data_6KQG
# 
_entry.id   6KQG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.323 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6KQG         
WWPDB D_1300013467 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6KQG 
_pdbx_database_status.recvd_initial_deposition_date   2019-08-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zhang, Y.'     1 ? 
'Li, L.'        2 ? 
'Ebright, R.H.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            117 
_citation.language                  ? 
_citation.page_first                5801 
_citation.page_last                 5809 
_citation.title                     
'RNA extension drives a stepwise displacement of an initiation-factor structural module in initial transcription.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1920747117 
_citation.pdbx_database_id_PubMed   32127479 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, L.'        1 ? 
primary 'Molodtsov, V.' 2 ? 
primary 'Lin, W.'       3 ? 
primary 'Ebright, R.H.' 4 ? 
primary 'Zhang, Y.'     5 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   98.650 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6KQG 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     184.236 
_cell.length_a_esd                 ? 
_cell.length_b                     104.037 
_cell.length_b_esd                 ? 
_cell.length_c                     296.845 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6KQG 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                                                        35056.164  2 
2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                                                         125436.539 1 
2.7.7.6 ? ? ? 
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 1   2.7.7.6 ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                                                        11533.316  1 
2.7.7.6 ? ? ? 
5  polymer     man 'RNA polymerase sigma factor SigA'                                                                 50769.398  1 
?       ? ? ? 
6  polymer     syn 
;DNA (5'-D(*CP*CP*T*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*CP*GP*AP*GP*GP*G)-3')
;
6480.172   1   ?       ? ? ? 
7  polymer     syn 
;DNA (5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*GP*CP*AP*GP*G*)-3')
;
8421.432   1   ?       ? ? ? 
8  polymer     syn 
;RNA (5'-R(*CP*CP*UP*CP*GP*A)-3')
;
1851.165   1   ?       ? ? ? 
9  non-polymer syn 'MAGNESIUM ION'                                                                                    24.305     4 
?       ? ? ? 
10 non-polymer syn 'ZINC ION'                                                                                         65.409     2 
?       ? ? ? 
11 water       nat water                                                                                              18.015     
220 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B ? 
2 'polypeptide(L)'        no no 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C   ? 
3 'polypeptide(L)'        no no 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D   ? 
4 'polypeptide(L)'        no no 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E   ? 
5 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
F   ? 
6 polydeoxyribonucleotide no no 
;(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DG)(DA)(DG)(DG)
(DG)
;
CCTGCATCCGTGAGTCGAGGG G   ? 
7 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGTCACGGATGCAGG H   ? 
8 polyribonucleotide      no no CCUCGA CCUCGA I   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLY n 
5 3    SER n 
5 4    SER n 
5 5    HIS n 
5 6    HIS n 
5 7    HIS n 
5 8    HIS n 
5 9    HIS n 
5 10   HIS n 
5 11   SER n 
5 12   SER n 
5 13   GLY n 
5 14   LEU n 
5 15   VAL n 
5 16   PRO n 
5 17   ARG n 
5 18   GLY n 
5 19   SER n 
5 20   HIS n 
5 21   MET n 
5 22   LYS n 
5 23   LYS n 
5 24   SER n 
5 25   LYS n 
5 26   ARG n 
5 27   LYS n 
5 28   ASN n 
5 29   ALA n 
5 30   GLN n 
5 31   ALA n 
5 32   GLN n 
5 33   GLU n 
5 34   ALA n 
5 35   GLN n 
5 36   GLU n 
5 37   THR n 
5 38   GLU n 
5 39   VAL n 
5 40   LEU n 
5 41   VAL n 
5 42   GLN n 
5 43   GLU n 
5 44   GLU n 
5 45   ALA n 
5 46   GLU n 
5 47   GLU n 
5 48   LEU n 
5 49   PRO n 
5 50   GLU n 
5 51   PHE n 
5 52   PRO n 
5 53   GLU n 
5 54   GLY n 
5 55   GLU n 
5 56   PRO n 
5 57   ASP n 
5 58   PRO n 
5 59   ASP n 
5 60   LEU n 
5 61   GLU n 
5 62   ASP n 
5 63   PRO n 
5 64   ASP n 
5 65   LEU n 
5 66   THR n 
5 67   LEU n 
5 68   GLU n 
5 69   ASP n 
5 70   ASP n 
5 71   LEU n 
5 72   LEU n 
5 73   ASP n 
5 74   LEU n 
5 75   PRO n 
5 76   GLU n 
5 77   GLU n 
5 78   GLY n 
5 79   GLU n 
5 80   GLY n 
5 81   LEU n 
5 82   ASP n 
5 83   LEU n 
5 84   GLU n 
5 85   GLU n 
5 86   GLU n 
5 87   GLU n 
5 88   GLU n 
5 89   ASP n 
5 90   LEU n 
5 91   PRO n 
5 92   ILE n 
5 93   PRO n 
5 94   LYS n 
5 95   ILE n 
5 96   SER n 
5 97   THR n 
5 98   SER n 
5 99   ASP n 
5 100  PRO n 
5 101  VAL n 
5 102  ARG n 
5 103  GLN n 
5 104  TYR n 
5 105  LEU n 
5 106  HIS n 
5 107  GLU n 
5 108  ILE n 
5 109  GLY n 
5 110  GLN n 
5 111  VAL n 
5 112  PRO n 
5 113  LEU n 
5 114  LEU n 
5 115  THR n 
5 116  LEU n 
5 117  GLU n 
5 118  GLU n 
5 119  GLU n 
5 120  VAL n 
5 121  GLU n 
5 122  LEU n 
5 123  ALA n 
5 124  ARG n 
5 125  LYS n 
5 126  VAL n 
5 127  GLU n 
5 128  GLU n 
5 129  GLY n 
5 130  MET n 
5 131  GLU n 
5 132  ALA n 
5 133  ILE n 
5 134  LYS n 
5 135  LYS n 
5 136  LEU n 
5 137  SER n 
5 138  GLU n 
5 139  ILE n 
5 140  THR n 
5 141  GLY n 
5 142  LEU n 
5 143  ASP n 
5 144  PRO n 
5 145  ASP n 
5 146  LEU n 
5 147  ILE n 
5 148  ARG n 
5 149  GLU n 
5 150  VAL n 
5 151  VAL n 
5 152  ARG n 
5 153  ALA n 
5 154  LYS n 
5 155  ILE n 
5 156  LEU n 
5 157  GLY n 
5 158  SER n 
5 159  ALA n 
5 160  ARG n 
5 161  VAL n 
5 162  ARG n 
5 163  HIS n 
5 164  ILE n 
5 165  PRO n 
5 166  GLY n 
5 167  LEU n 
5 168  LYS n 
5 169  GLU n 
5 170  THR n 
5 171  LEU n 
5 172  ASP n 
5 173  PRO n 
5 174  LYS n 
5 175  THR n 
5 176  VAL n 
5 177  GLU n 
5 178  GLU n 
5 179  ILE n 
5 180  ASP n 
5 181  GLN n 
5 182  LYS n 
5 183  LEU n 
5 184  LYS n 
5 185  SER n 
5 186  LEU n 
5 187  PRO n 
5 188  LYS n 
5 189  GLU n 
5 190  HIS n 
5 191  LYS n 
5 192  ARG n 
5 193  TYR n 
5 194  LEU n 
5 195  HIS n 
5 196  ILE n 
5 197  ALA n 
5 198  ARG n 
5 199  GLU n 
5 200  GLY n 
5 201  GLU n 
5 202  ALA n 
5 203  ALA n 
5 204  ARG n 
5 205  GLN n 
5 206  HIS n 
5 207  LEU n 
5 208  ILE n 
5 209  GLU n 
5 210  ALA n 
5 211  ASN n 
5 212  LEU n 
5 213  ARG n 
5 214  LEU n 
5 215  VAL n 
5 216  VAL n 
5 217  SER n 
5 218  ILE n 
5 219  ALA n 
5 220  LYS n 
5 221  LYS n 
5 222  TYR n 
5 223  THR n 
5 224  GLY n 
5 225  ARG n 
5 226  GLY n 
5 227  LEU n 
5 228  SER n 
5 229  PHE n 
5 230  LEU n 
5 231  ASP n 
5 232  LEU n 
5 233  ILE n 
5 234  GLN n 
5 235  GLU n 
5 236  GLY n 
5 237  ASN n 
5 238  GLN n 
5 239  GLY n 
5 240  LEU n 
5 241  ILE n 
5 242  ARG n 
5 243  ALA n 
5 244  VAL n 
5 245  GLU n 
5 246  LYS n 
5 247  PHE n 
5 248  GLU n 
5 249  TYR n 
5 250  LYS n 
5 251  ARG n 
5 252  ARG n 
5 253  PHE n 
5 254  LYS n 
5 255  PHE n 
5 256  SER n 
5 257  THR n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  TRP n 
5 262  TRP n 
5 263  ILE n 
5 264  ARG n 
5 265  GLN n 
5 266  ALA n 
5 267  ILE n 
5 268  ASN n 
5 269  ARG n 
5 270  ALA n 
5 271  ILE n 
5 272  ALA n 
5 273  ASP n 
5 274  GLN n 
5 275  ALA n 
5 276  ARG n 
5 277  THR n 
5 278  ILE n 
5 279  ARG n 
5 280  ILE n 
5 281  PRO n 
5 282  VAL n 
5 283  HIS n 
5 284  MET n 
5 285  VAL n 
5 286  GLU n 
5 287  THR n 
5 288  ILE n 
5 289  ASN n 
5 290  LYS n 
5 291  LEU n 
5 292  SER n 
5 293  ARG n 
5 294  THR n 
5 295  ALA n 
5 296  ARG n 
5 297  GLN n 
5 298  LEU n 
5 299  GLN n 
5 300  GLN n 
5 301  GLU n 
5 302  LEU n 
5 303  GLY n 
5 304  ARG n 
5 305  GLU n 
5 306  PRO n 
5 307  THR n 
5 308  TYR n 
5 309  GLU n 
5 310  GLU n 
5 311  ILE n 
5 312  ALA n 
5 313  GLU n 
5 314  ALA n 
5 315  MET n 
5 316  GLY n 
5 317  PRO n 
5 318  GLY n 
5 319  TRP n 
5 320  ASP n 
5 321  ALA n 
5 322  LYS n 
5 323  ARG n 
5 324  VAL n 
5 325  GLU n 
5 326  GLU n 
5 327  THR n 
5 328  LEU n 
5 329  LYS n 
5 330  ILE n 
5 331  ALA n 
5 332  GLN n 
5 333  GLU n 
5 334  PRO n 
5 335  VAL n 
5 336  SER n 
5 337  LEU n 
5 338  GLU n 
5 339  THR n 
5 340  PRO n 
5 341  ILE n 
5 342  GLY n 
5 343  ASP n 
5 344  GLU n 
5 345  LYS n 
5 346  ASP n 
5 347  SER n 
5 348  PHE n 
5 349  TYR n 
5 350  GLY n 
5 351  ASP n 
5 352  PHE n 
5 353  ILE n 
5 354  PRO n 
5 355  ASP n 
5 356  GLU n 
5 357  HIS n 
5 358  LEU n 
5 359  PRO n 
5 360  SER n 
5 361  PRO n 
5 362  VAL n 
5 363  ASP n 
5 364  ALA n 
5 365  ALA n 
5 366  THR n 
5 367  GLN n 
5 368  SER n 
5 369  LEU n 
5 370  LEU n 
5 371  SER n 
5 372  GLU n 
5 373  GLU n 
5 374  LEU n 
5 375  GLU n 
5 376  LYS n 
5 377  ALA n 
5 378  LEU n 
5 379  SER n 
5 380  LYS n 
5 381  LEU n 
5 382  SER n 
5 383  GLU n 
5 384  ARG n 
5 385  GLU n 
5 386  ALA n 
5 387  MET n 
5 388  VAL n 
5 389  LEU n 
5 390  LYS n 
5 391  LEU n 
5 392  ARG n 
5 393  LYS n 
5 394  GLY n 
5 395  LEU n 
5 396  ILE n 
5 397  ASP n 
5 398  GLY n 
5 399  ARG n 
5 400  GLU n 
5 401  HIS n 
5 402  THR n 
5 403  LEU n 
5 404  GLU n 
5 405  GLU n 
5 406  VAL n 
5 407  GLY n 
5 408  ALA n 
5 409  PHE n 
5 410  PHE n 
5 411  GLY n 
5 412  VAL n 
5 413  THR n 
5 414  ARG n 
5 415  GLU n 
5 416  ARG n 
5 417  ILE n 
5 418  ARG n 
5 419  GLN n 
5 420  ILE n 
5 421  GLU n 
5 422  ASN n 
5 423  LYS n 
5 424  ALA n 
5 425  LEU n 
5 426  ARG n 
5 427  LYS n 
5 428  LEU n 
5 429  LYS n 
5 430  TYR n 
5 431  HIS n 
5 432  GLU n 
5 433  SER n 
5 434  ARG n 
5 435  THR n 
5 436  ARG n 
5 437  LYS n 
5 438  LEU n 
5 439  ARG n 
5 440  ASP n 
5 441  PHE n 
5 442  LEU n 
5 443  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DT  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DC  n 
6 10   DG  n 
6 11   DT  n 
6 12   DG  n 
6 13   DA  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DG  n 
6 18   DA  n 
6 19   DG  n 
6 20   DG  n 
6 21   DG  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DC  n 
7 17   DA  n 
7 18   DC  n 
7 19   DG  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
8 1    C   n 
8 2    C   n 
8 3    U   n 
8 4    C   n 
8 5    G   n 
8 6    A   n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   443 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'sigA, TTHA0532' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'HB8 / ATCC 27634 / DSM 579' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     300852 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample 1 315  ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
2 1 sample 1 1119 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
3 1 sample 1 1524 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
4 1 sample 1 99   ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 21 'synthetic construct' ? 32630 ? 
7 1 sample 1 27 'synthetic construct' ? 32630 ? 
8 1 sample 1 6  'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_THET8   Q5SHR6 ? 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 
2 UNP RPOB_THET8   Q8RQE9 ? 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 
3 UNP RPOC_THET8   Q8RQE8 ? 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 
4 UNP RPOZ_THET8   Q8RQE7 ? 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 
5 UNP Q5SKW1_THET8 Q5SKW1 ? 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 
6 PDB 6KQG         6KQG   ? 6 ? 1 
7 PDB 6KQG         6KQG   ? 7 ? 1 
8 PDB 6KQG         6KQG   ? 8 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6KQG A 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
2 1 6KQG B 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
3 2 6KQG C 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4 3 6KQG D 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5 4 6KQG E 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6 5 6KQG F 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
7 6 6KQG G 1  ? 21   ? 6KQG   1 ? 21   ? 1 21   
8 7 6KQG H 1  ? 27   ? 6KQG   1 ? 27   ? 1 27   
9 8 6KQG I 1  ? 6    ? 6KQG   2 ? 7    ? 2 7    
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6 6KQG MET F 1  ? UNP Q5SKW1 ? ? 'initiating methionine' -19 1  
6 6KQG GLY F 2  ? UNP Q5SKW1 ? ? 'expression tag'        -18 2  
6 6KQG SER F 3  ? UNP Q5SKW1 ? ? 'expression tag'        -17 3  
6 6KQG SER F 4  ? UNP Q5SKW1 ? ? 'expression tag'        -16 4  
6 6KQG HIS F 5  ? UNP Q5SKW1 ? ? 'expression tag'        -15 5  
6 6KQG HIS F 6  ? UNP Q5SKW1 ? ? 'expression tag'        -14 6  
6 6KQG HIS F 7  ? UNP Q5SKW1 ? ? 'expression tag'        -13 7  
6 6KQG HIS F 8  ? UNP Q5SKW1 ? ? 'expression tag'        -12 8  
6 6KQG HIS F 9  ? UNP Q5SKW1 ? ? 'expression tag'        -11 9  
6 6KQG HIS F 10 ? UNP Q5SKW1 ? ? 'expression tag'        -10 10 
6 6KQG SER F 11 ? UNP Q5SKW1 ? ? 'expression tag'        -9  11 
6 6KQG SER F 12 ? UNP Q5SKW1 ? ? 'expression tag'        -8  12 
6 6KQG GLY F 13 ? UNP Q5SKW1 ? ? 'expression tag'        -7  13 
6 6KQG LEU F 14 ? UNP Q5SKW1 ? ? 'expression tag'        -6  14 
6 6KQG VAL F 15 ? UNP Q5SKW1 ? ? 'expression tag'        -5  15 
6 6KQG PRO F 16 ? UNP Q5SKW1 ? ? 'expression tag'        -4  16 
6 6KQG ARG F 17 ? UNP Q5SKW1 ? ? 'expression tag'        -3  17 
6 6KQG GLY F 18 ? UNP Q5SKW1 ? ? 'expression tag'        -2  18 
6 6KQG SER F 19 ? UNP Q5SKW1 ? ? 'expression tag'        -1  19 
6 6KQG HIS F 20 ? UNP Q5SKW1 ? ? 'expression tag'        0   20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6KQG 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.16 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.02 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.05 M Magnesium chloride, 0.2 M Potassium chloride, 0.1 M Tris-HCl pH8.0, 10% PEG 4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 270' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-07-30 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_synchrotron_site       CHESS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6KQG 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.783 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       137078 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.800 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.400 
_reflns.pdbx_Rmerge_I_obs                0.074 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.900 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.060 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.800 2.850  ? ? ? ? ? ? 6666 98.000  ? ? ? ? 0.710 ? ? ? ? ? ? ? ? 3.000 ? 0.906 ? ? ? ? ? 1  1 ? ? 
2.850 2.900  ? ? ? ? ? ? 6781 99.500  ? ? ? ? 0.659 ? ? ? ? ? ? ? ? 3.300 ? 0.913 ? ? ? ? ? 2  1 ? ? 
2.900 2.960  ? ? ? ? ? ? 6823 99.800  ? ? ? ? 0.576 ? ? ? ? ? ? ? ? 3.400 ? 0.929 ? ? ? ? ? 3  1 ? ? 
2.960 3.020  ? ? ? ? ? ? 6834 100.000 ? ? ? ? 0.511 ? ? ? ? ? ? ? ? 3.300 ? 0.944 ? ? ? ? ? 4  1 ? ? 
3.020 3.080  ? ? ? ? ? ? 6831 100.000 ? ? ? ? 0.420 ? ? ? ? ? ? ? ? 3.400 ? 0.928 ? ? ? ? ? 5  1 ? ? 
3.080 3.150  ? ? ? ? ? ? 6794 100.000 ? ? ? ? 0.335 ? ? ? ? ? ? ? ? 3.500 ? 0.951 ? ? ? ? ? 6  1 ? ? 
3.150 3.230  ? ? ? ? ? ? 6885 99.900  ? ? ? ? 0.288 ? ? ? ? ? ? ? ? 3.500 ? 0.982 ? ? ? ? ? 7  1 ? ? 
3.230 3.320  ? ? ? ? ? ? 6833 100.000 ? ? ? ? 0.236 ? ? ? ? ? ? ? ? 3.300 ? 1.009 ? ? ? ? ? 8  1 ? ? 
3.320 3.420  ? ? ? ? ? ? 6837 100.000 ? ? ? ? 0.188 ? ? ? ? ? ? ? ? 3.400 ? 1.075 ? ? ? ? ? 9  1 ? ? 
3.420 3.530  ? ? ? ? ? ? 6837 100.000 ? ? ? ? 0.159 ? ? ? ? ? ? ? ? 3.500 ? 1.102 ? ? ? ? ? 10 1 ? ? 
3.530 3.650  ? ? ? ? ? ? 6853 100.000 ? ? ? ? 0.130 ? ? ? ? ? ? ? ? 3.300 ? 1.177 ? ? ? ? ? 11 1 ? ? 
3.650 3.800  ? ? ? ? ? ? 6861 100.000 ? ? ? ? 0.105 ? ? ? ? ? ? ? ? 3.400 ? 1.130 ? ? ? ? ? 12 1 ? ? 
3.800 3.970  ? ? ? ? ? ? 6802 100.000 ? ? ? ? 0.090 ? ? ? ? ? ? ? ? 3.500 ? 1.196 ? ? ? ? ? 13 1 ? ? 
3.970 4.180  ? ? ? ? ? ? 6875 99.900  ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 3.300 ? 1.190 ? ? ? ? ? 14 1 ? ? 
4.180 4.440  ? ? ? ? ? ? 6862 99.900  ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 3.500 ? 1.186 ? ? ? ? ? 15 1 ? ? 
4.440 4.790  ? ? ? ? ? ? 6891 99.900  ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 3.400 ? 1.205 ? ? ? ? ? 16 1 ? ? 
4.790 5.270  ? ? ? ? ? ? 6875 99.800  ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 3.500 ? 1.119 ? ? ? ? ? 17 1 ? ? 
5.270 6.030  ? ? ? ? ? ? 6894 99.900  ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 3.400 ? 1.097 ? ? ? ? ? 18 1 ? ? 
6.030 7.590  ? ? ? ? ? ? 6977 99.900  ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 3.400 ? 1.089 ? ? ? ? ? 19 1 ? ? 
7.590 50.000 ? ? ? ? ? ? 7067 99.900  ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 3.300 ? 1.040 ? ? ? ? ? 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                219.020 
_refine.B_iso_mean                               88.4546 
_refine.B_iso_min                                35.670 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6KQG 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.7830 
_refine.ls_d_res_low                             49.0290 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     136907 
_refine.ls_number_reflns_R_free                  6825 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.2200 
_refine.ls_percent_reflns_R_free                 4.9900 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2070 
_refine.ls_R_factor_R_free                       0.2479 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2048 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4G7H 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.5800 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4100 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.7830 
_refine_hist.d_res_low                        49.0290 
_refine_hist.number_atoms_solvent             220 
_refine_hist.number_atoms_total               28772 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       3532 
_refine_hist.pdbx_B_iso_mean_ligand           81.27 
_refine_hist.pdbx_B_iso_mean_solvent          73.42 
_refine_hist.pdbx_number_atoms_protein        27557 
_refine_hist.pdbx_number_atoms_nucleic_acid   989 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.7830 2.8142  . . 127 2289 53.0000  . . . 0.4029 0.0000 0.3665 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8142 2.8473  . . 209 4343 99.0000  . . . 0.3900 0.0000 0.3338 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8473 2.8820  . . 228 4374 99.0000  . . . 0.3342 0.0000 0.3043 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8820 2.9185  . . 244 4356 100.0000 . . . 0.3331 0.0000 0.2992 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9185 2.9569  . . 236 4340 99.0000  . . . 0.3565 0.0000 0.2937 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9569 2.9974  . . 229 4391 100.0000 . . . 0.3527 0.0000 0.2935 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9974 3.0402  . . 220 4380 100.0000 . . . 0.3470 0.0000 0.2845 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0402 3.0856  . . 232 4397 100.0000 . . . 0.3410 0.0000 0.2835 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0856 3.1338  . . 228 4382 100.0000 . . . 0.3112 0.0000 0.2686 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1338 3.1852  . . 240 4389 100.0000 . . . 0.3244 0.0000 0.2611 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1852 3.2401  . . 226 4417 100.0000 . . . 0.3118 0.0000 0.2637 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2401 3.2990  . . 231 4394 100.0000 . . . 0.3321 0.0000 0.2476 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2990 3.3624  . . 240 4332 100.0000 . . . 0.2956 0.0000 0.2417 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3624 3.4311  . . 223 4436 100.0000 . . . 0.2798 0.0000 0.2403 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4311 3.5056  . . 231 4346 100.0000 . . . 0.3095 0.0000 0.2306 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5056 3.5872  . . 229 4412 100.0000 . . . 0.2586 0.0000 0.2248 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5872 3.6769  . . 237 4413 100.0000 . . . 0.3195 0.0000 0.2243 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6769 3.7762  . . 228 4436 100.0000 . . . 0.2873 0.0000 0.2207 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7762 3.8873  . . 235 4367 100.0000 . . . 0.2639 0.0000 0.2161 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8873 4.0127  . . 230 4426 100.0000 . . . 0.2379 0.0000 0.2035 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0127 4.1561  . . 224 4389 100.0000 . . . 0.2527 0.0000 0.1875 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1561 4.3224  . . 240 4403 100.0000 . . . 0.2252 0.0000 0.1861 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3224 4.5190  . . 225 4411 100.0000 . . . 0.2303 0.0000 0.1788 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5190 4.7570  . . 237 4434 100.0000 . . . 0.2297 0.0000 0.1782 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7570 5.0548  . . 224 4423 100.0000 . . . 0.2146 0.0000 0.1758 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0548 5.4446  . . 239 4426 100.0000 . . . 0.2316 0.0000 0.1848 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.4446 5.9917  . . 233 4439 100.0000 . . . 0.2592 0.0000 0.1915 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.9917 6.8567  . . 239 4452 100.0000 . . . 0.2320 0.0000 0.1919 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.8567 8.6310  . . 224 4515 100.0000 . . . 0.2038 0.0000 0.1673 . . . . . . . . . . 
'X-RAY DIFFRACTION' 8.6310 49.0290 . . 237 4570 100.0000 . . . 0.1585 0.0000 0.1688 . . . . . . . . . . 
# 
_struct.entry_id                     6KQG 
_struct.title                        
;Thermus thermophilus initial transcription complex comprising sigma A and 5'-OH RNA of 6 nt
;
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6KQG 
_struct_keywords.text            'Thermus thermophilus, RNA polymerase, transcription initiation complex, 6nt RNA, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 9  ? 
K N N 10 ? 
L N N 10 ? 
M N N 9  ? 
N N N 9  ? 
O N N 9  ? 
P N N 11 ? 
Q N N 11 ? 
R N N 11 ? 
S N N 11 ? 
T N N 11 ? 
U N N 11 ? 
V N N 11 ? 
W N N 11 ? 
X N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   AA2 ASP A 74   ? GLU A 84   ? ASP A 74   GLU A 84   1 ? 11 
HELX_P HELX_P3   AA3 ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   AA4 PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   AA5 THR A 206  ? TYR A 224  ? THR A 206  TYR A 224  1 ? 19 
HELX_P HELX_P6   AA6 GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P7   AA7 ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P8   AA8 ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P9   AA9 PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P10  AB1 THR B 206  ? THR B 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P11  AB2 TYR B 224  ? SER B 226  ? TYR B 224  SER B 226  5 ? 3  
HELX_P HELX_P12  AB3 THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P13  AB4 PRO C 35   ? ARG C 39   ? PRO C 35   ARG C 39   5 ? 5  
HELX_P HELX_P14  AB5 VAL C 42   ? PHE C 52   ? VAL C 42   PHE C 52   1 ? 11 
HELX_P HELX_P15  AB6 PRO C 79   ? LYS C 86   ? PRO C 79   LYS C 86   1 ? 8  
HELX_P HELX_P16  AB7 LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P17  AB8 ASP C 203  ? GLY C 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P18  AB9 LEU C 217  ? MET C 222  ? LEU C 217  MET C 222  5 ? 6  
HELX_P HELX_P19  AC1 ASP C 223  ? ALA C 228  ? ASP C 223  ALA C 228  1 ? 6  
HELX_P HELX_P20  AC2 ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P21  AC3 LYS C 249  ? ALA C 262  ? LYS C 249  ALA C 262  1 ? 14 
HELX_P HELX_P22  AC4 GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P23  AC5 VAL C 302  ? GLY C 316  ? VAL C 302  GLY C 316  1 ? 15 
HELX_P HELX_P24  AC6 THR C 335  ? MET C 361  ? THR C 335  MET C 361  1 ? 27 
HELX_P HELX_P25  AC7 THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P26  AC8 SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P27  AC9 ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P28  AD1 GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P29  AD2 HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P30  AD3 THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P31  AD4 SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P32  AD5 SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P33  AD6 ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P34  AD7 PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P35  AD8 ASP C 554  ? THR C 566  ? ASP C 554  THR C 566  1 ? 13 
HELX_P HELX_P36  AD9 LEU C 583  ? SER C 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P37  AE1 ASN C 683  ? ALA C 687  ? ASN C 683  ALA C 687  5 ? 5  
HELX_P HELX_P38  AE2 GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P39  AE3 SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  1 ? 6  
HELX_P HELX_P40  AE4 THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P41  AE5 PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P42  AE6 ASN C 872  ? VAL C 876  ? ASN C 872  VAL C 876  5 ? 5  
HELX_P HELX_P43  AE7 LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P44  AE8 LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P45  AE9 ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P46  AF1 THR C 958  ? GLN C 969  ? THR C 958  GLN C 969  1 ? 12 
HELX_P HELX_P47  AF2 MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P48  AF3 GLY C 1033 ? GLY C 1044 ? GLY C 1033 GLY C 1044 1 ? 12 
HELX_P HELX_P49  AF4 ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P50  AF5 ASP C 1059 ? LYS C 1072 ? ASP C 1059 LYS C 1072 1 ? 14 
HELX_P HELX_P51  AF6 PRO C 1082 ? LEU C 1095 ? PRO C 1082 LEU C 1095 1 ? 14 
HELX_P HELX_P52  AF7 SER D 14   ? TRP D 21   ? SER D 14   TRP D 21   1 ? 8  
HELX_P HELX_P53  AF8 LYS D 82   ? TYR D 88   ? LYS D 82   TYR D 88   5 ? 7  
HELX_P HELX_P54  AF9 ILE D 102  ? ASP D 107  ? ILE D 102  ASP D 107  1 ? 6  
HELX_P HELX_P55  AG1 SER D 110  ? LEU D 116  ? SER D 110  LEU D 116  1 ? 7  
HELX_P HELX_P56  AG2 SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P57  AG3 THR D 154  ? TYR D 163  ? THR D 154  TYR D 163  1 ? 10 
HELX_P HELX_P58  AG4 ASP D 372  ? GLU D 376  ? ASP D 372  GLU D 376  5 ? 5  
HELX_P HELX_P59  AG5 ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P60  AG6 MET D 456  ? LEU D 468  ? MET D 456  LEU D 468  1 ? 13 
HELX_P HELX_P61  AG7 ASP D 469  ? LYS D 482  ? ASP D 469  LYS D 482  1 ? 14 
HELX_P HELX_P62  AG8 SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P63  AG9 ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P64  AH1 PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P65  AH2 SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P66  AH3 PRO D 563  ? ASN D 584  ? PRO D 563  ASN D 584  1 ? 22 
HELX_P HELX_P67  AH4 SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P68  AH5 GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P69  AH6 LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P70  AH7 PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P71  AH8 ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P72  AH9 GLN D 680  ? ILE D 683  ? GLN D 680  ILE D 683  5 ? 4  
HELX_P HELX_P73  AI1 LYS D 684  ? ILE D 695  ? LYS D 684  ILE D 695  1 ? 12 
HELX_P HELX_P74  AI2 HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P75  AI3 HIS D 729  ? LEU D 731  ? HIS D 729  LEU D 731  5 ? 3  
HELX_P HELX_P76  AI4 VAL D 732  ? ASN D 737  ? VAL D 732  ASN D 737  1 ? 6  
HELX_P HELX_P77  AI5 SER D 752  ? GLN D 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P78  AI6 LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P79  AI7 SER D 782  ? GLN D 794  ? SER D 782  GLN D 794  1 ? 13 
HELX_P HELX_P80  AI8 THR D 808  ? ARG D 818  ? THR D 808  ARG D 818  1 ? 11 
HELX_P HELX_P81  AI9 VAL D 836  ? TYR D 841  ? VAL D 836  TYR D 841  1 ? 6  
HELX_P HELX_P82  AJ1 ASN D 845  ? GLY D 856  ? ASN D 845  GLY D 856  1 ? 12 
HELX_P HELX_P83  AJ2 SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P84  AJ3 ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P85  AJ4 GLU D 907  ? SER D 945  ? GLU D 907  SER D 945  1 ? 39 
HELX_P HELX_P86  AJ5 GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P87  AJ6 GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P88  AJ7 THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P89  AJ8 ASN D 1018 ? GLY D 1027 ? ASN D 1018 GLY D 1027 1 ? 10 
HELX_P HELX_P90  AJ9 ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P91  AK1 THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P92  AK2 LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P93  AK3 SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P94  AK4 GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P95  AK5 ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P96  AK6 PRO D 1232 ? LEU D 1236 ? PRO D 1232 LEU D 1236 5 ? 5  
HELX_P HELX_P97  AK7 GLN D 1254 ? GLU D 1264 ? GLN D 1254 GLU D 1264 1 ? 11 
HELX_P HELX_P98  AK8 ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P99  AK9 GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P100 AL1 HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P101 AL2 LYS D 1397 ? GLU D 1410 ? LYS D 1397 GLU D 1410 1 ? 14 
HELX_P HELX_P102 AL3 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P103 AL4 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P104 AL5 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P105 AL6 GLY D 1461 ? GLY D 1469 ? GLY D 1461 GLY D 1469 1 ? 9  
HELX_P HELX_P106 AL7 ALA D 1474 ? SER D 1478 ? ALA D 1474 SER D 1478 5 ? 5  
HELX_P HELX_P107 AL8 GLN D 1489 ? ALA D 1502 ? GLN D 1489 ALA D 1502 1 ? 14 
HELX_P HELX_P108 AL9 GLY E 5    ? VAL E 13   ? GLY E 5    VAL E 13   1 ? 9  
HELX_P HELX_P109 AM1 SER E 15   ? HIS E 33   ? SER E 15   HIS E 33   1 ? 19 
HELX_P HELX_P110 AM2 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P111 AM3 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P112 AM4 ASP F 99   ? VAL F 111  ? ASP F 79   VAL F 91   1 ? 13 
HELX_P HELX_P113 AM5 THR F 115  ? GLY F 141  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P114 AM6 ASP F 143  ? GLY F 157  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P115 AM7 ASP F 172  ? SER F 185  ? ASP F 152  SER F 165  1 ? 14 
HELX_P HELX_P116 AM8 PRO F 187  ? LYS F 220  ? PRO F 167  LYS F 200  1 ? 34 
HELX_P HELX_P117 AM9 SER F 228  ? PHE F 247  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P118 AN1 GLU F 248  ? ARG F 252  ? GLU F 228  ARG F 232  5 ? 5  
HELX_P HELX_P119 AN2 LYS F 254  ? ALA F 275  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P120 AN3 PRO F 281  ? GLY F 303  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P121 AN4 THR F 307  ? GLY F 316  ? THR F 287  GLY F 296  1 ? 10 
HELX_P HELX_P122 AN5 ASP F 320  ? ALA F 331  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P123 AN6 TYR F 349  ? ILE F 353  ? TYR F 329  ILE F 333  5 ? 5  
HELX_P HELX_P124 AN7 SER F 360  ? SER F 379  ? SER F 340  SER F 359  1 ? 20 
HELX_P HELX_P125 AN8 SER F 382  ? LYS F 393  ? SER F 362  LYS F 373  1 ? 12 
HELX_P HELX_P126 AN9 THR F 402  ? GLY F 411  ? THR F 382  GLY F 391  1 ? 10 
HELX_P HELX_P127 AO1 THR F 413  ? ARG F 436  ? THR F 393  ARG F 416  1 ? 24 
HELX_P HELX_P128 AO2 ARG F 439  ? ASP F 443  ? ARG F 419  ASP F 423  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B ASP 183  OD1   ? ? ? 1_555 J MG  .  MG ? ? B ASP 183  B MG  2001 1_555 ? ? ? ? ? ? ?                       
2.404 ? 
metalc2  metalc ? ? B ASP 191  O     ? ? ? 1_555 J MG  .  MG ? ? B ASP 191  B MG  2001 1_555 ? ? ? ? ? ? ?                       
2.628 ? 
metalc3  metalc ? ? B ASP 193  OD1   ? ? ? 1_555 J MG  .  MG ? ? B ASP 193  B MG  2001 1_555 ? ? ? ? ? ? ?                       
2.868 ? 
metalc4  metalc ? ? D CYS 58   SG    ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 58   D ZN  2002 1_555 ? ? ? ? ? ? ?                       
2.525 ? 
metalc5  metalc ? ? D CYS 60   SG    ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 60   D ZN  2002 1_555 ? ? ? ? ? ? ?                       
2.345 ? 
metalc6  metalc ? ? D CYS 73   SG    ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 73   D ZN  2002 1_555 ? ? ? ? ? ? ?                       
2.318 ? 
metalc7  metalc ? ? D CYS 76   SG    ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 76   D ZN  2002 1_555 ? ? ? ? ? ? ?                       
2.362 ? 
metalc8  metalc ? ? D ASP 739  OD1   ? ? ? 1_555 M MG  .  MG ? ? D ASP 739  D MG  2003 1_555 ? ? ? ? ? ? ?                       
2.052 ? 
metalc9  metalc ? ? D ASP 741  OD1   ? ? ? 1_555 M MG  .  MG ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?                       
2.169 ? 
metalc10 metalc ? ? D ASP 743  OD1   ? ? ? 1_555 M MG  .  MG ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?                       
2.154 ? 
metalc11 metalc ? ? D LYS 840  O     ? ? ? 1_555 N MG  .  MG ? ? D LYS 840  D MG  2004 1_555 ? ? ? ? ? ? ?                       
2.078 ? 
metalc12 metalc ? ? D CYS 1112 SG    ? ? ? 1_555 K ZN  .  ZN ? ? D CYS 1112 D ZN  2001 1_555 ? ? ? ? ? ? ?                       
2.321 ? 
metalc13 metalc ? ? D CYS 1194 SG    ? ? ? 1_555 K ZN  .  ZN ? ? D CYS 1194 D ZN  2001 1_555 ? ? ? ? ? ? ?                       
2.266 ? 
metalc14 metalc ? ? D CYS 1201 SG    ? ? ? 1_555 K ZN  .  ZN ? ? D CYS 1201 D ZN  2001 1_555 ? ? ? ? ? ? ?                       
2.259 ? 
metalc15 metalc ? ? D CYS 1204 SG    ? ? ? 1_555 K ZN  .  ZN ? ? D CYS 1204 D ZN  2001 1_555 ? ? ? ? ? ? ?                       
2.419 ? 
metalc16 metalc ? ? F ALA 312  O     ? ? ? 1_555 O MG  .  MG ? ? F ALA 292  F MG  2001 1_555 ? ? ? ? ? ? ?                       
2.852 ? 
metalc17 metalc ? ? F GLY 316  O     ? ? ? 1_555 O MG  .  MG ? ? F GLY 296  F MG  2001 1_555 ? ? ? ? ? ? ?                       
2.390 ? 
metalc18 metalc ? ? F TRP 319  O     ? ? ? 1_555 O MG  .  MG ? ? F TRP 299  F MG  2001 1_555 ? ? ? ? ? ? ?                       
2.972 ? 
metalc19 metalc ? ? I A   6    "O3'" ? ? ? 1_555 M MG  .  MG ? ? I A   7    D MG  2003 1_555 ? ? ? ? ? ? ?                       
2.259 ? 
metalc20 metalc ? ? M MG  .    MG    ? ? ? 1_555 S HOH .  O  ? ? D MG  2003 D HOH 2122 1_555 ? ? ? ? ? ? ?                       
1.871 ? 
metalc21 metalc ? ? M MG  .    MG    ? ? ? 1_555 S HOH .  O  ? ? D MG  2003 D HOH 2101 1_555 ? ? ? ? ? ? ?                       
2.137 ? 
metalc22 metalc ? ? N MG  .    MG    ? ? ? 1_555 Q HOH .  O  ? ? D MG  2004 B HOH 2103 1_555 ? ? ? ? ? ? ?                       
2.342 ? 
hydrog1  hydrog ? ? G DG  4    N1    ? ? ? 1_555 H DC  24 N3 ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog2  hydrog ? ? G DG  4    N2    ? ? ? 1_555 H DC  24 O2 ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog3  hydrog ? ? G DG  4    O6    ? ? ? 1_555 H DC  24 N4 ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog4  hydrog ? ? G DC  5    N3    ? ? ? 1_555 H DG  23 N1 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog5  hydrog ? ? G DC  5    N4    ? ? ? 1_555 H DG  23 O6 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog6  hydrog ? ? G DC  5    O2    ? ? ? 1_555 H DG  23 N2 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog7  hydrog ? ? G DA  6    N1    ? ? ? 1_555 H DT  22 N3 ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog8  hydrog ? ? G DA  6    N6    ? ? ? 1_555 H DT  22 O4 ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog9  hydrog ? ? G DT  7    N3    ? ? ? 1_555 H DA  21 N1 ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog10 hydrog ? ? G DT  7    O4    ? ? ? 1_555 H DA  21 N6 ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog11 hydrog ? ? G DC  8    N3    ? ? ? 1_555 H DG  20 N1 ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog12 hydrog ? ? G DC  8    N4    ? ? ? 1_555 H DG  20 O6 ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog13 hydrog ? ? G DC  8    O2    ? ? ? 1_555 H DG  20 N2 ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog14 hydrog ? ? G DC  9    N3    ? ? ? 1_555 H DG  19 N2 ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog15 hydrog ? ? G DC  9    O2    ? ? ? 1_555 H DG  19 N1 ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog16 hydrog ? ? G DG  10   N1    ? ? ? 1_555 H DC  18 O2 ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog17 hydrog ? ? G DG  10   N2    ? ? ? 1_555 H DC  18 N3 ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog18 hydrog ? ? G DT  11   N3    ? ? ? 1_555 H DA  17 N1 ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog19 hydrog ? ? G DT  11   O4    ? ? ? 1_555 H DA  17 N6 ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog20 hydrog ? ? G DG  12   N2    ? ? ? 1_555 H DC  16 O2 ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog21 hydrog ? ? G DA  13   N1    ? ? ? 1_555 H DT  15 N3 ? ? G DA  13   H DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog22 hydrog ? ? G DA  13   N6    ? ? ? 1_555 H DT  15 O4 ? ? G DA  13   H DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog23 hydrog ? ? G DG  14   N2    ? ? ? 1_555 I A   6  N1 ? ? G DG  14   I A   7    1_555 ? ? ? ? ? ? 'DG-A MISPAIR'          ? 
? 
hydrog24 hydrog ? ? G DT  15   N3    ? ? ? 1_555 I A   6  N1 ? ? G DT  15   I A   7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog25 hydrog ? ? G DT  15   O4    ? ? ? 1_555 I A   6  N6 ? ? G DT  15   I A   7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog26 hydrog ? ? G DC  16   N3    ? ? ? 1_555 I G   5  N1 ? ? G DC  16   I G   6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog27 hydrog ? ? G DC  16   N4    ? ? ? 1_555 I G   5  O6 ? ? G DC  16   I G   6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog28 hydrog ? ? G DC  16   O2    ? ? ? 1_555 I G   5  N2 ? ? G DC  16   I G   6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog29 hydrog ? ? G DG  17   N1    ? ? ? 1_555 I C   4  N3 ? ? G DG  17   I C   5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog30 hydrog ? ? G DG  17   N2    ? ? ? 1_555 I C   4  O2 ? ? G DG  17   I C   5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog31 hydrog ? ? G DG  17   O6    ? ? ? 1_555 I C   4  N4 ? ? G DG  17   I C   5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog32 hydrog ? ? G DA  18   N1    ? ? ? 1_555 I U   3  N3 ? ? G DA  18   I U   4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog33 hydrog ? ? G DA  18   N6    ? ? ? 1_555 I U   3  O4 ? ? G DA  18   I U   4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog34 hydrog ? ? G DG  19   N1    ? ? ? 1_555 I C   2  N3 ? ? G DG  19   I C   3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog35 hydrog ? ? G DG  19   N2    ? ? ? 1_555 I C   2  O2 ? ? G DG  19   I C   3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog36 hydrog ? ? G DG  19   O6    ? ? ? 1_555 I C   2  N4 ? ? G DG  19   I C   3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog37 hydrog ? ? G DG  20   N2    ? ? ? 1_555 I C   1  N3 ? ? G DG  20   I C   2    1_555 ? ? ? ? ? ? 'DG-C PAIR'             ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -3.33 
2 GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -4.93 
3 PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 2.38  
4 VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -4.51 
5 ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 2.12  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 4 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 6 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 5 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 8 ? 
AD2 ? 2 ? 
AD3 ? 3 ? 
AD4 ? 3 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 5 ? 
AD8 ? 4 ? 
AD9 ? 2 ? 
AE1 ? 3 ? 
AE2 ? 3 ? 
AE3 ? 4 ? 
AE4 ? 3 ? 
AE5 ? 4 ? 
AE6 ? 2 ? 
AE7 ? 3 ? 
AE8 ? 3 ? 
AE9 ? 3 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
AF4 ? 2 ? 
AF5 ? 4 ? 
AF6 ? 3 ? 
AF7 ? 2 ? 
AF8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? parallel      
AD1 6 7 ? anti-parallel 
AD1 7 8 ? parallel      
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? parallel      
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD7 4 5 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? parallel      
AE8 1 2 ? parallel      
AE8 2 3 ? anti-parallel 
AE9 1 2 ? parallel      
AE9 2 3 ? anti-parallel 
AF1 1 2 ? parallel      
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF5 3 4 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
AA1 2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
AA1 3 ARG A 189  ? THR A 201  ? ARG A 189  THR A 201  
AA1 4 VAL A 174  ? LEU A 186  ? VAL A 174  LEU A 186  
AA2 1 THR A 96   ? ALA A 103  ? THR A 96   ALA A 103  
AA2 2 LEU A 138  ? GLY A 147  ? LEU A 138  GLY A 147  
AA2 3 GLY A 50   ? ILE A 58   ? GLY A 50   ILE A 58   
AA2 4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
AA3 1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
AA3 2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
AA4 1 LYS A 107  ? LYS A 110  ? LYS A 107  LYS A 110  
AA4 2 HIS A 128  ? LEU A 132  ? HIS A 128  LEU A 132  
AA5 1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
AA5 2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
AA6 1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
AA6 2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
AA6 3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
AA6 4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
AA7 1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
AA7 2 ARG B 137  ? VAL B 148  ? ARG B 137  VAL B 148  
AA7 3 PRO B 49   ? ILE B 58   ? PRO B 49   ILE B 58   
AA7 4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
AA8 1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
AA8 2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
AA9 1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
AA9 2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
AB1 1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
AB1 2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
AB2 1 ILE C 3    ? ARG C 5    ? ILE C 3    ARG C 5    
AB2 2 ARG C 900  ? ILE C 902  ? ARG C 900  ILE C 902  
AB2 3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
AB3 1 ILE C 54   ? GLU C 55   ? ILE C 54   GLU C 55   
AB3 2 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
AB3 3 GLN C 91   ? ILE C 101  ? GLN C 91   ILE C 101  
AB3 4 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
AB4 1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
AB4 2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
AB4 3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
AB5 1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
AB5 2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
AB5 3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
AB5 4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
AB6 1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
AB6 2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
AB6 3 ILE C 172  ? VAL C 176  ? ILE C 172  VAL C 176  
AB6 4 VAL C 182  ? VAL C 186  ? VAL C 182  VAL C 186  
AB6 5 LYS C 190  ? PRO C 192  ? LYS C 190  PRO C 192  
AB7 1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
AB7 2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
AB8 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB8 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB8 3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
AB9 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB9 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB9 3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
AB9 4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
AB9 5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
AB9 6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
AC1 1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
AC1 2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
AC2 1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
AC2 2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
AC2 3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
AC3 1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
AC3 2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
AC3 3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
AC3 4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
AC4 1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
AC4 2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
AC5 1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
AC5 2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
AC6 1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
AC6 2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC6 3 LYS C 838  ? ASN C 841  ? LYS C 838  ASN C 841  
AC6 4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
AC6 5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
AC6 6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
AC6 7 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
AC6 8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC7 1 GLY C 718  ? PRO C 719  ? GLY C 718  PRO C 719  
AC7 2 SER C 702  ? THR C 715  ? SER C 702  THR C 715  
AC7 3 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
AC7 4 GLY C 798  ? ARG C 807  ? GLY C 798  ARG C 807  
AC7 5 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
AC8 1 ARG C 721  ? ILE C 722  ? ARG C 721  ILE C 722  
AC8 2 ARG C 758  ? PHE C 761  ? ARG C 758  PHE C 761  
AC8 3 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AC9 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AC9 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AD1 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AD1 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD1 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AD1 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AD1 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AD1 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AD1 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AD1 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD2 1 GLN C 1030 ? PHE C 1032 ? GLN C 1030 PHE C 1032 
AD2 2 LYS D 621  ? VAL D 623  ? LYS D 621  VAL D 623  
AD3 1 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD3 2 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD3 3 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AD4 1 SER D 22   ? GLU D 25   ? SER D 22   GLU D 25   
AD4 2 MET D 90   ? ALA D 100  ? MET D 90   ALA D 100  
AD4 3 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AD5 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AD5 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AD5 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AD6 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AD6 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AD7 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AD7 2 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AD7 3 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AD7 4 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AD7 5 ARG D 318  ? GLU D 327  ? ARG D 318  GLU D 327  
AD8 1 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AD8 2 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AD8 3 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AD8 4 ARG D 360  ? VAL D 361  ? ARG D 360  VAL D 361  
AD9 1 GLU D 190  ? ALA D 192  ? GLU D 190  ALA D 192  
AD9 2 VAL D 195  ? VAL D 196  ? VAL D 195  VAL D 196  
AE1 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE1 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE1 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AE2 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE2 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE2 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AE3 1 PRO D 278  ? LEU D 284  ? PRO D 278  LEU D 284  
AE3 2 ALA D 268  ? ARG D 273  ? ALA D 268  ARG D 273  
AE3 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AE3 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AE4 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AE4 2 LYS D 366  ? ALA D 369  ? LYS D 366  ALA D 369  
AE4 3 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AE5 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AE5 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AE5 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AE5 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AE6 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AE6 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AE7 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AE7 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AE7 3 VAL F 335  ? SER F 336  ? VAL F 315  SER F 316  
AE8 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AE8 2 PRO D 826  ? VAL D 829  ? PRO D 826  VAL D 829  
AE8 3 ARG D 832  ? SER D 835  ? ARG D 832  SER D 835  
AE9 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AE9 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AE9 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AF1 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AF1 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AF2 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AF2 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AF3 1 PHE D 1123 ? PRO D 1125 ? PHE D 1123 PRO D 1125 
AF3 2 LEU D 1132 ? LEU D 1134 ? LEU D 1132 LEU D 1134 
AF4 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AF4 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AF5 1 SER D 1300 ? LYS D 1304 ? SER D 1300 LYS D 1304 
AF5 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AF5 3 GLY D 1279 ? GLU D 1285 ? GLY D 1279 GLU D 1285 
AF5 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AF6 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AF6 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AF6 3 ALA D 1416 ? LEU D 1420 ? ALA D 1416 LEU D 1420 
AF7 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AF7 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
AF8 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AF8 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 14   ? N ARG A 14   O GLU A 22   ? O GLU A 22   
AA1 2 3 N LEU A 28   ? N LEU A 28   O ASP A 193  ? O ASP A 193  
AA1 3 4 O TRP A 200  ? O TRP A 200  N ARG A 176  ? N ARG A 176  
AA2 1 2 N VAL A 97   ? N VAL A 97   O VAL A 144  ? O VAL A 144  
AA2 2 3 O ARG A 143  ? O ARG A 143  N THR A 54   ? N THR A 54   
AA2 3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
AA3 1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
AA4 1 2 N LYS A 107  ? N LYS A 107  O LEU A 132  ? O LEU A 132  
AA5 1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
AA6 1 2 N GLN B 16   ? N GLN B 16   O TYR B 20   ? O TYR B 20   
AA6 2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
AA6 3 4 O THR B 196  ? O THR B 196  N GLN B 180  ? N GLN B 180  
AA7 1 2 N VAL B 97   ? N VAL B 97   O VAL B 144  ? O VAL B 144  
AA7 2 3 O GLY B 147  ? O GLY B 147  N GLY B 50   ? N GLY B 50   
AA7 3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
AA8 1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
AA9 1 2 N LYS B 107  ? N LYS B 107  O LEU B 132  ? O LEU B 132  
AB1 1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
AB2 1 2 N LYS C 4    ? N LYS C 4    O ARG C 900  ? O ARG C 900  
AB2 2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
AB3 1 2 N ILE C 54   ? N ILE C 54   O LEU C 66   ? O LEU C 66   
AB3 2 3 N GLU C 70   ? N GLU C 70   O ARG C 97   ? O ARG C 97   
AB3 3 4 N LEU C 100  ? N LEU C 100  O LYS C 109  ? O LYS C 109  
AB4 1 2 N ILE C 129  ? N ILE C 129  O ALA C 132  ? O ALA C 132  
AB4 2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
AB5 1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
AB5 2 3 N ILE C 140  ? N ILE C 140  O SER C 411  ? O SER C 411  
AB5 3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
AB6 1 2 N TYR C 147  ? N TYR C 147  O SER C 161  ? O SER C 161  
AB6 2 3 N ILE C 162  ? N ILE C 162  O ILE C 172  ? O ILE C 172  
AB6 3 4 N ASP C 173  ? N ASP C 173  O LYS C 185  ? O LYS C 185  
AB6 4 5 N MET C 184  ? N MET C 184  O PHE C 191  ? O PHE C 191  
AB7 1 2 N GLU C 294  ? N GLU C 294  O GLU C 297  ? O GLU C 297  
AB8 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB8 2 3 N ARG C 473  ? N ARG C 473  O THR C 480  ? O THR C 480  
AB9 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB9 2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
AB9 3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
AB9 4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
AB9 5 6 N ALA C 515  ? N ALA C 515  O VAL C 522  ? O VAL C 522  
AC1 1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
AC2 1 2 N LEU C 595  ? N LEU C 595  O LEU C 655  ? O LEU C 655  
AC2 2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
AC3 1 2 O TYR C 623  ? O TYR C 623  N ILE C 611  ? N ILE C 611  
AC3 2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
AC3 3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
AC4 1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
AC5 1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
AC6 1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
AC6 2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
AC6 3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
AC6 4 5 O ALA C 850  ? O ALA C 850  N ILE C 688  ? N ILE C 688  
AC6 5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
AC6 6 7 O LEU C 871  ? O LEU C 871  N ALA C 675  ? N ALA C 675  
AC6 7 8 N VAL C 674  ? N VAL C 674  O GLY C 990  ? O GLY C 990  
AC7 1 2 O GLY C 718  ? O GLY C 718  N THR C 715  ? N THR C 715  
AC7 2 3 N ALA C 712  ? N ALA C 712  O ARG C 820  ? O ARG C 820  
AC7 3 4 O ALA C 828  ? O ALA C 828  N ILE C 799  ? N ILE C 799  
AC7 4 5 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
AC8 1 2 N ARG C 721  ? N ARG C 721  O THR C 759  ? O THR C 759  
AC8 2 3 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AC9 1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AD1 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AD1 2 3 N SER D 629  ? N SER D 629  O MET D 745  ? O MET D 745  
AD1 3 4 O HIS D 748  ? O HIS D 748  N LEU D 701  ? N LEU D 701  
AD1 4 5 N LEU D 702  ? N LEU D 702  O GLN D 714  ? O GLN D 714  
AD1 5 6 O VAL D 719  ? O VAL D 719  N CYS D 642  ? N CYS D 642  
AD1 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AD1 7 8 O LEU D 728  ? O LEU D 728  N VAL D 632  ? N VAL D 632  
AD2 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD3 1 2 N GLN C 1100 ? N GLN C 1100 O ARG D 9    ? O ARG D 9    
AD3 2 3 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD4 1 2 N TYR D 23   ? N TYR D 23   O MET D 90   ? O MET D 90   
AD4 2 3 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AD5 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AD5 2 3 N ILE D 133  ? N ILE D 133  O ARG D 455  ? O ARG D 455  
AD6 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AD7 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AD7 2 3 O VAL D 396  ? O VAL D 396  N VAL D 202  ? N VAL D 202  
AD7 3 4 N LEU D 223  ? N LEU D 223  O LEU D 333  ? O LEU D 333  
AD7 4 5 O THR D 334  ? O THR D 334  N GLU D 323  ? N GLU D 323  
AD8 1 2 N VAL D 185  ? N VAL D 185  O GLY D 201  ? O GLY D 201  
AD8 2 3 N VAL D 202  ? N VAL D 202  O VAL D 396  ? O VAL D 396  
AD8 3 4 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AD9 1 2 N ALA D 192  ? N ALA D 192  O VAL D 195  ? O VAL D 195  
AE1 1 2 N LEU D 242  ? N LEU D 242  O LEU D 311  ? O LEU D 311  
AE1 2 3 O ALA D 307  ? O ALA D 307  N TYR D 249  ? N TYR D 249  
AE2 1 2 N LEU D 242  ? N LEU D 242  O LEU D 311  ? O LEU D 311  
AE2 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AE3 1 2 O TYR D 282  ? O TYR D 282  N LEU D 270  ? N LEU D 270  
AE3 2 3 O ARG D 273  ? O ARG D 273  N VAL D 258  ? N VAL D 258  
AE3 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AE4 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AE4 2 3 N VAL D 368  ? N VAL D 368  O VAL D 377  ? O VAL D 377  
AE5 1 2 N TYR D 401  ? N TYR D 401  O VAL D 444  ? O VAL D 444  
AE5 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AE5 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AE6 1 2 N ALA D 422  ? N ALA D 422  O VAL D 427  ? O VAL D 427  
AE7 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AE7 2 3 N THR D 537  ? N THR D 537  O VAL F 335  ? O VAL F 315  
AE8 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AE8 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AE9 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AE9 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AF1 1 2 N VAL D 1106 ? N VAL D 1106 O VAL D 1200 ? O VAL D 1200 
AF2 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AF3 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AF4 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AF5 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AF5 2 3 O GLU D 1295 ? O GLU D 1295 N VAL D 1280 ? N VAL D 1280 
AF5 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AF6 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AF6 2 3 N GLU D 1380 ? N GLU D 1380 O LYS D 1418 ? O LYS D 1418 
AF7 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
AF8 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B MG 2001 ? 3 'binding site for residue MG B 2001' 
AC2 Software D ZN 2001 ? 4 'binding site for residue ZN D 2001' 
AC3 Software D ZN 2002 ? 4 'binding site for residue ZN D 2002' 
AC4 Software D MG 2003 ? 6 'binding site for residue MG D 2003' 
AC5 Software D MG 2004 ? 4 'binding site for residue MG D 2004' 
AC6 Software F MG 2001 ? 3 'binding site for residue MG F 2001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 ASP B 183  ? ASP B 183  . ? 1_555 ? 
2  AC1 3 ASP B 191  ? ASP B 191  . ? 1_555 ? 
3  AC1 3 ASP B 193  ? ASP B 193  . ? 1_555 ? 
4  AC2 4 CYS D 1112 ? CYS D 1112 . ? 1_555 ? 
5  AC2 4 CYS D 1194 ? CYS D 1194 . ? 1_555 ? 
6  AC2 4 CYS D 1201 ? CYS D 1201 . ? 1_555 ? 
7  AC2 4 CYS D 1204 ? CYS D 1204 . ? 1_555 ? 
8  AC3 4 CYS D 58   ? CYS D 58   . ? 1_555 ? 
9  AC3 4 CYS D 60   ? CYS D 60   . ? 1_555 ? 
10 AC3 4 CYS D 73   ? CYS D 73   . ? 1_555 ? 
11 AC3 4 CYS D 76   ? CYS D 76   . ? 1_555 ? 
12 AC4 6 ASP D 739  ? ASP D 739  . ? 1_555 ? 
13 AC4 6 ASP D 741  ? ASP D 741  . ? 1_555 ? 
14 AC4 6 ASP D 743  ? ASP D 743  . ? 1_555 ? 
15 AC4 6 HOH S .    ? HOH D 2101 . ? 1_555 ? 
16 AC4 6 HOH S .    ? HOH D 2122 . ? 1_555 ? 
17 AC4 6 A   I 6    ? A   I 7    . ? 1_555 ? 
18 AC5 4 GLU B 154  ? GLU B 154  . ? 1_555 ? 
19 AC5 4 ASP B 168  ? ASP B 168  . ? 1_555 ? 
20 AC5 4 HOH Q .    ? HOH B 2103 . ? 1_555 ? 
21 AC5 4 LYS D 840  ? LYS D 840  . ? 1_555 ? 
22 AC6 3 ALA F 312  ? ALA F 292  . ? 1_555 ? 
23 AC6 3 GLY F 316  ? GLY F 296  . ? 1_555 ? 
24 AC6 3 TRP F 319  ? TRP F 299  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6KQG 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.005428 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000826 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009612 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003408 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1  4    ? -15.575 18.511  145.076 1.00 99.85  ? 4    SER A N     1 
ATOM   2     C  CA    . SER A 1  4    ? -15.817 17.461  144.095 1.00 109.59 ? 4    SER A CA    1 
ATOM   3     C  C     . SER A 1  4    ? -14.735 17.482  143.023 1.00 118.64 ? 4    SER A C     1 
ATOM   4     O  O     . SER A 1  4    ? -14.654 16.583  142.185 1.00 118.30 ? 4    SER A O     1 
ATOM   5     C  CB    . SER A 1  4    ? -17.202 17.621  143.458 1.00 112.74 ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A 1  4    ? -17.424 16.648  142.448 1.00 104.17 ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A 1  5    ? -13.909 18.525  143.055 1.00 119.80 ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A 1  5    ? -12.793 18.646  142.127 1.00 111.60 ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A 1  5    ? -11.614 17.824  142.629 1.00 110.34 ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A 1  5    ? -11.213 17.942  143.793 1.00 109.39 ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A 1  5    ? -12.390 20.114  141.970 1.00 109.46 ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A 1  5    ? -11.044 20.328  141.295 1.00 110.77 ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A 1  5    ? -11.045 19.814  139.864 1.00 110.99 ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A 1  5    ? -9.664  19.920  139.236 1.00 111.50 ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A 1  5    ? -9.108  21.299  139.322 1.00 115.05 ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A 1  6    ? -11.061 16.989  141.755 1.00 104.92 ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A 1  6    ? -9.896  16.217  142.148 1.00 98.58  ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A 1  6    ? -8.671  17.121  142.224 1.00 95.84  ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A 1  6    ? -8.625  18.201  141.631 1.00 97.94  ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A 1  6    ? -9.651  15.068  141.178 1.00 97.77  ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A 1  6    ? -9.343  13.783  141.940 1.00 97.65  ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A 1  6    ? -10.397 12.753  141.617 1.00 98.24  ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A 1  6    ? -7.951  13.292  141.610 1.00 93.71  ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A 1  7    ? -7.667  16.673  142.970 1.00 93.52  ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A 1  7    ? -6.512  17.512  143.245 1.00 93.79  ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A 1  7    ? -5.231  16.737  142.959 1.00 84.80  ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A 1  7    ? -5.262  15.558  142.594 1.00 78.44  ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A 1  7    ? -6.548  18.038  144.687 1.00 97.18  ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A 1  7    ? -7.776  18.890  144.976 1.00 100.93 ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A 1  7    ? -7.502  19.981  145.992 1.00 103.23 ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A 1  7    ? -8.720  20.880  146.151 1.00 104.49 ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A 1  7    ? -8.475  22.025  147.072 1.00 94.60  ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A 1  8    ? -4.104  17.422  143.163 1.00 78.28  ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A 1  8    ? -2.801  16.982  142.689 1.00 81.99  ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A 1  8    ? -2.543  15.520  143.051 1.00 88.25  ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A 1  8    ? -2.735  15.129  144.211 1.00 93.69  ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A 1  8    ? -1.704  17.871  143.276 1.00 87.91  ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A 1  9    ? -2.127  14.691  142.096 1.00 85.80  ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A 1  9    ? -1.937  13.262  142.350 1.00 81.12  ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A 1  9    ? -0.505  12.902  142.723 1.00 79.95  ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A 1  9    ? 0.446   13.645  142.468 1.00 76.35  ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A 1  9    ? -2.306  12.635  141.002 1.00 81.49  ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A 1  9    ? -1.848  13.644  140.017 1.00 85.67  ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A 1  9    ? -2.072  14.999  140.660 1.00 83.44  ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A 1  10   ? -0.370  11.715  143.319 1.00 82.51  ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A 1  10   ? 0.943   11.214  143.703 1.00 90.49  ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A 1  10   ? 1.707   10.777  142.456 1.00 86.94  ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A 1  10   ? 1.155   10.127  141.549 1.00 81.82  ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A 1  10   ? 0.822   10.091  144.753 1.00 86.95  ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A 1  10   ? 0.022   8.902   144.246 1.00 85.14  ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A 1  10   ? 2.201   9.637   145.230 1.00 83.66  ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A 1  11   ? 2.984   11.164  142.406 1.00 84.57  ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A 1  11   ? 3.872   10.992  141.262 1.00 82.84  ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A 1  11   ? 5.002   10.058  141.673 1.00 80.02  ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A 1  11   ? 5.939   10.473  142.361 1.00 86.33  ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A 1  11   ? 4.406   12.350  140.809 1.00 83.87  ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A 1  11   ? 5.505   12.274  139.782 1.00 92.81  ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A 1  11   ? 5.358   11.512  138.632 1.00 88.25  ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A 1  11   ? 6.685   12.981  139.957 1.00 100.48 ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A 1  11   ? 6.365   11.455  137.676 1.00 85.94  ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A 1  11   ? 7.700   12.927  139.001 1.00 94.27  ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A 1  11   ? 7.536   12.163  137.864 1.00 87.39  ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A 1  12   ? 4.921   8.807   141.238 1.00 77.60  ? 12   THR A N     1 
ATOM   64    C  CA    . THR A 1  12   ? 5.888   7.778   141.603 1.00 81.46  ? 12   THR A CA    1 
ATOM   65    C  C     . THR A 1  12   ? 6.943   7.631   140.510 1.00 80.88  ? 12   THR A C     1 
ATOM   66    O  O     . THR A 1  12   ? 6.626   7.709   139.321 1.00 82.43  ? 12   THR A O     1 
ATOM   67    C  CB    . THR A 1  12   ? 5.183   6.438   141.829 1.00 81.58  ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A 1  12   ? 4.019   6.643   142.642 1.00 78.54  ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1  12   ? 6.117   5.432   142.502 1.00 73.21  ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A 1  13   ? 8.194   7.404   140.912 1.00 81.00  ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A 1  13   ? 9.319   7.320   139.981 1.00 75.36  ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A 1  13   ? 10.089  6.038   140.258 1.00 81.28  ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A 1  13   ? 10.590  5.840   141.371 1.00 93.00  ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A 1  13   ? 10.255  8.534   140.095 1.00 70.56  ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1  13   ? 11.602  8.215   139.483 1.00 82.87  ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1  13   ? 9.641   9.744   139.422 1.00 73.25  ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A 1  14   ? 10.197  5.178   139.250 1.00 79.44  ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A 1  14   ? 10.991  3.961   139.327 1.00 80.66  ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A 1  14   ? 12.031  4.002   138.220 1.00 85.89  ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A 1  14   ? 11.747  4.479   137.121 1.00 88.93  ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A 1  14   ? 10.107  2.720   139.186 1.00 76.96  ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A 1  14   ? 8.821   2.808   139.990 1.00 78.78  ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A 1  14   ? 8.060   1.491   140.004 1.00 80.80  ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A 1  14   ? 6.999   1.441   139.001 1.00 82.89  ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A 1  14   ? 5.698   1.506   139.278 1.00 90.42  ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A 1  14   ? 5.288   1.625   140.536 1.00 94.62  ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A 1  14   ? 4.804   1.447   138.295 1.00 82.99  ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A 1  15   ? 13.245  3.533   138.505 1.00 88.27  ? 15   THR A N     1 
