ? 572  ILE C C     1 
ATOM   8025  O  O     . ILE C  2  572  ? 70.545  -5.402  103.679 1.00 49.77  ? 572  ILE C O     1 
ATOM   8026  C  CB    . ILE C  2  572  ? 70.358  -2.642  102.141 1.00 39.47  ? 572  ILE C CB    1 
ATOM   8027  C  CG1   . ILE C  2  572  ? 69.472  -1.870  103.115 1.00 48.23  ? 572  ILE C CG1   1 
ATOM   8028  C  CG2   . ILE C  2  572  ? 70.532  -1.860  100.851 1.00 41.62  ? 572  ILE C CG2   1 
ATOM   8029  C  CD1   . ILE C  2  572  ? 70.023  -0.511  103.489 1.00 47.75  ? 572  ILE C CD1   1 
ATOM   8030  N  N     . ARG C  2  573  ? 68.363  -4.875  103.675 1.00 46.93  ? 573  ARG C N     1 
ATOM   8031  C  CA    . ARG C  2  573  ? 68.051  -5.664  104.860 1.00 46.55  ? 573  ARG C CA    1 
ATOM   8032  C  C     . ARG C  2  573  ? 67.049  -6.774  104.562 1.00 53.89  ? 573  ARG C C     1 
ATOM   8033  O  O     . ARG C  2  573  ? 66.337  -7.220  105.469 1.00 59.86  ? 573  ARG C O     1 
ATOM   8034  C  CB    . ARG C  2  573  ? 67.525  -4.765  105.979 1.00 46.68  ? 573  ARG C CB    1 
ATOM   8035  C  CG    . ARG C  2  573  ? 68.430  -3.604  106.334 1.00 51.92  ? 573  ARG C CG    1 
ATOM   8036  C  CD    . ARG C  2  573  ? 68.081  -3.044  107.701 1.00 56.87  ? 573  ARG C CD    1 
ATOM   8037  N  NE    . ARG C  2  573  ? 68.347  -4.009  108.763 1.00 55.82  ? 573  ARG C NE    1 
ATOM   8038  C  CZ    . ARG C  2  573  ? 68.061  -3.803  110.044 1.00 69.78  ? 573  ARG C CZ    1 
ATOM   8039  N  NH1   . ARG C  2  573  ? 67.496  -2.665  110.423 1.00 67.68  ? 573  ARG C NH1   1 
ATOM   8040  N  NH2   . ARG C  2  573  ? 68.335  -4.735  110.948 1.00 90.38  ? 573  ARG C NH2   1 
ATOM   8041  N  N     . ALA C  2  574  ? 66.981  -7.221  103.307 1.00 46.48  ? 574  ALA C N     1 
ATOM   8042  C  CA    . ALA C  2  574  ? 65.982  -8.196  102.889 1.00 51.54  ? 574  ALA C CA    1 
ATOM   8043  C  C     . ALA C  2  574  ? 66.045  -9.454  103.747 1.00 50.28  ? 574  ALA C C     1 
ATOM   8044  O  O     . ALA C  2  574  ? 67.113  -9.874  104.200 1.00 52.43  ? 574  ALA C O     1 
ATOM   8045  C  CB    . ALA C  2  574  ? 66.179  -8.560  101.415 1.00 49.70  ? 574  ALA C CB    1 
ATOM   8046  N  N     . GLN C  2  575  ? 64.877  -10.054 103.972 1.00 48.57  ? 575  GLN C N     1 
ATOM   8047  C  CA    . GLN C  2  575  ? 64.771  -11.249 104.794 1.00 51.32  ? 575  GLN C CA    1 
ATOM   8048  C  C     . GLN C  2  575  ? 63.752  -12.204 104.193 1.00 49.64  ? 575  GLN C C     1 
ATOM   8049  O  O     . GLN C  2  575  ? 62.850  -11.798 103.455 1.00 47.34  ? 575  GLN C O     1 
ATOM   8050  C  CB    . GLN C  2  575  ? 64.387  -10.906 106.237 1.00 50.49  ? 575  GLN C CB    1 
ATOM   8051  C  CG    . GLN C  2  575  ? 63.363  -9.802  106.361 1.00 47.36  ? 575  GLN C CG    1 
ATOM   8052  C  CD    . GLN C  2  575  ? 63.130  -9.407  107.802 1.00 47.97  ? 575  GLN C CD    1 
ATOM   8053  O  OE1   . GLN C  2  575  ? 63.665  -10.032 108.720 1.00 49.05  ? 575  GLN C OE1   1 
ATOM   8054  N  NE2   . GLN C  2  575  ? 62.330  -8.366  108.011 1.00 47.37  ? 575  GLN C NE2   1 
ATOM   8055  N  N     . ALA C  2  576  ? 63.924  -13.485 104.504 1.00 50.98  ? 576  ALA C N     1 
ATOM   8056  C  CA    . ALA C  2  576  ? 63.019  -14.506 104.016 1.00 48.48  ? 576  ALA C CA    1 
ATOM   8057  C  C     . ALA C  2  576  ? 61.687  -14.427 104.760 1.00 54.16  ? 576  ALA C C     1 
ATOM   8058  O  O     . ALA C  2  576  ? 61.637  -13.995 105.915 1.00 56.14  ? 576  ALA C O     1 
ATOM   8059  C  CB    . ALA C  2  576  ? 63.636  -15.888 104.194 1.00 51.19  ? 576  ALA C CB    1 
ATOM   8060  N  N     . PRO C  2  577  ? 60.591  -14.840 104.121 1.00 53.91  ? 577  PRO C N     1 
ATOM   8061  C  CA    . PRO C  2  577  ? 59.274  -14.713 104.758 1.00 53.81  ? 577  PRO C CA    1 
ATOM   8062  C  C     . PRO C  2  577  ? 59.136  -15.582 106.000 1.00 53.18  ? 577  PRO C C     1 
ATOM   8063  O  O     . PRO C  2  577  ? 59.805  -16.607 106.153 1.00 54.16  ? 577  PRO C O     1 
ATOM   8064  C  CB    . PRO C  2  577  ? 58.306  -15.163 103.656 1.00 50.67  ? 577  PRO C CB    1 
ATOM   8065  C  CG    . PRO C  2  577  ? 59.130  -15.991 102.734 1.00 47.88  ? 577  PRO C CG    1 
ATOM   8066  C  CD    . PRO C  2  577  ? 60.487  -15.363 102.749 1.00 50.19  ? 577  PRO C CD    1 
ATOM   8067  N  N     . VAL C  2  578  ? 58.244  -15.154 106.899 1.00 51.50  ? 578  VAL C N     1 
ATOM   8068  C  CA    . VAL C  2  578  ? 57.970  -15.937 108.101 1.00 53.22  ? 578  VAL C CA    1 
ATOM   8069  C  C     . VAL C  2  578  ? 57.215  -17.210 107.750 1.00 54.44  ? 578  VAL C C     1 
ATOM   8070  O  O     . VAL C  2  578  ? 57.329  -18.221 108.453 1.00 61.71  ? 578  VAL C O     1 
ATOM   8071  C  CB    . VAL C  2  578  ? 57.196  -15.102 109.139 1.00 49.98  ? 578  VAL C CB    1 
ATOM   8072  C  CG1   . VAL C  2  578  ? 58.039  -13.935 109.629 1.00 51.93  ? 578  VAL C CG1   1 
ATOM   8073  C  CG2   . VAL C  2  578  ? 55.881  -14.612 108.556 1.00 51.52  ? 578  VAL C CG2   1 
ATOM   8074  N  N     . VAL C  2  579  ? 56.432  -17.187 106.677 1.00 48.55  ? 579  VAL C N     1 
ATOM   8075  C  CA    . VAL C  2  579  ? 55.709  -18.358 106.197 1.00 50.99  ? 579  VAL C CA    1 
ATOM   8076  C  C     . VAL C  2  579  ? 56.291  -18.710 104.839 1.00 57.33  ? 579  VAL C C     1 
ATOM   8077  O  O     . VAL C  2  579  ? 56.038  -18.015 103.847 1.00 61.17  ? 579  VAL C O     1 
ATOM   8078  C  CB    . VAL C  2  579  ? 54.198  -18.110 106.104 1.00 51.61  ? 579  VAL C CB    1 
ATOM   8079  C  CG1   . VAL C  2  579  ? 53.476  -19.375 105.661 1.00 46.29  ? 579  VAL C CG1   1 
ATOM   8080  C  CG2   . VAL C  2  579  ? 53.665  -17.624 107.438 1.00 60.32  ? 579  VAL C CG2   1 
ATOM   8081  N  N     . MET C  2  580  ? 57.074  -19.779 104.793 1.00 53.94  ? 580  MET C N     1 
ATOM   8082  C  CA    . MET C  2  580  ? 57.722  -20.222 103.572 1.00 50.96  ? 580  MET C CA    1 
ATOM   8083  C  C     . MET C  2  580  ? 57.003  -21.442 103.015 1.00 54.32  ? 580  MET C C     1 
ATOM   8084  O  O     . MET C  2  580  ? 56.185  -22.076 103.685 1.00 55.59  ? 580  MET C O     1 
ATOM   8085  C  CB    . MET C  2  580  ? 59.195  -20.531 103.836 1.00 51.49  ? 580  MET C CB    1 
ATOM   8086  C  CG    . MET C  2  580  ? 59.989  -19.325 104.281 1.00 52.02  ? 580  MET C CG    1 
ATOM   8087  S  SD    . MET C  2  580  ? 61.651  -19.765 104.806 1.00 57.76  ? 580  MET C SD    1 
ATOM   8088  C  CE    . MET C  2  580  ? 61.276  -20.907 106.131 1.00 50.82  ? 580  MET C CE    1 
ATOM   8089  N  N     . THR C  2  581  ? 57.316  -21.763 101.763 1.00 54.42  ? 581  THR C N     1 
ATOM   8090  C  CA    . THR C  2  581  ? 56.727  -22.913 101.095 1.00 56.28  ? 581  THR C CA    1 
ATOM   8091  C  C     . THR C  2  581  ? 57.654  -24.119 101.066 1.00 64.42  ? 581  THR C C     1 
ATOM   8092  O  O     . THR C  2  581  ? 57.185  -25.233 100.805 1.00 68.48  ? 581  THR C O     1 
ATOM   8093  C  CB    . THR C  2  581  ? 56.328  -22.548 99.660  1.00 56.35  ? 581  THR C CB    1 
ATOM   8094  O  OG1   . THR C  2  581  ? 57.505  -22.359 98.865  1.00 59.60  ? 581  THR C OG1   1 
ATOM   8095  C  CG2   . THR C  2  581  ? 55.521  -21.265 99.645  1.00 55.87  ? 581  THR C CG2   1 
ATOM   8096  N  N     . GLY C  2  582  ? 58.946  -23.927 101.332 1.00 58.62  ? 582  GLY C N     1 
ATOM   8097  C  CA    . GLY C  2  582  ? 59.919  -24.998 101.287 1.00 60.27  ? 582  GLY C CA    1 
ATOM   8098  C  C     . GLY C  2  582  ? 60.825  -24.996 100.075 1.00 68.99  ? 582  GLY C C     1 
ATOM   8099  O  O     . GLY C  2  582  ? 61.723  -25.844 99.995  1.00 77.94  ? 582  GLY C O     1 
ATOM   8100  N  N     . LEU C  2  583  ? 60.625  -24.077 99.134  1.00 61.13  ? 583  LEU C N     1 
ATOM   8101  C  CA    . LEU C  2  583  ? 61.454  -23.983 97.941  1.00 53.94  ? 583  LEU C CA    1 
ATOM   8102  C  C     . LEU C  2  583  ? 62.427  -22.814 97.978  1.00 53.18  ? 583  LEU C C     1 
ATOM   8103  O  O     . LEU C  2  583  ? 63.233  -22.671 97.055  1.00 49.61  ? 583  LEU C O     1 
ATOM   8104  C  CB    . LEU C  2  583  ? 60.572  -23.861 96.698  1.00 54.43  ? 583  LEU C CB    1 
ATOM   8105  C  CG    . LEU C  2  583  ? 60.488  -25.068 95.766  1.00 54.45  ? 583  LEU C CG    1 
ATOM   8106  C  CD1   . LEU C  2  583  ? 59.540  -26.127 96.320  1.00 58.62  ? 583  LEU C CD1   1 
ATOM   8107  C  CD2   . LEU C  2  583  ? 60.076  -24.626 94.365  1.00 47.60  ? 583  LEU C CD2   1 
ATOM   8108  N  N     . GLU C  2  584  ? 62.373  -21.975 99.014  1.00 53.92  ? 584  GLU C N     1 
ATOM   8109  C  CA    . GLU C  2  584  ? 63.143  -20.738 99.008  1.00 52.17  ? 584  GLU C CA    1 
ATOM   8110  C  C     . GLU C  2  584  ? 64.648  -20.976 99.090  1.00 54.32  ? 584  GLU C C     1 