ATOM   89    C  CA    . THR A 1  15   ? 14.295  3.554   137.496 1.00 88.20  ? 15   THR A CA    1 
ATOM   90    C  C     . THR A 1  15   ? 15.054  2.234   137.492 1.00 92.25  ? 15   THR A C     1 
ATOM   91    O  O     . THR A 1  15   ? 15.108  1.523   138.499 1.00 92.43  ? 15   THR A O     1 
ATOM   92    C  CB    . THR A 1  15   ? 15.304  4.703   137.698 1.00 83.88  ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A 1  15   ? 16.501  4.192   138.300 1.00 87.47  ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A 1  15   ? 14.727  5.814   138.571 1.00 85.42  ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A 1  16   ? 15.632  1.915   136.334 1.00 94.34  ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A 1  16   ? 16.565  0.803   136.180 1.00 97.06  ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A 1  16   ? 17.743  1.329   135.371 1.00 96.36  ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A 1  16   ? 17.589  1.672   134.190 1.00 98.54  ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A 1  16   ? 15.908  -0.399  135.500 1.00 94.76  ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A 1  16   ? 14.702  -0.935  136.270 1.00 110.06 ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A 1  16   ? 14.325  -2.355  135.890 1.00 116.74 ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A 1  16   ? 15.047  -3.027  135.150 1.00 120.02 ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A 1  16   ? 13.188  -2.822  136.403 1.00 107.20 ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A 1  17   ? 18.904  1.417   136.023 1.00 93.34  ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A 1  17   ? 20.096  2.013   135.453 1.00 89.48  ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A 1  17   ? 19.844  3.396   134.890 1.00 91.96  ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A 1  17   ? 18.901  4.088   135.299 1.00 81.18  ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A 1  18   ? 20.694  3.812   133.950 1.00 93.97  ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A 1  18   ? 20.445  5.016   133.172 1.00 85.60  ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A 1  18   ? 19.565  4.753   131.960 1.00 85.70  ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A 1  18   ? 19.169  5.709   131.283 1.00 82.49  ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A 1  18   ? 21.766  5.641   132.708 1.00 81.68  ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A 1  18   ? 22.585  6.295   133.800 1.00 78.51  ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A 1  18   ? 23.782  7.046   133.230 1.00 76.01  ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A 1  18   ? 23.384  8.184   132.406 1.00 84.35  ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A 1  18   ? 23.390  9.450   132.818 1.00 92.15  ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A 1  18   ? 23.775  9.747   134.051 1.00 89.97  ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A 1  18   ? 23.006  10.421  131.996 1.00 89.07  ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A 1  19   ? 19.244  3.487   131.682 1.00 90.47  ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A 1  19   ? 18.585  3.113   130.437 1.00 89.57  ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A 1  19   ? 17.061  3.127   130.519 1.00 89.41  ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A 1  19   ? 16.408  3.408   129.509 1.00 92.03  ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A 1  19   ? 19.042  1.718   129.988 1.00 88.39  ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A 1  19   ? 20.519  1.400   130.239 1.00 101.10 ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A 1  19   ? 21.366  1.399   128.968 1.00 104.21 ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A 1  19   ? 21.295  2.381   128.200 1.00 103.48 ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A 1  19   ? 22.103  0.411   128.738 1.00 102.75 ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A 1  20   ? 16.464  2.816   131.672 1.00 89.22  ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A 1  20   ? 15.029  2.563   131.701 1.00 83.00  ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A 1  20   ? 14.367  3.270   132.875 1.00 88.40  ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A 1  20   ? 14.976  3.444   133.935 1.00 90.78  ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A 1  20   ? 14.751  1.059   131.768 1.00 81.39  ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A 1  20   ? 13.293  0.704   131.842 1.00 86.64  ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A 1  20   ? 12.434  0.985   130.789 1.00 83.87  ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A 1  20   ? 12.770  0.089   132.969 1.00 91.38  ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A 1  20   ? 11.093  0.657   130.854 1.00 81.85  ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A 1  20   ? 11.434  -0.247  133.044 1.00 86.32  ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A 1  20   ? 10.601  0.039   131.986 1.00 85.56  ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A 1  20   ? 9.274   -0.298  132.065 1.00 82.91  ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A 1  21   ? 13.098  3.648   132.688 1.00 85.32  ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A 1  21   ? 12.360  4.319   133.744 1.00 83.90  ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A 1  21   ? 10.861  4.177   133.607 1.00 86.00  ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A 1  21   ? 10.327  4.069   132.498 1.00 87.26  ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A 1  22   ? 10.175  4.180   134.755 1.00 82.91  ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A 1  22   ? 8.720   4.181   134.841 1.00 75.05  ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A 1  22   ? 8.276   5.367   135.680 1.00 73.40  ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A 1  22   ? 8.912   5.700   136.683 1.00 76.64  ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A 1  22   ? 8.180   2.891   135.458 1.00 70.40  ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A 1  22   ? 8.568   1.643   134.700 1.00 79.70  ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A 1  22   ? 7.853   0.416   135.210 1.00 85.99  ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A 1  22   ? 6.962   0.574   136.068 1.00 86.60  ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A 1  22   ? 8.179   -0.702  134.751 1.00 83.20  ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A 1  23   ? 7.199   6.019   135.254 1.00 67.99  ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A 1  23   ? 6.743   7.249   135.896 1.00 70.47  ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A 1  23   ? 5.229   7.186   136.016 1.00 82.43  ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A 1  23   ? 4.528   7.209   135.003 1.00 81.49  ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A 1  23   ? 7.182   8.480   135.105 1.00 72.52  ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A 1  23   ? 8.659   8.523   134.835 1.00 81.69  ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A 1  23   ? 9.208   7.791   133.792 1.00 75.50  ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A 1  23   ? 9.504   9.281   135.628 1.00 83.83  ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A 1  23   ? 10.564  7.812   133.549 1.00 76.49  ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A 1  23   ? 10.866  9.312   135.380 1.00 78.60  ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A 1  23   ? 11.393  8.575   134.340 1.00 78.72  ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A 1  24   ? 4.727   7.106   137.246 1.00 77.81  ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A 1  24   ? 3.310   6.907   137.508 1.00 74.61  ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A 1  24   ? 2.709   8.209   138.009 1.00 74.50  ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A 1  24   ? 3.342   8.951   138.767 1.00 79.86  ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A 1  24   ? 3.075   5.774   138.525 1.00 72.16  ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A 1  24   ? 1.588   5.464   138.642 1.00 70.11  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A 1  24   ? 3.856   4.538   138.125 1.00 71.75  ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A 1  25   ? 1.478   8.469   137.586 1.00 72.05  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A 1  25   ? 0.664   9.575   138.063 1.00 74.01  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A 1  25   ? -0.686  8.990   138.441 1.00 81.99  ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A 1  25   ? -1.371  8.419   137.579 1.00 80.29  ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A 1  25   ? 0.503   10.646  136.981 1.00 71.04  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A 1  25   ? 0.784   12.101  137.339 1.00 74.09  ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A 1  25   ? 2.228   12.264  137.705 1.00 68.42  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A 1  25   ? 0.423   13.011  136.184 1.00 74.40  ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A 1  26   ? -1.051  9.085   139.733 1.00 89.04  ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A 1  26   ? -2.409  8.653   140.126 1.00 81.89  ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A 1  26   ? -2.890  9.404   141.357 1.00 81.59  ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A 1  26   ? -2.081  9.697   142.245 1.00 85.51  ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A 1  26   ? -2.507  7.140   140.384 1.00 75.02  ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A 1  26   ? -1.624  6.553   141.463 1.00 70.34  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A 1  26   ? -1.870  5.053   141.626 1.00 80.89  ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A 1  26   ? -2.982  4.595   141.267 1.00 73.07  ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A 1  26   ? -0.957  4.333   142.097 1.00 74.57  ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A 1  27   ? -4.190  9.739   141.438 1.00 87.56  ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A 1  27   ? -5.174  9.490   140.382 1.00 82.35  ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A 1  27   ? -5.357  10.689  139.455 1.00 80.81  ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A 1  27   ? -4.921  11.794  139.774 1.00 78.31  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A 1  27   ? -6.452  9.217   141.171 1.00 82.43  ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A 1  27   ? -6.324  10.137  142.351 1.00 83.85  ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A 1  27   ? -4.838  10.242  142.665 1.00 89.50  ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A 1  28   ? -6.011  10.466  138.318 1.00 76.25  ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A 1  28   ? -6.312  11.527  137.372 1.00 73.39  ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A 1  28   ? -7.730  11.333  136.864 1.00 70.29  ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A 1  28   ? -8.225  10.204  136.786 1.00 69.87  ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A 1  28   ? -5.325  11.538  136.196 1.00 77.76  ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A 1  28   ? -3.872  11.894  136.506 1.00 74.21  ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A 1  28   ? -2.932  11.109  135.609 1.00 80.41  ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A 1  28   ? -3.636  13.394  136.351 1.00 73.96  ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A 1  29   ? -8.379  12.445  136.521 1.00 65.81  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A 1  29   ? -9.739  12.386  136.011 1.00 76.29  ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A 1  29   ? -9.793  11.523  134.754 1.00 82.06  ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A 1  29   ? -8.777  11.264  134.101 1.00 82.13  ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A 1  29   ? -10.273 13.792  135.718 1.00 77.03  ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A 1  29   ? -10.643 14.607  136.959 1.00 89.67  ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A 1  29   ? -11.878 14.075  137.681 1.00 95.98  ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A 1  29   ? -12.556 13.176  137.135 1.00 93.03  ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A 1  29   ? -12.172 14.558  138.799 1.00 97.71  ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A 1  30   ? -11.001 11.063  134.430 1.00 82.10  ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A 1  30   ? -11.194 10.171  133.295 1.00 77.66  ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A 1  30   ? -10.591 10.770  132.029 1.00 82.01  ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A 1  30   ? -10.702 11.973  131.775 1.00 81.25  ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A 1  30   ? -12.686 9.894   133.094 1.00 72.90  ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A 1  30   ? -12.994 8.554   132.448 1.00 80.05  ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A 1  30   ? -14.440 8.488   131.975 1.00 81.58  ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A 1  30   ? -15.004 9.819   131.757 1.00 86.25  ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A 1  30   ? -16.023 10.080  130.940 1.00 91.41  ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A 1  30   ? -16.591 9.103   130.240 1.00 83.66  ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A 1  30   ? -16.469 11.325  130.814 1.00 93.98  ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A 1  31   ? -9.917  9.922   131.247 1.00 80.25  ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A 1  31   ? -9.354  10.331  129.979 1.00 80.52  ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A 1  31   ? -8.056  11.101  130.053 1.00 76.97  ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A 1  31   ? -7.381  11.239  129.027 1.00 78.38  ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A 1  32   ? -7.675  11.615  131.221 1.00 74.82  ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A 1  32   ? -6.440  12.380  131.303 1.00 74.38  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A 1  32   ? -5.206  11.495  131.240 1.00 72.86  ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A 1  32   ? -4.106  12.007  131.004 1.00 70.82  ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A 1  32   ? -6.421  13.228  132.575 1.00 73.06  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A 1  32   ? -7.045  14.577  132.399 1.00 70.26  ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A 1  32   ? -8.414  14.701  132.233 1.00 69.79  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A 1  32   ? -6.265  15.722  132.390 1.00 69.16  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A 1  32   ? -8.995  15.939  132.063 1.00 63.18  ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A 1  32   ? -6.839  16.967  132.219 1.00 69.97  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A 1  32   ? -8.208  17.076  132.057 1.00 69.31  ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A 1  33   ? -5.360  10.186  131.437 1.00 75.06  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A 1  33   ? -4.256  9.285   131.160 1.00 73.75  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A 1  33   ? -3.768  9.426   129.734 1.00 77.34  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A 1  33   ? -2.587  9.670   129.491 1.00 78.92  ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A 1  34   ? -4.686  9.319   128.774 1.00 74.51  ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A 1  34   ? -4.343  9.528   127.371 1.00 73.06  ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A 1  34   ? -3.923  10.974  127.136 1.00 75.81  ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A 1  34   ? -2.884  11.240  126.518 1.00 79.30  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A 1  34   ? -5.529  9.131   126.472 1.00 66.59  ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A 1  34   ? -5.511  9.918   125.183 1.00 64.63  ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A 1  34   ? -5.506  7.637   126.187 1.00 66.35  ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A 1  35   ? -4.709  11.923  127.658 1.00 72.04  ? 35   THR A N     1 
ATOM   250   C  CA    . THR A 1  35   ? -4.473  13.340  127.400 1.00 71.76  ? 35   THR A CA    1 
ATOM   251   C  C     . THR A 1  35   ? -3.060  13.759  127.791 1.00 70.61  ? 35   THR A C     1 
ATOM   252   O  O     . THR A 1  35   ? -2.441  14.588  127.115 1.00 65.51  ? 35   THR A O     1 
ATOM   253   C  CB    . THR A 1  35   ? -5.517  14.175  128.144 1.00 72.12  ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A 1  35   ? -6.786  14.039  127.494 1.00 75.10  ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A 1  35   ? -5.130  15.646  128.175 1.00 69.28  ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A 1  36   ? -2.524  13.186  128.868 1.00 78.78  ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A 1  36   ? -1.175  13.528  129.308 1.00 73.99  ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A 1  36   ? -0.105  12.601  128.751 1.00 71.93  ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A 1  36   ? 1.015   13.056  128.499 1.00 75.19  ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A 1  36   ? -1.088  13.507  130.835 1.00 75.78  ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A 1  36   ? -1.446  14.778  131.588 1.00 78.98  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A 1  36   ? -1.277  14.545  133.086 1.00 85.17  ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A 1  36   ? -0.593  15.956  131.118 1.00 76.43  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A 1  37   ? -0.405  11.316  128.565 1.00 72.88  ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A 1  37   ? 0.610   10.376  128.154 1.00 75.12  ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A 1  37   ? 0.934   10.416  126.681 1.00 78.73  ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A 1  37   ? 2.095   10.230  126.304 1.00 79.67  ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A 1  38   ? -0.066  10.664  125.830 1.00 75.70  ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A 1  38   ? 0.213   10.620  124.396 1.00 78.21  ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A 1  38   ? 1.073   11.787  123.930 1.00 71.84  ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A 1  38   ? 2.081   11.542  123.244 1.00 69.39  ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A 1  38   ? -1.092  10.528  123.611 1.00 79.02  ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A 1  38   ? -0.855  10.154  122.184 1.00 68.84  ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A 1  38   ? -0.418  9.039   121.902 1.00 68.08  ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A 1  38   ? -1.123  11.081  121.269 1.00 64.59  ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A 1  39   ? 0.747   13.053  124.229 1.00 70.41  ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A 1  39   ? 1.631   14.145  123.787 1.00 70.95  ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A 1  39   ? 3.045   13.985  124.289 1.00 72.67  ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A 1  39   ? 4.005   14.244  123.551 1.00 76.80  ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A 1  39   ? 0.973   15.396  124.380 1.00 64.92  ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A 1  39   ? -0.386  15.001  124.662 1.00 64.04  ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A 1  39   ? -0.387  13.568  125.005 1.00 64.35  ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A 1  40   ? 3.199   13.568  125.544 1.00 72.43  ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A 1  40   ? 4.535   13.321  126.059 1.00 73.50  ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A 1  40   ? 5.234   12.250  125.242 1.00 71.34  ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A 1  40   ? 6.428   12.364  124.960 1.00 74.79  ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A 1  40   ? 4.477   12.928  127.535 1.00 79.09  ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A 1  40   ? 4.003   14.024  128.490 1.00 73.68  ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A 1  40   ? 3.989   13.495  129.912 1.00 75.98  ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A 1  40   ? 4.862   15.279  128.373 1.00 71.19  ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A 1  41   ? 4.504   11.212  124.829 1.00 71.66  ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A 1  41   ? 5.134   10.156  124.042 1.00 71.87  ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A 1  41   ? 5.614   10.693  122.703 1.00 70.97  ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A 1  41   ? 6.737   10.404  122.272 1.00 72.65  ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A 1  41   ? 4.172   8.993   123.828 1.00 69.65  ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A 1  41   ? 4.663   8.042   122.766 1.00 67.79  ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A 1  41   ? 3.984   6.705   122.843 1.00 69.87  ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A 1  41   ? 4.575   5.790   121.878 1.00 71.72  ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A 1  41   ? 4.202   5.714   120.607 1.00 74.76  ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A 1  41   ? 3.229   6.499   120.159 1.00 75.75  ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A 1  41   ? 4.800   4.858   119.787 1.00 69.00  ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A 1  42   ? 4.767   11.474  122.028 1.00 66.03  ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A 1  42   ? 5.158   12.053  120.747 1.00 72.48  ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A 1  42   ? 6.391   12.943  120.895 1.00 77.43  ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A 1  42   ? 7.344   12.845  120.102 1.00 75.63  ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A 1  42   ? 3.975   12.820  120.150 1.00 66.62  ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A 1  42   ? 2.770   11.915  119.877 1.00 63.38  ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A 1  42   ? 1.556   12.679  119.368 1.00 62.17  ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A 1  42   ? 1.899   13.626  118.315 1.00 68.59  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A 1  42   ? 2.060   13.299  117.035 1.00 75.70  ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A 1  42   ? 1.909   12.040  116.634 1.00 68.14  ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A 1  42   ? 2.378   14.235  116.152 1.00 72.64  ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A 1  43   ? 6.409   13.788  121.932 1.00 73.28  ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A 1  43   ? 7.546   14.681  122.146 1.00 72.77  ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A 1  43   ? 8.800   13.884  122.495 1.00 71.97  ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A 1  43   ? 9.909   14.230  122.069 1.00 68.15  ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A 1  43   ? 7.208   15.721  123.228 1.00 67.37  ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A 1  43   ? 6.014   16.570  122.786 1.00 70.27  ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A 1  43   ? 8.405   16.607  123.505 1.00 68.40  ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A 1  43   ? 5.684   17.706  123.717 1.00 70.27  ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A 1  44   ? 8.644   12.801  123.263 1.00 67.66  ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A 1  44   ? 9.783   11.965  123.625 1.00 68.71  ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A 1  44   ? 10.375  11.280  122.400 1.00 73.29  ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A 1  44   ? 11.601  11.164  122.273 1.00 72.40  ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A 1  44   ? 9.362   10.924  124.670 1.00 70.93  ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A 1  44   ? 9.100   11.330  126.126 1.00 72.18  ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A 1  44   ? 8.396   10.199  126.854 1.00 71.71  ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A 1  44   ? 10.379  11.717  126.860 1.00 64.20  ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A 1  45   ? 9.522   10.818  121.487 1.00 69.90  ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A 1  45   ? 10.020  10.142  120.301 1.00 66.60  ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A 1  45   ? 10.582  11.110  119.269 1.00 75.42  ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A 1  45   ? 11.403  10.696  118.440 1.00 68.67  ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A 1  45   ? 8.918   9.283   119.679 1.00 59.95  ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A 1  45   ? 8.536   8.056   120.515 1.00 61.86  ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A 1  45   ? 7.401   7.267   119.875 1.00 62.09  ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A 1  45   ? 9.737   7.155   120.763 1.00 58.05  ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A 1  46   ? 10.208  12.391  119.316 1.00 71.20  ? 46   SER A N     1 
ATOM   338   C  CA    . SER A 1  46   ? 10.631  13.307  118.265 1.00 67.68  ? 46   SER A CA    1 
ATOM   339   C  C     . SER A 1  46   ? 11.669  14.329  118.713 1.00 68.03  ? 46   SER A C     1 
ATOM   340   O  O     . SER A 1  46   ? 12.744  14.402  118.112 1.00 72.60  ? 46   SER A O     1 
ATOM   341   C  CB    . SER A 1  46   ? 9.412   14.027  117.683 1.00 66.47  ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A 1  46   ? 9.126   15.196  118.423 1.00 72.43  ? 46   SER A OG    1 
ATOM   343   N  N     . SER A 1  47   ? 11.395  15.117  119.756 1.00 69.75  ? 47   SER A N     1 
ATOM   344   C  CA    . SER A 1  47   ? 12.082  16.390  119.959 1.00 63.85  ? 47   SER A CA    1 
ATOM   345   C  C     . SER A 1  47   ? 13.088  16.387  121.114 1.00 66.46  ? 47   SER A C     1 
ATOM   346   O  O     . SER A 1  47   ? 13.477  17.459  121.589 1.00 58.38  ? 47   SER A O     1 
ATOM   347   C  CB    . SER A 1  47   ? 11.063  17.500  120.180 1.00 61.00  ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A 1  47   ? 10.259  17.646  119.014 1.00 79.98  ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A 1  48   ? 13.552  15.219  121.545 1.00 65.75  ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A 1  48   ? 14.482  15.109  122.669 1.00 67.05  ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A 1  48   ? 15.908  15.205  122.121 1.00 73.56  ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A 1  48   ? 16.320  14.328  121.345 1.00 73.59  ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A 1  48   ? 14.289  13.796  123.440 1.00 70.78  ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A 1  48   ? 12.933  13.780  124.099 1.00 69.55  ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A 1  48   ? 15.361  13.647  124.497 1.00 69.20  ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A 1  48   ? 12.605  15.045  124.860 1.00 68.38  ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A 1  49   ? 16.675  16.232  122.488 1.00 75.07  ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A 1  49   ? 18.040  16.363  121.959 1.00 74.22  ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A 1  49   ? 18.948  15.238  122.429 1.00 74.66  ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A 1  49   ? 18.668  14.537  123.404 1.00 79.16  ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A 1  49   ? 18.503  17.720  122.507 1.00 70.17  ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A 1  49   ? 17.237  18.472  122.759 1.00 70.58  ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A 1  49   ? 16.247  17.435  123.213 1.00 74.82  ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A 1  50   ? 20.045  15.068  121.700 1.00 79.52  ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A 1  50   ? 20.999  14.024  122.017 1.00 77.75  ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A 1  50   ? 22.238  14.123  121.153 1.00 84.42  ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A 1  50   ? 22.565  15.185  120.615 1.00 81.57  ? 50   GLY A O     1 
ATOM   368   N  N     . THR A 1  51   ? 22.929  12.992  121.028 1.00 80.73  ? 51   THR A N     1 
ATOM   369   C  CA    . THR A 1  51   ? 24.197  12.927  120.323 1.00 84.21  ? 51   THR A CA    1 
ATOM   370   C  C     . THR A 1  51   ? 24.152  11.824  119.275 1.00 85.30  ? 51   THR A C     1 
ATOM   371   O  O     . THR A 1  51   ? 23.342  10.892  119.355 1.00 83.25  ? 51   THR A O     1 
ATOM   372   C  CB    . THR A 1  51   ? 25.366  12.688  121.293 1.00 81.59  ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A 1  51   ? 25.121  11.499  122.056 1.00 68.62  ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A 1  51   ? 25.533  13.870  122.235 1.00 73.47  ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A 1  52   ? 25.033  11.957  118.279 1.00 82.46  ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A 1  52   ? 25.167  10.989  117.193 1.00 82.81  ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A 1  52   ? 26.412  11.294  116.373 1.00 80.80  ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A 1  52   ? 26.807  12.457  116.233 1.00 80.63  ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A 1  52   ? 23.934  10.993  116.279 1.00 80.85  ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A 1  53   ? 27.007  10.237  115.820 1.00 79.45  ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A 1  53   ? 28.146  10.396  114.922 1.00 84.50  ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A 1  53   ? 27.674  11.064  113.640 1.00 77.13  ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A 1  53   ? 26.743  10.580  112.984 1.00 72.23  ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A 1  53   ? 28.803  9.046   114.618 1.00 76.98  ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A 1  53   ? 29.889  9.218   113.596 1.00 76.43  ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A 1  53   ? 29.367  8.440   115.873 1.00 84.61  ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A 1  54   ? 28.318  12.183  113.278 1.00 74.77  ? 54   THR A N     1 
ATOM   388   C  CA    . THR A 1  54   ? 28.001  12.901  112.048 1.00 77.92  ? 54   THR A CA    1 
ATOM   389   C  C     . THR A 1  54   ? 29.067  12.802  110.964 1.00 81.68  ? 54   THR A C     1 
ATOM   390   O  O     . THR A 1  54   ? 28.759  13.107  109.807 1.00 80.47  ? 54   THR A O     1 
ATOM   391   C  CB    . THR A 1  54   ? 27.745  14.391  112.327 1.00 75.77  ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A 1  54   ? 28.934  14.994  112.852 1.00 74.45  ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A 1  54   ? 26.604  14.565  113.310 1.00 76.62  ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A 1  55   ? 30.300  12.403  111.289 1.00 83.07  ? 55   SER A N     1 
ATOM   395   C  CA    . SER A 1  55   ? 31.281  12.269  110.211 1.00 76.03  ? 55   SER A CA    1 
ATOM   396   C  C     . SER A 1  55   ? 32.359  11.262  110.589 1.00 75.61  ? 55   SER A C     1 
ATOM   397   O  O     . SER A 1  55   ? 32.631  11.044  111.767 1.00 75.25  ? 55   SER A O     1 
ATOM   398   C  CB    . SER A 1  55   ? 31.920  13.618  109.860 1.00 79.24  ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A 1  55   ? 32.753  13.495  108.720 1.00 82.13  ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A 1  56   ? 32.973  10.653  109.572 1.00 74.16  ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A 1  56   ? 34.014  9.644   109.769 1.00 80.08  ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A 1  56   ? 35.125  9.872   108.749 1.00 81.89  ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A 1  56   ? 34.859  9.941   107.544 1.00 80.63  ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A 1  56   ? 33.470  8.205   109.632 1.00 77.29  ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A 1  56   ? 34.592  7.179   109.801 1.00 69.35  ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A 1  56   ? 32.364  7.945   110.634 1.00 84.88  ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A 1  57   ? 36.368  9.975   109.221 1.00 78.35  ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A 1  57   ? 37.535  9.995   108.346 1.00 86.70  ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A 1  57   ? 38.423  8.809   108.680 1.00 85.41  ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A 1  57   ? 38.901  8.688   109.809 1.00 90.52  ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A 1  57   ? 38.335  11.293  108.474 1.00 89.09  ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A 1  57   ? 39.708  11.175  107.843 1.00 96.62  ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A 1  57   ? 39.865  11.195  106.460 1.00 96.50  ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A 1  57   ? 40.845  11.017  108.626 1.00 102.26 ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A 1  57   ? 41.121  11.076  105.878 1.00 99.28  ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A 1  57   ? 42.103  10.895  108.051 1.00 102.30 ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A 1  57   ? 42.233  10.926  106.681 1.00 98.52  ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A 1  57   ? 43.480  10.806  106.118 1.00 104.76 ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A 1  58   ? 38.656  7.949   107.698 1.00 83.93  ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A 1  58   ? 39.571  6.827   107.838 1.00 88.34  ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A 1  58   ? 40.772  7.088   106.945 1.00 93.95  ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A 1  58   ? 40.620  7.520   105.796 1.00 95.75  ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A 1  58   ? 38.893  5.490   107.481 1.00 89.23  ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A 1  58   ? 37.645  5.286   108.342 1.00 86.98  ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A 1  58   ? 39.865  4.335   107.656 1.00 87.50  ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A 1  58   ? 36.870  4.019   108.022 1.00 87.07  ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A 1  59   ? 41.963  6.844   107.481 1.00 96.24  ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A 1  59   ? 43.184  7.049   106.718 1.00 98.91  ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A 1  59   ? 43.261  6.049   105.568 1.00 98.75  ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A 1  59   ? 42.915  4.872   105.722 1.00 96.32  ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A 1  59   ? 44.398  6.915   107.636 1.00 98.42  ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A 1  59   ? 45.730  7.205   106.971 1.00 108.97 ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A 1  59   ? 46.901  6.979   107.906 1.00 108.98 ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A 1  59   ? 46.702  7.095   109.135 1.00 107.61 ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A 1  59   ? 48.014  6.681   107.413 1.00 105.88 ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A 1  60   ? 43.699  6.537   104.402 1.00 96.79  ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A 1  60   ? 43.823  5.734   103.180 1.00 97.45  ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A 1  60   ? 42.468  5.243   102.678 1.00 96.94  ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A 1  60   ? 42.372  4.183   102.054 1.00 98.44  ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A 1  60   ? 44.778  4.553   103.377 1.00 97.76  ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A 1  60   ? 46.168  4.994   103.783 1.00 106.47 ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A 1  60   ? 46.636  6.033   103.265 1.00 104.88 ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A 1  60   ? 46.788  4.306   104.625 1.00 111.99 ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A 1  61   ? 41.414  6.009   102.946 1.00 94.90  ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A 1  61   ? 40.065  5.708   102.481 1.00 86.01  ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A 1  61   ? 39.487  6.988   101.901 1.00 85.76  ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A 1  61   ? 39.381  8.000   102.604 1.00 85.34  ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A 1  61   ? 39.170  5.163   103.605 1.00 81.55  ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A 1  61   ? 37.733  5.099   103.144 1.00 81.25  ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A 1  61   ? 39.643  3.785   104.033 1.00 85.36  ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A 1  62   ? 39.123  6.948   100.620 1.00 86.85  ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A 1  62   ? 38.711  8.150   99.911  1.00 84.22  ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A 1  62   ? 37.212  8.408   99.971  1.00 85.03  ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A 1  62   ? 36.786  9.555   99.792  1.00 86.07  ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A 1  62   ? 39.156  8.059   98.452  1.00 78.87  ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A 1  62   ? 40.670  8.115   98.243  1.00 79.04  ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A 1  62   ? 41.043  7.761   96.810  1.00 77.07  ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A 1  62   ? 41.192  9.496   98.612  1.00 73.65  ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A 1  63   ? 36.408  7.381   100.223 1.00 80.06  ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A 1  63   ? 34.960  7.502   100.137 1.00 75.07  ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A 1  63   ? 34.333  6.273   100.775 1.00 77.92  ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A 1  63   ? 35.017  5.300   101.105 1.00 73.84  ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A 1  63   ? 34.500  7.634   98.690  1.00 73.08  ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A 1  63   ? 34.917  6.484   97.833  1.00 77.08  ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A 1  63   ? 34.472  5.196   98.047  1.00 78.23  ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A 1  63   ? 35.758  6.421   96.775  1.00 77.01  ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A 1  63   ? 35.012  4.392   97.150  1.00 78.49  ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A 1  63   ? 35.794  5.111   96.364  1.00 80.00  ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A 1  64   ? 33.002  6.311   100.881 1.00 78.58  ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A 1  64   ? 32.260  5.332   101.670 1.00 76.97  ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A 1  64   ? 32.346  3.925   101.089 1.00 74.84  ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A 1  64   ? 32.251  2.940   101.830 1.00 70.71  ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A 1  64   ? 30.802  5.778   101.770 1.00 78.46  ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A 1  64   ? 29.949  5.021   102.768 1.00 82.91  ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A 1  64   ? 28.642  5.743   103.040 1.00 91.70  ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A 1  64   ? 28.368  6.743   102.335 1.00 91.94  ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A 1  64   ? 27.898  5.321   103.954 1.00 85.61  ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A 1  65   ? 32.532  3.805   99.779  1.00 76.66  ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A 1  65   ? 32.437  2.524   99.097  1.00 75.42  ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A 1  65   ? 33.770  1.805   99.013  1.00 77.92  ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A 1  65   ? 33.989  1.030   98.076  1.00 72.95  ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A 1  65   ? 31.845  2.732   97.708  1.00 73.11  ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A 1  65   ? 30.576  3.514   97.730  1.00 67.22  ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A 1  65   ? 30.595  4.896   97.630  1.00 68.50  ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A 1  65   ? 29.361  2.873   97.882  1.00 63.26  ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A 1  65   ? 29.419  5.622   97.664  1.00 67.95  ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A 1  65   ? 28.181  3.592   97.915  1.00 65.03  ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A 1  65   ? 28.210  4.968   97.803  1.00 64.87  ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A 1  66   ? 34.655  2.043   99.975  1.00 76.55  ? 66   SER A N     1 
ATOM   490   C  CA    . SER A 1  66   ? 35.986  1.468   99.993  1.00 72.18  ? 66   SER A CA    1 
ATOM   491   C  C     . SER A 1  66   ? 36.015  0.171   100.804 1.00 69.61  ? 66   SER A C     1 
ATOM   492   O  O     . SER A 1  66   ? 35.015  -0.259  101.380 1.00 75.98  ? 66   SER A O     1 
ATOM   493   C  CB    . SER A 1  66   ? 36.972  2.492   100.551 1.00 79.29  ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A 1  66   ? 36.737  3.777   99.997  1.00 81.02  ? 66   SER A OG    1 
ATOM   495   N  N     . THR A 1  67   ? 37.176  -0.481  100.815 1.00 78.59  ? 67   THR A N     1 
ATOM   496   C  CA    . THR A 1  67   ? 37.526  -1.517  101.781 1.00 77.61  ? 67   THR A CA    1 
ATOM   497   C  C     . THR A 1  67   ? 38.896  -1.167  102.347 1.00 85.38  ? 67   THR A C     1 
ATOM   498   O  O     . THR A 1  67   ? 39.517  -0.176  101.948 1.00 90.22  ? 67   THR A O     1 
ATOM   499   C  CB    . THR A 1  67   ? 37.534  -2.925  101.164 1.00 70.89  ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A 1  67   ? 38.506  -2.989  100.113 1.00 91.48  ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A 1  67   ? 36.165  -3.287  100.610 1.00 71.59  ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A 1  68   ? 39.377  -1.972  103.288 1.00 85.28  ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A 1  68   ? 40.693  -1.722  103.872 1.00 85.43  ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A 1  68   ? 41.458  -3.036  103.934 1.00 86.66  ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A 1  68   ? 40.881  -4.064  104.317 1.00 87.69  ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A 1  68   ? 40.588  -1.090  105.269 1.00 91.79  ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A 1  68   ? 39.719  0.167   105.238 1.00 88.43  ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A 1  68   ? 41.974  -0.752  105.801 1.00 92.90  ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A 1  68   ? 39.581  0.838   106.583 1.00 90.53  ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A 1  69   ? 42.735  -3.059  103.558 1.00 93.09  ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A 1  69   ? 43.520  -4.290  103.704 1.00 87.22  ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A 1  69   ? 43.622  -4.682  105.169 1.00 92.40  ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A 1  69   ? 43.872  -3.843  106.039 1.00 91.70  ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A 1  69   ? 44.884  -3.913  103.118 1.00 83.73  ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A 1  69   ? 44.614  -2.733  102.246 1.00 85.71  ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A 1  69   ? 43.505  -1.987  102.906 1.00 90.22  ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A 1  70   ? 43.409  -5.969  105.437 1.00 89.75  ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A 1  70   ? 43.410  -6.478  106.789 1.00 87.30  ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A 1  70   ? 42.115  -6.292  107.545 1.00 90.03  ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A 1  70   ? 41.983  -6.830  108.650 1.00 97.23  ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A 1  71   ? 41.150  -5.559  106.996 1.00 89.89  ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A 1  71   ? 39.873  -5.313  107.658 1.00 86.31  ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A 1  71   ? 38.799  -6.144  106.967 1.00 85.24  ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A 1  71   ? 38.665  -6.106  105.737 1.00 87.56  ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A 1  71   ? 39.510  -3.818  107.655 1.00 82.95  ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A 1  71   ? 38.172  -3.604  108.330 1.00 87.65  ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A 1  71   ? 40.581  -3.015  108.364 1.00 83.92  ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A 1  72   ? 38.036  -6.895  107.764 1.00 83.51  ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A 1  72   ? 36.961  -7.729  107.235 1.00 83.29  ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A 1  72   ? 35.756  -6.892  106.821 1.00 84.09  ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A 1  72   ? 35.187  -7.095  105.742 1.00 82.33  ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A 1  72   ? 36.556  -8.772  108.277 1.00 81.66  ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A 1  72   ? 35.306  -9.549  107.924 1.00 81.31  ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A 1  72   ? 35.028  -10.629 108.949 1.00 85.26  ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A 1  72   ? 33.828  -11.465 108.541 1.00 88.59  ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A 1  72   ? 33.620  -12.613 109.462 1.00 93.43  ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A 1  73   ? 35.350  -5.953  107.668 1.00 88.93  ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A 1  73   ? 34.212  -5.106  107.348 1.00 86.23  ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A 1  73   ? 34.589  -4.068  106.296 1.00 81.54  ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A 1  73   ? 35.667  -3.471  106.341 1.00 77.80  ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A 1  73   ? 33.690  -4.413  108.609 1.00 79.99  ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A 1  73   ? 32.921  -5.325  109.562 1.00 87.47  ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A 1  73   ? 33.797  -5.949  110.642 1.00 94.02  ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A 1  73   ? 35.020  -5.704  110.633 1.00 96.20  ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A 1  73   ? 33.261  -6.684  111.504 1.00 92.41  ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A 1  74   ? 33.694  -3.867  105.335 1.00 76.11  ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A 1  74   ? 33.836  -2.757  104.413 1.00 76.88  ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A 1  74   ? 33.475  -1.451  105.124 1.00 79.09  ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A 1  74   ? 32.975  -1.449  106.252 1.00 77.56  ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A 1  74   ? 32.952  -2.981  103.191 1.00 81.01  ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A 1  74   ? 31.508  -3.229  103.565 1.00 89.31  ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A 1  74   ? 30.755  -2.240  103.693 1.00 87.36  ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A 1  74   ? 31.129  -4.409  103.752 1.00 96.26  ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A 1  75   ? 33.727  -0.324  104.450 1.00 76.01  ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A 1  75   ? 33.544  0.973   105.101 1.00 78.60  ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A 1  75   ? 32.064  1.250   105.351 1.00 76.71  ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A 1  75   ? 31.698  1.874   106.355 1.00 75.82  ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A 1  75   ? 34.212  2.088   104.275 1.00 65.95  ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A 1  75   ? 33.715  3.459   104.695 1.00 66.06  ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A 1  75   ? 35.705  2.021   104.458 1.00 73.38  ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A 1  76   ? 31.191  0.785   104.457 1.00 74.42  ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A 1  76   ? 29.755  0.959   104.663 1.00 73.21  ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A 1  76   ? 29.325  0.318   105.981 1.00 75.06  ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A 1  76   ? 28.625  0.935   106.796 1.00 75.75  ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A 1  76   ? 28.974  0.396   103.461 1.00 71.78  ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A 1  76   ? 27.504  0.277   103.781 1.00 62.22  ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A 1  76   ? 29.177  1.291   102.254 1.00 69.35  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A 1  77   ? 29.781  -0.911  106.236 1.00 76.54  ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A 1  77   ? 29.429  -1.584  107.484 1.00 80.50  ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A 1  77   ? 30.110  -0.942  108.683 1.00 76.41  ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A 1  77   ? 29.530  -0.901  109.775 1.00 79.11  ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A 1  77   ? 29.795  -3.063  107.406 1.00 81.45  ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A 1  77   ? 29.407  -3.861  108.629 1.00 69.91  ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A 1  77   ? 29.566  -5.353  108.409 1.00 89.05  ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A 1  77   ? 28.993  -6.137  109.199 1.00 86.42  ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A 1  77   ? 30.261  -5.736  107.439 1.00 85.48  ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A 1  78   ? 31.332  -0.437  108.506 1.00 77.83  ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A 1  78   ? 32.012  0.252   109.601 1.00 79.74  ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A 1  78   ? 31.211  1.473   110.034 1.00 79.23  ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A 1  78   ? 31.015  1.716   111.230 1.00 81.01  ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A 1  78   ? 33.449  0.622   109.192 1.00 79.89  ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A 1  78   ? 34.356  -0.607  109.293 1.00 76.35  ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A 1  78   ? 33.989  1.770   110.038 1.00 73.19  ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A 1  78   ? 35.761  -0.353  108.825 1.00 81.84  ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A 1  79   ? 30.712  2.246   109.067 1.00 79.96  ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A 1  79   ? 29.891  3.405   109.407 1.00 76.92  ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A 1  79   ? 28.535  2.971   109.957 1.00 75.30  ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A 1  79   ? 27.963  3.650   110.817 1.00 74.12  ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A 1  79   ? 29.747  4.332   108.187 1.00 74.04  ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A 1  79   ? 31.124  4.740   107.679 1.00 71.17  ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A 1  79   ? 28.970  5.585   108.543 1.00 63.48  ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A 1  79   ? 31.070  5.514   106.400 1.00 76.60  ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A 1  80   ? 27.993  1.845   109.484 1.00 78.04  ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A 1  80   ? 26.762  1.329   110.079 1.00 75.98  ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A 1  80   ? 26.959  1.019   111.553 1.00 77.75  ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A 1  80   ? 26.078  1.287   112.376 1.00 80.29  ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A 1  80   ? 26.286  0.078   109.345 1.00 73.77  ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1  80   ? 25.458  0.290   108.085 1.00 71.27  ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1  80   ? 24.898  -1.043  107.650 1.00 68.58  ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1  80   ? 24.349  1.309   108.324 1.00 63.04  ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A 1  81   ? 28.111  0.445   111.902 1.00 74.98  ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A 1  81   ? 28.418  0.204   113.305 1.00 71.16  ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A 1  81   ? 28.632  1.515   114.050 1.00 75.51  ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A 1  81   ? 28.128  1.691   115.164 1.00 83.93  ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A 1  81   ? 29.643  -0.697  113.426 1.00 69.13  ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A 1  81   ? 29.436  -2.041  112.762 1.00 75.73  ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A 1  81   ? 28.305  -2.429  112.454 1.00 67.80  ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A 1  81   ? 30.529  -2.765  112.541 1.00 77.21  ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A 1  82   ? 29.350  2.457   113.442 1.00 75.91  ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A 1  82   ? 29.582  3.746   114.081 1.00 75.81  ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A 1  82   ? 28.313  4.578   114.205 1.00 80.05  ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A 1  82   ? 28.329  5.600   114.897 1.00 82.86  ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A 1  82   ? 30.647  4.534   113.314 1.00 83.10  ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A 1  82   ? 32.062  3.950   113.322 1.00 80.33  ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A 1  82   ? 33.045  4.928   112.701 1.00 76.46  ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A 1  82   ? 32.486  3.583   114.732 1.00 76.55  ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A 1  83   ? 27.226  4.178   113.545 1.00 84.45  ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A 1  83   ? 25.938  4.821   113.771 1.00 83.34  ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A 1  83   ? 25.336  4.407   115.105 1.00 80.36  ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A 1  83   ? 24.629  5.201   115.736 1.00 87.24  ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A 1  83   ? 24.973  4.488   112.630 1.00 75.81  ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A 1  83   ? 24.824  5.596   111.608 1.00 79.29  ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A 1  83   ? 23.967  5.164   110.429 1.00 82.00  ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A 1  83   ? 22.571  4.739   110.851 1.00 81.26  ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A 1  83   ? 21.719  4.428   109.658 1.00 79.41  ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A 1  84   ? 25.614  3.182   115.549 1.00 78.11  ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A 1  84   ? 25.090  2.662   116.803 1.00 87.87  ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A 1  84   ? 25.849  3.164   118.024 1.00 90.06  ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A 1  84   ? 25.407  2.913   119.152 1.00 89.16  ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A 1  84   ? 25.118  1.133   116.785 1.00 84.22  ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A 1  84   ? 24.133  0.506   115.826 1.00 88.07  ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A 1  84   ? 23.795  -0.914  116.216 1.00 111.60 ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A 1  84   ? 22.662  -1.144  116.698 1.00 118.84 ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A 1  84   ? 24.673  -1.794  116.062 1.00 113.92 ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A 1  85   ? 26.964  3.864   117.828 1.00 91.15  ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A 1  85   ? 27.759  4.344   118.950 1.00 85.53  ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A 1  85   ? 26.972  5.347   119.790 1.00 83.84  ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A 1  85   ? 26.427  6.326   119.269 1.00 78.65  ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A 1  85   ? 29.049  4.980   118.434 1.00 78.56  ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A 1  85   ? 29.993  5.509   119.512 1.00 79.20  ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A 1  85   ? 30.636  4.352   120.245 1.00 80.93  ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A 1  85   ? 31.047  6.428   118.922 1.00 82.27  ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A 1  86   ? 26.918  5.095   121.095 1.00 85.13  ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A 1  86   ? 26.305  6.003   122.059 1.00 81.50  ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A 1  86   ? 27.421  6.766   122.760 1.00 77.30  ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A 1  86   ? 28.331  6.159   123.336 1.00 78.96  ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A 1  86   ? 25.441  5.244   123.076 1.00 82.04  ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A 1  86   ? 24.685  6.223   123.961 1.00 86.89  ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A 1  86   ? 24.488  4.292   122.369 1.00 84.80  ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A 1  87   ? 27.358  8.092   122.716 1.00 73.64  ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A 1  87   ? 28.374  8.941   123.326 1.00 78.29  ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A 1  87   ? 27.669  10.018  124.131 1.00 84.10  ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A 1  87   ? 26.904  10.814  123.573 1.00 82.32  ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A 1  87   ? 29.309  9.581   122.286 1.00 85.87  ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A 1  87   ? 30.199  10.618  122.952 1.00 84.83  ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A 1  87   ? 30.151  8.524   121.601 1.00 85.84  ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A 1  88   ? 27.939  10.052  125.430 1.00 90.38  ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A 1  88   ? 27.349  11.014  126.345 1.00 92.38  ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A 1  88   ? 28.320  12.162  126.587 1.00 95.28  ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A 1  88   ? 29.507  11.934  126.859 1.00 93.94  ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A 1  88   ? 26.995  10.339  127.668 1.00 93.21  ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A 1  88   ? 26.461  11.296  128.696 1.00 97.16  ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A 1  88   ? 26.435  10.673  130.073 1.00 101.31 ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A 1  88   ? 26.079  11.667  131.078 1.00 100.19 ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A 1  88   ? 26.159  11.467  132.384 1.00 91.51  ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A 1  88   ? 26.586  10.301  132.850 1.00 88.36  ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A 1  88   ? 25.818  12.436  133.220 1.00 95.55  ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A 1  89   ? 27.806  13.388  126.484 1.00 94.17  ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A 1  89   ? 28.544  14.597  126.822 1.00 98.04  ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A 1  89   ? 28.201  14.981  128.253 1.00 106.65 ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A 1  89   ? 27.025  15.180  128.580 1.00 111.43 ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A 1  89   ? 28.190  15.752  125.886 1.00 98.50  ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A 1  89   ? 28.690  15.587  124.481 1.00 102.51 ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A 1  89   ? 29.467  14.500  124.121 1.00 100.56 ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A 1  89   ? 28.390  16.540  123.518 1.00 103.53 ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A 1  89   ? 29.925  14.358  122.825 1.00 98.16  ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A 1  89   ? 28.846  16.408  122.222 1.00 99.05  ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A 1  89   ? 29.615  15.315  121.874 1.00 99.77  ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A 1  90   ? 29.217  15.102  129.101 1.00 108.52 ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A 1  90   ? 28.936  15.545  130.460 1.00 104.81 ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A 1  90   ? 28.847  17.066  130.550 1.00 102.24 ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A 1  90   ? 27.962  17.593  131.231 1.00 102.72 ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A 1  90   ? 29.983  14.980  131.415 1.00 104.50 ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A 1  90   ? 29.649  13.531  131.779 1.00 103.82 ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A 1  90   ? 30.751  12.571  131.369 1.00 98.20  ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A 1  90   ? 29.344  13.422  133.265 1.00 106.52 ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A 1  91   ? 29.721  17.783  129.854 1.00 111.99 ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A 1  91   ? 29.655  19.244  129.836 1.00 111.83 ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A 1  91   ? 28.478  19.706  128.985 1.00 111.72 ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A 1  91   ? 28.390  19.332  127.807 1.00 107.84 ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A 1  91   ? 30.958  19.827  129.300 1.00 110.26 ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A 1  91   ? 31.118  21.306  129.626 1.00 112.11 ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A 1  91   ? 30.203  22.109  129.426 1.00 111.80 ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A 1  91   ? 32.287  21.669  130.145 1.00 113.19 ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A 1  92   ? 27.560  20.513  129.529 1.00 109.98 ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A 1  92   ? 26.398  20.951  128.738 1.00 108.57 ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A 1  92   ? 26.742  21.944  127.647 1.00 109.08 ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A 1  92   ? 25.966  22.084  126.693 1.00 110.48 ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A 1  92   ? 25.476  21.591  129.787 1.00 112.15 ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A 1  92   ? 26.016  21.157  131.120 1.00 114.83 ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A 1  92   ? 27.490  20.990  130.916 1.00 112.39 ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A 1  93   ? 27.866  22.647  127.760 1.00 108.93 ? 93   SER A N     1 
ATOM   703   C  CA    . SER A 1  93   ? 28.273  23.605  126.742 1.00 111.68 ? 93   SER A CA    1 
ATOM   704   C  C     . SER A 1  93   ? 29.001  22.955  125.569 1.00 114.35 ? 93   SER A C     1 
ATOM   705   O  O     . SER A 1  93   ? 29.298  23.646  124.586 1.00 109.37 ? 93   SER A O     1 
ATOM   706   C  CB    . SER A 1  93   ? 29.164  24.674  127.378 1.00 107.27 ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A 1  93   ? 28.580  25.163  128.570 1.00 109.21 ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A 1  94   ? 29.276  21.652  125.648 1.00 114.73 ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A 1  94   ? 30.064  20.941  124.644 1.00 108.09 ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A 1  94   ? 29.180  20.568  123.457 1.00 108.60 ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A 1  94   ? 28.229  19.794  123.606 1.00 107.28 ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A 1  94   ? 30.684  19.691  125.268 1.00 108.88 ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A 1  94   ? 32.075  19.177  124.897 1.00 99.84  ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A 1  94   ? 32.057  17.666  125.040 1.00 100.60 ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A 1  94   ? 32.517  19.610  123.510 1.00 99.50  ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A 1  95   ? 29.496  21.104  122.276 1.00 108.00 ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A 1  95   ? 28.689  20.824  121.092 1.00 104.90 ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A 1  95   ? 29.212  19.649  120.267 1.00 103.17 ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A 1  95   ? 28.411  18.893  119.705 1.00 102.92 ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A 1  95   ? 28.593  22.071  120.207 1.00 105.44 ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A 1  95   ? 27.803  23.210  120.833 1.00 107.08 ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A 1  95   ? 26.407  22.788  121.266 1.00 113.85 ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1  95   ? 25.748  21.989  120.595 1.00 113.53 ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1  95   ? 25.952  23.322  122.395 1.00 113.95 ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A 1  96   ? 30.531  19.473  120.165 1.00 102.34 ? 96   THR A N     1 
ATOM   726   C  CA    . THR A 1  96   ? 31.073  18.476  119.251 1.00 96.85  ? 96   THR A CA    1 
ATOM   727   C  C     . THR A 1  96   ? 32.391  17.914  119.774 1.00 90.34  ? 96   THR A C     1 
ATOM   728   O  O     . THR A 1  96   ? 33.161  18.607  120.446 1.00 85.49  ? 96   THR A O     1 
ATOM   729   C  CB    . THR A 1  96   ? 31.268  19.066  117.852 1.00 93.03  ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A 1  96   ? 32.307  18.351  117.174 1.00 99.72  ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A 1  96   ? 31.631  20.543  117.939 1.00 93.22  ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A 1  97   ? 32.639  16.642  119.450 1.00 88.31  ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A 1  97   ? 33.829  15.917  119.895 1.00 90.21  ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A 1  97   ? 34.367  15.076  118.744 1.00 93.82  ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A 1  97   ? 33.601  14.420  118.031 1.00 96.50  ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A 1  97   ? 33.529  15.014  121.110 1.00 89.73  ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A 1  97   ? 34.743  14.172  121.468 1.00 90.09  ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A 1  97   ? 33.125  15.845  122.286 1.00 99.20  ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A 1  98   ? 35.688  15.068  118.582 1.00 92.03  ? 98   THR A N     1 
ATOM   740   C  CA    . THR A 1  98   ? 36.352  14.254  117.569 1.00 88.20  ? 98   THR A CA    1 
ATOM   741   C  C     . THR A 1  98   ? 37.108  13.113  118.249 1.00 84.86  ? 98   THR A C     1 
ATOM   742   O  O     . THR A 1  98   ? 38.229  13.297  118.728 1.00 87.29  ? 98   THR A O     1 