ATOM   8111  O  O     . GLU C  2  584  ? 65.418  -20.111 98.663  1.00 51.82  ? 584  GLU C O     1 
ATOM   8112  C  CB    . GLU C  2  584  ? 62.689  -19.827 100.152 1.00 49.44  ? 584  GLU C CB    1 
ATOM   8113  C  CG    . GLU C  2  584  ? 61.707  -20.466 101.126 1.00 54.67  ? 584  GLU C CG    1 
ATOM   8114  C  CD    . GLU C  2  584  ? 60.254  -20.407 100.654 1.00 64.28  ? 584  GLU C CD    1 
ATOM   8115  O  OE1   . GLU C  2  584  ? 59.808  -19.344 100.165 1.00 61.01  ? 584  GLU C OE1   1 
ATOM   8116  O  OE2   . GLU C  2  584  ? 59.551  -21.432 100.783 1.00 63.66  ? 584  GLU C OE2   1 
ATOM   8117  N  N     . GLU C  2  585  ? 65.083  -22.121 99.627  1.00 57.27  ? 585  GLU C N     1 
ATOM   8118  C  CA    . GLU C  2  585  ? 66.511  -22.427 99.709  1.00 53.74  ? 585  GLU C CA    1 
ATOM   8119  C  C     . GLU C  2  585  ? 67.042  -22.954 98.380  1.00 54.62  ? 585  GLU C C     1 
ATOM   8120  O  O     . GLU C  2  585  ? 68.091  -22.511 97.891  1.00 55.39  ? 585  GLU C O     1 
ATOM   8121  C  CB    . GLU C  2  585  ? 66.764  -23.454 100.816 1.00 55.21  ? 585  GLU C CB    1 
ATOM   8122  C  CG    . GLU C  2  585  ? 67.234  -22.877 102.141 1.00 61.56  ? 585  GLU C CG    1 
ATOM   8123  C  CD    . GLU C  2  585  ? 67.456  -23.950 103.200 1.00 67.20  ? 585  GLU C CD    1 
ATOM   8124  O  OE1   . GLU C  2  585  ? 66.666  -24.920 103.245 1.00 63.20  ? 585  GLU C OE1   1 
ATOM   8125  O  OE2   . GLU C  2  585  ? 68.424  -23.824 103.984 1.00 70.73  ? 585  GLU C OE2   1 
ATOM   8126  N  N     . ARG C  2  586  ? 66.329  -23.915 97.795  1.00 53.43  ? 586  ARG C N     1 
ATOM   8127  C  CA    . ARG C  2  586  ? 66.743  -24.497 96.525  1.00 53.04  ? 586  ARG C CA    1 
ATOM   8128  C  C     . ARG C  2  586  ? 66.787  -23.452 95.414  1.00 55.59  ? 586  ARG C C     1 
ATOM   8129  O  O     . ARG C  2  586  ? 67.609  -23.554 94.496  1.00 57.59  ? 586  ARG C O     1 
ATOM   8130  C  CB    . ARG C  2  586  ? 65.796  -25.646 96.173  1.00 55.99  ? 586  ARG C CB    1 
ATOM   8131  C  CG    . ARG C  2  586  ? 66.098  -26.355 94.880  1.00 57.25  ? 586  ARG C CG    1 
ATOM   8132  C  CD    . ARG C  2  586  ? 67.354  -27.193 94.974  1.00 51.29  ? 586  ARG C CD    1 
ATOM   8133  N  NE    . ARG C  2  586  ? 67.646  -27.796 93.681  1.00 52.57  ? 586  ARG C NE    1 
ATOM   8134  C  CZ    . ARG C  2  586  ? 67.110  -28.933 93.256  1.00 54.02  ? 586  ARG C CZ    1 
ATOM   8135  N  NH1   . ARG C  2  586  ? 66.265  -29.599 94.027  1.00 59.53  ? 586  ARG C NH1   1 
ATOM   8136  N  NH2   . ARG C  2  586  ? 67.424  -29.408 92.060  1.00 62.97  ? 586  ARG C NH2   1 
ATOM   8137  N  N     . VAL C  2  587  ? 65.919  -22.439 95.479  1.00 57.76  ? 587  VAL C N     1 
ATOM   8138  C  CA    . VAL C  2  587  ? 65.951  -21.372 94.482  1.00 52.94  ? 587  VAL C CA    1 
ATOM   8139  C  C     . VAL C  2  587  ? 67.245  -20.572 94.597  1.00 52.29  ? 587  VAL C C     1 
ATOM   8140  O  O     . VAL C  2  587  ? 67.882  -20.248 93.588  1.00 53.16  ? 587  VAL C O     1 
ATOM   8141  C  CB    . VAL C  2  587  ? 64.707  -20.477 94.625  1.00 46.98  ? 587  VAL C CB    1 
ATOM   8142  C  CG1   . VAL C  2  587  ? 64.861  -19.222 93.791  1.00 50.39  ? 587  VAL C CG1   1 
ATOM   8143  C  CG2   . VAL C  2  587  ? 63.462  -21.240 94.207  1.00 45.04  ? 587  VAL C CG2   1 
ATOM   8144  N  N     . VAL C  2  588  ? 67.657  -20.246 95.823  1.00 48.46  ? 588  VAL C N     1 
ATOM   8145  C  CA    . VAL C  2  588  ? 68.937  -19.573 96.023  1.00 50.59  ? 588  VAL C CA    1 
ATOM   8146  C  C     . VAL C  2  588  ? 70.081  -20.462 95.563  1.00 60.08  ? 588  VAL C C     1 
ATOM   8147  O  O     . VAL C  2  588  ? 71.130  -19.971 95.128  1.00 62.82  ? 588  VAL C O     1 
ATOM   8148  C  CB    . VAL C  2  588  ? 69.089  -19.170 97.501  1.00 46.84  ? 588  VAL C CB    1 
ATOM   8149  C  CG1   . VAL C  2  588  ? 70.410  -18.458 97.743  1.00 59.41  ? 588  VAL C CG1   1 
ATOM   8150  C  CG2   . VAL C  2  588  ? 67.946  -18.292 97.906  1.00 49.06  ? 588  VAL C CG2   1 
ATOM   8151  N  N     . ARG C  2  589  ? 69.904  -21.778 95.659  1.00 61.00  ? 589  ARG C N     1 
ATOM   8152  C  CA    . ARG C  2  589  ? 70.962  -22.698 95.248  1.00 57.40  ? 589  ARG C CA    1 
ATOM   8153  C  C     . ARG C  2  589  ? 71.119  -22.736 93.728  1.00 54.57  ? 589  ARG C C     1 
ATOM   8154  O  O     . ARG C  2  589  ? 72.226  -22.564 93.206  1.00 55.51  ? 589  ARG C O     1 
ATOM   8155  C  CB    . ARG C  2  589  ? 70.672  -24.097 95.789  1.00 59.20  ? 589  ARG C CB    1 
ATOM   8156  C  CG    . ARG C  2  589  ? 71.692  -25.158 95.400  1.00 64.63  ? 589  ARG C CG    1 
ATOM   8157  C  CD    . ARG C  2  589  ? 72.806  -25.276 96.431  1.00 72.45  ? 589  ARG C CD    1 
ATOM   8158  N  NE    . ARG C  2  589  ? 72.300  -25.694 97.735  1.00 78.84  ? 589  ARG C NE    1 
ATOM   8159  C  CZ    . ARG C  2  589  ? 73.069  -25.986 98.780  1.00 79.78  ? 589  ARG C CZ    1 
ATOM   8160  N  NH1   . ARG C  2  589  ? 74.390  -25.911 98.678  1.00 72.10  ? 589  ARG C NH1   1 
ATOM   8161  N  NH2   . ARG C  2  589  ? 72.515  -26.355 99.928  1.00 85.74  ? 589  ARG C NH2   1 
ATOM   8162  N  N     . ASP C  2  590  ? 70.024  -22.975 93.001  1.00 53.19  ? 590  ASP C N     1 
ATOM   8163  C  CA    . ASP C  2  590  ? 70.145  -23.370 91.600  1.00 53.91  ? 590  ASP C CA    1 
ATOM   8164  C  C     . ASP C  2  590  ? 70.511  -22.191 90.706  1.00 60.08  ? 590  ASP C C     1 
ATOM   8165  O  O     . ASP C  2  590  ? 71.341  -22.328 89.798  1.00 73.66  ? 590  ASP C O     1 
ATOM   8166  C  CB    . ASP C  2  590  ? 68.859  -24.050 91.135  1.00 51.72  ? 590  ASP C CB    1 
ATOM   8167  C  CG    . ASP C  2  590  ? 68.762  -25.488 91.624  1.00 56.76  ? 590  ASP C CG    1 
ATOM   8168  O  OD1   . ASP C  2  590  ? 69.421  -25.822 92.634  1.00 49.12  ? 590  ASP C OD1   1 
ATOM   8169  O  OD2   . ASP C  2  590  ? 68.052  -26.293 90.986  1.00 59.18  ? 590  ASP C OD2   1 
ATOM   8170  N  N     . SER C  2  591  ? 69.902  -21.033 90.928  1.00 59.68  ? 591  SER C N     1 
ATOM   8171  C  CA    . SER C  2  591  ? 70.505  -19.805 90.434  1.00 62.79  ? 591  SER C CA    1 
ATOM   8172  C  C     . SER C  2  591  ? 71.667  -19.453 91.346  1.00 61.04  ? 591  SER C C     1 
ATOM   8173  O  O     . SER C  2  591  ? 71.565  -19.551 92.570  1.00 64.79  ? 591  SER C O     1 
ATOM   8174  C  CB    . SER C  2  591  ? 69.490  -18.666 90.404  1.00 68.26  ? 591  SER C CB    1 
ATOM   8175  O  OG    . SER C  2  591  ? 69.318  -18.103 91.694  1.00 74.63  ? 591  SER C OG    1 
ATOM   8176  N  N     . LEU C  2  592  ? 72.786  -19.057 90.750  1.00 62.30  ? 592  LEU C N     1 
ATOM   8177  C  CA    . LEU C  2  592  ? 74.018  -18.882 91.515  1.00 67.16  ? 592  LEU C CA    1 
ATOM   8178  C  C     . LEU C  2  592  ? 74.047  -17.465 92.074  1.00 70.77  ? 592  LEU C C     1 
ATOM   8179  O  O     . LEU C  2  592  ? 74.762  -16.580 91.599  1.00 78.69  ? 592  LEU C O     1 
ATOM   8180  C  CB    . LEU C  2  592  ? 75.236  -19.196 90.657  1.00 67.28  ? 592  LEU C CB    1 
ATOM   8181  C  CG    . LEU C  2  592  ? 75.351  -20.675 90.277  1.00 66.14  ? 592  LEU C CG    1 
ATOM   8182  C  CD1   . LEU C  2  592  ? 74.721  -20.931 88.917  1.00 64.55  ? 592  LEU C CD1   1 
ATOM   8183  C  CD2   . LEU C  2  592  ? 76.796  -21.158 90.316  1.00 72.39  ? 592  LEU C CD2   1 
ATOM   8184  N  N     . ALA C  2  593  ? 73.231  -17.255 93.104  1.00 76.16  ? 593  ALA C N     1 
ATOM   8185  C  CA    . ALA C  2  593  ? 73.288  -16.043 93.908  1.00 88.07  ? 593  ALA C CA    1 
ATOM   8186  C  C     . ALA C  2  593  ? 74.260  -16.200 95.074  1.00 89.14  ? 593  ALA C C     1 
ATOM   8187  O  O     . ALA C  2  593  ? 75.177  -15.388 95.237  1.00 82.68  ? 593  ALA C O     1 
ATOM   8188  C  CB    . ALA C  2  593  ? 71.892  -15.685 94.428  1.00 77.87  ? 593  ALA C CB    1 
ATOM   8189  N  N     . ALA C  2  594  ? 74.084  -17.252 95.869  1.00 78.75  ? 594  ALA C N     1 
ATOM   8190  C  CA    . ALA C  2  594  ? 74.870  -17.487 97.069  1.00 65.61  ? 594  ALA C CA    1 
ATOM   8191  C  C     . ALA C  2  594  ? 76.074  -18.374 96.772  1.00 67.59  ? 594  ALA C C     1 
ATOM   8192  O  O     . ALA C  2  594  ? 76.100  -19.132 95.799  1.00 71.01  ? 594  ALA C O     1 
ATOM   8193  C  CB    . ALA C  2  594  ? 74.009  -18.124 98.161  1.00 62.19  ? 594  ALA C CB    1 
ATOM   8194  N  N     . LEU C  2  595  ? 77.074  -18.274 97.642  1.00 66.37  ? 595  LEU C N     1 
ATOM   8195  C  CA    . LEU C  2  595  ? 78.341  -18.978 97.504  1.00 60.00  ? 595  LEU C CA    1 