ATOM   743   C  CB    . THR A 1  98   ? 37.287  15.108  116.723 1.00 92.48  ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A 1  98   ? 36.520  16.097  116.025 1.00 103.72 ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A 1  98   ? 38.033  14.242  115.717 1.00 88.50  ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A 1  99   ? 36.492  11.932  118.267 1.00 80.06  ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A 1  99   ? 37.139  10.729  118.777 1.00 83.17  ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A 1  99   ? 38.213  10.249  117.812 1.00 90.10  ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A 1  99   ? 38.051  10.331  116.590 1.00 91.52  ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A 1  99   ? 36.114  9.610   118.973 1.00 83.38  ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A 1  99   ? 35.394  9.407   120.302 1.00 89.85  ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A 1  99   ? 34.729  10.678  120.796 1.00 83.60  ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A 1  99   ? 34.368  8.310   120.115 1.00 95.97  ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A 1  100  ? 39.296  9.711   118.367 1.00 91.78  ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A 1  100  ? 40.389  9.146   117.587 1.00 90.51  ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A 1  100  ? 40.530  7.671   117.926 1.00 90.59  ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A 1  100  ? 40.568  7.301   119.105 1.00 96.41  ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A 1  100  ? 41.707  9.876   117.864 1.00 81.96  ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A 1  100  ? 41.619  11.395  118.028 1.00 84.20  ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A 1  100  ? 42.975  11.962  118.391 1.00 95.01  ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A 1  100  ? 41.084  12.057  116.771 1.00 90.55  ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A 1  101  ? 40.596  6.831   116.897 1.00 91.68  ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A 1  101  ? 40.843  5.405   117.061 1.00 90.69  ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A 1  101  ? 42.094  5.036   116.276 1.00 94.14  ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A 1  101  ? 42.250  5.436   115.119 1.00 89.06  ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A 1  101  ? 39.641  4.574   116.597 1.00 91.18  ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A 1  101  ? 39.566  3.107   117.034 1.00 90.16  ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A 1  101  ? 38.113  2.691   117.199 1.00 92.60  ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A 1  101  ? 40.267  2.192   116.042 1.00 91.17  ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A 1  102  ? 42.988  4.289   116.914 1.00 96.86  ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A 1  102  ? 44.224  3.846   116.284 1.00 92.50  ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A 1  102  ? 44.443  2.400   116.695 1.00 94.94  ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A 1  102  ? 44.619  2.112   117.884 1.00 96.70  ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A 1  102  ? 45.401  4.734   116.698 1.00 89.96  ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A 1  102  ? 46.592  4.673   115.768 1.00 101.32 ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A 1  102  ? 47.347  5.996   115.762 1.00 107.31 ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A 1  102  ? 46.462  7.140   115.276 1.00 104.04 ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A 1  102  ? 47.230  8.402   115.063 1.00 108.05 ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A 1  103  ? 44.400  1.491   115.723 1.00 93.97  ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A 1  103  ? 44.453  0.070   116.020 1.00 95.10  ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A 1  103  ? 45.192  -0.648  114.904 1.00 93.35  ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A 1  103  ? 45.355  -0.122  113.800 1.00 94.88  ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A 1  103  ? 43.049  -0.517  116.198 1.00 98.26  ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A 1  104  ? 45.629  -1.865  115.206 1.00 95.96  ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A 1  104  ? 46.440  -2.651  114.283 1.00 99.50  ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A 1  104  ? 46.444  -4.097  114.763 1.00 97.60  ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A 1  104  ? 45.770  -4.453  115.736 1.00 95.46  ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A 1  104  ? 47.861  -2.085  114.175 1.00 104.93 ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A 1  104  ? 48.563  -1.889  115.515 1.00 105.83 ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A 1  104  ? 49.875  -1.130  115.389 1.00 115.77 ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A 1  104  ? 50.524  -0.886  116.431 1.00 118.65 ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A 1  104  ? 50.256  -0.774  114.252 1.00 123.55 ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A 1  105  ? 47.209  -4.931  114.059 1.00 99.82  ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A 1  105  ? 47.395  -6.315  114.420 1.00 100.66 ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A 1  105  ? 46.101  -7.099  114.396 1.00 100.27 ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A 1  105  ? 45.032  -6.572  114.076 1.00 101.29 ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A 1  106  ? 46.174  -8.389  114.722 1.00 99.61  ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A 1  106  ? 44.946  -9.182  114.878 1.00 94.73  ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A 1  106  ? 44.202  -8.738  116.127 1.00 97.80  ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A 1  106  ? 44.761  -8.763  117.225 1.00 110.96 ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A 1  106  ? 45.464  -10.620 115.010 1.00 94.54  ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A 1  106  ? 46.885  -10.582 114.512 1.00 102.15 ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A 1  106  ? 47.386  -9.215  114.846 1.00 102.91 ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A 1  107  ? 42.945  -8.325  115.958 1.00 97.53  ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A 1  107  ? 42.099  -7.956  117.094 1.00 101.01 ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A 1  107  ? 40.688  -7.684  116.586 1.00 98.46  ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A 1  107  ? 40.426  -7.676  115.380 1.00 96.38  ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A 1  107  ? 42.620  -6.729  117.853 1.00 98.39  ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A 1  107  ? 42.538  -5.430  117.075 1.00 97.50  ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A 1  107  ? 43.099  -4.269  117.884 1.00 95.76  ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A 1  107  ? 42.362  -4.103  119.201 1.00 89.46  ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A 1  107  ? 42.890  -2.952  119.982 1.00 89.49  ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A 1  108  ? 39.778  -7.470  117.529 1.00 95.56  ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A 1  108  ? 38.422  -7.031  117.233 1.00 91.24  ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A 1  108  ? 38.234  -5.667  117.881 1.00 88.05  ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A 1  108  ? 38.060  -5.569  119.100 1.00 92.38  ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A 1  108  ? 37.394  -8.038  117.738 1.00 89.09  ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A 1  108  ? 37.395  -9.352  116.988 1.00 92.15  ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A 1  108  ? 36.241  -10.248 117.395 1.00 108.01 ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A 1  108  ? 35.506  -9.885  118.341 1.00 102.93 ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A 1  108  ? 36.065  -11.314 116.767 1.00 121.89 ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A 1  109  ? 38.266  -4.620  117.069 1.00 85.78  ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A 1  109  ? 38.169  -3.260  117.581 1.00 86.23  ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A 1  109  ? 36.727  -2.985  117.986 1.00 92.47  ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A 1  109  ? 35.828  -2.955  117.133 1.00 92.83  ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A 1  109  ? 38.654  -2.245  116.541 1.00 85.83  ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A 1  109  ? 38.534  -0.840  117.095 1.00 86.02  ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A 1  109  ? 40.082  -2.553  116.136 1.00 86.94  ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A 1  110  ? 36.512  -2.799  119.289 1.00 91.64  ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A 1  110  ? 35.253  -2.363  119.873 1.00 87.97  ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A 1  110  ? 35.343  -0.884  120.233 1.00 88.06  ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A 1  110  ? 36.412  -0.269  120.191 1.00 87.34  ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A 1  110  ? 34.914  -3.188  121.119 1.00 88.01  ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A 1  110  ? 35.234  -4.665  121.011 1.00 90.73  ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A 1  110  ? 34.324  -5.383  120.031 1.00 90.59  ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A 1  110  ? 34.633  -6.872  120.010 1.00 86.14  ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A 1  110  ? 33.693  -7.639  119.148 1.00 87.67  ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A 1  111  ? 34.199  -0.319  120.622 1.00 86.83  ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A 1  111  ? 34.118  1.118   120.855 1.00 89.75  ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A 1  111  ? 34.976  1.575   122.028 1.00 96.74  ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A 1  111  ? 35.248  2.776   122.146 1.00 98.86  ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A 1  111  ? 32.662  1.526   121.075 1.00 90.83  ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A 1  112  ? 35.400  0.648   122.893 1.00 99.47  ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A 1  112  ? 36.284  0.996   124.002 1.00 93.45  ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A 1  112  ? 37.574  1.632   123.505 1.00 96.35  ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A 1  112  ? 38.093  2.570   124.124 1.00 91.96  ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A 1  112  ? 36.605  -0.256  124.814 1.00 89.56  ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A 1  112  ? 36.222  -0.197  126.276 1.00 102.12 ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A 1  112  ? 36.601  -1.495  126.962 1.00 103.62 ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A 1  112  ? 36.760  -2.574  125.989 1.00 98.71  ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A 1  112  ? 35.827  -3.479  125.716 1.00 101.36 ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A 1  112  ? 34.663  -3.440  126.353 1.00 105.84 ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A 1  112  ? 36.060  -4.423  124.810 1.00 91.37  ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A 1  113  ? 38.100  1.141   122.381 1.00 93.72  ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A 1  113  ? 39.443  1.477   121.917 1.00 89.42  ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A 1  113  ? 39.595  2.938   121.502 1.00 89.03  ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A 1  113  ? 40.696  3.377   121.153 1.00 85.63  ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A 1  113  ? 39.836  0.563   120.758 1.00 82.24  ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A 1  113  ? 39.991  -0.879  121.188 1.00 88.57  ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A 1  113  ? 41.018  -1.208  121.818 1.00 95.13  ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A 1  113  ? 39.068  -1.677  120.932 1.00 90.00  ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A 1  114  ? 38.504  3.698   121.533 1.00 89.20  ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A 1  114  ? 38.601  5.128   121.291 1.00 88.56  ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A 1  114  ? 39.398  5.797   122.400 1.00 92.77  ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A 1  114  ? 39.197  5.525   123.588 1.00 96.34  ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A 1  114  ? 37.213  5.754   121.197 1.00 91.83  ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A 1  114  ? 36.546  5.540   119.878 1.00 98.36  ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A 1  114  ? 37.056  6.124   118.730 1.00 96.78  ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A 1  114  ? 35.417  4.748   119.778 1.00 99.50  ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A 1  114  ? 36.446  5.929   117.509 1.00 94.94  ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A 1  114  ? 34.799  4.552   118.558 1.00 94.52  ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A 1  114  ? 35.316  5.142   117.422 1.00 94.06  ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A 1  115  ? 40.316  6.665   122.006 1.00 91.59  ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A 1  115  ? 41.159  7.342   122.980 1.00 91.57  ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A 1  115  ? 40.302  8.269   123.831 1.00 92.11  ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A 1  115  ? 39.561  9.094   123.284 1.00 95.83  ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A 1  115  ? 42.275  8.119   122.288 1.00 91.36  ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A 1  115  ? 43.252  7.249   121.492 1.00 85.05  ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A 1  115  ? 44.520  8.017   121.170 1.00 90.22  ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A 1  115  ? 43.573  5.955   122.233 1.00 87.98  ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A 1  116  ? 40.370  8.159   125.158 1.00 98.72  ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A 1  116  ? 39.439  8.901   126.017 1.00 96.16  ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A 1  116  ? 39.621  10.407  125.906 1.00 96.10  ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A 1  116  ? 40.729  10.915  125.709 1.00 96.66  ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A 1  116  ? 39.787  8.403   127.425 1.00 90.05  ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A 1  116  ? 40.460  7.080   127.203 1.00 89.46  ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A 1  116  ? 41.215  7.232   125.927 1.00 93.93  ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A 1  117  ? 38.501  11.119  126.020 1.00 98.74  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A 1  117  ? 38.470  12.574  126.008 1.00 102.59 ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A 1  117  ? 37.719  13.045  127.245 1.00 111.46 ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A 1  117  ? 36.802  12.374  127.733 1.00 105.99 ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A 1  117  ? 37.812  13.128  124.726 1.00 103.21 ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A 1  117  ? 38.018  14.633  124.629 1.00 106.15 ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A 1  117  ? 38.365  12.423  123.497 1.00 103.45 ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A 1  118  ? 38.125  14.206  127.757 1.00 115.64 ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A 1  118  ? 37.533  14.742  128.975 1.00 108.42 ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A 1  118  ? 36.065  15.088  128.760 1.00 109.84 ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A 1  118  ? 35.679  15.611  127.711 1.00 112.05 ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A 1  118  ? 38.302  15.981  129.435 1.00 104.21 ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A 1  119  ? 35.248  14.780  129.771 1.00 106.47 ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A 1  119  ? 33.812  15.065  129.761 1.00 111.80 ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A 1  119  ? 33.091  14.337  128.630 1.00 111.23 ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A 1  119  ? 32.115  14.851  128.072 1.00 111.60 ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A 1  119  ? 33.539  16.571  129.681 1.00 113.56 ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A 1  119  ? 33.872  17.297  130.972 1.00 116.71 ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A 1  119  ? 33.829  16.657  132.048 1.00 116.31 ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A 1  119  ? 34.165  18.512  130.907 1.00 113.22 ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A 1  120  ? 33.561  13.141  128.278 1.00 103.75 ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A 1  120  ? 32.976  12.349  127.200 1.00 100.35 ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A 1  120  ? 33.001  10.882  127.606 1.00 98.38  ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A 1  120  ? 34.068  10.345  127.923 1.00 95.65  ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A 1  120  ? 33.730  12.545  125.871 1.00 105.09 ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A 1  120  ? 33.211  11.573  124.820 1.00 99.75  ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A 1  120  ? 33.606  13.985  125.387 1.00 103.11 ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A 1  121  ? 31.837  10.224  127.571 1.00 95.74  ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A 1  121  ? 31.734  8.824   127.980 1.00 96.19  ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A 1  121  ? 31.042  7.986   126.913 1.00 92.27  ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A 1  121  ? 29.971  8.357   126.429 1.00 88.96  ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A 1  121  ? 30.967  8.690   129.298 1.00 96.79  ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A 1  121  ? 30.702  7.244   129.698 1.00 93.57  ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A 1  121  ? 29.808  7.120   130.916 1.00 101.17 ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A 1  121  ? 29.248  8.150   131.358 1.00 103.67 ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A 1  121  ? 29.669  5.989   131.432 1.00 102.93 ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A 1  122  ? 31.627  6.836   126.583 1.00 84.72  ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A 1  122  ? 31.017  5.896   125.645 1.00 88.05  ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A 1  122  ? 30.108  4.956   126.435 1.00 87.63  ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A 1  122  ? 30.580  4.142   127.233 1.00 86.91  ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A 1  122  ? 32.074  5.115   124.852 1.00 83.76  ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A 1  122  ? 32.664  5.978   123.731 1.00 87.31  ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A 1  122  ? 31.479  3.840   124.266 1.00 82.54  ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A 1  122  ? 33.849  6.814   124.144 1.00 90.65  ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A 1  123  ? 28.796  5.055   126.198 1.00 82.73  ? 123  MET A N     1 
ATOM   933   C  CA    . MET A 1  123  ? 27.811  4.297   126.962 1.00 86.18  ? 123  MET A CA    1 
ATOM   934   C  C     . MET A 1  123  ? 27.686  2.844   126.520 1.00 85.79  ? 123  MET A C     1 
ATOM   935   O  O     . MET A 1  123  ? 27.004  2.066   127.196 1.00 83.61  ? 123  MET A O     1 
ATOM   936   C  CB    . MET A 1  123  ? 26.440  4.974   126.865 1.00 87.18  ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A 1  123  ? 26.441  6.460   127.209 1.00 89.82  ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A 1  123  ? 26.747  6.797   128.957 1.00 101.88 ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A 1  123  ? 25.453  5.831   129.733 1.00 95.74  ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A 1  124  ? 28.300  2.461   125.404 1.00 86.69  ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A 1  124  ? 28.332  1.066   124.962 1.00 90.23  ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A 1  124  ? 29.748  0.741   124.516 1.00 95.97  ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A 1  124  ? 30.059  0.718   123.318 1.00 89.91  ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A 1  124  ? 27.312  0.799   123.850 1.00 89.66  ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A 1  124  ? 27.393  1.803   122.715 1.00 87.48  ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A 1  124  ? 27.720  2.971   122.923 1.00 86.00  ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A 1  124  ? 27.085  1.350   121.506 1.00 91.55  ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A 1  125  ? 30.645  0.482   125.469 1.00 95.95  ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A 1  125  ? 32.041  0.211   125.105 1.00 95.14  ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A 1  125  ? 32.243  -1.126  124.413 1.00 96.55  ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A 1  125  ? 33.282  -1.314  123.767 1.00 99.47  ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A 1  125  ? 32.762  0.258   126.458 1.00 97.73  ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A 1  125  ? 31.718  -0.136  127.437 1.00 90.29  ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A 1  125  ? 30.434  0.445   126.925 1.00 84.13  ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A 1  126  ? 31.293  -2.054  124.521 1.00 98.65  ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A 1  126  ? 31.406  -3.374  123.909 1.00 100.39 ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A 1  126  ? 30.880  -3.420  122.479 1.00 98.48  ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A 1  126  ? 30.923  -4.489  121.855 1.00 97.91  ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A 1  126  ? 30.664  -4.414  124.759 1.00 106.77 ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A 1  126  ? 31.349  -4.685  126.089 1.00 116.41 ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A 1  126  ? 32.071  -3.790  126.586 1.00 113.03 ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A 1  126  ? 31.176  -5.800  126.631 1.00 119.61 ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A 1  127  ? 30.393  -2.298  121.946 1.00 88.93  ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A 1  127  ? 29.874  -2.277  120.584 1.00 95.19  ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A 1  127  ? 30.969  -2.629  119.584 1.00 91.56  ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A 1  127  ? 32.033  -2.003  119.558 1.00 88.63  ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A 1  127  ? 29.290  -0.901  120.259 1.00 95.62  ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A 1  127  ? 29.085  -0.602  118.768 1.00 88.68  ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A 1  127  ? 27.981  -1.462  118.174 1.00 85.94  ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A 1  127  ? 28.795  0.871   118.550 1.00 84.80  ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A 1  128  ? 30.702  -3.633  118.756 1.00 87.48  ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A 1  128  ? 31.684  -4.053  117.769 1.00 92.27  ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A 1  128  ? 31.790  -3.026  116.649 1.00 88.72  ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A 1  128  ? 30.784  -2.493  116.174 1.00 85.02  ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A 1  128  ? 31.314  -5.417  117.193 1.00 91.15  ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A 1  128  ? 32.263  -5.899  116.144 1.00 89.40  ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A 1  128  ? 33.310  -6.748  116.424 1.00 96.50  ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A 1  128  ? 32.335  -5.635  114.818 1.00 92.48  ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A 1  128  ? 33.984  -6.995  115.314 1.00 94.55  ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A 1  128  ? 33.413  -6.329  114.325 1.00 98.27  ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A 1  129  ? 33.023  -2.750  116.226 1.00 89.29  ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A 1  129  ? 33.263  -1.786  115.157 1.00 89.56  ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A 1  129  ? 33.929  -2.473  113.974 1.00 87.75  ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A 1  129  ? 33.438  -2.395  112.842 1.00 86.55  ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A 1  129  ? 34.118  -0.605  115.642 1.00 85.72  ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A 1  129  ? 33.313  0.266   116.601 1.00 79.24  ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A 1  129  ? 34.615  0.220   114.460 1.00 84.55  ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A 1  129  ? 34.087  1.446   117.119 1.00 86.52  ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A 1  130  ? 35.053  -3.141  114.215 1.00 90.56  ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A 1  130  ? 35.776  -3.727  113.097 1.00 81.92  ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A 1  130  ? 36.491  -4.995  113.542 1.00 86.38  ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A 1  130  ? 36.739  -5.210  114.728 1.00 94.80  ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A 1  130  ? 36.771  -2.726  112.500 1.00 84.47  ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A 1  131  ? 36.811  -5.841  112.570 1.00 85.36  ? 131  THR A N     1 
ATOM   995   C  CA    . THR A 1  131  ? 37.611  -7.042  112.793 1.00 88.15  ? 131  THR A CA    1 
ATOM   996   C  C     . THR A 1  131  ? 38.919  -6.880  112.025 1.00 90.91  ? 131  THR A C     1 
ATOM   997   O  O     . THR A 1  131  ? 38.943  -7.009  110.797 1.00 96.51  ? 131  THR A O     1 
ATOM   998   C  CB    . THR A 1  131  ? 36.856  -8.296  112.348 1.00 87.99  ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A 1  131  ? 35.721  -8.504  113.202 1.00 92.72  ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A 1  131  ? 37.761  -9.522  112.397 1.00 78.83  ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A 1  132  ? 40.002  -6.581  112.738 1.00 91.07  ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A 1  132  ? 41.299  -6.374  112.117 1.00 85.59  ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A 1  132  ? 42.113  -7.659  112.160 1.00 92.53  ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A 1  132  ? 42.058  -8.419  113.133 1.00 97.26  ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A 1  132  ? 42.068  -5.243  112.799 1.00 88.64  ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A 1  132  ? 41.935  -3.870  112.140 1.00 89.89  ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A 1  132  ? 40.485  -3.412  112.129 1.00 86.55  ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A 1  132  ? 42.817  -2.848  112.835 1.00 91.34  ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A 1  133  ? 42.880  -7.872  111.104 1.00 100.29 ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A 1  133  ? 43.638  -9.077  110.815 1.00 99.36  ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A 1  133  ? 45.127  -8.778  110.989 1.00 103.41 ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A 1  133  ? 45.520  -7.648  111.299 1.00 104.86 ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A 1  133  ? 43.295  -9.535  109.396 1.00 98.63  ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A 1  133  ? 43.768  -10.883 108.944 1.00 103.30 ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A 1  133  ? 43.706  -10.986 107.433 1.00 99.61  ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A 1  133  ? 43.930  -9.959  106.753 1.00 91.29  ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A 1  133  ? 43.413  -12.082 106.922 1.00 100.10 ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A 1  134  ? 45.960  -9.800  110.793 1.00 104.65 ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A 1  134  ? 47.403  -9.620  110.901 1.00 104.30 ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A 1  134  ? 47.871  -8.557  109.918 1.00 102.54 ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A 1  134  ? 47.689  -8.696  108.705 1.00 100.92 ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A 1  134  ? 48.124  -10.941 110.638 1.00 106.75 ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A 1  134  ? 49.105  -11.353 111.732 1.00 108.77 ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A 1  134  ? 50.029  -10.223 112.155 1.00 118.15 ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A 1  134  ? 50.075  -9.914  113.368 1.00 117.06 ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A 1  134  ? 50.703  -9.640  111.276 1.00 116.42 ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A 1  135  ? 48.475  -7.492  110.446 1.00 104.29 ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A 1  135  ? 48.921  -6.385  109.630 1.00 108.94 ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A 1  135  ? 47.841  -5.407  109.235 1.00 101.64 ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A 1  135  ? 48.160  -4.354  108.668 1.00 102.44 ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A 1  136  ? 46.577  -5.715  109.510 1.00 98.22  ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A 1  136  ? 45.508  -4.779  109.206 1.00 93.97  ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A 1  136  ? 45.519  -3.623  110.185 1.00 95.42  ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A 1  136  ? 45.519  -3.822  111.405 1.00 101.59 ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A 1  137  ? 45.530  -2.405  109.652 1.00 93.37  ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A 1  137  ? 45.625  -1.187  110.441 1.00 98.05  ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A 1  137  ? 44.374  -0.346  110.228 1.00 97.39  ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A 1  137  ? 43.821  -0.312  109.126 1.00 99.13  ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A 1  137  ? 46.886  -0.392  110.065 1.00 99.57  ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A 1  137  ? 48.138  -0.849  110.807 1.00 107.77 ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A 1  137  ? 49.430  -0.433  110.114 1.00 121.48 ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A 1  137  ? 49.356  0.892   109.499 1.00 130.57 ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A 1  137  ? 49.568  1.129   108.206 1.00 123.03 ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A 1  137  ? 49.879  0.129   107.391 1.00 114.01 ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A 1  137  ? 49.480  2.365   107.728 1.00 120.14 ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A 1  138  ? 43.922  0.322   111.290 1.00 94.50  ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A 1  138  ? 42.732  1.164   111.216 1.00 88.21  ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A 1  138  ? 42.947  2.425   112.040 1.00 88.81  ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A 1  138  ? 43.118  2.348   113.259 1.00 99.09  ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A 1  138  ? 41.497  0.402   111.704 1.00 88.01  ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A 1  138  ? 40.179  1.175   111.710 1.00 88.44  ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A 1  138  ? 39.933  1.830   110.369 1.00 86.47  ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A 1  138  ? 39.023  0.253   112.071 1.00 92.40  ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A 1  139  ? 42.936  3.583   111.377 1.00 86.62  ? 139  ASN A N     1 
ATOM   1055  C  CA    A ASN A 1  139  ? 43.087  4.881   112.032 0.50 87.64  ? 139  ASN A CA    1 
ATOM   1056  C  CA    B ASN A 1  139  ? 43.082  4.877   112.037 0.50 87.66  ? 139  ASN A CA    1 
ATOM   1057  C  C     . ASN A 1  139  ? 41.900  5.754   111.644 1.00 87.69  ? 139  ASN A C     1 
ATOM   1058  O  O     . ASN A 1  139  ? 41.800  6.188   110.493 1.00 86.61  ? 139  ASN A O     1 
ATOM   1059  C  CB    A ASN A 1  139  ? 44.408  5.548   111.642 0.50 88.58  ? 139  ASN A CB    1 
ATOM   1060  C  CB    B ASN A 1  139  ? 44.406  5.541   111.664 0.50 88.57  ? 139  ASN A CB    1 
ATOM   1061  C  CG    A ASN A 1  139  ? 44.561  6.941   112.235 0.50 90.59  ? 139  ASN A CG    1 
ATOM   1062  C  CG    B ASN A 1  139  ? 45.606  4.680   112.007 0.50 92.17  ? 139  ASN A CG    1 
ATOM   1063  O  OD1   A ASN A 1  139  ? 43.899  7.290   113.213 0.50 93.37  ? 139  ASN A OD1   1 
ATOM   1064  O  OD1   B ASN A 1  139  ? 45.537  3.819   112.884 0.50 91.77  ? 139  ASN A OD1   1 
ATOM   1065  N  ND2   A ASN A 1  139  ? 45.439  7.742   111.647 0.50 89.51  ? 139  ASN A ND2   1 
ATOM   1066  N  ND2   B ASN A 1  139  ? 46.714  4.906   111.313 0.50 93.81  ? 139  ASN A ND2   1 
ATOM   1067  N  N     . MET A 1  140  ? 41.014  6.020   112.602 1.00 89.40  ? 140  MET A N     1 
ATOM   1068  C  CA    . MET A 1  140  ? 39.797  6.782   112.359 1.00 89.38  ? 140  MET A CA    1 
ATOM   1069  C  C     . MET A 1  140  ? 39.752  8.056   113.189 1.00 84.59  ? 140  MET A C     1 
ATOM   1070  O  O     . MET A 1  140  ? 40.318  8.135   114.283 1.00 88.00  ? 140  MET A O     1 
ATOM   1071  C  CB    . MET A 1  140  ? 38.533  5.968   112.679 1.00 88.13  ? 140  MET A CB    1 
ATOM   1072  C  CG    . MET A 1  140  ? 38.377  4.674   111.911 1.00 86.19  ? 140  MET A CG    1 
ATOM   1073  S  SD    . MET A 1  140  ? 36.742  3.946   112.163 1.00 90.29  ? 140  MET A SD    1 
ATOM   1074  C  CE    . MET A 1  140  ? 36.604  3.992   113.949 1.00 96.01  ? 140  MET A CE    1 
ATOM   1075  N  N     . GLU A 1  141  ? 39.038  9.041   112.651 1.00 80.42  ? 141  GLU A N     1 
ATOM   1076  C  CA    . GLU A 1  141  ? 38.629  10.243  113.368 1.00 87.90  ? 141  GLU A CA    1 
ATOM   1077  C  C     . GLU A 1  141  ? 37.128  10.399  113.152 1.00 86.95  ? 141  GLU A C     1 
ATOM   1078  O  O     . GLU A 1  141  ? 36.690  10.673  112.030 1.00 84.86  ? 141  GLU A O     1 
ATOM   1079  C  CB    . GLU A 1  141  ? 39.389  11.471  112.866 1.00 83.83  ? 141  GLU A CB    1 
ATOM   1080  C  CG    . GLU A 1  141  ? 40.890  11.391  113.044 1.00 89.21  ? 141  GLU A CG    1 
ATOM   1081  C  CD    . GLU A 1  141  ? 41.613  12.554  112.396 1.00 100.69 ? 141  GLU A CD    1 
ATOM   1082  O  OE1   . GLU A 1  141  ? 40.960  13.338  111.674 1.00 102.41 ? 141  GLU A OE1   1 
ATOM   1083  O  OE2   . GLU A 1  141  ? 42.836  12.683  112.611 1.00 101.86 ? 141  GLU A OE2   1 
ATOM   1084  N  N     . VAL A 1  142  ? 36.334  10.210  114.207 1.00 79.03  ? 142  VAL A N     1 
ATOM   1085  C  CA    . VAL A 1  142  ? 34.878  10.292  114.103 1.00 82.36  ? 142  VAL A CA    1 
ATOM   1086  C  C     . VAL A 1  142  ? 34.407  11.561  114.805 1.00 83.56  ? 142  VAL A C     1 
ATOM   1087  O  O     . VAL A 1  142  ? 34.851  11.872  115.916 1.00 86.62  ? 142  VAL A O     1 
ATOM   1088  C  CB    . VAL A 1  142  ? 34.185  9.026   114.652 1.00 73.41  ? 142  VAL A CB    1 
ATOM   1089  C  CG1   . VAL A 1  142  ? 35.109  7.816   114.553 1.00 80.14  ? 142  VAL A CG1   1 
ATOM   1090  C  CG2   . VAL A 1  142  ? 33.667  9.203   116.065 1.00 85.05  ? 142  VAL A CG2   1 
ATOM   1091  N  N     . ARG A 1  143  ? 33.549  12.322  114.134 1.00 78.90  ? 143  ARG A N     1 
ATOM   1092  C  CA    . ARG A 1  143  ? 33.003  13.555  114.682 1.00 79.96  ? 143  ARG A CA    1 
ATOM   1093  C  C     . ARG A 1  143  ? 31.572  13.301  115.139 1.00 86.00  ? 143  ARG A C     1 
ATOM   1094  O  O     . ARG A 1  143  ? 30.707  12.935  114.323 1.00 84.93  ? 143  ARG A O     1 
ATOM   1095  C  CB    . ARG A 1  143  ? 33.051  14.698  113.669 1.00 79.68  ? 143  ARG A CB    1 
ATOM   1096  C  CG    . ARG A 1  143  ? 32.228  15.902  114.102 1.00 85.71  ? 143  ARG A CG    1 
ATOM   1097  C  CD    . ARG A 1  143  ? 32.356  17.089  113.162 1.00 87.00  ? 143  ARG A CD    1 
ATOM   1098  N  NE    . ARG A 1  143  ? 31.305  18.075  113.410 1.00 86.36  ? 143  ARG A NE    1 
ATOM   1099  C  CZ    . ARG A 1  143  ? 31.341  19.340  113.000 1.00 89.98  ? 143  ARG A CZ    1 
ATOM   1100  N  NH1   . ARG A 1  143  ? 32.385  19.798  112.321 1.00 99.55  ? 143  ARG A NH1   1 
ATOM   1101  N  NH2   . ARG A 1  143  ? 30.334  20.155  113.274 1.00 92.30  ? 143  ARG A NH2   1 
ATOM   1102  N  N     . VAL A 1  144  ? 31.350  13.495  116.446 1.00 90.00  ? 144  VAL A N     1 
ATOM   1103  C  CA    . VAL A 1  144  ? 30.064  13.362  117.121 1.00 83.67  ? 144  VAL A CA    1 
ATOM   1104  C  C     . VAL A 1  144  ? 29.564  14.755  117.466 1.00 83.32  ? 144  VAL A C     1 
ATOM   1105  O  O     . VAL A 1  144  ? 30.330  15.589  117.963 1.00 87.88  ? 144  VAL A O     1 
ATOM   1106  C  CB    . VAL A 1  144  ? 30.202  12.513  118.399 1.00 81.51  ? 144  VAL A CB    1 
ATOM   1107  C  CG1   . VAL A 1  144  ? 28.948  12.611  119.243 1.00 84.29  ? 144  VAL A CG1   1 
ATOM   1108  C  CG2   . VAL A 1  144  ? 30.513  11.074  118.056 1.00 84.85  ? 144  VAL A CG2   1 
ATOM   1109  N  N     . ASP A 1  145  ? 28.279  15.005  117.217 1.00 84.67  ? 145  ASP A N     1 
ATOM   1110  C  CA    . ASP A 1  145  ? 27.687  16.317  117.439 1.00 90.96  ? 145  ASP A CA    1 
ATOM   1111  C  C     . ASP A 1  145  ? 26.432  16.223  118.307 1.00 90.47  ? 145  ASP A C     1 
ATOM   1112  O  O     . ASP A 1  145  ? 25.850  15.150  118.500 1.00 84.58  ? 145  ASP A O     1 
ATOM   1113  C  CB    . ASP A 1  145  ? 27.346  16.992  116.102 1.00 85.93  ? 145  ASP A CB    1 
ATOM   1114  C  CG    . ASP A 1  145  ? 28.442  17.923  115.623 1.00 92.36  ? 145  ASP A CG    1 
ATOM   1115  O  OD1   . ASP A 1  145  ? 28.521  19.066  116.125 1.00 96.67  ? 145  ASP A OD1   1 
ATOM   1116  O  OD2   . ASP A 1  145  ? 29.233  17.506  114.750 1.00 92.90  ? 145  ASP A OD2   1 
ATOM   1117  N  N     . ARG A 1  146  ? 26.029  17.378  118.838 1.00 88.10  ? 146  ARG A N     1 
ATOM   1118  C  CA    . ARG A 1  146  ? 24.748  17.529  119.514 1.00 91.33  ? 146  ARG A CA    1 
ATOM   1119  C  C     . ARG A 1  146  ? 23.698  17.966  118.507 1.00 87.50  ? 146  ARG A C     1 
ATOM   1120  O  O     . ARG A 1  146  ? 23.962  18.804  117.640 1.00 93.83  ? 146  ARG A O     1 
ATOM   1121  C  CB    . ARG A 1  146  ? 24.824  18.568  120.633 1.00 97.90  ? 146  ARG A CB    1 
ATOM   1122  C  CG    . ARG A 1  146  ? 25.510  18.134  121.911 1.00 95.33  ? 146  ARG A CG    1 
ATOM   1123  C  CD    . ARG A 1  146  ? 25.288  19.210  122.973 1.00 106.74 ? 146  ARG A CD    1 
ATOM   1124  N  NE    . ARG A 1  146  ? 25.881  18.883  124.269 1.00 109.41 ? 146  ARG A NE    1 
ATOM   1125  C  CZ    . ARG A 1  146  ? 25.269  18.173  125.213 1.00 104.54 ? 146  ARG A CZ    1 
ATOM   1126  N  NH1   . ARG A 1  146  ? 24.045  17.702  125.007 1.00 90.65  ? 146  ARG A NH1   1 
ATOM   1127  N  NH2   . ARG A 1  146  ? 25.883  17.930  126.362 1.00 109.16 ? 146  ARG A NH2   1 
ATOM   1128  N  N     . GLY A 1  147  ? 22.501  17.413  118.633 1.00 84.89  ? 147  GLY A N     1 
ATOM   1129  C  CA    . GLY A 1  147  ? 21.447  17.788  117.711 1.00 85.43  ? 147  GLY A CA    1 
ATOM   1130  C  C     . GLY A 1  147  ? 20.138  17.159  118.122 1.00 81.98  ? 147  GLY A C     1 
ATOM   1131  O  O     . GLY A 1  147  ? 20.064  16.400  119.093 1.00 77.25  ? 147  GLY A O     1 
ATOM   1132  N  N     . VAL A 1  148  ? 19.100  17.491  117.357 1.00 79.97  ? 148  VAL A N     1 
ATOM   1133  C  CA    . VAL A 1  148  ? 17.761  16.961  117.558 1.00 80.59  ? 148  VAL A CA    1 
ATOM   1134  C  C     . VAL A 1  148  ? 17.319  16.222  116.306 1.00 79.31  ? 148  VAL A C     1 
ATOM   1135  O  O     . VAL A 1  148  ? 17.714  16.549  115.182 1.00 77.87  ? 148  VAL A O     1 
ATOM   1136  C  CB    . VAL A 1  148  ? 16.726  18.058  117.886 1.00 83.55  ? 148  VAL A CB    1 
ATOM   1137  C  CG1   . VAL A 1  148  ? 16.204  17.908  119.313 1.00 71.12  ? 148  VAL A CG1   1 
ATOM   1138  C  CG2   . VAL A 1  148  ? 17.303  19.451  117.614 1.00 86.42  ? 148  VAL A CG2   1 
ATOM   1139  N  N     . GLY A 1  149  ? 16.451  15.244  116.513 1.00 79.13  ? 149  GLY A N     1 
ATOM   1140  C  CA    . GLY A 1  149  ? 15.771  14.638  115.404 1.00 75.14  ? 149  GLY A CA    1 
ATOM   1141  C  C     . GLY A 1  149  ? 16.679  13.718  114.615 1.00 75.29  ? 149  GLY A C     1 
ATOM   1142  O  O     . GLY A 1  149  ? 17.725  13.247  115.081 1.00 76.72  ? 149  GLY A O     1 
ATOM   1143  N  N     . TYR A 1  150  ? 16.243  13.463  113.387 1.00 77.33  ? 150  TYR A N     1 
ATOM   1144  C  CA    . TYR A 1  150  ? 16.938  12.602  112.437 1.00 80.25  ? 150  TYR A CA    1 
ATOM   1145  C  C     . TYR A 1  150  ? 17.396  13.460  111.264 1.00 78.04  ? 150  TYR A C     1 
ATOM   1146  O  O     . TYR A 1  150  ? 16.574  13.929  110.469 1.00 72.86  ? 150  TYR A O     1 
ATOM   1147  C  CB    . TYR A 1  150  ? 16.031  11.466  111.976 1.00 74.98  ? 150  TYR A CB    1 
ATOM   1148  C  CG    . TYR A 1  150  ? 16.499  10.764  110.728 1.00 76.57  ? 150  TYR A CG    1 
ATOM   1149  C  CD1   . TYR A 1  150  ? 17.640  9.970   110.736 1.00 78.18  ? 150  TYR A CD1   1 
ATOM   1150  C  CD2   . TYR A 1  150  ? 15.786  10.874  109.546 1.00 72.51  ? 150  TYR A CD2   1 
ATOM   1151  C  CE1   . TYR A 1  150  ? 18.064  9.314   109.592 1.00 77.64  ? 150  TYR A CE1   1 
ATOM   1152  C  CE2   . TYR A 1  150  ? 16.201  10.224  108.397 1.00 80.36  ? 150  TYR A CE2   1 
ATOM   1153  C  CZ    . TYR A 1  150  ? 17.341  9.448   108.422 1.00 82.25  ? 150  TYR A CZ    1 
ATOM   1154  O  OH    . TYR A 1  150  ? 17.753  8.804   107.273 1.00 79.21  ? 150  TYR A OH    1 
ATOM   1155  N  N     . VAL A 1  151  ? 18.704  13.664  111.160 1.00 78.30  ? 151  VAL A N     1 
ATOM   1156  C  CA    . VAL A 1  151  ? 19.308  14.518  110.146 1.00 81.73  ? 151  VAL A CA    1 
ATOM   1157  C  C     . VAL A 1  151  ? 20.091  13.627  109.182 1.00 79.61  ? 151  VAL A C     1 
ATOM   1158  O  O     . VAL A 1  151  ? 21.168  13.124  109.541 1.00 79.44  ? 151  VAL A O     1 
ATOM   1159  C  CB    . VAL A 1  151  ? 20.214  15.585  110.773 1.00 81.09  ? 151  VAL A CB    1 
ATOM   1160  C  CG1   . VAL A 1  151  ? 20.951  16.351  109.681 1.00 76.49  ? 151  VAL A CG1   1 
ATOM   1161  C  CG2   . VAL A 1  151  ? 19.394  16.518  111.646 1.00 71.05  ? 151  VAL A CG2   1 
ATOM   1162  N  N     . PRO A 1  152  ? 19.605  13.411  107.960 1.00 81.63  ? 152  PRO A N     1 
ATOM   1163  C  CA    . PRO A 1  152  ? 20.328  12.544  107.024 1.00 82.04  ? 152  PRO A CA    1 
ATOM   1164  C  C     . PRO A 1  152  ? 21.629  13.181  106.570 1.00 76.98  ? 152  PRO A C     1 
ATOM   1165  O  O     . PRO A 1  152  ? 21.784  14.404  106.572 1.00 77.27  ? 152  PRO A O     1 
ATOM   1166  C  CB    . PRO A 1  152  ? 19.350  12.386  105.853 1.00 82.37  ? 152  PRO A CB    1 
ATOM   1167  C  CG    . PRO A 1  152  ? 18.007  12.775  106.411 1.00 76.92  ? 152  PRO A CG    1 
ATOM   1168  C  CD    . PRO A 1  152  ? 18.308  13.842  107.413 1.00 76.89  ? 152  PRO A CD    1 
ATOM   1169  N  N     . ALA A 1  153  ? 22.569  12.321  106.171 1.00 79.88  ? 153  ALA A N     1 
ATOM   1170  C  CA    . ALA A 1  153  ? 23.870  12.790  105.701 1.00 80.09  ? 153  ALA A CA    1 
ATOM   1171  C  C     . ALA A 1  153  ? 23.731  13.790  104.559 1.00 76.44  ? 153  ALA A C     1 
ATOM   1172  O  O     . ALA A 1  153  ? 24.518  14.736  104.449 1.00 78.15  ? 153  ALA A O     1 
ATOM   1173  C  CB    . ALA A 1  153  ? 24.724  11.598  105.266 1.00 75.69  ? 153  ALA A CB    1 
ATOM   1174  N  N     . GLU A 1  154  ? 22.725  13.603  103.705 1.00 78.35  ? 154  GLU A N     1 
ATOM   1175  C  CA    . GLU A 1  154  ? 22.542  14.484  102.558 1.00 79.60  ? 154  GLU A CA    1 
ATOM   1176  C  C     . GLU A 1  154  ? 22.219  15.915  102.977 1.00 84.75  ? 154  GLU A C     1 
ATOM   1177  O  O     . GLU A 1  154  ? 22.425  16.848  102.193 1.00 88.38  ? 154  GLU A O     1 
ATOM   1178  C  CB    . GLU A 1  154  ? 21.438  13.936  101.647 1.00 81.73  ? 154  GLU A CB    1 
ATOM   1179  C  CG    . GLU A 1  154  ? 21.584  12.447  101.292 1.00 92.42  ? 154  GLU A CG    1 
ATOM   1180  C  CD    . GLU A 1  154  ? 21.111  11.502  102.409 1.00 99.50  ? 154  GLU A CD    1 
ATOM   1181  O  OE1   . GLU A 1  154  ? 19.880  11.353  102.588 1.00 95.61  ? 154  GLU A OE1   1 
ATOM   1182  O  OE2   . GLU A 1  154  ? 21.969  10.914  103.112 1.00 90.53  ? 154  GLU A OE2   1 
ATOM   1183  N  N     . LYS A 1  155  ? 21.714  16.115  104.196 1.00 89.76  ? 155  LYS A N     1 
ATOM   1184  C  CA    . LYS A 1  155  ? 21.262  17.445  104.591 1.00 86.76  ? 155  LYS A CA    1 
ATOM   1185  C  C     . LYS A 1  155  ? 22.315  18.239  105.359 1.00 87.46  ? 155  LYS A C     1 
ATOM   1186  O  O     . LYS A 1  155  ? 22.373  19.467  105.225 1.00 87.67  ? 155  LYS A O     1 
ATOM   1187  C  CB    . LYS A 1  155  ? 19.984  17.345  105.422 1.00 80.14  ? 155  LYS A CB    1 
ATOM   1188  C  CG    . LYS A 1  155  ? 19.280  18.683  105.576 1.00 89.34  ? 155  LYS A CG    1 
ATOM   1189  C  CD    . LYS A 1  155  ? 19.079  19.342  104.212 1.00 99.82  ? 155  LYS A CD    1 
ATOM   1190  C  CE    . LYS A 1  155  ? 18.507  20.749  104.334 1.00 105.10 ? 155  LYS A CE    1 
ATOM   1191  N  NZ    . LYS A 1  155  ? 18.139  21.309  103.002 1.00 103.21 ? 155  LYS A NZ    1 
ATOM   1192  N  N     . HIS A 1  156  ? 23.139  17.581  106.180 1.00 85.07  ? 156  HIS A N     1 
ATOM   1193  C  CA    . HIS A 1  156  ? 24.158  18.316  106.927 1.00 83.43  ? 156  HIS A CA    1 
ATOM   1194  C  C     . HIS A 1  156  ? 25.513  18.355  106.220 1.00 91.40  ? 156  HIS A C     1 
ATOM   1195  O  O     . HIS A 1  156  ? 26.266  19.322  106.403 1.00 86.68  ? 156  HIS A O     1 
ATOM   1196  C  CB    . HIS A 1  156  ? 24.309  17.741  108.341 1.00 77.53  ? 156  HIS A CB    1 
ATOM   1197  C  CG    . HIS A 1  156  ? 24.828  16.335  108.395 1.00 76.54  ? 156  HIS A CG    1 
ATOM   1198  N  ND1   . HIS A 1  156  ? 26.170  16.033  108.320 1.00 74.14  ? 156  HIS A ND1   1 
ATOM   1199  C  CD2   . HIS A 1  156  ? 24.189  15.155  108.571 1.00 79.57  ? 156  HIS A CD2   1 
ATOM   1200  C  CE1   . HIS A 1  156  ? 26.334  14.727  108.421 1.00 74.82  ? 156  HIS A CE1   1 
ATOM   1201  N  NE2   . HIS A 1  156  ? 25.147  14.171  108.576 1.00 77.23  ? 156  HIS A NE2   1 
ATOM   1202  N  N     . GLY A 1  157  ? 25.838  17.334  105.417 1.00 90.57  ? 157  GLY A N     1 
ATOM   1203  C  CA    . GLY A 1  157  ? 27.052  17.302  104.613 1.00 78.03  ? 157  GLY A CA    1 
ATOM   1204  C  C     . GLY A 1  157  ? 28.342  17.590  105.358 1.00 83.38  ? 157  GLY A C     1 
ATOM   1205  O  O     . GLY A 1  157  ? 29.288  18.139  104.784 1.00 89.72  ? 157  GLY A O     1 
ATOM   1206  N  N     . ILE A 1  158  ? 28.393  17.213  106.633 1.00 87.67  ? 158  ILE A N     1 
ATOM   1207  C  CA    . ILE A 1  158  ? 29.483  17.614  107.519 1.00 91.20  ? 158  ILE A CA    1 
ATOM   1208  C  C     . ILE A 1  158  ? 30.757  16.874  107.139 1.00 90.66  ? 158  ILE A C     1 
ATOM   1209  O  O     . ILE A 1  158  ? 30.819  15.640  107.198 1.00 90.23  ? 158  ILE A O     1 
ATOM   1210  C  CB    . ILE A 1  158  ? 29.118  17.353  108.986 1.00 88.73  ? 158  ILE A CB    1 
ATOM   1211  C  CG1   . ILE A 1  158  ? 28.098  18.376  109.484 1.00 82.66  ? 158  ILE A CG1   1 
ATOM   1212  C  CG2   . ILE A 1  158  ? 30.366  17.358  109.857 1.00 93.00  ? 158  ILE A CG2   1 
ATOM   1213  C  CD1   . ILE A 1  158  ? 27.637  18.103  110.904 1.00 92.75  ? 158  ILE A CD1   1 
ATOM   1214  N  N     . LYS A 1  159  ? 31.791  17.630  106.774 1.00 94.71  ? 159  LYS A N     1 
ATOM   1215  C  CA    . LYS A 1  159  ? 33.099  17.073  106.449 1.00 97.14  ? 159  LYS A CA    1 
ATOM   1216  C  C     . LYS A 1  159  ? 34.165  17.929  107.111 1.00 103.73 ? 159  LYS A C     1 
ATOM   1217  O  O     . LYS A 1  159  ? 34.328  19.101  106.756 1.00 107.94 ? 159  LYS A O     1 
ATOM   1218  C  CB    . LYS A 1  159  ? 33.324  17.015  104.934 1.00 90.40  ? 159  LYS A CB    1 
ATOM   1219  C  CG    . LYS A 1  159  ? 32.374  16.083  104.199 1.00 89.66  ? 159  LYS A CG    1 
ATOM   1220  C  CD    . LYS A 1  159  ? 32.561  16.136  102.683 1.00 87.86  ? 159  LYS A CD    1 
ATOM   1221  C  CE    . LYS A 1  159  ? 33.855  15.463  102.256 1.00 94.00  ? 159  LYS A CE    1 
ATOM   1222  N  NZ    . LYS A 1  159  ? 33.866  15.149  100.800 1.00 100.05 ? 159  LYS A NZ    1 
ATOM   1223  N  N     . ASP A 1  160  ? 34.885  17.347  108.073 1.00 99.48  ? 160  ASP A N     1 
ATOM   1224  C  CA    . ASP A 1  160  ? 35.998  18.056  108.696 1.00 103.09 ? 160  ASP A CA    1 
ATOM   1225  C  C     . ASP A 1  160  ? 37.169  18.201  107.726 1.00 108.13 ? 160  ASP A C     1 
ATOM   1226  O  O     . ASP A 1  160  ? 37.713  19.299  107.553 1.00 108.47 ? 160  ASP A O     1 
ATOM   1227  C  CB    . ASP A 1  160  ? 36.428  17.333  109.976 1.00 109.68 ? 160  ASP A CB    1 
ATOM   1228  C  CG    . ASP A 1  160  ? 35.494  17.605  111.147 1.00 110.49 ? 160  ASP A CG    1 
ATOM   1229  O  OD1   . ASP A 1  160  ? 34.491  18.323  110.945 1.00 108.52 ? 160  ASP A OD1   1 
ATOM   1230  O  OD2   . ASP A 1  160  ? 35.765  17.110  112.269 1.00 100.25 ? 160  ASP A OD2   1 
ATOM   1231  N  N     . ARG A 1  161  ? 37.565  17.110  107.072 1.00 107.25 ? 161  ARG A N     1 
ATOM   1232  C  CA    . ARG A 1  161  ? 38.636  17.142  106.088 1.00 102.48 ? 161  ARG A CA    1 
ATOM   1233  C  C     . ARG A 1  161  ? 38.146  16.552  104.768 1.00 104.15 ? 161  ARG A C     1 
ATOM   1234  O  O     . ARG A 1  161  ? 37.072  15.948  104.691 1.00 101.13 ? 161  ARG A O     1 
ATOM   1235  C  CB    . ARG A 1  161  ? 39.880  16.401  106.595 1.00 103.17 ? 161  ARG A CB    1 
ATOM   1236  C  CG    . ARG A 1  161  ? 39.652  14.961  106.990 1.00 100.54 ? 161  ARG A CG    1 
ATOM   1237  C  CD    . ARG A 1  161  ? 40.974  14.319  107.368 1.00 107.98 ? 161  ARG A CD    1 
ATOM   1238  N  NE    . ARG A 1  161  ? 41.502  14.850  108.623 1.00 117.88 ? 161  ARG A NE    1 
ATOM   1239  C  CZ    . ARG A 1  161  ? 42.739  14.635  109.067 1.00 121.16 ? 161  ARG A CZ    1 
ATOM   1240  N  NH1   . ARG A 1  161  ? 43.590  13.903  108.353 1.00 110.73 ? 161  ARG A NH1   1 
ATOM   1241  N  NH2   . ARG A 1  161  ? 43.127  15.159  110.226 1.00 118.03 ? 161  ARG A NH2   1 
ATOM   1242  N  N     . ILE A 1  162  ? 38.972  16.725  103.728 1.00 100.87 ? 162  ILE A N     1 
ATOM   1243  C  CA    . ILE A 1  162  ? 38.546  16.495  102.346 1.00 98.46  ? 162  ILE A CA    1 
ATOM   1244  C  C     . ILE A 1  162  ? 37.987  15.090  102.153 1.00 97.61  ? 162  ILE A C     1 
ATOM   1245  O  O     . ILE A 1  162  ? 37.012  14.890  101.417 1.00 100.51 ? 162  ILE A O     1 
ATOM   1246  C  CB    . ILE A 1  162  ? 39.716  16.766  101.379 1.00 106.65 ? 162  ILE A CB    1 
ATOM   1247  C  CG1   . ILE A 1  162  ? 40.178  18.226  101.478 1.00 113.09 ? 162  ILE A CG1   1 
ATOM   1248  C  CG2   . ILE A 1  162  ? 39.322  16.423  99.946  1.00 93.26  ? 162  ILE A CG2   1 
ATOM   1249  C  CD1   . ILE A 1  162  ? 39.298  19.216  100.728 1.00 110.47 ? 162  ILE A CD1   1 
ATOM   1250  N  N     . ASN A 1  163  ? 38.593  14.096  102.796 1.00 93.28  ? 163  ASN A N     1 
ATOM   1251  C  CA    . ASN A 1  163  ? 38.211  12.707  102.583 1.00 92.70  ? 163  ASN A CA    1 
ATOM   1252  C  C     . ASN A 1  163  ? 37.232  12.178  103.621 1.00 88.20  ? 163  ASN A C     1 
ATOM   1253  O  O     . ASN A 1  163  ? 37.059  10.959  103.717 1.00 86.18  ? 163  ASN A O     1 
ATOM   1254  C  CB    . ASN A 1  163  ? 39.452  11.817  102.553 1.00 95.20  ? 163  ASN A CB    1 
ATOM   1255  C  CG    . ASN A 1  163  ? 40.109  11.794  101.199 1.00 97.48  ? 163  ASN A CG    1 
ATOM   1256  O  OD1   . ASN A 1  163  ? 39.440  11.922  100.170 1.00 97.88  ? 163  ASN A OD1   1 
ATOM   1257  N  ND2   . ASN A 1  163  ? 41.426  11.628  101.184 1.00 99.75  ? 163  ASN A ND2   1 
ATOM   1258  N  N     . ALA A 1  164  ? 36.593  13.051  104.394 1.00 93.36  ? 164  ALA A N     1 
ATOM   1259  C  CA    . ALA A 1  164  ? 35.667  12.600  105.424 1.00 87.83  ? 164  ALA A CA    1 
ATOM   1260  C  C     . ALA A 1  164  ? 34.328  12.191  104.817 1.00 83.87  ? 164  ALA A C     1 
ATOM   1261  O  O     . ALA A 1  164  ? 33.927  12.675  103.757 1.00 90.96  ? 164  ALA A O     1 
ATOM   1262  C  CB    . ALA A 1  164  ? 35.457  13.691  106.472 1.00 92.36  ? 164  ALA A CB    1 
ATOM   1263  N  N     . ILE A 1  165  ? 33.631  11.297  105.510 1.00 81.00  ? 165  ILE A N     1 
ATOM   1264  C  CA    . ILE A 1  165  ? 32.385  10.708  105.036 1.00 76.70  ? 165  ILE A CA    1 
ATOM   1265  C  C     . ILE A 1  165  ? 31.250  11.200  105.934 1.00 78.45  ? 165  ILE A C     1 
ATOM   1266  O  O     . ILE A 1  165  ? 31.197  10.834  107.119 1.00 72.33  ? 165  ILE A O     1 
ATOM   1267  C  CB    . ILE A 1  165  ? 32.458  9.177   105.038 1.00 72.95  ? 165  ILE A CB    1 
ATOM   1268  C  CG1   . ILE A 1  165  ? 33.633  8.702   104.186 1.00 69.86  ? 165  ILE A CG1   1 
ATOM   1269  C  CG2   . ILE A 1  165  ? 31.145  8.590   104.565 1.00 72.48  ? 165  ILE A CG2   1 
ATOM   1270  C  CD1   . ILE A 1  165  ? 33.884  7.221   104.308 1.00 70.30  ? 165  ILE A CD1   1 
ATOM   1271  N  N     . PRO A 1  166  ? 30.321  12.009  105.422 1.00 75.17  ? 166  PRO A N     1 
ATOM   1272  C  CA    . PRO A 1  166  ? 29.145  12.375  106.220 1.00 79.19  ? 166  PRO A CA    1 
ATOM   1273  C  C     . PRO A 1  166  ? 28.297  11.154  106.558 1.00 79.72  ? 166  PRO A C     1 
ATOM   1274  O  O     . PRO A 1  166  ? 28.155  10.227  105.756 1.00 75.38  ? 166  PRO A O     1 
ATOM   1275  C  CB    . PRO A 1  166  ? 28.395  13.358  105.313 1.00 75.71  ? 166  PRO A CB    1 
ATOM   1276  C  CG    . PRO A 1  166  ? 29.448  13.927  104.436 1.00 72.42  ? 166  PRO A CG    1 
ATOM   1277  C  CD    . PRO A 1  166  ? 30.400  12.794  104.180 1.00 71.01  ? 166  PRO A CD    1 
ATOM   1278  N  N     . VAL A 1  167  ? 27.729  11.168  107.765 1.00 80.57  ? 167  VAL A N     1 
ATOM   1279  C  CA    . VAL A 1  167  ? 26.998  10.035  108.320 1.00 78.59  ? 167  VAL A CA    1 
ATOM   1280  C  C     . VAL A 1  167  ? 25.584  10.473  108.684 1.00 76.65  ? 167  VAL A C     1 
ATOM   1281  O  O     . VAL A 1  167  ? 25.369  11.605  109.135 1.00 74.54  ? 167  VAL A O     1 
ATOM   1282  C  CB    . VAL A 1  167  ? 27.727  9.458   109.552 1.00 76.78  ? 167  VAL A CB    1 
ATOM   1283  C  CG1   . VAL A 1  167  ? 27.004  8.234   110.091 1.00 77.08  ? 167  VAL A CG1   1 
ATOM   1284  C  CG2   . VAL A 1  167  ? 29.172  9.123   109.206 1.00 80.44  ? 167  VAL A CG2   1 
ATOM   1285  N  N     . ASP A 1  168  ? 24.620  9.574   108.468 1.00 82.89  ? 168  ASP A N     1 
ATOM   1286  C  CA    . ASP A 1  168  ? 23.258  9.775   108.952 1.00 81.36  ? 168  ASP A CA    1 
ATOM   1287  C  C     . ASP A 1  168  ? 23.242  9.828   110.475 1.00 72.74  ? 168  ASP A C     1 
ATOM   1288  O  O     . ASP A 1  168  ? 23.805  8.959   111.148 1.00 74.76  ? 168  ASP A O     1 
ATOM   1289  C  CB    . ASP A 1  168  ? 22.344  8.652   108.452 1.00 77.86  ? 168  ASP A CB    1 
ATOM   1290  C  CG    . ASP A 1  168  ? 22.071  8.740   106.958 1.00 83.13  ? 168  ASP A CG    1 
ATOM   1291  O  OD1   . ASP A 1  168  ? 21.894  9.866   106.446 1.00 83.88  ? 168  ASP A OD1   1 
ATOM   1292  O  OD2   . ASP A 1  168  ? 22.040  7.683   106.292 1.00 88.08  ? 168  ASP A OD2   1 
ATOM   1293  N  N     . ALA A 1  169  ? 22.591  10.848  111.020 1.00 71.68  ? 169  ALA A N     1 
ATOM   1294  C  CA    . ALA A 1  169  ? 22.572  11.080  112.459 1.00 80.51  ? 169  ALA A CA    1 
ATOM   1295  C  C     . ALA A 1  169  ? 21.142  11.034  112.980 1.00 80.24  ? 169  ALA A C     1 
ATOM   1296  O  O     . ALA A 1  169  ? 20.331  11.907  112.653 1.00 79.23  ? 169  ALA A O     1 
ATOM   1297  C  CB    . ALA A 1  169  ? 23.207  12.428  112.795 1.00 77.10  ? 169  ALA A CB    1 
ATOM   1298  N  N     . VAL A 1  170  ? 20.832  10.030  113.792 1.00 75.96  ? 170  VAL A N     1 
ATOM   1299  C  CA    . VAL A 1  170  ? 19.601  10.014  114.572 1.00 84.11  ? 170  VAL A CA    1 
ATOM   1300  C  C     . VAL A 1  170  ? 20.017  10.477  115.966 1.00 81.13  ? 170  VAL A C     1 
ATOM   1301  O  O     . VAL A 1  170  ? 20.683  9.755   116.716 1.00 86.65  ? 170  VAL A O     1 
ATOM   1302  C  CB    . VAL A 1  170  ? 18.906  8.643   114.540 1.00 80.29  ? 170  VAL A CB    1 
ATOM   1303  C  CG1   . VAL A 1  170  ? 19.772  7.608   113.829 1.00 88.27  ? 170  VAL A CG1   1 
ATOM   1304  C  CG2   . VAL A 1  170  ? 18.474  8.158   115.930 1.00 85.20  ? 170  VAL A CG2   1 
ATOM   1305  N  N     . PHE A 1  171  ? 19.728  11.745  116.263 1.00 78.00  ? 171  PHE A N     1 
ATOM   1306  C  CA    . PHE A 1  171  ? 20.250  12.347  117.482 1.00 80.00  ? 171  PHE A CA    1 
ATOM   1307  C  C     . PHE A 1  171  ? 19.487  11.876  118.709 1.00 81.33  ? 171  PHE A C     1 
ATOM   1308  O  O     . PHE A 1  171  ? 20.067  11.784  119.798 1.00 83.38  ? 171  PHE A O     1 
ATOM   1309  C  CB    . PHE A 1  171  ? 20.198  13.866  117.375 1.00 77.62  ? 171  PHE A CB    1 
ATOM   1310  C  CG    . PHE A 1  171  ? 21.201  14.446  116.415 1.00 82.69  ? 171  PHE A CG    1 
ATOM   1311  C  CD1   . PHE A 1  171  ? 22.564  14.369  116.672 1.00 83.91  ? 171  PHE A CD1   1 
ATOM   1312  C  CD2   . PHE A 1  171  ? 20.781  15.101  115.271 1.00 81.36  ? 171  PHE A CD2   1 
ATOM   1313  C  CE1   . PHE A 1  171  ? 23.484  14.919  115.792 1.00 75.51  ? 171  PHE A CE1   1 
ATOM   1314  C  CE2   . PHE A 1  171  ? 21.694  15.650  114.395 1.00 76.76  ? 171  PHE A CE2   1 
ATOM   1315  C  CZ    . PHE A 1  171  ? 23.043  15.559  114.655 1.00 72.25  ? 171  PHE A CZ    1 
ATOM   1316  N  N     . SER A 1  172  ? 18.209  11.533  118.536 1.00 81.56  ? 172  SER A N     1 
ATOM   1317  C  CA    . SER A 1  172  ? 17.310  11.212  119.633 1.00 82.89  ? 172  SER A CA    1 
ATOM   1318  C  C     . SER A 1  172  ? 17.914  10.127  120.517 1.00 80.93  ? 172  SER A C     1 
ATOM   1319  O  O     . SER A 1  172  ? 18.297  9.057   120.011 1.00 83.39  ? 172  SER A O     1 
ATOM   1320  C  CB    . SER A 1  172  ? 15.942  10.754  119.125 1.00 87.85  ? 172  SER A CB    1 
ATOM   1321  O  OG    . SER A 1  172  ? 15.101  10.351  120.202 1.00 80.81  ? 172  SER A OG    1 
ATOM   1322  N  N     . PRO A 1  173  ? 18.044  10.373  121.821 1.00 78.81  ? 173  PRO A N     1 
ATOM   1323  C  CA    . PRO A 1  173  ? 18.494  9.333   122.748 1.00 77.49  ? 173  PRO A CA    1 
ATOM   1324  C  C     . PRO A 1  173  ? 17.386  8.402   123.204 1.00 79.16  ? 173  PRO A C     1 
ATOM   1325  O  O     . PRO A 1  173  ? 17.656  7.491   123.992 1.00 81.17  ? 173  PRO A O     1 
ATOM   1326  C  CB    . PRO A 1  173  ? 19.037  10.158  123.923 1.00 73.38  ? 173  PRO A CB    1 
ATOM   1327  C  CG    . PRO A 1  173  ? 18.169  11.386  123.932 1.00 73.67  ? 173  PRO A CG    1 
ATOM   1328  C  CD    . PRO A 1  173  ? 17.781  11.656  122.500 1.00 72.98  ? 173  PRO A CD    1 
ATOM   1329  N  N     . VAL A 1  174  ? 16.163  8.604   122.728 1.00 76.04  ? 174  VAL A N     1 
ATOM   1330  C  CA    . VAL A 1  174  ? 15.005  7.857   123.202 1.00 76.34  ? 174  VAL A CA    1 
ATOM   1331  C  C     . VAL A 1  174  ? 14.779  6.657   122.290 1.00 73.33  ? 174  VAL A C     1 
ATOM   1332  O  O     . VAL A 1  174  ? 14.445  6.817   121.111 1.00 78.12  ? 174  VAL A O     1 
ATOM   1333  C  CB    . VAL A 1  174  ? 13.757  8.749   123.256 1.00 75.60  ? 174  VAL A CB    1 
ATOM   1334  C  CG1   . VAL A 1  174  ? 12.560  7.937   123.668 1.00 71.70  ? 174  VAL A CG1   1 
ATOM   1335  C  CG2   . VAL A 1  174  ? 13.970  9.908   124.213 1.00 69.77  ? 174  VAL A CG2   1 
ATOM   1336  N  N     . ARG A 1  175  ? 14.941  5.451   122.841 1.00 72.02  ? 175  ARG A N     1 
ATOM   1337  C  CA    . ARG A 1  175  ? 14.772  4.223   122.072 1.00 67.38  ? 175  ARG A CA    1 
ATOM   1338  C  C     . ARG A 1  175  ? 13.329  3.741   122.016 1.00 73.71  ? 175  ARG A C     1 
ATOM   1339  O  O     . ARG A 1  175  ? 12.936  3.140   121.010 1.00 69.98  ? 175  ARG A O     1 
ATOM   1340  C  CB    . ARG A 1  175  ? 15.648  3.101   122.641 1.00 65.97  ? 175  ARG A CB    1 
ATOM   1341  C  CG    . ARG A 1  175  ? 17.143  3.346   122.521 1.00 68.59  ? 175  ARG A CG    1 
ATOM   1342  C  CD    . ARG A 1  175  ? 17.924  2.035   122.433 1.00 79.58  ? 175  ARG A CD    1 
ATOM   1343  N  NE    . ARG A 1  175  ? 19.313  2.257   122.015 1.00 105.71 ? 175  ARG A NE    1 
ATOM   1344  C  CZ    . ARG A 1  175  ? 19.736  2.269   120.748 1.00 102.02 ? 175  ARG A CZ    1 
ATOM   1345  N  NH1   . ARG A 1  175  ? 18.884  2.064   119.749 1.00 93.15  ? 175  ARG A NH1   1 
ATOM   1346  N  NH2   . ARG A 1  175  ? 21.018  2.486   120.477 1.00 100.86 ? 175  ARG A NH2   1 
ATOM   1347  N  N     . ARG A 1  176  ? 12.537  3.960   123.072 1.00 75.90  ? 176  ARG A N     1 
ATOM   1348  C  CA    . ARG A 1  176  ? 11.156  3.480   123.075 1.00 68.64  ? 176  ARG A CA    1 
ATOM   1349  C  C     . ARG A 1  176  ? 10.339  4.228   124.121 1.00 74.37  ? 176  ARG A C     1 
ATOM   1350  O  O     . ARG A 1  176  ? 10.845  4.579   125.190 1.00 81.81  ? 176  ARG A O     1 
ATOM   1351  C  CB    . ARG A 1  176  ? 11.090  1.969   123.338 1.00 65.00  ? 176  ARG A CB    1 
ATOM   1352  C  CG    . ARG A 1  176  ? 9.679   1.391   123.333 1.00 70.73  ? 176  ARG A CG    1 
ATOM   1353  C  CD    . ARG A 1  176  ? 9.597   0.096   122.529 1.00 77.37  ? 176  ARG A CD    1 
ATOM   1354  N  NE    . ARG A 1  176  ? 10.537  -0.910  123.016 1.00 85.89  ? 176  ARG A NE    1 
ATOM   1355  C  CZ    . ARG A 1  176  ? 10.225  -1.873  123.877 1.00 86.82  ? 176  ARG A CZ    1 
ATOM   1356  N  NH1   . ARG A 1  176  ? 8.988   -1.972  124.345 1.00 82.39  ? 176  ARG A NH1   1 
ATOM   1357  N  NH2   . ARG A 1  176  ? 11.150  -2.740  124.271 1.00 89.84  ? 176  ARG A NH2   1 
ATOM   1358  N  N     . VAL A 1  177  ? 9.064   4.453   123.810 1.00 71.05  ? 177  VAL A N     1 
ATOM   1359  C  CA    . VAL A 1  177  ? 8.130   5.089   124.736 1.00 72.16  ? 177  VAL A CA    1 
ATOM   1360  C  C     . VAL A 1  177  ? 6.806   4.340   124.694 1.00 71.16  ? 177  VAL A C     1 
ATOM   1361  O  O     . VAL A 1  177  ? 6.270   4.078   123.613 1.00 70.94  ? 177  VAL A O     1 
ATOM   1362  C  CB    . VAL A 1  177  ? 7.895   6.575   124.405 1.00 66.83  ? 177  VAL A CB    1 
ATOM   1363  C  CG1   . VAL A 1  177  ? 6.883   7.157   125.362 1.00 74.04  ? 177  VAL A CG1   1 
ATOM   1364  C  CG2   . VAL A 1  177  ? 9.183   7.352   124.485 1.00 62.62  ? 177  VAL A CG2   1 
ATOM   1365  N  N     . ALA A 1  178  ? 6.275   4.000   125.869 1.00 78.81  ? 178  ALA A N     1 
ATOM   1366  C  CA    . ALA A 1  178  ? 4.940   3.425   125.981 1.00 78.45  ? 178  ALA A CA    1 
ATOM   1367  C  C     . ALA A 1  178  ? 4.248   4.061   127.177 1.00 79.62  ? 178  ALA A C     1 
ATOM   1368  O  O     . ALA A 1  178  ? 4.908   4.533   128.104 1.00 79.83  ? 178  ALA A O     1 
ATOM   1369  C  CB    . ALA A 1  178  ? 4.981   1.894   126.138 1.00 65.13  ? 178  ALA A CB    1 
ATOM   1370  N  N     . PHE A 1  179  ? 2.917   4.105   127.153 1.00 78.17  ? 179  PHE A N     1 
ATOM   1371  C  CA    . PHE A 1  179  ? 2.211   4.563   128.344 1.00 68.89  ? 179  PHE A CA    1 
ATOM   1372  C  C     . PHE A 1  179  ? 0.963   3.726   128.574 1.00 69.33  ? 179  PHE A C     1 
ATOM   1373  O  O     . PHE A 1  179  ? 0.138   3.542   127.674 1.00 66.83  ? 179  PHE A O     1 
ATOM   1374  C  CB    . PHE A 1  179  ? 1.876   6.065   128.289 1.00 64.90  ? 179  PHE A CB    1 
ATOM   1375  C  CG    . PHE A 1  179  ? 0.803   6.436   127.316 1.00 64.55  ? 179  PHE A CG    1 
ATOM   1376  C  CD1   . PHE A 1  179  ? -0.519  6.459   127.703 1.00 68.27  ? 179  PHE A CD1   1 
ATOM   1377  C  CD2   . PHE A 1  179  ? 1.120   6.811   126.028 1.00 76.44  ? 179  PHE A CD2   1 
ATOM   1378  C  CE1   . PHE A 1  179  ? -1.508  6.813   126.817 1.00 71.41  ? 179  PHE A CE1   1 
ATOM   1379  C  CE2   . PHE A 1  179  ? 0.133   7.168   125.137 1.00 77.91  ? 179  PHE A CE2   1 
ATOM   1380  C  CZ    . PHE A 1  179  ? -1.184  7.174   125.537 1.00 73.52  ? 179  PHE A CZ    1 
ATOM   1381  N  N     . GLN A 1  180  ? 0.865   3.212   129.794 1.00 80.32  ? 180  GLN A N     1 
ATOM   1382  C  CA    . GLN A 1  180  ? -0.259  2.424   130.263 1.00 73.88  ? 180  GLN A CA    1 
ATOM   1383  C  C     . GLN A 1  180  ? -1.280  3.334   130.939 1.00 70.05  ? 180  GLN A C     1 
ATOM   1384  O  O     . GLN A 1  180  ? -0.919  4.284   131.645 1.00 64.51  ? 180  GLN A O     1 
ATOM   1385  C  CB    . GLN A 1  180  ? 0.236   1.360   131.242 1.00 70.29  ? 180  GLN A CB    1 
ATOM   1386  C  CG    . GLN A 1  180  ? -0.695  0.183   131.420 1.00 85.23  ? 180  GLN A CG    1 
ATOM   1387  C  CD    . GLN A 1  180  ? -0.331  -0.978  130.523 1.00 90.38  ? 180  GLN A CD    1 
ATOM   1388  O  OE1   . GLN A 1  180  ? 0.782   -1.049  130.003 1.00 89.58  ? 180  GLN A OE1   1 
ATOM   1389  N  NE2   . GLN A 1  180  ? -1.271  -1.899  130.336 1.00 95.28  ? 180  GLN A NE2   1 
ATOM   1390  N  N     . VAL A 1  181  ? -2.556  3.048   130.701 1.00 68.25  ? 181  VAL A N     1 
ATOM   1391  C  CA    . VAL A 1  181  ? -3.660  3.702   131.395 1.00 74.08  ? 181  VAL A CA    1 
ATOM   1392  C  C     . VAL A 1  181  ? -4.467  2.616   132.090 1.00 71.80  ? 181  VAL A C     1 
ATOM   1393  O  O     . VAL A 1  181  ? -5.172  1.835   131.433 1.00 66.63  ? 181  VAL A O     1 
ATOM   1394  C  CB    . VAL A 1  181  ? -4.542  4.520   130.447 1.00 73.01  ? 181  VAL A CB    1 
ATOM   1395  C  CG1   . VAL A 1  181  ? -5.775  5.015   131.188 1.00 70.57  ? 181  VAL A CG1   1 
ATOM   1396  C  CG2   . VAL A 1  181  ? -3.758  5.687   129.882 1.00 70.45  ? 181  VAL A CG2   1 
ATOM   1397  N  N     . GLU A 1  182  ? -4.368  2.563   133.414 1.00 78.93  ? 182  GLU A N     1 
ATOM   1398  C  CA    . GLU A 1  182  ? -5.052  1.544   134.195 1.00 80.85  ? 182  GLU A CA    1 
ATOM   1399  C  C     . GLU A 1  182  ? -6.167  2.168   135.024 1.00 74.23  ? 182  GLU A C     1 
ATOM   1400  O  O     . GLU A 1  182  ? -6.157  3.368   135.323 1.00 75.03  ? 182  GLU A O     1 
ATOM   1401  C  CB    . GLU A 1  182  ? -4.065  0.794   135.093 1.00 74.34  ? 182  GLU A CB    1 
ATOM   1402  C  CG    . GLU A 1  182  ? -3.019  0.026   134.302 1.00 82.47  ? 182  GLU A CG    1 
ATOM   1403  C  CD    . GLU A 1  182  ? -1.780  -0.290  135.112 1.00 91.27  ? 182  GLU A CD    1 
ATOM   1404  O  OE1   . GLU A 1  182  ? -1.716  -1.397  135.689 1.00 95.85  ? 182  GLU A OE1   1 
ATOM   1405  O  OE2   . GLU A 1  182  ? -0.873  0.574   135.174 1.00 87.51  ? 182  GLU A OE2   1 
ATOM   1406  N  N     . ASP A 1  183  ? -7.145  1.337   135.366 1.00 83.97  ? 183  ASP A N     1 
ATOM   1407  C  CA    . ASP A 1  183  ? -8.273  1.778   136.176 1.00 88.54  ? 183  ASP A CA    1 
ATOM   1408  C  C     . ASP A 1  183  ? -7.825  2.086   137.600 1.00 79.01  ? 183  ASP A C     1 
ATOM   1409  O  O     . ASP A 1  183  ? -6.942  1.416   138.145 1.00 77.89  ? 183  ASP A O     1 
ATOM   1410  C  CB    . ASP A 1  183  ? -9.355  0.701   136.191 1.00 81.30  ? 183  ASP A CB    1 
ATOM   1411  C  CG    . ASP A 1  183  ? -10.730 1.270   136.409 1.00 96.57  ? 183  ASP A CG    1 
ATOM   1412  O  OD1   . ASP A 1  183  ? -10.902 2.488   136.189 1.00 94.37  ? 183  ASP A OD1   1 
ATOM   1413  O  OD2   . ASP A 1  183  ? -11.634 0.502   136.809 1.00 104.65 ? 183  ASP A OD2   1 
ATOM   1414  N  N     . THR A 1  184  ? -8.437  3.104   138.205 1.00 77.27  ? 184  THR A N     1 
ATOM   1415  C  CA    . THR A 1  184  ? -8.162  3.421   139.603 1.00 90.60  ? 184  THR A CA    1 
ATOM   1416  C  C     . THR A 1  184  ? -9.329  4.209   140.192 1.00 89.06  ? 184  THR A C     1 
ATOM   1417  O  O     . THR A 1  184  ? -10.156 4.780   139.471 1.00 94.73  ? 184  THR A O     1 
ATOM   1418  C  CB    . THR A 1  184  ? -6.853  4.206   139.756 1.00 85.99  ? 184  THR A CB    1 
ATOM   1419  O  OG1   . THR A 1  184  ? -6.366  4.069   141.094 1.00 81.73  ? 184  THR A OG1   1 
ATOM   1420  C  CG2   . THR A 1  184  ? -7.069  5.681   139.456 1.00 82.60  ? 184  THR A CG2   1 
ATOM   1421  N  N     . ARG A 1  185  ? -9.380  4.233   141.522 1.00 87.39  ? 185  ARG A N     1 
ATOM   1422  C  CA    . ARG A 1  185  ? -10.425 4.942   142.247 1.00 97.01  ? 185  ARG A CA    1 
ATOM   1423  C  C     . ARG A 1  185  ? -9.825  5.662   143.447 1.00 89.46  ? 185  ARG A C     1 
ATOM   1424  O  O     . ARG A 1  185  ? -8.818  5.229   144.015 1.00 81.61  ? 185  ARG A O     1 
ATOM   1425  C  CB    . ARG A 1  185  ? -11.547 3.994   142.715 1.00 95.96  ? 185  ARG A CB    1 
ATOM   1426  C  CG    . ARG A 1  185  ? -11.063 2.800   143.529 1.00 91.42  ? 185  ARG A CG    1 
ATOM   1427  C  CD    . ARG A 1  185  ? -12.211 2.073   144.228 1.00 101.58 ? 185  ARG A CD    1 
ATOM   1428  N  NE    . ARG A 1  185  ? -12.851 2.905   145.250 1.00 111.78 ? 185  ARG A NE    1 
ATOM   1429  C  CZ    . ARG A 1  185  ? -14.157 3.155   145.315 1.00 107.77 ? 185  ARG A CZ    1 
ATOM   1430  N  NH1   . ARG A 1  185  ? -14.988 2.628   144.424 1.00 105.99 ? 185  ARG A NH1   1 
ATOM   1431  N  NH2   . ARG A 1  185  ? -14.636 3.929   146.282 1.00 97.56  ? 185  ARG A NH2   1 
ATOM   1432  N  N     . LEU A 1  186  ? -10.451 6.782   143.811 1.00 90.87  ? 186  LEU A N     1 
ATOM   1433  C  CA    . LEU A 1  186  ? -10.118 7.544   145.009 1.00 89.82  ? 186  LEU A CA    1 
ATOM   1434  C  C     . LEU A 1  186  ? -11.412 8.036   145.631 1.00 95.76  ? 186  LEU A C     1 
ATOM   1435  O  O     . LEU A 1  186  ? -12.236 8.644   144.942 1.00 94.68  ? 186  LEU A O     1 
ATOM   1436  C  CB    . LEU A 1  186  ? -9.215  8.742   144.704 1.00 97.31  ? 186  LEU A CB    1 
ATOM   1437  C  CG    . LEU A 1  186  ? -9.162  9.756   145.853 1.00 96.76  ? 186  LEU A CG    1 
ATOM   1438  C  CD1   . LEU A 1  186  ? -8.419  9.157   147.028 1.00 100.33 ? 186  LEU A CD1   1 
ATOM   1439  C  CD2   . LEU A 1  186  ? -8.540  11.085  145.440 1.00 97.09  ? 186  LEU A CD2   1 
ATOM   1440  N  N     . GLY A 1  187  ? -11.579 7.793   146.928 1.00 100.17 ? 187  GLY A N     1 
ATOM   1441  C  CA    . GLY A 1  187  ? -12.846 8.121   147.548 1.00 90.08  ? 187  GLY A CA    1 
ATOM   1442  C  C     . GLY A 1  187  ? -13.944 7.264   146.959 1.00 91.99  ? 187  GLY A C     1 
ATOM   1443  O  O     . GLY A 1  187  ? -13.776 6.058   146.736 1.00 88.10  ? 187  GLY A O     1 
ATOM   1444  N  N     . GLN A 1  188  ? -15.082 7.895   146.680 1.00 95.95  ? 188  GLN A N     1 
ATOM   1445  C  CA    . GLN A 1  188  ? -16.245 7.202   146.141 1.00 100.52 ? 188  GLN A CA    1 
ATOM   1446  C  C     . GLN A 1  188  ? -16.323 7.271   144.622 1.00 104.62 ? 188  GLN A C     1 
ATOM   1447  O  O     . GLN A 1  188  ? -17.265 6.718   144.040 1.00 99.79  ? 188  GLN A O     1 
ATOM   1448  C  CB    . GLN A 1  188  ? -17.535 7.774   146.751 1.00 106.84 ? 188  GLN A CB    1 
ATOM   1449  C  CG    . GLN A 1  188  ? -17.677 7.570   148.264 1.00 104.08 ? 188  GLN A CG    1 
ATOM   1450  C  CD    . GLN A 1  188  ? -17.854 6.110   148.653 1.00 107.67 ? 188  GLN A CD    1 
ATOM   1451  O  OE1   . GLN A 1  188  ? -18.705 5.404   148.103 1.00 105.98 ? 188  GLN A OE1   1 
ATOM   1452  N  NE2   . GLN A 1  188  ? -17.045 5.649   149.603 1.00 100.42 ? 188  GLN A NE2   1 
ATOM   1453  N  N     . ARG A 1  189  ? -15.358 7.926   143.972 1.00 104.52 ? 189  ARG A N     1 
ATOM   1454  C  CA    . ARG A 1  189  ? -15.355 8.079   142.523 1.00 95.60  ? 189  ARG A CA    1 
ATOM   1455  C  C     . ARG A 1  189  ? -14.669 6.894   141.858 1.00 97.23  ? 189  ARG A C     1 
ATOM   1456  O  O     . ARG A 1  189  ? -13.632 6.410   142.325 1.00 92.49  ? 189  ARG A O     1 
ATOM   1457  C  CB    . ARG A 1  189  ? -14.659 9.377   142.110 1.00 89.19  ? 189  ARG A CB    1 
ATOM   1458  C  CG    . ARG A 1  189  ? -14.270 10.261  143.271 1.00 94.65  ? 189  ARG A CG    1 
ATOM   1459  C  CD    . ARG A 1  189  ? -13.810 11.632  142.815 1.00 93.20  ? 189  ARG A CD    1 
ATOM   1460  N  NE    . ARG A 1  189  ? -13.331 12.432  143.941 1.00 97.69  ? 189  ARG A NE    1 
ATOM   1461  C  CZ    . ARG A 1  189  ? -13.247 13.758  143.932 1.00 104.74 ? 189  ARG A CZ    1 
ATOM   1462  N  NH1   . ARG A 1  189  ? -12.800 14.408  144.999 1.00 105.06 ? 189  ARG A NH1   1 
ATOM   1463  N  NH2   . ARG A 1  189  ? -13.618 14.437  142.854 1.00 110.70 ? 189  ARG A NH2   1 
ATOM   1464  N  N     . THR A 1  190  ? -15.255 6.437   140.759 1.00 96.85  ? 190  THR A N     1 
ATOM   1465  C  CA    . THR A 1  190  ? -14.722 5.349   139.958 1.00 102.07 ? 190  THR A CA    1 
ATOM   1466  C  C     . THR A 1  190  ? -14.263 5.884   138.604 1.00 96.19  ? 190  THR A C     1 
ATOM   1467  O  O     . THR A 1  190  ? -14.414 7.068   138.287 1.00 90.07  ? 190  THR A O     1 
ATOM   1468  C  CB    . THR A 1  190  ? -15.766 4.242   139.787 1.00 104.31 ? 190  THR A CB    1 
ATOM   1469  O  OG1   . THR A 1  190  ? -16.987 4.803   139.285 1.00 102.69 ? 190  THR A OG1   1 
ATOM   1470  C  CG2   . THR A 1  190  ? -16.034 3.550   141.114 1.00 97.87  ? 190  THR A CG2   1 
ATOM   1471  N  N     . ASP A 1  191  ? -13.684 4.989   137.806 1.00 93.33  ? 191  ASP A N     1 
ATOM   1472  C  CA    . ASP A 1  191  ? -13.255 5.280   136.441 1.00 98.21  ? 191  ASP A CA    1 
ATOM   1473  C  C     . ASP A 1  191  ? -12.153 6.341   136.386 1.00 97.67  ? 191  ASP A C     1 
ATOM   1474  O  O     . ASP A 1  191  ? -11.958 6.986   135.347 1.00 93.47  ? 191  ASP A O     1 
ATOM   1475  C  CB    . ASP A 1  191  ? -14.450 5.698   135.569 1.00 97.37  ? 191  ASP A CB    1 
ATOM   1476  C  CG    . ASP A 1  191  ? -14.227 5.427   134.088 1.00 106.17 ? 191  ASP A CG    1 
ATOM   1477  O  OD1   . ASP A 1  191  ? -13.129 4.959   133.711 1.00 107.00 ? 191  ASP A OD1   1 
ATOM   1478  O  OD2   . ASP A 1  191  ? -15.162 5.681   133.297 1.00 109.16 ? 191  ASP A OD2   1 
ATOM   1479  N  N     . LEU A 1  192  ? -11.417 6.541   137.479 1.00 92.86  ? 192  LEU A N     1 
ATOM   1480  C  CA    . LEU A 1  192  ? -10.275 7.441   137.426 1.00 86.26  ? 192  LEU A CA    1 
ATOM   1481  C  C     . LEU A 1  192  ? -9.096  6.745   136.754 1.00 81.01  ? 192  LEU A C     1 
ATOM   1482  O  O     . LEU A 1  192  ? -9.006  5.516   136.727 1.00 81.50  ? 192  LEU A O     1 
ATOM   1483  C  CB    . LEU A 1  192  ? -9.885  7.910   138.825 1.00 85.10  ? 192  LEU A CB    1 
ATOM   1484  C  CG    . LEU A 1  192  ? -10.853 8.844   139.545 1.00 85.59  ? 192  LEU A CG    1 
ATOM   1485  C  CD1   . LEU A 1  192  ? -10.204 9.337   140.822 1.00 88.65  ? 192  LEU A CD1   1 
ATOM   1486  C  CD2   . LEU A 1  192  ? -11.253 10.008  138.658 1.00 79.26  ? 192  LEU A CD2   1 
ATOM   1487  N  N     . ASP A 1  193  ? -8.183  7.548   136.207 1.00 78.02  ? 193  ASP A N     1 
ATOM   1488  C  CA    . ASP A 1  193  ? -7.079  7.031   135.404 1.00 81.28  ? 193  ASP A CA    1 
ATOM   1489  C  C     . ASP A 1  193  ? -5.776  7.007   136.197 1.00 78.43  ? 193  ASP A C     1 
ATOM   1490  O  O     . ASP A 1  193  ? -5.490  7.921   136.978 1.00 77.10  ? 193  ASP A O     1 
ATOM   1491  C  CB    . ASP A 1  193  ? -6.878  7.859   134.127 1.00 79.21  ? 193  ASP A CB    1 
ATOM   1492  C  CG    . ASP A 1  193  ? -7.984  7.649   133.103 1.00 83.53  ? 193  ASP A CG    1 
ATOM   1493  O  OD1   . ASP A 1  193  ? -8.467  6.507   132.963 1.00 84.78  ? 193  ASP A OD1   1 
ATOM   1494  O  OD2   . ASP A 1  193  ? -8.378  8.632   132.441 1.00 82.39  ? 193  ASP A OD2   1 
ATOM   1495  N  N     . LYS A 1  194  ? -4.984  5.958   135.977 1.00 74.55  ? 194  LYS A N     1 
ATOM   1496  C  CA    . LYS A 1  194  ? -3.638  5.827   136.525 1.00 77.04  ? 194  LYS A CA    1 
ATOM   1497  C  C     . LYS A 1  194  ? -2.680  5.717   135.344 1.00 79.64  ? 194  LYS A C     1 
ATOM   1498  O  O     . LYS A 1  194  ? -2.737  4.741   134.583 1.00 77.98  ? 194  LYS A O     1 
ATOM   1499  C  CB    . LYS A 1  194  ? -3.551  4.606   137.440 1.00 76.87  ? 194  LYS A CB    1 
ATOM   1500  C  CG    . LYS A 1  194  ? -2.155  4.201   137.880 1.00 74.39  ? 194  LYS A CG    1 
ATOM   1501  C  CD    . LYS A 1  194  ? -2.200  2.784   138.450 1.00 71.40  ? 194  LYS A CD    1 
ATOM   1502  C  CE    . LYS A 1  194  ? -0.816  2.222   138.721 1.00 80.91  ? 194  LYS A CE    1 
ATOM   1503  N  NZ    . LYS A 1  194  ? -0.881  0.764   139.043 1.00 80.66  ? 194  LYS A NZ    1 
ATOM   1504  N  N     . LEU A 1  195  ? -1.817  6.718   135.184 1.00 73.52  ? 195  LEU A N     1 
ATOM   1505  C  CA    . LEU A 1  195  ? -0.987  6.852   133.994 1.00 73.96  ? 195  LEU A CA    1 
ATOM   1506  C  C     . LEU A 1  195  ? 0.445   6.435   134.297 1.00 73.79  ? 195  LEU A C     1 
ATOM   1507  O  O     . LEU A 1  195  ? 1.099   7.039   135.150 1.00 75.99  ? 195  LEU A O     1 
ATOM   1508  C  CB    . LEU A 1  195  ? -1.012  8.289   133.479 1.00 74.49  ? 195  LEU A CB    1 
ATOM   1509  C  CG    . LEU A 1  195  ? 0.001   8.533   132.359 1.00 70.19  ? 195  LEU A CG    1 
ATOM   1510  C  CD1   . LEU A 1  195  ? -0.357  7.703   131.131 1.00 61.46  ? 195  LEU A CD1   1 
ATOM   1511  C  CD2   . LEU A 1  195  ? 0.087   10.008  132.017 1.00 66.89  ? 195  LEU A CD2   1 
ATOM   1512  N  N     . THR A 1  196  ? 0.947   5.437   133.577 1.00 71.49  ? 196  THR A N     1 
ATOM   1513  C  CA    . THR A 1  196  ? 2.328   4.992   133.737 1.00 77.52  ? 196  THR A CA    1 
ATOM   1514  C  C     . THR A 1  196  ? 3.087   5.192   132.430 1.00 78.45  ? 196  THR A C     1 
ATOM   1515  O  O     . THR A 1  196  ? 2.744   4.586   131.414 1.00 77.27  ? 196  THR A O     1 
ATOM   1516  C  CB    . THR A 1  196  ? 2.393   3.524   134.158 1.00 77.62  ? 196  THR A CB    1 
ATOM   1517  O  OG1   . THR A 1  196  ? 1.532   3.304   135.286 1.00 86.02  ? 196  THR A OG1   1 
ATOM   1518  C  CG2   . THR A 1  196  ? 3.821   3.170   134.527 1.00 78.73  ? 196  THR A CG2   1 
ATOM   1519  N  N     . LEU A 1  197  ? 4.124   6.023   132.461 1.00 77.53  ? 197  LEU A N     1 
ATOM   1520  C  CA    . LEU A 1  197  ? 4.996   6.251   131.312 1.00 77.48  ? 197  LEU A CA    1 
ATOM   1521  C  C     . LEU A 1  197  ? 6.227   5.364   131.447 1.00 77.40  ? 197  LEU A C     1 
ATOM   1522  O  O     . LEU A 1  197  ? 7.014   5.527   132.384 1.00 82.52  ? 197  LEU A O     1 
ATOM   1523  C  CB    . LEU A 1  197  ? 5.407   7.719   131.219 1.00 73.69  ? 197  LEU A CB    1 
ATOM   1524  C  CG    . LEU A 1  197  ? 4.463   8.696   130.528 1.00 78.71  ? 197  LEU A CG    1 
ATOM   1525  C  CD1   . LEU A 1  197  ? 4.882   10.120  130.842 1.00 80.17  ? 197  LEU A CD1   1 
ATOM   1526  C  CD2   . LEU A 1  197  ? 4.476   8.454   129.028 1.00 79.83  ? 197  LEU A CD2   1 
ATOM   1527  N  N     . ARG A 1  198  ? 6.383   4.423   130.522 1.00 76.17  ? 198  ARG A N     1 
ATOM   1528  C  CA    . ARG A 1  198  ? 7.592   3.625   130.394 1.00 78.34  ? 198  ARG A CA    1 
ATOM   1529  C  C     . ARG A 1  198  ? 8.478   4.241   129.321 1.00 78.01  ? 198  ARG A C     1 
ATOM   1530  O  O     . ARG A 1  198  ? 8.016   4.492   128.199 1.00 79.26  ? 198  ARG A O     1 
ATOM   1531  C  CB    . ARG A 1  198  ? 7.256   2.187   130.019 1.00 77.77  ? 198  ARG A CB    1 
ATOM   1532  C  CG    . ARG A 1  198  ? 6.108   1.607   130.787 1.00 71.31  ? 198  ARG A CG    1 
ATOM   1533  C  CD    . ARG A 1  198  ? 6.438   0.188   131.150 1.00 80.43  ? 198  ARG A CD    1 
ATOM   1534  N  NE    . ARG A 1  198  ? 6.078   -0.778  130.122 1.00 77.45  ? 198  ARG A NE    1 
ATOM   1535  C  CZ    . ARG A 1  198  ? 6.658   -1.965  129.991 1.00 83.71  ? 198  ARG A CZ    1 
ATOM   1536  N  NH1   . ARG A 1  198  ? 6.258   -2.796  129.038 1.00 93.74  ? 198  ARG A NH1   1 
ATOM   1537  N  NH2   . ARG A 1  198  ? 7.651   -2.313  130.802 1.00 71.41  ? 198  ARG A NH2   1 
ATOM   1538  N  N     . ILE A 1  199  ? 9.746   4.470   129.660 1.00 79.90  ? 199  ILE A N     1 
ATOM   1539  C  CA    . ILE A 1  199  ? 10.701  5.131   128.776 1.00 80.39  ? 199  ILE A CA    1 
ATOM   1540  C  C     . ILE A 1  199  ? 11.985  4.311   128.742 1.00 80.20  ? 199  ILE A C     1 
ATOM   1541  O  O     . ILE A 1  199  ? 12.598  4.067   129.792 1.00 82.37  ? 199  ILE A O     1 
ATOM   1542  C  CB    . ILE A 1  199  ? 10.997  6.571   129.227 1.00 75.31  ? 199  ILE A CB    1 
ATOM   1543  C  CG1   . ILE A 1  199  ? 9.710   7.398   129.277 1.00 68.48  ? 199  ILE A CG1   1 
ATOM   1544  C  CG2   . ILE A 1  199  ? 12.021  7.215   128.310 1.00 70.41  ? 199  ILE A CG2   1 
ATOM   1545  C  CD1   . ILE A 1  199  ? 9.928   8.800   129.768 1.00 72.57  ? 199  ILE A CD1   1 
ATOM   1546  N  N     . TRP A 1  200  ? 12.386  3.885   127.543 1.00 77.27  ? 200  TRP A N     1 
ATOM   1547  C  CA    . TRP A 1  200  ? 13.681  3.265   127.293 1.00 72.03  ? 200  TRP A CA    1 
ATOM   1548  C  C     . TRP A 1  200  ? 14.551  4.245   126.525 1.00 73.27  ? 200  TRP A C     1 
ATOM   1549  O  O     . TRP A 1  200  ? 14.136  4.739   125.468 1.00 76.73  ? 200  TRP A O     1 
ATOM   1550  C  CB    . TRP A 1  200  ? 13.558  1.998   126.452 1.00 70.39  ? 200  TRP A CB    1 
ATOM   1551  C  CG    . TRP A 1  200  ? 12.869  0.845   127.052 1.00 71.53  ? 200  TRP A CG    1 
ATOM   1552  C  CD1   . TRP A 1  200  ? 13.448  -0.287  127.538 1.00 71.99  ? 200  TRP A CD1   1 
ATOM   1553  C  CD2   . TRP A 1  200  ? 11.455  0.662   127.176 1.00 76.62  ? 200  TRP A CD2   1 
ATOM   1554  N  NE1   . TRP A 1  200  ? 12.482  -1.159  127.981 1.00 82.01  ? 200  TRP A NE1   1 
ATOM   1555  C  CE2   . TRP A 1  200  ? 11.250  -0.598  127.770 1.00 74.78  ? 200  TRP A CE2   1 
ATOM   1556  C  CE3   . TRP A 1  200  ? 10.344  1.446   126.853 1.00 74.68  ? 200  TRP A CE3   1 
ATOM   1557  C  CZ2   . TRP A 1  200  ? 9.979   -1.093  128.045 1.00 72.02  ? 200  TRP A CZ2   1 
ATOM   1558  C  CZ3   . TRP A 1  200  ? 9.084   0.953   127.129 1.00 77.66  ? 200  TRP A CZ3   1 
ATOM   1559  C  CH2   . TRP A 1  200  ? 8.911   -0.305  127.718 1.00 77.02  ? 200  TRP A CH2   1 
ATOM   1560  N  N     . THR A 1  201  ? 15.768  4.477   127.017 1.00 75.32  ? 201  THR A N     1 
ATOM   1561  C  CA    . THR A 1  201  ? 16.744  5.320   126.338 1.00 79.35  ? 201  THR A CA    1 
ATOM   1562  C  C     . THR A 1  201  ? 18.046  4.548   126.138 1.00 79.84  ? 201  THR A C     1 
ATOM   1563  O  O     . THR A 1  201  ? 18.152  3.358   126.453 1.00 77.88  ? 201  THR A O     1 
ATOM   1564  C  CB    . THR A 1  201  ? 17.017  6.614   127.115 1.00 80.32  ? 201  THR A CB    1 
ATOM   1565  O  OG1   . THR A 1  201  ? 17.886  6.332   128.218 1.00 80.34  ? 201  THR A OG1   1 
ATOM   1566  C  CG2   . THR A 1  201  ? 15.720  7.223   127.622 1.00 72.17  ? 201  THR A CG2   1 
ATOM   1567  N  N     . ASP A 1  202  ? 19.043  5.250   125.598 1.00 84.71  ? 202  ASP A N     1 
ATOM   1568  C  CA    . ASP A 1  202  ? 20.356  4.696   125.290 1.00 87.10  ? 202  ASP A CA    1 
ATOM   1569  C  C     . ASP A 1  202  ? 21.383  4.951   126.385 1.00 91.61  ? 202  ASP A C     1 
ATOM   1570  O  O     . ASP A 1  202  ? 22.538  4.532   126.244 1.00 89.29  ? 202  ASP A O     1 
ATOM   1571  C  CB    . ASP A 1  202  ? 20.875  5.272   123.961 1.00 81.29  ? 202  ASP A CB    1 
ATOM   1572  C  CG    . ASP A 1  202  ? 21.088  6.789   124.011 1.00 81.12  ? 202  ASP A CG    1 
ATOM   1573  O  OD1   . ASP A 1  202  ? 20.492  7.469   124.871 1.00 80.37  ? 202  ASP A OD1   1 
ATOM   1574  O  OD2   . ASP A 1  202  ? 21.847  7.313   123.174 1.00 85.86  ? 202  ASP A OD2   1 
ATOM   1575  N  N     . GLY A 1  203  ? 20.994  5.626   127.470 1.00 89.65  ? 203  GLY A N     1 
ATOM   1576  C  CA    . GLY A 1  203  ? 21.916  6.029   128.503 1.00 85.83  ? 203  GLY A CA    1 
ATOM   1577  C  C     . GLY A 1  203  ? 22.558  7.384   128.288 1.00 85.77  ? 203  GLY A C     1 
ATOM   1578  O  O     . GLY A 1  203  ? 23.050  7.977   129.254 1.00 89.37  ? 203  GLY A O     1 
ATOM   1579  N  N     . SER A 1  204  ? 22.575  7.883   127.047 1.00 89.12  ? 204  SER A N     1 
ATOM   1580  C  CA    . SER A 1  204  ? 23.099  9.220   126.777 1.00 89.61  ? 204  SER A CA    1 
ATOM   1581  C  C     . SER A 1  204  ? 22.430  10.258  127.670 1.00 81.69  ? 204  SER A C     1 
ATOM   1582  O  O     . SER A 1  204  ? 23.102  11.067  128.319 1.00 72.91  ? 204  SER A O     1 
ATOM   1583  C  CB    . SER A 1  204  ? 22.903  9.568   125.297 1.00 85.32  ? 204  SER A CB    1 
ATOM   1584  O  OG    . SER A 1  204  ? 23.325  10.895  125.011 1.00 83.39  ? 204  SER A OG    1 
ATOM   1585  N  N     . VAL A 1  205  ? 21.100  10.256  127.699 1.00 77.06  ? 205  VAL A N     1 
ATOM   1586  C  CA    . VAL A 1  205  ? 20.330  10.984  128.696 1.00 84.20  ? 205  VAL A CA    1 
ATOM   1587  C  C     . VAL A 1  205  ? 19.363  9.997   129.339 1.00 85.99  ? 205  VAL A C     1 
ATOM   1588  O  O     . VAL A 1  205  ? 18.923  9.026   128.713 1.00 80.87  ? 205  VAL A O     1 
ATOM   1589  C  CB    . VAL A 1  205  ? 19.583  12.209  128.105 1.00 79.57  ? 205  VAL A CB    1 
ATOM   1590  C  CG1   . VAL A 1  205  ? 20.295  12.727  126.846 1.00 75.74  ? 205  VAL A CG1   1 
ATOM   1591  C  CG2   . VAL A 1  205  ? 18.105  11.904  127.848 1.00 69.02  ? 205  VAL A CG2   1 
ATOM   1592  N  N     . THR A 1  206  ? 19.061  10.231  130.609 1.00 87.52  ? 206  THR A N     1 
ATOM   1593  C  CA    . THR A 1  206  ? 18.263  9.274   131.354 1.00 83.06  ? 206  THR A CA    1 
ATOM   1594  C  C     . THR A 1  206  ? 16.772  9.520   131.133 1.00 79.81  ? 206  THR A C     1 
ATOM   1595  O  O     . THR A 1  206  ? 16.356  10.649  130.849 1.00 75.52  ? 206  THR A O     1 
ATOM   1596  C  CB    . THR A 1  206  ? 18.580  9.366   132.839 1.00 84.61  ? 206  THR A CB    1 
ATOM   1597  O  OG1   . THR A 1  206  ? 18.214  10.666  133.316 1.00 87.61  ? 206  THR A OG1   1 
ATOM   1598  C  CG2   . THR A 1  206  ? 20.064  9.134   133.074 1.00 79.96  ? 206  THR A CG2   1 
ATOM   1599  N  N     . PRO A 1  207  ? 15.952  8.472   131.267 1.00 75.21  ? 207  PRO A N     1 
ATOM   1600  C  CA    . PRO A 1  207  ? 14.503  8.633   131.055 1.00 77.32  ? 207  PRO A CA    1 
ATOM   1601  C  C     . PRO A 1  207  ? 13.889  9.794   131.820 1.00 86.89  ? 207  PRO A C     1 
ATOM   1602  O  O     . PRO A 1  207  ? 13.014  10.483  131.280 1.00 85.87  ? 207  PRO A O     1 
ATOM   1603  C  CB    . PRO A 1  207  ? 13.939  7.287   131.526 1.00 81.04  ? 207  PRO A CB    1 
ATOM   1604  C  CG    . PRO A 1  207  ? 15.054  6.319   131.319 1.00 81.47  ? 207  PRO A CG    1 
ATOM   1605  C  CD    . PRO A 1  207  ? 16.320  7.076   131.569 1.00 79.05  ? 207  PRO A CD    1 
ATOM   1606  N  N     . LEU A 1  208  ? 14.322  10.032  133.063 1.00 82.88  ? 208  LEU A N     1 
ATOM   1607  C  CA    . LEU A 1  208  ? 13.760  11.132  133.842 1.00 79.60  ? 208  LEU A CA    1 
ATOM   1608  C  C     . LEU A 1  208  ? 14.131  12.481  133.236 1.00 81.46  ? 208  LEU A C     1 
ATOM   1609  O  O     . LEU A 1  208  ? 13.282  13.374  133.123 1.00 82.19  ? 208  LEU A O     1 
ATOM   1610  C  CB    . LEU A 1  208  ? 14.220  11.041  135.300 1.00 90.80  ? 208  LEU A CB    1 
ATOM   1611  C  CG    . LEU A 1  208  ? 13.825  12.182  136.249 1.00 83.58  ? 208  LEU A CG    1 
ATOM   1612  C  CD1   . LEU A 1  208  ? 12.318  12.375  136.300 1.00 80.33  ? 208  LEU A CD1   1 
ATOM   1613  C  CD2   . LEU A 1  208  ? 14.378  11.922  137.637 1.00 82.29  ? 208  LEU A CD2   1 
ATOM   1614  N  N     . GLU A 1  209  ? 15.399  12.656  132.851 1.00 82.01  ? 209  GLU A N     1 
ATOM   1615  C  CA    . GLU A 1  209  ? 15.781  13.877  132.148 1.00 81.17  ? 209  GLU A CA    1 
ATOM   1616  C  C     . GLU A 1  209  ? 14.946  14.058  130.892 1.00 77.43  ? 209  GLU A C     1 
ATOM   1617  O  O     . GLU A 1  209  ? 14.496  15.170  130.581 1.00 75.89  ? 209  GLU A O     1 
ATOM   1618  C  CB    . GLU A 1  209  ? 17.265  13.837  131.795 1.00 80.14  ? 209  GLU A CB    1 
ATOM   1619  C  CG    . GLU A 1  209  ? 18.177  13.759  132.992 1.00 80.99  ? 209  GLU A CG    1 
ATOM   1620  C  CD    . GLU A 1  209  ? 19.606  13.434  132.620 1.00 88.40  ? 209  GLU A CD    1 
ATOM   1621  O  OE1   . GLU A 1  209  ? 20.457  13.385  133.533 1.00 87.07  ? 209  GLU A OE1   1 
ATOM   1622  O  OE2   . GLU A 1  209  ? 19.882  13.226  131.418 1.00 92.93  ? 209  GLU A OE2   1 
ATOM   1623  N  N     . ALA A 1  210  ? 14.724  12.962  130.165 1.00 74.68  ? 210  ALA A N     1 
ATOM   1624  C  CA    . ALA A 1  210  ? 13.907  13.008  128.961 1.00 77.30  ? 210  ALA A CA    1 
ATOM   1625  C  C     . ALA A 1  210  ? 12.517  13.530  129.269 1.00 75.03  ? 210  ALA A C     1 
ATOM   1626  O  O     . ALA A 1  210  ? 12.039  14.473  128.628 1.00 71.23  ? 210  ALA A O     1 
ATOM   1627  C  CB    . ALA A 1  210  ? 13.825  11.618  128.337 1.00 80.71  ? 210  ALA A CB    1 
ATOM   1628  N  N     . LEU A 1  211  ? 11.848  12.906  130.242 1.00 77.73  ? 211  LEU A N     1 
ATOM   1629  C  CA    . LEU A 1  211  ? 10.492  13.302  130.599 1.00 73.47  ? 211  LEU A CA    1 
ATOM   1630  C  C     . LEU A 1  211  ? 10.446  14.752  131.058 1.00 75.13  ? 211  LEU A C     1 
ATOM   1631  O  O     . LEU A 1  211  ? 9.499   15.482  130.741 1.00 73.96  ? 211  LEU A O     1 
ATOM   1632  C  CB    . LEU A 1  211  ? 9.955   12.369  131.678 1.00 71.16  ? 211  LEU A CB    1 
ATOM   1633  C  CG    . LEU A 1  211  ? 8.650   12.747  132.373 1.00 77.58  ? 211  LEU A CG    1 
ATOM   1634  C  CD1   . LEU A 1  211  ? 7.477   12.746  131.408 1.00 72.21  ? 211  LEU A CD1   1 
ATOM   1635  C  CD2   . LEU A 1  211  ? 8.392   11.795  133.533 1.00 80.99  ? 211  LEU A CD2   1 
ATOM   1636  N  N     . ASN A 1  212  ? 11.479  15.202  131.772 1.00 72.90  ? 212  ASN A N     1 
ATOM   1637  C  CA    . ASN A 1  212  ? 11.502  16.586  132.232 1.00 75.59  ? 212  ASN A CA    1 
ATOM   1638  C  C     . ASN A 1  212  ? 11.566  17.555  131.056 1.00 78.56  ? 212  ASN A C     1 
ATOM   1639  O  O     . ASN A 1  212  ? 10.753  18.482  130.961 1.00 73.66  ? 212  ASN A O     1 
ATOM   1640  C  CB    . ASN A 1  212  ? 12.669  16.807  133.197 1.00 84.78  ? 212  ASN A CB    1 
ATOM   1641  C  CG    . ASN A 1  212  ? 12.466  16.097  134.532 1.00 87.05  ? 212  ASN A CG    1 
ATOM   1642  O  OD1   . ASN A 1  212  ? 11.336  15.830  134.945 1.00 88.71  ? 212  ASN A OD1   1 
ATOM   1643  N  ND2   . ASN A 1  212  ? 13.566  15.787  135.212 1.00 86.76  ? 212  ASN A ND2   1 
ATOM   1644  N  N     . GLN A 1  213  ? 12.517  17.357  130.135 1.00 82.19  ? 213  GLN A N     1 
ATOM   1645  C  CA    . GLN A 1  213  ? 12.601  18.315  129.033 1.00 79.39  ? 213  GLN A CA    1 
ATOM   1646  C  C     . GLN A 1  213  ? 11.451  18.168  128.045 1.00 74.59  ? 213  GLN A C     1 
ATOM   1647  O  O     . GLN A 1  213  ? 11.090  19.150  127.387 1.00 73.93  ? 213  GLN A O     1 
ATOM   1648  C  CB    . GLN A 1  213  ? 13.940  18.225  128.306 1.00 75.72  ? 213  GLN A CB    1 
ATOM   1649  C  CG    . GLN A 1  213  ? 14.490  16.844  128.122 1.00 81.07  ? 213  GLN A CG    1 
ATOM   1650  C  CD    . GLN A 1  213  ? 15.960  16.878  127.752 1.00 84.22  ? 213  GLN A CD    1 
ATOM   1651  O  OE1   . GLN A 1  213  ? 16.379  17.685  126.916 1.00 89.39  ? 213  GLN A OE1   1 
ATOM   1652  N  NE2   . GLN A 1  213  ? 16.755  16.013  128.381 1.00 76.32  ? 213  GLN A NE2   1 
ATOM   1653  N  N     . ALA A 1  214  ? 10.826  16.992  127.965 1.00 66.98  ? 214  ALA A N     1 
ATOM   1654  C  CA    . ALA A 1  214  ? 9.624   16.861  127.147 1.00 71.44  ? 214  ALA A CA    1 
ATOM   1655  C  C     . ALA A 1  214  ? 8.458   17.633  127.757 1.00 77.94  ? 214  ALA A C     1 
ATOM   1656  O  O     . ALA A 1  214  ? 7.721   18.334  127.044 1.00 74.30  ? 214  ALA A O     1 
ATOM   1657  C  CB    . ALA A 1  214  ? 9.269   15.384  126.976 1.00 69.31  ? 214  ALA A CB    1 
ATOM   1658  N  N     . VAL A 1  215  ? 8.277   17.518  129.076 1.00 74.57  ? 215  VAL A N     1 
ATOM   1659  C  CA    . VAL A 1  215  ? 7.267   18.316  129.763 1.00 72.17  ? 215  VAL A CA    1 
ATOM   1660  C  C     . VAL A 1  215  ? 7.552   19.800  129.581 1.00 71.52  ? 215  VAL A C     1 
ATOM   1661  O  O     . VAL A 1  215  ? 6.635   20.609  129.383 1.00 72.24  ? 215  VAL A O     1 
ATOM   1662  C  CB    . VAL A 1  215  ? 7.203   17.927  131.253 1.00 70.97  ? 215  VAL A CB    1 
ATOM   1663  C  CG1   . VAL A 1  215  ? 6.396   18.947  132.032 1.00 74.66  ? 215  VAL A CG1   1 
ATOM   1664  C  CG2   . VAL A 1  215  ? 6.595   16.544  131.411 1.00 70.39  ? 215  VAL A CG2   1 
ATOM   1665  N  N     . GLU A 1  216  ? 8.828   20.181  129.629 1.00 70.18  ? 216  GLU A N     1 
ATOM   1666  C  CA    . GLU A 1  216  ? 9.176   21.583  129.432 1.00 73.47  ? 216  GLU A CA    1 
ATOM   1667  C  C     . GLU A 1  216  ? 8.845   22.038  128.015 1.00 80.36  ? 216  GLU A C     1 
ATOM   1668  O  O     . GLU A 1  216  ? 8.370   23.163  127.820 1.00 81.28  ? 216  GLU A O     1 
ATOM   1669  C  CB    . GLU A 1  216  ? 10.653  21.806  129.758 1.00 72.54  ? 216  GLU A CB    1 
ATOM   1670  C  CG    . GLU A 1  216  ? 11.180  23.203  129.451 1.00 76.59  ? 216  GLU A CG    1 
ATOM   1671  C  CD    . GLU A 1  216  ? 10.366  24.319  130.089 1.00 92.88  ? 216  GLU A CD    1 
ATOM   1672  O  OE1   . GLU A 1  216  ? 9.868   24.147  131.230 1.00 100.23 ? 216  GLU A OE1   1 
ATOM   1673  O  OE2   . GLU A 1  216  ? 10.229  25.380  129.439 1.00 85.39  ? 216  GLU A OE2   1 
ATOM   1674  N  N     . ILE A 1  217  ? 9.060   21.170  127.017 1.00 70.83  ? 217  ILE A N     1 
ATOM   1675  C  CA    . ILE A 1  217  ? 8.695   21.507  125.641 1.00 74.81  ? 217  ILE A CA    1 
ATOM   1676  C  C     . ILE A 1  217  ? 7.192   21.717  125.528 1.00 75.37  ? 217  ILE A C     1 
ATOM   1677  O  O     . ILE A 1  217  ? 6.721   22.673  124.898 1.00 76.19  ? 217  ILE A O     1 
ATOM   1678  C  CB    . ILE A 1  217  ? 9.182   20.415  124.668 1.00 84.97  ? 217  ILE A CB    1 
ATOM   1679  C  CG1   . ILE A 1  217  ? 10.704  20.466  124.508 1.00 77.73  ? 217  ILE A CG1   1 
ATOM   1680  C  CG2   . ILE A 1  217  ? 8.492   20.546  123.301 1.00 71.57  ? 217  ILE A CG2   1 
ATOM   1681  C  CD1   . ILE A 1  217  ? 11.282  19.229  123.865 1.00 55.17  ? 217  ILE A CD1   1 
ATOM   1682  N  N     . LEU A 1  218  ? 6.414   20.819  126.131 1.00 73.35  ? 218  LEU A N     1 
ATOM   1683  C  CA    . LEU A 1  218  ? 4.963   20.950  126.043 1.00 73.99  ? 218  LEU A CA    1 
ATOM   1684  C  C     . LEU A 1  218  ? 4.480   22.214  126.749 1.00 77.30  ? 218  LEU A C     1 
ATOM   1685  O  O     . LEU A 1  218  ? 3.594   22.919  126.246 1.00 74.81  ? 218  LEU A O     1 
ATOM   1686  C  CB    . LEU A 1  218  ? 4.299   19.703  126.618 1.00 68.99  ? 218  LEU A CB    1 
ATOM   1687  C  CG    . LEU A 1  218  ? 2.781   19.594  126.479 1.00 67.73  ? 218  LEU A CG    1 
ATOM   1688  C  CD1   . LEU A 1  218  ? 2.294   20.071  125.121 1.00 67.84  ? 218  LEU A CD1   1 
ATOM   1689  C  CD2   . LEU A 1  218  ? 2.368   18.157  126.706 1.00 75.51  ? 218  LEU A CD2   1 
ATOM   1690  N  N     . ARG A 1  219  ? 5.063   22.521  127.912 1.00 79.54  ? 219  ARG A N     1 
ATOM   1691  C  CA    . ARG A 1  219  ? 4.753   23.763  128.618 1.00 82.06  ? 219  ARG A CA    1 
ATOM   1692  C  C     . ARG A 1  219  ? 5.070   24.974  127.746 1.00 82.39  ? 219  ARG A C     1 
ATOM   1693  O  O     . ARG A 1  219  ? 4.256   25.901  127.608 1.00 84.04  ? 219  ARG A O     1 
ATOM   1694  C  CB    . ARG A 1  219  ? 5.545   23.806  129.930 1.00 83.37  ? 219  ARG A CB    1 
ATOM   1695  C  CG    . ARG A 1  219  ? 4.930   24.637  131.066 1.00 92.55  ? 219  ARG A CG    1 
ATOM   1696  C  CD    . ARG A 1  219  ? 5.464   26.062  131.083 1.00 91.12  ? 219  ARG A CD    1 
ATOM   1697  N  NE    . ARG A 1  219  ? 6.914   26.111  130.896 1.00 84.19  ? 219  ARG A NE    1 
ATOM   1698  C  CZ    . ARG A 1  219  ? 7.583   27.216  130.580 1.00 86.80  ? 219  ARG A CZ    1 
ATOM   1699  N  NH1   . ARG A 1  219  ? 6.932   28.361  130.417 1.00 84.83  ? 219  ARG A NH1   1 
ATOM   1700  N  NH2   . ARG A 1  219  ? 8.899   27.179  130.419 1.00 87.86  ? 219  ARG A NH2   1 
ATOM   1701  N  N     . GLU A 1  220  ? 6.256   24.973  127.139 1.00 80.95  ? 220  GLU A N     1 
ATOM   1702  C  CA    . GLU A 1  220  ? 6.666   26.081  126.288 1.00 87.88  ? 220  GLU A CA    1 
ATOM   1703  C  C     . GLU A 1  220  ? 5.719   26.250  125.108 1.00 87.52  ? 220  GLU A C     1 
ATOM   1704  O  O     . GLU A 1  220  ? 5.441   27.375  124.681 1.00 88.64  ? 220  GLU A O     1 
ATOM   1705  C  CB    . GLU A 1  220  ? 8.098   25.845  125.819 1.00 88.32  ? 220  GLU A CB    1 
ATOM   1706  C  CG    . GLU A 1  220  ? 8.753   27.003  125.107 1.00 94.47  ? 220  GLU A CG    1 
ATOM   1707  C  CD    . GLU A 1  220  ? 10.216  26.726  124.836 1.00 108.23 ? 220  GLU A CD    1 
ATOM   1708  O  OE1   . GLU A 1  220  ? 10.917  26.285  125.778 1.00 97.22  ? 220  GLU A OE1   1 
ATOM   1709  O  OE2   . GLU A 1  220  ? 10.657  26.926  123.681 1.00 117.59 ? 220  GLU A OE2   1 
ATOM   1710  N  N     . HIS A 1  221  ? 5.203   25.145  124.570 1.00 84.80  ? 221  HIS A N     1 
ATOM   1711  C  CA    . HIS A 1  221  ? 4.269   25.265  123.455 1.00 83.63  ? 221  HIS A CA    1 
ATOM   1712  C  C     . HIS A 1  221  ? 2.921   25.797  123.916 1.00 86.45  ? 221  HIS A C     1 
ATOM   1713  O  O     . HIS A 1  221  ? 2.283   26.584  123.206 1.00 83.73  ? 221  HIS A O     1 
ATOM   1714  C  CB    . HIS A 1  221  ? 4.110   23.926  122.744 1.00 81.62  ? 221  HIS A CB    1 
ATOM   1715  C  CG    . HIS A 1  221  ? 5.173   23.668  121.728 1.00 82.63  ? 221  HIS A CG    1 
ATOM   1716  N  ND1   . HIS A 1  221  ? 6.308   22.938  122.007 1.00 79.63  ? 221  HIS A ND1   1 
ATOM   1717  C  CD2   . HIS A 1  221  ? 5.292   24.073  120.442 1.00 78.85  ? 221  HIS A CD2   1 
ATOM   1718  C  CE1   . HIS A 1  221  ? 7.072   22.891  120.933 1.00 75.65  ? 221  HIS A CE1   1 
ATOM   1719  N  NE2   . HIS A 1  221  ? 6.478   23.572  119.969 1.00 88.12  ? 221  HIS A NE2   1 
ATOM   1720  N  N     . LEU A 1  222  ? 2.467   25.378  125.101 1.00 86.05  ? 222  LEU A N     1 
ATOM   1721  C  CA    . LEU A 1  222  ? 1.257   25.970  125.663 1.00 86.99  ? 222  LEU A CA    1 
ATOM   1722  C  C     . LEU A 1  222  ? 1.416   27.473  125.847 1.00 85.85  ? 222  LEU A C     1 
ATOM   1723  O  O     . LEU A 1  222  ? 0.437   28.221  125.745 1.00 83.38  ? 222  LEU A O     1 
ATOM   1724  C  CB    . LEU A 1  222  ? 0.908   25.298  126.990 1.00 81.06  ? 222  LEU A CB    1 
ATOM   1725  C  CG    . LEU A 1  222  ? 0.316   23.899  126.845 1.00 76.92  ? 222  LEU A CG    1 
ATOM   1726  C  CD1   . LEU A 1  222  ? 0.334   23.166  128.168 1.00 74.06  ? 222  LEU A CD1   1 
ATOM   1727  C  CD2   . LEU A 1  222  ? -1.097  24.002  126.311 1.00 78.41  ? 222  LEU A CD2   1 
ATOM   1728  N  N     . THR A 1  223  ? 2.645   27.926  126.106 1.00 84.69  ? 223  THR A N     1 
ATOM   1729  C  CA    . THR A 1  223  ? 2.914   29.362  126.160 1.00 87.57  ? 223  THR A CA    1 
ATOM   1730  C  C     . THR A 1  223  ? 2.491   30.081  124.879 1.00 92.34  ? 223  THR A C     1 
ATOM   1731  O  O     . THR A 1  223  ? 2.114   31.255  124.928 1.00 90.50  ? 223  THR A O     1 
ATOM   1732  C  CB    . THR A 1  223  ? 4.401   29.607  126.423 1.00 91.82  ? 223  THR A CB    1 
ATOM   1733  O  OG1   . THR A 1  223  ? 4.797   28.914  127.612 1.00 97.30  ? 223  THR A OG1   1 
ATOM   1734  C  CG2   . THR A 1  223  ? 4.693   31.090  126.583 1.00 101.08 ? 223  THR A CG2   1 
ATOM   1735  N  N     . TYR A 1  224  ? 2.535   29.405  123.728 1.00 92.11  ? 224  TYR A N     1 
ATOM   1736  C  CA    . TYR A 1  224  ? 2.327   30.098  122.459 1.00 91.11  ? 224  TYR A CA    1 
ATOM   1737  C  C     . TYR A 1  224  ? 0.901   30.600  122.269 1.00 89.73  ? 224  TYR A C     1 
ATOM   1738  O  O     . TYR A 1  224  ? 0.672   31.443  121.396 1.00 91.46  ? 224  TYR A O     1 
ATOM   1739  C  CB    . TYR A 1  224  ? 2.731   29.190  121.297 1.00 93.40  ? 224  TYR A CB    1 
ATOM   1740  C  CG    . TYR A 1  224  ? 4.201   28.835  121.322 1.00 93.20  ? 224  TYR A CG    1 
ATOM   1741  C  CD1   . TYR A 1  224  ? 5.136   29.720  121.849 1.00 93.59  ? 224  TYR A CD1   1 
ATOM   1742  C  CD2   . TYR A 1  224  ? 4.656   27.617  120.835 1.00 93.56  ? 224  TYR A CD2   1 
ATOM   1743  C  CE1   . TYR A 1  224  ? 6.483   29.405  121.888 1.00 85.90  ? 224  TYR A CE1   1 
ATOM   1744  C  CE2   . TYR A 1  224  ? 6.005   27.294  120.869 1.00 93.85  ? 224  TYR A CE2   1 
ATOM   1745  C  CZ    . TYR A 1  224  ? 6.911   28.192  121.401 1.00 93.82  ? 224  TYR A CZ    1 
ATOM   1746  O  OH    . TYR A 1  224  ? 8.250   27.879  121.444 1.00 105.99 ? 224  TYR A OH    1 
ATOM   1747  N  N     . PHE A 1  225  ? -0.053  30.125  123.060 1.00 99.53  ? 225  PHE A N     1 
ATOM   1748  C  CA    . PHE A 1  225  ? -1.400  30.681  123.029 1.00 99.46  ? 225  PHE A CA    1 
ATOM   1749  C  C     . PHE A 1  225  ? -1.512  31.996  123.792 1.00 101.63 ? 225  PHE A C     1 
ATOM   1750  O  O     . PHE A 1  225  ? -2.608  32.564  123.859 1.00 102.48 ? 225  PHE A O     1 
ATOM   1751  C  CB    . PHE A 1  225  ? -2.399  29.671  123.599 1.00 88.39  ? 225  PHE A CB    1 
ATOM   1752  C  CG    . PHE A 1  225  ? -2.567  28.439  122.757 1.00 88.25  ? 225  PHE A CG    1 
ATOM   1753  C  CD1   . PHE A 1  225  ? -1.672  27.385  122.855 1.00 90.84  ? 225  PHE A CD1   1 
ATOM   1754  C  CD2   . PHE A 1  225  ? -3.627  28.329  121.876 1.00 89.37  ? 225  PHE A CD2   1 
ATOM   1755  C  CE1   . PHE A 1  225  ? -1.826  26.245  122.081 1.00 82.14  ? 225  PHE A CE1   1 
ATOM   1756  C  CE2   . PHE A 1  225  ? -3.789  27.192  121.103 1.00 87.32  ? 225  PHE A CE2   1 
ATOM   1757  C  CZ    . PHE A 1  225  ? -2.886  26.149  121.208 1.00 80.61  ? 225  PHE A CZ    1 
ATOM   1758  N  N     . SER A 1  226  ? -0.405  32.496  124.347 1.00 103.71 ? 226  SER A N     1 
ATOM   1759  C  CA    . SER A 1  226  ? -0.469  33.632  125.262 1.00 110.18 ? 226  SER A CA    1 
ATOM   1760  C  C     . SER A 1  226  ? -0.940  34.899  124.563 1.00 118.36 ? 226  SER A C     1 
ATOM   1761  O  O     . SER A 1  226  ? -1.770  35.640  125.102 1.00 125.04 ? 226  SER A O     1 
ATOM   1762  C  CB    . SER A 1  226  ? 0.902   33.871  125.893 1.00 113.78 ? 226  SER A CB    1 
ATOM   1763  O  OG    . SER A 1  226  ? 1.864   34.167  124.889 1.00 110.70 ? 226  SER A OG    1 
ATOM   1764  N  N     . ASN A 1  227  ? -0.407  35.181  123.377 1.00 114.04 ? 227  ASN A N     1 
ATOM   1765  C  CA    . ASN A 1  227  ? -0.593  36.478  122.736 1.00 114.42 ? 227  ASN A CA    1 
ATOM   1766  C  C     . ASN A 1  227  ? -1.443  36.319  121.484 1.00 113.62 ? 227  ASN A C     1 
ATOM   1767  O  O     . ASN A 1  227  ? -0.906  36.115  120.387 1.00 114.54 ? 227  ASN A O     1 
ATOM   1768  C  CB    . ASN A 1  227  ? 0.765   37.096  122.395 1.00 119.68 ? 227  ASN A CB    1 
ATOM   1769  C  CG    . ASN A 1  227  ? 0.644   38.506  121.860 1.00 120.98 ? 227  ASN A CG    1 
ATOM   1770  O  OD1   . ASN A 1  227  ? -0.296  39.231  122.192 1.00 115.60 ? 227  ASN A OD1   1 
ATOM   1771  N  ND2   . ASN A 1  227  ? 1.590   38.899  121.017 1.00 115.45 ? 227  ASN A ND2   1 
ATOM   1772  N  N     . PRO A 1  228  ? -2.774  36.402  121.589 1.00 111.00 ? 228  PRO A N     1 
ATOM   1773  C  CA    . PRO A 1  228  ? -3.612  36.301  120.387 1.00 111.62 ? 228  PRO A CA    1 
ATOM   1774  C  C     . PRO A 1  228  ? -3.385  37.449  119.414 1.00 114.51 ? 228  PRO A C     1 
ATOM   1775  O  O     . PRO A 1  228  ? -2.597  38.362  119.684 1.00 112.91 ? 228  PRO A O     1 
ATOM   1776  C  CB    . PRO A 1  228  ? -5.041  36.320  120.950 1.00 106.47 ? 228  PRO A CB    1 
ATOM   1777  C  CG    . PRO A 1  228  ? -4.901  35.902  122.374 1.00 113.11 ? 228  PRO A CG    1 
ATOM   1778  C  CD    . PRO A 1  228  ? -3.584  36.467  122.814 1.00 108.69 ? 228  PRO A CD    1 
ATOM   1779  N  N     . GLN A 1  229  ? -4.068  37.397  118.272 1.00 115.23 ? 229  GLN A N     1 
ATOM   1780  C  CA    . GLN A 1  229  ? -3.990  38.443  117.263 1.00 112.83 ? 229  GLN A CA    1 
ATOM   1781  C  C     . GLN A 1  229  ? -5.309  38.490  116.509 1.00 110.94 ? 229  GLN A C     1 
ATOM   1782  O  O     . GLN A 1  229  ? -5.887  37.447  116.189 1.00 104.30 ? 229  GLN A O     1 
ATOM   1783  C  CB    . GLN A 1  229  ? -2.838  38.202  116.280 1.00 112.73 ? 229  GLN A CB    1 
ATOM   1784  C  CG    . GLN A 1  229  ? -2.313  39.451  115.594 1.00 117.49 ? 229  GLN A CG    1 
ATOM   1785  C  CD    . GLN A 1  229  ? -1.075  40.003  116.274 1.00 123.89 ? 229  GLN A CD    1 
ATOM   1786  O  OE1   . GLN A 1  229  ? -0.552  39.407  117.219 1.00 120.85 ? 229  GLN A OE1   1 
ATOM   1787  N  NE2   . GLN A 1  229  ? -0.597  41.147  115.795 1.00 124.39 ? 229  GLN A NE2   1 
ATOM   1788  N  N     . ALA A 1  230  ? -5.779  39.701  116.231 1.00 116.05 ? 230  ALA A N     1 
ATOM   1789  C  CA    . ALA A 1  230  ? -6.985  39.853  115.433 1.00 119.88 ? 230  ALA A CA    1 
ATOM   1790  C  C     . ALA A 1  230  ? -6.730  39.373  114.011 1.00 124.52 ? 230  ALA A C     1 
ATOM   1791  O  O     . ALA A 1  230  ? -5.668  39.624  113.433 1.00 124.78 ? 230  ALA A O     1 
ATOM   1792  C  CB    . ALA A 1  230  ? -7.446  41.310  115.427 1.00 120.28 ? 230  ALA A CB    1 
ATOM   1793  N  N     . ALA A 1  231  ? -7.702  38.656  113.454 1.00 128.35 ? 231  ALA A N     1 
ATOM   1794  C  CA    . ALA A 1  231  ? -7.622  38.219  112.065 1.00 130.55 ? 231  ALA A CA    1 
ATOM   1795  C  C     . ALA A 1  231  ? -8.010  39.388  111.169 1.00 140.61 ? 231  ALA A C     1 
ATOM   1796  O  O     . ALA A 1  231  ? -9.175  39.798  111.139 1.00 140.74 ? 231  ALA A O     1 
ATOM   1797  C  CB    . ALA A 1  231  ? -8.526  37.015  111.821 1.00 121.78 ? 231  ALA A CB    1 
ATOM   1798  N  N     . ALA A 1  232  ? -7.035  39.933  110.448 1.00 144.54 ? 232  ALA A N     1 
ATOM   1799  C  CA    . ALA A 1  232  ? -7.277  41.041  109.535 1.00 145.53 ? 232  ALA A CA    1 
ATOM   1800  C  C     . ALA A 1  232  ? -7.880  40.592  108.211 1.00 146.06 ? 232  ALA A C     1 
ATOM   1801  O  O     . ALA A 1  232  ? -7.979  41.407  107.287 1.00 147.65 ? 232  ALA A O     1 
ATOM   1802  C  CB    . ALA A 1  232  ? -5.976  41.808  109.282 1.00 143.36 ? 232  ALA A CB    1 
ATOM   1803  N  N     . VAL A 1  233  ? -8.286  39.324  108.106 1.00 142.79 ? 233  VAL A N     1 
ATOM   1804  C  CA    . VAL A 1  233  ? -8.779  38.790  106.838 1.00 150.31 ? 233  VAL A CA    1 
ATOM   1805  C  C     . VAL A 1  233  ? -10.023 39.544  106.379 1.00 152.48 ? 233  VAL A C     1 
ATOM   1806  O  O     . VAL A 1  233  ? -10.234 39.747  105.177 1.00 150.88 ? 233  VAL A O     1 
ATOM   1807  C  CB    . VAL A 1  233  ? -9.046  37.277  106.968 1.00 148.67 ? 233  VAL A CB    1 
ATOM   1808  C  CG1   . VAL A 1  233  ? -9.102  36.621  105.591 1.00 148.82 ? 233  VAL A CG1   1 
ATOM   1809  C  CG2   . VAL A 1  233  ? -7.987  36.622  107.844 1.00 143.36 ? 233  VAL A CG2   1 
ATOM   1810  N  N     . ALA A 1  234  ? -10.860 39.972  107.320 1.00 149.28 ? 234  ALA A N     1 
ATOM   1811  C  CA    . ALA A 1  234  ? -12.081 40.697  106.983 1.00 145.70 ? 234  ALA A CA    1 
ATOM   1812  C  C     . ALA A 1  234  ? -11.762 42.065  106.384 1.00 145.97 ? 234  ALA A C     1 
ATOM   1813  O  O     . ALA A 1  234  ? -11.773 43.081  107.079 1.00 143.69 ? 234  ALA A O     1 
ATOM   1814  C  CB    . ALA A 1  234  ? -12.963 40.847  108.211 1.00 141.88 ? 234  ALA A CB    1 
ATOM   1815  N  N     . LEU B 1  6    ? 8.774   25.916  117.761 1.00 116.46 ? 6    LEU B N     1 
ATOM   1816  C  CA    . LEU B 1  6    ? 9.874   26.740  117.273 1.00 138.08 ? 6    LEU B CA    1 
ATOM   1817  C  C     . LEU B 1  6    ? 9.589   28.223  117.483 1.00 137.91 ? 6    LEU B C     1 
ATOM   1818  O  O     . LEU B 1  6    ? 8.484   28.605  117.867 1.00 127.87 ? 6    LEU B O     1 
ATOM   1819  C  CB    . LEU B 1  6    ? 10.142  26.456  115.793 1.00 132.50 ? 6    LEU B CB    1 
ATOM   1820  C  CG    . LEU B 1  6    ? 10.977  27.486  115.028 1.00 122.56 ? 6    LEU B CG    1 
ATOM   1821  C  CD1   . LEU B 1  6    ? 12.346  27.659  115.667 1.00 114.24 ? 6    LEU B CD1   1 
ATOM   1822  C  CD2   . LEU B 1  6    ? 11.108  27.092  113.565 1.00 111.14 ? 6    LEU B CD2   1 
ATOM   1823  N  N     . LYS B 1  7    ? 10.595  29.052  117.230 1.00 137.51 ? 7    LYS B N     1 
ATOM   1824  C  CA    . LYS B 1  7    ? 10.475  30.497  117.384 1.00 135.19 ? 7    LYS B CA    1 
ATOM   1825  C  C     . LYS B 1  7    ? 9.578   31.120  116.318 1.00 129.77 ? 7    LYS B C     1 
ATOM   1826  O  O     . LYS B 1  7    ? 9.456   30.594  115.213 1.00 120.00 ? 7    LYS B O     1 
ATOM   1827  C  CB    . LYS B 1  7    ? 11.858  31.152  117.347 1.00 132.17 ? 7    LYS B CB    1 
ATOM   1828  C  CG    . LYS B 1  7    ? 11.955  32.456  118.123 1.00 127.74 ? 7    LYS B CG    1 
ATOM   1829  C  CD    . LYS B 1  7    ? 11.215  33.582  117.417 1.00 127.03 ? 7    LYS B CD    1 
ATOM   1830  C  CE    . LYS B 1  7    ? 11.528  33.609  115.930 1.00 123.59 ? 7    LYS B CE    1 
ATOM   1831  N  NZ    . LYS B 1  7    ? 10.752  34.662  115.220 1.00 118.76 ? 7    LYS B NZ    1 
ATOM   1832  N  N     . ALA B 1  8    ? 8.958   32.246  116.662 1.00 129.71 ? 8    ALA B N     1 
ATOM   1833  C  CA    . ALA B 1  8    ? 8.083   32.966  115.739 1.00 125.14 ? 8    ALA B CA    1 
ATOM   1834  C  C     . ALA B 1  8    ? 6.663   32.413  115.633 1.00 115.61 ? 8    ALA B C     1 
ATOM   1835  O  O     . ALA B 1  8    ? 5.916   32.812  114.733 1.00 119.77 ? 8    ALA B O     1 
ATOM   1836  C  CB    . ALA B 1  8    ? 8.723   33.052  114.359 1.00 121.07 ? 8    ALA B CB    1 
ATOM   1837  N  N     . PRO B 1  9    ? 6.289   31.469  116.584 1.00 108.31 ? 9    PRO B N     1 
ATOM   1838  C  CA    . PRO B 1  9    ? 4.906   30.979  116.426 1.00 99.53  ? 9    PRO B CA    1 
ATOM   1839  C  C     . PRO B 1  9    ? 3.920   32.125  116.621 1.00 95.01  ? 9    PRO B C     1 
ATOM   1840  O  O     . PRO B 1  9    ? 4.111   32.948  117.514 1.00 103.13 ? 9    PRO B O     1 
ATOM   1841  C  CB    . PRO B 1  9    ? 4.752   29.943  117.542 1.00 88.10  ? 9    PRO B CB    1 
ATOM   1842  C  CG    . PRO B 1  9    ? 5.681   30.392  118.602 1.00 102.39 ? 9    PRO B CG    1 
ATOM   1843  C  CD    . PRO B 1  9    ? 6.887   30.785  117.815 1.00 105.84 ? 9    PRO B CD    1 
ATOM   1844  N  N     . VAL B 1  10   ? 2.884   32.179  115.791 1.00 86.84  ? 10   VAL B N     1 
ATOM   1845  C  CA    . VAL B 1  10   ? 1.897   33.249  115.883 1.00 87.71  ? 10   VAL B CA    1 
ATOM   1846  C  C     . VAL B 1  10   ? 0.471   32.757  116.103 1.00 101.10 ? 10   VAL B C     1 
ATOM   1847  O  O     . VAL B 1  10   ? -0.003  31.860  115.408 1.00 98.07  ? 10   VAL B O     1 
ATOM   1848  C  CB    . VAL B 1  10   ? 1.923   34.138  114.626 1.00 87.83  ? 10   VAL B CB    1 
ATOM   1849  C  CG1   . VAL B 1  10   ? 0.863   35.224  114.720 1.00 94.51  ? 10   VAL B CG1   1 
ATOM   1850  C  CG2   . VAL B 1  10   ? 3.303   34.747  114.438 1.00 95.97  ? 10   VAL B CG2   1 
ATOM   1851  N  N     . PHE B 1  11   ? -0.207  33.362  117.073 1.00 102.22 ? 11   PHE B N     1 
ATOM   1852  C  CA    . PHE B 1  11   ? -1.586  33.016  117.389 1.00 98.21  ? 11   PHE B CA    1 
ATOM   1853  C  C     . PHE B 1  11   ? -2.506  33.933  116.594 1.00 101.39 ? 11   PHE B C     1 
ATOM   1854  O  O     . PHE B 1  11   ? -2.136  35.063  116.282 1.00 105.83 ? 11   PHE B O     1 
ATOM   1855  C  CB    . PHE B 1  11   ? -1.841  33.178  118.888 1.00 102.73 ? 11   PHE B CB    1 
ATOM   1856  C  CG    . PHE B 1  11   ? -3.062  32.455  119.382 1.00 106.06 ? 11   PHE B CG    1 
ATOM   1857  C  CD1   . PHE B 1  11   ? -3.719  31.539  118.578 1.00 97.97  ? 11   PHE B CD1   1 
ATOM   1858  C  CD2   . PHE B 1  11   ? -3.552  32.694  120.654 1.00 101.95 ? 11   PHE B CD2   1 
ATOM   1859  C  CE1   . PHE B 1  11   ? -4.842  30.876  119.033 1.00 99.10  ? 11   PHE B CE1   1 
ATOM   1860  C  CE2   . PHE B 1  11   ? -4.674  32.034  121.116 1.00 98.76  ? 11   PHE B CE2   1 
ATOM   1861  C  CZ    . PHE B 1  11   ? -5.320  31.124  120.304 1.00 98.77  ? 11   PHE B CZ    1 
ATOM   1862  N  N     . THR B 1  12   ? -3.700  33.455  116.260 1.00 96.71  ? 12   THR B N     1 
ATOM   1863  C  CA    . THR B 1  12   ? -4.634  34.270  115.485 1.00 95.13  ? 12   THR B CA    1 
ATOM   1864  C  C     . THR B 1  12   ? -6.061  33.855  115.805 1.00 96.22  ? 12   THR B C     1 
ATOM   1865  O  O     . THR B 1  12   ? -6.364  32.661  115.835 1.00 96.07  ? 12   THR B O     1 
ATOM   1866  C  CB    . THR B 1  12   ? -4.373  34.131  113.980 1.00 96.10  ? 12   THR B CB    1 
ATOM   1867  O  OG1   . THR B 1  12   ? -3.016  34.497  113.693 1.00 94.97  ? 12   THR B OG1   1 
ATOM   1868  C  CG2   . THR B 1  12   ? -5.320  35.020  113.185 1.00 96.47  ? 12   THR B CG2   1 
ATOM   1869  N  N     . VAL B 1  13   ? -6.939  34.834  116.024 1.00 99.35  ? 13   VAL B N     1 
ATOM   1870  C  CA    . VAL B 1  13   ? -8.288  34.587  116.519 1.00 94.30  ? 13   VAL B CA    1 
ATOM   1871  C  C     . VAL B 1  13   ? -9.300  35.220  115.574 1.00 96.25  ? 13   VAL B C     1 
ATOM   1872  O  O     . VAL B 1  13   ? -9.059  36.297  115.019 1.00 98.88  ? 13   VAL B O     1 
ATOM   1873  C  CB    . VAL B 1  13   ? -8.465  35.132  117.953 1.00 100.55 ? 13   VAL B CB    1 
ATOM   1874  C  CG1   . VAL B 1  13   ? -9.840  34.783  118.500 1.00 97.61  ? 13   VAL B CG1   1 
ATOM   1875  C  CG2   . VAL B 1  13   ? -7.375  34.591  118.872 1.00 98.01  ? 13   VAL B CG2   1 
ATOM   1876  N  N     . ARG B 1  14   ? -10.436 34.547  115.400 1.00 99.23  ? 14   ARG B N     1 
ATOM   1877  C  CA    . ARG B 1  14   ? -11.555 35.053  114.610 1.00 101.35 ? 14   ARG B CA    1 
ATOM   1878  C  C     . ARG B 1  14   ? -12.838 34.634  115.317 1.00 101.31 ? 14   ARG B C     1 
ATOM   1879  O  O     . ARG B 1  14   ? -13.149 33.442  115.371 1.00 97.53  ? 14   ARG B O     1 
ATOM   1880  C  CB    . ARG B 1  14   ? -11.503 34.498  113.188 1.00 97.81  ? 14   ARG B CB    1 
ATOM   1881  C  CG    . ARG B 1  14   ? -12.296 35.275  112.154 1.00 112.85 ? 14   ARG B CG    1 
ATOM   1882  C  CD    . ARG B 1  14   ? -12.099 34.653  110.773 1.00 120.64 ? 14   ARG B CD    1 
ATOM   1883  N  NE    . ARG B 1  14   ? -10.689 34.359  110.514 1.00 131.40 ? 14   ARG B NE    1 
ATOM   1884  C  CZ    . ARG B 1  14   ? -10.252 33.496  109.600 1.00 130.45 ? 14   ARG B CZ    1 
ATOM   1885  N  NH1   . ARG B 1  14   ? -8.949  33.296  109.446 1.00 126.77 ? 14   ARG B NH1   1 
ATOM   1886  N  NH2   . ARG B 1  14   ? -11.116 32.825  108.847 1.00 127.30 ? 14   ARG B NH2   1 
ATOM   1887  N  N     . THR B 1  15   ? -13.581 35.597  115.862 1.00 105.31 ? 15   THR B N     1 
ATOM   1888  C  CA    . THR B 1  15   ? -14.741 35.294  116.692 1.00 110.18 ? 15   THR B CA    1 
ATOM   1889  C  C     . THR B 1  15   ? -16.030 35.776  116.042 1.00 111.80 ? 15   THR B C     1 
ATOM   1890  O  O     . THR B 1  15   ? -16.056 36.818  115.377 1.00 114.74 ? 15   THR B O     1 
ATOM   1891  C  CB    . THR B 1  15   ? -14.632 35.930  118.086 1.00 105.32 ? 15   THR B CB    1 
ATOM   1892  O  OG1   . THR B 1  15   ? -14.790 37.350  117.979 1.00 105.77 ? 15   THR B OG1   1 
ATOM   1893  C  CG2   . THR B 1  15   ? -13.290 35.615  118.721 1.00 102.05 ? 15   THR B CG2   1 
ATOM   1894  N  N     . GLN B 1  16   ? -17.100 35.010  116.253 1.00 110.04 ? 16   GLN B N     1 
ATOM   1895  C  CA    . GLN B 1  16   ? -18.462 35.409  115.918 1.00 112.54 ? 16   GLN B CA    1 
ATOM   1896  C  C     . GLN B 1  16   ? -19.302 35.257  117.181 1.00 116.02 ? 16   GLN B C     1 
ATOM   1897  O  O     . GLN B 1  16   ? -19.559 34.129  117.637 1.00 114.48 ? 16   GLN B O     1 
ATOM   1898  C  CB    . GLN B 1  16   ? -19.016 34.572  114.768 1.00 110.20 ? 16   GLN B CB    1 
ATOM   1899  C  CG    . GLN B 1  16   ? -18.183 34.669  113.497 1.00 122.97 ? 16   GLN B CG    1 
ATOM   1900  C  CD    . GLN B 1  16   ? -18.585 33.640  112.455 1.00 125.85 ? 16   GLN B CD    1 
ATOM   1901  O  OE1   . GLN B 1  16   ? -19.669 33.058  112.526 1.00 134.84 ? 16   GLN B OE1   1 
ATOM   1902  N  NE2   . GLN B 1  16   ? -17.707 33.406  111.484 1.00 108.26 ? 16   GLN B NE2   1 
ATOM   1903  N  N     . GLY B 1  17   ? -19.705 36.395  117.749 1.00 108.89 ? 17   GLY B N     1 
ATOM   1904  C  CA    . GLY B 1  17   ? -20.435 36.505  118.990 1.00 113.13 ? 17   GLY B CA    1 
ATOM   1905  C  C     . GLY B 1  17   ? -19.689 35.852  120.144 1.00 106.42 ? 17   GLY B C     1 
ATOM   1906  O  O     . GLY B 1  17   ? -18.468 35.673  120.129 1.00 102.46 ? 17   GLY B O     1 
ATOM   1907  N  N     . ARG B 1  18   ? -20.461 35.507  121.170 1.00 107.82 ? 18   ARG B N     1 
ATOM   1908  C  CA    . ARG B 1  18   ? -19.974 34.694  122.274 1.00 109.73 ? 18   ARG B CA    1 
ATOM   1909  C  C     . ARG B 1  18   ? -20.152 33.204  122.007 1.00 107.81 ? 18   ARG B C     1 
ATOM   1910  O  O     . ARG B 1  18   ? -19.981 32.392  122.923 1.00 103.27 ? 18   ARG B O     1 
ATOM   1911  C  CB    . ARG B 1  18   ? -20.683 35.094  123.574 1.00 103.18 ? 18   ARG B CB    1 
ATOM   1912  C  CG    . ARG B 1  18   ? -20.320 36.495  124.062 1.00 99.50  ? 18   ARG B CG    1 
ATOM   1913  C  CD    . ARG B 1  18   ? -21.136 36.915  125.271 1.00 91.15  ? 18   ARG B CD    1 
ATOM   1914  N  NE    . ARG B 1  18   ? -21.056 35.947  126.359 1.00 91.03  ? 18   ARG B NE    1 
ATOM   1915  C  CZ    . ARG B 1  18   ? -20.062 35.895  127.241 1.00 95.79  ? 18   ARG B CZ    1 
ATOM   1916  N  NH1   . ARG B 1  18   ? -20.077 34.981  128.203 1.00 89.13  ? 18   ARG B NH1   1 
ATOM   1917  N  NH2   . ARG B 1  18   ? -19.050 36.753  127.162 1.00 88.15  ? 18   ARG B NH2   1 
ATOM   1918  N  N     . GLU B 1  19   ? -20.478 32.836  120.767 1.00 110.49 ? 19   GLU B N     1 
ATOM   1919  C  CA    . GLU B 1  19   ? -20.801 31.464  120.398 1.00 106.69 ? 19   GLU B CA    1 
ATOM   1920  C  C     . GLU B 1  19   ? -19.644 30.745  119.706 1.00 105.90 ? 19   GLU B C     1 
ATOM   1921  O  O     . GLU B 1  19   ? -19.228 29.672  120.152 1.00 102.84 ? 19   GLU B O     1 
ATOM   1922  C  CB    . GLU B 1  19   ? -22.043 31.462  119.497 1.00 111.16 ? 19   GLU B CB    1 
ATOM   1923  C  CG    . GLU B 1  19   ? -23.285 32.052  120.140 1.00 102.62 ? 19   GLU B CG    1 
ATOM   1924  C  CD    . GLU B 1  19   ? -24.098 31.011  120.877 1.00 110.38 ? 19   GLU B CD    1 
ATOM   1925  O  OE1   . GLU B 1  19   ? -25.342 31.144  120.930 1.00 112.13 ? 19   GLU B OE1   1 
ATOM   1926  O  OE2   . GLU B 1  19   ? -23.491 30.051  121.393 1.00 113.07 ? 19   GLU B OE2   1 
ATOM   1927  N  N     . TYR B 1  20   ? -19.117 31.302  118.614 1.00 96.28  ? 20   TYR B N     1 
ATOM   1928  C  CA    . TYR B 1  20   ? -18.231 30.535  117.747 1.00 95.32  ? 20   TYR B CA    1 
ATOM   1929  C  C     . TYR B 1  20   ? -16.858 31.185  117.610 1.00 103.52 ? 20   TYR B C     1 
ATOM   1930  O  O     . TYR B 1  20   ? -16.747 32.412  117.525 1.00 106.34 ? 20   TYR B O     1 
ATOM   1931  C  CB    . TYR B 1  20   ? -18.866 30.353  116.370 1.00 102.96 ? 20   TYR B CB    1 
ATOM   1932  C  CG    . TYR B 1  20   ? -17.977 29.641  115.389 1.00 96.75  ? 20   TYR B CG    1 
ATOM   1933  C  CD1   . TYR B 1  20   ? -17.593 28.329  115.604 1.00 98.19  ? 20   TYR B CD1   1 
ATOM   1934  C  CD2   . TYR B 1  20   ? -17.507 30.283  114.256 1.00 100.22 ? 20   TYR B CD2   1 
ATOM   1935  C  CE1   . TYR B 1  20   ? -16.770 27.671  114.715 1.00 98.15  ? 20   TYR B CE1   1 
ATOM   1936  C  CE2   . TYR B 1  20   ? -16.685 29.633  113.358 1.00 105.32 ? 20   TYR B CE2   1 
ATOM   1937  C  CZ    . TYR B 1  20   ? -16.318 28.325  113.594 1.00 99.47  ? 20   TYR B CZ    1 
ATOM   1938  O  OH    . TYR B 1  20   ? -15.497 27.663  112.708 1.00 99.10  ? 20   TYR B OH    1 
ATOM   1939  N  N     . GLY B 1  21   ? -15.816 30.359  117.565 1.00 95.11  ? 21   GLY B N     1 
ATOM   1940  C  CA    . GLY B 1  21   ? -14.463 30.879  117.428 1.00 91.11  ? 21   GLY B CA    1 
ATOM   1941  C  C     . GLY B 1  21   ? -13.565 29.991  116.591 1.00 98.81  ? 21   GLY B C     1 
ATOM   1942  O  O     . GLY B 1  21   ? -13.668 28.758  116.627 1.00 95.90  ? 21   GLY B O     1 
ATOM   1943  N  N     . GLU B 1  22   ? -12.662 30.632  115.841 1.00 93.75  ? 22   GLU B N     1 
ATOM   1944  C  CA    . GLU B 1  22   ? -11.620 29.966  115.068 1.00 87.26  ? 22   GLU B CA    1 
ATOM   1945  C  C     . GLU B 1  22   ? -10.257 30.473  115.518 1.00 87.49  ? 22   GLU B C     1 
ATOM   1946  O  O     . GLU B 1  22   ? -10.036 31.685  115.600 1.00 94.85  ? 22   GLU B O     1 
ATOM   1947  C  CB    . GLU B 1  22   ? -11.783 30.219  113.568 1.00 93.46  ? 22   GLU B CB    1 
ATOM   1948  C  CG    . GLU B 1  22   ? -13.142 29.856  113.009 1.00 100.82 ? 22   GLU B CG    1 
ATOM   1949  C  CD    . GLU B 1  22   ? -13.185 29.923  111.491 1.00 103.97 ? 22   GLU B CD    1 
ATOM   1950  O  OE1   . GLU B 1  22   ? -12.146 29.650  110.848 1.00 101.05 ? 22   GLU B OE1   1 
ATOM   1951  O  OE2   . GLU B 1  22   ? -14.263 30.249  110.946 1.00 98.43  ? 22   GLU B OE2   1 
ATOM   1952  N  N     . PHE B 1  23   ? -9.342  29.544  115.777 1.00 79.72  ? 23   PHE B N     1 
ATOM   1953  C  CA    . PHE B 1  23   ? -8.027  29.833  116.331 1.00 86.24  ? 23   PHE B CA    1 
ATOM   1954  C  C     . PHE B 1  23   ? -6.960  29.191  115.458 1.00 88.16  ? 23   PHE B C     1 
ATOM   1955  O  O     . PHE B 1  23   ? -7.082  28.024  115.088 1.00 91.00  ? 23   PHE B O     1 
ATOM   1956  C  CB    . PHE B 1  23   ? -7.922  29.312  117.763 1.00 86.73  ? 23   PHE B CB    1 
ATOM   1957  C  CG    . PHE B 1  23   ? -8.964  29.869  118.669 1.00 90.83  ? 23   PHE B CG    1 
ATOM   1958  C  CD1   . PHE B 1  23   ? -10.215 29.278  118.750 1.00 91.38  ? 23   PHE B CD1   1 
ATOM   1959  C  CD2   . PHE B 1  23   ? -8.706  30.998  119.422 1.00 91.56  ? 23   PHE B CD2   1 
ATOM   1960  C  CE1   . PHE B 1  23   ? -11.186 29.795  119.574 1.00 81.47  ? 23   PHE B CE1   1 
ATOM   1961  C  CE2   . PHE B 1  23   ? -9.673  31.522  120.248 1.00 94.07  ? 23   PHE B CE2   1 
ATOM   1962  C  CZ    . PHE B 1  23   ? -10.916 30.919  120.325 1.00 90.69  ? 23   PHE B CZ    1 
ATOM   1963  N  N     . VAL B 1  24   ? -5.912  29.940  115.137 1.00 86.41  ? 24   VAL B N     1 
ATOM   1964  C  CA    . VAL B 1  24   ? -4.916  29.493  114.173 1.00 89.13  ? 24   VAL B CA    1 
ATOM   1965  C  C     . VAL B 1  24   ? -3.529  29.683  114.768 1.00 88.85  ? 24   VAL B C     1 
ATOM   1966  O  O     . VAL B 1  24   ? -3.178  30.787  115.198 1.00 95.00  ? 24   VAL B O     1 
ATOM   1967  C  CB    . VAL B 1  24   ? -5.044  30.244  112.835 1.00 86.16  ? 24   VAL B CB    1 
ATOM   1968  C  CG1   . VAL B 1  24   ? -3.990  29.747  111.864 1.00 94.54  ? 24   VAL B CG1   1 
ATOM   1969  C  CG2   . VAL B 1  24   ? -6.448  30.073  112.251 1.00 75.75  ? 24   VAL B CG2   1 
ATOM   1970  N  N     . LEU B 1  25   ? -2.743  28.608  114.785 1.00 83.70  ? 25   LEU B N     1 
ATOM   1971  C  CA    . LEU B 1  25   ? -1.382  28.624  115.311 1.00 87.94  ? 25   LEU B CA    1 
ATOM   1972  C  C     . LEU B 1  25   ? -0.454  28.063  114.240 1.00 91.85  ? 25   LEU B C     1 
ATOM   1973  O  O     . LEU B 1  25   ? -0.557  26.885  113.881 1.00 92.11  ? 25   LEU B O     1 
ATOM   1974  C  CB    . LEU B 1  25   ? -1.283  27.814  116.602 1.00 81.09  ? 25   LEU B CB    1 
ATOM   1975  C  CG    . LEU B 1  25   ? -0.003  27.990  117.421 1.00 87.89  ? 25   LEU B CG    1 
ATOM   1976  C  CD1   . LEU B 1  25   ? 0.105   29.422  117.907 1.00 96.52  ? 25   LEU B CD1   1 
ATOM   1977  C  CD2   . LEU B 1  25   ? 0.037   27.024  118.595 1.00 82.86  ? 25   LEU B CD2   1 
ATOM   1978  N  N     . GLU B 1  26   ? 0.440   28.902  113.719 1.00 99.06  ? 26   GLU B N     1 
ATOM   1979  C  CA    . GLU B 1  26   ? 1.385   28.485  112.689 1.00 94.10  ? 26   GLU B CA    1 
ATOM   1980  C  C     . GLU B 1  26   ? 2.578   29.422  112.722 1.00 88.75  ? 26   GLU B C     1 
ATOM   1981  O  O     . GLU B 1  26   ? 2.422   30.606  113.040 1.00 92.65  ? 26   GLU B O     1 
ATOM   1982  C  CB    . GLU B 1  26   ? 0.742   28.506  111.297 1.00 85.56  ? 26   GLU B CB    1 
ATOM   1983  C  CG    . GLU B 1  26   ? 0.270   29.885  110.862 1.00 89.16  ? 26   GLU B CG    1 
ATOM   1984  C  CD    . GLU B 1  26   ? -0.371  29.881  109.487 1.00 96.49  ? 26   GLU B CD    1 
ATOM   1985  O  OE1   . GLU B 1  26   ? 0.229   29.314  108.546 1.00 93.32  ? 26   GLU B OE1   1 
ATOM   1986  O  OE2   . GLU B 1  26   ? -1.479  30.444  109.348 1.00 96.95  ? 26   GLU B OE2   1 
ATOM   1987  N  N     . PRO B 1  27   ? 3.779   28.935  112.397 1.00 86.18  ? 27   PRO B N     1 
ATOM   1988  C  CA    . PRO B 1  27   ? 4.118   27.544  112.096 1.00 86.78  ? 27   PRO B CA    1 
ATOM   1989  C  C     . PRO B 1  27   ? 4.525   26.757  113.335 1.00 86.07  ? 27   PRO B C     1 
ATOM   1990  O  O     . PRO B 1  27   ? 5.059   27.328  114.284 1.00 94.71  ? 27   PRO B O     1 
ATOM   1991  C  CB    . PRO B 1  27   ? 5.304   27.687  111.152 1.00 89.05  ? 27   PRO B CB    1 
ATOM   1992  C  CG    . PRO B 1  27   ? 6.009   28.878  111.688 1.00 90.75  ? 27   PRO B CG    1 
ATOM   1993  C  CD    . PRO B 1  27   ? 4.911   29.831  112.123 1.00 92.99  ? 27   PRO B CD    1 
ATOM   1994  N  N     . LEU B 1  28   ? 4.297   25.451  113.313 1.00 79.09  ? 28   LEU B N     1 
ATOM   1995  C  CA    . LEU B 1  28   ? 4.714   24.570  114.389 1.00 82.34  ? 28   LEU B CA    1 
ATOM   1996  C  C     . LEU B 1  28   ? 5.647   23.510  113.833 1.00 82.02  ? 28   LEU B C     1 
ATOM   1997  O  O     . LEU B 1  28   ? 5.535   23.119  112.668 1.00 81.12  ? 28   LEU B O     1 
ATOM   1998  C  CB    . LEU B 1  28   ? 3.515   23.898  115.060 1.00 87.24  ? 28   LEU B CB    1 
ATOM   1999  C  CG    . LEU B 1  28   ? 2.604   24.770  115.921 1.00 80.99  ? 28   LEU B CG    1 
ATOM   2000  C  CD1   . LEU B 1  28   ? 1.312   24.032  116.235 1.00 78.45  ? 28   LEU B CD1   1 
ATOM   2001  C  CD2   . LEU B 1  28   ? 3.324   25.157  117.199 1.00 83.38  ? 28   LEU B CD2   1 
ATOM   2002  N  N     . GLU B 1  29   ? 6.562   23.040  114.679 1.00 84.76  ? 29   GLU B N     1 
ATOM   2003  C  CA    . GLU B 1  29   ? 7.474   21.980  114.277 1.00 83.99  ? 29   GLU B CA    1 
ATOM   2004  C  C     . GLU B 1  29   ? 6.677   20.743  113.864 1.00 86.74  ? 29   GLU B C     1 
ATOM   2005  O  O     . GLU B 1  29   ? 5.488   20.610  114.163 1.00 88.93  ? 29   GLU B O     1 
ATOM   2006  C  CB    . GLU B 1  29   ? 8.444   21.658  115.415 1.00 84.67  ? 29   GLU B CB    1 
ATOM   2007  C  CG    . GLU B 1  29   ? 9.688   20.876  115.007 1.00 95.42  ? 29   GLU B CG    1 
ATOM   2008  C  CD    . GLU B 1  29   ? 10.507  21.568  113.922 1.00 107.11 ? 29   GLU B CD    1 
ATOM   2009  O  OE1   . GLU B 1  29   ? 10.647  20.988  112.820 1.00 101.12 ? 29   GLU B OE1   1 
ATOM   2010  O  OE2   . GLU B 1  29   ? 11.012  22.687  114.170 1.00 107.61 ? 29   GLU B OE2   1 
ATOM   2011  N  N     . ARG B 1  30   ? 7.342   19.838  113.153 1.00 81.51  ? 30   ARG B N     1 
ATOM   2012  C  CA    . ARG B 1  30   ? 6.644   18.737  112.502 1.00 83.82  ? 30   ARG B CA    1 
ATOM   2013  C  C     . ARG B 1  30   ? 5.939   17.846  113.516 1.00 78.21  ? 30   ARG B C     1 
ATOM   2014  O  O     . ARG B 1  30   ? 6.585   17.198  114.344 1.00 80.68  ? 30   ARG B O     1 
ATOM   2015  C  CB    . ARG B 1  30   ? 7.631   17.918  111.673 1.00 88.59  ? 30   ARG B CB    1 
ATOM   2016  C  CG    . ARG B 1  30   ? 6.980   16.838  110.835 1.00 77.13  ? 30   ARG B CG    1 
ATOM   2017  C  CD    . ARG B 1  30   ? 8.018   16.039  110.086 1.00 74.73  ? 30   ARG B CD    1 
ATOM   2018  N  NE    . ARG B 1  30   ? 8.718   15.080  110.935 1.00 67.36  ? 30   ARG B NE    1 
ATOM   2019  C  CZ    . ARG B 1  30   ? 9.746   14.338  110.528 1.00 73.39  ? 30   ARG B CZ    1 
ATOM   2020  N  NH1   . ARG B 1  30   ? 10.203  14.452  109.287 1.00 87.31  ? 30   ARG B NH1   1 
ATOM   2021  N  NH2   . ARG B 1  30   ? 10.325  13.484  111.358 1.00 64.94  ? 30   ARG B NH2   1 
ATOM   2022  N  N     . GLY B 1  31   ? 4.608   17.806  113.434 1.00 76.84  ? 31   GLY B N     1 
ATOM   2023  C  CA    . GLY B 1  31   ? 3.791   16.928  114.241 1.00 83.15  ? 31   GLY B CA    1 
ATOM   2024  C  C     . GLY B 1  31   ? 3.099   17.597  115.412 1.00 81.65  ? 31   GLY B C     1 
ATOM   2025  O  O     . GLY B 1  31   ? 2.088   17.074  115.901 1.00 75.53  ? 31   GLY B O     1 
ATOM   2026  N  N     . PHE B 1  32   ? 3.608   18.744  115.865 1.00 84.37  ? 32   PHE B N     1 
ATOM   2027  C  CA    . PHE B 1  32   ? 3.062   19.383  117.054 1.00 77.82  ? 32   PHE B CA    1 
ATOM   2028  C  C     . PHE B 1  32   ? 1.648   19.905  116.847 1.00 77.65  ? 32   PHE B C     1 
ATOM   2029  O  O     . PHE B 1  32   ? 0.968   20.201  117.836 1.00 80.86  ? 32   PHE B O     1 
ATOM   2030  C  CB    . PHE B 1  32   ? 3.987   20.513  117.509 1.00 79.94  ? 32   PHE B CB    1 
ATOM   2031  C  CG    . PHE B 1  32   ? 5.117   20.045  118.375 1.00 81.80  ? 32   PHE B CG    1 
ATOM   2032  C  CD1   . PHE B 1  32   ? 6.262   19.504  117.812 1.00 79.09  ? 32   PHE B CD1   1 
ATOM   2033  C  CD2   . PHE B 1  32   ? 5.028   20.130  119.753 1.00 74.98  ? 32   PHE B CD2   1 
ATOM   2034  C  CE1   . PHE B 1  32   ? 7.300   19.065  118.608 1.00 71.69  ? 32   PHE B CE1   1 
ATOM   2035  C  CE2   . PHE B 1  32   ? 6.062   19.691  120.553 1.00 78.05  ? 32   PHE B CE2   1 
ATOM   2036  C  CZ    . PHE B 1  32   ? 7.201   19.156  119.979 1.00 74.97  ? 32   PHE B CZ    1 
ATOM   2037  N  N     . GLY B 1  33   ? 1.190   20.018  115.600 1.00 73.69  ? 33   GLY B N     1 
ATOM   2038  C  CA    . GLY B 1  33   ? -0.203  20.359  115.371 1.00 71.91  ? 33   GLY B CA    1 
ATOM   2039  C  C     . GLY B 1  33   ? -1.149  19.416  116.086 1.00 73.98  ? 33   GLY B C     1 
ATOM   2040  O  O     . GLY B 1  33   ? -2.016  19.845  116.850 1.00 75.76  ? 33   GLY B O     1 
ATOM   2041  N  N     . VAL B 1  34   ? -0.972  18.110  115.886 1.00 71.74  ? 34   VAL B N     1 
ATOM   2042  C  CA    . VAL B 1  34   ? -1.867  17.181  116.563 1.00 73.11  ? 34   VAL B CA    1 
ATOM   2043  C  C     . VAL B 1  34   ? -1.470  17.023  118.028 1.00 73.56  ? 34   VAL B C     1 
ATOM   2044  O  O     . VAL B 1  34   ? -2.343  16.838  118.884 1.00 80.97  ? 34   VAL B O     1 
ATOM   2045  C  CB    . VAL B 1  34   ? -1.916  15.827  115.825 1.00 73.82  ? 34   VAL B CB    1 
ATOM   2046  C  CG1   . VAL B 1  34   ? -2.112  16.044  114.343 1.00 69.13  ? 34   VAL B CG1   1 
ATOM   2047  C  CG2   . VAL B 1  34   ? -0.682  15.009  116.088 1.00 67.52  ? 34   VAL B CG2   1 
ATOM   2048  N  N     . THR B 1  35   ? -0.174  17.154  118.343 1.00 72.43  ? 35   THR B N     1 
ATOM   2049  C  CA    . THR B 1  35   ? 0.288   17.086  119.728 1.00 72.28  ? 35   THR B CA    1 
ATOM   2050  C  C     . THR B 1  35   ? -0.400  18.130  120.606 1.00 75.54  ? 35   THR B C     1 
ATOM   2051  O  O     . THR B 1  35   ? -0.705  17.867  121.774 1.00 75.85  ? 35   THR B O     1 
ATOM   2052  C  CB    . THR B 1  35   ? 1.808   17.264  119.775 1.00 76.98  ? 35   THR B CB    1 
ATOM   2053  O  OG1   . THR B 1  35   ? 2.447   16.127  119.182 1.00 75.35  ? 35   THR B OG1   1 
ATOM   2054  C  CG2   . THR B 1  35   ? 2.293   17.427  121.206 1.00 74.46  ? 35   THR B CG2   1 
ATOM   2055  N  N     . LEU B 1  36   ? -0.653  19.321  120.067 1.00 78.06  ? 36   LEU B N     1 
ATOM   2056  C  CA    . LEU B 1  36   ? -1.421  20.307  120.817 1.00 72.52  ? 36   LEU B CA    1 
ATOM   2057  C  C     . LEU B 1  36   ? -2.919  20.097  120.659 1.00 72.35  ? 36   LEU B C     1 
ATOM   2058  O  O     . LEU B 1  36   ? -3.662  20.187  121.639 1.00 79.54  ? 36   LEU B O     1 
ATOM   2059  C  CB    . LEU B 1  36   ? -1.052  21.720  120.378 1.00 71.21  ? 36   LEU B CB    1 
ATOM   2060  C  CG    . LEU B 1  36   ? 0.364   22.174  120.709 1.00 74.51  ? 36   LEU B CG    1 
ATOM   2061  C  CD1   . LEU B 1  36   ? 0.494   23.659  120.444 1.00 85.53  ? 36   LEU B CD1   1 
ATOM   2062  C  CD2   . LEU B 1  36   ? 0.709   21.851  122.152 1.00 75.62  ? 36   LEU B CD2   1 
ATOM   2063  N  N     . GLY B 1  37   ? -3.385  19.808  119.444 1.00 71.64  ? 37   GLY B N     1 
ATOM   2064  C  CA    . GLY B 1  37   ? -4.816  19.826  119.187 1.00 73.88  ? 37   GLY B CA    1 
ATOM   2065  C  C     . GLY B 1  37   ? -5.587  18.720  119.884 1.00 70.27  ? 37   GLY B C     1 
ATOM   2066  O  O     . GLY B 1  37   ? -6.678  18.957  120.408 1.00 74.81  ? 37   GLY B O     1 
ATOM   2067  N  N     . ASN B 1  38   ? -5.058  17.495  119.881 1.00 68.65  ? 38   ASN B N     1 
ATOM   2068  C  CA    . ASN B 1  38   ? -5.807  16.393  120.482 1.00 73.82  ? 38   ASN B CA    1 
ATOM   2069  C  C     . ASN B 1  38   ? -6.038  16.590  121.974 1.00 74.72  ? 38   ASN B C     1 
ATOM   2070  O  O     . ASN B 1  38   ? -7.197  16.479  122.417 1.00 72.47  ? 38   ASN B O     1 
ATOM   2071  C  CB    . ASN B 1  38   ? -5.111  15.061  120.186 1.00 70.02  ? 38   ASN B CB    1 
ATOM   2072  C  CG    . ASN B 1  38   ? -5.597  14.434  118.903 1.00 75.31  ? 38   ASN B CG    1 
ATOM   2073  O  OD1   . ASN B 1  38   ? -6.790  14.477  118.590 1.00 73.49  ? 38   ASN B OD1   1 
ATOM   2074  N  ND2   . ASN B 1  38   ? -4.673  13.851  118.140 1.00 81.43  ? 38   ASN B ND2   1 
ATOM   2075  N  N     . PRO B 1  39   ? -5.022  16.887  122.792 1.00 73.74  ? 39   PRO B N     1 
ATOM   2076  C  CA    . PRO B 1  39   ? -5.294  17.112  124.224 1.00 72.45  ? 39   PRO B CA    1 
ATOM   2077  C  C     . PRO B 1  39   ? -6.259  18.253  124.483 1.00 70.77  ? 39   PRO B C     1 
ATOM   2078  O  O     . PRO B 1  39   ? -7.150  18.120  125.331 1.00 75.18  ? 39   PRO B O     1 
ATOM   2079  C  CB    . PRO B 1  39   ? -3.903  17.405  124.802 1.00 69.70  ? 39   PRO B CB    1 
ATOM   2080  C  CG    . PRO B 1  39   ? -2.965  16.866  123.825 1.00 72.17  ? 39   PRO B CG    1 
ATOM   2081  C  CD    . PRO B 1  39   ? -3.586  16.996  122.490 1.00 70.07  ? 39   PRO B CD    1 
ATOM   2082  N  N     . LEU B 1  40   ? -6.088  19.387  123.801 1.00 66.87  ? 40   LEU B N     1 
ATOM   2083  C  CA    . LEU B 1  40   ? -7.010  20.498  124.000 1.00 70.53  ? 40   LEU B CA    1 
ATOM   2084  C  C     . LEU B 1  40   ? -8.421  20.108  123.600 1.00 69.95  ? 40   LEU B C     1 
ATOM   2085  O  O     . LEU B 1  40   ? -9.387  20.499  124.258 1.00 72.75  ? 40   LEU B O     1 
ATOM   2086  C  CB    . LEU B 1  40   ? -6.548  21.719  123.210 1.00 73.77  ? 40   LEU B CB    1 
ATOM   2087  C  CG    . LEU B 1  40   ? -5.154  22.219  123.580 1.00 78.35  ? 40   LEU B CG    1 
ATOM   2088  C  CD1   . LEU B 1  40   ? -4.850  23.525  122.866 1.00 83.74  ? 40   LEU B CD1   1 
ATOM   2089  C  CD2   . LEU B 1  40   ? -5.016  22.364  125.091 1.00 74.45  ? 40   LEU B CD2   1 
ATOM   2090  N  N     . ARG B 1  41   ? -8.561  19.343  122.518 1.00 74.40  ? 41   ARG B N     1 
ATOM   2091  C  CA    . ARG B 1  41   ? -9.872  18.828  122.134 1.00 76.19  ? 41   ARG B CA    1 
ATOM   2092  C  C     . ARG B 1  41   ? -10.493 18.037  123.282 1.00 69.51  ? 41   ARG B C     1 
ATOM   2093  O  O     . ARG B 1  41   ? -11.645 18.282  123.682 1.00 75.96  ? 41   ARG B O     1 
ATOM   2094  C  CB    . ARG B 1  41   ? -9.719  17.966  120.872 1.00 71.47  ? 41   ARG B CB    1 
ATOM   2095  C  CG    . ARG B 1  41   ? -10.985 17.720  120.086 1.00 66.83  ? 41   ARG B CG    1 
ATOM   2096  C  CD    . ARG B 1  41   ? -11.176 16.233  119.850 1.00 65.43  ? 41   ARG B CD    1 
ATOM   2097  N  NE    . ARG B 1  41   ? -12.563 15.937  119.517 1.00 68.03  ? 41   ARG B NE    1 
ATOM   2098  C  CZ    . ARG B 1  41   ? -13.141 14.756  119.698 1.00 66.54  ? 41   ARG B CZ    1 