ATOM   8196  C  C     . LEU C  2  595  ? 78.432  -20.072 98.562  1.00 65.67  ? 595  LEU C C     1 
ATOM   8197  O  O     . LEU C  2  595  ? 78.225  -19.809 99.750  1.00 68.98  ? 595  LEU C O     1 
ATOM   8198  C  CB    . LEU C  2  595  ? 79.502  -17.995 97.648  1.00 55.41  ? 595  LEU C CB    1 
ATOM   8199  C  CG    . LEU C  2  595  ? 80.923  -18.487 97.420  1.00 59.92  ? 595  LEU C CG    1 
ATOM   8200  C  CD1   . LEU C  2  595  ? 81.154  -18.754 95.946  1.00 71.51  ? 595  LEU C CD1   1 
ATOM   8201  C  CD2   . LEU C  2  595  ? 81.891  -17.451 97.943  1.00 62.15  ? 595  LEU C CD2   1 
ATOM   8202  N  N     . TYR C  2  596  ? 78.749  -21.291 98.135  1.00 70.86  ? 596  TYR C N     1 
ATOM   8203  C  CA    . TYR C  2  596  ? 78.800  -22.441 99.028  1.00 71.57  ? 596  TYR C CA    1 
ATOM   8204  C  C     . TYR C  2  596  ? 80.194  -23.060 99.030  1.00 84.55  ? 596  TYR C C     1 
ATOM   8205  O  O     . TYR C  2  596  ? 81.043  -22.757 98.186  1.00 88.28  ? 596  TYR C O     1 
ATOM   8206  C  CB    . TYR C  2  596  ? 77.758  -23.494 98.631  1.00 72.74  ? 596  TYR C CB    1 
ATOM   8207  C  CG    . TYR C  2  596  ? 76.340  -22.975 98.575  1.00 72.53  ? 596  TYR C CG    1 
ATOM   8208  C  CD1   . TYR C  2  596  ? 75.548  -22.930 99.716  1.00 79.16  ? 596  TYR C CD1   1 
ATOM   8209  C  CD2   . TYR C  2  596  ? 75.788  -22.537 97.377  1.00 74.33  ? 596  TYR C CD2   1 
ATOM   8210  C  CE1   . TYR C  2  596  ? 74.246  -22.458 99.668  1.00 77.35  ? 596  TYR C CE1   1 
ATOM   8211  C  CE2   . TYR C  2  596  ? 74.488  -22.063 97.318  1.00 72.89  ? 596  TYR C CE2   1 
ATOM   8212  C  CZ    . TYR C  2  596  ? 73.722  -22.025 98.466  1.00 74.36  ? 596  TYR C CZ    1 
ATOM   8213  O  OH    . TYR C  2  596  ? 72.427  -21.555 98.414  1.00 72.67  ? 596  TYR C OH    1 
ATOM   8214  N  N     . ALA C  2  597  ? 80.416  -23.949 99.999  1.00 86.23  ? 597  ALA C N     1 
ATOM   8215  C  CA    . ALA C  2  597  ? 81.692  -24.634 100.162 1.00 92.47  ? 597  ALA C CA    1 
ATOM   8216  C  C     . ALA C  2  597  ? 81.726  -25.892 99.301  1.00 101.51 ? 597  ALA C C     1 
ATOM   8217  O  O     . ALA C  2  597  ? 80.762  -26.666 99.284  1.00 100.44 ? 597  ALA C O     1 
ATOM   8218  C  CB    . ALA C  2  597  ? 81.929  -24.986 101.631 1.00 82.04  ? 597  ALA C CB    1 
ATOM   8219  N  N     . GLU C  2  598  ? 82.842  -26.096 98.594  1.00 102.12 ? 598  GLU C N     1 
ATOM   8220  C  CA    . GLU C  2  598  ? 82.944  -27.218 97.663  1.00 100.68 ? 598  GLU C CA    1 
ATOM   8221  C  C     . GLU C  2  598  ? 83.114  -28.542 98.400  1.00 106.10 ? 598  GLU C C     1 
ATOM   8222  O  O     . GLU C  2  598  ? 82.472  -29.540 98.055  1.00 109.72 ? 598  GLU C O     1 
ATOM   8223  C  CB    . GLU C  2  598  ? 84.101  -26.989 96.691  1.00 109.31 ? 598  GLU C CB    1 
ATOM   8224  C  CG    . GLU C  2  598  ? 83.878  -25.838 95.720  1.00 110.01 ? 598  GLU C CG    1 
ATOM   8225  C  CD    . GLU C  2  598  ? 85.065  -25.613 94.807  1.00 113.78 ? 598  GLU C CD    1 
ATOM   8226  O  OE1   . GLU C  2  598  ? 85.880  -26.548 94.655  1.00 118.56 ? 598  GLU C OE1   1 
ATOM   8227  O  OE2   . GLU C  2  598  ? 85.188  -24.501 94.247  1.00 113.86 ? 598  GLU C OE2   1 
ATOM   8228  N  N     . GLU C  2  599  ? 83.987  -28.577 99.406  1.00 109.05 ? 599  GLU C N     1 
ATOM   8229  C  CA    . GLU C  2  599  ? 84.216  -29.764 100.221 1.00 109.59 ? 599  GLU C CA    1 
ATOM   8230  C  C     . GLU C  2  599  ? 84.250  -29.356 101.691 1.00 102.74 ? 599  GLU C C     1 
ATOM   8231  O  O     . GLU C  2  599  ? 84.085  -28.182 102.035 1.00 104.95 ? 599  GLU C O     1 
ATOM   8232  C  CB    . GLU C  2  599  ? 85.517  -30.471 99.816  1.00 119.60 ? 599  GLU C CB    1 
ATOM   8233  C  CG    . GLU C  2  599  ? 85.460  -31.995 99.879  1.00 124.13 ? 599  GLU C CG    1 
ATOM   8234  C  CD    . GLU C  2  599  ? 84.669  -32.601 98.730  1.00 125.77 ? 599  GLU C CD    1 
ATOM   8235  O  OE1   . GLU C  2  599  ? 84.654  -32.000 97.633  1.00 122.26 ? 599  GLU C OE1   1 
ATOM   8236  O  OE2   . GLU C  2  599  ? 84.059  -33.676 98.924  1.00 119.19 ? 599  GLU C OE2   1 
ATOM   8237  N  N     . ASP C  2  600  ? 84.460  -30.335 102.568 1.00 100.47 ? 600  ASP C N     1 
ATOM   8238  C  CA    . ASP C  2  600  ? 84.610  -30.028 103.982 1.00 96.33  ? 600  ASP C CA    1 
ATOM   8239  C  C     . ASP C  2  600  ? 85.902  -29.254 104.213 1.00 99.67  ? 600  ASP C C     1 
ATOM   8240  O  O     . ASP C  2  600  ? 86.847  -29.322 103.422 1.00 110.16 ? 600  ASP C O     1 
ATOM   8241  C  CB    . ASP C  2  600  ? 84.614  -31.307 104.823 1.00 101.27 ? 600  ASP C CB    1 
ATOM   8242  C  CG    . ASP C  2  600  ? 83.386  -32.167 104.592 1.00 109.25 ? 600  ASP C CG    1 
ATOM   8243  O  OD1   . ASP C  2  600  ? 83.334  -32.867 103.559 1.00 117.80 ? 600  ASP C OD1   1 
ATOM   8244  O  OD2   . ASP C  2  600  ? 82.473  -32.151 105.445 1.00 109.40 ? 600  ASP C OD2   1 
ATOM   8245  N  N     . GLY C  2  601  ? 85.939  -28.504 105.308 1.00 95.15  ? 601  GLY C N     1 
ATOM   8246  C  CA    . GLY C  2  601  ? 87.141  -27.766 105.634 1.00 100.88 ? 601  GLY C CA    1 
ATOM   8247  C  C     . GLY C  2  601  ? 86.901  -26.770 106.750 1.00 93.94  ? 601  GLY C C     1 
ATOM   8248  O  O     . GLY C  2  601  ? 85.892  -26.826 107.460 1.00 96.86  ? 601  GLY C O     1 
ATOM   8249  N  N     . GLU C  2  602  ? 87.862  -25.862 106.887 1.00 91.20  ? 602  GLU C N     1 
ATOM   8250  C  CA    . GLU C  2  602  ? 87.862  -24.816 107.898 1.00 89.78  ? 602  GLU C CA    1 
ATOM   8251  C  C     . GLU C  2  602  ? 88.126  -23.480 107.221 1.00 88.57  ? 602  GLU C C     1 
ATOM   8252  O  O     . GLU C  2  602  ? 88.942  -23.393 106.299 1.00 89.34  ? 602  GLU C O     1 
ATOM   8253  C  CB    . GLU C  2  602  ? 88.919  -25.087 108.982 1.00 96.46  ? 602  GLU C CB    1 
ATOM   8254  C  CG    . GLU C  2  602  ? 89.058  -23.990 110.033 1.00 101.15 ? 602  GLU C CG    1 
ATOM   8255  C  CD    . GLU C  2  602  ? 90.155  -24.279 111.051 1.00 108.78 ? 602  GLU C CD    1 
ATOM   8256  O  OE1   . GLU C  2  602  ? 89.850  -24.864 112.114 1.00 105.37 ? 602  GLU C OE1   1 
ATOM   8257  O  OE2   . GLU C  2  602  ? 91.323  -23.921 110.786 1.00 111.67 ? 602  GLU C OE2   1 
ATOM   8258  N  N     . VAL C  2  603  ? 87.429  -22.445 107.677 1.00 88.99  ? 603  VAL C N     1 
ATOM   8259  C  CA    . VAL C  2  603  ? 87.541  -21.121 107.078 1.00 88.63  ? 603  VAL C CA    1 
ATOM   8260  C  C     . VAL C  2  603  ? 88.863  -20.494 107.501 1.00 81.69  ? 603  VAL C C     1 
ATOM   8261  O  O     . VAL C  2  603  ? 89.134  -20.333 108.695 1.00 79.26  ? 603  VAL C O     1 
ATOM   8262  C  CB    . VAL C  2  603  ? 86.355  -20.234 107.476 1.00 79.43  ? 603  VAL C CB    1 
ATOM   8263  C  CG1   . VAL C  2  603  ? 86.548  -18.835 106.935 1.00 81.20  ? 603  VAL C CG1   1 
ATOM   8264  C  CG2   . VAL C  2  603  ? 85.057  -20.832 106.959 1.00 73.60  ? 603  VAL C CG2   1 
ATOM   8265  N  N     . ALA C  2  604  ? 89.689  -20.135 106.518 1.00 76.26  ? 604  ALA C N     1 
ATOM   8266  C  CA    . ALA C  2  604  ? 90.969  -19.508 106.818 1.00 81.75  ? 604  ALA C CA    1 
ATOM   8267  C  C     . ALA C  2  604  ? 90.822  -18.002 106.996 1.00 81.70  ? 604  ALA C C     1 
ATOM   8268  O  O     . ALA C  2  604  ? 91.339  -17.428 107.962 1.00 82.85  ? 604  ALA C O     1 
ATOM   8269  C  CB    . ALA C  2  604  ? 91.975  -19.820 105.708 1.00 87.94  ? 604  ALA C CB    1 
ATOM   8270  N  N     . LYS C  2  605  ? 90.117  -17.349 106.077 1.00 78.61  ? 605  LYS C N     1 
ATOM   8271  C  CA    . LYS C  2  605  ? 90.046  -15.896 106.040 1.00 78.23  ? 605  LYS C CA    1 
ATOM   8272  C  C     . LYS C  2  605  ? 88.637  -15.453 105.682 1.00 78.80  ? 605  LYS C C     1 
ATOM   8273  O  O     . LYS C  2  605  ? 87.978  -16.083 104.851 1.00 80.83  ? 605  LYS C O     1 
ATOM   8274  C  CB    . LYS C  2  605  ? 91.035  -15.320 105.016 1.00 78.96  ? 605  LYS C CB    1 
ATOM   8275  C  CG    . LYS C  2  605  ? 92.497  -15.453 105.396 1.00 77.54  ? 605  LYS C CG    1 
ATOM   8276  C  CD    . LYS C  2  605  ? 93.378  -14.694 104.417 1.00 83.39  ? 605  LYS C CD    1 
ATOM   8277  C  CE    . LYS C  2  605  ? 94.838  -14.732 104.836 1.00 86.84  ? 605  LYS C CE    1 
ATOM   8278  N  NZ    . LYS C  2  605  ? 95.694  -13.908 103.937 1.00 88.84  ? 605  LYS C NZ    1 
ATOM   8279  N  N     . VAL C  2  606  ? 88.191  -14.353 106.290 1.00 78.33  ? 606  VAL C N     1 
ATOM   8280  C  CA    . VAL C  2  606  ? 86.926  -13.712 105.940 1.00 74.53  ? 606  VAL C CA    1 
ATOM   8281  C  C     . VAL C  2  606  ? 87.152  -12.210 105.834 1.00 75.81  ? 606  VAL C C     1 