ATOM   2099  N  NH1   . ARG B 1  41   ? -12.446 13.747  120.213 1.00 61.88  ? 41   ARG B NH1   1 
ATOM   2100  N  NH2   . ARG B 1  41   ? -14.417 14.592  119.371 1.00 59.41  ? 41   ARG B NH2   1 
ATOM   2101  N  N     . ARG B 1  42   ? -9.711  17.126  123.870 1.00 64.31  ? 42   ARG B N     1 
ATOM   2102  C  CA    . ARG B 1  42   ? -10.219 16.293  124.954 1.00 69.64  ? 42   ARG B CA    1 
ATOM   2103  C  C     . ARG B 1  42   ? -10.611 17.134  126.159 1.00 72.13  ? 42   ARG B C     1 
ATOM   2104  O  O     . ARG B 1  42   ? -11.685 16.947  126.739 1.00 68.12  ? 42   ARG B O     1 
ATOM   2105  C  CB    . ARG B 1  42   ? -9.168  15.260  125.348 1.00 69.02  ? 42   ARG B CB    1 
ATOM   2106  C  CG    . ARG B 1  42   ? -9.002  14.169  124.339 1.00 60.46  ? 42   ARG B CG    1 
ATOM   2107  C  CD    . ARG B 1  42   ? -7.754  13.361  124.613 1.00 61.07  ? 42   ARG B CD    1 
ATOM   2108  N  NE    . ARG B 1  42   ? -7.935  12.380  125.669 1.00 64.50  ? 42   ARG B NE    1 
ATOM   2109  C  CZ    . ARG B 1  42   ? -8.624  11.252  125.522 1.00 72.52  ? 42   ARG B CZ    1 
ATOM   2110  N  NH1   . ARG B 1  42   ? -9.204  10.969  124.364 1.00 63.33  ? 42   ARG B NH1   1 
ATOM   2111  N  NH2   . ARG B 1  42   ? -8.739  10.403  126.537 1.00 80.00  ? 42   ARG B NH2   1 
ATOM   2112  N  N     . ILE B 1  43   ? -9.742  18.065  126.548 1.00 73.21  ? 43   ILE B N     1 
ATOM   2113  C  CA    . ILE B 1  43   ? -9.995  18.903  127.717 1.00 69.02  ? 43   ILE B CA    1 
ATOM   2114  C  C     . ILE B 1  43   ? -11.231 19.765  127.491 1.00 70.69  ? 43   ILE B C     1 
ATOM   2115  O  O     . ILE B 1  43   ? -12.159 19.782  128.308 1.00 74.02  ? 43   ILE B O     1 
ATOM   2116  C  CB    . ILE B 1  43   ? -8.753  19.755  128.030 1.00 67.67  ? 43   ILE B CB    1 
ATOM   2117  C  CG1   . ILE B 1  43   ? -7.588  18.855  128.445 1.00 66.32  ? 43   ILE B CG1   1 
ATOM   2118  C  CG2   . ILE B 1  43   ? -9.057  20.782  129.092 1.00 62.30  ? 43   ILE B CG2   1 
ATOM   2119  C  CD1   . ILE B 1  43   ? -6.288  19.590  128.599 1.00 61.73  ? 43   ILE B CD1   1 
ATOM   2120  N  N     . LEU B 1  44   ? -11.269 20.475  126.363 1.00 70.14  ? 44   LEU B N     1 
ATOM   2121  C  CA    . LEU B 1  44   ? -12.401 21.318  126.004 1.00 72.45  ? 44   LEU B CA    1 
ATOM   2122  C  C     . LEU B 1  44   ? -13.712 20.553  125.936 1.00 67.90  ? 44   LEU B C     1 
ATOM   2123  O  O     . LEU B 1  44   ? -14.776 21.171  126.029 1.00 71.91  ? 44   LEU B O     1 
ATOM   2124  C  CB    . LEU B 1  44   ? -12.133 21.989  124.654 1.00 70.83  ? 44   LEU B CB    1 
ATOM   2125  C  CG    . LEU B 1  44   ? -11.125 23.131  124.652 1.00 70.51  ? 44   LEU B CG    1 
ATOM   2126  C  CD1   . LEU B 1  44   ? -10.650 23.431  123.246 1.00 75.45  ? 44   LEU B CD1   1 
ATOM   2127  C  CD2   . LEU B 1  44   ? -11.775 24.350  125.261 1.00 80.25  ? 44   LEU B CD2   1 
ATOM   2128  N  N     . LEU B 1  45   ? -13.675 19.239  125.750 1.00 64.77  ? 45   LEU B N     1 
ATOM   2129  C  CA    . LEU B 1  45   ? -14.928 18.503  125.779 1.00 69.31  ? 45   LEU B CA    1 
ATOM   2130  C  C     . LEU B 1  45   ? -15.262 17.933  127.150 1.00 70.07  ? 45   LEU B C     1 
ATOM   2131  O  O     . LEU B 1  45   ? -16.382 17.447  127.339 1.00 70.70  ? 45   LEU B O     1 
ATOM   2132  C  CB    . LEU B 1  45   ? -14.898 17.369  124.751 1.00 73.72  ? 45   LEU B CB    1 
ATOM   2133  C  CG    . LEU B 1  45   ? -15.169 17.792  123.307 1.00 71.36  ? 45   LEU B CG    1 
ATOM   2134  C  CD1   . LEU B 1  45   ? -15.262 16.570  122.409 1.00 68.27  ? 45   LEU B CD1   1 
ATOM   2135  C  CD2   . LEU B 1  45   ? -16.442 18.620  123.237 1.00 70.05  ? 45   LEU B CD2   1 
ATOM   2136  N  N     . SER B 1  46   ? -14.326 17.945  128.098 1.00 64.07  ? 46   SER B N     1 
ATOM   2137  C  CA    . SER B 1  46   ? -14.527 17.213  129.343 1.00 71.52  ? 46   SER B CA    1 
ATOM   2138  C  C     . SER B 1  46   ? -14.427 18.066  130.601 1.00 81.54  ? 46   SER B C     1 
ATOM   2139  O  O     . SER B 1  46   ? -15.238 17.898  131.521 1.00 74.61  ? 46   SER B O     1 
ATOM   2140  C  CB    . SER B 1  46   ? -13.537 16.039  129.418 1.00 65.71  ? 46   SER B CB    1 
ATOM   2141  O  OG    . SER B 1  46   ? -12.210 16.491  129.609 1.00 73.51  ? 46   SER B OG    1 
ATOM   2142  N  N     . SER B 1  47   ? -13.429 18.943  130.700 1.00 75.24  ? 47   SER B N     1 
ATOM   2143  C  CA    . SER B 1  47   ? -13.061 19.546  131.974 1.00 70.94  ? 47   SER B CA    1 
ATOM   2144  C  C     . SER B 1  47   ? -13.349 21.041  132.055 1.00 77.55  ? 47   SER B C     1 
ATOM   2145  O  O     . SER B 1  47   ? -12.845 21.703  132.969 1.00 85.37  ? 47   SER B O     1 
ATOM   2146  C  CB    . SER B 1  47   ? -11.579 19.295  132.254 1.00 81.52  ? 47   SER B CB    1 
ATOM   2147  O  OG    . SER B 1  47   ? -11.217 17.976  131.879 1.00 81.22  ? 47   SER B OG    1 
ATOM   2148  N  N     . ILE B 1  48   ? -14.132 21.596  131.137 1.00 79.17  ? 48   ILE B N     1 
ATOM   2149  C  CA    . ILE B 1  48   ? -14.485 23.013  131.163 1.00 79.08  ? 48   ILE B CA    1 
ATOM   2150  C  C     . ILE B 1  48   ? -15.778 23.159  131.964 1.00 78.12  ? 48   ILE B C     1 
ATOM   2151  O  O     . ILE B 1  48   ? -16.807 22.595  131.559 1.00 75.92  ? 48   ILE B O     1 
ATOM   2152  C  CB    . ILE B 1  48   ? -14.653 23.591  129.754 1.00 81.44  ? 48   ILE B CB    1 
ATOM   2153  C  CG1   . ILE B 1  48   ? -13.393 23.346  128.920 1.00 76.12  ? 48   ILE B CG1   1 
ATOM   2154  C  CG2   . ILE B 1  48   ? -14.958 25.082  129.843 1.00 73.51  ? 48   ILE B CG2   1 
ATOM   2155  C  CD1   . ILE B 1  48   ? -12.158 24.062  129.433 1.00 78.69  ? 48   ILE B CD1   1 
ATOM   2156  N  N     . PRO B 1  49   ? -15.774 23.909  133.067 1.00 85.28  ? 49   PRO B N     1 
ATOM   2157  C  CA    . PRO B 1  49   ? -16.932 23.908  133.975 1.00 72.14  ? 49   PRO B CA    1 
ATOM   2158  C  C     . PRO B 1  49   ? -18.097 24.716  133.420 1.00 71.41  ? 49   PRO B C     1 
ATOM   2159  O  O     . PRO B 1  49   ? -17.927 25.855  132.974 1.00 70.51  ? 49   PRO B O     1 
ATOM   2160  C  CB    . PRO B 1  49   ? -16.376 24.540  135.255 1.00 72.06  ? 49   PRO B CB    1 
ATOM   2161  C  CG    . PRO B 1  49   ? -14.890 24.515  135.107 1.00 71.64  ? 49   PRO B CG    1 
ATOM   2162  C  CD    . PRO B 1  49   ? -14.635 24.634  133.642 1.00 83.37  ? 49   PRO B CD    1 
ATOM   2163  N  N     . GLY B 1  50   ? -19.287 24.105  133.445 1.00 73.91  ? 50   GLY B N     1 
ATOM   2164  C  CA    . GLY B 1  50   ? -20.532 24.736  133.070 1.00 77.46  ? 50   GLY B CA    1 
ATOM   2165  C  C     . GLY B 1  50   ? -21.590 24.490  134.132 1.00 82.24  ? 50   GLY B C     1 
ATOM   2166  O  O     . GLY B 1  50   ? -21.284 24.320  135.326 1.00 83.80  ? 50   GLY B O     1 
ATOM   2167  N  N     . THR B 1  51   ? -22.850 24.494  133.690 1.00 79.38  ? 51   THR B N     1 
ATOM   2168  C  CA    . THR B 1  51   ? -23.986 24.140  134.529 1.00 77.50  ? 51   THR B CA    1 
ATOM   2169  C  C     . THR B 1  51   ? -24.960 23.309  133.713 1.00 76.01  ? 51   THR B C     1 
ATOM   2170  O  O     . THR B 1  51   ? -25.042 23.456  132.494 1.00 85.51  ? 51   THR B O     1 
ATOM   2171  C  CB    . THR B 1  51   ? -24.715 25.372  135.075 1.00 77.86  ? 51   THR B CB    1 
ATOM   2172  O  OG1   . THR B 1  51   ? -25.298 26.100  133.990 1.00 83.37  ? 51   THR B OG1   1 
ATOM   2173  C  CG2   . THR B 1  51   ? -23.783 26.285  135.845 1.00 79.10  ? 51   THR B CG2   1 
ATOM   2174  N  N     . ALA B 1  52   ? -25.720 22.454  134.391 1.00 76.95  ? 52   ALA B N     1 
ATOM   2175  C  CA    . ALA B 1  52   ? -26.656 21.592  133.685 1.00 77.30  ? 52   ALA B CA    1 
ATOM   2176  C  C     . ALA B 1  52   ? -27.862 21.276  134.558 1.00 84.50  ? 52   ALA B C     1 
ATOM   2177  O  O     . ALA B 1  52   ? -27.772 21.257  135.787 1.00 77.81  ? 52   ALA B O     1 
ATOM   2178  C  CB    . ALA B 1  52   ? -25.997 20.280  133.255 1.00 74.19  ? 52   ALA B CB    1 
ATOM   2179  N  N     . VAL B 1  53   ? -28.988 21.007  133.899 1.00 82.11  ? 53   VAL B N     1 
ATOM   2180  C  CA    . VAL B 1  53   ? -30.215 20.571  134.560 1.00 71.84  ? 53   VAL B CA    1 
ATOM   2181  C  C     . VAL B 1  53   ? -30.116 19.080  134.860 1.00 78.96  ? 53   VAL B C     1 
ATOM   2182  O  O     . VAL B 1  53   ? -30.054 18.256  133.943 1.00 86.37  ? 53   VAL B O     1 
ATOM   2183  C  CB    . VAL B 1  53   ? -31.441 20.868  133.688 1.00 67.95  ? 53   VAL B CB    1 
ATOM   2184  C  CG1   . VAL B 1  53   ? -32.648 20.118  134.206 1.00 78.98  ? 53   VAL B CG1   1 
ATOM   2185  C  CG2   . VAL B 1  53   ? -31.705 22.355  133.640 1.00 75.74  ? 53   VAL B CG2   1 
ATOM   2186  N  N     . THR B 1  54   ? -30.149 18.723  136.146 1.00 82.60  ? 54   THR B N     1 
ATOM   2187  C  CA    . THR B 1  54   ? -29.926 17.344  136.560 1.00 84.00  ? 54   THR B CA    1 
ATOM   2188  C  C     . THR B 1  54   ? -31.167 16.603  137.048 1.00 82.87  ? 54   THR B C     1 
ATOM   2189  O  O     . THR B 1  54   ? -31.138 15.369  137.085 1.00 76.48  ? 54   THR B O     1 
ATOM   2190  C  CB    . THR B 1  54   ? -28.853 17.291  137.658 1.00 86.41  ? 54   THR B CB    1 
ATOM   2191  O  OG1   . THR B 1  54   ? -29.193 18.203  138.707 1.00 77.75  ? 54   THR B OG1   1 
ATOM   2192  C  CG2   . THR B 1  54   ? -27.495 17.677  137.091 1.00 86.28  ? 54   THR B CG2   1 
ATOM   2193  N  N     . SER B 1  55   ? -32.246 17.303  137.413 1.00 93.98  ? 55   SER B N     1 
ATOM   2194  C  CA    . SER B 1  55   ? -33.446 16.639  137.924 1.00 91.64  ? 55   SER B CA    1 
ATOM   2195  C  C     . SER B 1  55   ? -34.661 17.537  137.724 1.00 89.07  ? 55   SER B C     1 
ATOM   2196  O  O     . SER B 1  55   ? -34.556 18.763  137.770 1.00 90.47  ? 55   SER B O     1 
ATOM   2197  C  CB    . SER B 1  55   ? -33.301 16.274  139.406 1.00 76.70  ? 55   SER B CB    1 
ATOM   2198  O  OG    . SER B 1  55   ? -33.747 14.950  139.636 1.00 80.89  ? 55   SER B OG    1 
ATOM   2199  N  N     . VAL B 1  56   ? -35.820 16.915  137.510 1.00 87.48  ? 56   VAL B N     1 
ATOM   2200  C  CA    . VAL B 1  56   ? -37.057 17.646  137.246 1.00 93.28  ? 56   VAL B CA    1 
ATOM   2201  C  C     . VAL B 1  56   ? -38.205 16.988  137.999 1.00 98.56  ? 56   VAL B C     1 
ATOM   2202  O  O     . VAL B 1  56   ? -38.398 15.772  137.898 1.00 98.51  ? 56   VAL B O     1 
ATOM   2203  C  CB    . VAL B 1  56   ? -37.376 17.702  135.739 1.00 84.31  ? 56   VAL B CB    1 
ATOM   2204  C  CG1   . VAL B 1  56   ? -38.787 18.212  135.505 1.00 84.17  ? 56   VAL B CG1   1 
ATOM   2205  C  CG2   . VAL B 1  56   ? -36.381 18.587  135.025 1.00 96.70  ? 56   VAL B CG2   1 
ATOM   2206  N  N     . TYR B 1  57   ? -38.973 17.790  138.744 1.00 98.50  ? 57   TYR B N     1 
ATOM   2207  C  CA    . TYR B 1  57   ? -40.238 17.358  139.331 1.00 95.42  ? 57   TYR B CA    1 
ATOM   2208  C  C     . TYR B 1  57   ? -41.369 18.162  138.705 1.00 88.43  ? 57   TYR B C     1 
ATOM   2209  O  O     . TYR B 1  57   ? -41.331 19.398  138.699 1.00 86.31  ? 57   TYR B O     1 
ATOM   2210  C  CB    . TYR B 1  57   ? -40.250 17.521  140.862 1.00 103.94 ? 57   TYR B CB    1 
ATOM   2211  C  CG    . TYR B 1  57   ? -41.611 17.287  141.518 1.00 107.37 ? 57   TYR B CG    1 
ATOM   2212  C  CD1   . TYR B 1  57   ? -42.141 16.005  141.649 1.00 102.69 ? 57   TYR B CD1   1 
ATOM   2213  C  CD2   . TYR B 1  57   ? -42.356 18.352  142.018 1.00 107.25 ? 57   TYR B CD2   1 
ATOM   2214  C  CE1   . TYR B 1  57   ? -43.379 15.794  142.243 1.00 101.03 ? 57   TYR B CE1   1 
ATOM   2215  C  CE2   . TYR B 1  57   ? -43.593 18.152  142.615 1.00 105.48 ? 57   TYR B CE2   1 
ATOM   2216  C  CZ    . TYR B 1  57   ? -44.101 16.872  142.726 1.00 112.86 ? 57   TYR B CZ    1 
ATOM   2217  O  OH    . TYR B 1  57   ? -45.332 16.675  143.323 1.00 105.77 ? 57   TYR B OH    1 
ATOM   2218  N  N     . ILE B 1  58   ? -42.356 17.455  138.161 1.00 87.37  ? 58   ILE B N     1 
ATOM   2219  C  CA    . ILE B 1  58   ? -43.573 18.055  137.628 1.00 95.47  ? 58   ILE B CA    1 
ATOM   2220  C  C     . ILE B 1  58   ? -44.753 17.470  138.384 1.00 107.01 ? 58   ILE B C     1 
ATOM   2221  O  O     . ILE B 1  58   ? -44.891 16.242  138.470 1.00 99.77  ? 58   ILE B O     1 
ATOM   2222  C  CB    . ILE B 1  58   ? -43.738 17.805  136.119 1.00 97.38  ? 58   ILE B CB    1 
ATOM   2223  C  CG1   . ILE B 1  58   ? -42.503 18.266  135.349 1.00 102.05 ? 58   ILE B CG1   1 
ATOM   2224  C  CG2   . ILE B 1  58   ? -44.961 18.534  135.600 1.00 94.35  ? 58   ILE B CG2   1 
ATOM   2225  C  CD1   . ILE B 1  58   ? -42.546 17.901  133.881 1.00 86.93  ? 58   ILE B CD1   1 
ATOM   2226  N  N     . GLU B 1  59   ? -45.606 18.350  138.913 1.00 108.09 ? 59   GLU B N     1 
ATOM   2227  C  CA    . GLU B 1  59   ? -46.766 17.923  139.685 1.00 109.00 ? 59   GLU B CA    1 
ATOM   2228  C  C     . GLU B 1  59   ? -47.643 16.974  138.877 1.00 110.93 ? 59   GLU B C     1 
ATOM   2229  O  O     . GLU B 1  59   ? -47.805 17.130  137.662 1.00 107.32 ? 59   GLU B O     1 
ATOM   2230  C  CB    . GLU B 1  59   ? -47.587 19.138  140.117 1.00 118.68 ? 59   GLU B CB    1 
ATOM   2231  C  CG    . GLU B 1  59   ? -47.161 19.773  141.429 1.00 119.81 ? 59   GLU B CG    1 
ATOM   2232  C  CD    . GLU B 1  59   ? -48.239 20.681  141.993 1.00 123.37 ? 59   GLU B CD    1 
ATOM   2233  O  OE1   . GLU B 1  59   ? -47.897 21.732  142.580 1.00 126.70 ? 59   GLU B OE1   1 
ATOM   2234  O  OE2   . GLU B 1  59   ? -49.434 20.342  141.838 1.00 118.07 ? 59   GLU B OE2   1 
ATOM   2235  N  N     . ASP B 1  60   ? -48.207 15.980  139.569 1.00 111.11 ? 60   ASP B N     1 
ATOM   2236  C  CA    . ASP B 1  60   ? -49.137 15.002  139.003 1.00 116.63 ? 60   ASP B CA    1 
ATOM   2237  C  C     . ASP B 1  60   ? -48.519 14.202  137.854 1.00 116.20 ? 60   ASP B C     1 
ATOM   2238  O  O     . ASP B 1  60   ? -49.241 13.694  136.987 1.00 117.60 ? 60   ASP B O     1 
ATOM   2239  C  CB    . ASP B 1  60   ? -50.438 15.679  138.547 1.00 118.65 ? 60   ASP B CB    1 
ATOM   2240  C  CG    . ASP B 1  60   ? -51.022 16.610  139.609 1.00 116.09 ? 60   ASP B CG    1 
ATOM   2241  O  OD1   . ASP B 1  60   ? -51.144 16.187  140.784 1.00 117.37 ? 60   ASP B OD1   1 
ATOM   2242  O  OD2   . ASP B 1  60   ? -51.352 17.770  139.271 1.00 106.25 ? 60   ASP B OD2   1 
ATOM   2243  N  N     . VAL B 1  61   ? -47.193 14.070  137.833 1.00 111.08 ? 61   VAL B N     1 
ATOM   2244  C  CA    . VAL B 1  61   ? -46.476 13.301  136.821 1.00 105.41 ? 61   VAL B CA    1 
ATOM   2245  C  C     . VAL B 1  61   ? -45.634 12.250  137.531 1.00 102.44 ? 61   VAL B C     1 
ATOM   2246  O  O     . VAL B 1  61   ? -44.826 12.584  138.406 1.00 103.31 ? 61   VAL B O     1 
ATOM   2247  C  CB    . VAL B 1  61   ? -45.588 14.201  135.944 1.00 109.20 ? 61   VAL B CB    1 
ATOM   2248  C  CG1   . VAL B 1  61   ? -44.813 13.361  134.952 1.00 104.89 ? 61   VAL B CG1   1 
ATOM   2249  C  CG2   . VAL B 1  61   ? -46.433 15.238  135.225 1.00 106.58 ? 61   VAL B CG2   1 
ATOM   2250  N  N     . LEU B 1  62   ? -45.813 10.985  137.148 1.00 100.71 ? 62   LEU B N     1 
ATOM   2251  C  CA    . LEU B 1  62   ? -45.177 9.886   137.873 1.00 104.21 ? 62   LEU B CA    1 
ATOM   2252  C  C     . LEU B 1  62   ? -43.837 9.483   137.259 1.00 105.97 ? 62   LEU B C     1 
ATOM   2253  O  O     . LEU B 1  62   ? -42.799 9.563   137.923 1.00 99.55  ? 62   LEU B O     1 
ATOM   2254  C  CB    . LEU B 1  62   ? -46.129 8.684   137.945 1.00 108.61 ? 62   LEU B CB    1 
ATOM   2255  C  CG    . LEU B 1  62   ? -47.380 8.849   138.820 1.00 102.87 ? 62   LEU B CG    1 
ATOM   2256  C  CD1   . LEU B 1  62   ? -48.117 7.522   138.997 1.00 93.08  ? 62   LEU B CD1   1 
ATOM   2257  C  CD2   . LEU B 1  62   ? -47.032 9.461   140.174 1.00 97.24  ? 62   LEU B CD2   1 
ATOM   2258  N  N     . HIS B 1  63   ? -43.840 9.051   135.998 1.00 114.03 ? 63   HIS B N     1 
ATOM   2259  C  CA    . HIS B 1  63   ? -42.610 8.664   135.322 1.00 114.48 ? 63   HIS B CA    1 
ATOM   2260  C  C     . HIS B 1  63   ? -42.427 9.458   134.032 1.00 107.19 ? 63   HIS B C     1 
ATOM   2261  O  O     . HIS B 1  63   ? -43.352 10.102  133.527 1.00 107.65 ? 63   HIS B O     1 
ATOM   2262  C  CB    . HIS B 1  63   ? -42.563 7.150   135.036 1.00 114.14 ? 63   HIS B CB    1 
ATOM   2263  C  CG    . HIS B 1  63   ? -43.751 6.624   134.291 1.00 118.67 ? 63   HIS B CG    1 
ATOM   2264  N  ND1   . HIS B 1  63   ? -43.837 6.645   132.915 1.00 116.21 ? 63   HIS B ND1   1 
ATOM   2265  C  CD2   . HIS B 1  63   ? -44.891 6.037   134.729 1.00 117.76 ? 63   HIS B CD2   1 
ATOM   2266  C  CE1   . HIS B 1  63   ? -44.983 6.106   132.539 1.00 120.62 ? 63   HIS B CE1   1 
ATOM   2267  N  NE2   . HIS B 1  63   ? -45.642 5.729   133.620 1.00 121.74 ? 63   HIS B NE2   1 
ATOM   2268  N  N     . GLU B 1  64   ? -41.202 9.384   133.506 1.00 103.67 ? 64   GLU B N     1 
ATOM   2269  C  CA    . GLU B 1  64   ? -40.757 10.267  132.430 1.00 106.02 ? 64   GLU B CA    1 
ATOM   2270  C  C     . GLU B 1  64   ? -41.537 10.055  131.135 1.00 107.06 ? 64   GLU B C     1 
ATOM   2271  O  O     . GLU B 1  64   ? -41.645 10.976  130.315 1.00 102.22 ? 64   GLU B O     1 
ATOM   2272  C  CB    . GLU B 1  64   ? -39.257 10.048  132.209 1.00 109.94 ? 64   GLU B CB    1 
ATOM   2273  C  CG    . GLU B 1  64   ? -38.630 10.762  131.021 1.00 111.91 ? 64   GLU B CG    1 
ATOM   2274  C  CD    . GLU B 1  64   ? -37.124 10.543  130.953 1.00 113.04 ? 64   GLU B CD    1 
ATOM   2275  O  OE1   . GLU B 1  64   ? -36.412 11.431  130.432 1.00 103.69 ? 64   GLU B OE1   1 
ATOM   2276  O  OE2   . GLU B 1  64   ? -36.654 9.485   131.434 1.00 107.43 ? 64   GLU B OE2   1 
ATOM   2277  N  N     . PHE B 1  65   ? -42.089 8.866   130.927 1.00 107.73 ? 65   PHE B N     1 
ATOM   2278  C  CA    . PHE B 1  65   ? -42.793 8.555   129.692 1.00 107.32 ? 65   PHE B CA    1 
ATOM   2279  C  C     . PHE B 1  65   ? -44.301 8.736   129.804 1.00 117.15 ? 65   PHE B C     1 
ATOM   2280  O  O     . PHE B 1  65   ? -45.039 8.251   128.940 1.00 120.97 ? 65   PHE B O     1 
ATOM   2281  C  CB    . PHE B 1  65   ? -42.454 7.133   129.249 1.00 111.13 ? 65   PHE B CB    1 
ATOM   2282  C  CG    . PHE B 1  65   ? -40.986 6.915   129.038 1.00 114.52 ? 65   PHE B CG    1 
ATOM   2283  C  CD1   . PHE B 1  65   ? -40.358 7.413   127.908 1.00 102.87 ? 65   PHE B CD1   1 
ATOM   2284  C  CD2   . PHE B 1  65   ? -40.226 6.237   129.979 1.00 113.58 ? 65   PHE B CD2   1 
ATOM   2285  C  CE1   . PHE B 1  65   ? -39.006 7.230   127.712 1.00 94.05  ? 65   PHE B CE1   1 
ATOM   2286  C  CE2   . PHE B 1  65   ? -38.870 6.048   129.787 1.00 115.25 ? 65   PHE B CE2   1 
ATOM   2287  C  CZ    . PHE B 1  65   ? -38.259 6.546   128.651 1.00 103.61 ? 65   PHE B CZ    1 
ATOM   2288  N  N     . SER B 1  66   ? -44.775 9.420   130.843 1.00 119.04 ? 66   SER B N     1 
ATOM   2289  C  CA    . SER B 1  66   ? -46.192 9.716   130.963 1.00 118.66 ? 66   SER B CA    1 
ATOM   2290  C  C     . SER B 1  66   ? -46.564 10.870  130.032 1.00 121.62 ? 66   SER B C     1 
ATOM   2291  O  O     . SER B 1  66   ? -45.718 11.467  129.356 1.00 114.17 ? 66   SER B O     1 
ATOM   2292  C  CB    . SER B 1  66   ? -46.546 10.050  132.410 1.00 121.53 ? 66   SER B CB    1 
ATOM   2293  O  OG    . SER B 1  66   ? -46.113 9.033   133.297 1.00 121.93 ? 66   SER B OG    1 
ATOM   2294  N  N     . THR B 1  67   ? -47.854 11.186  129.998 1.00 128.17 ? 67   THR B N     1 
ATOM   2295  C  CA    . THR B 1  67   ? -48.357 12.328  129.253 1.00 126.63 ? 67   THR B CA    1 
ATOM   2296  C  C     . THR B 1  67   ? -48.974 13.319  130.229 1.00 116.10 ? 67   THR B C     1 
ATOM   2297  O  O     . THR B 1  67   ? -49.400 12.948  131.327 1.00 112.62 ? 67   THR B O     1 
ATOM   2298  C  CB    . THR B 1  67   ? -49.383 11.904  128.189 1.00 126.52 ? 67   THR B CB    1 
ATOM   2299  O  OG1   . THR B 1  67   ? -49.722 13.033  127.374 1.00 124.21 ? 67   THR B OG1   1 
ATOM   2300  C  CG2   . THR B 1  67   ? -50.641 11.345  128.844 1.00 116.84 ? 67   THR B CG2   1 
ATOM   2301  N  N     . ILE B 1  68   ? -49.002 14.582  129.830 1.00 112.06 ? 68   ILE B N     1 
ATOM   2302  C  CA    . ILE B 1  68   ? -49.416 15.682  130.695 1.00 107.52 ? 68   ILE B CA    1 
ATOM   2303  C  C     . ILE B 1  68   ? -50.717 16.261  130.150 1.00 113.61 ? 68   ILE B C     1 
ATOM   2304  O  O     . ILE B 1  68   ? -50.756 16.705  128.994 1.00 110.91 ? 68   ILE B O     1 
ATOM   2305  C  CB    . ILE B 1  68   ? -48.332 16.764  130.801 1.00 108.70 ? 68   ILE B CB    1 
ATOM   2306  C  CG1   . ILE B 1  68   ? -47.138 16.241  131.598 1.00 105.35 ? 68   ILE B CG1   1 
ATOM   2307  C  CG2   . ILE B 1  68   ? -48.898 18.021  131.438 1.00 100.35 ? 68   ILE B CG2   1 
ATOM   2308  C  CD1   . ILE B 1  68   ? -46.099 17.299  131.888 1.00 109.09 ? 68   ILE B CD1   1 
ATOM   2309  N  N     . PRO B 1  69   ? -51.793 16.284  130.940 1.00 121.19 ? 69   PRO B N     1 
ATOM   2310  C  CA    . PRO B 1  69   ? -53.058 16.852  130.458 1.00 115.39 ? 69   PRO B CA    1 
ATOM   2311  C  C     . PRO B 1  69   ? -52.996 18.369  130.359 1.00 112.13 ? 69   PRO B C     1 
ATOM   2312  O  O     . PRO B 1  69   ? -52.485 19.050  131.252 1.00 112.27 ? 69   PRO B O     1 
ATOM   2313  C  CB    . PRO B 1  69   ? -54.073 16.405  131.519 1.00 116.75 ? 69   PRO B CB    1 
ATOM   2314  C  CG    . PRO B 1  69   ? -53.387 15.308  132.297 1.00 110.61 ? 69   PRO B CG    1 
ATOM   2315  C  CD    . PRO B 1  69   ? -51.938 15.652  132.261 1.00 109.79 ? 69   PRO B CD    1 
ATOM   2316  N  N     . GLY B 1  70   ? -53.538 18.895  129.263 1.00 109.83 ? 70   GLY B N     1 
ATOM   2317  C  CA    . GLY B 1  70   ? -53.575 20.327  129.051 1.00 116.98 ? 70   GLY B CA    1 
ATOM   2318  C  C     . GLY B 1  70   ? -52.292 20.927  128.530 1.00 118.25 ? 70   GLY B C     1 
ATOM   2319  O  O     . GLY B 1  70   ? -52.190 22.157  128.441 1.00 114.94 ? 70   GLY B O     1 
ATOM   2320  N  N     . VAL B 1  71   ? -51.306 20.100  128.192 1.00 120.63 ? 71   VAL B N     1 
ATOM   2321  C  CA    . VAL B 1  71   ? -50.038 20.554  127.638 1.00 116.03 ? 71   VAL B CA    1 
ATOM   2322  C  C     . VAL B 1  71   ? -49.770 19.768  126.364 1.00 114.03 ? 71   VAL B C     1 
ATOM   2323  O  O     . VAL B 1  71   ? -49.911 18.539  126.349 1.00 115.67 ? 71   VAL B O     1 
ATOM   2324  C  CB    . VAL B 1  71   ? -48.880 20.383  128.639 1.00 113.14 ? 71   VAL B CB    1 
ATOM   2325  C  CG1   . VAL B 1  71   ? -47.556 20.721  127.978 1.00 109.05 ? 71   VAL B CG1   1 
ATOM   2326  C  CG2   . VAL B 1  71   ? -49.109 21.260  129.866 1.00 112.11 ? 71   VAL B CG2   1 
ATOM   2327  N  N     . LYS B 1  72   ? -49.381 20.480  125.301 1.00 113.64 ? 72   LYS B N     1 
ATOM   2328  C  CA    . LYS B 1  72   ? -49.184 19.852  123.996 1.00 106.04 ? 72   LYS B CA    1 
ATOM   2329  C  C     . LYS B 1  72   ? -47.979 18.917  123.997 1.00 99.55  ? 72   LYS B C     1 
ATOM   2330  O  O     . LYS B 1  72   ? -48.054 17.799  123.475 1.00 95.40  ? 72   LYS B O     1 
ATOM   2331  C  CB    . LYS B 1  72   ? -49.030 20.932  122.929 1.00 104.82 ? 72   LYS B CB    1 
ATOM   2332  C  CG    . LYS B 1  72   ? -48.793 20.411  121.528 1.00 112.55 ? 72   LYS B CG    1 
ATOM   2333  C  CD    . LYS B 1  72   ? -48.614 21.564  120.556 1.00 113.02 ? 72   LYS B CD    1 
ATOM   2334  C  CE    . LYS B 1  72   ? -48.473 21.070  119.129 1.00 108.79 ? 72   LYS B CE    1 
ATOM   2335  N  NZ    . LYS B 1  72   ? -48.493 22.207  118.172 1.00 114.62 ? 72   LYS B NZ    1 
ATOM   2336  N  N     . GLU B 1  73   ? -46.862 19.358  124.569 1.00 95.59  ? 73   GLU B N     1 
ATOM   2337  C  CA    . GLU B 1  73   ? -45.675 18.524  124.683 1.00 92.74  ? 73   GLU B CA    1 
ATOM   2338  C  C     . GLU B 1  73   ? -45.938 17.312  125.575 1.00 96.23  ? 73   GLU B C     1 
ATOM   2339  O  O     . GLU B 1  73   ? -46.874 17.286  126.380 1.00 112.10 ? 73   GLU B O     1 
ATOM   2340  C  CB    . GLU B 1  73   ? -44.513 19.333  125.263 1.00 91.34  ? 73   GLU B CB    1 
ATOM   2341  C  CG    . GLU B 1  73   ? -43.942 20.399  124.340 1.00 100.37 ? 73   GLU B CG    1 
ATOM   2342  C  CD    . GLU B 1  73   ? -44.809 21.639  124.239 1.00 105.32 ? 73   GLU B CD    1 
ATOM   2343  O  OE1   . GLU B 1  73   ? -45.952 21.615  124.742 1.00 106.14 ? 73   GLU B OE1   1 
ATOM   2344  O  OE2   . GLU B 1  73   ? -44.341 22.642  123.654 1.00 102.64 ? 73   GLU B OE2   1 
ATOM   2345  N  N     . ASP B 1  74   ? -45.091 16.293  125.423 1.00 88.88  ? 74   ASP B N     1 
ATOM   2346  C  CA    . ASP B 1  74   ? -45.011 15.222  126.402 1.00 88.51  ? 74   ASP B CA    1 
ATOM   2347  C  C     . ASP B 1  74   ? -43.891 15.537  127.392 1.00 90.57  ? 74   ASP B C     1 
ATOM   2348  O  O     . ASP B 1  74   ? -43.206 16.558  127.291 1.00 89.30  ? 74   ASP B O     1 
ATOM   2349  C  CB    . ASP B 1  74   ? -44.810 13.856  125.733 1.00 93.46  ? 74   ASP B CB    1 
ATOM   2350  C  CG    . ASP B 1  74   ? -43.591 13.806  124.802 1.00 99.70  ? 74   ASP B CG    1 
ATOM   2351  O  OD1   . ASP B 1  74   ? -42.481 14.230  125.197 1.00 95.19  ? 74   ASP B OD1   1 
ATOM   2352  O  OD2   . ASP B 1  74   ? -43.745 13.308  123.666 1.00 98.65  ? 74   ASP B OD2   1 
ATOM   2353  N  N     . VAL B 1  75   ? -43.699 14.651  128.366 1.00 92.90  ? 75   VAL B N     1 
ATOM   2354  C  CA    . VAL B 1  75   ? -42.687 14.904  129.384 1.00 96.78  ? 75   VAL B CA    1 
ATOM   2355  C  C     . VAL B 1  75   ? -41.293 14.841  128.775 1.00 91.76  ? 75   VAL B C     1 
ATOM   2356  O  O     . VAL B 1  75   ? -40.418 15.653  129.102 1.00 91.95  ? 75   VAL B O     1 
ATOM   2357  C  CB    . VAL B 1  75   ? -42.851 13.912  130.550 1.00 105.78 ? 75   VAL B CB    1 
ATOM   2358  C  CG1   . VAL B 1  75   ? -41.877 14.240  131.668 1.00 94.57  ? 75   VAL B CG1   1 
ATOM   2359  C  CG2   . VAL B 1  75   ? -44.290 13.925  131.057 1.00 99.74  ? 75   VAL B CG2   1 
ATOM   2360  N  N     . VAL B 1  76   ? -41.074 13.887  127.867 1.00 94.28  ? 76   VAL B N     1 
ATOM   2361  C  CA    . VAL B 1  76   ? -39.770 13.734  127.226 1.00 93.19  ? 76   VAL B CA    1 
ATOM   2362  C  C     . VAL B 1  76   ? -39.379 15.014  126.497 1.00 89.05  ? 76   VAL B C     1 
ATOM   2363  O  O     . VAL B 1  76   ? -38.234 15.474  126.585 1.00 83.81  ? 76   VAL B O     1 
ATOM   2364  C  CB    . VAL B 1  76   ? -39.786 12.528  126.271 1.00 92.10  ? 76   VAL B CB    1 
ATOM   2365  C  CG1   . VAL B 1  76   ? -38.374 12.175  125.864 1.00 82.88  ? 76   VAL B CG1   1 
ATOM   2366  C  CG2   . VAL B 1  76   ? -40.489 11.344  126.918 1.00 92.82  ? 76   VAL B CG2   1 
ATOM   2367  N  N     . GLU B 1  77   ? -40.319 15.592  125.744 1.00 90.22  ? 77   GLU B N     1 
ATOM   2368  C  CA    . GLU B 1  77   ? -40.028 16.814  125.000 1.00 90.80  ? 77   GLU B CA    1 
ATOM   2369  C  C     . GLU B 1  77   ? -39.693 17.964  125.942 1.00 88.38  ? 77   GLU B C     1 
ATOM   2370  O  O     . GLU B 1  77   ? -38.792 18.769  125.662 1.00 92.38  ? 77   GLU B O     1 
ATOM   2371  C  CB    . GLU B 1  77   ? -41.213 17.167  124.098 1.00 88.98  ? 77   GLU B CB    1 
ATOM   2372  C  CG    . GLU B 1  77   ? -40.986 18.374  123.185 1.00 97.87  ? 77   GLU B CG    1 
ATOM   2373  C  CD    . GLU B 1  77   ? -40.096 18.079  121.977 1.00 95.24  ? 77   GLU B CD    1 
ATOM   2374  O  OE1   . GLU B 1  77   ? -39.727 19.044  121.276 1.00 88.35  ? 77   GLU B OE1   1 
ATOM   2375  O  OE2   . GLU B 1  77   ? -39.771 16.897  121.721 1.00 93.02  ? 77   GLU B OE2   1 
ATOM   2376  N  N     . ILE B 1  78   ? -40.396 18.052  127.072 1.00 87.63  ? 78   ILE B N     1 
ATOM   2377  C  CA    . ILE B 1  78   ? -40.080 19.087  128.052 1.00 90.11  ? 78   ILE B CA    1 
ATOM   2378  C  C     . ILE B 1  78   ? -38.672 18.889  128.588 1.00 84.39  ? 78   ILE B C     1 
ATOM   2379  O  O     . ILE B 1  78   ? -37.913 19.852  128.756 1.00 79.78  ? 78   ILE B O     1 
ATOM   2380  C  CB    . ILE B 1  78   ? -41.119 19.089  129.188 1.00 93.20  ? 78   ILE B CB    1 
ATOM   2381  C  CG1   . ILE B 1  78   ? -42.518 19.337  128.626 1.00 93.13  ? 78   ILE B CG1   1 
ATOM   2382  C  CG2   . ILE B 1  78   ? -40.759 20.144  130.228 1.00 85.35  ? 78   ILE B CG2   1 
ATOM   2383  C  CD1   . ILE B 1  78   ? -43.628 18.998  129.586 1.00 95.91  ? 78   ILE B CD1   1 
ATOM   2384  N  N     . ILE B 1  79   ? -38.297 17.639  128.860 1.00 81.00  ? 79   ILE B N     1 
ATOM   2385  C  CA    . ILE B 1  79   ? -36.966 17.378  129.396 1.00 84.79  ? 79   ILE B CA    1 
ATOM   2386  C  C     . ILE B 1  79   ? -35.895 17.712  128.361 1.00 87.89  ? 79   ILE B C     1 
ATOM   2387  O  O     . ILE B 1  79   ? -34.826 18.237  128.701 1.00 85.81  ? 79   ILE B O     1 
ATOM   2388  C  CB    . ILE B 1  79   ? -36.868 15.922  129.882 1.00 86.68  ? 79   ILE B CB    1 
ATOM   2389  C  CG1   . ILE B 1  79   ? -37.935 15.656  130.938 1.00 86.51  ? 79   ILE B CG1   1 
ATOM   2390  C  CG2   . ILE B 1  79   ? -35.498 15.646  130.469 1.00 87.94  ? 79   ILE B CG2   1 
ATOM   2391  C  CD1   . ILE B 1  79   ? -37.839 14.294  131.549 1.00 91.41  ? 79   ILE B CD1   1 
ATOM   2392  N  N     . LEU B 1  80   ? -36.163 17.423  127.083 1.00 81.35  ? 80   LEU B N     1 
ATOM   2393  C  CA    . LEU B 1  80   ? -35.244 17.836  126.025 1.00 79.52  ? 80   LEU B CA    1 
ATOM   2394  C  C     . LEU B 1  80   ? -35.066 19.349  126.033 1.00 81.17  ? 80   LEU B C     1 
ATOM   2395  O  O     . LEU B 1  80   ? -33.936 19.852  126.082 1.00 75.20  ? 80   LEU B O     1 
ATOM   2396  C  CB    . LEU B 1  80   ? -35.745 17.361  124.660 1.00 79.67  ? 80   LEU B CB    1 
ATOM   2397  C  CG    . LEU B 1  80   ? -35.919 15.858  124.437 1.00 77.84  ? 80   LEU B CG    1 
ATOM   2398  C  CD1   . LEU B 1  80   ? -36.621 15.598  123.118 1.00 77.57  ? 80   LEU B CD1   1 
ATOM   2399  C  CD2   . LEU B 1  80   ? -34.589 15.127  124.492 1.00 64.63  ? 80   LEU B CD2   1 
ATOM   2400  N  N     . ASN B 1  81   ? -36.182 20.091  126.013 1.00 83.27  ? 81   ASN B N     1 
ATOM   2401  C  CA    . ASN B 1  81   ? -36.108 21.550  126.076 1.00 83.19  ? 81   ASN B CA    1 
ATOM   2402  C  C     . ASN B 1  81   ? -35.323 22.012  127.295 1.00 83.22  ? 81   ASN B C     1 
ATOM   2403  O  O     . ASN B 1  81   ? -34.600 23.014  127.238 1.00 80.22  ? 81   ASN B O     1 
ATOM   2404  C  CB    . ASN B 1  81   ? -37.510 22.156  126.100 1.00 81.57  ? 81   ASN B CB    1 
ATOM   2405  C  CG    . ASN B 1  81   ? -38.257 21.959  124.799 1.00 90.74  ? 81   ASN B CG    1 
ATOM   2406  O  OD1   . ASN B 1  81   ? -37.690 22.098  123.713 1.00 100.15 ? 81   ASN B OD1   1 
ATOM   2407  N  ND2   . ASN B 1  81   ? -39.541 21.635  124.900 1.00 88.67  ? 81   ASN B ND2   1 
ATOM   2408  N  N     . LEU B 1  82   ? -35.450 21.284  128.407 1.00 80.26  ? 82   LEU B N     1 
ATOM   2409  C  CA    . LEU B 1  82   ? -34.719 21.641  129.616 1.00 84.09  ? 82   LEU B CA    1 
ATOM   2410  C  C     . LEU B 1  82   ? -33.232 21.337  129.487 1.00 82.10  ? 82   LEU B C     1 
ATOM   2411  O  O     . LEU B 1  82   ? -32.410 21.981  130.147 1.00 79.90  ? 82   LEU B O     1 
ATOM   2412  C  CB    . LEU B 1  82   ? -35.321 20.918  130.820 1.00 91.28  ? 82   LEU B CB    1 
ATOM   2413  C  CG    . LEU B 1  82   ? -36.630 21.526  131.332 1.00 88.79  ? 82   LEU B CG    1 
ATOM   2414  C  CD1   . LEU B 1  82   ? -37.428 20.501  132.111 1.00 85.13  ? 82   LEU B CD1   1 
ATOM   2415  C  CD2   . LEU B 1  82   ? -36.340 22.743  132.191 1.00 84.86  ? 82   LEU B CD2   1 
ATOM   2416  N  N     . LYS B 1  83   ? -32.868 20.364  128.650 1.00 86.79  ? 83   LYS B N     1 
ATOM   2417  C  CA    . LYS B 1  83   ? -31.453 20.125  128.385 1.00 84.01  ? 83   LYS B CA    1 
ATOM   2418  C  C     . LYS B 1  83   ? -30.811 21.309  127.672 1.00 79.42  ? 83   LYS B C     1 
ATOM   2419  O  O     . LYS B 1  83   ? -29.619 21.577  127.864 1.00 72.59  ? 83   LYS B O     1 
ATOM   2420  C  CB    . LYS B 1  83   ? -31.278 18.858  127.557 1.00 78.88  ? 83   LYS B CB    1 
ATOM   2421  C  CG    . LYS B 1  83   ? -31.446 17.565  128.327 1.00 76.67  ? 83   LYS B CG    1 
ATOM   2422  C  CD    . LYS B 1  83   ? -31.448 16.396  127.362 1.00 74.00  ? 83   LYS B CD    1 
ATOM   2423  C  CE    . LYS B 1  83   ? -31.233 15.081  128.070 1.00 77.33  ? 83   LYS B CE    1 
ATOM   2424  N  NZ    . LYS B 1  83   ? -31.220 13.934  127.119 1.00 76.32  ? 83   LYS B NZ    1 
ATOM   2425  N  N     . GLU B 1  84   ? -31.580 22.034  126.862 1.00 79.52  ? 84   GLU B N     1 
ATOM   2426  C  CA    . GLU B 1  84   ? -31.061 23.165  126.107 1.00 83.75  ? 84   GLU B CA    1 
ATOM   2427  C  C     . GLU B 1  84   ? -31.069 24.467  126.900 1.00 86.84  ? 84   GLU B C     1 
ATOM   2428  O  O     . GLU B 1  84   ? -30.746 25.521  126.346 1.00 94.09  ? 84   GLU B O     1 
ATOM   2429  C  CB    . GLU B 1  84   ? -31.847 23.333  124.804 1.00 88.81  ? 84   GLU B CB    1 
ATOM   2430  C  CG    . GLU B 1  84   ? -31.523 22.269  123.758 1.00 84.97  ? 84   GLU B CG    1 
ATOM   2431  C  CD    . GLU B 1  84   ? -32.164 22.544  122.405 1.00 98.25  ? 84   GLU B CD    1 
ATOM   2432  O  OE1   . GLU B 1  84   ? -32.388 23.734  122.081 1.00 97.20  ? 84   GLU B OE1   1 
ATOM   2433  O  OE2   . GLU B 1  84   ? -32.444 21.568  121.668 1.00 95.29  ? 84   GLU B OE2   1 
ATOM   2434  N  N     . LEU B 1  85   ? -31.427 24.424  128.177 1.00 94.38  ? 85   LEU B N     1 
ATOM   2435  C  CA    . LEU B 1  85   ? -31.368 25.622  129.003 1.00 94.43  ? 85   LEU B CA    1 
ATOM   2436  C  C     . LEU B 1  85   ? -29.914 26.010  129.257 1.00 94.06  ? 85   LEU B C     1 
ATOM   2437  O  O     . LEU B 1  85   ? -29.078 25.160  129.583 1.00 95.16  ? 85   LEU B O     1 
ATOM   2438  C  CB    . LEU B 1  85   ? -32.108 25.381  130.319 1.00 93.19  ? 85   LEU B CB    1 
ATOM   2439  C  CG    . LEU B 1  85   ? -32.447 26.567  131.225 1.00 93.12  ? 85   LEU B CG    1 
ATOM   2440  C  CD1   . LEU B 1  85   ? -33.428 27.517  130.553 1.00 94.03  ? 85   LEU B CD1   1 
ATOM   2441  C  CD2   . LEU B 1  85   ? -33.010 26.054  132.535 1.00 89.43  ? 85   LEU B CD2   1 
ATOM   2442  N  N     . VAL B 1  86   ? -29.606 27.293  129.088 1.00 95.22  ? 86   VAL B N     1 
ATOM   2443  C  CA    . VAL B 1  86   ? -28.267 27.822  129.324 1.00 98.77  ? 86   VAL B CA    1 
ATOM   2444  C  C     . VAL B 1  86   ? -28.333 28.722  130.547 1.00 99.39  ? 86   VAL B C     1 
ATOM   2445  O  O     . VAL B 1  86   ? -28.862 29.839  130.483 1.00 106.10 ? 86   VAL B O     1 
ATOM   2446  C  CB    . VAL B 1  86   ? -27.724 28.584  128.110 1.00 96.09  ? 86   VAL B CB    1 
ATOM   2447  C  CG1   . VAL B 1  86   ? -26.326 29.098  128.404 1.00 95.13  ? 86   VAL B CG1   1 
ATOM   2448  C  CG2   . VAL B 1  86   ? -27.725 27.687  126.889 1.00 100.95 ? 86   VAL B CG2   1 
ATOM   2449  N  N     . VAL B 1  87   ? -27.777 28.248  131.655 1.00 98.34  ? 87   VAL B N     1 
ATOM   2450  C  CA    . VAL B 1  87   ? -27.821 28.942  132.934 1.00 96.19  ? 87   VAL B CA    1 
ATOM   2451  C  C     . VAL B 1  87   ? -26.396 29.302  133.328 1.00 97.43  ? 87   VAL B C     1 
ATOM   2452  O  O     . VAL B 1  87   ? -25.456 28.554  133.040 1.00 100.12 ? 87   VAL B O     1 
ATOM   2453  C  CB    . VAL B 1  87   ? -28.505 28.070  134.010 1.00 88.84  ? 87   VAL B CB    1 
ATOM   2454  C  CG1   . VAL B 1  87   ? -28.345 28.671  135.389 1.00 98.18  ? 87   VAL B CG1   1 
ATOM   2455  C  CG2   . VAL B 1  87   ? -29.985 27.885  133.679 1.00 85.47  ? 87   VAL B CG2   1 
ATOM   2456  N  N     . ARG B 1  88   ? -26.232 30.453  133.974 1.00 98.70  ? 88   ARG B N     1 
ATOM   2457  C  CA    . ARG B 1  88   ? -24.925 30.948  134.378 1.00 104.32 ? 88   ARG B CA    1 
ATOM   2458  C  C     . ARG B 1  88   ? -24.959 31.332  135.852 1.00 107.05 ? 88   ARG B C     1 
ATOM   2459  O  O     . ARG B 1  88   ? -25.896 31.999  136.304 1.00 107.04 ? 88   ARG B O     1 
ATOM   2460  C  CB    . ARG B 1  88   ? -24.521 32.144  133.515 1.00 103.24 ? 88   ARG B CB    1 
ATOM   2461  C  CG    . ARG B 1  88   ? -23.086 32.564  133.654 1.00 97.76  ? 88   ARG B CG    1 
ATOM   2462  C  CD    . ARG B 1  88   ? -22.788 33.659  132.664 1.00 101.84 ? 88   ARG B CD    1 
ATOM   2463  N  NE    . ARG B 1  88   ? -21.405 34.106  132.746 1.00 101.60 ? 88   ARG B NE    1 
ATOM   2464  C  CZ    . ARG B 1  88   ? -20.950 35.202  132.154 1.00 101.02 ? 88   ARG B CZ    1 
ATOM   2465  N  NH1   . ARG B 1  88   ? -21.779 35.955  131.441 1.00 95.09  ? 88   ARG B NH1   1 
ATOM   2466  N  NH2   . ARG B 1  88   ? -19.674 35.547  132.278 1.00 98.30  ? 88   ARG B NH2   1 
ATOM   2467  N  N     . PHE B 1  89   ? -23.940 30.910  136.597 1.00 104.59 ? 89   PHE B N     1 
ATOM   2468  C  CA    . PHE B 1  89   ? -23.825 31.216  138.019 1.00 102.53 ? 89   PHE B CA    1 
ATOM   2469  C  C     . PHE B 1  89   ? -22.838 32.363  138.174 1.00 106.89 ? 89   PHE B C     1 
ATOM   2470  O  O     . PHE B 1  89   ? -21.626 32.172  138.032 1.00 104.97 ? 89   PHE B O     1 
ATOM   2471  C  CB    . PHE B 1  89   ? -23.370 29.995  138.814 1.00 101.06 ? 89   PHE B CB    1 
ATOM   2472  C  CG    . PHE B 1  89   ? -24.403 28.907  138.903 1.00 94.82  ? 89   PHE B CG    1 
ATOM   2473  C  CD1   . PHE B 1  89   ? -25.676 29.095  138.389 1.00 90.06  ? 89   PHE B CD1   1 
ATOM   2474  C  CD2   . PHE B 1  89   ? -24.104 27.696  139.511 1.00 94.45  ? 89   PHE B CD2   1 
ATOM   2475  C  CE1   . PHE B 1  89   ? -26.625 28.097  138.470 1.00 88.94  ? 89   PHE B CE1   1 
ATOM   2476  C  CE2   . PHE B 1  89   ? -25.057 26.691  139.601 1.00 89.03  ? 89   PHE B CE2   1 
ATOM   2477  C  CZ    . PHE B 1  89   ? -26.317 26.894  139.079 1.00 83.98  ? 89   PHE B CZ    1 
ATOM   2478  N  N     . LEU B 1  90   ? -23.358 33.553  138.469 1.00 110.95 ? 90   LEU B N     1 
ATOM   2479  C  CA    . LEU B 1  90   ? -22.501 34.724  138.586 1.00 112.64 ? 90   LEU B CA    1 
ATOM   2480  C  C     . LEU B 1  90   ? -21.721 34.730  139.892 1.00 115.11 ? 90   LEU B C     1 
ATOM   2481  O  O     . LEU B 1  90   ? -20.706 35.430  139.998 1.00 112.14 ? 90   LEU B O     1 
ATOM   2482  C  CB    . LEU B 1  90   ? -23.356 35.980  138.446 1.00 115.07 ? 90   LEU B CB    1 
ATOM   2483  C  CG    . LEU B 1  90   ? -24.225 35.916  137.183 1.00 116.52 ? 90   LEU B CG    1 
ATOM   2484  C  CD1   . LEU B 1  90   ? -25.681 36.209  137.495 1.00 109.21 ? 90   LEU B CD1   1 
ATOM   2485  C  CD2   . LEU B 1  90   ? -23.693 36.844  136.092 1.00 117.17 ? 90   LEU B CD2   1 
ATOM   2486  N  N     . ASN B 1  91   ? -22.117 33.921  140.859 1.00 111.81 ? 91   ASN B N     1 
ATOM   2487  C  CA    . ASN B 1  91   ? -21.338 33.869  142.078 1.00 111.10 ? 91   ASN B CA    1 
ATOM   2488  C  C     . ASN B 1  91   ? -20.585 32.572  142.046 1.00 107.84 ? 91   ASN B C     1 
ATOM   2489  O  O     . ASN B 1  91   ? -21.177 31.510  142.016 1.00 105.68 ? 91   ASN B O     1 
ATOM   2490  C  CB    . ASN B 1  91   ? -22.221 33.896  143.305 1.00 87.22  ? 91   ASN B CB    1 
ATOM   2491  C  CG    . ASN B 1  91   ? -21.429 33.767  144.580 1.00 101.49 ? 91   ASN B CG    1 
ATOM   2492  O  OD1   . ASN B 1  91   ? -20.611 32.858  144.733 1.00 100.18 ? 91   ASN B OD1   1 
ATOM   2493  N  ND2   . ASN B 1  91   ? -21.661 34.683  145.504 1.00 87.84  ? 91   ASN B ND2   1 
ATOM   2494  N  N     . PRO B 1  92   ? -19.271 32.659  142.070 1.00 108.37 ? 92   PRO B N     1 
ATOM   2495  C  CA    . PRO B 1  92   ? -18.434 31.447  142.007 1.00 109.00 ? 92   PRO B CA    1 
ATOM   2496  C  C     . PRO B 1  92   ? -18.607 30.525  143.197 1.00 108.85 ? 92   PRO B C     1 
ATOM   2497  O  O     . PRO B 1  92   ? -18.174 29.367  143.131 1.00 104.48 ? 92   PRO B O     1 
ATOM   2498  C  CB    . PRO B 1  92   ? -17.007 32.011  141.939 1.00 117.31 ? 92   PRO B CB    1 
ATOM   2499  C  CG    . PRO B 1  92   ? -17.108 33.377  142.539 1.00 117.28 ? 92   PRO B CG    1 
ATOM   2500  C  CD    . PRO B 1  92   ? -18.464 33.888  142.142 1.00 115.39 ? 92   PRO B CD    1 
ATOM   2501  N  N     . SER B 1  93   ? -19.210 31.009  144.288 1.00 110.80 ? 93   SER B N     1 
ATOM   2502  C  CA    . SER B 1  93   ? -19.521 30.146  145.423 1.00 110.44 ? 93   SER B CA    1 
ATOM   2503  C  C     . SER B 1  93   ? -20.606 29.139  145.065 1.00 108.56 ? 93   SER B C     1 
ATOM   2504  O  O     . SER B 1  93   ? -20.545 27.976  145.483 1.00 109.88 ? 93   SER B O     1 
ATOM   2505  C  CB    . SER B 1  93   ? -19.967 30.991  146.616 1.00 110.46 ? 93   SER B CB    1 
ATOM   2506  O  OG    . SER B 1  93   ? -19.217 32.185  146.715 1.00 115.28 ? 93   SER B OG    1 
ATOM   2507  N  N     . LEU B 1  94   ? -21.597 29.576  144.291 1.00 104.03 ? 94   LEU B N     1 
ATOM   2508  C  CA    . LEU B 1  94   ? -22.776 28.774  143.990 1.00 99.56  ? 94   LEU B CA    1 
ATOM   2509  C  C     . LEU B 1  94   ? -22.409 27.403  143.435 1.00 94.48  ? 94   LEU B C     1 
ATOM   2510  O  O     . LEU B 1  94   ? -21.559 27.280  142.553 1.00 110.46 ? 94   LEU B O     1 
ATOM   2511  C  CB    . LEU B 1  94   ? -23.652 29.525  142.990 1.00 99.24  ? 94   LEU B CB    1 
ATOM   2512  C  CG    . LEU B 1  94   ? -25.124 29.655  143.342 1.00 105.58 ? 94   LEU B CG    1 
ATOM   2513  C  CD1   . LEU B 1  94   ? -25.870 30.200  142.149 1.00 106.38 ? 94   LEU B CD1   1 
ATOM   2514  C  CD2   . LEU B 1  94   ? -25.677 28.316  143.776 1.00 101.05 ? 94   LEU B CD2   1 
ATOM   2515  N  N     . GLN B 1  95   ? -23.059 26.370  143.958 1.00 92.98  ? 95   GLN B N     1 
ATOM   2516  C  CA    . GLN B 1  95   ? -22.916 25.022  143.432 1.00 88.54  ? 95   GLN B CA    1 
ATOM   2517  C  C     . GLN B 1  95   ? -24.196 24.548  142.761 1.00 92.62  ? 95   GLN B C     1 
ATOM   2518  O  O     . GLN B 1  95   ? -24.176 24.166  141.590 1.00 97.96  ? 95   GLN B O     1 
ATOM   2519  C  CB    . GLN B 1  95   ? -22.519 24.050  144.548 1.00 96.05  ? 95   GLN B CB    1 
ATOM   2520  C  CG    . GLN B 1  95   ? -21.185 24.348  145.199 1.00 101.22 ? 95   GLN B CG    1 
ATOM   2521  C  CD    . GLN B 1  95   ? -20.048 23.572  144.567 1.00 109.34 ? 95   GLN B CD    1 
ATOM   2522  O  OE1   . GLN B 1  95   ? -19.968 23.450  143.343 1.00 111.37 ? 95   GLN B OE1   1 
ATOM   2523  N  NE2   . GLN B 1  95   ? -19.166 23.029  145.402 1.00 104.32 ? 95   GLN B NE2   1 
ATOM   2524  N  N     . THR B 1  96   ? -25.319 24.569  143.474 1.00 89.88  ? 96   THR B N     1 
ATOM   2525  C  CA    . THR B 1  96   ? -26.581 24.090  142.935 1.00 89.19  ? 96   THR B CA    1 
ATOM   2526  C  C     . THR B 1  96   ? -27.695 25.090  143.213 1.00 88.24  ? 96   THR B C     1 
ATOM   2527  O  O     . THR B 1  96   ? -27.623 25.899  144.139 1.00 94.44  ? 96   THR B O     1 
ATOM   2528  C  CB    . THR B 1  96   ? -26.971 22.725  143.513 1.00 90.05  ? 96   THR B CB    1 
ATOM   2529  O  OG1   . THR B 1  96   ? -28.323 22.426  143.142 1.00 83.71  ? 96   THR B OG1   1 
ATOM   2530  C  CG2   . THR B 1  96   ? -26.847 22.728  145.025 1.00 93.04  ? 96   THR B CG2   1 
ATOM   2531  N  N     . VAL B 1  97   ? -28.732 25.017  142.378 1.00 88.46  ? 97   VAL B N     1 
ATOM   2532  C  CA    . VAL B 1  97   ? -29.924 25.845  142.494 1.00 84.57  ? 97   VAL B CA    1 
ATOM   2533  C  C     . VAL B 1  97   ? -31.118 24.969  142.142 1.00 93.03  ? 97   VAL B C     1 
ATOM   2534  O  O     . VAL B 1  97   ? -30.990 23.950  141.461 1.00 92.07  ? 97   VAL B O     1 
ATOM   2535  C  CB    . VAL B 1  97   ? -29.887 27.090  141.570 1.00 92.04  ? 97   VAL B CB    1 
ATOM   2536  C  CG1   . VAL B 1  97   ? -31.076 28.010  141.817 1.00 96.91  ? 97   VAL B CG1   1 
ATOM   2537  C  CG2   . VAL B 1  97   ? -28.597 27.862  141.746 1.00 95.68  ? 97   VAL B CG2   1 
ATOM   2538  N  N     . THR B 1  98   ? -32.286 25.358  142.645 1.00 94.61  ? 98   THR B N     1 
ATOM   2539  C  CA    . THR B 1  98   ? -33.557 24.821  142.183 1.00 93.74  ? 98   THR B CA    1 
ATOM   2540  C  C     . THR B 1  98   ? -34.379 25.978  141.638 1.00 95.65  ? 98   THR B C     1 
ATOM   2541  O  O     . THR B 1  98   ? -34.645 26.947  142.356 1.00 101.35 ? 98   THR B O     1 
ATOM   2542  C  CB    . THR B 1  98   ? -34.297 24.092  143.308 1.00 93.39  ? 98   THR B CB    1 
ATOM   2543  O  OG1   . THR B 1  98   ? -33.594 22.885  143.639 1.00 92.78  ? 98   THR B OG1   1 
ATOM   2544  C  CG2   . THR B 1  98   ? -35.717 23.737  142.878 1.00 93.74  ? 98   THR B CG2   1 
ATOM   2545  N  N     . LEU B 1  99   ? -34.740 25.897  140.362 1.00 100.60 ? 99   LEU B N     1 
ATOM   2546  C  CA    . LEU B 1  99   ? -35.612 26.881  139.743 1.00 98.82  ? 99   LEU B CA    1 
ATOM   2547  C  C     . LEU B 1  99   ? -37.048 26.388  139.809 1.00 98.75  ? 99   LEU B C     1 
ATOM   2548  O  O     . LEU B 1  99   ? -37.314 25.189  139.680 1.00 94.35  ? 99   LEU B O     1 
ATOM   2549  C  CB    . LEU B 1  99   ? -35.215 27.137  138.290 1.00 94.79  ? 99   LEU B CB    1 
ATOM   2550  C  CG    . LEU B 1  99   ? -34.232 28.272  138.005 1.00 95.91  ? 99   LEU B CG    1 
ATOM   2551  C  CD1   . LEU B 1  99   ? -32.904 28.057  138.711 1.00 89.70  ? 99   LEU B CD1   1 
ATOM   2552  C  CD2   . LEU B 1  99   ? -34.030 28.399  136.506 1.00 101.38 ? 99   LEU B CD2   1 
ATOM   2553  N  N     . LEU B 1  100  ? -37.971 27.316  140.026 1.00 99.11  ? 100  LEU B N     1 
ATOM   2554  C  CA    . LEU B 1  100  ? -39.382 26.991  140.141 1.00 99.60  ? 100  LEU B CA    1 
ATOM   2555  C  C     . LEU B 1  100  ? -40.155 27.732  139.063 1.00 92.71  ? 100  LEU B C     1 
ATOM   2556  O  O     . LEU B 1  100  ? -39.823 28.872  138.720 1.00 93.18  ? 100  LEU B O     1 
ATOM   2557  C  CB    . LEU B 1  100  ? -39.923 27.344  141.538 1.00 103.59 ? 100  LEU B CB    1 
ATOM   2558  C  CG    . LEU B 1  100  ? -39.386 26.523  142.719 1.00 99.52  ? 100  LEU B CG    1 
ATOM   2559  C  CD1   . LEU B 1  100  ? -38.221 27.226  143.412 1.00 93.09  ? 100  LEU B CD1   1 
ATOM   2560  C  CD2   . LEU B 1  100  ? -40.497 26.201  143.712 1.00 112.71 ? 100  LEU B CD2   1 
ATOM   2561  N  N     . LEU B 1  101  ? -41.181 27.073  138.527 1.00 94.28  ? 101  LEU B N     1 
ATOM   2562  C  CA    . LEU B 1  101  ? -41.995 27.664  137.477 1.00 102.41 ? 101  LEU B CA    1 
ATOM   2563  C  C     . LEU B 1  101  ? -43.441 27.217  137.626 1.00 106.99 ? 101  LEU B C     1 
ATOM   2564  O  O     . LEU B 1  101  ? -43.720 26.017  137.714 1.00 108.05 ? 101  LEU B O     1 
ATOM   2565  C  CB    . LEU B 1  101  ? -41.463 27.282  136.093 1.00 106.30 ? 101  LEU B CB    1 
ATOM   2566  C  CG    . LEU B 1  101  ? -42.157 27.945  134.908 1.00 106.21 ? 101  LEU B CG    1 
ATOM   2567  C  CD1   . LEU B 1  101  ? -41.112 28.468  133.942 1.00 107.90 ? 101  LEU B CD1   1 
ATOM   2568  C  CD2   . LEU B 1  101  ? -43.103 26.965  134.219 1.00 102.64 ? 101  LEU B CD2   1 
ATOM   2569  N  N     . LYS B 1  102  ? -44.352 28.190  137.640 1.00 109.60 ? 102  LYS B N     1 
ATOM   2570  C  CA    . LYS B 1  102  ? -45.787 27.945  137.714 1.00 108.16 ? 102  LYS B CA    1 
ATOM   2571  C  C     . LYS B 1  102  ? -46.474 28.752  136.623 1.00 106.38 ? 102  LYS B C     1 
ATOM   2572  O  O     . LYS B 1  102  ? -46.193 29.945  136.461 1.00 101.94 ? 102  LYS B O     1 
ATOM   2573  C  CB    . LYS B 1  102  ? -46.351 28.330  139.088 1.00 110.44 ? 102  LYS B CB    1 
ATOM   2574  C  CG    . LYS B 1  102  ? -45.758 27.551  140.251 1.00 117.98 ? 102  LYS B CG    1 
ATOM   2575  C  CD    . LYS B 1  102  ? -45.977 28.268  141.582 1.00 120.59 ? 102  LYS B CD    1 
ATOM   2576  C  CE    . LYS B 1  102  ? -45.288 27.533  142.729 1.00 119.65 ? 102  LYS B CE    1 
ATOM   2577  N  NZ    . LYS B 1  102  ? -45.341 28.293  144.009 1.00 120.14 ? 102  LYS B NZ    1 
ATOM   2578  N  N     . ALA B 1  103  ? -47.362 28.100  135.875 1.00 107.68 ? 103  ALA B N     1 
ATOM   2579  C  CA    . ALA B 1  103  ? -48.155 28.783  134.859 1.00 114.51 ? 103  ALA B CA    1 
ATOM   2580  C  C     . ALA B 1  103  ? -49.332 27.892  134.482 1.00 114.63 ? 103  ALA B C     1 
ATOM   2581  O  O     . ALA B 1  103  ? -49.404 26.721  134.869 1.00 108.40 ? 103  ALA B O     1 
ATOM   2582  C  CB    . ALA B 1  103  ? -47.314 29.142  133.628 1.00 109.87 ? 103  ALA B CB    1 
ATOM   2583  N  N     . GLU B 1  104  ? -50.254 28.462  133.712 1.00 118.65 ? 104  GLU B N     1 
ATOM   2584  C  CA    . GLU B 1  104  ? -51.465 27.755  133.305 1.00 121.09 ? 104  GLU B CA    1 
ATOM   2585  C  C     . GLU B 1  104  ? -52.136 28.541  132.184 1.00 122.43 ? 104  GLU B C     1 
ATOM   2586  O  O     . GLU B 1  104  ? -51.634 29.576  131.732 1.00 120.77 ? 104  GLU B O     1 
ATOM   2587  C  CB    . GLU B 1  104  ? -52.423 27.567  134.484 1.00 127.98 ? 104  GLU B CB    1 
ATOM   2588  C  CG    . GLU B 1  104  ? -52.976 28.869  135.045 1.00 126.59 ? 104  GLU B CG    1 
ATOM   2589  C  CD    . GLU B 1  104  ? -54.121 28.644  136.010 1.00 130.31 ? 104  GLU B CD    1 
ATOM   2590  O  OE1   . GLU B 1  104  ? -54.721 29.642  136.463 1.00 131.20 ? 104  GLU B OE1   1 
ATOM   2591  O  OE2   . GLU B 1  104  ? -54.422 27.470  136.311 1.00 131.24 ? 104  GLU B OE2   1 
ATOM   2592  N  N     . GLY B 1  105  ? -53.286 28.032  131.739 1.00 122.39 ? 105  GLY B N     1 
ATOM   2593  C  CA    . GLY B 1  105  ? -54.125 28.725  130.791 1.00 127.28 ? 105  GLY B CA    1 
ATOM   2594  C  C     . GLY B 1  105  ? -53.523 28.788  129.403 1.00 130.98 ? 105  GLY B C     1 
ATOM   2595  O  O     . GLY B 1  105  ? -52.601 28.040  129.065 1.00 132.90 ? 105  GLY B O     1 
ATOM   2596  N  N     . PRO B 1  106  ? -54.042 29.689  128.567 1.00 132.64 ? 106  PRO B N     1 
ATOM   2597  C  CA    . PRO B 1  106  ? -53.530 29.814  127.193 1.00 132.92 ? 106  PRO B CA    1 
ATOM   2598  C  C     . PRO B 1  106  ? -52.186 30.527  127.125 1.00 132.47 ? 106  PRO B C     1 
ATOM   2599  O  O     . PRO B 1  106  ? -52.148 31.750  126.939 1.00 129.40 ? 106  PRO B O     1 
ATOM   2600  C  CB    . PRO B 1  106  ? -54.630 30.617  126.485 1.00 133.74 ? 106  PRO B CB    1 
ATOM   2601  C  CG    . PRO B 1  106  ? -55.274 31.413  127.579 1.00 136.94 ? 106  PRO B CG    1 
ATOM   2602  C  CD    . PRO B 1  106  ? -55.209 30.556  128.813 1.00 134.63 ? 106  PRO B CD    1 
ATOM   2603  N  N     . LYS B 1  107  ? -51.079 29.796  127.279 1.00 126.07 ? 107  LYS B N     1 
ATOM   2604  C  CA    . LYS B 1  107  ? -49.789 30.471  127.371 1.00 126.53 ? 107  LYS B CA    1 
ATOM   2605  C  C     . LYS B 1  107  ? -48.668 29.569  126.869 1.00 124.31 ? 107  LYS B C     1 
ATOM   2606  O  O     . LYS B 1  107  ? -48.704 28.347  127.037 1.00 120.11 ? 107  LYS B O     1 
ATOM   2607  C  CB    . LYS B 1  107  ? -49.505 30.917  128.814 1.00 128.28 ? 107  LYS B CB    1 
ATOM   2608  C  CG    . LYS B 1  107  ? -48.302 31.839  128.969 1.00 126.78 ? 107  LYS B CG    1 
ATOM   2609  C  CD    . LYS B 1  107  ? -48.012 32.124  130.432 1.00 122.85 ? 107  LYS B CD    1 
ATOM   2610  C  CE    . LYS B 1  107  ? -46.857 33.094  130.596 1.00 121.07 ? 107  LYS B CE    1 
ATOM   2611  N  NZ    . LYS B 1  107  ? -46.636 33.412  132.035 1.00 128.00 ? 107  LYS B NZ    1 
ATOM   2612  N  N     . GLU B 1  108  ? -47.656 30.192  126.268 1.00 121.07 ? 108  GLU B N     1 
ATOM   2613  C  CA    . GLU B 1  108  ? -46.447 29.504  125.829 1.00 120.29 ? 108  GLU B CA    1 
ATOM   2614  C  C     . GLU B 1  108  ? -45.308 29.914  126.757 1.00 118.17 ? 108  GLU B C     1 
ATOM   2615  O  O     . GLU B 1  108  ? -44.851 31.062  126.722 1.00 115.67 ? 108  GLU B O     1 
ATOM   2616  C  CB    . GLU B 1  108  ? -46.130 29.830  124.371 1.00 117.35 ? 108  GLU B CB    1 
ATOM   2617  C  CG    . GLU B 1  108  ? -47.252 29.461  123.417 1.00 121.80 ? 108  GLU B CG    1 
ATOM   2618  C  CD    . GLU B 1  108  ? -46.827 29.503  121.964 1.00 124.08 ? 108  GLU B CD    1 
ATOM   2619  O  OE1   . GLU B 1  108  ? -45.654 29.841  121.694 1.00 127.41 ? 108  GLU B OE1   1 
ATOM   2620  O  OE2   . GLU B 1  108  ? -47.667 29.194  121.091 1.00 116.10 ? 108  GLU B OE2   1 
ATOM   2621  N  N     . VAL B 1  109  ? -44.852 28.971  127.577 1.00 114.80 ? 109  VAL B N     1 
ATOM   2622  C  CA    . VAL B 1  109  ? -43.871 29.257  128.617 1.00 113.42 ? 109  VAL B CA    1 
ATOM   2623  C  C     . VAL B 1  109  ? -42.474 29.265  128.014 1.00 111.99 ? 109  VAL B C     1 
ATOM   2624  O  O     . VAL B 1  109  ? -42.061 28.304  127.351 1.00 109.76 ? 109  VAL B O     1 
ATOM   2625  C  CB    . VAL B 1  109  ? -43.973 28.227  129.753 1.00 116.56 ? 109  VAL B CB    1 
ATOM   2626  C  CG1   . VAL B 1  109  ? -42.889 28.478  130.791 1.00 112.06 ? 109  VAL B CG1   1 
ATOM   2627  C  CG2   . VAL B 1  109  ? -45.359 28.263  130.388 1.00 112.30 ? 109  VAL B CG2   1 
ATOM   2628  N  N     . LYS B 1  110  ? -41.739 30.346  128.255 1.00 112.72 ? 110  LYS B N     1 
ATOM   2629  C  CA    . LYS B 1  110  ? -40.345 30.482  127.869 1.00 106.71 ? 110  LYS B CA    1 
ATOM   2630  C  C     . LYS B 1  110  ? -39.458 30.333  129.101 1.00 105.52 ? 110  LYS B C     1 
ATOM   2631  O  O     . LYS B 1  110  ? -39.936 30.138  130.220 1.00 104.83 ? 110  LYS B O     1 
ATOM   2632  C  CB    . LYS B 1  110  ? -40.118 31.826  127.175 1.00 110.20 ? 110  LYS B CB    1 
ATOM   2633  C  CG    . LYS B 1  110  ? -40.884 31.983  125.866 1.00 116.06 ? 110  LYS B CG    1 
ATOM   2634  C  CD    . LYS B 1  110  ? -40.401 30.975  124.828 1.00 118.16 ? 110  LYS B CD    1 
ATOM   2635  C  CE    . LYS B 1  110  ? -41.150 31.092  123.506 1.00 116.63 ? 110  LYS B CE    1 
ATOM   2636  N  NZ    . LYS B 1  110  ? -42.584 30.708  123.646 1.00 121.37 ? 110  LYS B NZ    1 
ATOM   2637  N  N     . ALA B 1  111  ? -38.143 30.416  128.889 1.00 105.34 ? 111  ALA B N     1 
ATOM   2638  C  CA    . ALA B 1  111  ? -37.217 30.371  130.015 1.00 107.84 ? 111  ALA B CA    1 
ATOM   2639  C  C     . ALA B 1  111  ? -37.310 31.621  130.877 1.00 114.80 ? 111  ALA B C     1 
ATOM   2640  O  O     . ALA B 1  111  ? -36.901 31.588  132.044 1.00 119.21 ? 111  ALA B O     1 
ATOM   2641  C  CB    . ALA B 1  111  ? -35.781 30.184  129.521 1.00 104.36 ? 111  ALA B CB    1 
ATOM   2642  N  N     . ARG B 1  112  ? -37.837 32.715  130.322 1.00 114.59 ? 112  ARG B N     1 
ATOM   2643  C  CA    . ARG B 1  112  ? -38.056 33.934  131.095 1.00 118.81 ? 112  ARG B CA    1 
ATOM   2644  C  C     . ARG B 1  112  ? -38.944 33.672  132.306 1.00 118.26 ? 112  ARG B C     1 
ATOM   2645  O  O     . ARG B 1  112  ? -38.702 34.206  133.396 1.00 111.83 ? 112  ARG B O     1 
ATOM   2646  C  CB    . ARG B 1  112  ? -38.689 34.990  130.193 1.00 116.80 ? 112  ARG B CB    1 
ATOM   2647  C  CG    . ARG B 1  112  ? -38.617 36.408  130.706 1.00 122.58 ? 112  ARG B CG    1 
ATOM   2648  C  CD    . ARG B 1  112  ? -39.309 37.333  129.725 1.00 129.01 ? 112  ARG B CD    1 
ATOM   2649  N  NE    . ARG B 1  112  ? -39.355 36.755  128.383 1.00 125.19 ? 112  ARG B NE    1 
ATOM   2650  C  CZ    . ARG B 1  112  ? -38.398 36.899  127.471 1.00 122.27 ? 112  ARG B CZ    1 
ATOM   2651  N  NH1   . ARG B 1  112  ? -37.310 37.603  127.755 1.00 123.38 ? 112  ARG B NH1   1 
ATOM   2652  N  NH2   . ARG B 1  112  ? -38.527 36.336  126.277 1.00 125.65 ? 112  ARG B NH2   1 
ATOM   2653  N  N     . ASP B 1  113  ? -39.967 32.833  132.133 1.00 115.71 ? 113  ASP B N     1 
ATOM   2654  C  CA    . ASP B 1  113  ? -40.968 32.570  133.157 1.00 109.85 ? 113  ASP B CA    1 
ATOM   2655  C  C     . ASP B 1  113  ? -40.400 31.918  134.409 1.00 114.20 ? 113  ASP B C     1 
ATOM   2656  O  O     . ASP B 1  113  ? -41.120 31.813  135.408 1.00 115.26 ? 113  ASP B O     1 
ATOM   2657  C  CB    . ASP B 1  113  ? -42.065 31.688  132.565 1.00 106.40 ? 113  ASP B CB    1 
ATOM   2658  C  CG    . ASP B 1  113  ? -42.677 32.288  131.321 1.00 111.93 ? 113  ASP B CG    1 
ATOM   2659  O  OD1   . ASP B 1  113  ? -41.978 33.072  130.639 1.00 116.52 ? 113  ASP B OD1   1 
ATOM   2660  O  OD2   . ASP B 1  113  ? -43.857 31.997  131.034 1.00 115.92 ? 113  ASP B OD2   1 
ATOM   2661  N  N     . PHE B 1  114  ? -39.151 31.463  134.385 1.00 113.60 ? 114  PHE B N     1 
ATOM   2662  C  CA    . PHE B 1  114  ? -38.554 30.917  135.594 1.00 116.89 ? 114  PHE B CA    1 
ATOM   2663  C  C     . PHE B 1  114  ? -38.370 32.023  136.623 1.00 118.76 ? 114  PHE B C     1 
ATOM   2664  O  O     . PHE B 1  114  ? -37.926 33.129  136.297 1.00 120.40 ? 114  PHE B O     1 
ATOM   2665  C  CB    . PHE B 1  114  ? -37.219 30.240  135.284 1.00 111.92 ? 114  PHE B CB    1 
ATOM   2666  C  CG    . PHE B 1  114  ? -37.357 28.814  134.828 1.00 110.74 ? 114  PHE B CG    1 
ATOM   2667  C  CD1   . PHE B 1  114  ? -37.654 27.809  135.737 1.00 106.28 ? 114  PHE B CD1   1 
ATOM   2668  C  CD2   . PHE B 1  114  ? -37.185 28.477  133.496 1.00 107.48 ? 114  PHE B CD2   1 
ATOM   2669  C  CE1   . PHE B 1  114  ? -37.783 26.494  135.323 1.00 105.72 ? 114  PHE B CE1   1 
ATOM   2670  C  CE2   . PHE B 1  114  ? -37.311 27.164  133.076 1.00 102.41 ? 114  PHE B CE2   1 
ATOM   2671  C  CZ    . PHE B 1  114  ? -37.611 26.172  133.991 1.00 102.81 ? 114  PHE B CZ    1 
ATOM   2672  N  N     . LEU B 1  115  ? -38.736 31.727  137.863 1.00 104.96 ? 115  LEU B N     1 
ATOM   2673  C  CA    . LEU B 1  115  ? -38.679 32.730  138.920 1.00 108.30 ? 115  LEU B CA    1 
ATOM   2674  C  C     . LEU B 1  115  ? -37.230 33.076  139.238 1.00 110.40 ? 115  LEU B C     1 
ATOM   2675  O  O     . LEU B 1  115  ? -36.450 32.178  139.584 1.00 107.78 ? 115  LEU B O     1 
ATOM   2676  C  CB    . LEU B 1  115  ? -39.406 32.223  140.156 1.00 109.56 ? 115  LEU B CB    1 
ATOM   2677  C  CG    . LEU B 1  115  ? -40.923 32.256  139.976 1.00 104.33 ? 115  LEU B CG    1 
ATOM   2678  C  CD1   . LEU B 1  115  ? -41.619 31.665  141.185 1.00 109.48 ? 115  LEU B CD1   1 
ATOM   2679  C  CD2   . LEU B 1  115  ? -41.390 33.680  139.719 1.00 96.63  ? 115  LEU B CD2   1 
ATOM   2680  N  N     . PRO B 1  116  ? -36.832 34.348  139.133 1.00 109.11 ? 116  PRO B N     1 
ATOM   2681  C  CA    . PRO B 1  116  ? -35.409 34.700  139.246 1.00 105.01 ? 116  PRO B CA    1 
ATOM   2682  C  C     . PRO B 1  116  ? -34.808 34.286  140.580 1.00 104.76 ? 116  PRO B C     1 
ATOM   2683  O  O     . PRO B 1  116  ? -35.508 34.116  141.580 1.00 114.53 ? 116  PRO B O     1 
ATOM   2684  C  CB    . PRO B 1  116  ? -35.409 36.226  139.083 1.00 99.80  ? 116  PRO B CB    1 
ATOM   2685  C  CG    . PRO B 1  116  ? -36.631 36.510  138.272 1.00 109.04 ? 116  PRO B CG    1 
ATOM   2686  C  CD    . PRO B 1  116  ? -37.657 35.495  138.714 1.00 106.37 ? 116  PRO B CD    1 
ATOM   2687  N  N     . VAL B 1  117  ? -33.487 34.103  140.571 1.00 98.19  ? 117  VAL B N     1 
ATOM   2688  C  CA    . VAL B 1  117  ? -32.722 33.693  141.740 1.00 97.56  ? 117  VAL B CA    1 
ATOM   2689  C  C     . VAL B 1  117  ? -31.467 34.553  141.815 1.00 105.65 ? 117  VAL B C     1 
ATOM   2690  O  O     . VAL B 1  117  ? -30.940 35.007  140.795 1.00 104.57 ? 117  VAL B O     1 
ATOM   2691  C  CB    . VAL B 1  117  ? -32.367 32.188  141.699 1.00 99.57  ? 117  VAL B CB    1 
ATOM   2692  C  CG1   . VAL B 1  117  ? -31.606 31.770  142.951 1.00 100.55 ? 117  VAL B CG1   1 
ATOM   2693  C  CG2   . VAL B 1  117  ? -33.630 31.345  141.539 1.00 95.79  ? 117  VAL B CG2   1 
ATOM   2694  N  N     . ALA B 1  118  ? -31.003 34.791  143.040 1.00 115.92 ? 118  ALA B N     1 
ATOM   2695  C  CA    . ALA B 1  118  ? -29.857 35.662  143.271 1.00 118.10 ? 118  ALA B CA    1 
ATOM   2696  C  C     . ALA B 1  118  ? -28.611 35.108  142.597 1.00 112.10 ? 118  ALA B C     1 
ATOM   2697  O  O     . ALA B 1  118  ? -28.202 33.974  142.868 1.00 117.99 ? 118  ALA B O     1 
ATOM   2698  C  CB    . ALA B 1  118  ? -29.624 35.824  144.774 1.00 116.15 ? 118  ALA B CB    1 
ATOM   2699  N  N     . ASP B 1  119  ? -28.011 35.914  141.719 1.00 110.17 ? 119  ASP B N     1 
ATOM   2700  C  CA    . ASP B 1  119  ? -26.766 35.559  141.030 1.00 123.64 ? 119  ASP B CA    1 
ATOM   2701  C  C     . ASP B 1  119  ? -26.934 34.306  140.163 1.00 120.41 ? 119  ASP B C     1 
ATOM   2702  O  O     . ASP B 1  119  ? -26.069 33.426  140.131 1.00 115.45 ? 119  ASP B O     1 
ATOM   2703  C  CB    . ASP B 1  119  ? -25.611 35.393  142.025 1.00 126.70 ? 119  ASP B CB    1 
ATOM   2704  C  CG    . ASP B 1  119  ? -25.287 36.683  142.772 1.00 126.20 ? 119  ASP B CG    1 
ATOM   2705  O  OD1   . ASP B 1  119  ? -25.552 37.774  142.222 1.00 126.14 ? 119  ASP B OD1   1 
ATOM   2706  O  OD2   . ASP B 1  119  ? -24.763 36.604  143.907 1.00 120.45 ? 119  ASP B OD2   1 
ATOM   2707  N  N     . VAL B 1  120  ? -28.059 34.226  139.450 1.00 118.65 ? 120  VAL B N     1 
ATOM   2708  C  CA    . VAL B 1  120  ? -28.332 33.163  138.483 1.00 111.42 ? 120  VAL B CA    1 
ATOM   2709  C  C     . VAL B 1  120  ? -28.919 33.817  137.238 1.00 111.96 ? 120  VAL B C     1 
ATOM   2710  O  O     . VAL B 1  120  ? -30.064 34.288  137.262 1.00 110.09 ? 120  VAL B O     1 
ATOM   2711  C  CB    . VAL B 1  120  ? -29.290 32.096  139.033 1.00 110.71 ? 120  VAL B CB    1 
ATOM   2712  C  CG1   . VAL B 1  120  ? -29.672 31.120  137.928 1.00 110.02 ? 120  VAL B CG1   1 
ATOM   2713  C  CG2   . VAL B 1  120  ? -28.667 31.360  140.205 1.00 103.07 ? 120  VAL B CG2   1 
ATOM   2714  N  N     . GLU B 1  121  ? -28.153 33.832  136.150 1.00 113.87 ? 121  GLU B N     1 
ATOM   2715  C  CA    . GLU B 1  121  ? -28.553 34.484  134.909 1.00 110.82 ? 121  GLU B CA    1 
ATOM   2716  C  C     . GLU B 1  121  ? -28.973 33.445  133.879 1.00 108.20 ? 121  GLU B C     1 
ATOM   2717  O  O     . GLU B 1  121  ? -28.269 32.453  133.664 1.00 103.91 ? 121  GLU B O     1 
ATOM   2718  C  CB    . GLU B 1  121  ? -27.410 35.338  134.359 1.00 107.94 ? 121  GLU B CB    1 
ATOM   2719  C  CG    . GLU B 1  121  ? -27.645 35.872  132.957 1.00 111.07 ? 121  GLU B CG    1 
ATOM   2720  C  CD    . GLU B 1  121  ? -26.465 36.670  132.438 1.00 113.52 ? 121  GLU B CD    1 
ATOM   2721  O  OE1   . GLU B 1  121  ? -26.677 37.569  131.594 1.00 112.08 ? 121  GLU B OE1   1 
ATOM   2722  O  OE2   . GLU B 1  121  ? -25.325 36.401  132.881 1.00 111.05 ? 121  GLU B OE2   1 
ATOM   2723  N  N     . ILE B 1  122  ? -30.114 33.673  133.239 1.00 105.73 ? 122  ILE B N     1 
ATOM   2724  C  CA    . ILE B 1  122  ? -30.590 32.815  132.162 1.00 103.49 ? 122  ILE B CA    1 
ATOM   2725  C  C     . ILE B 1  122  ? -30.146 33.434  130.844 1.00 109.36 ? 122  ILE B C     1 
ATOM   2726  O  O     . ILE B 1  122  ? -30.641 34.492  130.441 1.00 105.72 ? 122  ILE B O     1 
ATOM   2727  C  CB    . ILE B 1  122  ? -32.108 32.623  132.217 1.00 102.04 ? 122  ILE B CB    1 
ATOM   2728  C  CG1   . ILE B 1  122  ? -32.467 31.762  133.423 1.00 96.85  ? 122  ILE B CG1   1 
ATOM   2729  C  CG2   . ILE B 1  122  ? -32.610 31.982  130.936 1.00 109.88 ? 122  ILE B CG2   1 
ATOM   2730  C  CD1   . ILE B 1  122  ? -33.918 31.372  133.463 1.00 102.52 ? 122  ILE B CD1   1 
ATOM   2731  N  N     . MET B 1  123  ? -29.209 32.765  130.168 1.00 110.55 ? 123  MET B N     1 
ATOM   2732  C  CA    . MET B 1  123  ? -28.629 33.320  128.951 1.00 109.36 ? 123  MET B CA    1 
ATOM   2733  C  C     . MET B 1  123  ? -29.616 33.309  127.793 1.00 109.17 ? 123  MET B C     1 
ATOM   2734  O  O     . MET B 1  123  ? -29.559 34.189  126.928 1.00 111.21 ? 123  MET B O     1 
ATOM   2735  C  CB    . MET B 1  123  ? -27.367 32.545  128.570 1.00 104.47 ? 123  MET B CB    1 
ATOM   2736  C  CG    . MET B 1  123  ? -26.292 32.515  129.649 1.00 108.45 ? 123  MET B CG    1 
ATOM   2737  S  SD    . MET B 1  123  ? -25.351 34.049  129.784 1.00 116.15 ? 123  MET B SD    1 
ATOM   2738  C  CE    . MET B 1  123  ? -24.846 34.296  128.086 1.00 102.24 ? 123  MET B CE    1 
ATOM   2739  N  N     . ASN B 1  124  ? -30.522 32.332  127.751 1.00 107.54 ? 124  ASN B N     1 
ATOM   2740  C  CA    . ASN B 1  124  ? -31.460 32.166  126.643 1.00 112.59 ? 124  ASN B CA    1 
ATOM   2741  C  C     . ASN B 1  124  ? -32.889 32.225  127.172 1.00 111.02 ? 124  ASN B C     1 
ATOM   2742  O  O     . ASN B 1  124  ? -33.588 31.205  127.225 1.00 106.29 ? 124  ASN B O     1 
ATOM   2743  C  CB    . ASN B 1  124  ? -31.207 30.856  125.899 1.00 106.11 ? 124  ASN B CB    1 
ATOM   2744  C  CG    . ASN B 1  124  ? -31.069 29.673  126.836 1.00 106.21 ? 124  ASN B CG    1 
ATOM   2745  O  OD1   . ASN B 1  124  ? -30.723 29.833  128.006 1.00 108.80 ? 124  ASN B OD1   1 
ATOM   2746  N  ND2   . ASN B 1  124  ? -31.341 28.479  126.326 1.00 100.27 ? 124  ASN B ND2   1 
ATOM   2747  N  N     . PRO B 1  125  ? -33.363 33.417  127.545 1.00 114.93 ? 125  PRO B N     1 
ATOM   2748  C  CA    . PRO B 1  125  ? -34.714 33.521  128.117 1.00 117.68 ? 125  PRO B CA    1 
ATOM   2749  C  C     . PRO B 1  125  ? -35.819 33.276  127.105 1.00 117.50 ? 125  PRO B C     1 
ATOM   2750  O  O     . PRO B 1  125  ? -36.953 32.983  127.508 1.00 116.89 ? 125  PRO B O     1 
ATOM   2751  C  CB    . PRO B 1  125  ? -34.752 34.957  128.654 1.00 118.61 ? 125  PRO B CB    1 
ATOM   2752  C  CG    . PRO B 1  125  ? -33.826 35.701  127.744 1.00 119.63 ? 125  PRO B CG    1 
ATOM   2753  C  CD    . PRO B 1  125  ? -32.723 34.735  127.388 1.00 116.17 ? 125  PRO B CD    1 
ATOM   2754  N  N     . ASP B 1  126  ? -35.527 33.384  125.809 1.00 117.14 ? 126  ASP B N     1 
ATOM   2755  C  CA    . ASP B 1  126  ? -36.513 33.154  124.760 1.00 115.72 ? 126  ASP B CA    1 
ATOM   2756  C  C     . ASP B 1  126  ? -36.717 31.675  124.455 1.00 113.37 ? 126  ASP B C     1 
ATOM   2757  O  O     . ASP B 1  126  ? -37.549 31.345  123.603 1.00 113.46 ? 126  ASP B O     1 
ATOM   2758  C  CB    . ASP B 1  126  ? -36.094 33.895  123.487 1.00 125.52 ? 126  ASP B CB    1 
ATOM   2759  C  CG    . ASP B 1  126  ? -35.928 35.390  123.708 1.00 133.82 ? 126  ASP B CG    1 
ATOM   2760  O  OD1   . ASP B 1  126  ? -35.653 35.792  124.858 1.00 131.80 ? 126  ASP B OD1   1 
ATOM   2761  O  OD2   . ASP B 1  126  ? -36.084 36.163  122.737 1.00 140.41 ? 126  ASP B OD2   1 
ATOM   2762  N  N     . LEU B 1  127  ? -35.990 30.787  125.131 1.00 110.28 ? 127  LEU B N     1 
ATOM   2763  C  CA    . LEU B 1  127  ? -36.077 29.358  124.855 1.00 106.86 ? 127  LEU B CA    1 
ATOM   2764  C  C     . LEU B 1  127  ? -37.445 28.811  125.241 1.00 101.45 ? 127  LEU B C     1 
ATOM   2765  O  O     . LEU B 1  127  ? -37.913 29.015  126.363 1.00 111.43 ? 127  LEU B O     1 
ATOM   2766  C  CB    . LEU B 1  127  ? -34.980 28.612  125.613 1.00 103.96 ? 127  LEU B CB    1 
ATOM   2767  C  CG    . LEU B 1  127  ? -35.073 27.086  125.606 1.00 100.62 ? 127  LEU B CG    1 
ATOM   2768  C  CD1   . LEU B 1  127  ? -35.077 26.554  124.184 1.00 103.01 ? 127  LEU B CD1   1 
ATOM   2769  C  CD2   . LEU B 1  127  ? -33.933 26.475  126.401 1.00 100.54 ? 127  LEU B CD2   1 
ATOM   2770  N  N     . HIS B 1  128  ? -38.077 28.097  124.314 1.00 95.02  ? 128  HIS B N     1 
ATOM   2771  C  CA    . HIS B 1  128  ? -39.391 27.526  124.574 1.00 100.02 ? 128  HIS B CA    1 
ATOM   2772  C  C     . HIS B 1  128  ? -39.298 26.350  125.542 1.00 102.81 ? 128  HIS B C     1 
ATOM   2773  O  O     . HIS B 1  128  ? -38.352 25.559  125.491 1.00 105.55 ? 128  HIS B O     1 
ATOM   2774  C  CB    . HIS B 1  128  ? -40.036 27.073  123.267 1.00 96.50  ? 128  HIS B CB    1 
ATOM   2775  C  CG    . HIS B 1  128  ? -41.358 26.397  123.454 1.00 105.51 ? 128  HIS B CG    1 
ATOM   2776  N  ND1   . HIS B 1  128  ? -42.534 27.097  123.613 1.00 107.19 ? 128  HIS B ND1   1 
ATOM   2777  C  CD2   . HIS B 1  128  ? -41.689 25.085  123.522 1.00 101.25 ? 128  HIS B CD2   1 
ATOM   2778  C  CE1   . HIS B 1  128  ? -43.533 26.246  123.764 1.00 104.63 ? 128  HIS B CE1   1 
ATOM   2779  N  NE2   . HIS B 1  128  ? -43.048 25.019  123.710 1.00 96.23  ? 128  HIS B NE2   1 
ATOM   2780  N  N     . ILE B 1  129  ? -40.291 26.240  126.433 1.00 99.30  ? 129  ILE B N     1 
ATOM   2781  C  CA    . ILE B 1  129  ? -40.418 25.109  127.359 1.00 97.10  ? 129  ILE B CA    1 
ATOM   2782  C  C     . ILE B 1  129  ? -41.643 24.253  127.028 1.00 102.45 ? 129  ILE B C     1 
ATOM   2783  O  O     . ILE B 1  129  ? -41.524 23.049  126.791 1.00 102.17 ? 129  ILE B O     1 
ATOM   2784  C  CB    . ILE B 1  129  ? -40.449 25.581  128.830 1.00 99.70  ? 129  ILE B CB    1 
ATOM   2785  C  CG1   . ILE B 1  129  ? -39.034 25.792  129.372 1.00 90.60  ? 129  ILE B CG1   1 
ATOM   2786  C  CG2   . ILE B 1  129  ? -41.153 24.552  129.699 1.00 95.17  ? 129  ILE B CG2   1 
ATOM   2787  C  CD1   . ILE B 1  129  ? -38.415 27.104  129.002 1.00 92.33  ? 129  ILE B CD1   1 
ATOM   2788  N  N     . ALA B 1  130  ? -42.834 24.854  127.029 1.00 107.30 ? 130  ALA B N     1 
ATOM   2789  C  CA    . ALA B 1  130  ? -44.048 24.101  126.741 1.00 105.01 ? 130  ALA B CA    1 
ATOM   2790  C  C     . ALA B 1  130  ? -45.161 25.057  126.336 1.00 107.06 ? 130  ALA B C     1 
ATOM   2791  O  O     . ALA B 1  130  ? -45.117 26.256  126.619 1.00 110.14 ? 130  ALA B O     1 
ATOM   2792  C  CB    . ALA B 1  130  ? -44.480 23.250  127.938 1.00 99.88  ? 130  ALA B CB    1 
ATOM   2793  N  N     . THR B 1  131  ? -46.150 24.508  125.638 1.00 108.58 ? 131  THR B N     1 
ATOM   2794  C  CA    . THR B 1  131  ? -47.364 25.225  125.274 1.00 111.75 ? 131  THR B CA    1 
ATOM   2795  C  C     . THR B 1  131  ? -48.523 24.657  126.080 1.00 111.54 ? 131  THR B C     1 
ATOM   2796  O  O     . THR B 1  131  ? -48.733 23.440  126.095 1.00 104.36 ? 131  THR B O     1 
ATOM   2797  C  CB    . THR B 1  131  ? -47.667 25.106  123.777 1.00 119.68 ? 131  THR B CB    1 
ATOM   2798  O  OG1   . THR B 1  131  ? -47.598 23.730  123.377 1.00 121.10 ? 131  THR B OG1   1 
ATOM   2799  C  CG2   . THR B 1  131  ? -46.690 25.928  122.946 1.00 117.18 ? 131  THR B CG2   1 
ATOM   2800  N  N     . LEU B 1  132  ? -49.269 25.535  126.746 1.00 119.38 ? 132  LEU B N     1 
ATOM   2801  C  CA    . LEU B 1  132  ? -50.421 25.154  127.545 1.00 115.94 ? 132  LEU B CA    1 
ATOM   2802  C  C     . LEU B 1  132  ? -51.674 25.794  126.971 1.00 116.75 ? 132  LEU B C     1 
ATOM   2803  O  O     . LEU B 1  132  ? -51.652 26.955  126.541 1.00 118.68 ? 132  LEU B O     1 
ATOM   2804  C  CB    . LEU B 1  132  ? -50.253 25.575  129.001 1.00 116.57 ? 132  LEU B CB    1 
ATOM   2805  C  CG    . LEU B 1  132  ? -49.157 24.907  129.824 1.00 119.04 ? 132  LEU B CG    1 
ATOM   2806  C  CD1   . LEU B 1  132  ? -47.811 25.608  129.652 1.00 114.18 ? 132  LEU B CD1   1 
ATOM   2807  C  CD2   . LEU B 1  132  ? -49.566 24.861  131.288 1.00 118.76 ? 132  LEU B CD2   1 
ATOM   2808  N  N     . GLU B 1  133  ? -52.766 25.039  126.996 1.00 116.56 ? 133  GLU B N     1 
ATOM   2809  C  CA    . GLU B 1  133  ? -54.043 25.458  126.444 1.00 126.43 ? 133  GLU B CA    1 
ATOM   2810  C  C     . GLU B 1  133  ? -54.993 25.867  127.574 1.00 125.96 ? 133  GLU B C     1 
ATOM   2811  O  O     . GLU B 1  133  ? -54.606 25.950  128.745 1.00 123.00 ? 133  GLU B O     1 
ATOM   2812  C  CB    . GLU B 1  133  ? -54.626 24.330  125.590 1.00 122.84 ? 133  GLU B CB    1 
ATOM   2813  C  CG    . GLU B 1  133  ? -53.594 23.580  124.779 1.00 118.70 ? 133  GLU B CG    1 
ATOM   2814  C  CD    . GLU B 1  133  ? -53.517 22.112  125.152 1.00 122.52 ? 133  GLU B CD    1 
ATOM   2815  O  OE1   . GLU B 1  133  ? -54.145 21.720  126.159 1.00 119.43 ? 133  GLU B OE1   1 
ATOM   2816  O  OE2   . GLU B 1  133  ? -52.834 21.348  124.437 1.00 125.36 ? 133  GLU B OE2   1 
ATOM   2817  N  N     . GLU B 1  134  ? -56.248 26.144  127.219 1.00 125.09 ? 134  GLU B N     1 
ATOM   2818  C  CA    . GLU B 1  134  ? -57.278 26.403  128.215 1.00 125.90 ? 134  GLU B CA    1 
ATOM   2819  C  C     . GLU B 1  134  ? -57.484 25.164  129.074 1.00 128.15 ? 134  GLU B C     1 
ATOM   2820  O  O     . GLU B 1  134  ? -57.888 24.111  128.569 1.00 130.65 ? 134  GLU B O     1 
ATOM   2821  C  CB    . GLU B 1  134  ? -58.582 26.789  127.524 1.00 132.34 ? 134  GLU B CB    1 
ATOM   2822  C  CG    . GLU B 1  134  ? -58.457 27.908  126.505 1.00 139.38 ? 134  GLU B CG    1 
ATOM   2823  C  CD    . GLU B 1  134  ? -58.691 29.280  127.109 1.00 141.67 ? 134  GLU B CD    1 
ATOM   2824  O  OE1   . GLU B 1  134  ? -58.588 30.281  126.368 1.00 140.54 ? 134  GLU B OE1   1 
ATOM   2825  O  OE2   . GLU B 1  134  ? -58.983 29.357  128.322 1.00 132.40 ? 134  GLU B OE2   1 
ATOM   2826  N  N     . GLY B 1  135  ? -57.214 25.286  130.370 1.00 119.86 ? 135  GLY B N     1 
ATOM   2827  C  CA    . GLY B 1  135  ? -57.275 24.146  131.259 1.00 119.89 ? 135  GLY B CA    1 
ATOM   2828  C  C     . GLY B 1  135  ? -55.972 23.418  131.446 1.00 117.78 ? 135  GLY B C     1 
ATOM   2829  O  O     . GLY B 1  135  ? -55.957 22.357  132.083 1.00 112.72 ? 135  GLY B O     1 
ATOM   2830  N  N     . GLY B 1  136  ? -54.882 23.939  130.893 1.00 121.86 ? 136  GLY B N     1 
ATOM   2831  C  CA    . GLY B 1  136  ? -53.569 23.363  131.114 1.00 123.66 ? 136  GLY B CA    1 
ATOM   2832  C  C     . GLY B 1  136  ? -52.926 23.983  132.342 1.00 122.10 ? 136  GLY B C     1 
ATOM   2833  O  O     . GLY B 1  136  ? -53.092 25.167  132.614 1.00 121.50 ? 136  GLY B O     1 
ATOM   2834  N  N     . ARG B 1  137  ? -52.190 23.162  133.083 1.00 119.89 ? 137  ARG B N     1 
ATOM   2835  C  CA    . ARG B 1  137  ? -51.547 23.603  134.313 1.00 119.37 ? 137  ARG B CA    1 
ATOM   2836  C  C     . ARG B 1  137  ? -50.161 22.983  134.402 1.00 112.47 ? 137  ARG B C     1 
ATOM   2837  O  O     . ARG B 1  137  ? -50.011 21.768  134.225 1.00 100.38 ? 137  ARG B O     1 
ATOM   2838  C  CB    . ARG B 1  137  ? -52.388 23.219  135.540 1.00 124.55 ? 137  ARG B CB    1 
ATOM   2839  C  CG    . ARG B 1  137  ? -53.803 23.805  135.553 1.00 131.93 ? 137  ARG B CG    1 
ATOM   2840  C  CD    . ARG B 1  137  ? -54.545 23.492  136.850 1.00 135.66 ? 137  ARG B CD    1 
ATOM   2841  N  NE    . ARG B 1  137  ? -53.932 24.143  138.005 1.00 142.00 ? 137  ARG B NE    1 
ATOM   2842  C  CZ    . ARG B 1  137  ? -54.285 25.340  138.464 1.00 138.23 ? 137  ARG B CZ    1 
ATOM   2843  N  NH1   . ARG B 1  137  ? -55.252 26.021  137.865 1.00 134.95 ? 137  ARG B NH1   1 
ATOM   2844  N  NH2   . ARG B 1  137  ? -53.673 25.856  139.522 1.00 133.12 ? 137  ARG B NH2   1 
ATOM   2845  N  N     . LEU B 1  138  ? -49.151 23.814  134.679 1.00 110.60 ? 138  LEU B N     1 
ATOM   2846  C  CA    . LEU B 1  138  ? -47.771 23.361  134.802 1.00 106.97 ? 138  LEU B CA    1 
ATOM   2847  C  C     . LEU B 1  138  ? -47.139 23.976  136.043 1.00 106.68 ? 138  LEU B C     1 
ATOM   2848  O  O     . LEU B 1  138  ? -47.030 25.204  136.151 1.00 107.92 ? 138  LEU B O     1 
ATOM   2849  C  CB    . LEU B 1  138  ? -46.956 23.723  133.557 1.00 111.17 ? 138  LEU B CB    1 
ATOM   2850  C  CG    . LEU B 1  138  ? -45.480 23.313  133.582 1.00 102.21 ? 138  LEU B CG    1 
ATOM   2851  C  CD1   . LEU B 1  138  ? -45.341 21.795  133.578 1.00 93.23  ? 138  LEU B CD1   1 
ATOM   2852  C  CD2   . LEU B 1  138  ? -44.730 23.939  132.420 1.00 90.93  ? 138  LEU B CD2   1 
ATOM   2853  N  N     . ASN B 1  139  ? -46.712 23.117  136.966 1.00 101.02 ? 139  ASN B N     1 
ATOM   2854  C  CA    . ASN B 1  139  ? -45.958 23.509  138.151 1.00 104.71 ? 139  ASN B CA    1 
ATOM   2855  C  C     . ASN B 1  139  ? -44.755 22.582  138.244 1.00 105.56 ? 139  ASN B C     1 
ATOM   2856  O  O     . ASN B 1  139  ? -44.925 21.369  138.407 1.00 101.35 ? 139  ASN B O     1 
ATOM   2857  C  CB    . ASN B 1  139  ? -46.831 23.408  139.408 1.00 115.55 ? 139  ASN B CB    1 
ATOM   2858  C  CG    . ASN B 1  139  ? -46.145 23.934  140.660 1.00 117.35 ? 139  ASN B CG    1 
ATOM   2859  O  OD1   . ASN B 1  139  ? -44.923 23.865  140.802 1.00 116.43 ? 139  ASN B OD1   1 
ATOM   2860  N  ND2   . ASN B 1  139  ? -46.942 24.456  141.585 1.00 126.87 ? 139  ASN B ND2   1 
ATOM   2861  N  N     . MET B 1  140  ? -43.544 23.141  138.138 1.00 106.42 ? 140  MET B N     1 
ATOM   2862  C  CA    . MET B 1  140  ? -42.362 22.289  138.073 1.00 105.62 ? 140  MET B CA    1 
ATOM   2863  C  C     . MET B 1  140  ? -41.150 22.935  138.738 1.00 101.67 ? 140  MET B C     1 
ATOM   2864  O  O     . MET B 1  140  ? -40.992 24.162  138.762 1.00 95.45  ? 140  MET B O     1 
ATOM   2865  C  CB    . MET B 1  140  ? -42.017 21.914  136.625 1.00 103.87 ? 140  MET B CB    1 
ATOM   2866  C  CG    . MET B 1  140  ? -41.525 23.065  135.765 1.00 110.74 ? 140  MET B CG    1 
ATOM   2867  S  SD    . MET B 1  140  ? -40.539 22.487  134.363 1.00 102.70 ? 140  MET B SD    1 
ATOM   2868  C  CE    . MET B 1  140  ? -41.696 21.351  133.604 1.00 96.43  ? 140  MET B CE    1 
ATOM   2869  N  N     . GLU B 1  141  ? -40.285 22.068  139.263 1.00 100.37 ? 141  GLU B N     1 
ATOM   2870  C  CA    . GLU B 1  141  ? -39.035 22.447  139.909 1.00 101.50 ? 141  GLU B CA    1 
ATOM   2871  C  C     . GLU B 1  141  ? -37.891 21.719  139.216 1.00 104.41 ? 141  GLU B C     1 
ATOM   2872  O  O     . GLU B 1  141  ? -37.972 20.506  138.989 1.00 102.98 ? 141  GLU B O     1 
ATOM   2873  C  CB    . GLU B 1  141  ? -39.055 22.098  141.403 1.00 107.12 ? 141  GLU B CB    1 
ATOM   2874  C  CG    . GLU B 1  141  ? -40.232 22.686  142.172 1.00 112.43 ? 141  GLU B CG    1 
ATOM   2875  C  CD    . GLU B 1  141  ? -40.459 22.006  143.515 1.00 117.52 ? 141  GLU B CD    1 
ATOM   2876  O  OE1   . GLU B 1  141  ? -39.572 21.244  143.962 1.00 113.36 ? 141  GLU B OE1   1 
ATOM   2877  O  OE2   . GLU B 1  141  ? -41.533 22.229  144.118 1.00 114.91 ? 141  GLU B OE2   1 
ATOM   2878  N  N     . VAL B 1  142  ? -36.829 22.455  138.882 1.00 99.37  ? 142  VAL B N     1 
ATOM   2879  C  CA    . VAL B 1  142  ? -35.710 21.914  138.116 1.00 97.11  ? 142  VAL B CA    1 
ATOM   2880  C  C     . VAL B 1  142  ? -34.404 22.172  138.865 1.00 97.29  ? 142  VAL B C     1 
ATOM   2881  O  O     . VAL B 1  142  ? -34.101 23.310  139.241 1.00 94.59  ? 142  VAL B O     1 
ATOM   2882  C  CB    . VAL B 1  142  ? -35.656 22.490  136.683 1.00 96.46  ? 142  VAL B CB    1 
ATOM   2883  C  CG1   . VAL B 1  142  ? -36.881 22.048  135.894 1.00 96.99  ? 142  VAL B CG1   1 
ATOM   2884  C  CG2   . VAL B 1  142  ? -35.567 24.007  136.687 1.00 96.94  ? 142  VAL B CG2   1 
ATOM   2885  N  N     . ARG B 1  143  ? -33.640 21.106  139.079 1.00 95.19  ? 143  ARG B N     1 
ATOM   2886  C  CA    . ARG B 1  143  ? -32.366 21.141  139.783 1.00 89.08  ? 143  ARG B CA    1 
ATOM   2887  C  C     . ARG B 1  143  ? -31.235 21.423  138.795 1.00 91.46  ? 143  ARG B C     1 
ATOM   2888  O  O     . ARG B 1  143  ? -31.112 20.742  137.773 1.00 83.92  ? 143  ARG B O     1 
ATOM   2889  C  CB    . ARG B 1  143  ? -32.157 19.804  140.499 1.00 80.97  ? 143  ARG B CB    1 
ATOM   2890  C  CG    . ARG B 1  143  ? -30.767 19.556  141.030 1.00 84.77  ? 143  ARG B CG    1 
ATOM   2891  C  CD    . ARG B 1  143  ? -30.515 20.308  142.308 1.00 88.28  ? 143  ARG B CD    1 
ATOM   2892  N  NE    . ARG B 1  143  ? -29.180 20.050  142.844 1.00 91.11  ? 143  ARG B NE    1 
ATOM   2893  C  CZ    . ARG B 1  143  ? -28.812 18.916  143.434 1.00 90.59  ? 143  ARG B CZ    1 
ATOM   2894  N  NH1   . ARG B 1  143  ? -29.674 17.912  143.555 1.00 85.42  ? 143  ARG B NH1   1 
ATOM   2895  N  NH2   . ARG B 1  143  ? -27.577 18.783  143.900 1.00 88.62  ? 143  ARG B NH2   1 
ATOM   2896  N  N     . VAL B 1  144  ? -30.410 22.424  139.100 1.00 89.60  ? 144  VAL B N     1 
ATOM   2897  C  CA    . VAL B 1  144  ? -29.346 22.877  138.210 1.00 79.30  ? 144  VAL B CA    1 
ATOM   2898  C  C     . VAL B 1  144  ? -28.038 22.881  138.986 1.00 86.08  ? 144  VAL B C     1 
ATOM   2899  O  O     . VAL B 1  144  ? -27.905 23.602  139.982 1.00 88.02  ? 144  VAL B O     1 
ATOM   2900  C  CB    . VAL B 1  144  ? -29.635 24.274  137.638 1.00 82.41  ? 144  VAL B CB    1 
ATOM   2901  C  CG1   . VAL B 1  144  ? -28.367 24.894  137.076 1.00 80.41  ? 144  VAL B CG1   1 
ATOM   2902  C  CG2   . VAL B 1  144  ? -30.708 24.194  136.572 1.00 85.52  ? 144  VAL B CG2   1 
ATOM   2903  N  N     . ASP B 1  145  ? -27.065 22.107  138.515 1.00 91.70  ? 145  ASP B N     1 
ATOM   2904  C  CA    . ASP B 1  145  ? -25.789 21.960  139.195 1.00 89.46  ? 145  ASP B CA    1 
ATOM   2905  C  C     . ASP B 1  145  ? -24.637 22.464  138.335 1.00 82.96  ? 145  ASP B C     1 
ATOM   2906  O  O     . ASP B 1  145  ? -24.755 22.614  137.119 1.00 87.52  ? 145  ASP B O     1 
ATOM   2907  C  CB    . ASP B 1  145  ? -25.531 20.500  139.574 1.00 90.75  ? 145  ASP B CB    1 
ATOM   2908  C  CG    . ASP B 1  145  ? -26.261 20.094  140.824 1.00 93.22  ? 145  ASP B CG    1 
ATOM   2909  O  OD1   . ASP B 1  145  ? -25.718 20.337  141.926 1.00 94.63  ? 145  ASP B OD1   1 
ATOM   2910  O  OD2   . ASP B 1  145  ? -27.377 19.545  140.700 1.00 92.81  ? 145  ASP B OD2   1 
ATOM   2911  N  N     . ARG B 1  146  ? -23.514 22.714  139.001 1.00 77.63  ? 146  ARG B N     1 
ATOM   2912  C  CA    . ARG B 1  146  ? -22.260 23.082  138.366 1.00 84.97  ? 146  ARG B CA    1 
ATOM   2913  C  C     . ARG B 1  146  ? -21.385 21.844  138.238 1.00 88.99  ? 146  ARG B C     1 
ATOM   2914  O  O     . ARG B 1  146  ? -21.123 21.157  139.231 1.00 88.13  ? 146  ARG B O     1 
ATOM   2915  C  CB    . ARG B 1  146  ? -21.547 24.167  139.173 1.00 89.80  ? 146  ARG B CB    1 
ATOM   2916  C  CG    . ARG B 1  146  ? -20.026 24.114  139.119 1.00 93.82  ? 146  ARG B CG    1 
ATOM   2917  C  CD    . ARG B 1  146  ? -19.433 25.508  138.978 1.00 106.30 ? 146  ARG B CD    1 
ATOM   2918  N  NE    . ARG B 1  146  ? -20.074 26.479  139.864 1.00 103.88 ? 146  ARG B NE    1 
ATOM   2919  C  CZ    . ARG B 1  146  ? -19.853 27.791  139.817 1.00 106.49 ? 146  ARG B CZ    1 
ATOM   2920  N  NH1   . ARG B 1  146  ? -19.006 28.294  138.925 1.00 106.26 ? 146  ARG B NH1   1 
ATOM   2921  N  NH2   . ARG B 1  146  ? -20.482 28.602  140.655 1.00 100.84 ? 146  ARG B NH2   1 
ATOM   2922  N  N     . GLY B 1  147  ? -20.951 21.558  137.016 1.00 87.90  ? 147  GLY B N     1 
ATOM   2923  C  CA    . GLY B 1  147  ? -20.153 20.380  136.768 1.00 86.89  ? 147  GLY B CA    1 
ATOM   2924  C  C     . GLY B 1  147  ? -19.419 20.464  135.446 1.00 85.44  ? 147  GLY B C     1 
ATOM   2925  O  O     . GLY B 1  147  ? -19.364 21.518  134.806 1.00 79.81  ? 147  GLY B O     1 
ATOM   2926  N  N     . VAL B 1  148  ? -18.848 19.329  135.046 1.00 82.29  ? 148  VAL B N     1 
ATOM   2927  C  CA    . VAL B 1  148  ? -18.008 19.256  133.861 1.00 77.59  ? 148  VAL B CA    1 
ATOM   2928  C  C     . VAL B 1  148  ? -18.382 18.031  133.041 1.00 80.82  ? 148  VAL B C     1 
ATOM   2929  O  O     . VAL B 1  148  ? -18.691 16.962  133.581 1.00 76.05  ? 148  VAL B O     1 
ATOM   2930  C  CB    . VAL B 1  148  ? -16.507 19.208  134.217 1.00 74.86  ? 148  VAL B CB    1 
ATOM   2931  C  CG1   . VAL B 1  148  ? -16.055 20.499  134.877 1.00 73.45  ? 148  VAL B CG1   1 
ATOM   2932  C  CG2   . VAL B 1  148  ? -16.198 17.994  135.084 1.00 55.26  ? 148  VAL B CG2   1 
ATOM   2933  N  N     . GLY B 1  149  ? -18.336 18.196  131.720 1.00 76.87  ? 149  GLY B N     1 
ATOM   2934  C  CA    . GLY B 1  149  ? -18.448 17.047  130.830 1.00 71.14  ? 149  GLY B CA    1 
ATOM   2935  C  C     . GLY B 1  149  ? -19.884 16.645  130.607 1.00 67.43  ? 149  GLY B C     1 
ATOM   2936  O  O     . GLY B 1  149  ? -20.752 17.495  130.359 1.00 66.02  ? 149  GLY B O     1 
ATOM   2937  N  N     . TYR B 1  150  ? -20.140 15.341  130.667 1.00 59.40  ? 150  TYR B N     1 
ATOM   2938  C  CA    . TYR B 1  150  ? -21.474 14.825  130.387 1.00 64.70  ? 150  TYR B CA    1 
ATOM   2939  C  C     . TYR B 1  150  ? -21.734 13.615  131.268 1.00 77.53  ? 150  TYR B C     1 
ATOM   2940  O  O     . TYR B 1  150  ? -21.002 12.624  131.194 1.00 70.65  ? 150  TYR B O     1 
ATOM   2941  C  CB    . TYR B 1  150  ? -21.617 14.472  128.914 1.00 64.69  ? 150  TYR B CB    1 
ATOM   2942  C  CG    . TYR B 1  150  ? -22.972 13.964  128.481 1.00 66.47  ? 150  TYR B CG    1 
ATOM   2943  C  CD1   . TYR B 1  150  ? -23.277 12.609  128.527 1.00 69.65  ? 150  TYR B CD1   1 
ATOM   2944  C  CD2   . TYR B 1  150  ? -23.926 14.833  127.973 1.00 68.92  ? 150  TYR B CD2   1 
ATOM   2945  C  CE1   . TYR B 1  150  ? -24.508 12.140  128.104 1.00 69.48  ? 150  TYR B CE1   1 
ATOM   2946  C  CE2   . TYR B 1  150  ? -25.160 14.372  127.546 1.00 68.76  ? 150  TYR B CE2   1 
ATOM   2947  C  CZ    . TYR B 1  150  ? -25.446 13.025  127.615 1.00 69.07  ? 150  TYR B CZ    1 
ATOM   2948  O  OH    . TYR B 1  150  ? -26.672 12.562  127.192 1.00 72.24  ? 150  TYR B OH    1 
ATOM   2949  N  N     . VAL B 1  151  ? -22.770 13.710  132.102 1.00 81.19  ? 151  VAL B N     1 
ATOM   2950  C  CA    . VAL B 1  151  ? -23.173 12.637  133.008 1.00 76.12  ? 151  VAL B CA    1 
ATOM   2951  C  C     . VAL B 1  151  ? -24.589 12.197  132.654 1.00 75.77  ? 151  VAL B C     1 
ATOM   2952  O  O     . VAL B 1  151  ? -25.537 12.982  132.820 1.00 73.60  ? 151  VAL B O     1 
ATOM   2953  C  CB    . VAL B 1  151  ? -23.093 13.088  134.475 1.00 75.44  ? 151  VAL B CB    1 
ATOM   2954  C  CG1   . VAL B 1  151  ? -23.310 11.901  135.396 1.00 75.66  ? 151  VAL B CG1   1 
ATOM   2955  C  CG2   . VAL B 1  151  ? -21.759 13.775  134.764 1.00 68.87  ? 151  VAL B CG2   1 
ATOM   2956  N  N     . PRO B 1  152  ? -24.782 10.970  132.165 1.00 77.63  ? 152  PRO B N     1 
ATOM   2957  C  CA    . PRO B 1  152  ? -26.138 10.504  131.858 1.00 79.73  ? 152  PRO B CA    1 
ATOM   2958  C  C     . PRO B 1  152  ? -26.987 10.463  133.120 1.00 82.57  ? 152  PRO B C     1 
ATOM   2959  O  O     . PRO B 1  152  ? -26.480 10.522  134.241 1.00 80.43  ? 152  PRO B O     1 
ATOM   2960  C  CB    . PRO B 1  152  ? -25.920 9.097   131.283 1.00 75.44  ? 152  PRO B CB    1 
ATOM   2961  C  CG    . PRO B 1  152  ? -24.469 9.019   130.961 1.00 72.20  ? 152  PRO B CG    1 
ATOM   2962  C  CD    . PRO B 1  152  ? -23.769 9.934   131.909 1.00 73.14  ? 152  PRO B CD    1 
ATOM   2963  N  N     . ALA B 1  153  ? -28.301 10.351  132.921 1.00 88.04  ? 153  ALA B N     1 
ATOM   2964  C  CA    . ALA B 1  153  ? -29.243 10.451  134.033 1.00 84.64  ? 153  ALA B CA    1 
ATOM   2965  C  C     . ALA B 1  153  ? -28.999 9.363   135.074 1.00 85.80  ? 153  ALA B C     1 
ATOM   2966  O  O     . ALA B 1  153  ? -28.776 9.647   136.257 1.00 85.46  ? 153  ALA B O     1 
ATOM   2967  C  CB    . ALA B 1  153  ? -30.677 10.381  133.505 1.00 81.89  ? 153  ALA B CB    1 
ATOM   2968  N  N     . GLU B 1  154  ? -29.031 8.104   134.646 1.00 82.14  ? 154  GLU B N     1 
ATOM   2969  C  CA    . GLU B 1  154  ? -28.924 6.987   135.575 1.00 72.91  ? 154  GLU B CA    1 
ATOM   2970  C  C     . GLU B 1  154  ? -27.553 6.861   136.230 1.00 78.03  ? 154  GLU B C     1 
ATOM   2971  O  O     . GLU B 1  154  ? -27.379 5.975   137.072 1.00 92.52  ? 154  GLU B O     1 
ATOM   2972  C  CB    . GLU B 1  154  ? -29.274 5.683   134.856 1.00 73.82  ? 154  GLU B CB    1 
ATOM   2973  C  CG    . GLU B 1  154  ? -28.860 5.637   133.385 1.00 92.86  ? 154  GLU B CG    1 
ATOM   2974  C  CD    . GLU B 1  154  ? -29.875 6.312   132.471 1.00 98.06  ? 154  GLU B CD    1 
ATOM   2975  O  OE1   . GLU B 1  154  ? -29.502 6.721   131.347 1.00 92.42  ? 154  GLU B OE1   1 
ATOM   2976  O  OE2   . GLU B 1  154  ? -31.047 6.441   132.891 1.00 97.54  ? 154  GLU B OE2   1 
ATOM   2977  N  N     . LYS B 1  155  ? -26.582 7.703   135.880 1.00 78.00  ? 155  LYS B N     1 
ATOM   2978  C  CA    . LYS B 1  155  ? -25.265 7.625   136.506 1.00 79.97  ? 155  LYS B CA    1 
ATOM   2979  C  C     . LYS B 1  155  ? -25.114 8.568   137.694 1.00 84.09  ? 155  LYS B C     1 
ATOM   2980  O  O     . LYS B 1  155  ? -24.381 8.248   138.637 1.00 88.99  ? 155  LYS B O     1 
ATOM   2981  C  CB    . LYS B 1  155  ? -24.164 7.912   135.481 1.00 86.71  ? 155  LYS B CB    1 
ATOM   2982  C  CG    . LYS B 1  155  ? -23.972 6.814   134.433 1.00 88.26  ? 155  LYS B CG    1 
ATOM   2983  C  CD    . LYS B 1  155  ? -23.701 5.462   135.081 1.00 91.79  ? 155  LYS B CD    1 
ATOM   2984  C  CE    . LYS B 1  155  ? -23.665 4.343   134.046 1.00 95.07  ? 155  LYS B CE    1 
ATOM   2985  N  NZ    . LYS B 1  155  ? -22.512 4.471   133.102 1.00 99.07  ? 155  LYS B NZ    1 
ATOM   2986  N  N     . HIS B 1  156  ? -25.775 9.726   137.673 1.00 82.23  ? 156  HIS B N     1 
ATOM   2987  C  CA    . HIS B 1  156  ? -25.803 10.573  138.858 1.00 81.50  ? 156  HIS B CA    1 
ATOM   2988  C  C     . HIS B 1  156  ? -26.944 10.183  139.795 1.00 92.50  ? 156  HIS B C     1 
ATOM   2989  O  O     . HIS B 1  156  ? -26.763 10.172  141.018 1.00 86.75  ? 156  HIS B O     1 
ATOM   2990  C  CB    . HIS B 1  156  ? -25.909 12.051  138.461 1.00 80.15  ? 156  HIS B CB    1 
ATOM   2991  C  CG    . HIS B 1  156  ? -27.188 12.411  137.767 1.00 81.51  ? 156  HIS B CG    1 
ATOM   2992  N  ND1   . HIS B 1  156  ? -28.341 12.736  138.450 1.00 88.25  ? 156  HIS B ND1   1 
ATOM   2993  C  CD2   . HIS B 1  156  ? -27.491 12.517  136.452 1.00 84.81  ? 156  HIS B CD2   1 
ATOM   2994  C  CE1   . HIS B 1  156  ? -29.301 13.013  137.586 1.00 85.14  ? 156  HIS B CE1   1 
ATOM   2995  N  NE2   . HIS B 1  156  ? -28.811 12.889  136.367 1.00 86.62  ? 156  HIS B NE2   1 
ATOM   2996  N  N     . GLY B 1  157  ? -28.110 9.850   139.232 1.00 95.52  ? 157  GLY B N     1 
ATOM   2997  C  CA    . GLY B 1  157  ? -29.251 9.333   139.972 1.00 91.16  ? 157  GLY B CA    1 
ATOM   2998  C  C     . GLY B 1  157  ? -29.692 10.144  141.175 1.00 97.80  ? 157  GLY B C     1 
ATOM   2999  O  O     . GLY B 1  157  ? -29.858 9.587   142.267 1.00 101.11 ? 157  GLY B O     1 
ATOM   3000  N  N     . ILE B 1  158  ? -29.902 11.450  140.997 1.00 91.13  ? 158  ILE B N     1 
ATOM   3001  C  CA    . ILE B 1  158  ? -30.186 12.344  142.115 1.00 99.80  ? 158  ILE B CA    1 
ATOM   3002  C  C     . ILE B 1  158  ? -31.685 12.607  142.183 1.00 104.05 ? 158  ILE B C     1 
ATOM   3003  O  O     . ILE B 1  158  ? -32.347 12.801  141.153 1.00 98.21  ? 158  ILE B O     1 
ATOM   3004  C  CB    . ILE B 1  158  ? -29.379 13.657  142.015 1.00 92.81  ? 158  ILE B CB    1 
ATOM   3005  C  CG1   . ILE B 1  158  ? -29.927 14.590  140.943 1.00 90.33  ? 158  ILE B CG1   1 
ATOM   3006  C  CG2   . ILE B 1  158  ? -27.901 13.369  141.745 1.00 85.19  ? 158  ILE B CG2   1 
ATOM   3007  C  CD1   . ILE B 1  158  ? -29.207 15.909  140.908 1.00 95.00  ? 158  ILE B CD1   1 
ATOM   3008  N  N     . LYS B 1  159  ? -32.224 12.583  143.404 1.00 97.27  ? 159  LYS B N     1 
ATOM   3009  C  CA    . LYS B 1  159  ? -33.651 12.781  143.638 1.00 95.98  ? 159  LYS B CA    1 
ATOM   3010  C  C     . LYS B 1  159  ? -33.846 13.487  144.971 1.00 104.14 ? 159  LYS B C     1 
ATOM   3011  O  O     . LYS B 1  159  ? -33.382 12.998  146.007 1.00 105.39 ? 159  LYS B O     1 
ATOM   3012  C  CB    . LYS B 1  159  ? -34.398 11.443  143.636 1.00 95.54  ? 159  LYS B CB    1 
ATOM   3013  C  CG    . LYS B 1  159  ? -34.805 10.921  142.268 1.00 92.93  ? 159  LYS B CG    1 
ATOM   3014  C  CD    . LYS B 1  159  ? -35.777 9.757   142.420 1.00 94.86  ? 159  LYS B CD    1 
ATOM   3015  C  CE    . LYS B 1  159  ? -36.220 9.194   141.079 1.00 97.17  ? 159  LYS B CE    1 
ATOM   3016  N  NZ    . LYS B 1  159  ? -35.104 8.534   140.336 1.00 95.96  ? 159  LYS B NZ    1 
ATOM   3017  N  N     . ASP B 1  160  ? -34.529 14.635  144.945 1.00 105.56 ? 160  ASP B N     1 
ATOM   3018  C  CA    . ASP B 1  160  ? -35.014 15.270  146.166 1.00 101.04 ? 160  ASP B CA    1 
ATOM   3019  C  C     . ASP B 1  160  ? -36.393 14.771  146.576 1.00 101.45 ? 160  ASP B C     1 
ATOM   3020  O  O     . ASP B 1  160  ? -36.762 14.902  147.748 1.00 101.77 ? 160  ASP B O     1 
ATOM   3021  C  CB    . ASP B 1  160  ? -35.089 16.794  146.001 1.00 102.06 ? 160  ASP B CB    1 
ATOM   3022  C  CG    . ASP B 1  160  ? -34.230 17.310  144.861 1.00 109.89 ? 160  ASP B CG    1 
ATOM   3023  O  OD1   . ASP B 1  160  ? -32.991 17.130  144.920 1.00 103.75 ? 160  ASP B OD1   1 
ATOM   3024  O  OD2   . ASP B 1  160  ? -34.799 17.890  143.902 1.00 103.20 ? 160  ASP B OD2   1 
ATOM   3025  N  N     . ARG B 1  161  ? -37.156 14.217  145.633 1.00 95.35  ? 161  ARG B N     1 
ATOM   3026  C  CA    . ARG B 1  161  ? -38.544 13.813  145.810 1.00 89.39  ? 161  ARG B CA    1 
ATOM   3027  C  C     . ARG B 1  161  ? -38.725 12.409  145.246 1.00 94.55  ? 161  ARG B C     1 
ATOM   3028  O  O     . ARG B 1  161  ? -37.781 11.804  144.733 1.00 106.42 ? 161  ARG B O     1 
ATOM   3029  C  CB    . ARG B 1  161  ? -39.487 14.808  145.121 1.00 90.52  ? 161  ARG B CB    1 
ATOM   3030  C  CG    . ARG B 1  161  ? -39.280 16.239  145.565 1.00 99.29  ? 161  ARG B CG    1 
ATOM   3031  C  CD    . ARG B 1  161  ? -39.882 17.227  144.583 1.00 106.26 ? 161  ARG B CD    1 
ATOM   3032  N  NE    . ARG B 1  161  ? -40.144 18.516  145.215 1.00 107.25 ? 161  ARG B NE    1 
ATOM   3033  C  CZ    . ARG B 1  161  ? -41.246 18.788  145.907 1.00 110.96 ? 161  ARG B CZ    1 
ATOM   3034  N  NH1   . ARG B 1  161  ? -42.182 17.857  146.055 1.00 107.37 ? 161  ARG B NH1   1 
ATOM   3035  N  NH2   . ARG B 1  161  ? -41.410 19.986  146.454 1.00 109.83 ? 161  ARG B NH2   1 
ATOM   3036  N  N     . ILE B 1  162  ? -39.947 11.886  145.333 1.00 94.73  ? 162  ILE B N     1 
ATOM   3037  C  CA    . ILE B 1  162  ? -40.203 10.547  144.808 1.00 99.99  ? 162  ILE B CA    1 
ATOM   3038  C  C     . ILE B 1  162  ? -40.582 10.577  143.330 1.00 104.63 ? 162  ILE B C     1 
ATOM   3039  O  O     . ILE B 1  162  ? -40.254 9.641   142.594 1.00 105.33 ? 162  ILE B O     1 
ATOM   3040  C  CB    . ILE B 1  162  ? -41.279 9.829   145.642 1.00 102.98 ? 162  ILE B CB    1 
ATOM   3041  C  CG1   . ILE B 1  162  ? -40.883 8.378   145.892 1.00 102.77 ? 162  ILE B CG1   1 
ATOM   3042  C  CG2   . ILE B 1  162  ? -42.642 9.873   144.956 1.00 103.28 ? 162  ILE B CG2   1 
ATOM   3043  C  CD1   . ILE B 1  162  ? -39.612 8.230   146.689 1.00 102.18 ? 162  ILE B CD1   1 
ATOM   3044  N  N     . ASN B 1  163  ? -41.254 11.634  142.875 1.00 106.08 ? 163  ASN B N     1 
ATOM   3045  C  CA    . ASN B 1  163  ? -41.663 11.763  141.484 1.00 104.25 ? 163  ASN B CA    1 
ATOM   3046  C  C     . ASN B 1  163  ? -40.685 12.598  140.671 1.00 102.67 ? 163  ASN B C     1 
ATOM   3047  O  O     . ASN B 1  163  ? -40.957 12.895  139.502 1.00 99.16  ? 163  ASN B O     1 
ATOM   3048  C  CB    . ASN B 1  163  ? -43.070 12.363  141.401 1.00 105.61 ? 163  ASN B CB    1 
ATOM   3049  C  CG    . ASN B 1  163  ? -44.125 11.445  141.985 1.00 116.07 ? 163  ASN B CG    1 
ATOM   3050  O  OD1   . ASN B 1  163  ? -44.005 10.219  141.913 1.00 113.91 ? 163  ASN B OD1   1 
ATOM   3051  N  ND2   . ASN B 1  163  ? -45.167 12.032  142.572 1.00 118.41 ? 163  ASN B ND2   1 
ATOM   3052  N  N     . ALA B 1  164  ? -39.566 12.996  141.271 1.00 97.53  ? 164  ALA B N     1 
ATOM   3053  C  CA    . ALA B 1  164  ? -38.536 13.718  140.538 1.00 99.62  ? 164  ALA B CA    1 
ATOM   3054  C  C     . ALA B 1  164  ? -37.902 12.810  139.490 1.00 97.90  ? 164  ALA B C     1 
ATOM   3055  O  O     . ALA B 1  164  ? -37.692 11.615  139.725 1.00 93.25  ? 164  ALA B O     1 
ATOM   3056  C  CB    . ALA B 1  164  ? -37.472 14.244  141.498 1.00 91.72  ? 164  ALA B CB    1 
ATOM   3057  N  N     . ILE B 1  165  ? -37.607 13.383  138.331 1.00 97.89  ? 165  ILE B N     1 
ATOM   3058  C  CA    . ILE B 1  165  ? -37.062 12.657  137.185 1.00 94.78  ? 165  ILE B CA    1 
ATOM   3059  C  C     . ILE B 1  165  ? -35.607 13.069  137.007 1.00 85.71  ? 165  ILE B C     1 
ATOM   3060  O  O     . ILE B 1  165  ? -35.324 14.269  136.902 1.00 82.14  ? 165  ILE B O     1 
ATOM   3061  C  CB    . ILE B 1  165  ? -37.859 12.933  135.898 1.00 92.28  ? 165  ILE B CB    1 
ATOM   3062  C  CG1   . ILE B 1  165  ? -39.360 12.919  136.188 1.00 85.70  ? 165  ILE B CG1   1 
ATOM   3063  C  CG2   . ILE B 1  165  ? -37.519 11.903  134.843 1.00 91.10  ? 165  ILE B CG2   1 
ATOM   3064  C  CD1   . ILE B 1  165  ? -40.221 13.103  134.965 1.00 84.22  ? 165  ILE B CD1   1 
ATOM   3065  N  N     . PRO B 1  166  ? -34.665 12.126  136.971 1.00 85.98  ? 166  PRO B N     1 
ATOM   3066  C  CA    . PRO B 1  166  ? -33.270 12.478  136.673 1.00 88.11  ? 166  PRO B CA    1 
ATOM   3067  C  C     . PRO B 1  166  ? -33.079 12.761  135.189 1.00 83.65  ? 166  PRO B C     1 
ATOM   3068  O  O     . PRO B 1  166  ? -33.621 12.064  134.325 1.00 80.46  ? 166  PRO B O     1 
ATOM   3069  C  CB    . PRO B 1  166  ? -32.494 11.229  137.109 1.00 86.36  ? 166  PRO B CB    1 
ATOM   3070  C  CG    . PRO B 1  166  ? -33.475 10.111  136.946 1.00 84.31  ? 166  PRO B CG    1 
ATOM   3071  C  CD    . PRO B 1  166  ? -34.834 10.689  137.252 1.00 79.72  ? 166  PRO B CD    1 
ATOM   3072  N  N     . VAL B 1  167  ? -32.300 13.801  134.898 1.00 80.94  ? 167  VAL B N     1 
ATOM   3073  C  CA    . VAL B 1  167  ? -32.074 14.277  133.537 1.00 85.55  ? 167  VAL B CA    1 
ATOM   3074  C  C     . VAL B 1  167  ? -30.611 14.067  133.171 1.00 83.34  ? 167  VAL B C     1 
ATOM   3075  O  O     . VAL B 1  167  ? -29.725 14.239  134.017 1.00 83.32  ? 167  VAL B O     1 
ATOM   3076  C  CB    . VAL B 1  167  ? -32.470 15.761  133.406 1.00 86.27  ? 167  VAL B CB    1 
ATOM   3077  C  CG1   . VAL B 1  167  ? -32.201 16.280  131.998 1.00 74.33  ? 167  VAL B CG1   1 
ATOM   3078  C  CG2   . VAL B 1  167  ? -33.936 15.952  133.786 1.00 85.77  ? 167  VAL B CG2   1 
ATOM   3079  N  N     . ASP B 1  168  ? -30.359 13.681  131.916 1.00 80.52  ? 168  ASP B N     1 
ATOM   3080  C  CA    . ASP B 1  168  ? -28.992 13.641  131.402 1.00 74.38  ? 168  ASP B CA    1 
ATOM   3081  C  C     . ASP B 1  168  ? -28.354 15.023  131.533 1.00 67.35  ? 168  ASP B C     1 
ATOM   3082  O  O     . ASP B 1  168  ? -28.893 16.018  131.037 1.00 63.55  ? 168  ASP B O     1 
ATOM   3083  C  CB    . ASP B 1  168  ? -28.989 13.180  129.943 1.00 73.58  ? 168  ASP B CB    1 
ATOM   3084  C  CG    . ASP B 1  168  ? -29.555 11.774  129.761 1.00 77.90  ? 168  ASP B CG    1 
ATOM   3085  O  OD1   . ASP B 1  168  ? -29.203 10.874  130.554 1.00 76.08  ? 168  ASP B OD1   1 
ATOM   3086  O  OD2   . ASP B 1  168  ? -30.347 11.563  128.814 1.00 71.85  ? 168  ASP B OD2   1 
ATOM   3087  N  N     . ALA B 1  169  ? -27.214 15.093  132.210 1.00 62.52  ? 169  ALA B N     1 
ATOM   3088  C  CA    . ALA B 1  169  ? -26.636 16.371  132.612 1.00 68.90  ? 169  ALA B CA    1 
ATOM   3089  C  C     . ALA B 1  169  ? -25.632 16.834  131.562 1.00 74.63  ? 169  ALA B C     1 
ATOM   3090  O  O     . ALA B 1  169  ? -24.509 16.334  131.509 1.00 74.20  ? 169  ALA B O     1 
ATOM   3091  C  CB    . ALA B 1  169  ? -25.970 16.251  133.978 1.00 69.74  ? 169  ALA B CB    1 
ATOM   3092  N  N     . VAL B 1  170  ? -26.023 17.812  130.751 1.00 70.55  ? 170  VAL B N     1 
ATOM   3093  C  CA    . VAL B 1  170  ? -25.128 18.370  129.726 1.00 61.36  ? 170  VAL B CA    1 
ATOM   3094  C  C     . VAL B 1  170  ? -24.383 19.527  130.386 1.00 62.65  ? 170  VAL B C     1 
ATOM   3095  O  O     . VAL B 1  170  ? -24.715 20.703  130.231 1.00 68.69  ? 170  VAL B O     1 
ATOM   3096  C  CB    . VAL B 1  170  ? -25.888 18.803  128.466 1.00 70.78  ? 170  VAL B CB    1 
ATOM   3097  C  CG1   . VAL B 1  170  ? -24.907 19.084  127.336 1.00 77.14  ? 170  VAL B CG1   1 
ATOM   3098  C  CG2   . VAL B 1  170  ? -26.909 17.760  128.064 1.00 69.00  ? 170  VAL B CG2   1 
ATOM   3099  N  N     . PHE B 1  171  ? -23.320 19.182  131.110 1.00 60.94  ? 171  PHE B N     1 
ATOM   3100  C  CA    . PHE B 1  171  ? -22.564 20.201  131.831 1.00 70.48  ? 171  PHE B CA    1 
ATOM   3101  C  C     . PHE B 1  171  ? -21.801 21.112  130.880 1.00 78.14  ? 171  PHE B C     1 
ATOM   3102  O  O     . PHE B 1  171  ? -21.829 22.338  131.038 1.00 80.99  ? 171  PHE B O     1 
ATOM   3103  C  CB    . PHE B 1  171  ? -21.595 19.548  132.823 1.00 74.98  ? 171  PHE B CB    1 
ATOM   3104  C  CG    . PHE B 1  171  ? -22.269 18.999  134.050 1.00 84.89  ? 171  PHE B CG    1 
ATOM   3105  C  CD1   . PHE B 1  171  ? -22.946 19.841  134.917 1.00 79.28  ? 171  PHE B CD1   1 
ATOM   3106  C  CD2   . PHE B 1  171  ? -22.234 17.643  134.332 1.00 83.72  ? 171  PHE B CD2   1 
ATOM   3107  C  CE1   . PHE B 1  171  ? -23.569 19.346  136.035 1.00 83.33  ? 171  PHE B CE1   1 
ATOM   3108  C  CE2   . PHE B 1  171  ? -22.859 17.139  135.451 1.00 84.14  ? 171  PHE B CE2   1 
ATOM   3109  C  CZ    . PHE B 1  171  ? -23.529 17.991  136.306 1.00 79.95  ? 171  PHE B CZ    1 
ATOM   3110  N  N     . SER B 1  172  ? -21.129 20.532  129.881 1.00 78.48  ? 172  SER B N     1 
ATOM   3111  C  CA    . SER B 1  172  ? -20.108 21.249  129.126 1.00 74.21  ? 172  SER B CA    1 
ATOM   3112  C  C     . SER B 1  172  ? -20.676 22.509  128.474 1.00 79.30  ? 172  SER B C     1 
ATOM   3113  O  O     . SER B 1  172  ? -21.713 22.442  127.794 1.00 79.62  ? 172  SER B O     1 
ATOM   3114  C  CB    . SER B 1  172  ? -19.503 20.336  128.060 1.00 80.64  ? 172  SER B CB    1 
ATOM   3115  O  OG    . SER B 1  172  ? -18.559 21.033  127.256 1.00 77.80  ? 172  SER B OG    1 
ATOM   3116  N  N     . PRO B 1  173  ? -20.042 23.669  128.666 1.00 79.72  ? 173  PRO B N     1 
ATOM   3117  C  CA    . PRO B 1  173  ? -20.397 24.837  127.852 1.00 81.78  ? 173  PRO B CA    1 
ATOM   3118  C  C     . PRO B 1  173  ? -19.970 24.686  126.411 1.00 84.97  ? 173  PRO B C     1 
ATOM   3119  O  O     . PRO B 1  173  ? -20.475 25.416  125.551 1.00 87.60  ? 173  PRO B O     1 
ATOM   3120  C  CB    . PRO B 1  173  ? -19.641 25.981  128.534 1.00 81.78  ? 173  PRO B CB    1 
ATOM   3121  C  CG    . PRO B 1  173  ? -18.422 25.312  129.095 1.00 75.78  ? 173  PRO B CG    1 
ATOM   3122  C  CD    . PRO B 1  173  ? -18.872 23.929  129.525 1.00 77.25  ? 173  PRO B CD    1 
ATOM   3123  N  N     . VAL B 1  174  ? -19.051 23.766  126.130 1.00 83.93  ? 174  VAL B N     1 
ATOM   3124  C  CA    . VAL B 1  174  ? -18.572 23.503  124.779 1.00 83.41  ? 174  VAL B CA    1 
ATOM   3125  C  C     . VAL B 1  174  ? -19.541 22.543  124.101 1.00 86.11  ? 174  VAL B C     1 
ATOM   3126  O  O     . VAL B 1  174  ? -19.794 21.445  124.611 1.00 89.30  ? 174  VAL B O     1 
ATOM   3127  C  CB    . VAL B 1  174  ? -17.155 22.916  124.807 1.00 79.79  ? 174  VAL B CB    1 
ATOM   3128  C  CG1   . VAL B 1  174  ? -16.780 22.402  123.436 1.00 85.28  ? 174  VAL B CG1   1 
ATOM   3129  C  CG2   . VAL B 1  174  ? -16.148 23.947  125.299 1.00 75.63  ? 174  VAL B CG2   1 
ATOM   3130  N  N     . ARG B 1  175  ? -20.085 22.951  122.953 1.00 82.85  ? 175  ARG B N     1 
ATOM   3131  C  CA    . ARG B 1  175  ? -20.967 22.076  122.189 1.00 87.10  ? 175  ARG B CA    1 
ATOM   3132  C  C     . ARG B 1  175  ? -20.217 21.228  121.169 1.00 86.51  ? 175  ARG B C     1 
ATOM   3133  O  O     . ARG B 1  175  ? -20.627 20.093  120.897 1.00 78.78  ? 175  ARG B O     1 
ATOM   3134  C  CB    . ARG B 1  175  ? -22.046 22.895  121.475 1.00 90.79  ? 175  ARG B CB    1 
ATOM   3135  C  CG    . ARG B 1  175  ? -22.934 23.706  122.404 1.00 89.84  ? 175  ARG B CG    1 
ATOM   3136  C  CD    . ARG B 1  175  ? -24.269 24.017  121.746 1.00 93.46  ? 175  ARG B CD    1 
ATOM   3137  N  NE    . ARG B 1  175  ? -25.177 24.699  122.665 1.00 104.24 ? 175  ARG B NE    1 
ATOM   3138  C  CZ    . ARG B 1  175  ? -25.827 24.097  123.661 1.00 110.53 ? 175  ARG B CZ    1 
ATOM   3139  N  NH1   . ARG B 1  175  ? -25.669 22.795  123.876 1.00 107.04 ? 175  ARG B NH1   1 
ATOM   3140  N  NH2   . ARG B 1  175  ? -26.634 24.798  124.450 1.00 104.20 ? 175  ARG B NH2   1 
ATOM   3141  N  N     . ARG B 1  176  ? -19.136 21.754  120.594 1.00 87.39  ? 176  ARG B N     1 
ATOM   3142  C  CA    . ARG B 1  176  ? -18.334 20.997  119.645 1.00 81.80  ? 176  ARG B CA    1 
ATOM   3143  C  C     . ARG B 1  176  ? -16.941 21.603  119.543 1.00 80.01  ? 176  ARG B C     1 
ATOM   3144  O  O     . ARG B 1  176  ? -16.774 22.826  119.623 1.00 82.42  ? 176  ARG B O     1 
ATOM   3145  C  CB    . ARG B 1  176  ? -18.989 20.960  118.256 1.00 84.20  ? 176  ARG B CB    1 
ATOM   3146  C  CG    . ARG B 1  176  ? -18.101 20.358  117.168 1.00 89.35  ? 176  ARG B CG    1 
ATOM   3147  C  CD    . ARG B 1  176  ? -18.911 19.762  116.039 1.00 85.64  ? 176  ARG B CD    1 
ATOM   3148  N  NE    . ARG B 1  176  ? -19.614 20.774  115.263 1.00 82.01  ? 176  ARG B NE    1 
ATOM   3149  C  CZ    . ARG B 1  176  ? -19.519 20.902  113.944 1.00 84.56  ? 176  ARG B CZ    1 
ATOM   3150  N  NH1   . ARG B 1  176  ? -18.749 20.078  113.241 1.00 81.21  ? 176  ARG B NH1   1 
ATOM   3151  N  NH2   . ARG B 1  176  ? -20.203 21.854  113.329 1.00 87.18  ? 176  ARG B NH2   1 
ATOM   3152  N  N     . VAL B 1  177  ? -15.951 20.730  119.379 1.00 77.13  ? 177  VAL B N     1 
ATOM   3153  C  CA    . VAL B 1  177  ? -14.590 21.109  119.026 1.00 80.06  ? 177  VAL B CA    1 
ATOM   3154  C  C     . VAL B 1  177  ? -14.231 20.420  117.718 1.00 82.58  ? 177  VAL B C     1 
ATOM   3155  O  O     . VAL B 1  177  ? -14.627 19.274  117.475 1.00 84.16  ? 177  VAL B O     1 
ATOM   3156  C  CB    . VAL B 1  177  ? -13.578 20.732  120.128 1.00 81.96  ? 177  VAL B CB    1 
ATOM   3157  C  CG1   . VAL B 1  177  ? -12.159 21.145  119.727 1.00 82.58  ? 177  VAL B CG1   1 
ATOM   3158  C  CG2   . VAL B 1  177  ? -13.967 21.365  121.444 1.00 74.51  ? 177  VAL B CG2   1 
ATOM   3159  N  N     . ALA B 1  178  ? -13.489 21.123  116.874 1.00 86.13  ? 178  ALA B N     1 
ATOM   3160  C  CA    . ALA B 1  178  ? -12.948 20.534  115.659 1.00 75.60  ? 178  ALA B CA    1 
ATOM   3161  C  C     . ALA B 1  178  ? -11.566 21.116  115.432 1.00 75.91  ? 178  ALA B C     1 
ATOM   3162  O  O     . ALA B 1  178  ? -11.353 22.307  115.647 1.00 81.39  ? 178  ALA B O     1 
ATOM   3163  C  CB    . ALA B 1  178  ? -13.848 20.808  114.448 1.00 70.34  ? 178  ALA B CB    1 
ATOM   3164  N  N     . PHE B 1  179  ? -10.616 20.287  115.024 1.00 76.04  ? 179  PHE B N     1 
ATOM   3165  C  CA    . PHE B 1  179  ? -9.316  20.838  114.675 1.00 83.72  ? 179  PHE B CA    1 
ATOM   3166  C  C     . PHE B 1  179  ? -8.762  20.133  113.447 1.00 78.15  ? 179  PHE B C     1 
ATOM   3167  O  O     . PHE B 1  179  ? -9.000  18.943  113.225 1.00 73.88  ? 179  PHE B O     1 
ATOM   3168  C  CB    . PHE B 1  179  ? -8.327  20.769  115.851 1.00 79.01  ? 179  PHE B CB    1 
ATOM   3169  C  CG    . PHE B 1  179  ? -7.759  19.407  116.107 1.00 77.32  ? 179  PHE B CG    1 
ATOM   3170  C  CD1   . PHE B 1  179  ? -8.433  18.501  116.905 1.00 71.45  ? 179  PHE B CD1   1 
ATOM   3171  C  CD2   . PHE B 1  179  ? -6.533  19.044  115.575 1.00 77.14  ? 179  PHE B CD2   1 
ATOM   3172  C  CE1   . PHE B 1  179  ? -7.904  17.250  117.159 1.00 74.67  ? 179  PHE B CE1   1 
ATOM   3173  C  CE2   . PHE B 1  179  ? -6.001  17.795  115.823 1.00 78.99  ? 179  PHE B CE2   1 
ATOM   3174  C  CZ    . PHE B 1  179  ? -6.689  16.896  116.618 1.00 76.48  ? 179  PHE B CZ    1 
ATOM   3175  N  N     . GLN B 1  180  ? -8.027  20.898  112.647 1.00 79.45  ? 180  GLN B N     1 
ATOM   3176  C  CA    . GLN B 1  180  ? -7.418  20.406  111.424 1.00 80.92  ? 180  GLN B CA    1 
ATOM   3177  C  C     . GLN B 1  180  ? -5.977  20.880  111.362 1.00 82.00  ? 180  GLN B C     1 
ATOM   3178  O  O     . GLN B 1  180  ? -5.677  22.038  111.673 1.00 83.22  ? 180  GLN B O     1 
ATOM   3179  C  CB    . GLN B 1  180  ? -8.180  20.888  110.187 1.00 77.71  ? 180  GLN B CB    1 
ATOM   3180  C  CG    . GLN B 1  180  ? -8.454  19.800  109.162 1.00 85.28  ? 180  GLN B CG    1 
ATOM   3181  C  CD    . GLN B 1  180  ? -8.954  20.364  107.835 1.00 104.81 ? 180  GLN B CD    1 
ATOM   3182  O  OE1   . GLN B 1  180  ? -8.670  21.516  107.492 1.00 105.90 ? 180  GLN B OE1   1 
ATOM   3183  N  NE2   . GLN B 1  180  ? -9.705  19.555  107.086 1.00 94.84  ? 180  GLN B NE2   1 
ATOM   3184  N  N     . VAL B 1  181  ? -5.083  19.981  110.962 1.00 86.58  ? 181  VAL B N     1 
ATOM   3185  C  CA    . VAL B 1  181  ? -3.670  20.298  110.796 1.00 86.28  ? 181  VAL B CA    1 
ATOM   3186  C  C     . VAL B 1  181  ? -3.342  20.277  109.310 1.00 84.00  ? 181  VAL B C     1 
ATOM   3187  O  O     . VAL B 1  181  ? -3.515  19.253  108.638 1.00 84.13  ? 181  VAL B O     1 
ATOM   3188  C  CB    . VAL B 1  181  ? -2.771  19.323  111.568 1.00 83.03  ? 181  VAL B CB    1 
ATOM   3189  C  CG1   . VAL B 1  181  ? -1.313  19.550  111.198 1.00 81.44  ? 181  VAL B CG1   1 
ATOM   3190  C  CG2   . VAL B 1  181  ? -2.980  19.497  113.056 1.00 80.78  ? 181  VAL B CG2   1 
ATOM   3191  N  N     . GLU B 1  182  ? -2.869  21.407  108.800 1.00 85.13  ? 182  GLU B N     1 
ATOM   3192  C  CA    . GLU B 1  182  ? -2.427  21.519  107.423 1.00 80.51  ? 182  GLU B CA    1 
ATOM   3193  C  C     . GLU B 1  182  ? -0.916  21.684  107.397 1.00 89.37  ? 182  GLU B C     1 
ATOM   3194  O  O     . GLU B 1  182  ? -0.309  22.134  108.372 1.00 87.86  ? 182  GLU B O     1 
ATOM   3195  C  CB    . GLU B 1  182  ? -3.089  22.705  106.723 1.00 77.26  ? 182  GLU B CB    1 
ATOM   3196  C  CG    . GLU B 1  182  ? -4.601  22.639  106.683 1.00 85.60  ? 182  GLU B CG    1 
ATOM   3197  C  CD    . GLU B 1  182  ? -5.208  23.980  106.341 1.00 96.23  ? 182  GLU B CD    1 
ATOM   3198  O  OE1   . GLU B 1  182  ? -6.331  24.274  106.806 1.00 99.41  ? 182  GLU B OE1   1 
ATOM   3199  O  OE2   . GLU B 1  182  ? -4.545  24.751  105.618 1.00 95.71  ? 182  GLU B OE2   1 
ATOM   3200  N  N     . ASP B 1  183  ? -0.306  21.292  106.286 1.00 94.79  ? 183  ASP B N     1 
ATOM   3201  C  CA    . ASP B 1  183  ? 1.122   21.499  106.137 1.00 88.56  ? 183  ASP B CA    1 
ATOM   3202  C  C     . ASP B 1  183  ? 1.398   22.947  105.747 1.00 89.12  ? 183  ASP B C     1 
ATOM   3203  O  O     . ASP B 1  183  ? 0.560   23.626  105.145 1.00 88.43  ? 183  ASP B O     1 
ATOM   3204  C  CB    . ASP B 1  183  ? 1.709   20.533  105.107 1.00 101.22 ? 183  ASP B CB    1 
ATOM   3205  C  CG    . ASP B 1  183  ? 1.709   19.091  105.596 1.00 103.96 ? 183  ASP B CG    1 
ATOM   3206  O  OD1   . ASP B 1  183  ? 2.683   18.682  106.265 1.00 108.44 ? 183  ASP B OD1   1 
ATOM   3207  O  OD2   . ASP B 1  183  ? 0.728   18.370  105.320 1.00 104.39 ? 183  ASP B OD2   1 
ATOM   3208  N  N     . THR B 1  184  ? 2.578   23.424  106.127 1.00 85.79  ? 184  THR B N     1 
ATOM   3209  C  CA    . THR B 1  184  ? 2.960   24.805  105.890 1.00 91.47  ? 184  THR B CA    1 
ATOM   3210  C  C     . THR B 1  184  ? 4.480   24.869  105.875 1.00 98.22  ? 184  THR B C     1 
ATOM   3211  O  O     . THR B 1  184  ? 5.168   23.986  106.413 1.00 97.50  ? 184  THR B O     1 
ATOM   3212  C  CB    . THR B 1  184  ? 2.365   25.746  106.949 1.00 90.10  ? 184  THR B CB    1 
ATOM   3213  O  OG1   . THR B 1  184  ? 2.271   27.076  106.423 1.00 94.47  ? 184  THR B OG1   1 
ATOM   3214  C  CG2   . THR B 1  184  ? 3.222   25.762  108.212 1.00 87.02  ? 184  THR B CG2   1 
ATOM   3215  N  N     . ARG B 1  185  ? 4.991   25.927  105.240 1.00 105.05 ? 185  ARG B N     1 
ATOM   3216  C  CA    . ARG B 1  185  ? 6.415   26.081  104.981 1.00 108.68 ? 185  ARG B CA    1 
ATOM   3217  C  C     . ARG B 1  185  ? 6.869   27.486  105.352 1.00 109.09 ? 185  ARG B C     1 
ATOM   3218  O  O     . ARG B 1  185  ? 6.183   28.472  105.056 1.00 108.51 ? 185  ARG B O     1 
ATOM   3219  C  CB    . ARG B 1  185  ? 6.751   25.784  103.507 1.00 104.57 ? 185  ARG B CB    1 
ATOM   3220  C  CG    . ARG B 1  185  ? 6.144   26.758  102.501 1.00 109.28 ? 185  ARG B CG    1 
ATOM   3221  C  CD    . ARG B 1  185  ? 6.657   26.490  101.089 1.00 120.20 ? 185  ARG B CD    1 
ATOM   3222  N  NE    . ARG B 1  185  ? 6.545   27.659  100.218 1.00 114.94 ? 185  ARG B NE    1 
ATOM   3223  C  CZ    . ARG B 1  185  ? 7.515   28.553  100.037 1.00 117.96 ? 185  ARG B CZ    1 
ATOM   3224  N  NH1   . ARG B 1  185  ? 8.678   28.417  100.668 1.00 112.93 ? 185  ARG B NH1   1 
ATOM   3225  N  NH2   . ARG B 1  185  ? 7.324   29.586  99.224  1.00 112.67 ? 185  ARG B NH2   1 
ATOM   3226  N  N     . LEU B 1  186  ? 8.017   27.566  106.019 1.00 108.03 ? 186  LEU B N     1 
ATOM   3227  C  CA    . LEU B 1  186  ? 8.715   28.820  106.280 1.00 109.18 ? 186  LEU B CA    1 
ATOM   3228  C  C     . LEU B 1  186  ? 10.086  28.695  105.633 1.00 113.23 ? 186  LEU B C     1 
ATOM   3229  O  O     . LEU B 1  186  ? 10.928  27.918  106.100 1.00 108.59 ? 186  LEU B O     1 
ATOM   3230  C  CB    . LEU B 1  186  ? 8.832   29.101  107.780 1.00 113.61 ? 186  LEU B CB    1 
ATOM   3231  C  CG    . LEU B 1  186  ? 9.666   30.323  108.190 1.00 115.36 ? 186  LEU B CG    1 
ATOM   3232  C  CD1   . LEU B 1  186  ? 8.886   31.624  108.004 1.00 113.51 ? 186  LEU B CD1   1 
ATOM   3233  C  CD2   . LEU B 1  186  ? 10.189  30.190  109.622 1.00 108.47 ? 186  LEU B CD2   1 
ATOM   3234  N  N     . GLY B 1  187  ? 10.302  29.447  104.559 1.00 113.66 ? 187  GLY B N     1 
ATOM   3235  C  CA    . GLY B 1  187  ? 11.535  29.316  103.802 1.00 111.09 ? 187  GLY B CA    1 
ATOM   3236  C  C     . GLY B 1  187  ? 11.636  27.933  103.189 1.00 111.70 ? 187  GLY B C     1 
ATOM   3237  O  O     . GLY B 1  187  ? 10.769  27.501  102.416 1.00 107.04 ? 187  GLY B O     1 
ATOM   3238  N  N     . GLN B 1  188  ? 12.706  27.219  103.538 1.00 112.43 ? 188  GLN B N     1 
ATOM   3239  C  CA    . GLN B 1  188  ? 12.940  25.867  103.050 1.00 116.88 ? 188  GLN B CA    1 
ATOM   3240  C  C     . GLN B 1  188  ? 12.615  24.796  104.088 1.00 119.42 ? 188  GLN B C     1 
ATOM   3241  O  O     . GLN B 1  188  ? 12.905  23.617  103.859 1.00 119.34 ? 188  GLN B O     1 
ATOM   3242  C  CB    . GLN B 1  188  ? 14.385  25.723  102.568 1.00 114.73 ? 188  GLN B CB    1 
ATOM   3243  C  CG    . GLN B 1  188  ? 14.478  25.086  101.197 1.00 111.02 ? 188  GLN B CG    1 
ATOM   3244  C  CD    . GLN B 1  188  ? 13.425  25.633  100.244 1.00 114.44 ? 188  GLN B CD    1 
ATOM   3245  O  OE1   . GLN B 1  188  ? 13.311  26.847  100.051 1.00 114.94 ? 188  GLN B OE1   1 
ATOM   3246  N  NE2   . GLN B 1  188  ? 12.638  24.738  99.655  1.00 108.93 ? 188  GLN B NE2   1 
ATOM   3247  N  N     . ARG B 1  189  ? 12.035  25.180  105.225 1.00 122.48 ? 189  ARG B N     1 
ATOM   3248  C  CA    . ARG B 1  189  ? 11.421  24.228  106.145 1.00 111.55 ? 189  ARG B CA    1 
ATOM   3249  C  C     . ARG B 1  189  ? 10.034  23.907  105.603 1.00 113.08 ? 189  ARG B C     1 
ATOM   3250  O  O     . ARG B 1  189  ? 9.176   24.790  105.520 1.00 109.94 ? 189  ARG B O     1 
ATOM   3251  C  CB    . ARG B 1  189  ? 11.343  24.811  107.552 1.00 109.74 ? 189  ARG B CB    1 
ATOM   3252  C  CG    . ARG B 1  189  ? 12.665  25.320  108.106 1.00 113.72 ? 189  ARG B CG    1 
ATOM   3253  C  CD    . ARG B 1  189  ? 13.463  24.211  108.775 1.00 117.81 ? 189  ARG B CD    1 
ATOM   3254  N  NE    . ARG B 1  189  ? 14.061  24.661  110.031 1.00 119.37 ? 189  ARG B NE    1 
ATOM   3255  C  CZ    . ARG B 1  189  ? 13.527  24.454  111.232 1.00 120.75 ? 189  ARG B CZ    1 
ATOM   3256  N  NH1   . ARG B 1  189  ? 14.139  24.900  112.321 1.00 117.71 ? 189  ARG B NH1   1 
ATOM   3257  N  NH2   . ARG B 1  189  ? 12.381  23.794  111.346 1.00 117.37 ? 189  ARG B NH2   1 
ATOM   3258  N  N     . THR B 1  190  ? 9.812   22.650  105.215 1.00 112.30 ? 190  THR B N     1 
ATOM   3259  C  CA    . THR B 1  190  ? 8.645   22.285  104.423 1.00 113.29 ? 190  THR B CA    1 
ATOM   3260  C  C     . THR B 1  190  ? 7.621   21.436  105.165 1.00 111.80 ? 190  THR B C     1 
ATOM   3261  O  O     . THR B 1  190  ? 6.478   21.328  104.705 1.00 108.52 ? 190  THR B O     1 
ATOM   3262  C  CB    . THR B 1  190  ? 9.100   21.531  103.169 1.00 111.35 ? 190  THR B CB    1 
ATOM   3263  O  OG1   . THR B 1  190  ? 9.558   20.224  103.538 1.00 110.74 ? 190  THR B OG1   1 
ATOM   3264  C  CG2   . THR B 1  190  ? 10.241  22.280  102.528 1.00 114.74 ? 190  THR B CG2   1 
ATOM   3265  N  N     . ASP B 1  191  ? 7.997   20.833  106.285 1.00 101.82 ? 191  ASP B N     1 
ATOM   3266  C  CA    . ASP B 1  191  ? 7.139   19.916  107.016 1.00 100.82 ? 191  ASP B CA    1 
ATOM   3267  C  C     . ASP B 1  191  ? 6.421   20.578  108.185 1.00 103.83 ? 191  ASP B C     1 
ATOM   3268  O  O     . ASP B 1  191  ? 5.893   19.872  109.052 1.00 91.01  ? 191  ASP B O     1 
ATOM   3269  C  CB    . ASP B 1  191  ? 7.972   18.729  107.511 1.00 107.66 ? 191  ASP B CB    1 
ATOM   3270  C  CG    . ASP B 1  191  ? 9.411   19.126  107.863 1.00 115.44 ? 191  ASP B CG    1 
ATOM   3271  O  OD1   . ASP B 1  191  ? 9.786   20.297  107.626 1.00 114.04 ? 191  ASP B OD1   1 
ATOM   3272  O  OD2   . ASP B 1  191  ? 10.171  18.268  108.373 1.00 112.41 ? 191  ASP B OD2   1 
ATOM   3273  N  N     . LEU B 1  192  ? 6.387   21.910  108.235 1.00 101.12 ? 192  LEU B N     1 
ATOM   3274  C  CA    . LEU B 1  192  ? 5.880   22.565  109.428 1.00 88.75  ? 192  LEU B CA    1 
ATOM   3275  C  C     . LEU B 1  192  ? 4.357   22.468  109.470 1.00 89.04  ? 192  LEU B C     1 
ATOM   3276  O  O     . LEU B 1  192  ? 3.702   22.220  108.458 1.00 94.20  ? 192  LEU B O     1 
ATOM   3277  C  CB    . LEU B 1  192  ? 6.357   24.017  109.476 1.00 90.00  ? 192  LEU B CB    1 
ATOM   3278  C  CG    . LEU B 1  192  ? 7.871   24.189  109.286 1.00 86.86  ? 192  LEU B CG    1 
ATOM   3279  C  CD1   . LEU B 1  192  ? 8.282   25.647  109.424 1.00 89.70  ? 192  LEU B CD1   1 
ATOM   3280  C  CD2   . LEU B 1  192  ? 8.665   23.312  110.249 1.00 85.97  ? 192  LEU B CD2   1 
ATOM   3281  N  N     . ASP B 1  193  ? 3.793   22.643  110.664 1.00 87.03  ? 193  ASP B N     1 
ATOM   3282  C  CA    . ASP B 1  193  ? 2.369   22.427  110.881 1.00 84.52  ? 193  ASP B CA    1 
ATOM   3283  C  C     . ASP B 1  193  ? 1.633   23.744  111.097 1.00 84.62  ? 193  ASP B C     1 
ATOM   3284  O  O     . ASP B 1  193  ? 2.165   24.690  111.686 1.00 85.31  ? 193  ASP B O     1 
ATOM   3285  C  CB    . ASP B 1  193  ? 2.122   21.501  112.078 1.00 83.28  ? 193  ASP B CB    1 
ATOM   3286  C  CG    . ASP B 1  193  ? 2.331   20.031  111.738 1.00 91.28  ? 193  ASP B CG    1 
ATOM   3287  O  OD1   . ASP B 1  193  ? 2.858   19.734  110.643 1.00 102.57 ? 193  ASP B OD1   1 
ATOM   3288  O  OD2   . ASP B 1  193  ? 1.959   19.166  112.561 1.00 87.36  ? 193  ASP B OD2   1 
ATOM   3289  N  N     . LYS B 1  194  ? 0.395   23.788  110.611 1.00 80.19  ? 194  LYS B N     1 
ATOM   3290  C  CA    . LYS B 1  194  ? -0.514  24.909  110.812 1.00 81.03  ? 194  LYS B CA    1 
ATOM   3291  C  C     . LYS B 1  194  ? -1.792  24.347  111.419 1.00 84.35  ? 194  LYS B C     1 
ATOM   3292  O  O     . LYS B 1  194  ? -2.504  23.574  110.767 1.00 85.88  ? 194  LYS B O     1 
ATOM   3293  C  CB    . LYS B 1  194  ? -0.801  25.633  109.494 1.00 79.91  ? 194  LYS B CB    1 
ATOM   3294  C  CG    . LYS B 1  194  ? -1.803  26.763  109.622 1.00 81.38  ? 194  LYS B CG    1 
ATOM   3295  C  CD    . LYS B 1  194  ? -2.574  26.976  108.339 1.00 78.55  ? 194  LYS B CD    1 
ATOM   3296  C  CE    . LYS B 1  194  ? -3.607  28.072  108.497 1.00 78.16  ? 194  LYS B CE    1 
ATOM   3297  N  NZ    . LYS B 1  194  ? -4.605  28.007  107.399 1.00 82.97  ? 194  LYS B NZ    1 
ATOM   3298  N  N     . LEU B 1  195  ? -2.080  24.732  112.662 1.00 86.25  ? 195  LEU B N     1 
ATOM   3299  C  CA    . LEU B 1  195  ? -3.182  24.175  113.437 1.00 85.12  ? 195  LEU B CA    1 
ATOM   3300  C  C     . LEU B 1  195  ? -4.359  25.146  113.440 1.00 82.19  ? 195  LEU B C     1 
ATOM   3301  O  O     . LEU B 1  195  ? -4.236  26.272  113.934 1.00 82.83  ? 195  LEU B O     1 
ATOM   3302  C  CB    . LEU B 1  195  ? -2.722  23.875  114.864 1.00 81.91  ? 195  LEU B CB    1 
ATOM   3303  C  CG    . LEU B 1  195  ? -3.772  23.630  115.947 1.00 73.80  ? 195  LEU B CG    1 
ATOM   3304  C  CD1   . LEU B 1  195  ? -4.515  22.331  115.715 1.00 75.67  ? 195  LEU B CD1   1 
ATOM   3305  C  CD2   . LEU B 1  195  ? -3.110  23.617  117.305 1.00 73.28  ? 195  LEU B CD2   1 
ATOM   3306  N  N     . THR B 1  196  ? -5.487  24.715  112.876 1.00 81.80  ? 196  THR B N     1 
ATOM   3307  C  CA    . THR B 1  196  ? -6.740  25.455  112.932 1.00 80.69  ? 196  THR B CA    1 
ATOM   3308  C  C     . THR B 1  196  ? -7.667  24.746  113.910 1.00 83.82  ? 196  THR B C     1 
ATOM   3309  O  O     . THR B 1  196  ? -7.770  23.514  113.891 1.00 83.39  ? 196  THR B O     1 
ATOM   3310  C  CB    . THR B 1  196  ? -7.388  25.560  111.546 1.00 86.43  ? 196  THR B CB    1 
ATOM   3311  O  OG1   . THR B 1  196  ? -6.648  26.482  110.734 1.00 88.77  ? 196  THR B OG1   1 
ATOM   3312  C  CG2   . THR B 1  196  ? -8.831  26.038  111.654 1.00 88.77  ? 196  THR B CG2   1 
ATOM   3313  N  N     . LEU B 1  197  ? -8.327  25.528  114.763 1.00 88.52  ? 197  LEU B N     1 
ATOM   3314  C  CA    . LEU B 1  197  ? -9.128  25.042  115.877 1.00 80.93  ? 197  LEU B CA    1 
ATOM   3315  C  C     . LEU B 1  197  ? -10.454 25.785  115.892 1.00 80.70  ? 197  LEU B C     1 
ATOM   3316  O  O     . LEU B 1  197  ? -10.492 26.997  115.689 1.00 84.29  ? 197  LEU B O     1 
ATOM   3317  C  CB    . LEU B 1  197  ? -8.386  25.249  117.190 1.00 71.88  ? 197  LEU B CB    1 
ATOM   3318  C  CG    . LEU B 1  197  ? -8.970  24.611  118.440 1.00 82.01  ? 197  LEU B CG    1 
ATOM   3319  C  CD1   . LEU B 1  197  ? -9.478  23.226  118.131 1.00 83.61  ? 197  LEU B CD1   1 
ATOM   3320  C  CD2   . LEU B 1  197  ? -7.894  24.557  119.501 1.00 81.18  ? 197  LEU B CD2   1 
ATOM   3321  N  N     . ARG B 1  198  ? -11.540 25.060  116.124 1.00 78.65  ? 198  ARG B N     1 
ATOM   3322  C  CA    . ARG B 1  198  ? -12.885 25.596  115.988 1.00 84.46  ? 198  ARG B CA    1 
ATOM   3323  C  C     . ARG B 1  198  ? -13.695 25.183  117.204 1.00 85.36  ? 198  ARG B C     1 
ATOM   3324  O  O     . ARG B 1  198  ? -13.794 23.989  117.511 1.00 87.33  ? 198  ARG B O     1 
ATOM   3325  C  CB    . ARG B 1  198  ? -13.551 25.090  114.704 1.00 85.37  ? 198  ARG B CB    1 
ATOM   3326  C  CG    . ARG B 1  198  ? -12.785 25.415  113.424 1.00 87.49  ? 198  ARG B CG    1 
ATOM   3327  C  CD    . ARG B 1  198  ? -13.244 24.537  112.254 1.00 84.61  ? 198  ARG B CD    1 
ATOM   3328  N  NE    . ARG B 1  198  ? -14.592 24.867  111.793 1.00 83.50  ? 198  ARG B NE    1 
ATOM   3329  C  CZ    . ARG B 1  198  ? -15.376 24.031  111.115 1.00 86.11  ? 198  ARG B CZ    1 
ATOM   3330  N  NH1   . ARG B 1  198  ? -16.590 24.416  110.728 1.00 75.12  ? 198  ARG B NH1   1 
ATOM   3331  N  NH2   . ARG B 1  198  ? -14.951 22.804  110.832 1.00 78.58  ? 198  ARG B NH2   1 
ATOM   3332  N  N     . ILE B 1  199  ? -14.266 26.167  117.894 1.00 87.16  ? 199  ILE B N     1 
ATOM   3333  C  CA    . ILE B 1  199  ? -14.942 25.931  119.164 1.00 82.57  ? 199  ILE B CA    1 
ATOM   3334  C  C     . ILE B 1  199  ? -16.335 26.543  119.121 1.00 82.37  ? 199  ILE B C     1 
ATOM   3335  O  O     . ILE B 1  199  ? -16.490 27.736  118.823 1.00 85.63  ? 199  ILE B O     1 
ATOM   3336  C  CB    . ILE B 1  199  ? -14.140 26.496  120.348 1.00 75.41  ? 199  ILE B CB    1 
ATOM   3337  C  CG1   . ILE B 1  199  ? -12.710 25.954  120.318 1.00 76.73  ? 199  ILE B CG1   1 
ATOM   3338  C  CG2   . ILE B 1  199  ? -14.813 26.131  121.647 1.00 84.65  ? 199  ILE B CG2   1 
ATOM   3339  C  CD1   . ILE B 1  199  ? -11.885 26.345  121.503 1.00 78.19  ? 199  ILE B CD1   1 
ATOM   3340  N  N     . TRP B 1  200  ? -17.341 25.721  119.413 1.00 79.13  ? 200  TRP B N     1 
ATOM   3341  C  CA    . TRP B 1  200  ? -18.718 26.158  119.582 1.00 83.68  ? 200  TRP B CA    1 
ATOM   3342  C  C     . TRP B 1  200  ? -19.084 26.070  121.060 1.00 93.47  ? 200  TRP B C     1 
ATOM   3343  O  O     . TRP B 1  200  ? -18.764 25.079  121.727 1.00 91.80  ? 200  TRP B O     1 
ATOM   3344  C  CB    . TRP B 1  200  ? -19.687 25.284  118.775 1.00 87.05  ? 200  TRP B CB    1 
ATOM   3345  C  CG    . TRP B 1  200  ? -19.529 25.312  117.276 1.00 90.34  ? 200  TRP B CG    1 
ATOM   3346  C  CD1   . TRP B 1  200  ? -20.342 25.944  116.381 1.00 90.61  ? 200  TRP B CD1   1 
ATOM   3347  C  CD2   . TRP B 1  200  ? -18.522 24.647  116.499 1.00 86.36  ? 200  TRP B CD2   1 
ATOM   3348  N  NE1   . TRP B 1  200  ? -19.897 25.729  115.100 1.00 83.56  ? 200  TRP B NE1   1 
ATOM   3349  C  CE2   . TRP B 1  200  ? -18.783 24.935  115.145 1.00 82.25  ? 200  TRP B CE2   1 
ATOM   3350  C  CE3   . TRP B 1  200  ? -17.422 23.845  116.817 1.00 87.35  ? 200  TRP B CE3   1 
ATOM   3351  C  CZ2   . TRP B 1  200  ? -17.985 24.450  114.113 1.00 84.48  ? 200  TRP B CZ2   1 
ATOM   3352  C  CZ3   . TRP B 1  200  ? -16.630 23.366  115.791 1.00 87.09  ? 200  TRP B CZ3   1 
ATOM   3353  C  CH2   . TRP B 1  200  ? -16.914 23.671  114.456 1.00 86.63  ? 200  TRP B CH2   1 
ATOM   3354  N  N     . THR B 1  201  ? -19.769 27.096  121.569 1.00 95.43  ? 201  THR B N     1 
ATOM   3355  C  CA    . THR B 1  201  ? -20.199 27.140  122.962 1.00 89.44  ? 201  THR B CA    1 
ATOM   3356  C  C     . THR B 1  201  ? -21.699 27.413  123.024 1.00 90.14  ? 201  THR B C     1 
ATOM   3357  O  O     . THR B 1  201  ? -22.368 27.562  121.998 1.00 93.30  ? 201  THR B O     1 
ATOM   3358  C  CB    . THR B 1  201  ? -19.423 28.200  123.751 1.00 90.76  ? 201  THR B CB    1 
ATOM   3359  O  OG1   . THR B 1  201  ? -19.619 29.484  123.151 1.00 99.68  ? 201  THR B OG1   1 
ATOM   3360  C  CG2   . THR B 1  201  ? -17.935 27.881  123.769 1.00 90.14  ? 201  THR B CG2   1 
ATOM   3361  N  N     . ASP B 1  202  ? -22.236 27.468  124.243 1.00 93.28  ? 202  ASP B N     1 
ATOM   3362  C  CA    . ASP B 1  202  ? -23.640 27.801  124.462 1.00 95.42  ? 202  ASP B CA    1 
ATOM   3363  C  C     . ASP B 1  202  ? -23.856 29.278  124.772 1.00 93.54  ? 202  ASP B C     1 
ATOM   3364  O  O     . ASP B 1  202  ? -25.005 29.714  124.885 1.00 92.71  ? 202  ASP B O     1 
ATOM   3365  C  CB    . ASP B 1  202  ? -24.237 26.931  125.587 1.00 91.30  ? 202  ASP B CB    1 
ATOM   3366  C  CG    . ASP B 1  202  ? -23.438 26.990  126.889 1.00 90.13  ? 202  ASP B CG    1 
ATOM   3367  O  OD1   . ASP B 1  202  ? -22.616 27.912  127.068 1.00 92.77  ? 202  ASP B OD1   1 
ATOM   3368  O  OD2   . ASP B 1  202  ? -23.634 26.098  127.742 1.00 84.53  ? 202  ASP B OD2   1 
ATOM   3369  N  N     . GLY B 1  203  ? -22.788 30.060  124.887 1.00 93.71  ? 203  GLY B N     1 
ATOM   3370  C  CA    . GLY B 1  203  ? -22.878 31.461  125.219 1.00 98.89  ? 203  GLY B CA    1 
ATOM   3371  C  C     . GLY B 1  203  ? -22.489 31.793  126.643 1.00 97.67  ? 203  GLY B C     1 
ATOM   3372  O  O     . GLY B 1  203  ? -22.126 32.942  126.919 1.00 93.60  ? 203  GLY B O     1 
ATOM   3373  N  N     . SER B 1  204  ? -22.563 30.817  127.552 1.00 97.42  ? 204  SER B N     1 
ATOM   3374  C  CA    . SER B 1  204  ? -22.131 31.034  128.928 1.00 94.87  ? 204  SER B CA    1 
ATOM   3375  C  C     . SER B 1  204  ? -20.639 31.340  128.984 1.00 94.78  ? 204  SER B C     1 
ATOM   3376  O  O     . SER B 1  204  ? -20.230 32.420  129.423 1.00 99.65  ? 204  SER B O     1 
ATOM   3377  C  CB    . SER B 1  204  ? -22.481 29.815  129.788 1.00 90.61  ? 204  SER B CB    1 
ATOM   3378  O  OG    . SER B 1  204  ? -22.003 28.614  129.210 1.00 95.02  ? 204  SER B OG    1 
ATOM   3379  N  N     . VAL B 1  205  ? -19.808 30.399  128.537 1.00 96.27  ? 205  VAL B N     1 
ATOM   3380  C  CA    . VAL B 1  205  ? -18.371 30.611  128.391 1.00 93.42  ? 205  VAL B CA    1 
ATOM   3381  C  C     . VAL B 1  205  ? -18.083 30.821  126.914 1.00 90.66  ? 205  VAL B C     1 
ATOM   3382  O  O     . VAL B 1  205  ? -18.722 30.201  126.057 1.00 93.38  ? 205  VAL B O     1 
ATOM   3383  C  CB    . VAL B 1  205  ? -17.568 29.420  128.949 1.00 88.13  ? 205  VAL B CB    1 
ATOM   3384  C  CG1   . VAL B 1  205  ? -16.129 29.818  129.193 1.00 85.77  ? 205  VAL B CG1   1 
ATOM   3385  C  CG2   . VAL B 1  205  ? -18.202 28.907  130.228 1.00 94.65  ? 205  VAL B CG2   1 
ATOM   3386  N  N     . THR B 1  206  ? -17.135 31.702  126.604 1.00 93.44  ? 206  THR B N     1 
ATOM   3387  C  CA    . THR B 1  206  ? -16.874 31.953  125.192 1.00 97.08  ? 206  THR B CA    1 
ATOM   3388  C  C     . THR B 1  206  ? -15.827 30.988  124.652 1.00 92.58  ? 206  THR B C     1 
ATOM   3389  O  O     . THR B 1  206  ? -15.103 30.343  125.419 1.00 90.27  ? 206  THR B O     1 
ATOM   3390  C  CB    . THR B 1  206  ? -16.401 33.391  124.982 1.00 92.88  ? 206  THR B CB    1 
ATOM   3391  O  OG1   . THR B 1  206  ? -15.068 33.541  125.485 1.00 92.61  ? 206  THR B OG1   1 
ATOM   3392  C  CG2   . THR B 1  206  ? -17.330 34.368  125.674 1.00 96.92  ? 206  THR B CG2   1 
ATOM   3393  N  N     . PRO B 1  207  ? -15.736 30.858  123.322 1.00 95.23  ? 207  PRO B N     1 
ATOM   3394  C  CA    . PRO B 1  207  ? -14.670 30.022  122.742 1.00 88.38  ? 207  PRO B CA    1 
ATOM   3395  C  C     . PRO B 1  207  ? -13.281 30.341  123.274 1.00 88.72  ? 207  PRO B C     1 
ATOM   3396  O  O     . PRO B 1  207  ? -12.554 29.433  123.708 1.00 86.08  ? 207  PRO B O     1 
ATOM   3397  C  CB    . PRO B 1  207  ? -14.797 30.318  121.242 1.00 93.10  ? 207  PRO B CB    1 
ATOM   3398  C  CG    . PRO B 1  207  ? -16.239 30.632  121.046 1.00 93.46  ? 207  PRO B CG    1 
ATOM   3399  C  CD    . PRO B 1  207  ? -16.692 31.324  122.298 1.00 99.14  ? 207  PRO B CD    1 
ATOM   3400  N  N     . LEU B 1  208  ? -12.893 31.619  123.260 1.00 88.25  ? 208  LEU B N     1 
ATOM   3401  C  CA    . LEU B 1  208  ? -11.558 31.990  123.718 1.00 89.43  ? 208  LEU B CA    1 
ATOM   3402  C  C     . LEU B 1  208  ? -11.380 31.701  125.207 1.00 87.56  ? 208  LEU B C     1 
ATOM   3403  O  O     . LEU B 1  208  ? -10.339 31.172  125.626 1.00 83.95  ? 208  LEU B O     1 
ATOM   3404  C  CB    . LEU B 1  208  ? -11.296 33.464  123.401 1.00 83.40  ? 208  LEU B CB    1 
ATOM   3405  C  CG    . LEU B 1  208  ? -9.976  34.067  123.885 1.00 82.52  ? 208  LEU B CG    1 
ATOM   3406  C  CD1   . LEU B 1  208  ? -8.805  33.202  123.466 1.00 84.98  ? 208  LEU B CD1   1 
ATOM   3407  C  CD2   . LEU B 1  208  ? -9.818  35.480  123.349 1.00 85.54  ? 208  LEU B CD2   1 
ATOM   3408  N  N     . GLU B 1  209  ? -12.381 32.045  126.022 1.00 85.15  ? 209  GLU B N     1 
ATOM   3409  C  CA    . GLU B 1  209  ? -12.335 31.692  127.437 1.00 89.50  ? 209  GLU B CA    1 
ATOM   3410  C  C     . GLU B 1  209  ? -12.177 30.187  127.619 1.00 87.57  ? 209  GLU B C     1 
ATOM   3411  O  O     . GLU B 1  209  ? -11.385 29.731  128.457 1.00 83.29  ? 209  GLU B O     1 
ATOM   3412  C  CB    . GLU B 1  209  ? -13.599 32.189  128.141 1.00 89.75  ? 209  GLU B CB    1 
ATOM   3413  C  CG    . GLU B 1  209  ? -13.653 33.698  128.355 1.00 95.09  ? 209  GLU B CG    1 
ATOM   3414  C  CD    . GLU B 1  209  ? -15.032 34.184  128.767 1.00 99.65  ? 209  GLU B CD    1 
ATOM   3415  O  OE1   . GLU B 1  209  ? -15.231 35.415  128.845 1.00 101.12 ? 209  GLU B OE1   1 
ATOM   3416  O  OE2   . GLU B 1  209  ? -15.918 33.335  129.005 1.00 104.89 ? 209  GLU B OE2   1 
ATOM   3417  N  N     . ALA B 1  210  ? -12.919 29.402  126.832 1.00 84.33  ? 210  ALA B N     1 
ATOM   3418  C  CA    . ALA B 1  210  ? -12.840 27.950  126.939 1.00 78.82  ? 210  ALA B CA    1 
ATOM   3419  C  C     . ALA B 1  210  ? -11.434 27.448  126.629 1.00 86.06  ? 210  ALA B C     1 
ATOM   3420  O  O     . ALA B 1  210  ? -10.891 26.601  127.354 1.00 85.40  ? 210  ALA B O     1 
ATOM   3421  C  CB    . ALA B 1  210  ? -13.865 27.306  126.008 1.00 73.21  ? 210  ALA B CB    1 
ATOM   3422  N  N     . LEU B 1  211  ? -10.820 27.972  125.564 1.00 80.17  ? 211  LEU B N     1 
ATOM   3423  C  CA    . LEU B 1  211  ? -9.483  27.517  125.200 1.00 80.36  ? 211  LEU B CA    1 
ATOM   3424  C  C     . LEU B 1  211  ? -8.453  27.920  126.252 1.00 80.21  ? 211  LEU B C     1 
ATOM   3425  O  O     . LEU B 1  211  ? -7.523  27.155  126.546 1.00 79.85  ? 211  LEU B O     1 
ATOM   3426  C  CB    . LEU B 1  211  ? -9.101  28.062  123.821 1.00 85.92  ? 211  LEU B CB    1 
ATOM   3427  C  CG    . LEU B 1  211  ? -7.697  27.734  123.294 1.00 79.40  ? 211  LEU B CG    1 
ATOM   3428  C  CD1   . LEU B 1  211  ? -7.424  26.234  123.323 1.00 74.32  ? 211  LEU B CD1   1 
ATOM   3429  C  CD2   . LEU B 1  211  ? -7.500  28.293  121.887 1.00 85.88  ? 211  LEU B CD2   1 
ATOM   3430  N  N     . ASN B 1  212  ? -8.598  29.114  126.830 1.00 81.75  ? 212  ASN B N     1 
ATOM   3431  C  CA    . ASN B 1  212  ? -7.661  29.529  127.871 1.00 82.01  ? 212  ASN B CA    1 
ATOM   3432  C  C     . ASN B 1  212  ? -7.780  28.639  129.103 1.00 80.02  ? 212  ASN B C     1 
ATOM   3433  O  O     . ASN B 1  212  ? -6.766  28.221  129.686 1.00 72.74  ? 212  ASN B O     1 
ATOM   3434  C  CB    . ASN B 1  212  ? -7.894  30.994  128.225 1.00 82.44  ? 212  ASN B CB    1 
ATOM   3435  C  CG    . ASN B 1  212  ? -7.442  31.927  127.126 1.00 84.70  ? 212  ASN B CG    1 
ATOM   3436  O  OD1   . ASN B 1  212  ? -6.411  31.698  126.491 1.00 90.23  ? 212  ASN B OD1   1 
ATOM   3437  N  ND2   . ASN B 1  212  ? -8.216  32.978  126.884 1.00 88.39  ? 212  ASN B ND2   1 
ATOM   3438  N  N     . GLN B 1  213  ? -9.013  28.324  129.502 1.00 72.02  ? 213  GLN B N     1 
ATOM   3439  C  CA    . GLN B 1  213  ? -9.202  27.384  130.598 1.00 79.57  ? 213  GLN B CA    1 
ATOM   3440  C  C     . GLN B 1  213  ? -8.569  26.039  130.273 1.00 79.01  ? 213  GLN B C     1 
ATOM   3441  O  O     . GLN B 1  213  ? -7.934  25.417  131.135 1.00 78.09  ? 213  GLN B O     1 
ATOM   3442  C  CB    . GLN B 1  213  ? -10.693 27.220  130.905 1.00 85.10  ? 213  GLN B CB    1 
ATOM   3443  C  CG    . GLN B 1  213  ? -11.353 28.469  131.488 1.00 83.05  ? 213  GLN B CG    1 
ATOM   3444  C  CD    . GLN B 1  213  ? -12.784 28.227  131.930 1.00 80.72  ? 213  GLN B CD    1 
ATOM   3445  O  OE1   . GLN B 1  213  ? -13.095 27.189  132.514 1.00 84.15  ? 213  GLN B OE1   1 
ATOM   3446  N  NE2   . GLN B 1  213  ? -13.665 29.185  131.651 1.00 78.34  ? 213  GLN B NE2   1 
ATOM   3447  N  N     . ALA B 1  214  ? -8.715  25.584  129.025 1.00 83.94  ? 214  ALA B N     1 
ATOM   3448  C  CA    . ALA B 1  214  ? -8.180  24.280  128.641 1.00 79.00  ? 214  ALA B CA    1 
ATOM   3449  C  C     . ALA B 1  214  ? -6.657  24.250  128.743 1.00 74.51  ? 214  ALA B C     1 
ATOM   3450  O  O     . ALA B 1  214  ? -6.076  23.326  129.336 1.00 75.90  ? 214  ALA B O     1 
ATOM   3451  C  CB    . ALA B 1  214  ? -8.637  23.931  127.228 1.00 75.91  ? 214  ALA B CB    1 
ATOM   3452  N  N     . VAL B 1  215  ? -5.989  25.253  128.165 1.00 72.96  ? 215  VAL B N     1 
ATOM   3453  C  CA    . VAL B 1  215  ? -4.527  25.272  128.221 1.00 79.36  ? 215  VAL B CA    1 
ATOM   3454  C  C     . VAL B 1  215  ? -4.045  25.410  129.661 1.00 81.60  ? 215  VAL B C     1 
ATOM   3455  O  O     . VAL B 1  215  ? -3.023  24.817  130.041 1.00 75.93  ? 215  VAL B O     1 
ATOM   3456  C  CB    . VAL B 1  215  ? -3.943  26.371  127.302 1.00 76.73  ? 215  VAL B CB    1 
ATOM   3457  C  CG1   . VAL B 1  215  ? -4.308  26.093  125.857 1.00 86.03  ? 215  VAL B CG1   1 
ATOM   3458  C  CG2   . VAL B 1  215  ? -4.428  27.748  127.689 1.00 85.40  ? 215  VAL B CG2   1 
ATOM   3459  N  N     . GLU B 1  216  ? -4.778  26.159  130.495 1.00 84.20  ? 216  GLU B N     1 
ATOM   3460  C  CA    . GLU B 1  216  ? -4.387  26.270  131.897 1.00 80.21  ? 216  GLU B CA    1 
ATOM   3461  C  C     . GLU B 1  216  ? -4.496  24.925  132.610 1.00 78.25  ? 216  GLU B C     1 
ATOM   3462  O  O     . GLU B 1  216  ? -3.591  24.539  133.365 1.00 80.65  ? 216  GLU B O     1 