ATOM   8282  O  O     . VAL C  2  606  ? 87.535  -11.561 106.814 1.00 71.68  ? 606  VAL C O     1 
ATOM   8283  C  CB    . VAL C  2  606  ? 85.813  -14.013 106.956 1.00 86.59  ? 606  VAL C CB    1 
ATOM   8284  C  CG1   . VAL C  2  606  ? 84.619  -13.102 106.706 1.00 88.02  ? 606  VAL C CG1   1 
ATOM   8285  C  CG2   . VAL C  2  606  ? 85.389  -15.462 106.856 1.00 86.12  ? 606  VAL C CG2   1 
ATOM   8286  N  N     . ASP C  2  607  ? 86.903  -11.663 104.648 1.00 83.19  ? 607  ASP C N     1 
ATOM   8287  C  CA    . ASP C  2  607  ? 87.004  -10.243 104.353 1.00 78.69  ? 607  ASP C CA    1 
ATOM   8288  C  C     . ASP C  2  607  ? 85.666  -9.789  103.783 1.00 76.84  ? 607  ASP C C     1 
ATOM   8289  O  O     . ASP C  2  607  ? 84.745  -10.590 103.595 1.00 80.76  ? 607  ASP C O     1 
ATOM   8290  C  CB    . ASP C  2  607  ? 88.148  -9.973  103.362 1.00 79.79  ? 607  ASP C CB    1 
ATOM   8291  C  CG    . ASP C  2  607  ? 88.678  -8.554  103.442 1.00 84.10  ? 607  ASP C CG    1 
ATOM   8292  O  OD1   . ASP C  2  607  ? 88.246  -7.809  104.348 1.00 87.65  ? 607  ASP C OD1   1 
ATOM   8293  O  OD2   . ASP C  2  607  ? 89.531  -8.187  102.600 1.00 78.48  ? 607  ASP C OD2   1 
ATOM   8294  N  N     . GLY C  2  608  ? 85.548  -8.491  103.507 1.00 75.35  ? 608  GLY C N     1 
ATOM   8295  C  CA    . GLY C  2  608  ? 84.438  -8.043  102.688 1.00 72.54  ? 608  GLY C CA    1 
ATOM   8296  C  C     . GLY C  2  608  ? 84.606  -8.378  101.222 1.00 79.08  ? 608  GLY C C     1 
ATOM   8297  O  O     . GLY C  2  608  ? 83.616  -8.405  100.482 1.00 79.07  ? 608  GLY C O     1 
ATOM   8298  N  N     . ASN C  2  609  ? 85.838  -8.662  100.797 1.00 75.86  ? 609  ASN C N     1 
ATOM   8299  C  CA    . ASN C  2  609  ? 86.172  -8.841  99.392  1.00 64.99  ? 609  ASN C CA    1 
ATOM   8300  C  C     . ASN C  2  609  ? 86.445  -10.288 99.001  1.00 72.27  ? 609  ASN C C     1 
ATOM   8301  O  O     . ASN C  2  609  ? 86.402  -10.603 97.805  1.00 76.70  ? 609  ASN C O     1 
ATOM   8302  C  CB    . ASN C  2  609  ? 87.393  -7.987  99.045  1.00 63.72  ? 609  ASN C CB    1 
ATOM   8303  C  CG    . ASN C  2  609  ? 87.221  -6.543  99.452  1.00 57.63  ? 609  ASN C CG    1 
ATOM   8304  O  OD1   . ASN C  2  609  ? 86.162  -5.960  99.248  1.00 54.92  ? 609  ASN C OD1   1 
ATOM   8305  N  ND2   . ASN C  2  609  ? 88.261  -5.959  100.037 1.00 64.32  ? 609  ASN C ND2   1 
ATOM   8306  N  N     . ARG C  2  610  ? 86.729  -11.170 99.959  1.00 68.73  ? 610  ARG C N     1 
ATOM   8307  C  CA    . ARG C  2  610  ? 87.057  -12.550 99.626  1.00 68.94  ? 610  ARG C CA    1 
ATOM   8308  C  C     . ARG C  2  610  ? 86.936  -13.419 100.869 1.00 71.26  ? 610  ARG C C     1 
ATOM   8309  O  O     . ARG C  2  610  ? 86.995  -12.933 102.001 1.00 66.07  ? 610  ARG C O     1 
ATOM   8310  C  CB    . ARG C  2  610  ? 88.465  -12.663 99.033  1.00 77.31  ? 610  ARG C CB    1 
ATOM   8311  C  CG    . ARG C  2  610  ? 89.537  -11.970 99.860  1.00 86.00  ? 610  ARG C CG    1 
ATOM   8312  C  CD    . ARG C  2  610  ? 90.332  -12.950 100.715 1.00 81.64  ? 610  ARG C CD    1 
ATOM   8313  N  NE    . ARG C  2  610  ? 91.362  -12.263 101.489 1.00 85.80  ? 610  ARG C NE    1 
ATOM   8314  C  CZ    . ARG C  2  610  ? 91.278  -12.011 102.791 1.00 82.33  ? 610  ARG C CZ    1 
ATOM   8315  N  NH1   . ARG C  2  610  ? 90.216  -12.406 103.477 1.00 74.90  ? 610  ARG C NH1   1 
ATOM   8316  N  NH2   . ARG C  2  610  ? 92.262  -11.373 103.409 1.00 86.49  ? 610  ARG C NH2   1 
ATOM   8317  N  N     . ILE C  2  611  ? 86.765  -14.719 100.629 1.00 75.97  ? 611  ILE C N     1 
ATOM   8318  C  CA    . ILE C  2  611  ? 86.664  -15.740 101.671 1.00 77.49  ? 611  ILE C CA    1 
ATOM   8319  C  C     . ILE C  2  611  ? 87.634  -16.860 101.309 1.00 81.04  ? 611  ILE C C     1 
ATOM   8320  O  O     . ILE C  2  611  ? 87.533  -17.440 100.223 1.00 81.85  ? 611  ILE C O     1 
ATOM   8321  C  CB    . ILE C  2  611  ? 85.233  -16.297 101.811 1.00 80.44  ? 611  ILE C CB    1 
ATOM   8322  C  CG1   . ILE C  2  611  ? 84.227  -15.194 102.158 1.00 74.25  ? 611  ILE C CG1   1 
ATOM   8323  C  CG2   . ILE C  2  611  ? 85.176  -17.400 102.861 1.00 76.10  ? 611  ILE C CG2   1 
ATOM   8324  C  CD1   . ILE C  2  611  ? 82.783  -15.680 102.192 1.00 64.07  ? 611  ILE C CD1   1 
ATOM   8325  N  N     . VAL C  2  612  ? 88.565  -17.170 102.209 1.00 82.42  ? 612  VAL C N     1 
ATOM   8326  C  CA    . VAL C  2  612  ? 89.594  -18.177 101.960 1.00 80.02  ? 612  VAL C CA    1 
ATOM   8327  C  C     . VAL C  2  612  ? 89.308  -19.392 102.834 1.00 90.34  ? 612  VAL C C     1 
ATOM   8328  O  O     . VAL C  2  612  ? 89.234  -19.275 104.064 1.00 90.74  ? 612  VAL C O     1 
ATOM   8329  C  CB    . VAL C  2  612  ? 91.003  -17.627 102.223 1.00 74.44  ? 612  VAL C CB    1 
ATOM   8330  C  CG1   . VAL C  2  612  ? 92.037  -18.695 101.949 1.00 78.53  ? 612  VAL C CG1   1 
ATOM   8331  C  CG2   . VAL C  2  612  ? 91.262  -16.398 101.367 1.00 74.97  ? 612  VAL C CG2   1 
ATOM   8332  N  N     . VAL C  2  613  ? 89.172  -20.557 102.196 1.00 96.47  ? 613  VAL C N     1 
ATOM   8333  C  CA    . VAL C  2  613  ? 88.814  -21.813 102.848 1.00 91.69  ? 613  VAL C CA    1 
ATOM   8334  C  C     . VAL C  2  613  ? 89.942  -22.816 102.645 1.00 98.63  ? 613  VAL C C     1 
ATOM   8335  O  O     . VAL C  2  613  ? 90.473  -22.957 101.537 1.00 98.99  ? 613  VAL C O     1 
ATOM   8336  C  CB    . VAL C  2  613  ? 87.487  -22.377 102.301 1.00 87.07  ? 613  VAL C CB    1 
ATOM   8337  C  CG1   . VAL C  2  613  ? 87.067  -23.620 103.075 1.00 89.62  ? 613  VAL C CG1   1 
ATOM   8338  C  CG2   . VAL C  2  613  ? 86.397  -21.320 102.339 1.00 88.96  ? 613  VAL C CG2   1 
ATOM   8339  N  N     . ARG C  2  614  ? 90.298  -23.521 103.719 1.00 98.93  ? 614  ARG C N     1 
ATOM   8340  C  CA    . ARG C  2  614  ? 91.276  -24.602 103.684 1.00 100.62 ? 614  ARG C CA    1 
ATOM   8341  C  C     . ARG C  2  614  ? 90.522  -25.923 103.778 1.00 100.31 ? 614  ARG C C     1 
ATOM   8342  O  O     . ARG C  2  614  ? 89.939  -26.236 104.821 1.00 98.06  ? 614  ARG C O     1 
ATOM   8343  C  CB    . ARG C  2  614  ? 92.286  -24.460 104.822 1.00 103.53 ? 614  ARG C CB    1 
ATOM   8344  C  CG    . ARG C  2  614  ? 93.219  -25.646 104.973 1.00 109.39 ? 614  ARG C CG    1 
ATOM   8345  C  CD    . ARG C  2  614  ? 94.370  -25.326 105.912 1.00 109.28 ? 614  ARG C CD    1 
ATOM   8346  N  NE    . ARG C  2  614  ? 95.184  -24.222 105.414 1.00 108.69 ? 614  ARG C NE    1 
ATOM   8347  C  CZ    . ARG C  2  614  ? 96.141  -24.355 104.502 1.00 104.92 ? 614  ARG C CZ    1 
ATOM   8348  N  NH1   . ARG C  2  614  ? 96.834  -23.297 104.105 1.00 107.09 ? 614  ARG C NH1   1 
ATOM   8349  N  NH2   . ARG C  2  614  ? 96.403  -25.547 103.982 1.00 98.56  ? 614  ARG C NH2   1 
ATOM   8350  N  N     . TYR C  2  615  ? 90.540  -26.698 102.696 1.00 104.88 ? 615  TYR C N     1 
ATOM   8351  C  CA    . TYR C  2  615  ? 89.713  -27.890 102.591 1.00 108.97 ? 615  TYR C CA    1 
ATOM   8352  C  C     . TYR C  2  615  ? 90.416  -29.109 103.191 1.00 112.42 ? 615  TYR C C     1 
ATOM   8353  O  O     . TYR C  2  615  ? 91.521  -29.024 103.733 1.00 114.69 ? 615  TYR C O     1 
ATOM   8354  C  CB    . TYR C  2  615  ? 89.334  -28.145 101.132 1.00 108.93 ? 615  TYR C CB    1 
ATOM   8355  C  CG    . TYR C  2  615  ? 88.288  -27.194 100.595 1.00 109.84 ? 615  TYR C CG    1 
ATOM   8356  C  CD1   . TYR C  2  615  ? 87.007  -27.166 101.134 1.00 107.07 ? 615  TYR C CD1   1 
ATOM   8357  C  CD2   . TYR C  2  615  ? 88.575  -26.331 99.545  1.00 107.67 ? 615  TYR C CD2   1 
ATOM   8358  C  CE1   . TYR C  2  615  ? 86.044  -26.300 100.648 1.00 101.34 ? 615  TYR C CE1   1 
ATOM   8359  C  CE2   . TYR C  2  615  ? 87.614  -25.463 99.051  1.00 106.65 ? 615  TYR C CE2   1 
ATOM   8360  C  CZ    . TYR C  2  615  ? 86.352  -25.453 99.607  1.00 104.73 ? 615  TYR C CZ    1 
ATOM   8361  O  OH    . TYR C  2  615  ? 85.395  -24.591 99.122  1.00 97.58  ? 615  TYR C OH    1 
ATOM   8362  N  N     . GLU C  2  616  ? 89.746  -30.265 103.098 1.00 115.68 ? 616  GLU C N     1 
ATOM   8363  C  CA    . GLU C  2  616  ? 90.349  -31.526 103.522 1.00 118.70 ? 616  GLU C CA    1 
ATOM   8364  C  C     . GLU C  2  616  ? 91.585  -31.854 102.701 1.00 123.78 ? 616  GLU C C     1 
ATOM   8365  O  O     . GLU C  2  616  ? 92.542  -32.441 103.219 1.00 128.67 ? 616  GLU C O     1 
ATOM   8366  C  CB    . GLU C  2  616  ? 89.337  -32.667 103.397 1.00 114.78 ? 616  GLU C CB    1 
ATOM   8367  C  CG    . GLU C  2  616  ? 88.076  -32.505 104.224 1.00 117.20 ? 616  GLU C CG    1 