ATOM   3463  C  CB    . GLU B 1  216  ? -5.241  27.327  132.591 1.00 83.22  ? 216  GLU B CB    1 
ATOM   3464  C  CG    . GLU B 1  216  ? -5.037  27.425  134.094 1.00 92.42  ? 216  GLU B CG    1 
ATOM   3465  C  CD    . GLU B 1  216  ? -3.632  27.855  134.483 1.00 96.87  ? 216  GLU B CD    1 
ATOM   3466  O  OE1   . GLU B 1  216  ? -3.237  27.598  135.643 1.00 99.26  ? 216  GLU B OE1   1 
ATOM   3467  O  OE2   . GLU B 1  216  ? -2.926  28.447  133.639 1.00 91.29  ? 216  GLU B OE2   1 
ATOM   3468  N  N     . ILE B 1  217  ? -5.594  24.198  132.375 1.00 73.82  ? 217  ILE B N     1 
ATOM   3469  C  CA    . ILE B 1  217  ? -5.746  22.852  132.929 1.00 70.05  ? 217  ILE B CA    1 
ATOM   3470  C  C     . ILE B 1  217  ? -4.553  21.989  132.553 1.00 78.57  ? 217  ILE B C     1 
ATOM   3471  O  O     . ILE B 1  217  ? -3.963  21.294  133.396 1.00 77.10  ? 217  ILE B O     1 
ATOM   3472  C  CB    . ILE B 1  217  ? -7.060  22.220  132.435 1.00 70.01  ? 217  ILE B CB    1 
ATOM   3473  C  CG1   . ILE B 1  217  ? -8.263  22.930  133.062 1.00 66.30  ? 217  ILE B CG1   1 
ATOM   3474  C  CG2   . ILE B 1  217  ? -7.068  20.711  132.697 1.00 65.70  ? 217  ILE B CG2   1 
ATOM   3475  C  CD1   . ILE B 1  217  ? -9.555  22.730  132.312 1.00 64.60  ? 217  ILE B CD1   1 
ATOM   3476  N  N     . LEU B 1  218  ? -4.179  22.031  131.269 1.00 80.02  ? 218  LEU B N     1 
ATOM   3477  C  CA    . LEU B 1  218  ? -3.109  21.167  130.780 1.00 71.54  ? 218  LEU B CA    1 
ATOM   3478  C  C     . LEU B 1  218  ? -1.771  21.523  131.423 1.00 73.78  ? 218  LEU B C     1 
ATOM   3479  O  O     . LEU B 1  218  ? -1.023  20.634  131.854 1.00 70.96  ? 218  LEU B O     1 
ATOM   3480  C  CB    . LEU B 1  218  ? -3.030  21.251  129.255 1.00 79.46  ? 218  LEU B CB    1 
ATOM   3481  C  CG    . LEU B 1  218  ? -2.015  20.353  128.536 1.00 73.09  ? 218  LEU B CG    1 
ATOM   3482  C  CD1   . LEU B 1  218  ? -2.238  18.884  128.876 1.00 73.91  ? 218  LEU B CD1   1 
ATOM   3483  C  CD2   . LEU B 1  218  ? -2.105  20.569  127.043 1.00 64.81  ? 218  LEU B CD2   1 
ATOM   3484  N  N     . ARG B 1  219  ? -1.446  22.818  131.490 1.00 69.84  ? 219  ARG B N     1 
ATOM   3485  C  CA    . ARG B 1  219  ? -0.198  23.228  132.133 1.00 79.11  ? 219  ARG B CA    1 
ATOM   3486  C  C     . ARG B 1  219  ? -0.162  22.793  133.593 1.00 83.84  ? 219  ARG B C     1 
ATOM   3487  O  O     . ARG B 1  219  ? 0.867   22.300  134.091 1.00 79.40  ? 219  ARG B O     1 
ATOM   3488  C  CB    . ARG B 1  219  ? -0.026  24.742  132.032 1.00 78.08  ? 219  ARG B CB    1 
ATOM   3489  C  CG    . ARG B 1  219  ? 1.226   25.257  132.728 1.00 85.79  ? 219  ARG B CG    1 
ATOM   3490  C  CD    . ARG B 1  219  ? 1.071   26.710  133.127 1.00 90.53  ? 219  ARG B CD    1 
ATOM   3491  N  NE    . ARG B 1  219  ? -0.063  26.894  134.029 1.00 89.40  ? 219  ARG B NE    1 
ATOM   3492  C  CZ    . ARG B 1  219  ? 0.002   26.740  135.347 1.00 92.35  ? 219  ARG B CZ    1 
ATOM   3493  N  NH1   . ARG B 1  219  ? 1.149   26.400  135.918 1.00 89.97  ? 219  ARG B NH1   1 
ATOM   3494  N  NH2   . ARG B 1  219  ? -1.078  26.922  136.096 1.00 92.97  ? 219  ARG B NH2   1 
ATOM   3495  N  N     . GLU B 1  220  ? -1.279  22.979  134.298 1.00 82.69  ? 220  GLU B N     1 
ATOM   3496  C  CA    . GLU B 1  220  ? -1.357  22.556  135.688 1.00 85.49  ? 220  GLU B CA    1 
ATOM   3497  C  C     . GLU B 1  220  ? -1.050  21.070  135.819 1.00 85.35  ? 220  GLU B C     1 
ATOM   3498  O  O     . GLU B 1  220  ? -0.283  20.659  136.699 1.00 86.64  ? 220  GLU B O     1 
ATOM   3499  C  CB    . GLU B 1  220  ? -2.739  22.885  136.246 1.00 89.34  ? 220  GLU B CB    1 
ATOM   3500  C  CG    . GLU B 1  220  ? -2.888  22.636  137.730 1.00 93.98  ? 220  GLU B CG    1 
ATOM   3501  C  CD    . GLU B 1  220  ? -4.239  23.082  138.237 1.00 100.71 ? 220  GLU B CD    1 
ATOM   3502  O  OE1   . GLU B 1  220  ? -5.068  23.508  137.399 1.00 91.90  ? 220  GLU B OE1   1 
ATOM   3503  O  OE2   . GLU B 1  220  ? -4.467  23.011  139.467 1.00 102.99 ? 220  GLU B OE2   1 
ATOM   3504  N  N     . HIS B 1  221  ? -1.626  20.248  134.936 1.00 80.28  ? 221  HIS B N     1 
ATOM   3505  C  CA    . HIS B 1  221  ? -1.322  18.819  134.980 1.00 80.06  ? 221  HIS B CA    1 
ATOM   3506  C  C     . HIS B 1  221  ? 0.142   18.538  134.657 1.00 82.58  ? 221  HIS B C     1 
ATOM   3507  O  O     . HIS B 1  221  ? 0.722   17.590  135.197 1.00 76.99  ? 221  HIS B O     1 
ATOM   3508  C  CB    . HIS B 1  221  ? -2.219  18.052  134.018 1.00 76.36  ? 221  HIS B CB    1 
ATOM   3509  C  CG    . HIS B 1  221  ? -3.596  17.814  134.541 1.00 75.76  ? 221  HIS B CG    1 
ATOM   3510  N  ND1   . HIS B 1  221  ? -4.574  18.785  134.527 1.00 75.63  ? 221  HIS B ND1   1 
ATOM   3511  C  CD2   . HIS B 1  221  ? -4.161  16.715  135.097 1.00 78.02  ? 221  HIS B CD2   1 
ATOM   3512  C  CE1   . HIS B 1  221  ? -5.683  18.294  135.050 1.00 79.23  ? 221  HIS B CE1   1 
ATOM   3513  N  NE2   . HIS B 1  221  ? -5.459  17.041  135.405 1.00 80.22  ? 221  HIS B NE2   1 
ATOM   3514  N  N     . LEU B 1  222  ? 0.749   19.334  133.768 1.00 84.34  ? 222  LEU B N     1 
ATOM   3515  C  CA    . LEU B 1  222  ? 2.173   19.166  133.482 1.00 83.41  ? 222  LEU B CA    1 
ATOM   3516  C  C     . LEU B 1  222  ? 3.018   19.414  134.724 1.00 84.39  ? 222  LEU B C     1 
ATOM   3517  O  O     . LEU B 1  222  ? 4.117   18.859  134.855 1.00 80.60  ? 222  LEU B O     1 
ATOM   3518  C  CB    . LEU B 1  222  ? 2.611   20.104  132.354 1.00 86.21  ? 222  LEU B CB    1 
ATOM   3519  C  CG    . LEU B 1  222  ? 2.113   19.806  130.933 1.00 80.27  ? 222  LEU B CG    1 
ATOM   3520  C  CD1   . LEU B 1  222  ? 2.554   20.903  129.979 1.00 70.11  ? 222  LEU B CD1   1 
ATOM   3521  C  CD2   . LEU B 1  222  ? 2.611   18.449  130.465 1.00 77.56  ? 222  LEU B CD2   1 
ATOM   3522  N  N     . THR B 1  223  ? 2.527   20.255  135.637 1.00 89.08  ? 223  THR B N     1 
ATOM   3523  C  CA    . THR B 1  223  ? 3.249   20.459  136.893 1.00 87.94  ? 223  THR B CA    1 
ATOM   3524  C  C     . THR B 1  223  ? 3.208   19.248  137.827 1.00 84.06  ? 223  THR B C     1 
ATOM   3525  O  O     . THR B 1  223  ? 3.983   19.210  138.788 1.00 83.58  ? 223  THR B O     1 
ATOM   3526  C  CB    . THR B 1  223  ? 2.699   21.666  137.641 1.00 84.63  ? 223  THR B CB    1 
ATOM   3527  O  OG1   . THR B 1  223  ? 1.344   21.403  138.021 1.00 81.07  ? 223  THR B OG1   1 
ATOM   3528  C  CG2   . THR B 1  223  ? 2.749   22.901  136.758 1.00 82.11  ? 223  THR B CG2   1 
ATOM   3529  N  N     . TYR B 1  224  ? 2.339   18.265  137.576 1.00 79.73  ? 224  TYR B N     1 
ATOM   3530  C  CA    . TYR B 1  224  ? 2.236   17.098  138.448 1.00 71.56  ? 224  TYR B CA    1 
ATOM   3531  C  C     . TYR B 1  224  ? 3.428   16.160  138.346 1.00 83.20  ? 224  TYR B C     1 
ATOM   3532  O  O     . TYR B 1  224  ? 3.457   15.156  139.065 1.00 81.72  ? 224  TYR B O     1 
ATOM   3533  C  CB    . TYR B 1  224  ? 0.960   16.313  138.140 1.00 75.51  ? 224  TYR B CB    1 
ATOM   3534  C  CG    . TYR B 1  224  ? -0.318  17.088  138.395 1.00 85.83  ? 224  TYR B CG    1 
ATOM   3535  C  CD1   . TYR B 1  224  ? -0.319  18.232  139.190 1.00 84.40  ? 224  TYR B CD1   1 
ATOM   3536  C  CD2   . TYR B 1  224  ? -1.523  16.677  137.839 1.00 86.62  ? 224  TYR B CD2   1 
ATOM   3537  C  CE1   . TYR B 1  224  ? -1.484  18.942  139.418 1.00 82.82  ? 224  TYR B CE1   1 
ATOM   3538  C  CE2   . TYR B 1  224  ? -2.693  17.377  138.069 1.00 84.10  ? 224  TYR B CE2   1 
ATOM   3539  C  CZ    . TYR B 1  224  ? -2.669  18.510  138.855 1.00 85.92  ? 224  TYR B CZ    1 
ATOM   3540  O  OH    . TYR B 1  224  ? -3.838  19.205  139.074 1.00 91.12  ? 224  TYR B OH    1 
ATOM   3541  N  N     . PHE B 1  225  ? 4.392   16.442  137.470 1.00 90.23  ? 225  PHE B N     1 
ATOM   3542  C  CA    . PHE B 1  225  ? 5.605   15.649  137.341 1.00 86.68  ? 225  PHE B CA    1 
ATOM   3543  C  C     . PHE B 1  225  ? 6.748   16.204  138.176 1.00 94.96  ? 225  PHE B C     1 
ATOM   3544  O  O     . PHE B 1  225  ? 7.918   15.969  137.846 1.00 94.73  ? 225  PHE B O     1 
ATOM   3545  C  CB    . PHE B 1  225  ? 6.014   15.558  135.871 1.00 87.50  ? 225  PHE B CB    1 
ATOM   3546  C  CG    . PHE B 1  225  ? 4.966   14.941  134.996 1.00 79.66  ? 225  PHE B CG    1 
ATOM   3547  C  CD1   . PHE B 1  225  ? 4.920   13.571  134.812 1.00 74.54  ? 225  PHE B CD1   1 
ATOM   3548  C  CD2   . PHE B 1  225  ? 4.019   15.728  134.368 1.00 80.70  ? 225  PHE B CD2   1 
ATOM   3549  C  CE1   . PHE B 1  225  ? 3.952   12.998  134.010 1.00 73.08  ? 225  PHE B CE1   1 
ATOM   3550  C  CE2   . PHE B 1  225  ? 3.047   15.161  133.563 1.00 82.04  ? 225  PHE B CE2   1 
ATOM   3551  C  CZ    . PHE B 1  225  ? 3.014   13.794  133.384 1.00 74.25  ? 225  PHE B CZ    1 
ATOM   3552  N  N     . SER B 1  226  ? 6.428   16.928  139.251 1.00 105.95 ? 226  SER B N     1 
ATOM   3553  C  CA    . SER B 1  226  ? 7.423   17.642  140.044 1.00 107.47 ? 226  SER B CA    1 
ATOM   3554  C  C     . SER B 1  226  ? 7.987   16.797  141.186 1.00 108.50 ? 226  SER B C     1 
ATOM   3555  O  O     . SER B 1  226  ? 9.199   16.568  141.257 1.00 104.36 ? 226  SER B O     1 
ATOM   3556  C  CB    . SER B 1  226  ? 6.811   18.933  140.599 1.00 109.35 ? 226  SER B CB    1 
ATOM   3557  O  OG    . SER B 1  226  ? 6.458   19.824  139.559 1.00 111.00 ? 226  SER B OG    1 
ATOM   3558  N  N     . ASN B 1  227  ? 7.127   16.335  142.090 1.00 103.76 ? 227  ASN B N     1 
ATOM   3559  C  CA    . ASN B 1  227  ? 7.570   15.896  143.414 1.00 106.78 ? 227  ASN B CA    1 
ATOM   3560  C  C     . ASN B 1  227  ? 7.253   14.431  143.683 1.00 107.91 ? 227  ASN B C     1 
ATOM   3561  O  O     . ASN B 1  227  ? 6.117   14.095  144.068 1.00 108.87 ? 227  ASN B O     1 
ATOM   3562  C  CB    . ASN B 1  227  ? 6.939   16.781  144.488 1.00 112.61 ? 227  ASN B CB    1 
ATOM   3563  C  CG    . ASN B 1  227  ? 7.536   16.548  145.853 1.00 118.27 ? 227  ASN B CG    1 
ATOM   3564  O  OD1   . ASN B 1  227  ? 6.994   15.789  146.660 1.00 118.06 ? 227  ASN B OD1   1 
ATOM   3565  N  ND2   . ASN B 1  227  ? 8.669   17.189  146.119 1.00 118.85 ? 227  ASN B ND2   1 
ATOM   3566  N  N     . PRO B 1  228  ? 8.222   13.520  143.512 1.00 106.45 ? 228  PRO B N     1 
ATOM   3567  C  CA    . PRO B 1  228  ? 8.067   12.121  143.933 1.00 101.30 ? 228  PRO B CA    1 
ATOM   3568  C  C     . PRO B 1  228  ? 7.902   11.979  145.449 1.00 94.33  ? 228  PRO B C     1 
ATOM   3569  O  O     . PRO B 1  228  ? 7.708   10.866  145.945 1.00 89.34  ? 228  PRO B O     1 
ATOM   3570  C  CB    . PRO B 1  228  ? 9.370   11.464  143.462 1.00 95.32  ? 228  PRO B CB    1 
ATOM   3571  C  CG    . PRO B 1  228  ? 9.884   12.366  142.378 1.00 87.98  ? 228  PRO B CG    1 
ATOM   3572  C  CD    . PRO B 1  228  ? 9.481   13.746  142.780 1.00 93.19  ? 228  PRO B CD    1 
ATOM   3573  N  N     . MET C 2  1    ? 19.194  -17.567 114.400 1.00 113.68 ? 1    MET C N     1 
ATOM   3574  C  CA    . MET C 2  1    ? 17.850  -17.867 114.884 1.00 114.64 ? 1    MET C CA    1 
ATOM   3575  C  C     . MET C 2  1    ? 17.386  -19.243 114.406 1.00 115.72 ? 1    MET C C     1 
ATOM   3576  O  O     . MET C 2  1    ? 17.660  -19.640 113.270 1.00 111.76 ? 1    MET C O     1 
ATOM   3577  C  CB    . MET C 2  1    ? 16.867  -16.782 114.434 1.00 112.90 ? 1    MET C CB    1 
ATOM   3578  C  CG    . MET C 2  1    ? 17.017  -16.358 112.976 1.00 113.45 ? 1    MET C CG    1 
ATOM   3579  S  SD    . MET C 2  1    ? 16.023  -14.895 112.592 1.00 132.36 ? 1    MET C SD    1 
ATOM   3580  C  CE    . MET C 2  1    ? 16.704  -13.688 113.730 1.00 119.48 ? 1    MET C CE    1 
ATOM   3581  N  N     . GLU C 2  2    ? 16.691  -19.961 115.290 1.00 109.38 ? 2    GLU C N     1 
ATOM   3582  C  CA    . GLU C 2  2    ? 16.233  -21.311 114.983 1.00 107.73 ? 2    GLU C CA    1 
ATOM   3583  C  C     . GLU C 2  2    ? 15.273  -21.300 113.797 1.00 103.14 ? 2    GLU C C     1 
ATOM   3584  O  O     . GLU C 2  2    ? 14.475  -20.374 113.631 1.00 100.47 ? 2    GLU C O     1 
ATOM   3585  C  CB    . GLU C 2  2    ? 15.555  -21.923 116.211 1.00 104.63 ? 2    GLU C CB    1 
ATOM   3586  C  CG    . GLU C 2  2    ? 15.005  -23.329 116.005 1.00 108.60 ? 2    GLU C CG    1 
ATOM   3587  C  CD    . GLU C 2  2    ? 14.158  -23.795 117.174 1.00 117.46 ? 2    GLU C CD    1 
ATOM   3588  O  OE1   . GLU C 2  2    ? 14.532  -24.793 117.827 1.00 130.11 ? 2    GLU C OE1   1 
ATOM   3589  O  OE2   . GLU C 2  2    ? 13.119  -23.156 117.444 1.00 115.13 ? 2    GLU C OE2   1 
ATOM   3590  N  N     . ILE C 2  3    ? 15.357  -22.334 112.963 1.00 92.46  ? 3    ILE C N     1 
ATOM   3591  C  CA    . ILE C 2  3    ? 14.515  -22.457 111.777 1.00 88.24  ? 3    ILE C CA    1 
ATOM   3592  C  C     . ILE C 2  3    ? 13.716  -23.746 111.882 1.00 86.70  ? 3    ILE C C     1 
ATOM   3593  O  O     . ILE C 2  3    ? 14.295  -24.839 111.909 1.00 92.26  ? 3    ILE C O     1 
ATOM   3594  C  CB    . ILE C 2  3    ? 15.341  -22.438 110.482 1.00 90.25  ? 3    ILE C CB    1 
ATOM   3595  C  CG1   . ILE C 2  3    ? 16.025  -21.081 110.301 1.00 88.44  ? 3    ILE C CG1   1 
ATOM   3596  C  CG2   . ILE C 2  3    ? 14.454  -22.770 109.291 1.00 80.45  ? 3    ILE C CG2   1 
ATOM   3597  C  CD1   . ILE C 2  3    ? 16.775  -20.946 108.998 1.00 86.59  ? 3    ILE C CD1   1 
ATOM   3598  N  N     . LYS C 2  4    ? 12.393  -23.620 111.926 1.00 82.19  ? 4    LYS C N     1 
ATOM   3599  C  CA    . LYS C 2  4    ? 11.484  -24.759 111.950 1.00 83.62  ? 4    LYS C CA    1 
ATOM   3600  C  C     . LYS C 2  4    ? 10.899  -24.965 110.561 1.00 82.76  ? 4    LYS C C     1 
ATOM   3601  O  O     . LYS C 2  4    ? 10.393  -24.017 109.956 1.00 87.35  ? 4    LYS C O     1 
ATOM   3602  C  CB    . LYS C 2  4    ? 10.357  -24.536 112.961 1.00 88.22  ? 4    LYS C CB    1 
ATOM   3603  C  CG    . LYS C 2  4    ? 9.318   -25.656 113.000 1.00 88.16  ? 4    LYS C CG    1 
ATOM   3604  C  CD    . LYS C 2  4    ? 8.233   -25.377 114.039 1.00 94.85  ? 4    LYS C CD    1 
ATOM   3605  C  CE    . LYS C 2  4    ? 7.501   -26.654 114.465 1.00 102.25 ? 4    LYS C CE    1 
ATOM   3606  N  NZ    . LYS C 2  4    ? 6.873   -27.382 113.322 1.00 97.39  ? 4    LYS C NZ    1 
ATOM   3607  N  N     . ARG C 2  5    ? 10.962  -26.193 110.057 1.00 81.34  ? 5    ARG C N     1 
ATOM   3608  C  CA    . ARG C 2  5    ? 10.387  -26.510 108.758 1.00 81.22  ? 5    ARG C CA    1 
ATOM   3609  C  C     . ARG C 2  5    ? 9.179   -27.418 108.921 1.00 80.18  ? 5    ARG C C     1 
ATOM   3610  O  O     . ARG C 2  5    ? 9.149   -28.281 109.802 1.00 86.42  ? 5    ARG C O     1 
ATOM   3611  C  CB    . ARG C 2  5    ? 11.416  -27.157 107.825 1.00 82.01  ? 5    ARG C CB    1 
ATOM   3612  C  CG    . ARG C 2  5    ? 11.924  -28.523 108.233 1.00 88.49  ? 5    ARG C CG    1 
ATOM   3613  C  CD    . ARG C 2  5    ? 13.198  -28.842 107.459 1.00 90.46  ? 5    ARG C CD    1 
ATOM   3614  N  NE    . ARG C 2  5    ? 13.004  -28.734 106.014 1.00 93.47  ? 5    ARG C NE    1 
ATOM   3615  C  CZ    . ARG C 2  5    ? 13.932  -28.299 105.163 1.00 97.75  ? 5    ARG C CZ    1 
ATOM   3616  N  NH1   . ARG C 2  5    ? 15.120  -27.912 105.614 1.00 94.63  ? 5    ARG C NH1   1 
ATOM   3617  N  NH2   . ARG C 2  5    ? 13.671  -28.235 103.861 1.00 90.72  ? 5    ARG C NH2   1 
ATOM   3618  N  N     . PHE C 2  6    ? 8.177   -27.201 108.075 1.00 78.14  ? 6    PHE C N     1 
ATOM   3619  C  CA    . PHE C 2  6    ? 6.957   -27.988 108.067 1.00 78.74  ? 6    PHE C CA    1 
ATOM   3620  C  C     . PHE C 2  6    ? 6.973   -28.958 106.885 1.00 88.80  ? 6    PHE C C     1 
ATOM   3621  O  O     . PHE C 2  6    ? 7.874   -28.941 106.037 1.00 88.52  ? 6    PHE C O     1 
ATOM   3622  C  CB    . PHE C 2  6    ? 5.721   -27.085 107.994 1.00 77.11  ? 6    PHE C CB    1 
ATOM   3623  C  CG    . PHE C 2  6    ? 5.637   -26.050 109.087 1.00 79.06  ? 6    PHE C CG    1 
ATOM   3624  C  CD1   . PHE C 2  6    ? 6.308   -24.841 108.976 1.00 75.47  ? 6    PHE C CD1   1 
ATOM   3625  C  CD2   . PHE C 2  6    ? 4.861   -26.273 110.211 1.00 79.70  ? 6    PHE C CD2   1 
ATOM   3626  C  CE1   . PHE C 2  6    ? 6.220   -23.884 109.971 1.00 77.42  ? 6    PHE C CE1   1 
ATOM   3627  C  CE2   . PHE C 2  6    ? 4.772   -25.321 111.209 1.00 77.50  ? 6    PHE C CE2   1 
ATOM   3628  C  CZ    . PHE C 2  6    ? 5.454   -24.124 111.088 1.00 77.26  ? 6    PHE C CZ    1 
ATOM   3629  N  N     . GLY C 2  7    ? 5.951   -29.812 106.828 1.00 92.40  ? 7    GLY C N     1 
ATOM   3630  C  CA    . GLY C 2  7    ? 5.763   -30.691 105.691 1.00 100.43 ? 7    GLY C CA    1 
ATOM   3631  C  C     . GLY C 2  7    ? 6.212   -32.123 105.896 1.00 105.73 ? 7    GLY C C     1 
ATOM   3632  O  O     . GLY C 2  7    ? 7.287   -32.379 106.449 1.00 106.48 ? 7    GLY C O     1 
ATOM   3633  N  N     . ARG C 2  8    ? 5.403   -33.067 105.421 1.00 106.31 ? 8    ARG C N     1 
ATOM   3634  C  CA    . ARG C 2  8    ? 5.663   -34.488 105.593 1.00 107.97 ? 8    ARG C CA    1 
ATOM   3635  C  C     . ARG C 2  8    ? 6.224   -35.155 104.345 1.00 111.94 ? 8    ARG C C     1 
ATOM   3636  O  O     . ARG C 2  8    ? 6.546   -36.346 104.394 1.00 121.61 ? 8    ARG C O     1 
ATOM   3637  C  CB    . ARG C 2  8    ? 4.380   -35.209 106.018 1.00 116.22 ? 8    ARG C CB    1 
ATOM   3638  C  CG    . ARG C 2  8    ? 3.622   -34.523 107.142 1.00 120.07 ? 8    ARG C CG    1 
ATOM   3639  C  CD    . ARG C 2  8    ? 2.535   -35.422 107.704 1.00 126.55 ? 8    ARG C CD    1 
ATOM   3640  N  NE    . ARG C 2  8    ? 1.867   -34.814 108.851 1.00 131.75 ? 8    ARG C NE    1 
ATOM   3641  C  CZ    . ARG C 2  8    ? 1.043   -35.464 109.667 1.00 134.03 ? 8    ARG C CZ    1 
ATOM   3642  N  NH1   . ARG C 2  8    ? 0.787   -36.751 109.467 1.00 128.86 ? 8    ARG C NH1   1 
ATOM   3643  N  NH2   . ARG C 2  8    ? 0.478   -34.829 110.687 1.00 134.92 ? 8    ARG C NH2   1 
ATOM   3644  N  N     . ILE C 2  9    ? 6.355   -34.434 103.235 1.00 113.20 ? 9    ILE C N     1 
ATOM   3645  C  CA    . ILE C 2  9    ? 6.796   -35.043 101.982 1.00 115.23 ? 9    ILE C CA    1 
ATOM   3646  C  C     . ILE C 2  9    ? 8.320   -35.102 101.959 1.00 116.30 ? 9    ILE C C     1 
ATOM   3647  O  O     . ILE C 2  9    ? 8.995   -34.069 102.037 1.00 112.25 ? 9    ILE C O     1 
ATOM   3648  C  CB    . ILE C 2  9    ? 6.250   -34.281 100.764 1.00 110.21 ? 9    ILE C CB    1 
ATOM   3649  C  CG1   . ILE C 2  9    ? 4.720   -34.382 100.706 1.00 103.67 ? 9    ILE C CG1   1 
ATOM   3650  C  CG2   . ILE C 2  9    ? 6.869   -34.822 99.478  1.00 110.54 ? 9    ILE C CG2   1 
ATOM   3651  C  CD1   . ILE C 2  9    ? 4.099   -33.811 99.441  1.00 93.32  ? 9    ILE C CD1   1 
ATOM   3652  N  N     . ARG C 2  10   ? 8.862   -36.315 101.857 1.00 117.85 ? 10   ARG C N     1 
ATOM   3653  C  CA    . ARG C 2  10   ? 10.300  -36.531 101.736 1.00 119.51 ? 10   ARG C CA    1 
ATOM   3654  C  C     . ARG C 2  10   ? 10.667  -36.633 100.257 1.00 111.91 ? 10   ARG C C     1 
ATOM   3655  O  O     . ARG C 2  10   ? 10.232  -37.561 99.566  1.00 109.54 ? 10   ARG C O     1 
ATOM   3656  C  CB    . ARG C 2  10   ? 10.719  -37.792 102.493 1.00 120.25 ? 10   ARG C CB    1 
ATOM   3657  C  CG    . ARG C 2  10   ? 12.126  -38.278 102.178 1.00 119.57 ? 10   ARG C CG    1 
ATOM   3658  C  CD    . ARG C 2  10   ? 12.363  -39.676 102.737 1.00 118.60 ? 10   ARG C CD    1 
ATOM   3659  N  NE    . ARG C 2  10   ? 11.372  -40.644 102.267 1.00 118.15 ? 10   ARG C NE    1 
ATOM   3660  C  CZ    . ARG C 2  10   ? 11.504  -41.387 101.169 1.00 123.04 ? 10   ARG C CZ    1 
ATOM   3661  N  NH1   . ARG C 2  10   ? 10.548  -42.243 100.826 1.00 117.46 ? 10   ARG C NH1   1 
ATOM   3662  N  NH2   . ARG C 2  10   ? 12.590  -41.275 100.413 1.00 119.86 ? 10   ARG C NH2   1 
ATOM   3663  N  N     . GLU C 2  11   ? 11.468  -35.683 99.777  1.00 111.56 ? 11   GLU C N     1 
ATOM   3664  C  CA    . GLU C 2  11   ? 11.742  -35.544 98.351  1.00 104.80 ? 11   GLU C CA    1 
ATOM   3665  C  C     . GLU C 2  11   ? 12.966  -36.367 97.977  1.00 95.55  ? 11   GLU C C     1 
ATOM   3666  O  O     . GLU C 2  11   ? 14.065  -36.137 98.492  1.00 91.48  ? 11   GLU C O     1 
ATOM   3667  C  CB    . GLU C 2  11   ? 11.920  -34.073 97.982  1.00 99.25  ? 11   GLU C CB    1 
ATOM   3668  C  CG    . GLU C 2  11   ? 10.580  -33.376 97.782  1.00 98.83  ? 11   GLU C CG    1 
ATOM   3669  C  CD    . GLU C 2  11   ? 10.632  -31.881 98.019  1.00 99.02  ? 11   GLU C CD    1 
ATOM   3670  O  OE1   . GLU C 2  11   ? 11.702  -31.367 98.421  1.00 98.85  ? 11   GLU C OE1   1 
ATOM   3671  O  OE2   . GLU C 2  11   ? 9.589   -31.225 97.804  1.00 97.96  ? 11   GLU C OE2   1 
ATOM   3672  N  N     . VAL C 2  12   ? 12.764  -37.310 97.059  1.00 93.62  ? 12   VAL C N     1 
ATOM   3673  C  CA    . VAL C 2  12   ? 13.759  -38.343 96.799  1.00 94.05  ? 12   VAL C CA    1 
ATOM   3674  C  C     . VAL C 2  12   ? 15.012  -37.756 96.165  1.00 90.12  ? 12   VAL C C     1 
ATOM   3675  O  O     . VAL C 2  12   ? 16.136  -38.132 96.521  1.00 95.04  ? 12   VAL C O     1 
ATOM   3676  C  CB    . VAL C 2  12   ? 13.137  -39.446 95.928  1.00 94.35  ? 12   VAL C CB    1 
ATOM   3677  C  CG1   . VAL C 2  12   ? 14.202  -40.422 95.458  1.00 103.16 ? 12   VAL C CG1   1 
ATOM   3678  C  CG2   . VAL C 2  12   ? 12.073  -40.162 96.718  1.00 102.59 ? 12   VAL C CG2   1 
ATOM   3679  N  N     . ILE C 2  13   ? 14.850  -36.838 95.218  1.00 90.61  ? 13   ILE C N     1 
ATOM   3680  C  CA    . ILE C 2  13   ? 15.993  -36.299 94.484  1.00 84.47  ? 13   ILE C CA    1 
ATOM   3681  C  C     . ILE C 2  13   ? 16.101  -34.797 94.718  1.00 80.43  ? 13   ILE C C     1 
ATOM   3682  O  O     . ILE C 2  13   ? 15.075  -34.117 94.855  1.00 82.15  ? 13   ILE C O     1 
ATOM   3683  C  CB    . ILE C 2  13   ? 15.886  -36.613 92.985  1.00 77.55  ? 13   ILE C CB    1 
ATOM   3684  C  CG1   . ILE C 2  13   ? 14.519  -36.191 92.442  1.00 78.54  ? 13   ILE C CG1   1 
ATOM   3685  C  CG2   . ILE C 2  13   ? 16.123  -38.089 92.740  1.00 80.14  ? 13   ILE C CG2   1 
ATOM   3686  C  CD1   . ILE C 2  13   ? 14.390  -36.361 90.937  1.00 73.53  ? 13   ILE C CD1   1 
ATOM   3687  N  N     . PRO C 2  14   ? 17.304  -34.240 94.778  1.00 79.41  ? 14   PRO C N     1 
ATOM   3688  C  CA    . PRO C 2  14   ? 17.443  -32.786 94.840  1.00 72.82  ? 14   PRO C CA    1 
ATOM   3689  C  C     . PRO C 2  14   ? 17.182  -32.175 93.470  1.00 78.50  ? 14   PRO C C     1 
ATOM   3690  O  O     . PRO C 2  14   ? 17.134  -32.863 92.448  1.00 81.61  ? 14   PRO C O     1 
ATOM   3691  C  CB    . PRO C 2  14   ? 18.900  -32.593 95.266  1.00 68.12  ? 14   PRO C CB    1 
ATOM   3692  C  CG    . PRO C 2  14   ? 19.595  -33.765 94.664  1.00 64.35  ? 14   PRO C CG    1 
ATOM   3693  C  CD    . PRO C 2  14   ? 18.614  -34.914 94.734  1.00 74.10  ? 14   PRO C CD    1 
ATOM   3694  N  N     . LEU C 2  15   ? 17.011  -30.861 93.466  1.00 76.42  ? 15   LEU C N     1 
ATOM   3695  C  CA    . LEU C 2  15   ? 16.867  -30.157 92.201  1.00 79.27  ? 15   LEU C CA    1 
ATOM   3696  C  C     . LEU C 2  15   ? 18.124  -30.338 91.353  1.00 69.81  ? 15   LEU C C     1 
ATOM   3697  O  O     . LEU C 2  15   ? 19.242  -30.278 91.880  1.00 66.84  ? 15   LEU C O     1 
ATOM   3698  C  CB    . LEU C 2  15   ? 16.609  -28.671 92.442  1.00 75.75  ? 15   LEU C CB    1 
ATOM   3699  C  CG    . LEU C 2  15   ? 15.201  -28.332 92.909  1.00 69.31  ? 15   LEU C CG    1 
ATOM   3700  C  CD1   . LEU C 2  15   ? 15.076  -26.841 93.106  1.00 65.15  ? 15   LEU C CD1   1 
ATOM   3701  C  CD2   . LEU C 2  15   ? 14.195  -28.833 91.886  1.00 70.66  ? 15   LEU C CD2   1 
ATOM   3702  N  N     . PRO C 2  16   ? 17.984  -30.561 90.049  1.00 69.98  ? 16   PRO C N     1 
ATOM   3703  C  CA    . PRO C 2  16   ? 19.162  -30.680 89.176  1.00 78.24  ? 16   PRO C CA    1 
ATOM   3704  C  C     . PRO C 2  16   ? 19.910  -29.361 89.105  1.00 75.16  ? 16   PRO C C     1 
ATOM   3705  O  O     . PRO C 2  16   ? 19.407  -28.334 89.587  1.00 71.15  ? 16   PRO C O     1 
ATOM   3706  C  CB    . PRO C 2  16   ? 18.556  -31.058 87.812  1.00 75.34  ? 16   PRO C CB    1 
ATOM   3707  C  CG    . PRO C 2  16   ? 17.162  -30.558 87.863  1.00 73.98  ? 16   PRO C CG    1 
ATOM   3708  C  CD    . PRO C 2  16   ? 16.723  -30.694 89.301  1.00 75.69  ? 16   PRO C CD    1 
ATOM   3709  N  N     . PRO C 2  17   ? 21.119  -29.343 88.543  1.00 75.46  ? 17   PRO C N     1 
ATOM   3710  C  CA    . PRO C 2  17   ? 21.818  -28.060 88.362  1.00 75.73  ? 17   PRO C CA    1 
ATOM   3711  C  C     . PRO C 2  17   ? 20.971  -27.133 87.507  1.00 75.83  ? 17   PRO C C     1 
ATOM   3712  O  O     . PRO C 2  17   ? 20.590  -27.470 86.384  1.00 78.80  ? 17   PRO C O     1 
ATOM   3713  C  CB    . PRO C 2  17   ? 23.120  -28.462 87.662  1.00 75.20  ? 17   PRO C CB    1 
ATOM   3714  C  CG    . PRO C 2  17   ? 23.306  -29.899 88.008  1.00 74.87  ? 17   PRO C CG    1 
ATOM   3715  C  CD    . PRO C 2  17   ? 21.927  -30.478 88.067  1.00 69.23  ? 17   PRO C CD    1 
ATOM   3716  N  N     . LEU C 2  18   ? 20.664  -25.956 88.051  1.00 76.28  ? 18   LEU C N     1 
ATOM   3717  C  CA    . LEU C 2  18   ? 19.589  -25.159 87.469  1.00 77.31  ? 18   LEU C CA    1 
ATOM   3718  C  C     . LEU C 2  18   ? 20.004  -24.470 86.169  1.00 74.45  ? 18   LEU C C     1 
ATOM   3719  O  O     . LEU C 2  18   ? 19.151  -24.246 85.304  1.00 72.79  ? 18   LEU C O     1 
ATOM   3720  C  CB    . LEU C 2  18   ? 19.066  -24.154 88.504  1.00 74.34  ? 18   LEU C CB    1 
ATOM   3721  C  CG    . LEU C 2  18   ? 18.230  -24.813 89.621  1.00 73.70  ? 18   LEU C CG    1 
ATOM   3722  C  CD1   . LEU C 2  18   ? 17.732  -23.814 90.663  1.00 59.67  ? 18   LEU C CD1   1 
ATOM   3723  C  CD2   . LEU C 2  18   ? 17.053  -25.599 89.041  1.00 67.87  ? 18   LEU C CD2   1 
ATOM   3724  N  N     . THR C 2  19   ? 21.288  -24.167 85.985  1.00 71.30  ? 19   THR C N     1 
ATOM   3725  C  CA    . THR C 2  19   ? 21.758  -23.604 84.724  1.00 71.11  ? 19   THR C CA    1 
ATOM   3726  C  C     . THR C 2  19   ? 22.192  -24.673 83.723  1.00 71.20  ? 19   THR C C     1 
ATOM   3727  O  O     . THR C 2  19   ? 22.763  -24.329 82.682  1.00 67.24  ? 19   THR C O     1 
ATOM   3728  C  CB    . THR C 2  19   ? 22.922  -22.630 84.959  1.00 74.59  ? 19   THR C CB    1 
ATOM   3729  O  OG1   . THR C 2  19   ? 24.130  -23.366 85.184  1.00 72.02  ? 19   THR C OG1   1 
ATOM   3730  C  CG2   . THR C 2  19   ? 22.652  -21.739 86.159  1.00 71.76  ? 19   THR C CG2   1 
ATOM   3731  N  N     . GLU C 2  20   ? 21.926  -25.955 84.005  1.00 70.95  ? 20   GLU C N     1 
ATOM   3732  C  CA    . GLU C 2  20   ? 22.466  -27.026 83.170  1.00 69.88  ? 20   GLU C CA    1 
ATOM   3733  C  C     . GLU C 2  20   ? 21.949  -26.952 81.740  1.00 67.79  ? 20   GLU C C     1 
ATOM   3734  O  O     . GLU C 2  20   ? 22.654  -27.360 80.807  1.00 73.48  ? 20   GLU C O     1 
ATOM   3735  C  CB    . GLU C 2  20   ? 22.142  -28.394 83.773  1.00 74.13  ? 20   GLU C CB    1 
ATOM   3736  C  CG    . GLU C 2  20   ? 20.712  -28.857 83.555  1.00 81.09  ? 20   GLU C CG    1 
ATOM   3737  C  CD    . GLU C 2  20   ? 20.501  -30.319 83.906  1.00 83.01  ? 20   GLU C CD    1 
ATOM   3738  O  OE1   . GLU C 2  20   ? 21.495  -31.073 83.966  1.00 83.69  ? 20   GLU C OE1   1 
ATOM   3739  O  OE2   . GLU C 2  20   ? 19.336  -30.713 84.122  1.00 80.15  ? 20   GLU C OE2   1 
ATOM   3740  N  N     . ILE C 2  21   ? 20.740  -26.419 81.548  1.00 62.83  ? 21   ILE C N     1 
ATOM   3741  C  CA    . ILE C 2  21   ? 20.177  -26.288 80.209  1.00 61.16  ? 21   ILE C CA    1 
ATOM   3742  C  C     . ILE C 2  21   ? 21.069  -25.421 79.331  1.00 65.38  ? 21   ILE C C     1 
ATOM   3743  O  O     . ILE C 2  21   ? 21.074  -25.567 78.105  1.00 64.20  ? 21   ILE C O     1 
ATOM   3744  C  CB    . ILE C 2  21   ? 18.744  -25.727 80.294  1.00 59.75  ? 21   ILE C CB    1 
ATOM   3745  C  CG1   . ILE C 2  21   ? 18.081  -25.723 78.918  1.00 57.19  ? 21   ILE C CG1   1 
ATOM   3746  C  CG2   . ILE C 2  21   ? 18.749  -24.328 80.893  1.00 58.75  ? 21   ILE C CG2   1 
ATOM   3747  C  CD1   . ILE C 2  21   ? 16.715  -25.084 78.903  1.00 58.27  ? 21   ILE C CD1   1 
ATOM   3748  N  N     . GLN C 2  22   ? 21.836  -24.510 79.934  1.00 67.50  ? 22   GLN C N     1 
ATOM   3749  C  CA    . GLN C 2  22   ? 22.800  -23.696 79.199  1.00 64.67  ? 22   GLN C CA    1 
ATOM   3750  C  C     . GLN C 2  22   ? 24.166  -24.379 79.120  1.00 68.82  ? 22   GLN C C     1 
ATOM   3751  O  O     . GLN C 2  22   ? 24.712  -24.578 78.025  1.00 67.82  ? 22   GLN C O     1 
ATOM   3752  C  CB    . GLN C 2  22   ? 22.935  -22.316 79.862  1.00 58.29  ? 22   GLN C CB    1 
ATOM   3753  C  CG    . GLN C 2  22   ? 21.680  -21.452 79.840  1.00 57.32  ? 22   GLN C CG    1 
ATOM   3754  C  CD    . GLN C 2  22   ? 21.548  -20.621 78.573  1.00 63.50  ? 22   GLN C CD    1 
ATOM   3755  O  OE1   . GLN C 2  22   ? 22.518  -20.030 78.090  1.00 65.83  ? 22   GLN C OE1   1 
ATOM   3756  N  NE2   . GLN C 2  22   ? 20.339  -20.569 78.029  1.00 62.02  ? 22   GLN C NE2   1 
ATOM   3757  N  N     . VAL C 2  23   ? 24.720  -24.742 80.283  1.00 65.98  ? 23   VAL C N     1 
ATOM   3758  C  CA    . VAL C 2  23   ? 26.106  -25.192 80.365  1.00 64.41  ? 23   VAL C CA    1 
ATOM   3759  C  C     . VAL C 2  23   ? 26.303  -26.488 79.585  1.00 69.21  ? 23   VAL C C     1 
ATOM   3760  O  O     . VAL C 2  23   ? 27.241  -26.615 78.787  1.00 67.56  ? 23   VAL C O     1 
ATOM   3761  C  CB    . VAL C 2  23   ? 26.528  -25.348 81.837  1.00 64.45  ? 23   VAL C CB    1 
ATOM   3762  C  CG1   . VAL C 2  23   ? 27.846  -26.097 81.934  1.00 74.42  ? 23   VAL C CG1   1 
ATOM   3763  C  CG2   . VAL C 2  23   ? 26.644  -23.992 82.501  1.00 62.74  ? 23   VAL C CG2   1 
ATOM   3764  N  N     . GLU C 2  24   ? 25.430  -27.478 79.814  1.00 69.93  ? 24   GLU C N     1 
ATOM   3765  C  CA    . GLU C 2  24   ? 25.589  -28.764 79.140  1.00 70.14  ? 24   GLU C CA    1 
ATOM   3766  C  C     . GLU C 2  24   ? 25.345  -28.634 77.644  1.00 69.30  ? 24   GLU C C     1 
ATOM   3767  O  O     . GLU C 2  24   ? 26.040  -29.263 76.840  1.00 71.75  ? 24   GLU C O     1 
ATOM   3768  C  CB    . GLU C 2  24   ? 24.648  -29.807 79.747  1.00 67.39  ? 24   GLU C CB    1 
ATOM   3769  C  CG    . GLU C 2  24   ? 25.119  -30.371 81.090  1.00 78.94  ? 24   GLU C CG    1 
ATOM   3770  C  CD    . GLU C 2  24   ? 26.542  -30.924 81.039  1.00 89.17  ? 24   GLU C CD    1 
ATOM   3771  O  OE1   . GLU C 2  24   ? 27.347  -30.596 81.941  1.00 86.67  ? 24   GLU C OE1   1 
ATOM   3772  O  OE2   . GLU C 2  24   ? 26.857  -31.681 80.093  1.00 85.54  ? 24   GLU C OE2   1 
ATOM   3773  N  N     . SER C 2  25   ? 24.360  -27.827 77.255  1.00 69.63  ? 25   SER C N     1 
ATOM   3774  C  CA    . SER C 2  25   ? 24.099  -27.596 75.840  1.00 63.81  ? 25   SER C CA    1 
ATOM   3775  C  C     . SER C 2  25   ? 25.338  -27.050 75.146  1.00 68.47  ? 25   SER C C     1 
ATOM   3776  O  O     . SER C 2  25   ? 25.751  -27.549 74.087  1.00 67.40  ? 25   SER C O     1 
ATOM   3777  C  CB    . SER C 2  25   ? 22.919  -26.634 75.685  1.00 61.65  ? 25   SER C CB    1 
ATOM   3778  O  OG    . SER C 2  25   ? 22.599  -26.418 74.327  1.00 66.80  ? 25   SER C OG    1 
ATOM   3779  N  N     . TYR C 2  26   ? 25.966  -26.034 75.743  1.00 63.46  ? 26   TYR C N     1 
ATOM   3780  C  CA    . TYR C 2  26   ? 27.113  -25.425 75.085  1.00 62.37  ? 26   TYR C CA    1 
ATOM   3781  C  C     . TYR C 2  26   ? 28.325  -26.357 75.103  1.00 71.42  ? 26   TYR C C     1 
ATOM   3782  O  O     . TYR C 2  26   ? 29.063  -26.449 74.109  1.00 68.53  ? 26   TYR C O     1 
ATOM   3783  C  CB    . TYR C 2  26   ? 27.436  -24.082 75.732  1.00 57.93  ? 26   TYR C CB    1 
ATOM   3784  C  CG    . TYR C 2  26   ? 28.052  -23.100 74.763  1.00 58.94  ? 26   TYR C CG    1 
ATOM   3785  C  CD1   . TYR C 2  26   ? 27.374  -22.721 73.614  1.00 55.54  ? 26   TYR C CD1   1 
ATOM   3786  C  CD2   . TYR C 2  26   ? 29.308  -22.555 74.994  1.00 62.16  ? 26   TYR C CD2   1 
ATOM   3787  C  CE1   . TYR C 2  26   ? 27.925  -21.826 72.722  1.00 59.95  ? 26   TYR C CE1   1 
ATOM   3788  C  CE2   . TYR C 2  26   ? 29.868  -21.657 74.106  1.00 60.69  ? 26   TYR C CE2   1 
ATOM   3789  C  CZ    . TYR C 2  26   ? 29.171  -21.299 72.970  1.00 64.13  ? 26   TYR C CZ    1 
ATOM   3790  O  OH    . TYR C 2  26   ? 29.716  -20.410 72.076  1.00 66.57  ? 26   TYR C OH    1 
ATOM   3791  N  N     . ARG C 2  27   ? 28.546  -27.061 76.218  1.00 70.87  ? 27   ARG C N     1 
ATOM   3792  C  CA    . ARG C 2  27   ? 29.628  -28.038 76.275  1.00 70.91  ? 27   ARG C CA    1 
ATOM   3793  C  C     . ARG C 2  27   ? 29.471  -29.088 75.184  1.00 68.60  ? 27   ARG C C     1 
ATOM   3794  O  O     . ARG C 2  27   ? 30.452  -29.486 74.546  1.00 77.41  ? 27   ARG C O     1 
ATOM   3795  C  CB    . ARG C 2  27   ? 29.660  -28.701 77.654  1.00 73.47  ? 27   ARG C CB    1 
ATOM   3796  C  CG    . ARG C 2  27   ? 31.040  -29.138 78.123  1.00 77.90  ? 27   ARG C CG    1 
ATOM   3797  C  CD    . ARG C 2  27   ? 30.951  -30.240 79.173  1.00 89.97  ? 27   ARG C CD    1 
ATOM   3798  N  NE    . ARG C 2  27   ? 30.848  -31.568 78.567  1.00 97.58  ? 27   ARG C NE    1 
ATOM   3799  C  CZ    . ARG C 2  27   ? 29.703  -32.196 78.308  1.00 97.50  ? 27   ARG C CZ    1 
ATOM   3800  N  NH1   . ARG C 2  27   ? 29.715  -33.401 77.749  1.00 95.65  ? 27   ARG C NH1   1 
ATOM   3801  N  NH2   . ARG C 2  27   ? 28.544  -31.622 78.608  1.00 93.89  ? 27   ARG C NH2   1 
ATOM   3802  N  N     . ARG C 2  28   ? 28.236  -29.538 74.952  1.00 66.67  ? 28   ARG C N     1 
ATOM   3803  C  CA    . ARG C 2  28   ? 27.973  -30.527 73.917  1.00 69.29  ? 28   ARG C CA    1 
ATOM   3804  C  C     . ARG C 2  28   ? 28.251  -29.958 72.535  1.00 73.20  ? 28   ARG C C     1 
ATOM   3805  O  O     . ARG C 2  28   ? 28.799  -30.651 71.669  1.00 72.54  ? 28   ARG C O     1 
ATOM   3806  C  CB    . ARG C 2  28   ? 26.524  -31.001 74.018  1.00 76.75  ? 28   ARG C CB    1 
ATOM   3807  C  CG    . ARG C 2  28   ? 26.212  -32.302 73.308  1.00 86.15  ? 28   ARG C CG    1 
ATOM   3808  C  CD    . ARG C 2  28   ? 26.327  -33.489 74.265  1.00 103.13 ? 28   ARG C CD    1 
ATOM   3809  N  NE    . ARG C 2  28   ? 25.759  -34.711 73.697  1.00 110.78 ? 28   ARG C NE    1 
ATOM   3810  C  CZ    . ARG C 2  28   ? 26.412  -35.531 72.877  1.00 113.36 ? 28   ARG C CZ    1 
ATOM   3811  N  NH1   . ARG C 2  28   ? 27.665  -35.265 72.521  1.00 98.63  ? 28   ARG C NH1   1 
ATOM   3812  N  NH2   . ARG C 2  28   ? 25.810  -36.618 72.409  1.00 120.38 ? 28   ARG C NH2   1 
ATOM   3813  N  N     . ALA C 2  29   ? 27.881  -28.696 72.307  1.00 73.24  ? 29   ALA C N     1 
ATOM   3814  C  CA    . ALA C 2  29   ? 28.120  -28.094 70.996  1.00 68.25  ? 29   ALA C CA    1 
ATOM   3815  C  C     . ALA C 2  29   ? 29.611  -27.931 70.705  1.00 71.08  ? 29   ALA C C     1 
ATOM   3816  O  O     . ALA C 2  29   ? 30.051  -28.127 69.563  1.00 71.71  ? 29   ALA C O     1 
ATOM   3817  C  CB    . ALA C 2  29   ? 27.406  -26.747 70.895  1.00 63.06  ? 29   ALA C CB    1 
ATOM   3818  N  N     . LEU C 2  30   ? 30.406  -27.573 71.718  1.00 71.02  ? 30   LEU C N     1 
ATOM   3819  C  CA    . LEU C 2  30   ? 31.820  -27.281 71.485  1.00 69.25  ? 30   LEU C CA    1 
ATOM   3820  C  C     . LEU C 2  30   ? 32.719  -28.513 71.558  1.00 66.88  ? 30   LEU C C     1 
ATOM   3821  O  O     . LEU C 2  30   ? 33.623  -28.661 70.729  1.00 64.63  ? 30   LEU C O     1 
ATOM   3822  C  CB    . LEU C 2  30   ? 32.320  -26.235 72.484  1.00 71.36  ? 30   LEU C CB    1 
ATOM   3823  C  CG    . LEU C 2  30   ? 31.813  -24.809 72.310  1.00 66.06  ? 30   LEU C CG    1 
ATOM   3824  C  CD1   . LEU C 2  30   ? 32.677  -23.850 73.113  1.00 68.59  ? 30   LEU C CD1   1 
ATOM   3825  C  CD2   . LEU C 2  30   ? 31.789  -24.422 70.846  1.00 60.27  ? 30   LEU C CD2   1 
ATOM   3826  N  N     . GLN C 2  31   ? 32.504  -29.390 72.541  1.00 72.29  ? 31   GLN C N     1 
ATOM   3827  C  CA    . GLN C 2  31   ? 33.329  -30.586 72.728  1.00 71.67  ? 31   GLN C CA    1 
ATOM   3828  C  C     . GLN C 2  31   ? 34.801  -30.239 72.936  1.00 67.09  ? 31   GLN C C     1 
ATOM   3829  O  O     . GLN C 2  31   ? 35.683  -31.009 72.566  1.00 75.42  ? 31   GLN C O     1 
ATOM   3830  C  CB    . GLN C 2  31   ? 33.175  -31.556 71.551  1.00 63.23  ? 31   GLN C CB    1 
ATOM   3831  C  CG    . GLN C 2  31   ? 31.818  -32.214 71.462  1.00 63.19  ? 31   GLN C CG    1 
ATOM   3832  C  CD    . GLN C 2  31   ? 31.714  -33.149 70.282  1.00 63.42  ? 31   GLN C CD    1 
ATOM   3833  O  OE1   . GLN C 2  31   ? 31.734  -34.372 70.438  1.00 62.53  ? 31   GLN C OE1   1 
ATOM   3834  N  NE2   . GLN C 2  31   ? 31.592  -32.578 69.087  1.00 68.98  ? 31   GLN C NE2   1 
ATOM   3835  N  N     . ALA C 2  32   ? 35.078  -29.090 73.557  1.00 71.48  ? 32   ALA C N     1 
ATOM   3836  C  CA    . ALA C 2  32   ? 36.451  -28.610 73.681  1.00 70.15  ? 32   ALA C CA    1 
ATOM   3837  C  C     . ALA C 2  32   ? 37.296  -29.450 74.630  1.00 73.25  ? 32   ALA C C     1 
ATOM   3838  O  O     . ALA C 2  32   ? 38.528  -29.357 74.583  1.00 77.14  ? 32   ALA C O     1 
ATOM   3839  C  CB    . ALA C 2  32   ? 36.453  -27.155 74.148  1.00 67.06  ? 32   ALA C CB    1 
ATOM   3840  N  N     . ASP C 2  33   ? 36.669  -30.243 75.498  1.00 83.73  ? 33   ASP C N     1 
ATOM   3841  C  CA    . ASP C 2  33   ? 37.369  -31.136 76.414  1.00 82.61  ? 33   ASP C CA    1 
ATOM   3842  C  C     . ASP C 2  33   ? 37.615  -32.513 75.818  1.00 77.54  ? 33   ASP C C     1 
ATOM   3843  O  O     . ASP C 2  33   ? 38.248  -33.350 76.470  1.00 86.32  ? 33   ASP C O     1 
ATOM   3844  C  CB    . ASP C 2  33   ? 36.578  -31.287 77.722  1.00 84.71  ? 33   ASP C CB    1 
ATOM   3845  C  CG    . ASP C 2  33   ? 36.862  -30.171 78.711  1.00 100.73 ? 33   ASP C CG    1 
ATOM   3846  O  OD1   . ASP C 2  33   ? 36.871  -28.991 78.294  1.00 99.10  ? 33   ASP C OD1   1 
ATOM   3847  O  OD2   . ASP C 2  33   ? 37.066  -30.474 79.908  1.00 112.03 ? 33   ASP C OD2   1 
ATOM   3848  N  N     . VAL C 2  34   ? 37.132  -32.762 74.610  1.00 72.44  ? 34   VAL C N     1 
ATOM   3849  C  CA    . VAL C 2  34   ? 37.235  -34.064 73.956  1.00 69.98  ? 34   VAL C CA    1 
ATOM   3850  C  C     . VAL C 2  34   ? 38.437  -34.045 73.020  1.00 72.34  ? 34   VAL C C     1 
ATOM   3851  O  O     . VAL C 2  34   ? 38.568  -33.103 72.222  1.00 73.48  ? 34   VAL C O     1 
ATOM   3852  C  CB    . VAL C 2  34   ? 35.954  -34.404 73.177  1.00 75.80  ? 34   VAL C CB    1 
ATOM   3853  C  CG1   . VAL C 2  34   ? 36.105  -35.744 72.451  1.00 73.97  ? 34   VAL C CG1   1 
ATOM   3854  C  CG2   . VAL C 2  34   ? 34.759  -34.400 74.109  1.00 61.26  ? 34   VAL C CG2   1 
ATOM   3855  N  N     . PRO C 2  35   ? 39.321  -35.035 73.085  1.00 73.74  ? 35   PRO C N     1 
ATOM   3856  C  CA    . PRO C 2  35   ? 40.356  -35.188 72.059  1.00 64.13  ? 35   PRO C CA    1 
ATOM   3857  C  C     . PRO C 2  35   ? 39.738  -35.346 70.681  1.00 64.95  ? 35   PRO C C     1 
ATOM   3858  O  O     . PRO C 2  35   ? 38.846  -36.186 70.487  1.00 68.04  ? 35   PRO C O     1 
ATOM   3859  C  CB    . PRO C 2  35   ? 41.099  -36.462 72.492  1.00 68.91  ? 35   PRO C CB    1 
ATOM   3860  C  CG    . PRO C 2  35   ? 40.242  -37.099 73.550  1.00 67.73  ? 35   PRO C CG    1 
ATOM   3861  C  CD    . PRO C 2  35   ? 39.496  -35.985 74.194  1.00 76.39  ? 35   PRO C CD    1 
ATOM   3862  N  N     . PRO C 2  36   ? 40.219  -34.574 69.696  1.00 66.39  ? 36   PRO C N     1 
ATOM   3863  C  CA    . PRO C 2  36   ? 39.511  -34.463 68.402  1.00 72.66  ? 36   PRO C CA    1 
ATOM   3864  C  C     . PRO C 2  36   ? 38.991  -35.761 67.795  1.00 74.52  ? 36   PRO C C     1 
ATOM   3865  O  O     . PRO C 2  36   ? 37.829  -35.813 67.372  1.00 75.94  ? 36   PRO C O     1 
ATOM   3866  C  CB    . PRO C 2  36   ? 40.572  -33.814 67.504  1.00 69.59  ? 36   PRO C CB    1 
ATOM   3867  C  CG    . PRO C 2  36   ? 41.378  -32.982 68.430  1.00 73.06  ? 36   PRO C CG    1 
ATOM   3868  C  CD    . PRO C 2  36   ? 41.398  -33.694 69.763  1.00 65.63  ? 36   PRO C CD    1 
ATOM   3869  N  N     . GLU C 2  37   ? 39.814  -36.808 67.724  1.00 77.29  ? 37   GLU C N     1 
ATOM   3870  C  CA    . GLU C 2  37   ? 39.398  -38.041 67.059  1.00 79.65  ? 37   GLU C CA    1 
ATOM   3871  C  C     . GLU C 2  37   ? 38.270  -38.763 67.788  1.00 82.38  ? 37   GLU C C     1 
ATOM   3872  O  O     . GLU C 2  37   ? 37.676  -39.680 67.210  1.00 86.39  ? 37   GLU C O     1 
ATOM   3873  C  CB    . GLU C 2  37   ? 40.595  -38.981 66.891  1.00 78.41  ? 37   GLU C CB    1 
ATOM   3874  C  CG    . GLU C 2  37   ? 41.125  -39.574 68.188  1.00 77.63  ? 37   GLU C CG    1 
ATOM   3875  C  CD    . GLU C 2  37   ? 41.885  -38.573 69.036  1.00 83.84  ? 37   GLU C CD    1 
ATOM   3876  O  OE1   . GLU C 2  37   ? 42.327  -37.534 68.485  1.00 72.44  ? 37   GLU C OE1   1 
ATOM   3877  O  OE2   . GLU C 2  37   ? 42.033  -38.828 70.256  1.00 83.87  ? 37   GLU C OE2   1 
ATOM   3878  N  N     . LYS C 2  38   ? 37.964  -38.378 69.027  1.00 76.92  ? 38   LYS C N     1 
ATOM   3879  C  CA    . LYS C 2  38   ? 36.875  -38.964 69.795  1.00 77.04  ? 38   LYS C CA    1 
ATOM   3880  C  C     . LYS C 2  38   ? 35.594  -38.137 69.749  1.00 79.71  ? 38   LYS C C     1 
ATOM   3881  O  O     . LYS C 2  38   ? 34.626  -38.483 70.436  1.00 83.95  ? 38   LYS C O     1 
ATOM   3882  C  CB    . LYS C 2  38   ? 37.298  -39.147 71.255  1.00 75.45  ? 38   LYS C CB    1 
ATOM   3883  C  CG    . LYS C 2  38   ? 38.390  -40.165 71.501  1.00 73.64  ? 38   LYS C CG    1 
ATOM   3884  C  CD    . LYS C 2  38   ? 38.648  -40.259 72.997  1.00 71.95  ? 38   LYS C CD    1 
ATOM   3885  C  CE    . LYS C 2  38   ? 39.727  -41.264 73.338  1.00 67.93  ? 38   LYS C CE    1 
ATOM   3886  N  NZ    . LYS C 2  38   ? 40.083  -41.152 74.783  1.00 72.81  ? 38   LYS C NZ    1 
ATOM   3887  N  N     . ARG C 2  39   ? 35.562  -37.055 68.977  1.00 78.76  ? 39   ARG C N     1 
ATOM   3888  C  CA    . ARG C 2  39   ? 34.388  -36.195 68.946  1.00 73.61  ? 39   ARG C CA    1 
ATOM   3889  C  C     . ARG C 2  39   ? 33.261  -36.864 68.173  1.00 75.33  ? 39   ARG C C     1 
ATOM   3890  O  O     . ARG C 2  39   ? 33.496  -37.583 67.197  1.00 70.17  ? 39   ARG C O     1 
ATOM   3891  C  CB    . ARG C 2  39   ? 34.727  -34.838 68.325  1.00 67.24  ? 39   ARG C CB    1 
ATOM   3892  C  CG    . ARG C 2  39   ? 35.688  -33.999 69.167  1.00 70.03  ? 39   ARG C CG    1 
ATOM   3893  C  CD    . ARG C 2  39   ? 35.695  -32.538 68.748  1.00 65.39  ? 39   ARG C CD    1 
ATOM   3894  N  NE    . ARG C 2  39   ? 36.448  -31.715 69.692  1.00 67.14  ? 39   ARG C NE    1 
ATOM   3895  C  CZ    . ARG C 2  39   ? 37.535  -31.015 69.381  1.00 70.07  ? 39   ARG C CZ    1 
ATOM   3896  N  NH1   . ARG C 2  39   ? 38.002  -31.020 68.139  1.00 65.79  ? 39   ARG C NH1   1 
ATOM   3897  N  NH2   . ARG C 2  39   ? 38.152  -30.298 70.311  1.00 72.24  ? 39   ARG C NH2   1 
ATOM   3898  N  N     . GLU C 2  40   ? 32.032  -36.640 68.632  1.00 80.69  ? 40   GLU C N     1 
ATOM   3899  C  CA    . GLU C 2  40   ? 30.861  -37.146 67.938  1.00 76.25  ? 40   GLU C CA    1 
ATOM   3900  C  C     . GLU C 2  40   ? 30.458  -36.198 66.812  1.00 71.72  ? 40   GLU C C     1 
ATOM   3901  O  O     . GLU C 2  40   ? 30.916  -35.053 66.731  1.00 71.90  ? 40   GLU C O     1 
ATOM   3902  C  CB    . GLU C 2  40   ? 29.704  -37.344 68.913  1.00 73.84  ? 40   GLU C CB    1 
ATOM   3903  C  CG    . GLU C 2  40   ? 29.906  -38.493 69.879  1.00 80.25  ? 40   GLU C CG    1 
ATOM   3904  C  CD    . GLU C 2  40   ? 28.684  -38.738 70.733  1.00 99.41  ? 40   GLU C CD    1 
ATOM   3905  O  OE1   . GLU C 2  40   ? 27.557  -38.518 70.237  1.00 103.92 ? 40   GLU C OE1   1 
ATOM   3906  O  OE2   . GLU C 2  40   ? 28.851  -39.135 71.905  1.00 103.96 ? 40   GLU C OE2   1 
ATOM   3907  N  N     . ASN C 2  41   ? 29.580  -36.689 65.934  1.00 72.50  ? 41   ASN C N     1 
ATOM   3908  C  CA    . ASN C 2  41   ? 29.146  -35.938 64.759  1.00 79.88  ? 41   ASN C CA    1 
ATOM   3909  C  C     . ASN C 2  41   ? 28.095  -34.877 65.100  1.00 82.27  ? 41   ASN C C     1 
ATOM   3910  O  O     . ASN C 2  41   ? 27.323  -34.474 64.230  1.00 84.73  ? 41   ASN C O     1 
ATOM   3911  C  CB    . ASN C 2  41   ? 28.624  -36.895 63.678  1.00 77.33  ? 41   ASN C CB    1 
ATOM   3912  C  CG    . ASN C 2  41   ? 28.483  -36.223 62.311  1.00 80.23  ? 41   ASN C CG    1 
ATOM   3913  O  OD1   . ASN C 2  41   ? 28.962  -35.105 62.101  1.00 78.90  ? 41   ASN C OD1   1 
ATOM   3914  N  ND2   . ASN C 2  41   ? 27.825  -36.905 61.380  1.00 84.79  ? 41   ASN C ND2   1 
ATOM   3915  N  N     . VAL C 2  42   ? 28.002  -34.496 66.371  1.00 79.42  ? 42   VAL C N     1 
ATOM   3916  C  CA    . VAL C 2  42   ? 27.153  -33.412 66.855  1.00 74.93  ? 42   VAL C CA    1 
ATOM   3917  C  C     . VAL C 2  42   ? 27.892  -32.077 66.836  1.00 75.15  ? 42   VAL C C     1 
ATOM   3918  O  O     . VAL C 2  42   ? 29.122  -32.040 66.720  1.00 77.60  ? 42   VAL C O     1 
ATOM   3919  C  CB    . VAL C 2  42   ? 26.668  -33.737 68.274  1.00 74.21  ? 42   VAL C CB    1 
ATOM   3920  C  CG1   . VAL C 2  42   ? 26.137  -35.164 68.335  1.00 83.31  ? 42   VAL C CG1   1 
ATOM   3921  C  CG2   . VAL C 2  42   ? 27.807  -33.547 69.262  1.00 65.62  ? 42   VAL C CG2   1 
ATOM   3922  N  N     . GLY C 2  43   ? 27.148  -30.969 66.932  1.00 66.99  ? 43   GLY C N     1 
ATOM   3923  C  CA    . GLY C 2  43   ? 27.753  -29.683 67.245  1.00 67.22  ? 43   GLY C CA    1 
ATOM   3924  C  C     . GLY C 2  43   ? 28.501  -29.035 66.089  1.00 74.06  ? 43   GLY C C     1 
ATOM   3925  O  O     . GLY C 2  43   ? 28.233  -29.283 64.904  1.00 76.33  ? 43   GLY C O     1 
ATOM   3926  N  N     . ILE C 2  44   ? 29.447  -28.160 66.449  1.00 69.88  ? 44   ILE C N     1 
ATOM   3927  C  CA    . ILE C 2  44   ? 30.264  -27.524 65.419  1.00 69.75  ? 44   ILE C CA    1 
ATOM   3928  C  C     . ILE C 2  44   ? 31.061  -28.571 64.657  1.00 73.35  ? 44   ILE C C     1 
ATOM   3929  O  O     . ILE C 2  44   ? 31.411  -28.370 63.484  1.00 80.36  ? 44   ILE C O     1 
ATOM   3930  C  CB    . ILE C 2  44   ? 31.181  -26.443 66.023  1.00 67.52  ? 44   ILE C CB    1 
ATOM   3931  C  CG1   . ILE C 2  44   ? 32.187  -27.064 66.984  1.00 68.47  ? 44   ILE C CG1   1 
ATOM   3932  C  CG2   . ILE C 2  44   ? 30.367  -25.376 66.716  1.00 68.87  ? 44   ILE C CG2   1 
ATOM   3933  C  CD1   . ILE C 2  44   ? 33.130  -26.060 67.591  1.00 66.38  ? 44   ILE C CD1   1 
ATOM   3934  N  N     . GLN C 2  45   ? 31.355  -29.705 65.298  1.00 69.36  ? 45   GLN C N     1 
ATOM   3935  C  CA    . GLN C 2  45   ? 31.882  -30.844 64.561  1.00 71.10  ? 45   GLN C CA    1 
ATOM   3936  C  C     . GLN C 2  45   ? 30.916  -31.266 63.456  1.00 77.07  ? 45   GLN C C     1 
ATOM   3937  O  O     . GLN C 2  45   ? 31.340  -31.552 62.328  1.00 80.81  ? 45   GLN C O     1 
ATOM   3938  C  CB    . GLN C 2  45   ? 32.172  -31.995 65.526  1.00 72.59  ? 45   GLN C CB    1 
ATOM   3939  C  CG    . GLN C 2  45   ? 32.650  -33.286 64.871  1.00 74.70  ? 45   GLN C CG    1 
ATOM   3940  C  CD    . GLN C 2  45   ? 34.092  -33.235 64.363  1.00 78.02  ? 45   GLN C CD    1 
ATOM   3941  O  OE1   . GLN C 2  45   ? 34.787  -32.225 64.489  1.00 74.57  ? 45   GLN C OE1   1 
ATOM   3942  N  NE2   . GLN C 2  45   ? 34.542  -34.341 63.783  1.00 83.78  ? 45   GLN C NE2   1 
ATOM   3943  N  N     . ALA C 2  46   ? 29.609  -31.275 63.749  1.00 77.40  ? 46   ALA C N     1 
ATOM   3944  C  CA    . ALA C 2  46   ? 28.620  -31.594 62.719  1.00 78.14  ? 46   ALA C CA    1 
ATOM   3945  C  C     . ALA C 2  46   ? 28.618  -30.553 61.610  1.00 79.50  ? 46   ALA C C     1 
ATOM   3946  O  O     . ALA C 2  46   ? 28.429  -30.889 60.437  1.00 84.29  ? 46   ALA C O     1 
ATOM   3947  C  CB    . ALA C 2  46   ? 27.224  -31.700 63.325  1.00 80.00  ? 46   ALA C CB    1 
ATOM   3948  N  N     . ALA C 2  47   ? 28.800  -29.279 61.963  1.00 76.94  ? 47   ALA C N     1 
ATOM   3949  C  CA    . ALA C 2  47   ? 28.852  -28.237 60.938  1.00 77.81  ? 47   ALA C CA    1 
ATOM   3950  C  C     . ALA C 2  47   ? 30.025  -28.461 59.989  1.00 79.35  ? 47   ALA C C     1 
ATOM   3951  O  O     . ALA C 2  47   ? 29.889  -28.346 58.763  1.00 75.81  ? 47   ALA C O     1 
ATOM   3952  C  CB    . ALA C 2  47   ? 28.948  -26.861 61.596  1.00 74.58  ? 47   ALA C CB    1 
ATOM   3953  N  N     . PHE C 2  48   ? 31.194  -28.774 60.549  1.00 80.97  ? 48   PHE C N     1 
ATOM   3954  C  CA    . PHE C 2  48   ? 32.350  -29.096 59.719  1.00 79.78  ? 48   PHE C CA    1 
ATOM   3955  C  C     . PHE C 2  48   ? 32.070  -30.303 58.830  1.00 79.92  ? 48   PHE C C     1 
ATOM   3956  O  O     . PHE C 2  48   ? 32.284  -30.252 57.613  1.00 82.58  ? 48   PHE C O     1 
ATOM   3957  C  CB    . PHE C 2  48   ? 33.571  -29.335 60.603  1.00 76.77  ? 48   PHE C CB    1 
ATOM   3958  C  CG    . PHE C 2  48   ? 34.253  -28.071 61.040  1.00 74.65  ? 48   PHE C CG    1 
ATOM   3959  C  CD1   . PHE C 2  48   ? 34.675  -27.142 60.104  1.00 72.50  ? 48   PHE C CD1   1 
ATOM   3960  C  CD2   . PHE C 2  48   ? 34.483  -27.816 62.383  1.00 68.72  ? 48   PHE C CD2   1 
ATOM   3961  C  CE1   . PHE C 2  48   ? 35.308  -25.977 60.496  1.00 67.34  ? 48   PHE C CE1   1 
ATOM   3962  C  CE2   . PHE C 2  48   ? 35.116  -26.656 62.781  1.00 70.45  ? 48   PHE C CE2   1 
ATOM   3963  C  CZ    . PHE C 2  48   ? 35.529  -25.732 61.834  1.00 66.52  ? 48   PHE C CZ    1 
ATOM   3964  N  N     . ARG C 2  49   ? 31.562  -31.392 59.418  1.00 72.70  ? 49   ARG C N     1 
ATOM   3965  C  CA    . ARG C 2  49   ? 31.276  -32.597 58.643  1.00 76.45  ? 49   ARG C CA    1 
ATOM   3966  C  C     . ARG C 2  49   ? 30.155  -32.396 57.626  1.00 81.85  ? 49   ARG C C     1 
ATOM   3967  O  O     . ARG C 2  49   ? 30.002  -33.221 56.720  1.00 86.77  ? 49   ARG C O     1 
ATOM   3968  C  CB    . ARG C 2  49   ? 30.924  -33.747 59.582  1.00 78.34  ? 49   ARG C CB    1 
ATOM   3969  C  CG    . ARG C 2  49   ? 32.002  -34.063 60.604  1.00 81.67  ? 49   ARG C CG    1 
ATOM   3970  C  CD    . ARG C 2  49   ? 33.125  -34.896 60.020  1.00 91.24  ? 49   ARG C CD    1 
ATOM   3971  N  NE    . ARG C 2  49   ? 32.741  -36.297 59.865  1.00 97.54  ? 49   ARG C NE    1 
ATOM   3972  C  CZ    . ARG C 2  49   ? 32.347  -36.841 58.719  1.00 95.98  ? 49   ARG C CZ    1 
ATOM   3973  N  NH1   . ARG C 2  49   ? 32.284  -36.102 57.617  1.00 85.77  ? 49   ARG C NH1   1 
ATOM   3974  N  NH2   . ARG C 2  49   ? 32.019  -38.125 58.672  1.00 97.81  ? 49   ARG C NH2   1 
ATOM   3975  N  N     . GLU C 2  50   ? 29.355  -31.340 57.771  1.00 86.86  ? 50   GLU C N     1 
ATOM   3976  C  CA    . GLU C 2  50   ? 28.367  -30.999 56.753  1.00 86.78  ? 50   GLU C CA    1 
ATOM   3977  C  C     . GLU C 2  50   ? 28.994  -30.211 55.612  1.00 86.97  ? 50   GLU C C     1 
ATOM   3978  O  O     . GLU C 2  50   ? 28.722  -30.491 54.439  1.00 95.62  ? 50   GLU C O     1 
ATOM   3979  C  CB    . GLU C 2  50   ? 27.222  -30.184 57.365  1.00 90.58  ? 50   GLU C CB    1 
ATOM   3980  C  CG    . GLU C 2  50   ? 26.138  -30.990 58.071  1.00 103.08 ? 50   GLU C CG    1 
ATOM   3981  C  CD    . GLU C 2  50   ? 24.943  -30.133 58.468  1.00 105.11 ? 50   GLU C CD    1 
ATOM   3982  O  OE1   . GLU C 2  50   ? 24.586  -30.114 59.668  1.00 108.80 ? 50   GLU C OE1   1 
ATOM   3983  O  OE2   . GLU C 2  50   ? 24.367  -29.472 57.576  1.00 104.12 ? 50   GLU C OE2   1 
ATOM   3984  N  N     . THR C 2  51   ? 29.826  -29.218 55.936  1.00 84.79  ? 51   THR C N     1 
ATOM   3985  C  CA    . THR C 2  51   ? 30.366  -28.340 54.901  1.00 87.80  ? 51   THR C CA    1 
ATOM   3986  C  C     . THR C 2  51   ? 31.371  -29.072 54.018  1.00 92.65  ? 51   THR C C     1 
ATOM   3987  O  O     . THR C 2  51   ? 31.315  -28.979 52.787  1.00 91.27  ? 51   THR C O     1 
ATOM   3988  C  CB    . THR C 2  51   ? 31.017  -27.115 55.537  1.00 83.06  ? 51   THR C CB    1 
ATOM   3989  O  OG1   . THR C 2  51   ? 30.066  -26.454 56.377  1.00 80.26  ? 51   THR C OG1   1 
ATOM   3990  C  CG2   . THR C 2  51   ? 31.494  -26.155 54.460  1.00 79.40  ? 51   THR C CG2   1 
ATOM   3991  N  N     . PHE C 2  52   ? 32.295  -29.804 54.631  1.00 93.76  ? 52   PHE C N     1 
ATOM   3992  C  CA    . PHE C 2  52   ? 33.393  -30.473 53.951  1.00 90.94  ? 52   PHE C CA    1 
ATOM   3993  C  C     . PHE C 2  52   ? 33.032  -31.918 53.613  1.00 96.93  ? 52   PHE C C     1 
ATOM   3994  O  O     . PHE C 2  52   ? 32.219  -32.545 54.307  1.00 87.92  ? 52   PHE C O     1 
ATOM   3995  C  CB    . PHE C 2  52   ? 34.647  -30.436 54.821  1.00 89.42  ? 52   PHE C CB    1 
ATOM   3996  C  CG    . PHE C 2  52   ? 35.243  -29.061 54.958  1.00 88.60  ? 52   PHE C CG    1 
ATOM   3997  C  CD1   . PHE C 2  52   ? 34.838  -28.211 55.972  1.00 89.24  ? 52   PHE C CD1   1 
ATOM   3998  C  CD2   . PHE C 2  52   ? 36.199  -28.614 54.061  1.00 89.17  ? 52   PHE C CD2   1 
ATOM   3999  C  CE1   . PHE C 2  52   ? 35.385  -26.943 56.091  1.00 89.11  ? 52   PHE C CE1   1 
ATOM   4000  C  CE2   . PHE C 2  52   ? 36.750  -27.349 54.180  1.00 84.27  ? 52   PHE C CE2   1 
ATOM   4001  C  CZ    . PHE C 2  52   ? 36.342  -26.514 55.192  1.00 80.27  ? 52   PHE C CZ    1 
ATOM   4002  N  N     . PRO C 2  53   ? 33.630  -32.480 52.541  1.00 97.70  ? 53   PRO C N     1 
ATOM   4003  C  CA    . PRO C 2  53   ? 34.644  -31.874 51.667  1.00 90.81  ? 53   PRO C CA    1 
ATOM   4004  C  C     . PRO C 2  53   ? 34.099  -30.876 50.639  1.00 92.37  ? 53   PRO C C     1 
ATOM   4005  O  O     . PRO C 2  53   ? 32.944  -30.974 50.234  1.00 95.20  ? 53   PRO C O     1 
ATOM   4006  C  CB    . PRO C 2  53   ? 35.239  -33.086 50.959  1.00 97.21  ? 53   PRO C CB    1 
ATOM   4007  C  CG    . PRO C 2  53   ? 34.098  -34.033 50.874  1.00 91.57  ? 53   PRO C CG    1 
ATOM   4008  C  CD    . PRO C 2  53   ? 33.348  -33.874 52.151  1.00 88.01  ? 53   PRO C CD    1 
ATOM   4009  N  N     . ILE C 2  54   ? 34.940  -29.927 50.229  1.00 95.15  ? 54   ILE C N     1 
ATOM   4010  C  CA    . ILE C 2  54   ? 34.601  -28.932 49.215  1.00 98.34  ? 54   ILE C CA    1 
ATOM   4011  C  C     . ILE C 2  54   ? 35.269  -29.332 47.906  1.00 104.18 ? 54   ILE C C     1 
ATOM   4012  O  O     . ILE C 2  54   ? 36.483  -29.565 47.869  1.00 105.12 ? 54   ILE C O     1 
ATOM   4013  C  CB    . ILE C 2  54   ? 35.046  -27.526 49.648  1.00 93.43  ? 54   ILE C CB    1 
ATOM   4014  C  CG1   . ILE C 2  54   ? 34.492  -27.193 51.032  1.00 90.07  ? 54   ILE C CG1   1 
ATOM   4015  C  CG2   . ILE C 2  54   ? 34.599  -26.492 48.637  1.00 100.26 ? 54   ILE C CG2   1 
ATOM   4016  C  CD1   . ILE C 2  54   ? 34.931  -25.842 51.544  1.00 92.49  ? 54   ILE C CD1   1 
ATOM   4017  N  N     . GLU C 2  55   ? 34.489  -29.396 46.826  1.00 107.80 ? 55   GLU C N     1 
ATOM   4018  C  CA    . GLU C 2  55   ? 34.961  -29.977 45.577  1.00 105.66 ? 55   GLU C CA    1 
ATOM   4019  C  C     . GLU C 2  55   ? 34.738  -29.021 44.410  1.00 113.85 ? 55   GLU C C     1 
ATOM   4020  O  O     . GLU C 2  55   ? 33.916  -28.102 44.478  1.00 109.88 ? 55   GLU C O     1 
ATOM   4021  C  CB    . GLU C 2  55   ? 34.269  -31.323 45.318  1.00 107.66 ? 55   GLU C CB    1 
ATOM   4022  C  CG    . GLU C 2  55   ? 34.415  -32.293 46.494  1.00 109.04 ? 55   GLU C CG    1 
ATOM   4023  C  CD    . GLU C 2  55   ? 33.794  -33.654 46.241  1.00 112.82 ? 55   GLU C CD    1 
ATOM   4024  O  OE1   . GLU C 2  55   ? 33.305  -34.269 47.216  1.00 100.95 ? 55   GLU C OE1   1 
ATOM   4025  O  OE2   . GLU C 2  55   ? 33.801  -34.110 45.076  1.00 119.34 ? 55   GLU C OE2   1 
ATOM   4026  N  N     . GLU C 2  56   ? 35.499  -29.254 43.338  1.00 120.18 ? 56   GLU C N     1 
ATOM   4027  C  CA    . GLU C 2  56   ? 35.440  -28.463 42.103  1.00 113.69 ? 56   GLU C CA    1 
ATOM   4028  C  C     . GLU C 2  56   ? 35.779  -26.995 42.337  1.00 114.27 ? 56   GLU C C     1 
ATOM   4029  O  O     . GLU C 2  56   ? 35.452  -26.135 41.519  1.00 114.25 ? 56   GLU C O     1 
ATOM   4030  C  CB    . GLU C 2  56   ? 34.059  -28.573 41.457  1.00 109.81 ? 56   GLU C CB    1 
ATOM   4031  C  CG    . GLU C 2  56   ? 33.573  -29.995 41.298  1.00 112.15 ? 56   GLU C CG    1 
ATOM   4032  C  CD    . GLU C 2  56   ? 32.136  -30.053 40.846  1.00 120.66 ? 56   GLU C CD    1 
ATOM   4033  O  OE1   . GLU C 2  56   ? 31.890  -29.891 39.632  1.00 131.90 ? 56   GLU C OE1   1 
ATOM   4034  O  OE2   . GLU C 2  56   ? 31.253  -30.242 41.708  1.00 114.65 ? 56   GLU C OE2   1 
ATOM   4035  N  N     . GLY C 2  63   ? 42.993  -25.975 43.650  1.00 106.64 ? 63   GLY C N     1 
ATOM   4036  C  CA    . GLY C 2  63   ? 42.921  -27.424 43.672  1.00 112.64 ? 63   GLY C CA    1 
ATOM   4037  C  C     . GLY C 2  63   ? 41.521  -27.960 43.434  1.00 117.02 ? 63   GLY C C     1 
ATOM   4038  O  O     . GLY C 2  63   ? 40.565  -27.193 43.319  1.00 117.41 ? 63   GLY C O     1 
ATOM   4039  N  N     . LEU C 2  64   ? 41.398  -29.285 43.367  1.00 117.50 ? 64   LEU C N     1 
ATOM   4040  C  CA    . LEU C 2  64   ? 40.107  -29.898 43.094  1.00 116.47 ? 64   LEU C CA    1 
ATOM   4041  C  C     . LEU C 2  64   ? 39.331  -30.250 44.359  1.00 115.73 ? 64   LEU C C     1 
ATOM   4042  O  O     . LEU C 2  64   ? 38.094  -30.283 44.321  1.00 115.58 ? 64   LEU C O     1 
ATOM   4043  C  CB    . LEU C 2  64   ? 40.291  -31.149 42.229  1.00 116.68 ? 64   LEU C CB    1 
ATOM   4044  C  CG    . LEU C 2  64   ? 40.800  -30.898 40.809  1.00 122.62 ? 64   LEU C CG    1 
ATOM   4045  C  CD1   . LEU C 2  64   ? 40.677  -32.152 39.964  1.00 129.83 ? 64   LEU C CD1   1 
ATOM   4046  C  CD2   . LEU C 2  64   ? 40.052  -29.744 40.166  1.00 124.52 ? 64   LEU C CD2   1 
ATOM   4047  N  N     . VAL C 2  65   ? 40.014  -30.510 45.478  1.00 112.24 ? 65   VAL C N     1 
ATOM   4048  C  CA    . VAL C 2  65   ? 39.360  -30.964 46.705  1.00 106.25 ? 65   VAL C CA    1 
ATOM   4049  C  C     . VAL C 2  65   ? 39.984  -30.266 47.911  1.00 104.55 ? 65   VAL C C     1 
ATOM   4050  O  O     . VAL C 2  65   ? 41.201  -30.071 47.969  1.00 105.58 ? 65   VAL C O     1 
ATOM   4051  C  CB    . VAL C 2  65   ? 39.446  -32.502 46.836  1.00 100.61 ? 65   VAL C CB    1 
ATOM   4052  C  CG1   . VAL C 2  65   ? 39.387  -32.939 48.286  1.00 98.28  ? 65   VAL C CG1   1 
ATOM   4053  C  CG2   . VAL C 2  65   ? 38.328  -33.159 46.040  1.00 101.52 ? 65   VAL C CG2   1 
ATOM   4054  N  N     . LEU C 2  66   ? 39.140  -29.876 48.870  1.00 104.27 ? 66   LEU C N     1 
ATOM   4055  C  CA    . LEU C 2  66   ? 39.574  -29.349 50.164  1.00 99.17  ? 66   LEU C CA    1 
ATOM   4056  C  C     . LEU C 2  66   ? 38.790  -30.056 51.258  1.00 92.89  ? 66   LEU C C     1 
ATOM   4057  O  O     . LEU C 2  66   ? 37.566  -29.910 51.337  1.00 88.74  ? 66   LEU C O     1 
ATOM   4058  C  CB    . LEU C 2  66   ? 39.364  -27.834 50.255  1.00 91.27  ? 66   LEU C CB    1 
ATOM   4059  C  CG    . LEU C 2  66   ? 39.716  -27.181 51.593  1.00 83.54  ? 66   LEU C CG    1 
ATOM   4060  C  CD1   . LEU C 2  66   ? 41.125  -27.557 52.016  1.00 85.26  ? 66   LEU C CD1   1 
ATOM   4061  C  CD2   . LEU C 2  66   ? 39.571  -25.672 51.502  1.00 77.24  ? 66   LEU C CD2   1 
ATOM   4062  N  N     . ASP C 2  67   ? 39.486  -30.813 52.101  1.00 90.33  ? 67   ASP C N     1 
ATOM   4063  C  CA    . ASP C 2  67   ? 38.825  -31.650 53.088  1.00 88.11  ? 67   ASP C CA    1 
ATOM   4064  C  C     . ASP C 2  67   ? 39.236  -31.251 54.500  1.00 87.22  ? 67   ASP C C     1 
ATOM   4065  O  O     . ASP C 2  67   ? 40.282  -30.632 54.720  1.00 88.90  ? 67   ASP C O     1 
ATOM   4066  C  CB    . ASP C 2  67   ? 39.121  -33.136 52.846  1.00 96.75  ? 67   ASP C CB    1 
ATOM   4067  C  CG    . ASP C 2  67   ? 38.202  -34.051 53.647  1.00 104.93 ? 67   ASP C CG    1 
ATOM   4068  O  OD1   . ASP C 2  67   ? 36.986  -33.762 53.710  1.00 100.74 ? 67   ASP C OD1   1 
ATOM   4069  O  OD2   . ASP C 2  67   ? 38.693  -35.055 54.212  1.00 104.96 ? 67   ASP C OD2   1 
ATOM   4070  N  N     . PHE C 2  68   ? 38.379  -31.617 55.453  1.00 88.13  ? 68   PHE C N     1 
ATOM   4071  C  CA    . PHE C 2  68   ? 38.499  -31.237 56.856  1.00 84.99  ? 68   PHE C CA    1 
ATOM   4072  C  C     . PHE C 2  68   ? 38.939  -32.441 57.675  1.00 81.44  ? 68   PHE C C     1 
ATOM   4073  O  O     . PHE C 2  68   ? 38.338  -33.515 57.571  1.00 82.76  ? 68   PHE C O     1 
ATOM   4074  C  CB    . PHE C 2  68   ? 37.161  -30.694 57.379  1.00 78.88  ? 68   PHE C CB    1 
ATOM   4075  C  CG    . PHE C 2  68   ? 36.999  -30.781 58.880  1.00 78.70  ? 68   PHE C CG    1 
ATOM   4076  C  CD1   . PHE C 2  68   ? 37.530  -29.807 59.704  1.00 71.33  ? 68   PHE C CD1   1 
ATOM   4077  C  CD2   . PHE C 2  68   ? 36.300  -31.830 59.460  1.00 74.06  ? 68   PHE C CD2   1 
ATOM   4078  C  CE1   . PHE C 2  68   ? 37.387  -29.884 61.065  1.00 68.26  ? 68   PHE C CE1   1 
ATOM   4079  C  CE2   . PHE C 2  68   ? 36.156  -31.914 60.826  1.00 69.44  ? 68   PHE C CE2   1 
ATOM   4080  C  CZ    . PHE C 2  68   ? 36.698  -30.939 61.629  1.00 72.66  ? 68   PHE C CZ    1 
ATOM   4081  N  N     . LEU C 2  69   ? 39.968  -32.257 58.504  1.00 75.98  ? 69   LEU C N     1 
ATOM   4082  C  CA    . LEU C 2  69   ? 40.456  -33.318 59.374  1.00 74.82  ? 69   LEU C CA    1 
ATOM   4083  C  C     . LEU C 2  69   ? 39.933  -33.182 60.798  1.00 76.68  ? 69   LEU C C     1 
ATOM   4084  O  O     . LEU C 2  69   ? 39.305  -34.105 61.327  1.00 82.13  ? 69   LEU C O     1 
ATOM   4085  C  CB    . LEU C 2  69   ? 41.985  -33.316 59.384  1.00 82.05  ? 69   LEU C CB    1 
ATOM   4086  C  CG    . LEU C 2  69   ? 42.697  -33.637 58.077  1.00 77.13  ? 69   LEU C CG    1 
ATOM   4087  C  CD1   . LEU C 2  69   ? 44.147  -33.946 58.373  1.00 79.83  ? 69   LEU C CD1   1 
ATOM   4088  C  CD2   . LEU C 2  69   ? 42.012  -34.802 57.382  1.00 82.20  ? 69   LEU C CD2   1 
ATOM   4089  N  N     . GLU C 2  70   ? 40.191  -32.039 61.428  1.00 74.03  ? 70   GLU C N     1 
ATOM   4090  C  CA    . GLU C 2  70   ? 39.795  -31.799 62.808  1.00 74.58  ? 70   GLU C CA    1 
ATOM   4091  C  C     . GLU C 2  70   ? 39.985  -30.319 63.103  1.00 75.80  ? 70   GLU C C     1 
ATOM   4092  O  O     . GLU C 2  70   ? 40.707  -29.616 62.387  1.00 74.85  ? 70   GLU C O     1 
ATOM   4093  C  CB    . GLU C 2  70   ? 40.607  -32.658 63.784  1.00 77.18  ? 70   GLU C CB    1 
ATOM   4094  C  CG    . GLU C 2  70   ? 42.100  -32.379 63.746  1.00 78.84  ? 70   GLU C CG    1 
ATOM   4095  C  CD    . GLU C 2  70   ? 42.903  -33.439 64.465  1.00 87.93  ? 70   GLU C CD    1 
ATOM   4096  O  OE1   . GLU C 2  70   ? 44.107  -33.207 64.716  1.00 93.96  ? 70   GLU C OE1   1 
ATOM   4097  O  OE2   . GLU C 2  70   ? 42.329  -34.507 64.775  1.00 85.97  ? 70   GLU C OE2   1 
ATOM   4098  N  N     . TYR C 2  71   ? 39.315  -29.850 64.154  1.00 71.58  ? 71   TYR C N     1 
ATOM   4099  C  CA    . TYR C 2  71   ? 39.475  -28.484 64.630  1.00 64.90  ? 71   TYR C CA    1 
ATOM   4100  C  C     . TYR C 2  71   ? 40.041  -28.507 66.041  1.00 62.72  ? 71   TYR C C     1 
ATOM   4101  O  O     . TYR C 2  71   ? 40.198  -29.565 66.658  1.00 64.89  ? 71   TYR C O     1 
ATOM   4102  C  CB    . TYR C 2  71   ? 38.146  -27.714 64.609  1.00 64.46  ? 71   TYR C CB    1 
ATOM   4103  C  CG    . TYR C 2  71   ? 37.115  -28.233 65.592  1.00 69.20  ? 71   TYR C CG    1 
ATOM   4104  C  CD1   . TYR C 2  71   ? 37.105  -27.803 66.918  1.00 67.55  ? 71   TYR C CD1   1 
ATOM   4105  C  CD2   . TYR C 2  71   ? 36.153  -29.150 65.196  1.00 69.91  ? 71   TYR C CD2   1 
ATOM   4106  C  CE1   . TYR C 2  71   ? 36.171  -28.279 67.817  1.00 63.71  ? 71   TYR C CE1   1 
ATOM   4107  C  CE2   . TYR C 2  71   ? 35.213  -29.630 66.092  1.00 68.91  ? 71   TYR C CE2   1 
ATOM   4108  C  CZ    . TYR C 2  71   ? 35.227  -29.192 67.398  1.00 67.53  ? 71   TYR C CZ    1 
ATOM   4109  O  OH    . TYR C 2  71   ? 34.286  -29.667 68.283  1.00 72.54  ? 71   TYR C OH    1 
ATOM   4110  N  N     . ARG C 2  72   ? 40.343  -27.321 66.555  1.00 56.50  ? 72   ARG C N     1 
ATOM   4111  C  CA    . ARG C 2  72   ? 40.735  -27.206 67.950  1.00 68.96  ? 72   ARG C CA    1 
ATOM   4112  C  C     . ARG C 2  72   ? 40.447  -25.789 68.427  1.00 69.10  ? 72   ARG C C     1 
ATOM   4113  O  O     . ARG C 2  72   ? 40.506  -24.835 67.647  1.00 67.68  ? 72   ARG C O     1 
ATOM   4114  C  CB    . ARG C 2  72   ? 42.214  -27.562 68.161  1.00 60.05  ? 72   ARG C CB    1 
ATOM   4115  C  CG    . ARG C 2  72   ? 43.176  -26.502 67.712  1.00 59.83  ? 72   ARG C CG    1 
ATOM   4116  C  CD    . ARG C 2  72   ? 44.594  -26.774 68.181  1.00 59.31  ? 72   ARG C CD    1 
ATOM   4117  N  NE    . ARG C 2  72   ? 45.522  -25.860 67.519  1.00 65.52  ? 72   ARG C NE    1 
ATOM   4118  C  CZ    . ARG C 2  72   ? 45.904  -24.686 68.014  1.00 65.85  ? 72   ARG C CZ    1 
ATOM   4119  N  NH1   . ARG C 2  72   ? 45.458  -24.279 69.196  1.00 69.16  ? 72   ARG C NH1   1 
ATOM   4120  N  NH2   . ARG C 2  72   ? 46.734  -23.917 67.325  1.00 66.30  ? 72   ARG C NH2   1 
ATOM   4121  N  N     . LEU C 2  73   ? 40.121  -25.666 69.710  1.00 57.09  ? 73   LEU C N     1 
ATOM   4122  C  CA    . LEU C 2  73   ? 39.874  -24.371 70.327  1.00 59.45  ? 73   LEU C CA    1 
ATOM   4123  C  C     . LEU C 2  73   ? 41.038  -24.029 71.244  1.00 60.96  ? 73   LEU C C     1 
ATOM   4124  O  O     . LEU C 2  73   ? 41.408  -24.831 72.105  1.00 68.58  ? 73   LEU C O     1 
ATOM   4125  C  CB    . LEU C 2  73   ? 38.561  -24.370 71.113  1.00 68.06  ? 73   LEU C CB    1 
ATOM   4126  C  CG    . LEU C 2  73   ? 37.259  -24.485 70.312  1.00 66.07  ? 73   LEU C CG    1 
ATOM   4127  C  CD1   . LEU C 2  73   ? 36.108  -24.867 71.234  1.00 55.49  ? 73   LEU C CD1   1 
ATOM   4128  C  CD2   . LEU C 2  73   ? 36.944  -23.195 69.550  1.00 59.28  ? 73   LEU C CD2   1 
ATOM   4129  N  N     . GLY C 2  74   ? 41.616  -22.848 71.050  1.00 62.88  ? 74   GLY C N     1 
ATOM   4130  C  CA    . GLY C 2  74   ? 42.703  -22.386 71.882  1.00 62.39  ? 74   GLY C CA    1 
ATOM   4131  C  C     . GLY C 2  74   ? 42.191  -21.818 73.190  1.00 65.23  ? 74   GLY C C     1 
ATOM   4132  O  O     . GLY C 2  74   ? 41.018  -21.933 73.542  1.00 65.39  ? 74   GLY C O     1 
ATOM   4133  N  N     . GLU C 2  75   ? 43.090  -21.211 73.916  1.00 76.00  ? 75   GLU C N     1 
ATOM   4134  C  CA    . GLU C 2  75   ? 42.773  -20.570 75.182  1.00 64.40  ? 75   GLU C CA    1 
ATOM   4135  C  C     . GLU C 2  75   ? 42.421  -19.101 74.959  1.00 66.60  ? 75   GLU C C     1 
ATOM   4136  O  O     . GLU C 2  75   ? 42.929  -18.470 74.026  1.00 68.73  ? 75   GLU C O     1 
ATOM   4137  C  CB    . GLU C 2  75   ? 43.954  -20.685 76.143  1.00 64.29  ? 75   GLU C CB    1 
ATOM   4138  C  CG    . GLU C 2  75   ? 44.224  -22.108 76.639  1.00 71.70  ? 75   GLU C CG    1 
ATOM   4139  C  CD    . GLU C 2  75   ? 43.117  -22.659 77.538  1.00 95.56  ? 75   GLU C CD    1 
ATOM   4140  O  OE1   . GLU C 2  75   ? 42.805  -23.868 77.422  1.00 102.38 ? 75   GLU C OE1   1 
ATOM   4141  O  OE2   . GLU C 2  75   ? 42.560  -21.893 78.361  1.00 93.70  ? 75   GLU C OE2   1 
ATOM   4142  N  N     . PRO C 2  76   ? 41.551  -18.539 75.795  1.00 69.89  ? 76   PRO C N     1 
ATOM   4143  C  CA    . PRO C 2  76   ? 41.069  -17.170 75.569  1.00 66.84  ? 76   PRO C CA    1 
ATOM   4144  C  C     . PRO C 2  76   ? 42.199  -16.162 75.656  1.00 67.41  ? 76   PRO C C     1 