ATOM   8368  C  CD    . GLU C  2  616  ? 88.233  -33.018 105.641 1.00 125.74 ? 616  GLU C CD    1 
ATOM   8369  O  OE1   . GLU C  2  616  ? 89.386  -33.185 106.093 1.00 133.00 ? 616  GLU C OE1   1 
ATOM   8370  O  OE2   . GLU C  2  616  ? 87.201  -33.261 106.303 1.00 122.41 ? 616  GLU C OE2   1 
ATOM   8371  N  N     . ASP C  2  617  ? 91.579  -31.488 101.419 1.00 123.53 ? 617  ASP C N     1 
ATOM   8372  C  CA    . ASP C  2  617  ? 92.717  -31.748 100.550 1.00 120.45 ? 617  ASP C CA    1 
ATOM   8373  C  C     . ASP C  2  617  ? 93.969  -31.012 101.004 1.00 116.51 ? 617  ASP C C     1 
ATOM   8374  O  O     . ASP C  2  617  ? 95.072  -31.356 100.564 1.00 119.42 ? 617  ASP C O     1 
ATOM   8375  C  CB    . ASP C  2  617  ? 92.354  -31.350 99.119  1.00 120.24 ? 617  ASP C CB    1 
ATOM   8376  C  CG    . ASP C  2  617  ? 90.848  -31.278 98.901  1.00 129.82 ? 617  ASP C CG    1 
ATOM   8377  O  OD1   . ASP C  2  617  ? 90.109  -32.016 99.590  1.00 127.78 ? 617  ASP C OD1   1 
ATOM   8378  O  OD2   . ASP C  2  617  ? 90.399  -30.480 98.051  1.00 131.72 ? 617  ASP C OD2   1 
ATOM   8379  N  N     . GLY C  2  618  ? 93.827  -30.019 101.880 1.00 113.08 ? 618  GLY C N     1 
ATOM   8380  C  CA    . GLY C  2  618  ? 94.914  -29.150 102.250 1.00 114.01 ? 618  GLY C CA    1 
ATOM   8381  C  C     . GLY C  2  618  ? 95.071  -27.938 101.359 1.00 111.15 ? 618  GLY C C     1 
ATOM   8382  O  O     . GLY C  2  618  ? 95.742  -26.976 101.753 1.00 106.20 ? 618  GLY C O     1 
ATOM   8383  N  N     . ARG C  2  619  ? 94.466  -27.953 100.174 1.00 109.34 ? 619  ARG C N     1 
ATOM   8384  C  CA    . ARG C  2  619  ? 94.578  -26.823 99.266  1.00 111.02 ? 619  ARG C CA    1 
ATOM   8385  C  C     . ARG C  2  619  ? 93.826  -25.620 99.819  1.00 105.10 ? 619  ARG C C     1 
ATOM   8386  O  O     . ARG C  2  619  ? 92.765  -25.754 100.437 1.00 102.86 ? 619  ARG C O     1 
ATOM   8387  C  CB    . ARG C  2  619  ? 94.052  -27.197 97.878  1.00 111.44 ? 619  ARG C CB    1 
ATOM   8388  C  CG    . ARG C  2  619  ? 92.620  -27.698 97.854  1.00 111.15 ? 619  ARG C CG    1 
ATOM   8389  C  CD    . ARG C  2  619  ? 92.255  -28.260 96.488  1.00 110.41 ? 619  ARG C CD    1 
ATOM   8390  N  NE    . ARG C  2  619  ? 90.843  -28.627 96.407  1.00 123.42 ? 619  ARG C NE    1 
ATOM   8391  C  CZ    . ARG C  2  619  ? 89.918  -27.910 95.775  1.00 121.83 ? 619  ARG C CZ    1 
ATOM   8392  N  NH1   . ARG C  2  619  ? 88.656  -28.320 95.753  1.00 116.51 ? 619  ARG C NH1   1 
ATOM   8393  N  NH2   . ARG C  2  619  ? 90.257  -26.786 95.158  1.00 113.63 ? 619  ARG C NH2   1 
ATOM   8394  N  N     . LEU C  2  620  ? 94.394  -24.441 99.601  1.00 103.26 ? 620  LEU C N     1 
ATOM   8395  C  CA    . LEU C  2  620  ? 93.844  -23.187 100.097 1.00 94.56  ? 620  LEU C CA    1 
ATOM   8396  C  C     . LEU C  2  620  ? 93.122  -22.499 98.944  1.00 98.99  ? 620  LEU C C     1 
ATOM   8397  O  O     . LEU C  2  620  ? 93.764  -21.965 98.033  1.00 96.59  ? 620  LEU C O     1 
ATOM   8398  C  CB    . LEU C  2  620  ? 94.956  -22.306 100.659 1.00 91.13  ? 620  LEU C CB    1 
ATOM   8399  C  CG    . LEU C  2  620  ? 94.564  -21.195 101.626 1.00 87.33  ? 620  LEU C CG    1 
ATOM   8400  C  CD1   . LEU C  2  620  ? 94.019  -21.794 102.907 1.00 93.90  ? 620  LEU C CD1   1 
ATOM   8401  C  CD2   . LEU C  2  620  ? 95.752  -20.293 101.914 1.00 84.49  ? 620  LEU C CD2   1 
ATOM   8402  N  N     . VAL C  2  621  ? 91.788  -22.515 98.979  1.00 96.02  ? 621  VAL C N     1 
ATOM   8403  C  CA    . VAL C  2  621  ? 90.965  -21.947 97.917  1.00 90.81  ? 621  VAL C CA    1 
ATOM   8404  C  C     . VAL C  2  621  ? 90.503  -20.565 98.348  1.00 87.32  ? 621  VAL C C     1 
ATOM   8405  O  O     . VAL C  2  621  ? 90.091  -20.364 99.496  1.00 83.19  ? 621  VAL C O     1 
ATOM   8406  C  CB    . VAL C  2  621  ? 89.767  -22.856 97.589  1.00 86.75  ? 621  VAL C CB    1 
ATOM   8407  C  CG1   . VAL C  2  621  ? 88.908  -22.239 96.490  1.00 84.66  ? 621  VAL C CG1   1 
ATOM   8408  C  CG2   . VAL C  2  621  ? 90.255  -24.230 97.176  1.00 96.00  ? 621  VAL C CG2   1 
ATOM   8409  N  N     . GLU C  2  622  ? 90.590  -19.603 97.436  1.00 86.43  ? 622  GLU C N     1 
ATOM   8410  C  CA    . GLU C  2  622  ? 90.117  -18.250 97.677  1.00 79.27  ? 622  GLU C CA    1 
ATOM   8411  C  C     . GLU C  2  622  ? 88.920  -17.975 96.779  1.00 79.75  ? 622  GLU C C     1 
ATOM   8412  O  O     . GLU C  2  622  ? 88.981  -18.205 95.567  1.00 83.85  ? 622  GLU C O     1 
ATOM   8413  C  CB    . GLU C  2  622  ? 91.223  -17.223 97.424  1.00 75.94  ? 622  GLU C CB    1 
ATOM   8414  C  CG    . GLU C  2  622  ? 90.774  -15.789 97.622  1.00 76.63  ? 622  GLU C CG    1 
ATOM   8415  C  CD    . GLU C  2  622  ? 91.915  -14.802 97.512  1.00 85.88  ? 622  GLU C CD    1 
ATOM   8416  O  OE1   . GLU C  2  622  ? 93.079  -15.214 97.707  1.00 88.86  ? 622  GLU C OE1   1 
ATOM   8417  O  OE2   . GLU C  2  622  ? 91.645  -13.615 97.229  1.00 81.88  ? 622  GLU C OE2   1 
ATOM   8418  N  N     . TYR C  2  623  ? 87.830  -17.506 97.379  1.00 82.36  ? 623  TYR C N     1 
ATOM   8419  C  CA    . TYR C  2  623  ? 86.639  -17.096 96.652  1.00 74.80  ? 623  TYR C CA    1 
ATOM   8420  C  C     . TYR C  2  623  ? 86.558  -15.580 96.679  1.00 73.50  ? 623  TYR C C     1 
ATOM   8421  O  O     . TYR C  2  623  ? 86.347  -14.998 97.757  1.00 66.49  ? 623  TYR C O     1 
ATOM   8422  C  CB    . TYR C  2  623  ? 85.382  -17.700 97.276  1.00 72.87  ? 623  TYR C CB    1 
ATOM   8423  C  CG    . TYR C  2  623  ? 85.330  -19.209 97.280  1.00 75.46  ? 623  TYR C CG    1 
ATOM   8424  C  CD1   . TYR C  2  623  ? 84.930  -19.910 96.152  1.00 81.32  ? 623  TYR C CD1   1 
ATOM   8425  C  CD2   . TYR C  2  623  ? 85.656  -19.933 98.420  1.00 77.20  ? 623  TYR C CD2   1 
ATOM   8426  C  CE1   . TYR C  2  623  ? 84.870  -21.289 96.151  1.00 89.18  ? 623  TYR C CE1   1 
ATOM   8427  C  CE2   . TYR C  2  623  ? 85.598  -21.314 98.430  1.00 82.36  ? 623  TYR C CE2   1 
ATOM   8428  C  CZ    . TYR C  2  623  ? 85.204  -21.986 97.292  1.00 88.39  ? 623  TYR C CZ    1 
ATOM   8429  O  OH    . TYR C  2  623  ? 85.145  -23.359 97.291  1.00 93.11  ? 623  TYR C OH    1 
ATOM   8430  N  N     . PRO C  2  624  ? 86.747  -14.898 95.552  1.00 74.35  ? 624  PRO C N     1 
ATOM   8431  C  CA    . PRO C  2  624  ? 86.493  -13.455 95.517  1.00 77.30  ? 624  PRO C CA    1 
ATOM   8432  C  C     . PRO C  2  624  ? 84.998  -13.182 95.481  1.00 80.32  ? 624  PRO C C     1 
ATOM   8433  O  O     . PRO C  2  624  ? 84.230  -13.884 94.815  1.00 74.60  ? 624  PRO C O     1 
ATOM   8434  C  CB    . PRO C  2  624  ? 87.179  -13.006 94.222  1.00 73.08  ? 624  PRO C CB    1 
ATOM   8435  C  CG    . PRO C  2  624  ? 87.130  -14.213 93.350  1.00 79.20  ? 624  PRO C CG    1 
ATOM   8436  C  CD    . PRO C  2  624  ? 87.263  -15.402 94.268  1.00 74.51  ? 624  PRO C CD    1 
ATOM   8437  N  N     . LEU C  2  625  ? 84.589  -12.155 96.215  1.00 76.89  ? 625  LEU C N     1 
ATOM   8438  C  CA    . LEU C  2  625  ? 83.184  -11.813 96.362  1.00 70.90  ? 625  LEU C CA    1 
ATOM   8439  C  C     . LEU C  2  625  ? 82.838  -10.645 95.451  1.00 73.47  ? 625  LEU C C     1 
ATOM   8440  O  O     . LEU C  2  625  ? 83.558  -9.640  95.415  1.00 77.97  ? 625  LEU C O     1 
ATOM   8441  C  CB    . LEU C  2  625  ? 82.859  -11.468 97.815  1.00 70.11  ? 625  LEU C CB    1 
ATOM   8442  C  CG    . LEU C  2  625  ? 83.084  -12.592 98.831  1.00 69.94  ? 625  LEU C CG    1 
ATOM   8443  C  CD1   . LEU C  2  625  ? 82.688  -12.149 100.234 1.00 69.11  ? 625  LEU C CD1   1 
ATOM   8444  C  CD2   . LEU C  2  625  ? 82.327  -13.848 98.428  1.00 61.83  ? 625  LEU C CD2   1 
ATOM   8445  N  N     . ARG C  2  626  ? 81.743  -10.789 94.710  1.00 67.66  ? 626  ARG C N     1 
ATOM   8446  C  CA    . ARG C  2  626  ? 81.226  -9.701  93.893  1.00 69.44  ? 626  ARG C CA    1 
ATOM   8447  C  C     . ARG C  2  626  ? 80.570  -8.674  94.805  1.00 70.00  ? 626  ARG C C     1 
ATOM   8448  O  O     . ARG C  2  626  ? 79.627  -9.003  95.530  1.00 72.92  ? 626  ARG C O     1 
ATOM   8449  C  CB    . ARG C  2  626  ? 80.228  -10.246 92.875  1.00 73.24  ? 626  ARG C CB    1 
ATOM   8450  C  CG    . ARG C  2  626  ? 79.888  -9.293  91.743  1.00 86.18  ? 626  ARG C CG    1 
ATOM   8451  C  CD    . ARG C  2  626  ? 78.941  -9.938  90.730  1.00 92.58  ? 626  ARG C CD    1 
ATOM   8452  N  NE    . ARG C  2  626  ? 79.543  -11.079 90.042  1.00 101.46 ? 626  ARG C NE    1 
ATOM   8453  C  CZ    . ARG C  2  626  ? 79.322  -12.350 90.365  1.00 97.02  ? 626  ARG C CZ    1 
ATOM   8454  N  NH1   . ARG C  2  626  ? 78.509  -12.652 91.369  1.00 86.05  ? 626  ARG C NH1   1 
ATOM   8455  N  NH2   . ARG C  2  626  ? 79.916  -13.321 89.683  1.00 100.35 ? 626  ARG C NH2   1 
ATOM   8456  N  N     . ARG C  2  627  ? 81.075  -7.441  94.791  1.00 70.42  ? 627  ARG C N     1 
ATOM   8457  C  CA    . ARG C  2  627  ? 80.620  -6.398  95.705  1.00 71.02  ? 627  ARG C CA    1 
ATOM   8458  C  C     . ARG C  2  627  ? 80.135  -5.188  94.918  1.00 72.74  ? 627  ARG C C     1 
ATOM   8459  O  O     . ARG C  2  627  ? 80.925  -4.533  94.228  1.00 82.54  ? 627  ARG C O     1 
ATOM   8460  C  CB    . ARG C  2  627  ? 81.728  -5.992  96.679  1.00 75.14  ? 627  ARG C CB    1 
ATOM   8461  C  CG    . ARG C  2  627  ? 81.807  -6.862  97.927  1.00 71.17  ? 627  ARG C CG    1 
ATOM   8462  C  CD    . ARG C  2  627  ? 80.416  -7.193  98.441  1.00 69.59  ? 627  ARG C CD    1 
ATOM   8463  N  NE    . ARG C  2  627  ? 80.433  -7.793  99.772  1.00 74.28  ? 627  ARG C NE    1 
ATOM   8464  C  CZ    . ARG C  2  627  ? 79.975  -7.191  100.865 1.00 73.76  ? 627  ARG C CZ    1 
ATOM   8465  N  NH1   . ARG C  2  627  ? 79.460  -5.973  100.780 1.00 74.48  ? 627  ARG C NH1   1 
ATOM   8466  N  NH2   . ARG C  2  627  ? 80.022  -7.806  102.040 1.00 70.16  ? 627  ARG C NH2   1 
ATOM   8467  N  N     . PHE C  2  628  ? 78.837  -4.898  95.031  1.00 69.58  ? 628  PHE C N     1 
ATOM   8468  C  CA    . PHE C  2  628  ? 78.206  -3.708  94.458  1.00 67.01  ? 628  PHE C CA    1 
ATOM   8469  C  C     . PHE C  2  628  ? 78.391  -3.644  92.939  1.00 68.85  ? 628  PHE C C     1 
ATOM   8470  O  O     . PHE C  2  628  ? 78.915  -2.674  92.388  1.00 73.50  ? 628  PHE C O     1 
ATOM   8471  C  CB    . PHE C  2  628  ? 78.736  -2.440  95.131  1.00 62.56  ? 628  PHE C CB    1 
ATOM   8472  C  CG    . PHE C  2  628  ? 78.574  -2.440  96.617  1.00 71.71  ? 628  PHE C CG    1 
ATOM   8473  C  CD1   . PHE C  2  628  ? 77.363  -2.099  97.195  1.00 71.24  ? 628  PHE C CD1   1 
ATOM   8474  C  CD2   . PHE C  2  628  ? 79.631  -2.787  97.441  1.00 74.55  ? 628  PHE C CD2   1 
ATOM   8475  C  CE1   . PHE C  2  628  ? 77.211  -2.097  98.568  1.00 66.20  ? 628  PHE C CE1   1 
ATOM   8476  C  CE2   . PHE C  2  628  ? 79.486  -2.787  98.815  1.00 71.88  ? 628  PHE C CE2   1 
ATOM   8477  C  CZ    . PHE C  2  628  ? 78.275  -2.442  99.379  1.00 67.06  ? 628  PHE C CZ    1 
ATOM   8478  N  N     . TYR C  2  629  ? 77.930  -4.694  92.266  1.00 65.21  ? 629  TYR C N     1 
ATOM   8479  C  CA    . TYR C  2  629  ? 77.962  -4.763  90.813  1.00 65.63  ? 629  TYR C CA    1 
ATOM   8480  C  C     . TYR C  2  629  ? 76.567  -4.511  90.255  1.00 62.15  ? 629  TYR C C     1 
ATOM   8481  O  O     . TYR C  2  629  ? 75.575  -5.051  90.754  1.00 54.50  ? 629  TYR C O     1 
ATOM   8482  C  CB    . TYR C  2  629  ? 78.497  -6.117  90.331  1.00 71.00  ? 629  TYR C CB    1 
ATOM   8483  C  CG    . TYR C  2  629  ? 78.307  -6.358  88.844  1.00 81.12  ? 629  TYR C CG    1 
ATOM   8484  C  CD1   . TYR C  2  629  ? 79.003  -5.609  87.898  1.00 81.06  ? 629  TYR C CD1   1 
ATOM   8485  C  CD2   . TYR C  2  629  ? 77.428  -7.336  88.387  1.00 84.85  ? 629  TYR C CD2   1 
ATOM   8486  C  CE1   . TYR C  2  629  ? 78.823  -5.826  86.537  1.00 83.97  ? 629  TYR C CE1   1 
ATOM   8487  C  CE2   . TYR C  2  629  ? 77.243  -7.561  87.030  1.00 78.70  ? 629  TYR C CE2   1 
ATOM   8488  C  CZ    . TYR C  2  629  ? 77.941  -6.805  86.111  1.00 85.66  ? 629  TYR C CZ    1 
ATOM   8489  O  OH    . TYR C  2  629  ? 77.754  -7.030  84.764  1.00 91.45  ? 629  TYR C OH    1 
ATOM   8490  N  N     . ARG C  2  630  ? 76.501  -3.678  89.219  1.00 64.37  ? 630  ARG C N     1 
ATOM   8491  C  CA    . ARG C  2  630  ? 75.235  -3.287  88.618  1.00 53.97  ? 630  ARG C CA    1 
ATOM   8492  C  C     . ARG C  2  630  ? 74.719  -4.387  87.699  1.00 54.30  ? 630  ARG C C     1 
ATOM   8493  O  O     . ARG C  2  630  ? 75.425  -4.826  86.787  1.00 63.02  ? 630  ARG C O     1 
ATOM   8494  C  CB    . ARG C  2  630  ? 75.410  -1.984  87.838  1.00 50.79  ? 630  ARG C CB    1 
ATOM   8495  C  CG    . ARG C  2  630  ? 74.189  -1.568  87.049  1.00 53.24  ? 630  ARG C CG    1 
ATOM   8496  C  CD    . ARG C  2  630  ? 74.516  -0.467  86.062  1.00 53.11  ? 630  ARG C CD    1 
ATOM   8497  N  NE    . ARG C  2  630  ? 73.327  -0.033  85.335  1.00 63.60  ? 630  ARG C NE    1 
ATOM   8498  C  CZ    . ARG C  2  630  ? 72.874  -0.612  84.227  1.00 65.82  ? 630  ARG C CZ    1 
ATOM   8499  N  NH1   . ARG C  2  630  ? 73.515  -1.653  83.711  1.00 60.20  ? 630  ARG C NH1   1 
ATOM   8500  N  NH2   . ARG C  2  630  ? 71.779  -0.150  83.635  1.00 68.91  ? 630  ARG C NH2   1 
ATOM   8501  N  N     . SER C  2  631  ? 73.484  -4.825  87.936  1.00 51.94  ? 631  SER C N     1 
ATOM   8502  C  CA    . SER C  2  631  ? 72.844  -5.803  87.072  1.00 51.01  ? 631  SER C CA    1 
ATOM   8503  C  C     . SER C  2  631  ? 72.245  -5.111  85.853  1.00 51.76  ? 631  SER C C     1 
ATOM   8504  O  O     . SER C  2  631  ? 72.303  -3.886  85.710  1.00 56.88  ? 631  SER C O     1 
ATOM   8505  C  CB    . SER C  2  631  ? 71.767  -6.569  87.833  1.00 55.27  ? 631  SER C CB    1 
ATOM   8506  O  OG    . SER C  2  631  ? 70.631  -5.750  88.054  1.00 61.72  ? 631  SER C OG    1 
ATOM   8507  N  N     . ASN C  2  632  ? 71.647  -5.914  84.968  1.00 49.69  ? 632  ASN C N     1 
ATOM   8508  C  CA    . ASN C  2  632  ? 71.038  -5.379  83.752  1.00 56.25  ? 632  ASN C CA    1 
ATOM   8509  C  C     . ASN C  2  632  ? 70.058  -4.255  84.064  1.00 58.69  ? 632  ASN C C     1 
ATOM   8510  O  O     . ASN C  2  632  ? 69.978  -3.262  83.329  1.00 59.97  ? 632  ASN C O     1 
ATOM   8511  C  CB    . ASN C  2  632  ? 70.325  -6.496  82.987  1.00 56.31  ? 632  ASN C CB    1 
ATOM   8512  C  CG    . ASN C  2  632  ? 71.279  -7.376  82.201  1.00 55.32  ? 632  ASN C CG    1 
ATOM   8513  O  OD1   . ASN C  2  632  ? 72.398  -6.974  81.879  1.00 59.79  ? 632  ASN C OD1   1 
ATOM   8514  N  ND2   . ASN C  2  632  ? 70.832  -8.584  81.878  1.00 48.56  ? 632  ASN C ND2   1 
ATOM   8515  N  N     . GLN C  2  633  ? 69.316  -4.388  85.161  1.00 54.43  ? 633  GLN C N     1 
ATOM   8516  C  CA    . GLN C  2  633  ? 68.247  -3.466  85.506  1.00 53.86  ? 633  GLN C CA    1 
ATOM   8517  C  C     . GLN C  2  633  ? 68.657  -2.431  86.543  1.00 55.75  ? 633  GLN C C     1 
ATOM   8518  O  O     . GLN C  2  633  ? 67.818  -1.629  86.962  1.00 65.07  ? 633  GLN C O     1 
ATOM   8519  C  CB    . GLN C  2  633  ? 67.035  -4.252  86.010  1.00 53.05  ? 633  GLN C CB    1 
ATOM   8520  C  CG    . GLN C  2  633  ? 67.221  -5.760  85.969  1.00 47.42  ? 633  GLN C CG    1 
ATOM   8521  C  CD    . GLN C  2  633  ? 67.044  -6.345  84.583  1.00 41.68  ? 633  GLN C CD    1 
ATOM   8522  O  OE1   . GLN C  2  633  ? 67.453  -7.472  84.321  1.00 44.00  ? 633  GLN C OE1   1 
ATOM   8523  N  NE2   . GLN C  2  633  ? 66.427  -5.584  83.690  1.00 40.16  ? 633  GLN C NE2   1 
ATOM   8524  N  N     . GLY C  2  634  ? 69.915  -2.426  86.973  1.00 52.49  ? 634  GLY C N     1 
ATOM   8525  C  CA    . GLY C  2  634  ? 70.374  -1.466  87.948  1.00 52.91  ? 634  GLY C CA    1 
ATOM   8526  C  C     . GLY C  2  634  ? 70.337  -1.937  89.385  1.00 50.03  ? 634  GLY C C     1 
ATOM   8527  O  O     . GLY C  2  634  ? 70.947  -1.289  90.243  1.00 48.35  ? 634  GLY C O     1 
ATOM   8528  N  N     . THR C  2  635  ? 69.642  -3.033  89.683  1.00 49.98  ? 635  THR C N     1 
ATOM   8529  C  CA    . THR C  2  635  ? 69.666  -3.570  91.035  1.00 51.43  ? 635  THR C CA    1 
ATOM   8530  C  C     . THR C  2  635  ? 71.050  -4.130  91.329  1.00 52.76  ? 635  THR C C     1 
ATOM   8531  O  O     . THR C  2  635  ? 71.641  -4.820  90.494  1.00 53.46  ? 635  THR C O     1 
ATOM   8532  C  CB    . THR C  2  635  ? 68.599  -4.655  91.219  1.00 46.47  ? 635  THR C CB    1 
ATOM   8533  O  OG1   . THR C  2  635  ? 68.933  -5.808  90.439  1.00 47.89  ? 635  THR C OG1   1 
ATOM   8534  C  CG2   . THR C  2  635  ? 67.239  -4.141  90.788  1.00 47.15  ? 635  THR C CG2   1 
ATOM   8535  N  N     . ALA C  2  636  ? 71.577  -3.822  92.511  1.00 58.94  ? 636  ALA C N     1 
ATOM   8536  C  CA    . ALA C  2  636  ? 72.953  -4.183  92.831  1.00 58.15  ? 636  ALA C CA    1 
ATOM   8537  C  C     . ALA C  2  636  ? 73.082  -5.680  93.090  1.00 60.01  ? 636  ALA C C     1 
ATOM   8538  O  O     . ALA C  2  636  ? 72.269  -6.277  93.803  1.00 51.01  ? 636  ALA C O     1 
ATOM   8539  C  CB    . ALA C  2  636  ? 73.440  -3.393  94.045  1.00 51.54  ? 636  ALA C CB    1 
ATOM   8540  N  N     . LEU C  2  637  ? 74.105  -6.286  92.493  1.00 66.21  ? 637  LEU C N     1 
ATOM   8541  C  CA    . LEU C  2  637  ? 74.518  -7.646  92.814  1.00 64.21  ? 637  LEU C CA    1 
ATOM   8542  C  C     . LEU C  2  637  ? 75.695  -7.555  93.773  1.00 62.41  ? 637  LEU C C     1 
ATOM   8543  O  O     . LEU C  2  637  ? 76.716  -6.942  93.444  1.00 70.65  ? 637  LEU C O     1 
ATOM   8544  C  CB    . LEU C  2  637  ? 74.924  -8.431  91.564  1.00 66.36  ? 637  LEU C CB    1 
ATOM   8545  C  CG    . LEU C  2  637  ? 73.995  -8.547  90.356  1.00 62.51  ? 637  LEU C CG    1 
ATOM   8546  C  CD1   . LEU C  2  637  ? 74.340  -9.796  89.559  1.00 58.55  ? 637  LEU C CD1   1 
ATOM   8547  C  CD2   . LEU C  2  637  ? 72.537  -8.559  90.779  1.00 66.53  ? 637  LEU C CD2   1 
ATOM   8548  N  N     . ASP C  2  638  ? 75.556  -8.150  94.954  1.00 62.57  ? 638  ASP C N     1 
ATOM   8549  C  CA    . ASP C  2  638  ? 76.662  -8.134  95.900  1.00 71.14  ? 638  ASP C CA    1 
ATOM   8550  C  C     . ASP C  2  638  ? 76.497  -9.273  96.899  1.00 72.57  ? 638  ASP C C     1 
ATOM   8551  O  O     . ASP C  2  638  ? 75.383  -9.571  97.342  1.00 71.01  ? 638  ASP C O     1 
ATOM   8552  C  CB    . ASP C  2  638  ? 76.773  -6.762  96.592  1.00 68.57  ? 638  ASP C CB    1 
ATOM   8553  C  CG    . ASP C  2  638  ? 76.359  -6.788  98.042  1.00 74.38  ? 638  ASP C CG    1 
ATOM   8554  O  OD1   . ASP C  2  638  ? 75.160  -6.998  98.323  1.00 86.65  ? 638  ASP C OD1   1 
ATOM   8555  O  OD2   . ASP C  2  638  ? 77.241  -6.579  98.901  1.00 73.64  ? 638  ASP C OD2   1 
ATOM   8556  N  N     . GLN C  2  639  ? 77.617  -9.915  97.224  1.00 72.45  ? 639  GLN C N     1 
ATOM   8557  C  CA    . GLN C  2  639  ? 77.658  -11.087 98.088  1.00 72.62  ? 639  GLN C CA    1 
ATOM   8558  C  C     . GLN C  2  639  ? 78.302  -10.716 99.414  1.00 72.68  ? 639  GLN C C     1 
ATOM   8559  O  O     . GLN C  2  639  ? 79.425  -10.201 99.441  1.00 74.16  ? 639  GLN C O     1 
ATOM   8560  C  CB    . GLN C  2  639  ? 78.444  -12.223 97.431  1.00 72.24  ? 639  GLN C CB    1 
ATOM   8561  C  CG    . GLN C  2  639  ? 77.868  -12.711 96.119  1.00 72.20  ? 639  GLN C CG    1 
ATOM   8562  C  CD    . GLN C  2  639  ? 78.809  -13.652 95.398  1.00 73.81  ? 639  GLN C CD    1 
ATOM   8563  O  OE1   . GLN C  2  639  ? 79.812  -13.225 94.826  1.00 81.29  ? 639  GLN C OE1   1 
ATOM   8564  N  NE2   . GLN C  2  639  ? 78.495  -14.942 95.428  1.00 70.73  ? 639  GLN C NE2   1 
ATOM   8565  N  N     . ARG C  2  640  ? 77.599  -10.987 100.508 1.00 71.22  ? 640  ARG C N     1 
ATOM   8566  C  CA    . ARG C  2  640  ? 78.097  -10.667 101.833 1.00 72.14  ? 640  ARG C CA    1 
ATOM   8567  C  C     . ARG C  2  640  ? 78.544  -11.936 102.540 1.00 71.47  ? 640  ARG C C     1 
ATOM   8568  O  O     . ARG C  2  640  ? 77.821  -12.940 102.511 1.00 71.45  ? 640  ARG C O     1 
ATOM   8569  C  CB    . ARG C  2  640  ? 77.018  -9.958  102.662 1.00 77.20  ? 640  ARG C CB    1 
ATOM   8570  C  CG    . ARG C  2  640  ? 76.734  -8.521  102.235 1.00 77.97  ? 640  ARG C CG    1 
ATOM   8571  C  CD    . ARG C  2  640  ? 75.675  -8.428  101.139 1.00 75.35  ? 640  ARG C CD    1 
ATOM   8572  N  NE    . ARG C  2  640  ? 74.311  -8.522  101.658 1.00 80.57  ? 640  ARG C NE    1 
ATOM   8573  C  CZ    . ARG C  2  640  ? 73.507  -9.563  101.465 1.00 78.31  ? 640  ARG C CZ    1 
ATOM   8574  N  NH1   . ARG C  2  640  ? 73.927  -10.602 100.756 1.00 73.85  ? 640  ARG C NH1   1 
ATOM   8575  N  NH2   . ARG C  2  640  ? 72.280  -9.563  101.973 1.00 78.57  ? 640  ARG C NH2   1 
ATOM   8576  N  N     . PRO C  2  641  ? 79.714  -11.937 103.178 1.00 73.80  ? 641  PRO C N     1 
ATOM   8577  C  CA    . PRO C  2  641  ? 80.193  -13.158 103.840 1.00 70.45  ? 641  PRO C CA    1 
ATOM   8578  C  C     . PRO C  2  641  ? 79.338  -13.488 105.057 1.00 76.02  ? 641  PRO C C     1 
ATOM   8579  O  O     . PRO C  2  641  ? 79.040  -12.618 105.877 1.00 77.77  ? 641  PRO C O     1 
ATOM   8580  C  CB    . PRO C  2  641  ? 81.631  -12.805 104.235 1.00 73.45  ? 641  PRO C CB    1 
ATOM   8581  C  CG    . PRO C  2  641  ? 81.611  -11.314 104.389 1.00 75.28  ? 641  PRO C CG    1 
ATOM   8582  C  CD    . PRO C  2  641  ? 80.635  -10.802 103.364 1.00 76.51  ? 641  PRO C CD    1 
ATOM   8583  N  N     . ARG C  2  642  ? 78.941  -14.758 105.164 1.00 76.12  ? 642  ARG C N     1 
ATOM   8584  C  CA    . ARG C  2  642  ? 78.084  -15.231 106.247 1.00 73.82  ? 642  ARG C CA    1 
ATOM   8585  C  C     . ARG C  2  642  ? 78.817  -16.138 107.229 1.00 73.63  ? 642  ARG C C     1 
ATOM   8586  O  O     . ARG C  2  642  ? 78.177  -16.729 108.105 1.00 80.86  ? 642  ARG C O     1 
ATOM   8587  C  CB    . ARG C  2  642  ? 76.861  -15.959 105.679 1.00 66.15  ? 642  ARG C CB    1 
ATOM   8588  C  CG    . ARG C  2  642  ? 75.874  -15.060 104.943 1.00 63.91  ? 642  ARG C CG    1 
ATOM   8589  C  CD    . ARG C  2  642  ? 75.143  -14.132 105.905 1.00 69.78  ? 642  ARG C CD    1 
ATOM   8590  N  NE    . ARG C  2  642  ? 74.379  -13.094 105.213 1.00 69.06  ? 642  ARG C NE    1 
ATOM   8591  C  CZ    . ARG C  2  642  ? 74.729  -11.810 105.168 1.00 68.58  ? 642  ARG C CZ    1 
ATOM   8592  N  NH1   . ARG C  2  642  ? 75.832  -11.398 105.780 1.00 67.37  ? 642  ARG C NH1   1 
ATOM   8593  N  NH2   . ARG C  2  642  ? 73.974  -10.935 104.516 1.00 61.68  ? 642  ARG C NH2   1 
ATOM   8594  N  N     . VAL C  2  643  ? 80.137  -16.265 107.107 1.00 78.58  ? 643  VAL C N     1 
ATOM   8595  C  CA    . VAL C  2  643  ? 80.918  -17.120 107.996 1.00 79.09  ? 643  VAL C CA    1 
ATOM   8596  C  C     . VAL C  2  643  ? 81.931  -16.276 108.764 1.00 80.60  ? 643  VAL C C     1 
ATOM   8597  O  O     . VAL C  2  643  ? 82.045  -15.065 108.542 1.00 82.02  ? 643  VAL C O     1 
ATOM   8598  C  CB    . VAL C  2  643  ? 81.612  -18.247 107.210 1.00 74.18  ? 643  VAL C CB    1 
ATOM   8599  C  CG1   . VAL C  2  643  ? 80.577  -19.118 106.517 1.00 76.41  ? 643  VAL C CG1   1 
ATOM   8600  C  CG2   . VAL C  2  643  ? 82.581  -17.669 106.196 1.00 75.82  ? 643  VAL C CG2   1 
ATOM   8601  N  N     . VAL C  2  644  ? 82.672  -16.907 109.673 1.00 75.79  ? 644  VAL C N     1 
ATOM   8602  C  CA    . VAL C  2  644  ? 83.658  -16.217 110.494 1.00 77.59  ? 644  VAL C CA    1 
ATOM   8603  C  C     . VAL C  2  644  ? 84.974  -16.984 110.431 1.00 80.96  ? 644  VAL C C     1 
ATOM   8604  O  O     . VAL C  2  644  ? 84.999  -18.191 110.168 1.00 78.96  ? 644  VAL C O     1 
ATOM   8605  C  CB    . VAL C  2  644  ? 83.171  -16.064 111.952 1.00 75.23  ? 644  VAL C CB    1 
ATOM   8606  C  CG1   . VAL C  2  644  ? 83.240  -17.396 112.680 1.00 82.13  ? 644  VAL C CG1   1 
ATOM   8607  C  CG2   . VAL C  2  644  ? 83.966  -14.986 112.683 1.00 87.30  ? 644  VAL C CG2   1 
ATOM   8608  N  N     . VAL C  2  645  ? 86.078  -16.267 110.662 1.00 79.05  ? 645  VAL C N     1 
ATOM   8609  C  CA    . VAL C  2  645  ? 87.402  -16.870 110.551 1.00 79.98  ? 645  VAL C CA    1 
ATOM   8610  C  C     . VAL C  2  645  ? 87.531  -18.011 111.549 1.00 79.62  ? 645  VAL C C     1 
ATOM   8611  O  O     . VAL C  2  645  ? 87.247  -17.852 112.743 1.00 81.20  ? 645  VAL C O     1 
ATOM   8612  C  CB    . VAL C  2  645  ? 88.495  -15.811 110.767 1.00 78.93  ? 645  VAL C CB    1 
ATOM   8613  C  CG1   . VAL C  2  645  ? 89.873  -16.450 110.701 1.00 69.16  ? 645  VAL C CG1   1 
ATOM   8614  C  CG2   . VAL C  2  645  ? 88.372  -14.697 109.736 1.00 81.69  ? 645  VAL C CG2   1 
ATOM   8615  N  N     . GLY C  2  646  ? 87.954  -19.173 111.060 1.00 80.03  ? 646  GLY C N     1 
ATOM   8616  C  CA    . GLY C  2  646  ? 88.116  -20.342 111.899 1.00 85.38  ? 646  GLY C CA    1 
ATOM   8617  C  C     . GLY C  2  646  ? 86.899  -21.229 112.006 1.00 87.37  ? 646  GLY C C     1 
ATOM   8618  O  O     . GLY C  2  646  ? 86.911  -22.177 112.801 1.00 90.76  ? 646  GLY C O     1 
ATOM   8619  N  N     . GLN C  2  647  ? 85.854  -20.960 111.231 1.00 83.77  ? 647  GLN C N     1 
ATOM   8620  C  CA    . GLN C  2  647  ? 84.625  -21.734 111.304 1.00 82.07  ? 647  GLN C CA    1 
ATOM   8621  C  C     . GLN C  2  647  ? 84.751  -23.027 110.509 1.00 80.78  ? 647  GLN C C     1 
ATOM   8622  O  O     . GLN C  2  647  ? 85.285  -23.040 109.397 1.00 87.37  ? 647  GLN C O     1 
ATOM   8623  C  CB    . GLN C  2  647  ? 83.458  -20.898 110.781 1.00 80.75  ? 647  GLN C CB    1 
ATOM   8624  C  CG    . GLN C  2  647  ? 82.164  -21.654 110.585 1.00 77.07  ? 647  GLN C CG    1 
ATOM   8625  C  CD    . GLN C  2  647  ? 81.030  -20.739 110.183 1.00 72.03  ? 647  GLN C CD    1 
ATOM   8626  O  OE1   . GLN C  2  647  ? 81.150  -19.516 110.257 1.00 71.45  ? 647  GLN C OE1   1 
ATOM   8627  N  NE2   . GLN C  2  647  ? 79.921  -21.326 109.752 1.00 69.72  ? 647  GLN C NE2   1 
ATOM   8628  N  N     . ARG C  2  648  ? 84.258  -24.120 111.090 1.00 82.61  ? 648  ARG C N     1 
ATOM   8629  C  CA    . ARG C  2  648  ? 84.276  -25.423 110.435 1.00 92.59  ? 648  ARG C CA    1 
ATOM   8630  C  C     . ARG C  2  648  ? 83.035  -25.566 109.561 1.00 93.04  ? 648  ARG C C     1 
ATOM   8631  O  O     . ARG C  2  648  ? 81.906  -25.511 110.062 1.00 99.72  ? 648  ARG C O     1 
ATOM   8632  C  CB    . ARG C  2  648  ? 84.343  -26.552 111.465 1.00 97.60  ? 648  ARG C CB    1 
ATOM   8633  C  CG    . ARG C  2  648  ? 85.585  -26.520 112.347 1.00 105.25 ? 648  ARG C CG    1 
ATOM   8634  C  CD    . ARG C  2  648  ? 86.195  -27.908 112.511 1.00 107.17 ? 648  ARG C CD    1 
ATOM   8635  N  NE    . ARG C  2  648  ? 87.538  -27.982 111.941 1.00 112.40 ? 648  ARG C NE    1 
ATOM   8636  C  CZ    . ARG C  2  648  ? 87.806  -28.368 110.697 1.00 114.36 ? 648  ARG C CZ    1 
ATOM   8637  N  NH1   . ARG C  2  648  ? 86.820  -28.722 109.882 1.00 116.49 ? 648  ARG C NH1   1 
ATOM   8638  N  NH2   . ARG C  2  648  ? 89.060  -28.402 110.265 1.00 110.31 ? 648  ARG C NH2   1 
ATOM   8639  N  N     . VAL C  2  649  ? 83.247  -25.748 108.259 1.00 93.90  ? 649  VAL C N     1 
ATOM   8640  C  CA    . VAL C  2  649  ? 82.164  -25.864 107.290 1.00 94.22  ? 649  VAL C CA    1 
ATOM   8641  C  C     . VAL C  2  649  ? 82.233  -27.241 106.642 1.00 97.44  ? 649  VAL C C     1 
ATOM   8642  O  O     . VAL C  2  649  ? 83.289  -27.880 106.586 1.00 102.05 ? 649  VAL C O     1 
ATOM   8643  C  CB    . VAL C  2  649  ? 82.215  -24.754 106.219 1.00 92.90  ? 649  VAL C CB    1 
ATOM   8644  C  CG1   . VAL C  2  649  ? 82.180  -23.380 106.872 1.00 90.45  ? 649  VAL C CG1   1 
ATOM   8645  C  CG2   . VAL C  2  649  ? 83.453  -24.898 105.343 1.00 86.91  ? 649  VAL C CG2   1 
ATOM   8646  N  N     . ARG C  2  650  ? 81.084  -27.696 106.152 1.00 100.71 ? 650  ARG C N     1 
ATOM   8647  C  CA    . ARG C  2  650  ? 80.958  -28.979 105.473 1.00 100.13 ? 650  ARG C CA    1 
ATOM   8648  C  C     . ARG C  2  650  ? 80.763  -28.754 103.975 1.00 97.05  ? 650  ARG C C     1 
ATOM   8649  O  O     . ARG C  2  650  ? 80.820  -27.624 103.477 1.00 97.76  ? 650  ARG C O     1 
ATOM   8650  C  CB    . ARG C  2  650  ? 79.807  -29.792 106.071 1.00 104.66 ? 650  ARG C CB    1 
ATOM   8651  C  CG    . ARG C  2  650  ? 80.011  -30.238 107.511 1.00 110.81 ? 650  ARG C CG    1 
ATOM   8652  C  CD    . ARG C  2  650  ? 79.094  -31.411 107.832 1.00 126.48 ? 650  ARG C CD    1 
ATOM   8653  N  NE    . ARG C  2  650  ? 78.874  -31.572 109.265 1.00 144.15 ? 650  ARG C NE    1 
ATOM   8654  C  CZ    . ARG C  2  650  ? 77.821  -31.088 109.917 1.00 145.22 ? 650  ARG C CZ    1 
ATOM   8655  N  NH1   . ARG C  2  650  ? 76.885  -30.412 109.263 1.00 139.18 ? 650  ARG C NH1   1 
ATOM   8656  N  NH2   . ARG C  2  650  ? 77.702  -31.281 111.224 1.00 143.27 ? 650  ARG C NH2   1 
ATOM   8657  N  N     . LYS C  2  651  ? 80.533  -29.845 103.251 1.00 98.68  ? 651  LYS C N     1 
ATOM   8658  C  CA    . LYS C  2  651  ? 80.301  -29.770 101.813 1.00 100.80 ? 651  LYS C CA    1 
ATOM   8659  C  C     . LYS C  2  651  ? 78.897  -29.239 101.549 1.00 100.97 ? 651  LYS C C     1 
ATOM   8660  O  O     . LYS C  2  651  ? 77.910  -29.806 102.032 1.00 99.57  ? 651  LYS C O     1 
ATOM   8661  C  CB    . LYS C  2  651  ? 80.488  -31.142 101.172 1.00 101.92 ? 651  LYS C CB    1 
ATOM   8662  C  CG    . LYS C  2  651  ? 80.185  -31.187 99.682  1.00 97.64  ? 651  LYS C CG    1 
ATOM   8663  C  CD    . LYS C  2  651  ? 80.261  -32.610 99.151  1.00 105.43 ? 651  LYS C CD    1 
ATOM   8664  C  CE    . LYS C  2  651  ? 79.994  -32.662 97.655  1.00 113.48 ? 651  LYS C CE    1 
ATOM   8665  N  NZ    . LYS C  2  651  ? 81.058  -31.976 96.869  1.00 114.98 ? 651  LYS C NZ    1 
ATOM   8666  N  N     . GLY C  2  652  ? 78.808  -28.150 100.789 1.00 98.46  ? 652  GLY C N     1 
ATOM   8667  C  CA    . GLY C  2  652  ? 77.535  -27.534 100.491 1.00 93.48  ? 652  GLY C CA    1 
ATOM   8668  C  C     . GLY C  2  652  ? 77.040  -26.544 101.520 1.00 90.66  ? 652  GLY C C     1 
ATOM   8669  O  O     . GLY C  2  652  ? 75.905  -26.066 101.398 1.00 91.95  ? 652  GLY C O     1 
ATOM   8670  N  N     . ASP C  2  653  ? 77.843  -26.225 102.531 1.00 90.35  ? 653  ASP C N     1 
ATOM   8671  C  CA    . ASP C  2  653  ? 77.452  -25.232 103.519 1.00 84.35  ? 653  ASP C CA    1 
ATOM   8672  C  C     . ASP C  2  653  ? 77.616  -23.827 102.956 1.00 76.81  ? 653  ASP C C     1 
ATOM   8673  O  O     . ASP C  2  653  ? 78.461  -23.571 102.093 1.00 82.44  ? 653  ASP C O     1 
ATOM   8674  C  CB    . ASP C  2  653  ? 78.275  -25.378 104.801 1.00 88.44  ? 653  ASP C CB    1 
ATOM   8675  C  CG    . ASP C  2  653  ? 77.720  -26.437 105.736 1.00 96.10  ? 653  ASP C CG    1 
ATOM   8676  O  OD1   . ASP C  2  653  ? 76.839  -27.214 105.307 1.00 98.43  ? 653  ASP C OD1   1 
ATOM   8677  O  OD2   . ASP C  2  653  ? 78.161  -26.486 106.904 1.00 96.35  ? 653  ASP C OD2   1 
ATOM   8678  N  N     . LEU C  2  654  ? 76.793  -22.914 103.457 1.00 76.05  ? 654  LEU C N     1 
ATOM   8679  C  CA    . LEU C  2  654  ? 76.786  -21.552 102.948 1.00 72.63  ? 654  LEU C CA    1 
ATOM   8680  C  C     . LEU C  2  654  ? 78.069  -20.824 103.332 1.00 70.63  ? 654  LEU C C     1 
ATOM   8681  O  O     . LEU C  2  654  ? 78.567  -20.956 104.454 1.00 77.67  ? 654  LEU C O     1 
ATOM   8682  C  CB    . LEU C  2  654  ? 75.568  -20.801 103.485 1.00 63.37  ? 654  LEU C CB    1 
ATOM   8683  C  CG    . LEU C  2  654  ? 75.307  -19.400 102.937 1.00 57.90  ? 654  LEU C CG    1 
ATOM   8684  C  CD1   . LEU C  2  654  ? 74.783  -19.475 101.518 1.00 61.05  ? 654  LEU C CD1   1 
ATOM   8685  C  CD2   . LEU C  2  654  ? 74.338  -18.659 103.836 1.00 59.95  ? 654  LEU C CD2   1 
ATOM   8686  N  N     . LEU C  2  655  ? 78.610  -20.059 102.387 1.00 61.70  ? 655  LEU C N     1 
ATOM   8687  C  CA    . LEU C  2  655  ? 79.768  -19.210 102.627 1.00 62.46  ? 655  LEU C CA    1 
ATOM   8688  C  C     . LEU C  2  655  ? 79.422  -17.732 102.573 1.00 63.00  ? 655  LEU C C     1 
ATOM   8689  O  O     . LEU C  2  655  ? 79.799  -16.973 103.470 1.00 66.04  ? 655  LEU C O     1 
ATOM   8690  C  CB    . LEU C  2  655  ? 80.874  -19.520 101.607 1.00 73.55  ? 655  LEU C CB    1 
ATOM   8691  C  CG    . LEU C  2  655  ? 81.517  -20.904 101.672 1.00 72.76  ? 655  LEU C CG    1 
ATOM   8692  C  CD1   . LEU C  2  655  ? 82.587  -21.031 100.606 1.00 71.01  ? 655  LEU C CD1   1 
ATOM   8693  C  CD2   . LEU C  2  655  ? 82.101  -21.153 103.052 1.00 79.07  ? 655  LEU C CD2   1 
ATOM   8694  N  N     . ALA C  2  656  ? 78.713  -17.301 101.533 1.00 60.63  ? 656  ALA C N     1 
ATOM   8695  C  CA    . ALA C  2  656  ? 78.285  -15.918 101.402 1.00 64.98  ? 656  ALA C CA    1 
ATOM   8696  C  C     . ALA C  2  656  ? 76.856  -15.879 100.879 1.00 65.72  ? 656  ALA C C     1 
ATOM   8697  O  O     . ALA C  2  656  ? 76.484  -16.676 100.014 1.00 65.29  ? 656  ALA C O     1 
ATOM   8698  C  CB    . ALA C  2  656  ? 79.212  -15.131 100.467 1.00 63.66  ? 656  ALA C CB    1 
ATOM   8699  N  N     . ASP C  2  657  ? 76.059  -14.957 101.417 1.00 64.53  ? 657  ASP C N     1 
ATOM   8700  C  CA    . ASP C  2  657  ? 74.711  -14.724 100.912 1.00 63.36  ? 657  ASP C CA    1 
ATOM   8701  C  C     . ASP C  2  657  ? 74.761  -13.837 99.674  1.00 67.76  ? 657  ASP C C     1 
ATOM   8702  O  O     . ASP C  2  657  ? 75.481  -12.836 99.639  1.00 69.49  ? 657  ASP C O     1 
ATOM   8703  C  CB    . ASP C  2  657  ? 73.836  -14.066 101.983 1.00 65.67  ? 657  ASP C CB    1 
ATOM   8704  C  CG    . ASP C  2  657  ? 72.892  -15.046 102.672 1.00 65.23  ? 657  ASP C CG    1 
ATOM   8705  O  OD1   . ASP C  2  657  ? 72.380  -15.977 102.008 1.00 61.17  ? 657  ASP C OD1   1 
ATOM   8706  O  OD2   . ASP C  2  657  ? 72.650  -14.869 103.886 1.00 59.09  ? 657  ASP C OD2   1 
ATOM   8707  N  N     . GLY C  2  658  ? 73.991  -14.211 98.656  1.00 67.33  ? 658  GLY C N     1 
ATOM   8708  C  CA    . GLY C  2  658  ? 73.892  -13.423 97.452  1.00 69.90  ? 658  GLY C CA    1 
ATOM   8709  C  C     . GLY C  2  658  ? 72.915  -12.277 97.610  1.00 67.80  ? 658  GLY C C     1 
ATOM   8710  O  O     . GLY C  2  658  ? 72.448  -11.979 98.714  1.00 68.69  ? 658  GLY C O     1 
ATOM   8711  N  N     . PRO C  2