ATOM   4145  O  O     . PRO C 2  76   ? 43.041  -16.240 76.562  1.00 71.17  ? 76   PRO C O     1 
ATOM   4146  C  CB    . PRO C 2  76   ? 40.057  -16.959 76.705  1.00 68.90  ? 76   PRO C CB    1 
ATOM   4147  C  CG    . PRO C 2  76   ? 39.689  -18.322 77.153  1.00 69.78  ? 76   PRO C CG    1 
ATOM   4148  C  CD    . PRO C 2  76   ? 40.909  -19.155 76.968  1.00 70.12  ? 76   PRO C CD    1 
ATOM   4149  N  N     . PRO C 2  77   ? 42.244  -15.193 74.738  1.00 65.98  ? 77   PRO C N     1 
ATOM   4150  C  CA    . PRO C 2  77   ? 43.263  -14.135 74.835  1.00 66.56  ? 77   PRO C CA    1 
ATOM   4151  C  C     . PRO C 2  77   ? 43.155  -13.266 76.080  1.00 74.97  ? 77   PRO C C     1 
ATOM   4152  O  O     . PRO C 2  77   ? 44.155  -12.647 76.462  1.00 75.74  ? 77   PRO C O     1 
ATOM   4153  C  CB    . PRO C 2  77   ? 43.036  -13.308 73.562  1.00 60.83  ? 77   PRO C CB    1 
ATOM   4154  C  CG    . PRO C 2  77   ? 41.671  -13.668 73.092  1.00 58.04  ? 77   PRO C CG    1 
ATOM   4155  C  CD    . PRO C 2  77   ? 41.458  -15.090 73.498  1.00 62.29  ? 77   PRO C CD    1 
ATOM   4156  N  N     . PHE C 2  78   ? 41.989  -13.184 76.722  1.00 78.85  ? 78   PHE C N     1 
ATOM   4157  C  CA    . PHE C 2  78   ? 41.824  -12.284 77.857  1.00 83.95  ? 78   PHE C CA    1 
ATOM   4158  C  C     . PHE C 2  78   ? 40.813  -12.858 78.838  1.00 80.76  ? 78   PHE C C     1 
ATOM   4159  O  O     . PHE C 2  78   ? 39.861  -13.531 78.424  1.00 81.05  ? 78   PHE C O     1 
ATOM   4160  C  CB    . PHE C 2  78   ? 41.373  -10.887 77.404  1.00 83.63  ? 78   PHE C CB    1 
ATOM   4161  C  CG    . PHE C 2  78   ? 42.321  -10.227 76.449  1.00 81.52  ? 78   PHE C CG    1 
ATOM   4162  C  CD1   . PHE C 2  78   ? 43.424  -9.536  76.919  1.00 85.90  ? 78   PHE C CD1   1 
ATOM   4163  C  CD2   . PHE C 2  78   ? 42.121  -10.312 75.083  1.00 70.53  ? 78   PHE C CD2   1 
ATOM   4164  C  CE1   . PHE C 2  78   ? 44.303  -8.929  76.044  1.00 78.89  ? 78   PHE C CE1   1 
ATOM   4165  C  CE2   . PHE C 2  78   ? 42.995  -9.711  74.207  1.00 69.51  ? 78   PHE C CE2   1 
ATOM   4166  C  CZ    . PHE C 2  78   ? 44.087  -9.017  74.688  1.00 72.01  ? 78   PHE C CZ    1 
ATOM   4167  N  N     . PRO C 2  79   ? 40.988  -12.607 80.134  1.00 83.65  ? 79   PRO C N     1 
ATOM   4168  C  CA    . PRO C 2  79   ? 40.057  -13.137 81.136  1.00 79.23  ? 79   PRO C CA    1 
ATOM   4169  C  C     . PRO C 2  79   ? 38.755  -12.345 81.167  1.00 80.87  ? 79   PRO C C     1 
ATOM   4170  O  O     . PRO C 2  79   ? 38.637  -11.262 80.595  1.00 85.13  ? 79   PRO C O     1 
ATOM   4171  C  CB    . PRO C 2  79   ? 40.833  -12.980 82.443  1.00 82.81  ? 79   PRO C CB    1 
ATOM   4172  C  CG    . PRO C 2  79   ? 41.714  -11.799 82.195  1.00 86.99  ? 79   PRO C CG    1 
ATOM   4173  C  CD    . PRO C 2  79   ? 42.111  -11.880 80.751  1.00 81.38  ? 79   PRO C CD    1 
ATOM   4174  N  N     . GLN C 2  80   ? 37.773  -12.910 81.877  1.00 82.38  ? 80   GLN C N     1 
ATOM   4175  C  CA    . GLN C 2  80   ? 36.414  -12.371 81.848  1.00 81.61  ? 80   GLN C CA    1 
ATOM   4176  C  C     . GLN C 2  80   ? 36.348  -10.956 82.424  1.00 85.84  ? 80   GLN C C     1 
ATOM   4177  O  O     . GLN C 2  80   ? 35.662  -10.080 81.874  1.00 80.57  ? 80   GLN C O     1 
ATOM   4178  C  CB    . GLN C 2  80   ? 35.476  -13.303 82.611  1.00 73.01  ? 80   GLN C CB    1 
ATOM   4179  C  CG    . GLN C 2  80   ? 35.580  -14.759 82.195  1.00 71.25  ? 80   GLN C CG    1 
ATOM   4180  C  CD    . GLN C 2  80   ? 34.557  -15.633 82.890  1.00 71.34  ? 80   GLN C CD    1 
ATOM   4181  O  OE1   . GLN C 2  80   ? 33.927  -15.223 83.866  1.00 83.38  ? 80   GLN C OE1   1 
ATOM   4182  N  NE2   . GLN C 2  80   ? 34.385  -16.844 82.390  1.00 74.28  ? 80   GLN C NE2   1 
ATOM   4183  N  N     . ASP C 2  81   ? 37.045  -10.716 83.535  1.00 86.48  ? 81   ASP C N     1 
ATOM   4184  C  CA    . ASP C 2  81   ? 37.071  -9.378  84.117  1.00 88.74  ? 81   ASP C CA    1 
ATOM   4185  C  C     . ASP C 2  81   ? 37.657  -8.373  83.135  1.00 85.87  ? 81   ASP C C     1 
ATOM   4186  O  O     . ASP C 2  81   ? 37.064  -7.319  82.871  1.00 82.86  ? 81   ASP C O     1 
ATOM   4187  C  CB    . ASP C 2  81   ? 37.869  -9.396  85.419  1.00 94.54  ? 81   ASP C CB    1 
ATOM   4188  C  CG    . ASP C 2  81   ? 37.770  -10.731 86.141  1.00 111.43 ? 81   ASP C CG    1 
ATOM   4189  O  OD1   . ASP C 2  81   ? 38.472  -11.683 85.716  1.00 104.03 ? 81   ASP C OD1   1 
ATOM   4190  O  OD2   . ASP C 2  81   ? 36.985  -10.830 87.118  1.00 114.81 ? 81   ASP C OD2   1 
ATOM   4191  N  N     . GLU C 2  82   ? 38.830  -8.689  82.586  1.00 87.25  ? 82   GLU C N     1 
ATOM   4192  C  CA    . GLU C 2  82   ? 39.461  -7.811  81.610  1.00 86.53  ? 82   GLU C CA    1 
ATOM   4193  C  C     . GLU C 2  82   ? 38.565  -7.602  80.396  1.00 84.04  ? 82   GLU C C     1 
ATOM   4194  O  O     . GLU C 2  82   ? 38.538  -6.509  79.814  1.00 84.33  ? 82   GLU C O     1 
ATOM   4195  C  CB    . GLU C 2  82   ? 40.809  -8.396  81.201  1.00 85.89  ? 82   GLU C CB    1 
ATOM   4196  C  CG    . GLU C 2  82   ? 41.594  -7.540  80.237  1.00 96.52  ? 82   GLU C CG    1 
ATOM   4197  C  CD    . GLU C 2  82   ? 43.022  -8.021  80.089  1.00 102.51 ? 82   GLU C CD    1 
ATOM   4198  O  OE1   . GLU C 2  82   ? 43.448  -8.878  80.900  1.00 104.10 ? 82   GLU C OE1   1 
ATOM   4199  O  OE2   . GLU C 2  82   ? 43.714  -7.541  79.164  1.00 93.56  ? 82   GLU C OE2   1 
ATOM   4200  N  N     . CYS C 2  83   ? 37.820  -8.637  80.003  1.00 82.24  ? 83   CYS C N     1 
ATOM   4201  C  CA    . CYS C 2  83   ? 36.897  -8.492  78.884  1.00 83.38  ? 83   CYS C CA    1 
ATOM   4202  C  C     . CYS C 2  83   ? 35.796  -7.493  79.204  1.00 80.48  ? 83   CYS C C     1 
ATOM   4203  O  O     . CYS C 2  83   ? 35.422  -6.681  78.352  1.00 82.41  ? 83   CYS C O     1 
ATOM   4204  C  CB    . CYS C 2  83   ? 36.304  -9.848  78.506  1.00 79.60  ? 83   CYS C CB    1 
ATOM   4205  S  SG    . CYS C 2  83   ? 37.398  -10.866 77.488  1.00 74.99  ? 83   CYS C SG    1 
ATOM   4206  N  N     . ARG C 2  84   ? 35.263  -7.533  80.427  1.00 87.40  ? 84   ARG C N     1 
ATOM   4207  C  CA    . ARG C 2  84   ? 34.273  -6.532  80.817  1.00 81.35  ? 84   ARG C CA    1 
ATOM   4208  C  C     . ARG C 2  84   ? 34.887  -5.138  80.840  1.00 85.83  ? 84   ARG C C     1 
ATOM   4209  O  O     . ARG C 2  84   ? 34.247  -4.160  80.432  1.00 83.57  ? 84   ARG C O     1 
ATOM   4210  C  CB    . ARG C 2  84   ? 33.677  -6.881  82.181  1.00 82.17  ? 84   ARG C CB    1 
ATOM   4211  C  CG    . ARG C 2  84   ? 32.947  -8.217  82.206  1.00 78.40  ? 84   ARG C CG    1 
ATOM   4212  C  CD    . ARG C 2  84   ? 32.270  -8.493  83.539  1.00 62.90  ? 84   ARG C CD    1 
ATOM   4213  N  NE    . ARG C 2  84   ? 31.365  -9.634  83.427  1.00 62.41  ? 84   ARG C NE    1 
ATOM   4214  C  CZ    . ARG C 2  84   ? 31.643  -10.867 83.843  1.00 65.74  ? 84   ARG C CZ    1 
ATOM   4215  N  NH1   . ARG C 2  84   ? 32.803  -11.136 84.429  1.00 65.86  ? 84   ARG C NH1   1 
ATOM   4216  N  NH2   . ARG C 2  84   ? 30.748  -11.833 83.679  1.00 69.38  ? 84   ARG C NH2   1 
ATOM   4217  N  N     . GLU C 2  85   ? 36.136  -5.038  81.302  1.00 88.61  ? 85   GLU C N     1 
ATOM   4218  C  CA    . GLU C 2  85   ? 36.824  -3.751  81.368  1.00 87.35  ? 85   GLU C CA    1 
ATOM   4219  C  C     . GLU C 2  85   ? 36.965  -3.123  79.988  1.00 88.12  ? 85   GLU C C     1 
ATOM   4220  O  O     . GLU C 2  85   ? 36.507  -1.999  79.752  1.00 91.43  ? 85   GLU C O     1 
ATOM   4221  C  CB    . GLU C 2  85   ? 38.201  -3.922  82.009  1.00 90.67  ? 85   GLU C CB    1 
ATOM   4222  C  CG    . GLU C 2  85   ? 38.210  -3.802  83.517  1.00 92.27  ? 85   GLU C CG    1 
ATOM   4223  C  CD    . GLU C 2  85   ? 38.015  -2.372  83.989  1.00 105.10 ? 85   GLU C CD    1 
ATOM   4224  O  OE1   . GLU C 2  85   ? 37.890  -2.168  85.217  1.00 105.32 ? 85   GLU C OE1   1 
ATOM   4225  O  OE2   . GLU C 2  85   ? 37.989  -1.453  83.138  1.00 107.73 ? 85   GLU C OE2   1 
ATOM   4226  N  N     . LYS C 2  86   ? 37.597  -3.842  79.061  1.00 87.81  ? 86   LYS C N     1 
ATOM   4227  C  CA    . LYS C 2  86   ? 38.006  -3.289  77.775  1.00 84.31  ? 86   LYS C CA    1 
ATOM   4228  C  C     . LYS C 2  86   ? 36.959  -3.452  76.680  1.00 84.07  ? 86   LYS C C     1 
ATOM   4229  O  O     . LYS C 2  86   ? 37.284  -3.263  75.503  1.00 90.48  ? 86   LYS C O     1 
ATOM   4230  C  CB    . LYS C 2  86   ? 39.322  -3.928  77.331  1.00 76.68  ? 86   LYS C CB    1 
ATOM   4231  C  CG    . LYS C 2  86   ? 40.509  -3.545  78.197  1.00 82.79  ? 86   LYS C CG    1 
ATOM   4232  C  CD    . LYS C 2  86   ? 41.714  -4.420  77.914  1.00 87.24  ? 86   LYS C CD    1 
ATOM   4233  C  CE    . LYS C 2  86   ? 42.955  -3.913  78.636  1.00 96.03  ? 86   LYS C CE    1 
ATOM   4234  N  NZ    . LYS C 2  86   ? 44.178  -4.676  78.238  1.00 109.27 ? 86   LYS C NZ    1 
ATOM   4235  N  N     . ASP C 2  87   ? 35.720  -3.796  77.037  1.00 81.16  ? 87   ASP C N     1 
ATOM   4236  C  CA    . ASP C 2  87   ? 34.612  -3.923  76.083  1.00 80.59  ? 87   ASP C CA    1 
ATOM   4237  C  C     . ASP C 2  87   ? 34.942  -4.912  74.961  1.00 80.21  ? 87   ASP C C     1 
ATOM   4238  O  O     . ASP C 2  87   ? 34.659  -4.672  73.784  1.00 79.40  ? 87   ASP C O     1 
ATOM   4239  C  CB    . ASP C 2  87   ? 34.195  -2.554  75.524  1.00 79.51  ? 87   ASP C CB    1 
ATOM   4240  C  CG    . ASP C 2  87   ? 33.385  -1.712  76.537  1.00 101.78 ? 87   ASP C CG    1 
ATOM   4241  O  OD1   . ASP C 2  87   ? 33.553  -1.892  77.770  1.00 99.50  ? 87   ASP C OD1   1 
ATOM   4242  O  OD2   . ASP C 2  87   ? 32.563  -0.872  76.100  1.00 100.56 ? 87   ASP C OD2   1 
ATOM   4243  N  N     . LEU C 2  88   ? 35.533  -6.047  75.338  1.00 81.83  ? 88   LEU C N     1 
ATOM   4244  C  CA    . LEU C 2  88   ? 35.877  -7.122  74.423  1.00 77.36  ? 88   LEU C CA    1 
ATOM   4245  C  C     . LEU C 2  88   ? 34.858  -8.253  74.519  1.00 74.59  ? 88   LEU C C     1 
ATOM   4246  O  O     . LEU C 2  88   ? 33.944  -8.243  75.346  1.00 79.82  ? 88   LEU C O     1 
ATOM   4247  C  CB    . LEU C 2  88   ? 37.272  -7.668  74.729  1.00 82.72  ? 88   LEU C CB    1 
ATOM   4248  C  CG    . LEU C 2  88   ? 38.421  -6.693  74.944  1.00 81.65  ? 88   LEU C CG    1 
ATOM   4249  C  CD1   . LEU C 2  88   ? 39.725  -7.469  75.058  1.00 73.33  ? 88   LEU C CD1   1 
ATOM   4250  C  CD2   . LEU C 2  88   ? 38.477  -5.688  73.812  1.00 76.65  ? 88   LEU C CD2   1 
ATOM   4251  N  N     . THR C 2  89   ? 35.039  -9.255  73.669  1.00 68.05  ? 89   THR C N     1 
ATOM   4252  C  CA    . THR C 2  89   ? 34.281  -10.495 73.739  1.00 68.18  ? 89   THR C CA    1 
ATOM   4253  C  C     . THR C 2  89   ? 35.148  -11.580 74.372  1.00 70.81  ? 89   THR C C     1 
ATOM   4254  O  O     . THR C 2  89   ? 36.354  -11.654 74.118  1.00 71.84  ? 89   THR C O     1 
ATOM   4255  C  CB    . THR C 2  89   ? 33.809  -10.916 72.344  1.00 65.84  ? 89   THR C CB    1 
ATOM   4256  O  OG1   . THR C 2  89   ? 32.860  -9.958  71.856  1.00 63.31  ? 89   THR C OG1   1 
ATOM   4257  C  CG2   . THR C 2  89   ? 33.168  -12.306 72.360  1.00 57.75  ? 89   THR C CG2   1 
ATOM   4258  N  N     . TYR C 2  90   ? 34.532  -12.400 75.223  1.00 66.35  ? 90   TYR C N     1 
ATOM   4259  C  CA    . TYR C 2  90   ? 35.212  -13.508 75.887  1.00 64.80  ? 90   TYR C CA    1 
ATOM   4260  C  C     . TYR C 2  90   ? 35.114  -14.729 74.982  1.00 66.03  ? 90   TYR C C     1 
ATOM   4261  O  O     . TYR C 2  90   ? 34.057  -15.365 74.896  1.00 67.77  ? 90   TYR C O     1 
ATOM   4262  C  CB    . TYR C 2  90   ? 34.592  -13.772 77.256  1.00 63.46  ? 90   TYR C CB    1 
ATOM   4263  C  CG    . TYR C 2  90   ? 35.216  -14.910 78.030  1.00 65.30  ? 90   TYR C CG    1 
ATOM   4264  C  CD1   . TYR C 2  90   ? 36.562  -14.885 78.378  1.00 60.52  ? 90   TYR C CD1   1 
ATOM   4265  C  CD2   . TYR C 2  90   ? 34.446  -15.996 78.447  1.00 64.12  ? 90   TYR C CD2   1 
ATOM   4266  C  CE1   . TYR C 2  90   ? 37.131  -15.919 79.096  1.00 64.14  ? 90   TYR C CE1   1 
ATOM   4267  C  CE2   . TYR C 2  90   ? 35.002  -17.031 79.169  1.00 62.26  ? 90   TYR C CE2   1 
ATOM   4268  C  CZ    . TYR C 2  90   ? 36.345  -16.990 79.493  1.00 73.11  ? 90   TYR C CZ    1 
ATOM   4269  O  OH    . TYR C 2  90   ? 36.900  -18.024 80.214  1.00 76.19  ? 90   TYR C OH    1 
ATOM   4270  N  N     . GLN C 2  91   ? 36.219  -15.058 74.315  1.00 66.05  ? 91   GLN C N     1 
ATOM   4271  C  CA    . GLN C 2  91   ? 36.194  -15.995 73.203  1.00 64.50  ? 91   GLN C CA    1 
ATOM   4272  C  C     . GLN C 2  91   ? 37.514  -16.750 73.139  1.00 65.05  ? 91   GLN C C     1 
ATOM   4273  O  O     . GLN C 2  91   ? 38.510  -16.356 73.753  1.00 73.46  ? 91   GLN C O     1 
ATOM   4274  C  CB    . GLN C 2  91   ? 35.931  -15.254 71.888  1.00 62.53  ? 91   GLN C CB    1 
ATOM   4275  C  CG    . GLN C 2  91   ? 36.676  -13.934 71.797  1.00 65.10  ? 91   GLN C CG    1 
ATOM   4276  C  CD    . GLN C 2  91   ? 36.356  -13.165 70.532  1.00 69.10  ? 91   GLN C CD    1 
ATOM   4277  O  OE1   . GLN C 2  91   ? 35.382  -13.465 69.827  1.00 65.15  ? 91   GLN C OE1   1 
ATOM   4278  N  NE2   . GLN C 2  91   ? 37.186  -12.173 70.225  1.00 73.33  ? 91   GLN C NE2   1 
ATOM   4279  N  N     . ALA C 2  92   ? 37.507  -17.845 72.372  1.00 64.17  ? 92   ALA C N     1 
ATOM   4280  C  CA    . ALA C 2  92   ? 38.661  -18.699 72.116  1.00 63.33  ? 92   ALA C CA    1 
ATOM   4281  C  C     . ALA C 2  92   ? 38.974  -18.766 70.628  1.00 59.41  ? 92   ALA C C     1 
ATOM   4282  O  O     . ALA C 2  92   ? 38.058  -18.862 69.802  1.00 56.64  ? 92   ALA C O     1 
ATOM   4283  C  CB    . ALA C 2  92   ? 38.428  -20.126 72.632  1.00 60.53  ? 92   ALA C CB    1 
ATOM   4284  N  N     . PRO C 2  93   ? 40.252  -18.739 70.259  1.00 64.67  ? 93   PRO C N     1 
ATOM   4285  C  CA    . PRO C 2  93   ? 40.609  -18.918 68.851  1.00 57.47  ? 93   PRO C CA    1 
ATOM   4286  C  C     . PRO C 2  93   ? 40.233  -20.313 68.382  1.00 61.52  ? 93   PRO C C     1 
ATOM   4287  O  O     . PRO C 2  93   ? 40.353  -21.290 69.127  1.00 57.02  ? 93   PRO C O     1 
ATOM   4288  C  CB    . PRO C 2  93   ? 42.124  -18.709 68.846  1.00 59.06  ? 93   PRO C CB    1 
ATOM   4289  C  CG    . PRO C 2  93   ? 42.550  -19.056 70.222  1.00 56.27  ? 93   PRO C CG    1 
ATOM   4290  C  CD    . PRO C 2  93   ? 41.443  -18.609 71.115  1.00 65.98  ? 93   PRO C CD    1 
ATOM   4291  N  N     . LEU C 2  94   ? 39.753  -20.393 67.140  1.00 60.93  ? 94   LEU C N     1 
ATOM   4292  C  CA    . LEU C 2  94   ? 39.333  -21.635 66.504  1.00 62.52  ? 94   LEU C CA    1 
ATOM   4293  C  C     . LEU C 2  94   ? 40.223  -21.901 65.298  1.00 68.86  ? 94   LEU C C     1 
ATOM   4294  O  O     . LEU C 2  94   ? 40.282  -21.086 64.369  1.00 69.31  ? 94   LEU C O     1 
ATOM   4295  C  CB    . LEU C 2  94   ? 37.870  -21.564 66.067  1.00 61.18  ? 94   LEU C CB    1 
ATOM   4296  C  CG    . LEU C 2  94   ? 37.366  -22.750 65.237  1.00 70.53  ? 94   LEU C CG    1 
ATOM   4297  C  CD1   . LEU C 2  94   ? 37.502  -24.053 66.005  1.00 65.19  ? 94   LEU C CD1   1 
ATOM   4298  C  CD2   . LEU C 2  94   ? 35.926  -22.530 64.814  1.00 61.39  ? 94   LEU C CD2   1 
ATOM   4299  N  N     . TYR C 2  95   ? 40.906  -23.038 65.311  1.00 65.35  ? 95   TYR C N     1 
ATOM   4300  C  CA    . TYR C 2  95   ? 41.726  -23.482 64.200  1.00 61.98  ? 95   TYR C CA    1 
ATOM   4301  C  C     . TYR C 2  95   ? 41.132  -24.767 63.642  1.00 63.66  ? 95   TYR C C     1 
ATOM   4302  O  O     . TYR C 2  95   ? 40.533  -25.558 64.374  1.00 67.17  ? 95   TYR C O     1 
ATOM   4303  C  CB    . TYR C 2  95   ? 43.176  -23.721 64.639  1.00 66.74  ? 95   TYR C CB    1 
ATOM   4304  C  CG    . TYR C 2  95   ? 43.803  -22.586 65.424  1.00 64.66  ? 95   TYR C CG    1 
ATOM   4305  C  CD1   . TYR C 2  95   ? 43.609  -22.470 66.792  1.00 60.82  ? 95   TYR C CD1   1 
ATOM   4306  C  CD2   . TYR C 2  95   ? 44.604  -21.642 64.797  1.00 62.00  ? 95   TYR C CD2   1 
ATOM   4307  C  CE1   . TYR C 2  95   ? 44.185  -21.440 67.509  1.00 61.35  ? 95   TYR C CE1   1 
ATOM   4308  C  CE2   . TYR C 2  95   ? 45.185  -20.608 65.507  1.00 57.79  ? 95   TYR C CE2   1 
ATOM   4309  C  CZ    . TYR C 2  95   ? 44.974  -20.513 66.861  1.00 64.28  ? 95   TYR C CZ    1 
ATOM   4310  O  OH    . TYR C 2  95   ? 45.549  -19.484 67.573  1.00 76.23  ? 95   TYR C OH    1 
ATOM   4311  N  N     . ALA C 2  96   ? 41.291  -24.974 62.342  1.00 61.85  ? 96   ALA C N     1 
ATOM   4312  C  CA    . ALA C 2  96   ? 40.818  -26.202 61.720  1.00 67.08  ? 96   ALA C CA    1 
ATOM   4313  C  C     . ALA C 2  96   ? 41.881  -26.699 60.756  1.00 71.65  ? 96   ALA C C     1 
ATOM   4314  O  O     . ALA C 2  96   ? 42.435  -25.912 59.980  1.00 74.07  ? 96   ALA C O     1 
ATOM   4315  C  CB    . ALA C 2  96   ? 39.482  -25.985 60.997  1.00 60.15  ? 96   ALA C CB    1 
ATOM   4316  N  N     . ARG C 2  97   ? 42.176  -27.995 60.822  1.00 68.18  ? 97   ARG C N     1 
ATOM   4317  C  CA    . ARG C 2  97   ? 43.171  -28.608 59.953  1.00 74.42  ? 97   ARG C CA    1 
ATOM   4318  C  C     . ARG C 2  97   ? 42.508  -29.034 58.650  1.00 74.63  ? 97   ARG C C     1 
ATOM   4319  O  O     . ARG C 2  97   ? 41.591  -29.863 58.645  1.00 71.45  ? 97   ARG C O     1 
ATOM   4320  C  CB    . ARG C 2  97   ? 43.839  -29.793 60.643  1.00 77.19  ? 97   ARG C CB    1 
ATOM   4321  C  CG    . ARG C 2  97   ? 44.737  -29.386 61.805  1.00 84.31  ? 97   ARG C CG    1 
ATOM   4322  C  CD    . ARG C 2  97   ? 45.509  -30.573 62.345  1.00 87.37  ? 97   ARG C CD    1 
ATOM   4323  N  NE    . ARG C 2  97   ? 45.985  -31.429 61.261  1.00 100.28 ? 97   ARG C NE    1 
ATOM   4324  C  CZ    . ARG C 2  97   ? 46.848  -32.427 61.419  1.00 98.45  ? 97   ARG C CZ    1 
ATOM   4325  N  NH1   . ARG C 2  97   ? 47.218  -33.158 60.372  1.00 94.19  ? 97   ARG C NH1   1 
ATOM   4326  N  NH2   . ARG C 2  97   ? 47.344  -32.690 62.622  1.00 96.04  ? 97   ARG C NH2   1 
ATOM   4327  N  N     . LEU C 2  98   ? 42.961  -28.447 57.552  1.00 73.43  ? 98   LEU C N     1 
ATOM   4328  C  CA    . LEU C 2  98   ? 42.399  -28.695 56.237  1.00 87.05  ? 98   LEU C CA    1 
ATOM   4329  C  C     . LEU C 2  98   ? 43.494  -29.192 55.302  1.00 94.68  ? 98   LEU C C     1 
ATOM   4330  O  O     . LEU C 2  98   ? 44.667  -28.833 55.449  1.00 93.85  ? 98   LEU C O     1 
ATOM   4331  C  CB    . LEU C 2  98   ? 41.759  -27.421 55.673  1.00 84.51  ? 98   LEU C CB    1 
ATOM   4332  C  CG    . LEU C 2  98   ? 40.736  -26.758 56.593  1.00 78.47  ? 98   LEU C CG    1 
ATOM   4333  C  CD1   . LEU C 2  98   ? 40.090  -25.562 55.909  1.00 74.50  ? 98   LEU C CD1   1 
ATOM   4334  C  CD2   . LEU C 2  98   ? 39.691  -27.777 57.022  1.00 70.32  ? 98   LEU C CD2   1 
ATOM   4335  N  N     . GLN C 2  99   ? 43.115  -30.032 54.343  1.00 95.39  ? 99   GLN C N     1 
ATOM   4336  C  CA    . GLN C 2  99   ? 44.068  -30.504 53.347  1.00 98.17  ? 99   GLN C CA    1 
ATOM   4337  C  C     . GLN C 2  99   ? 43.523  -30.254 51.952  1.00 97.82  ? 99   GLN C C     1 
ATOM   4338  O  O     . GLN C 2  99   ? 42.351  -30.527 51.672  1.00 98.37  ? 99   GLN C O     1 
ATOM   4339  C  CB    . GLN C 2  99   ? 44.409  -31.987 53.533  1.00 98.32  ? 99   GLN C CB    1 
ATOM   4340  C  CG    . GLN C 2  99   ? 43.298  -32.952 53.202  1.00 102.25 ? 99   GLN C CG    1 
ATOM   4341  C  CD    . GLN C 2  99   ? 43.713  -34.379 53.447  1.00 110.24 ? 99   GLN C CD    1 
ATOM   4342  O  OE1   . GLN C 2  99   ? 44.756  -34.632 54.052  1.00 107.12 ? 99   GLN C OE1   1 
ATOM   4343  N  NE2   . GLN C 2  99   ? 42.902  -35.324 52.981  1.00 113.51 ? 99   GLN C NE2   1 
ATOM   4344  N  N     . LEU C 2  100  ? 44.377  -29.709 51.094  1.00 102.76 ? 100  LEU C N     1 
ATOM   4345  C  CA    . LEU C 2  100  ? 44.076  -29.502 49.687  1.00 108.56 ? 100  LEU C CA    1 
ATOM   4346  C  C     . LEU C 2  100  ? 44.622  -30.682 48.896  1.00 109.47 ? 100  LEU C C     1 
ATOM   4347  O  O     . LEU C 2  100  ? 45.774  -31.081 49.087  1.00 114.11 ? 100  LEU C O     1 
ATOM   4348  C  CB    . LEU C 2  100  ? 44.689  -28.190 49.197  1.00 107.89 ? 100  LEU C CB    1 
ATOM   4349  C  CG    . LEU C 2  100  ? 44.146  -27.570 47.914  1.00 107.43 ? 100  LEU C CG    1 
ATOM   4350  C  CD1   . LEU C 2  100  ? 44.489  -26.095 47.887  1.00 109.47 ? 100  LEU C CD1   1 
ATOM   4351  C  CD2   . LEU C 2  100  ? 44.717  -28.263 46.696  1.00 115.38 ? 100  LEU C CD2   1 
ATOM   4352  N  N     . ILE C 2  101  ? 43.797  -31.238 48.016  1.00 106.57 ? 101  ILE C N     1 
ATOM   4353  C  CA    . ILE C 2  101  ? 44.151  -32.417 47.240  1.00 114.96 ? 101  ILE C CA    1 
ATOM   4354  C  C     . ILE C 2  101  ? 43.771  -32.173 45.786  1.00 125.39 ? 101  ILE C C     1 
ATOM   4355  O  O     . ILE C 2  101  ? 42.593  -31.932 45.480  1.00 125.98 ? 101  ILE C O     1 
ATOM   4356  C  CB    . ILE C 2  101  ? 43.456  -33.683 47.771  1.00 110.04 ? 101  ILE C CB    1 
ATOM   4357  C  CG1   . ILE C 2  101  ? 43.935  -34.010 49.184  1.00 112.28 ? 101  ILE C CG1   1 
ATOM   4358  C  CG2   . ILE C 2  101  ? 43.711  -34.856 46.845  1.00 115.47 ? 101  ILE C CG2   1 
ATOM   4359  C  CD1   . ILE C 2  101  ? 43.350  -35.294 49.736  1.00 112.45 ? 101  ILE C CD1   1 
ATOM   4360  N  N     . HIS C 2  102  ? 44.767  -32.207 44.896  1.00 129.44 ? 102  HIS C N     1 
ATOM   4361  C  CA    A HIS C 2  102  ? 44.490  -32.222 43.467  0.50 128.56 ? 102  HIS C CA    1 
ATOM   4362  C  CA    B HIS C 2  102  ? 44.518  -32.225 43.459  0.50 128.57 ? 102  HIS C CA    1 
ATOM   4363  C  C     . HIS C 2  102  ? 44.250  -33.665 43.039  1.00 133.83 ? 102  HIS C C     1 
ATOM   4364  O  O     . HIS C 2  102  ? 45.100  -34.538 43.254  1.00 136.31 ? 102  HIS C O     1 
ATOM   4365  C  CB    A HIS C 2  102  ? 45.635  -31.589 42.679  0.50 127.46 ? 102  HIS C CB    1 
ATOM   4366  C  CB    B HIS C 2  102  ? 45.713  -31.671 42.682  0.50 127.46 ? 102  HIS C CB    1 
ATOM   4367  C  CG    A HIS C 2  102  ? 45.209  -30.998 41.370  0.50 127.86 ? 102  HIS C CG    1 
ATOM   4368  C  CG    B HIS C 2  102  ? 46.202  -30.338 43.160  0.50 124.72 ? 102  HIS C CG    1 
ATOM   4369  N  ND1   A HIS C 2  102  ? 45.096  -31.743 40.217  0.50 130.33 ? 102  HIS C ND1   1 
ATOM   4370  N  ND1   B HIS C 2  102  ? 47.047  -30.197 44.240  0.50 122.86 ? 102  HIS C ND1   1 
ATOM   4371  C  CD2   A HIS C 2  102  ? 44.853  -29.734 41.037  0.50 125.89 ? 102  HIS C CD2   1 
ATOM   4372  C  CD2   B HIS C 2  102  ? 45.988  -29.088 42.685  0.50 125.28 ? 102  HIS C CD2   1 
ATOM   4373  C  CE1   A HIS C 2  102  ? 44.694  -30.964 39.228  0.50 130.58 ? 102  HIS C CE1   1 
ATOM   4374  C  CE1   B HIS C 2  102  ? 47.321  -28.917 44.419  0.50 121.60 ? 102  HIS C CE1   1 
ATOM   4375  N  NE2   A HIS C 2  102  ? 44.538  -29.740 39.700  0.50 125.41 ? 102  HIS C NE2   1 
ATOM   4376  N  NE2   B HIS C 2  102  ? 46.690  -28.222 43.489  0.50 123.84 ? 102  HIS C NE2   1 
ATOM   4377  N  N     . LYS C 2  103  ? 43.076  -33.923 42.456  1.00 136.57 ? 103  LYS C N     1 
ATOM   4378  C  CA    . LYS C 2  103  ? 42.745  -35.287 42.051  1.00 137.82 ? 103  LYS C CA    1 
ATOM   4379  C  C     . LYS C 2  103  ? 43.758  -35.828 41.048  1.00 142.75 ? 103  LYS C C     1 
ATOM   4380  O  O     . LYS C 2  103  ? 44.179  -36.988 41.142  1.00 140.41 ? 103  LYS C O     1 
ATOM   4381  C  CB    . LYS C 2  103  ? 41.333  -35.335 41.465  1.00 135.00 ? 103  LYS C CB    1 
ATOM   4382  C  CG    . LYS C 2  103  ? 40.236  -34.927 42.431  1.00 130.93 ? 103  LYS C CG    1 
ATOM   4383  C  CD    . LYS C 2  103  ? 38.867  -35.030 41.776  1.00 132.99 ? 103  LYS C CD    1 
ATOM   4384  C  CE    . LYS C 2  103  ? 37.756  -34.763 42.778  1.00 128.17 ? 103  LYS C CE    1 
ATOM   4385  N  NZ    . LYS C 2  103  ? 36.407  -34.860 42.156  1.00 129.67 ? 103  LYS C NZ    1 
ATOM   4386  N  N     . ASP C 2  104  ? 44.174  -34.995 40.091  1.00 140.76 ? 104  ASP C N     1 
ATOM   4387  C  CA    . ASP C 2  104  ? 45.106  -35.430 39.054  1.00 140.58 ? 104  ASP C CA    1 
ATOM   4388  C  C     . ASP C 2  104  ? 46.538  -35.467 39.575  1.00 137.63 ? 104  ASP C C     1 
ATOM   4389  O  O     . ASP C 2  104  ? 47.187  -36.518 39.571  1.00 136.48 ? 104  ASP C O     1 
ATOM   4390  C  CB    . ASP C 2  104  ? 45.004  -34.502 37.842  1.00 140.30 ? 104  ASP C CB    1 
ATOM   4391  C  CG    . ASP C 2  104  ? 43.572  -34.178 37.481  1.00 150.18 ? 104  ASP C CG    1 
ATOM   4392  O  OD1   . ASP C 2  104  ? 42.748  -35.116 37.428  1.00 152.49 ? 104  ASP C OD1   1 
ATOM   4393  O  OD2   . ASP C 2  104  ? 43.267  -32.986 37.266  1.00 153.33 ? 104  ASP C OD2   1 
ATOM   4394  N  N     . THR C 2  105  ? 47.045  -34.316 40.027  1.00 137.53 ? 105  THR C N     1 
ATOM   4395  C  CA    . THR C 2  105  ? 48.424  -34.232 40.499  1.00 135.61 ? 105  THR C CA    1 
ATOM   4396  C  C     . THR C 2  105  ? 48.686  -35.189 41.654  1.00 134.43 ? 105  THR C C     1 
ATOM   4397  O  O     . THR C 2  105  ? 49.827  -35.620 41.857  1.00 130.69 ? 105  THR C O     1 
ATOM   4398  C  CB    . THR C 2  105  ? 48.744  -32.797 40.926  1.00 131.07 ? 105  THR C CB    1 
ATOM   4399  O  OG1   . THR C 2  105  ? 48.236  -31.879 39.950  1.00 129.53 ? 105  THR C OG1   1 
ATOM   4400  C  CG2   . THR C 2  105  ? 50.243  -32.597 41.063  1.00 126.53 ? 105  THR C CG2   1 
ATOM   4401  N  N     . GLY C 2  106  ? 47.649  -35.537 42.418  1.00 135.01 ? 106  GLY C N     1 
ATOM   4402  C  CA    . GLY C 2  106  ? 47.827  -36.266 43.653  1.00 136.57 ? 106  GLY C CA    1 
ATOM   4403  C  C     . GLY C 2  106  ? 48.484  -35.474 44.760  1.00 134.96 ? 106  GLY C C     1 
ATOM   4404  O  O     . GLY C 2  106  ? 48.556  -35.969 45.894  1.00 128.46 ? 106  GLY C O     1 
ATOM   4405  N  N     . LEU C 2  107  ? 48.958  -34.260 44.470  1.00 134.58 ? 107  LEU C N     1 
ATOM   4406  C  CA    . LEU C 2  107  ? 49.627  -33.429 45.461  1.00 132.54 ? 107  LEU C CA    1 
ATOM   4407  C  C     . LEU C 2  107  ? 48.699  -33.137 46.635  1.00 127.72 ? 107  LEU C C     1 
ATOM   4408  O  O     . LEU C 2  107  ? 47.512  -32.846 46.457  1.00 120.90 ? 107  LEU C O     1 
ATOM   4409  C  CB    . LEU C 2  107  ? 50.101  -32.122 44.812  1.00 128.78 ? 107  LEU C CB    1 
ATOM   4410  C  CG    . LEU C 2  107  ? 50.806  -31.069 45.672  1.00 125.66 ? 107  LEU C CG    1 
ATOM   4411  C  CD1   . LEU C 2  107  ? 52.024  -31.664 46.358  1.00 125.52 ? 107  LEU C CD1   1 
ATOM   4412  C  CD2   . LEU C 2  107  ? 51.200  -29.860 44.829  1.00 121.36 ? 107  LEU C CD2   1 
ATOM   4413  N  N     . ILE C 2  108  ? 49.249  -33.229 47.842  1.00 121.56 ? 108  ILE C N     1 
ATOM   4414  C  CA    . ILE C 2  108  ? 48.495  -33.045 49.074  1.00 115.93 ? 108  ILE C CA    1 
ATOM   4415  C  C     . ILE C 2  108  ? 49.206  -31.991 49.911  1.00 109.46 ? 108  ILE C C     1 
ATOM   4416  O  O     . ILE C 2  108  ? 50.362  -32.181 50.306  1.00 110.47 ? 108  ILE C O     1 
ATOM   4417  C  CB    . ILE C 2  108  ? 48.346  -34.361 49.854  1.00 114.35 ? 108  ILE C CB    1 
ATOM   4418  C  CG1   . ILE C 2  108  ? 47.761  -35.446 48.942  1.00 114.68 ? 108  ILE C CG1   1 
ATOM   4419  C  CG2   . ILE C 2  108  ? 47.470  -34.158 51.083  1.00 108.22 ? 108  ILE C CG2   1 
ATOM   4420  C  CD1   . ILE C 2  108  ? 47.783  -36.834 49.535  1.00 112.02 ? 108  ILE C CD1   1 
ATOM   4421  N  N     . LYS C 2  109  ? 48.524  -30.876 50.162  1.00 105.84 ? 109  LYS C N     1 
ATOM   4422  C  CA    . LYS C 2  109  ? 49.030  -29.798 51.003  1.00 106.24 ? 109  LYS C CA    1 
ATOM   4423  C  C     . LYS C 2  109  ? 48.047  -29.587 52.149  1.00 101.51 ? 109  LYS C C     1 
ATOM   4424  O  O     . LYS C 2  109  ? 46.866  -29.304 51.915  1.00 101.80 ? 109  LYS C O     1 
ATOM   4425  C  CB    . LYS C 2  109  ? 49.217  -28.514 50.188  1.00 102.95 ? 109  LYS C CB    1 
ATOM   4426  C  CG    . LYS C 2  109  ? 49.384  -27.250 51.021  1.00 105.20 ? 109  LYS C CG    1 
ATOM   4427  C  CD    . LYS C 2  109  ? 50.618  -27.312 51.908  1.00 105.68 ? 109  LYS C CD    1 
ATOM   4428  C  CE    . LYS C 2  109  ? 50.713  -26.087 52.805  1.00 101.13 ? 109  LYS C CE    1 
ATOM   4429  N  NZ    . LYS C 2  109  ? 51.884  -26.161 53.723  1.00 103.83 ? 109  LYS C NZ    1 
ATOM   4430  N  N     . GLU C 2  110  ? 48.527  -29.736 53.384  1.00 93.58  ? 110  GLU C N     1 
ATOM   4431  C  CA    . GLU C 2  110  ? 47.674  -29.641 54.560  1.00 95.85  ? 110  GLU C CA    1 
ATOM   4432  C  C     . GLU C 2  110  ? 48.217  -28.594 55.525  1.00 91.39  ? 110  GLU C C     1 
ATOM   4433  O  O     . GLU C 2  110  ? 49.434  -28.429 55.665  1.00 86.46  ? 110  GLU C O     1 
ATOM   4434  C  CB    . GLU C 2  110  ? 47.532  -31.003 55.254  1.00 86.80  ? 110  GLU C CB    1 
ATOM   4435  C  CG    . GLU C 2  110  ? 48.537  -31.294 56.347  1.00 90.13  ? 110  GLU C CG    1 
ATOM   4436  C  CD    . GLU C 2  110  ? 48.231  -32.597 57.055  1.00 98.12  ? 110  GLU C CD    1 
ATOM   4437  O  OE1   . GLU C 2  110  ? 48.610  -32.743 58.239  1.00 92.06  ? 110  GLU C OE1   1 
ATOM   4438  O  OE2   . GLU C 2  110  ? 47.599  -33.474 56.423  1.00 99.09  ? 110  GLU C OE2   1 
ATOM   4439  N  N     . ASP C 2  111  ? 47.300  -27.881 56.178  1.00 84.72  ? 111  ASP C N     1 
ATOM   4440  C  CA    . ASP C 2  111  ? 47.653  -26.739 57.009  1.00 87.75  ? 111  ASP C CA    1 
ATOM   4441  C  C     . ASP C 2  111  ? 46.573  -26.515 58.065  1.00 86.34  ? 111  ASP C C     1 
ATOM   4442  O  O     . ASP C 2  111  ? 45.408  -26.882 57.879  1.00 87.64  ? 111  ASP C O     1 
ATOM   4443  C  CB    . ASP C 2  111  ? 47.836  -25.479 56.150  1.00 91.97  ? 111  ASP C CB    1 
ATOM   4444  C  CG    . ASP C 2  111  ? 48.509  -24.341 56.903  1.00 96.10  ? 111  ASP C CG    1 
ATOM   4445  O  OD1   . ASP C 2  111  ? 48.870  -24.529 58.086  1.00 93.40  ? 111  ASP C OD1   1 
ATOM   4446  O  OD2   . ASP C 2  111  ? 48.696  -23.261 56.299  1.00 98.41  ? 111  ASP C OD2   1 
ATOM   4447  N  N     . GLU C 2  112  ? 46.971  -25.900 59.173  1.00 80.76  ? 112  GLU C N     1 
ATOM   4448  C  CA    . GLU C 2  112  ? 46.047  -25.521 60.234  1.00 77.55  ? 112  GLU C CA    1 
ATOM   4449  C  C     . GLU C 2  112  ? 45.669  -24.058 60.034  1.00 78.56  ? 112  GLU C C     1 
ATOM   4450  O  O     . GLU C 2  112  ? 46.468  -23.161 60.323  1.00 76.67  ? 112  GLU C O     1 
ATOM   4451  C  CB    . GLU C 2  112  ? 46.677  -25.742 61.606  1.00 71.27  ? 112  GLU C CB    1 
ATOM   4452  C  CG    . GLU C 2  112  ? 45.783  -25.315 62.759  1.00 74.76  ? 112  GLU C CG    1 
ATOM   4453  C  CD    . GLU C 2  112  ? 46.431  -25.503 64.120  1.00 76.26  ? 112  GLU C CD    1 
ATOM   4454  O  OE1   . GLU C 2  112  ? 47.425  -24.806 64.418  1.00 77.07  ? 112  GLU C OE1   1 
ATOM   4455  O  OE2   . GLU C 2  112  ? 45.944  -26.354 64.895  1.00 77.02  ? 112  GLU C OE2   1 
ATOM   4456  N  N     . VAL C 2  113  ? 44.451  -23.813 59.555  1.00 70.99  ? 113  VAL C N     1 
ATOM   4457  C  CA    . VAL C 2  113  ? 44.018  -22.461 59.219  1.00 76.97  ? 113  VAL C CA    1 
ATOM   4458  C  C     . VAL C 2  113  ? 43.212  -21.881 60.371  1.00 73.33  ? 113  VAL C C     1 
ATOM   4459  O  O     . VAL C 2  113  ? 42.476  -22.589 61.071  1.00 78.05  ? 113  VAL C O     1 
ATOM   4460  C  CB    . VAL C 2  113  ? 43.213  -22.434 57.904  1.00 78.26  ? 113  VAL C CB    1 
ATOM   4461  C  CG1   . VAL C 2  113  ? 44.080  -22.889 56.756  1.00 73.03  ? 113  VAL C CG1   1 
ATOM   4462  C  CG2   . VAL C 2  113  ? 41.987  -23.311 58.016  1.00 83.54  ? 113  VAL C CG2   1 
ATOM   4463  N  N     . PHE C 2  114  ? 43.351  -20.572 60.563  1.00 73.57  ? 114  PHE C N     1 
ATOM   4464  C  CA    . PHE C 2  114  ? 42.760  -19.855 61.686  1.00 69.92  ? 114  PHE C CA    1 
ATOM   4465  C  C     . PHE C 2  114  ? 41.434  -19.240 61.254  1.00 70.72  ? 114  PHE C C     1 
ATOM   4466  O  O     . PHE C 2  114  ? 41.406  -18.353 60.396  1.00 79.21  ? 114  PHE C O     1 
ATOM   4467  C  CB    . PHE C 2  114  ? 43.728  -18.782 62.185  1.00 67.48  ? 114  PHE C CB    1 
ATOM   4468  C  CG    . PHE C 2  114  ? 43.116  -17.795 63.122  1.00 75.66  ? 114  PHE C CG    1 
ATOM   4469  C  CD1   . PHE C 2  114  ? 42.856  -18.140 64.432  1.00 70.31  ? 114  PHE C CD1   1 
ATOM   4470  C  CD2   . PHE C 2  114  ? 42.821  -16.512 62.699  1.00 81.57  ? 114  PHE C CD2   1 
ATOM   4471  C  CE1   . PHE C 2  114  ? 42.302  -17.230 65.303  1.00 68.72  ? 114  PHE C CE1   1 
ATOM   4472  C  CE2   . PHE C 2  114  ? 42.264  -15.597 63.568  1.00 77.93  ? 114  PHE C CE2   1 
ATOM   4473  C  CZ    . PHE C 2  114  ? 42.004  -15.956 64.871  1.00 71.20  ? 114  PHE C CZ    1 
ATOM   4474  N  N     . LEU C 2  115  ? 40.341  -19.694 61.863  1.00 74.00  ? 115  LEU C N     1 
ATOM   4475  C  CA    . LEU C 2  115  ? 38.998  -19.312 61.447  1.00 76.44  ? 115  LEU C CA    1 
ATOM   4476  C  C     . LEU C 2  115  ? 38.395  -18.173 62.272  1.00 77.42  ? 115  LEU C C     1 
ATOM   4477  O  O     . LEU C 2  115  ? 37.217  -17.858 62.085  1.00 78.89  ? 115  LEU C O     1 
ATOM   4478  C  CB    . LEU C 2  115  ? 38.071  -20.530 61.504  1.00 64.23  ? 115  LEU C CB    1 
ATOM   4479  C  CG    . LEU C 2  115  ? 38.483  -21.690 60.607  1.00 61.64  ? 115  LEU C CG    1 
ATOM   4480  C  CD1   . LEU C 2  115  ? 37.499  -22.837 60.712  1.00 61.69  ? 115  LEU C CD1   1 
ATOM   4481  C  CD2   . LEU C 2  115  ? 38.586  -21.203 59.186  1.00 69.52  ? 115  LEU C CD2   1 
ATOM   4482  N  N     . GLY C 2  116  ? 39.158  -17.549 63.170  1.00 68.91  ? 116  GLY C N     1 
ATOM   4483  C  CA    . GLY C 2  116  ? 38.622  -16.517 64.043  1.00 65.65  ? 116  GLY C CA    1 
ATOM   4484  C  C     . GLY C 2  116  ? 38.277  -17.068 65.411  1.00 69.55  ? 116  GLY C C     1 
ATOM   4485  O  O     . GLY C 2  116  ? 38.644  -18.185 65.774  1.00 68.81  ? 116  GLY C O     1 
ATOM   4486  N  N     . HIS C 2  117  ? 37.533  -16.275 66.179  1.00 73.01  ? 117  HIS C N     1 
ATOM   4487  C  CA    . HIS C 2  117  ? 37.233  -16.620 67.564  1.00 61.04  ? 117  HIS C CA    1 
ATOM   4488  C  C     . HIS C 2  117  ? 35.769  -17.007 67.760  1.00 59.32  ? 117  HIS C C     1 
ATOM   4489  O  O     . HIS C 2  117  ? 34.871  -16.477 67.099  1.00 70.17  ? 117  HIS C O     1 
ATOM   4490  C  CB    . HIS C 2  117  ? 37.583  -15.462 68.493  1.00 57.83  ? 117  HIS C CB    1 
ATOM   4491  C  CG    . HIS C 2  117  ? 39.052  -15.223 68.628  1.00 62.03  ? 117  HIS C CG    1 
ATOM   4492  N  ND1   . HIS C 2  117  ? 39.751  -15.516 69.779  1.00 62.99  ? 117  HIS C ND1   1 
ATOM   4493  C  CD2   . HIS C 2  117  ? 39.956  -14.717 67.758  1.00 66.55  ? 117  HIS C CD2   1 
ATOM   4494  C  CE1   . HIS C 2  117  ? 41.024  -15.201 69.612  1.00 62.87  ? 117  HIS C CE1   1 
ATOM   4495  N  NE2   . HIS C 2  117  ? 41.174  -14.711 68.395  1.00 67.20  ? 117  HIS C NE2   1 
ATOM   4496  N  N     . ILE C 2  118  ? 35.542  -17.929 68.683  1.00 54.30  ? 118  ILE C N     1 
ATOM   4497  C  CA    . ILE C 2  118  ? 34.201  -18.338 69.104  1.00 65.57  ? 118  ILE C CA    1 
ATOM   4498  C  C     . ILE C 2  118  ? 33.978  -17.870 70.537  1.00 59.74  ? 118  ILE C C     1 
ATOM   4499  O  O     . ILE C 2  118  ? 34.826  -18.129 71.397  1.00 52.91  ? 118  ILE C O     1 
ATOM   4500  C  CB    . ILE C 2  118  ? 34.011  -19.861 69.006  1.00 65.89  ? 118  ILE C CB    1 
ATOM   4501  C  CG1   . ILE C 2  118  ? 33.951  -20.301 67.552  1.00 67.04  ? 118  ILE C CG1   1 
ATOM   4502  C  CG2   . ILE C 2  118  ? 32.749  -20.295 69.737  1.00 58.67  ? 118  ILE C CG2   1 
ATOM   4503  C  CD1   . ILE C 2  118  ? 33.436  -21.706 67.416  1.00 77.86  ? 118  ILE C CD1   1 
ATOM   4504  N  N     . PRO C 2  119  ? 32.857  -17.211 70.841  1.00 65.94  ? 119  PRO C N     1 
ATOM   4505  C  CA    . PRO C 2  119  ? 32.615  -16.748 72.217  1.00 63.05  ? 119  PRO C CA    1 
ATOM   4506  C  C     . PRO C 2  119  ? 32.426  -17.906 73.184  1.00 55.70  ? 119  PRO C C     1 
ATOM   4507  O  O     . PRO C 2  119  ? 31.763  -18.897 72.873  1.00 60.39  ? 119  PRO C O     1 
ATOM   4508  C  CB    . PRO C 2  119  ? 31.332  -15.917 72.093  1.00 60.51  ? 119  PRO C CB    1 
ATOM   4509  C  CG    . PRO C 2  119  ? 31.244  -15.561 70.644  1.00 59.31  ? 119  PRO C CG    1 
ATOM   4510  C  CD    . PRO C 2  119  ? 31.833  -16.722 69.908  1.00 61.56  ? 119  PRO C CD    1 
ATOM   4511  N  N     . LEU C 2  120  ? 33.015  -17.772 74.367  1.00 50.06  ? 120  LEU C N     1 
ATOM   4512  C  CA    . LEU C 2  120  ? 32.945  -18.803 75.395  1.00 56.93  ? 120  LEU C CA    1 
ATOM   4513  C  C     . LEU C 2  120  ? 31.888  -18.465 76.440  1.00 64.18  ? 120  LEU C C     1 
ATOM   4514  O  O     . LEU C 2  120  ? 31.730  -17.305 76.837  1.00 64.41  ? 120  LEU C O     1 
ATOM   4515  C  CB    . LEU C 2  120  ? 34.301  -18.984 76.078  1.00 58.55  ? 120  LEU C CB    1 
ATOM   4516  C  CG    . LEU C 2  120  ? 35.383  -19.603 75.199  1.00 59.57  ? 120  LEU C CG    1 
ATOM   4517  C  CD1   . LEU C 2  120  ? 36.647  -19.813 75.997  1.00 62.89  ? 120  LEU C CD1   1 
ATOM   4518  C  CD2   . LEU C 2  120  ? 34.895  -20.909 74.596  1.00 52.76  ? 120  LEU C CD2   1 
ATOM   4519  N  N     . MET C 2  121  ? 31.171  -19.494 76.885  1.00 65.15  ? 121  MET C N     1 
ATOM   4520  C  CA    . MET C 2  121  ? 30.199  -19.349 77.961  1.00 65.93  ? 121  MET C CA    1 
ATOM   4521  C  C     . MET C 2  121  ? 30.913  -19.358 79.305  1.00 63.23  ? 121  MET C C     1 
ATOM   4522  O  O     . MET C 2  121  ? 31.895  -20.079 79.491  1.00 66.58  ? 121  MET C O     1 
ATOM   4523  C  CB    . MET C 2  121  ? 29.168  -20.480 77.896  1.00 61.11  ? 121  MET C CB    1 
ATOM   4524  C  CG    . MET C 2  121  ? 28.203  -20.540 79.057  1.00 63.30  ? 121  MET C CG    1 
ATOM   4525  S  SD    . MET C 2  121  ? 27.011  -21.888 78.912  1.00 69.07  ? 121  MET C SD    1 
ATOM   4526  C  CE    . MET C 2  121  ? 26.018  -21.360 77.511  1.00 57.40  ? 121  MET C CE    1 
ATOM   4527  N  N     . THR C 2  122  ? 30.429  -18.543 80.241  1.00 65.89  ? 122  THR C N     1 
ATOM   4528  C  CA    . THR C 2  122  ? 31.048  -18.494 81.556  1.00 69.02  ? 122  THR C CA    1 
ATOM   4529  C  C     . THR C 2  122  ? 30.487  -19.604 82.439  1.00 68.06  ? 122  THR C C     1 
ATOM   4530  O  O     . THR C 2  122  ? 29.576  -20.343 82.057  1.00 66.77  ? 122  THR C O     1 
ATOM   4531  C  CB    . THR C 2  122  ? 30.845  -17.131 82.210  1.00 69.22  ? 122  THR C CB    1 
ATOM   4532  O  OG1   . THR C 2  122  ? 29.455  -16.942 82.508  1.00 69.77  ? 122  THR C OG1   1 
ATOM   4533  C  CG2   . THR C 2  122  ? 31.339  -16.024 81.285  1.00 64.04  ? 122  THR C CG2   1 
ATOM   4534  N  N     . GLU C 2  123  ? 31.050  -19.715 83.643  1.00 68.16  ? 123  GLU C N     1 
ATOM   4535  C  CA    . GLU C 2  123  ? 30.677  -20.799 84.543  1.00 74.26  ? 123  GLU C CA    1 
ATOM   4536  C  C     . GLU C 2  123  ? 29.173  -20.834 84.772  1.00 73.76  ? 123  GLU C C     1 
ATOM   4537  O  O     . GLU C 2  123  ? 28.567  -21.911 84.792  1.00 72.88  ? 123  GLU C O     1 
ATOM   4538  C  CB    . GLU C 2  123  ? 31.426  -20.646 85.868  1.00 83.21  ? 123  GLU C CB    1 
ATOM   4539  C  CG    . GLU C 2  123  ? 31.815  -21.954 86.539  1.00 86.20  ? 123  GLU C CG    1 
ATOM   4540  C  CD    . GLU C 2  123  ? 32.712  -21.740 87.754  1.00 98.85  ? 123  GLU C CD    1 
ATOM   4541  O  OE1   . GLU C 2  123  ? 32.979  -22.728 88.475  1.00 99.99  ? 123  GLU C OE1   1 
ATOM   4542  O  OE2   . GLU C 2  123  ? 33.151  -20.587 87.986  1.00 89.99  ? 123  GLU C OE2   1 
ATOM   4543  N  N     . ASP C 2  124  ? 28.551  -19.663 84.905  1.00 75.78  ? 124  ASP C N     1 
ATOM   4544  C  CA    . ASP C 2  124  ? 27.138  -19.549 85.243  1.00 71.04  ? 124  ASP C CA    1 
ATOM   4545  C  C     . ASP C 2  124  ? 26.218  -19.610 84.034  1.00 68.29  ? 124  ASP C C     1 
ATOM   4546  O  O     . ASP C 2  124  ? 25.011  -19.408 84.190  1.00 66.90  ? 124  ASP C O     1 
ATOM   4547  C  CB    . ASP C 2  124  ? 26.880  -18.242 85.989  1.00 70.89  ? 124  ASP C CB    1 
ATOM   4548  C  CG    . ASP C 2  124  ? 27.226  -17.029 85.156  1.00 77.12  ? 124  ASP C CG    1 
ATOM   4549  O  OD1   . ASP C 2  124  ? 28.421  -16.854 84.821  1.00 84.90  ? 124  ASP C OD1   1 
ATOM   4550  O  OD2   . ASP C 2  124  ? 26.300  -16.258 84.821  1.00 74.91  ? 124  ASP C OD2   1 
ATOM   4551  N  N     . GLY C 2  125  ? 26.748  -19.870 82.843  1.00 69.13  ? 125  GLY C N     1 
ATOM   4552  C  CA    . GLY C 2  125  ? 25.910  -20.016 81.672  1.00 65.89  ? 125  GLY C CA    1 
ATOM   4553  C  C     . GLY C 2  125  ? 25.595  -18.744 80.922  1.00 64.28  ? 125  GLY C C     1 
ATOM   4554  O  O     . GLY C 2  125  ? 24.619  -18.715 80.163  1.00 64.86  ? 125  GLY C O     1 
ATOM   4555  N  N     . SER C 2  126  ? 26.378  -17.691 81.104  1.00 64.89  ? 126  SER C N     1 
ATOM   4556  C  CA    . SER C 2  126  ? 26.187  -16.446 80.380  1.00 63.28  ? 126  SER C CA    1 
ATOM   4557  C  C     . SER C 2  126  ? 27.360  -16.219 79.434  1.00 68.12  ? 126  SER C C     1 
ATOM   4558  O  O     . SER C 2  126  ? 28.292  -17.023 79.348  1.00 67.54  ? 126  SER C O     1 
ATOM   4559  C  CB    . SER C 2  126  ? 26.024  -15.274 81.348  1.00 67.63  ? 126  SER C CB    1 
ATOM   4560  O  OG    . SER C 2  126  ? 27.092  -15.224 82.277  1.00 72.48  ? 126  SER C OG    1 
ATOM   4561  N  N     . PHE C 2  127  ? 27.300  -15.104 78.717  1.00 69.34  ? 127  PHE C N     1 
ATOM   4562  C  CA    . PHE C 2  127  ? 28.329  -14.726 77.762  1.00 64.73  ? 127  PHE C CA    1 
ATOM   4563  C  C     . PHE C 2  127  ? 28.749  -13.287 78.006  1.00 65.18  ? 127  PHE C C     1 
ATOM   4564  O  O     . PHE C 2  127  ? 28.060  -12.525 78.683  1.00 73.57  ? 127  PHE C O     1 
ATOM   4565  C  CB    . PHE C 2  127  ? 27.845  -14.867 76.322  1.00 57.35  ? 127  PHE C CB    1 
ATOM   4566  C  CG    . PHE C 2  127  ? 27.672  -16.283 75.877  1.00 63.29  ? 127  PHE C CG    1 
ATOM   4567  C  CD1   . PHE C 2  127  ? 28.725  -16.971 75.293  1.00 64.18  ? 127  PHE C CD1   1 
ATOM   4568  C  CD2   . PHE C 2  127  ? 26.454  -16.926 76.026  1.00 61.53  ? 127  PHE C CD2   1 
ATOM   4569  C  CE1   . PHE C 2  127  ? 28.566  -18.276 74.869  1.00 64.82  ? 127  PHE C CE1   1 
ATOM   4570  C  CE2   . PHE C 2  127  ? 26.287  -18.231 75.606  1.00 63.31  ? 127  PHE C CE2   1 
ATOM   4571  C  CZ    . PHE C 2  127  ? 27.343  -18.909 75.029  1.00 64.72  ? 127  PHE C CZ    1 
ATOM   4572  N  N     . ILE C 2  128  ? 29.881  -12.915 77.422  1.00 64.46  ? 128  ILE C N     1 
ATOM   4573  C  CA    . ILE C 2  128  ? 30.369  -11.542 77.431  1.00 66.84  ? 128  ILE C CA    1 
ATOM   4574  C  C     . ILE C 2  128  ? 30.609  -11.150 75.982  1.00 69.67  ? 128  ILE C C     1 
ATOM   4575  O  O     . ILE C 2  128  ? 31.610  -11.557 75.380  1.00 67.70  ? 128  ILE C O     1 
ATOM   4576  C  CB    . ILE C 2  128  ? 31.647  -11.384 78.264  1.00 67.30  ? 128  ILE C CB    1 
ATOM   4577  C  CG1   . ILE C 2  128  ? 31.384  -11.820 79.707  1.00 63.36  ? 128  ILE C CG1   1 
ATOM   4578  C  CG2   . ILE C 2  128  ? 32.154  -9.950  78.202  1.00 69.69  ? 128  ILE C CG2   1 
ATOM   4579  C  CD1   . ILE C 2  128  ? 32.619  -11.874 80.574  1.00 65.01  ? 128  ILE C CD1   1 
ATOM   4580  N  N     . ILE C 2  129  ? 29.688  -10.382 75.415  1.00 67.24  ? 129  ILE C N     1 
ATOM   4581  C  CA    . ILE C 2  129  ? 29.788  -9.909  74.044  1.00 62.64  ? 129  ILE C CA    1 
ATOM   4582  C  C     . ILE C 2  129  ? 30.062  -8.419  74.107  1.00 74.32  ? 129  ILE C C     1 
ATOM   4583  O  O     . ILE C 2  129  ? 29.259  -7.657  74.666  1.00 76.11  ? 129  ILE C O     1 
ATOM   4584  C  CB    . ILE C 2  129  ? 28.513  -10.208 73.247  1.00 63.80  ? 129  ILE C CB    1 
ATOM   4585  C  CG1   . ILE C 2  129  ? 28.153  -11.690 73.376  1.00 69.99  ? 129  ILE C CG1   1 
ATOM   4586  C  CG2   . ILE C 2  129  ? 28.677  -9.799  71.804  1.00 60.40  ? 129  ILE C CG2   1 
ATOM   4587  C  CD1   . ILE C 2  129  ? 29.243  -12.642 72.922  1.00 65.89  ? 129  ILE C CD1   1 
ATOM   4588  N  N     . ASN C 2  130  ? 31.210  -8.012  73.566  1.00 69.73  ? 130  ASN C N     1 
ATOM   4589  C  CA    . ASN C 2  130  ? 31.631  -6.612  73.568  1.00 72.49  ? 130  ASN C CA    1 
ATOM   4590  C  C     . ASN C 2  130  ? 31.532  -6.007  74.965  1.00 70.30  ? 130  ASN C C     1 
ATOM   4591  O  O     . ASN C 2  130  ? 31.039  -4.894  75.151  1.00 76.58  ? 130  ASN C O     1 
ATOM   4592  C  CB    . ASN C 2  130  ? 30.819  -5.798  72.563  1.00 66.57  ? 130  ASN C CB    1 
ATOM   4593  C  CG    . ASN C 2  130  ? 30.823  -6.417  71.182  1.00 70.35  ? 130  ASN C CG    1 
ATOM   4594  O  OD1   . ASN C 2  130  ? 31.871  -6.827  70.673  1.00 80.61  ? 130  ASN C OD1   1 
ATOM   4595  N  ND2   . ASN C 2  130  ? 29.647  -6.500  70.570  1.00 62.33  ? 130  ASN C ND2   1 
ATOM   4596  N  N     . GLY C 2  131  ? 31.992  -6.760  75.963  1.00 67.35  ? 131  GLY C N     1 
ATOM   4597  C  CA    . GLY C 2  131  ? 32.028  -6.285  77.328  1.00 77.90  ? 131  GLY C CA    1 
ATOM   4598  C  C     . GLY C 2  131  ? 30.725  -6.365  78.092  1.00 76.34  ? 131  GLY C C     1 
ATOM   4599  O  O     . GLY C 2  131  ? 30.726  -6.101  79.301  1.00 83.30  ? 131  GLY C O     1 
ATOM   4600  N  N     . ALA C 2  132  ? 29.615  -6.718  77.443  1.00 71.12  ? 132  ALA C N     1 
ATOM   4601  C  CA    . ALA C 2  132  ? 28.312  -6.787  78.097  1.00 75.15  ? 132  ALA C CA    1 
ATOM   4602  C  C     . ALA C 2  132  ? 27.881  -8.241  78.259  1.00 74.90  ? 132  ALA C C     1 
ATOM   4603  O  O     . ALA C 2  132  ? 27.966  -9.025  77.308  1.00 74.87  ? 132  ALA C O     1 
ATOM   4604  C  CB    . ALA C 2  132  ? 27.261  -6.009  77.301  1.00 68.78  ? 132  ALA C CB    1 
ATOM   4605  N  N     . ASP C 2  133  ? 27.423  -8.599  79.458  1.00 62.65  ? 133  ASP C N     1 
ATOM   4606  C  CA    . ASP C 2  133  ? 26.949  -9.958  79.690  1.00 63.99  ? 133  ASP C CA    1 
ATOM   4607  C  C     . ASP C 2  133  ? 25.615  -10.178 78.986  1.00 67.46  ? 133  ASP C C     1 
ATOM   4608  O  O     . ASP C 2  133  ? 24.711  -9.343  79.066  1.00 75.18  ? 133  ASP C O     1 
ATOM   4609  C  CB    . ASP C 2  133  ? 26.814  -10.233 81.186  1.00 68.13  ? 133  ASP C CB    1 
ATOM   4610  C  CG    . ASP C 2  133  ? 28.160  -10.361 81.884  1.00 75.81  ? 133  ASP C CG    1 
ATOM   4611  O  OD1   . ASP C 2  133  ? 28.971  -9.411  81.797  1.00 79.01  ? 133  ASP C OD1   1 
ATOM   4612  O  OD2   . ASP C 2  133  ? 28.405  -11.407 82.527  1.00 71.63  ? 133  ASP C OD2   1 
ATOM   4613  N  N     . ARG C 2  134  ? 25.496  -11.303 78.291  1.00 60.52  ? 134  ARG C N     1 
ATOM   4614  C  CA    . ARG C 2  134  ? 24.301  -11.623 77.525  1.00 63.90  ? 134  ARG C CA    1 
ATOM   4615  C  C     . ARG C 2  134  ? 23.911  -13.080 77.748  1.00 66.46  ? 134  ARG C C     1 
ATOM   4616  O  O     . ARG C 2  134  ? 24.719  -13.906 78.178  1.00 63.11  ? 134  ARG C O     1 
ATOM   4617  C  CB    . ARG C 2  134  ? 24.509  -11.344 76.033  1.00 60.61  ? 134  ARG C CB    1 
ATOM   4618  C  CG    . ARG C 2  134  ? 24.952  -9.919  75.739  1.00 69.37  ? 134  ARG C CG    1 
ATOM   4619  C  CD    . ARG C 2  134  ? 25.034  -9.652  74.250  1.00 63.09  ? 134  ARG C CD    1 
ATOM   4620  N  NE    . ARG C 2  134  ? 23.728  -9.715  73.600  1.00 63.60  ? 134  ARG C NE    1 
ATOM   4621  C  CZ    . ARG C 2  134  ? 22.941  -8.663  73.412  1.00 61.44  ? 134  ARG C CZ    1 
ATOM   4622  N  NH1   . ARG C 2  134  ? 21.769  -8.803  72.809  1.00 59.76  ? 134  ARG C NH1   1 
ATOM   4623  N  NH2   . ARG C 2  134  ? 23.332  -7.467  73.827  1.00 61.04  ? 134  ARG C NH2   1 
ATOM   4624  N  N     . VAL C 2  135  ? 22.649  -13.383 77.449  1.00 61.07  ? 135  VAL C N     1 
ATOM   4625  C  CA    . VAL C 2  135  ? 22.083  -14.713 77.638  1.00 57.08  ? 135  VAL C CA    1 
ATOM   4626  C  C     . VAL C 2  135  ? 21.434  -15.163 76.336  1.00 60.30  ? 135  VAL C C     1 
ATOM   4627  O  O     . VAL C 2  135  ? 20.765  -14.375 75.659  1.00 65.72  ? 135  VAL C O     1 
ATOM   4628  C  CB    . VAL C 2  135  ? 21.068  -14.733 78.805  1.00 64.21  ? 135  VAL C CB    1 
ATOM   4629  C  CG1   . VAL C 2  135  ? 20.163  -15.954 78.731  1.00 60.28  ? 135  VAL C CG1   1 
ATOM   4630  C  CG2   . VAL C 2  135  ? 21.790  -14.704 80.155  1.00 60.76  ? 135  VAL C CG2   1 
ATOM   4631  N  N     . ILE C 2  136  ? 21.649  -16.420 75.967  1.00 55.15  ? 136  ILE C N     1 
ATOM   4632  C  CA    . ILE C 2  136  ? 21.011  -17.002 74.792  1.00 58.23  ? 136  ILE C CA    1 
ATOM   4633  C  C     . ILE C 2  136  ? 19.788  -17.762 75.280  1.00 58.15  ? 136  ILE C C     1 
ATOM   4634  O  O     . ILE C 2  136  ? 19.903  -18.778 75.974  1.00 62.41  ? 136  ILE C O     1 
ATOM   4635  C  CB    . ILE C 2  136  ? 21.958  -17.918 74.001  1.00 60.28  ? 136  ILE C CB    1 
ATOM   4636  C  CG1   . ILE C 2  136  ? 23.205  -17.160 73.545  1.00 52.14  ? 136  ILE C CG1   1 
ATOM   4637  C  CG2   . ILE C 2  136  ? 21.250  -18.489 72.787  1.00 50.00  ? 136  ILE C CG2   1 
ATOM   4638  C  CD1   . ILE C 2  136  ? 22.911  -16.085 72.563  1.00 48.91  ? 136  ILE C CD1   1 
ATOM   4639  N  N     . VAL C 2  137  ? 18.619  -17.279 74.901  1.00 57.42  ? 137  VAL C N     1 
ATOM   4640  C  CA    . VAL C 2  137  ? 17.360  -17.803 75.402  1.00 61.68  ? 137  VAL C CA    1 
ATOM   4641  C  C     . VAL C 2  137  ? 16.927  -18.971 74.532  1.00 55.03  ? 137  VAL C C     1 
ATOM   4642  O  O     . VAL C 2  137  ? 16.846  -18.850 73.304  1.00 60.48  ? 137  VAL C O     1 
ATOM   4643  C  CB    . VAL C 2  137  ? 16.289  -16.701 75.433  1.00 59.48  ? 137  VAL C CB    1 
ATOM   4644  C  CG1   . VAL C 2  137  ? 14.903  -17.300 75.605  1.00 65.33  ? 137  VAL C CG1   1 
ATOM   4645  C  CG2   . VAL C 2  137  ? 16.591  -15.746 76.566  1.00 56.07  ? 137  VAL C CG2   1 
ATOM   4646  N  N     . SER C 2  138  ? 16.647  -20.104 75.174  1.00 60.01  ? 138  SER C N     1 
ATOM   4647  C  CA    . SER C 2  138  ? 16.148  -21.275 74.471  1.00 58.12  ? 138  SER C CA    1 
ATOM   4648  C  C     . SER C 2  138  ? 14.865  -20.936 73.730  1.00 61.37  ? 138  SER C C     1 
ATOM   4649  O  O     . SER C 2  138  ? 14.085  -20.081 74.154  1.00 65.54  ? 138  SER C O     1 
ATOM   4650  C  CB    . SER C 2  138  ? 15.900  -22.413 75.455  1.00 58.77  ? 138  SER C CB    1 
ATOM   4651  O  OG    . SER C 2  138  ? 17.039  -22.624 76.265  1.00 66.49  ? 138  SER C OG    1 
ATOM   4652  N  N     . GLN C 2  139  ? 14.648  -21.610 72.606  1.00 61.46  ? 139  GLN C N     1 
ATOM   4653  C  CA    . GLN C 2  139  ? 13.479  -21.352 71.780  1.00 62.04  ? 139  GLN C CA    1 
ATOM   4654  C  C     . GLN C 2  139  ? 12.612  -22.595 71.707  1.00 62.57  ? 139  GLN C C     1 
ATOM   4655  O  O     . GLN C 2  139  ? 13.117  -23.693 71.482  1.00 63.60  ? 139  GLN C O     1 
ATOM   4656  C  CB    . GLN C 2  139  ? 13.878  -20.923 70.373  1.00 70.62  ? 139  GLN C CB    1 
ATOM   4657  C  CG    . GLN C 2  139  ? 12.691  -20.687 69.466  1.00 71.96  ? 139  GLN C CG    1 
ATOM   4658  C  CD    . GLN C 2  139  ? 13.082  -19.976 68.203  1.00 82.21  ? 139  GLN C CD    1 
ATOM   4659  O  OE1   . GLN C 2  139  ? 14.175  -20.182 67.676  1.00 83.09  ? 139  GLN C OE1   1 
ATOM   4660  N  NE2   . GLN C 2  139  ? 12.199  -19.120 67.711  1.00 94.17  ? 139  GLN C NE2   1 
ATOM   4661  N  N     . ILE C 2  140  ? 11.323  -22.426 71.878  1.00 63.48  ? 140  ILE C N     1 
ATOM   4662  C  CA    . ILE C 2  140  ? 10.391  -23.530 71.700  1.00 65.54  ? 140  ILE C CA    1 
ATOM   4663  C  C     . ILE C 2  140  ? 9.884   -23.492 70.264  1.00 62.48  ? 140  ILE C C     1 
ATOM   4664  O  O     . ILE C 2  140  ? 9.702   -22.413 69.685  1.00 67.21  ? 140  ILE C O     1 
ATOM   4665  C  CB    . ILE C 2  140  ? 9.248   -23.446 72.731  1.00 61.06  ? 140  ILE C CB    1 
ATOM   4666  C  CG1   . ILE C 2  140  ? 8.408   -24.724 72.740  1.00 59.68  ? 140  ILE C CG1   1 
ATOM   4667  C  CG2   . ILE C 2  140  ? 8.395   -22.219 72.491  1.00 53.95  ? 140  ILE C CG2   1 
ATOM   4668  C  CD1   . ILE C 2  140  ? 7.546   -24.858 73.994  1.00 57.72  ? 140  ILE C CD1   1 
ATOM   4669  N  N     . HIS C 2  141  ? 9.712   -24.664 69.655  1.00 62.56  ? 141  HIS C N     1 
ATOM   4670  C  CA    . HIS C 2  141  ? 9.170   -24.690 68.302  1.00 60.47  ? 141  HIS C CA    1 
ATOM   4671  C  C     . HIS C 2  141  ? 8.558   -26.052 68.029  1.00 58.67  ? 141  HIS C C     1 
ATOM   4672  O  O     . HIS C 2  141  ? 8.731   -27.002 68.794  1.00 59.36  ? 141  HIS C O     1 
ATOM   4673  C  CB    . HIS C 2  141  ? 10.231  -24.356 67.251  1.00 52.50  ? 141  HIS C CB    1 
ATOM   4674  C  CG    . HIS C 2  141  ? 11.287  -25.405 67.096  1.00 63.95  ? 141  HIS C CG    1 
ATOM   4675  N  ND1   . HIS C 2  141  ? 11.759  -25.808 65.865  1.00 66.66  ? 141  HIS C ND1   1 
ATOM   4676  C  CD2   . HIS C 2  141  ? 11.976  -26.123 68.014  1.00 67.93  ? 141  HIS C CD2   1 
ATOM   4677  C  CE1   . HIS C 2  141  ? 12.687  -26.732 66.030  1.00 69.55  ? 141  HIS C CE1   1 
ATOM   4678  N  NE2   . HIS C 2  141  ? 12.839  -26.941 67.326  1.00 66.98  ? 141  HIS C NE2   1 
ATOM   4679  N  N     . ARG C 2  142  ? 7.810   -26.121 66.932  1.00 63.74  ? 142  ARG C N     1 
ATOM   4680  C  CA    . ARG C 2  142  ? 7.265   -27.390 66.478  1.00 66.13  ? 142  ARG C CA    1 
ATOM   4681  C  C     . ARG C 2  142  ? 8.398   -28.317 66.060  1.00 68.88  ? 142  ARG C C     1 
ATOM   4682  O  O     . ARG C 2  142  ? 9.248   -27.948 65.242  1.00 69.04  ? 142  ARG C O     1 
ATOM   4683  C  CB    . ARG C 2  142  ? 6.309   -27.179 65.309  1.00 63.35  ? 142  ARG C CB    1 
ATOM   4684  C  CG    . ARG C 2  142  ? 5.076   -26.387 65.649  1.00 70.30  ? 142  ARG C CG    1 
ATOM   4685  C  CD    . ARG C 2  142  ? 4.099   -26.461 64.500  1.00 77.29  ? 142  ARG C CD    1 
ATOM   4686  N  NE    . ARG C 2  142  ? 3.661   -27.833 64.277  1.00 78.07  ? 142  ARG C NE    1 
ATOM   4687  C  CZ    . ARG C 2  142  ? 3.060   -28.251 63.170  1.00 75.23  ? 142  ARG C CZ    1 
ATOM   4688  N  NH1   . ARG C 2  142  ? 2.835   -27.403 62.177  1.00 78.73  ? 142  ARG C NH1   1 
ATOM   4689  N  NH2   . ARG C 2  142  ? 2.690   -29.518 63.056  1.00 71.33  ? 142  ARG C NH2   1 
ATOM   4690  N  N     . SER C 2  143  ? 8.407   -29.520 66.626  1.00 71.42  ? 143  SER C N     1 
ATOM   4691  C  CA    . SER C 2  143  ? 9.440   -30.487 66.314  1.00 67.31  ? 143  SER C CA    1 
ATOM   4692  C  C     . SER C 2  143  ? 9.304   -30.956 64.871  1.00 75.94  ? 143  SER C C     1 
ATOM   4693  O  O     . SER C 2  143  ? 8.193   -31.053 64.345  1.00 74.22  ? 143  SER C O     1 
ATOM   4694  C  CB    . SER C 2  143  ? 9.346   -31.689 67.246  1.00 71.69  ? 143  SER C CB    1 
ATOM   4695  O  OG    . SER C 2  143  ? 10.252  -32.706 66.861  1.00 77.24  ? 143  SER C OG    1 
ATOM   4696  N  N     . PRO C 2  144  ? 10.423  -31.237 64.207  1.00 72.97  ? 144  PRO C N     1 
ATOM   4697  C  CA    . PRO C 2  144  ? 10.354  -31.907 62.907  1.00 75.23  ? 144  PRO C CA    1 
ATOM   4698  C  C     . PRO C 2  144  ? 9.662   -33.259 63.035  1.00 79.13  ? 144  PRO C C     1 
ATOM   4699  O  O     . PRO C 2  144  ? 9.628   -33.869 64.107  1.00 75.87  ? 144  PRO C O     1 
ATOM   4700  C  CB    . PRO C 2  144  ? 11.828  -32.061 62.511  1.00 79.91  ? 144  PRO C CB    1 
ATOM   4701  C  CG    . PRO C 2  144  ? 12.536  -30.975 63.264  1.00 77.86  ? 144  PRO C CG    1 
ATOM   4702  C  CD    . PRO C 2  144  ? 11.798  -30.847 64.563  1.00 72.98  ? 144  PRO C CD    1 
ATOM   4703  N  N     . GLY C 2  145  ? 9.089   -33.717 61.935  1.00 80.91  ? 145  GLY C N     1 
ATOM   4704  C  CA    . GLY C 2  145  ? 8.449   -35.013 61.905  1.00 80.11  ? 145  GLY C CA    1 
ATOM   4705  C  C     . GLY C 2  145  ? 7.306   -35.036 60.911  1.00 79.89  ? 145  GLY C C     1 
ATOM   4706  O  O     . GLY C 2  145  ? 7.161   -34.153 60.069  1.00 75.95  ? 145  GLY C O     1 
ATOM   4707  N  N     . VAL C 2  146  ? 6.495   -36.081 61.035  1.00 83.52  ? 146  VAL C N     1 
ATOM   4708  C  CA    . VAL C 2  146  ? 5.348   -36.312 60.169  1.00 82.37  ? 146  VAL C CA    1 
ATOM   4709  C  C     . VAL C 2  146  ? 4.098   -36.216 61.029  1.00 83.31  ? 146  VAL C C     1 
ATOM   4710  O  O     . VAL C 2  146  ? 3.932   -36.984 61.985  1.00 83.25  ? 146  VAL C O     1 
ATOM   4711  C  CB    . VAL C 2  146  ? 5.434   -37.674 59.465  1.00 80.89  ? 146  VAL C CB    1 
ATOM   4712  C  CG1   . VAL C 2  146  ? 4.158   -37.951 58.695  1.00 80.38  ? 146  VAL C CG1   1 
ATOM   4713  C  CG2   . VAL C 2  146  ? 6.638   -37.716 58.544  1.00 81.46  ? 146  VAL C CG2   1 
ATOM   4714  N  N     . TYR C 2  147  ? 3.222   -35.278 60.689  1.00 80.12  ? 147  TYR C N     1 
ATOM   4715  C  CA    . TYR C 2  147  ? 2.029   -34.992 61.461  1.00 78.08  ? 147  TYR C CA    1 
ATOM   4716  C  C     . TYR C 2  147  ? 0.798   -35.198 60.597  1.00 81.52  ? 147  TYR C C     1 
ATOM   4717  O  O     . TYR C 2  147  ? 0.863   -35.160 59.368  1.00 78.52  ? 147  TYR C O     1 
ATOM   4718  C  CB    . TYR C 2  147  ? 2.052   -33.560 62.001  1.00 76.79  ? 147  TYR C CB    1 
ATOM   4719  C  CG    . TYR C 2  147  ? 3.183   -33.292 62.961  1.00 78.25  ? 147  TYR C CG    1 
ATOM   4720  C  CD1   . TYR C 2  147  ? 3.116   -33.722 64.278  1.00 77.45  ? 147  TYR C CD1   1 
ATOM   4721  C  CD2   . TYR C 2  147  ? 4.321   -32.611 62.552  1.00 78.76  ? 147  TYR C CD2   1 
ATOM   4722  C  CE1   . TYR C 2  147  ? 4.149   -33.478 65.163  1.00 74.83  ? 147  TYR C CE1   1 
ATOM   4723  C  CE2   . TYR C 2  147  ? 5.359   -32.363 63.431  1.00 77.67  ? 147  TYR C CE2   1 
ATOM   4724  C  CZ    . TYR C 2  147  ? 5.266   -32.798 64.735  1.00 72.60  ? 147  TYR C CZ    1 
ATOM   4725  O  OH    . TYR C 2  147  ? 6.298   -32.552 65.613  1.00 76.73  ? 147  TYR C OH    1 
ATOM   4726  N  N     . PHE C 2  148  ? -0.333  -35.414 61.261  1.00 83.17  ? 148  PHE C N     1 
ATOM   4727  C  CA    . PHE C 2  148  ? -1.611  -35.582 60.583  1.00 84.60  ? 148  PHE C CA    1 
ATOM   4728  C  C     . PHE C 2  148  ? -2.647  -34.754 61.326  1.00 90.21  ? 148  PHE C C     1 
ATOM   4729  O  O     . PHE C 2  148  ? -2.874  -34.965 62.522  1.00 90.71  ? 148  PHE C O     1 
ATOM   4730  C  CB    . PHE C 2  148  ? -2.015  -37.059 60.518  1.00 83.40  ? 148  PHE C CB    1 
ATOM   4731  C  CG    . PHE C 2  148  ? -1.015  -37.930 59.802  1.00 84.39  ? 148  PHE C CG    1 
ATOM   4732  C  CD1   . PHE C 2  148  ? 0.054   -38.490 60.486  1.00 81.84  ? 148  PHE C CD1   1 
ATOM   4733  C  CD2   . PHE C 2  148  ? -1.144  -38.187 58.445  1.00 89.62  ? 148  PHE C CD2   1 
ATOM   4734  C  CE1   . PHE C 2  148  ? 0.976   -39.288 59.831  1.00 83.62  ? 148  PHE C CE1   1 
ATOM   4735  C  CE2   . PHE C 2  148  ? -0.223  -38.986 57.782  1.00 85.98  ? 148  PHE C CE2   1 
ATOM   4736  C  CZ    . PHE C 2  148  ? 0.835   -39.537 58.477  1.00 85.74  ? 148  PHE C CZ    1 
ATOM   4737  N  N     . THR C 2  149  ? -3.245  -33.793 60.629  1.00 92.25  ? 149  THR C N     1 
ATOM   4738  C  CA    . THR C 2  149  ? -4.207  -32.898 61.248  1.00 91.02  ? 149  THR C CA    1 
ATOM   4739  C  C     . THR C 2  149  ? -5.543  -32.989 60.524  1.00 94.15  ? 149  THR C C     1 
ATOM   4740  O  O     . THR C 2  149  ? -5.589  -33.375 59.353  1.00 100.24 ? 149  THR C O     1 
ATOM   4741  C  CB    . THR C 2  149  ? -3.711  -31.445 61.231  1.00 91.41  ? 149  THR C CB    1 
ATOM   4742  O  OG1   . THR C 2  149  ? -3.094  -31.152 59.968  1.00 95.52  ? 149  THR C OG1   1 
ATOM   4743  C  CG2   . THR C 2  149  ? -2.707  -31.213 62.352  1.00 88.70  ? 149  THR C CG2   1 
ATOM   4744  N  N     . PRO C 2  150  ? -6.649  -32.658 61.187  1.00 90.85  ? 150  PRO C N     1 
ATOM   4745  C  CA    . PRO C 2  150  ? -7.932  -32.629 60.477  1.00 96.47  ? 150  PRO C CA    1 
ATOM   4746  C  C     . PRO C 2  150  ? -7.980  -31.429 59.546  1.00 103.97 ? 150  PRO C C     1 
ATOM   4747  O  O     . PRO C 2  150  ? -7.683  -30.303 59.954  1.00 106.27 ? 150  PRO C O     1 
ATOM   4748  C  CB    . PRO C 2  150  ? -8.968  -32.511 61.604  1.00 99.86  ? 150  PRO C CB    1 
ATOM   4749  C  CG    . PRO C 2  150  ? -8.205  -32.716 62.888  1.00 102.17 ? 150  PRO C CG    1 
ATOM   4750  C  CD    . PRO C 2  150  ? -6.806  -32.282 62.600  1.00 96.80  ? 150  PRO C CD    1 
ATOM   4751  N  N     . ASP C 2  151  ? -8.338  -31.679 58.290  1.00 104.05 ? 151  ASP C N     1 
ATOM   4752  C  CA    . ASP C 2  151  ? -8.548  -30.593 57.346  1.00 106.94 ? 151  ASP C CA    1 
ATOM   4753  C  C     . ASP C 2  151  ? -9.683  -29.715 57.864  1.00 105.74 ? 151  ASP C C     1 
ATOM   4754  O  O     . ASP C 2  151  ? -10.818 -30.197 57.994  1.00 106.61 ? 151  ASP C O     1 
ATOM   4755  C  CB    . ASP C 2  151  ? -8.877  -31.139 55.953  1.00 108.66 ? 151  ASP C CB    1 
ATOM   4756  C  CG    . ASP C 2  151  ? -8.838  -30.064 54.868  1.00 112.07 ? 151  ASP C CG    1 
ATOM   4757  O  OD1   . ASP C 2  151  ? -9.158  -28.892 55.159  1.00 114.57 ? 151  ASP C OD1   1 
ATOM   4758  O  OD2   . ASP C 2  151  ? -8.491  -30.394 53.711  1.00 112.13 ? 151  ASP C OD2   1 
ATOM   4759  N  N     . PRO C 2  152  ? -9.423  -28.447 58.195  1.00 106.42 ? 152  PRO C N     1 
ATOM   4760  C  CA    . PRO C 2  152  ? -10.495 -27.606 58.752  1.00 114.74 ? 152  PRO C CA    1 
ATOM   4761  C  C     . PRO C 2  152  ? -11.614 -27.332 57.764  1.00 113.78 ? 152  PRO C C     1 
ATOM   4762  O  O     . PRO C 2  152  ? -12.748 -27.062 58.181  1.00 107.26 ? 152  PRO C O     1 
ATOM   4763  C  CB    . PRO C 2  152  ? -9.759  -26.320 59.153  1.00 116.82 ? 152  PRO C CB    1 
ATOM   4764  C  CG    . PRO C 2  152  ? -8.543  -26.292 58.278  1.00 112.43 ? 152  PRO C CG    1 
ATOM   4765  C  CD    . PRO C 2  152  ? -8.145  -27.724 58.074  1.00 108.58 ? 152  PRO C CD    1 
ATOM   4766  N  N     . ALA C 2  153  ? -11.330 -27.398 56.463  1.00 114.09 ? 153  ALA C N     1 
ATOM   4767  C  CA    . ALA C 2  153  ? -12.375 -27.197 55.466  1.00 120.14 ? 153  ALA C CA    1 
ATOM   4768  C  C     . ALA C 2  153  ? -13.295 -28.410 55.384  1.00 119.64 ? 153  ALA C C     1 
ATOM   4769  O  O     . ALA C 2  153  ? -14.520 -28.283 55.490  1.00 118.83 ? 153  ALA C O     1 
ATOM   4770  C  CB    . ALA C 2  153  ? -11.745 -26.899 54.103  1.00 111.21 ? 153  ALA C CB    1 
ATOM   4771  N  N     . ARG C 2  154  ? -12.716 -29.601 55.219  1.00 116.94 ? 154  ARG C N     1 
ATOM   4772  C  CA    . ARG C 2  154  ? -13.476 -30.811 54.918  1.00 115.93 ? 154  ARG C CA    1 
ATOM   4773  C  C     . ARG C 2  154  ? -13.426 -31.794 56.083  1.00 117.03 ? 154  ARG C C     1 
ATOM   4774  O  O     . ARG C 2  154  ? -12.406 -32.475 56.276  1.00 115.48 ? 154  ARG C O     1 
ATOM   4775  C  CB    . ARG C 2  154  ? -12.929 -31.463 53.645  1.00 118.73 ? 154  ARG C CB    1 
ATOM   4776  C  CG    . ARG C 2  154  ? -12.900 -30.539 52.435  1.00 111.86 ? 154  ARG C CG    1 
ATOM   4777  C  CD    . ARG C 2  154  ? -11.815 -30.933 51.441  1.00 114.82 ? 154  ARG C CD    1 
ATOM   4778  N  NE    . ARG C 2  154  ? -11.830 -32.359 51.129  1.00 120.79 ? 154  ARG C NE    1 
ATOM   4779  C  CZ    . ARG C 2  154  ? -12.688 -32.935 50.291  1.00 122.85 ? 154  ARG C CZ    1 
ATOM   4780  N  NH1   . ARG C 2  154  ? -13.614 -32.209 49.677  1.00 122.52 ? 154  ARG C NH1   1 
ATOM   4781  N  NH2   . ARG C 2  154  ? -12.623 -34.241 50.072  1.00 121.38 ? 154  ARG C NH2   1 
ATOM   4782  N  N     . PRO C 2  155  ? -14.488 -31.909 56.884  1.00 118.81 ? 155  PRO C N     1 
ATOM   4783  C  CA    . PRO C 2  155  ? -14.505 -32.928 57.943  1.00 115.49 ? 155  PRO C CA    1 
ATOM   4784  C  C     . PRO C 2  155  ? -14.408 -34.323 57.347  1.00 118.47 ? 155  PRO C C     1 
ATOM   4785  O  O     . PRO C 2  155  ? -14.956 -34.599 56.278  1.00 116.02 ? 155  PRO C O     1 
ATOM   4786  C  CB    . PRO C 2  155  ? -15.855 -32.703 58.634  1.00 110.74 ? 155  PRO C CB    1 
ATOM   4787  C  CG    . PRO C 2  155  ? -16.232 -31.298 58.290  1.00 115.55 ? 155  PRO C CG    1 
ATOM   4788  C  CD    . PRO C 2  155  ? -15.692 -31.064 56.911  1.00 115.97 ? 155  PRO C CD    1 
ATOM   4789  N  N     . GLY C 2  156  ? -13.694 -35.204 58.044  1.00 117.79 ? 156  GLY C N     1 
ATOM   4790  C  CA    . GLY C 2  156  ? -13.426 -36.530 57.540  1.00 110.80 ? 156  GLY C CA    1 
ATOM   4791  C  C     . GLY C 2  156  ? -12.230 -36.630 56.617  1.00 116.45 ? 156  GLY C C     1 
ATOM   4792  O  O     . GLY C 2  156  ? -11.795 -37.750 56.314  1.00 117.69 ? 156  GLY C O     1 
ATOM   4793  N  N     . ARG C 2  157  ? -11.695 -35.504 56.148  1.00 115.00 ? 157  ARG C N     1 
ATOM   4794  C  CA    . ARG C 2  157  ? -10.458 -35.469 55.383  1.00 109.31 ? 157  ARG C CA    1 
ATOM   4795  C  C     . ARG C 2  157  ? -9.338  -34.906 56.249  1.00 108.16 ? 157  ARG C C     1 
ATOM   4796  O  O     . ARG C 2  157  ? -9.573  -34.079 57.136  1.00 108.98 ? 157  ARG C O     1 
ATOM   4797  C  CB    . ARG C 2  157  ? -10.610 -34.634 54.106  1.00 110.84 ? 157  ARG C CB    1 
ATOM   4798  C  CG    . ARG C 2  157  ? -11.489 -35.281 53.057  1.00 107.97 ? 157  ARG C CG    1 
ATOM   4799  C  CD    . ARG C 2  157  ? -10.998 -36.680 52.739  1.00 113.01 ? 157  ARG C CD    1 
ATOM   4800  N  NE    . ARG C 2  157  ? -12.090 -37.552 52.317  1.00 120.05 ? 157  ARG C NE    1 
ATOM   4801  C  CZ    . ARG C 2  157  ? -12.435 -37.758 51.051  1.00 127.66 ? 157  ARG C CZ    1 
ATOM   4802  N  NH1   . ARG C 2  157  ? -11.768 -37.155 50.073  1.00 125.64 ? 157  ARG C NH1   1 
ATOM   4803  N  NH2   . ARG C 2  157  ? -13.446 -38.568 50.764  1.00 130.14 ? 157  ARG C NH2   1 
ATOM   4804  N  N     . TYR C 2  158  ? -8.116  -35.362 55.986  1.00 103.12 ? 158  TYR C N     1 
ATOM   4805  C  CA    . TYR C 2  158  ? -6.971  -35.044 56.825  1.00 97.68  ? 158  TYR C CA    1 
ATOM   4806  C  C     . TYR C 2  158  ? -5.800  -34.589 55.964  1.00 101.93 ? 158  TYR C C     1 
ATOM   4807  O  O     . TYR C 2  158  ? -5.707  -34.917 54.778  1.00 106.65 ? 158  TYR C O     1 
ATOM   4808  C  CB    . TYR C 2  158  ? -6.565  -36.253 57.687  1.00 100.27 ? 158  TYR C CB    1 
ATOM   4809  C  CG    . TYR C 2  158  ? -7.673  -36.775 58.588  1.00 106.37 ? 158  TYR C CG    1 
ATOM   4810  C  CD1   . TYR C 2  158  ? -8.577  -37.727 58.130  1.00 104.32 ? 158  TYR C CD1   1 
ATOM   4811  C  CD2   . TYR C 2  158  ? -7.813  -36.316 59.896  1.00 98.98  ? 158  TYR C CD2   1 
ATOM   4812  C  CE1   . TYR C 2  158  ? -9.589  -38.205 58.944  1.00 104.91 ? 158  TYR C CE1   1 
ATOM   4813  C  CE2   . TYR C 2  158  ? -8.822  -36.791 60.716  1.00 100.04 ? 158  TYR C CE2   1 
ATOM   4814  C  CZ    . TYR C 2  158  ? -9.709  -37.734 60.235  1.00 103.50 ? 158  TYR C CZ    1 
ATOM   4815  O  OH    . TYR C 2  158  ? -10.717 -38.215 61.042  1.00 104.13 ? 158  TYR C OH    1 
ATOM   4816  N  N     . ILE C 2  159  ? -4.906  -33.817 56.583  1.00 98.72  ? 159  ILE C N     1 
ATOM   4817  C  CA    . ILE C 2  159  ? -3.709  -33.287 55.935  1.00 99.60  ? 159  ILE C CA    1 
ATOM   4818  C  C     . ILE C 2  159  ? -2.485  -33.915 56.584  1.00 97.41  ? 159  ILE C C     1 
ATOM   4819  O  O     . ILE C 2  159  ? -2.343  -33.881 57.815  1.00 100.00 ? 159  ILE C O     1 
ATOM   4820  C  CB    . ILE C 2  159  ? -3.632  -31.753 56.042  1.00 100.15 ? 159  ILE C CB    1 
ATOM   4821  C  CG1   . ILE C 2  159  ? -4.890  -31.097 55.472  1.00 102.68 ? 159  ILE C CG1   1 
ATOM   4822  C  CG2   . ILE C 2  159  ? -2.379  -31.237 55.336  1.00 92.45  ? 159  ILE C CG2   1 
ATOM   4823  C  CD1   . ILE C 2  159  ? -4.913  -31.024 53.969  1.00 105.48 ? 159  ILE C CD1   1 
ATOM   4824  N  N     . ALA C 2  160  ? -1.592  -34.462 55.760  1.00 90.38  ? 160  ALA C N     1 
ATOM   4825  C  CA    . ALA C 2  160  ? -0.307  -34.973 56.219  1.00 88.35  ? 160  ALA C CA    1 
ATOM   4826  C  C     . ALA C 2  160  ? 0.758   -33.906 56.003  1.00 91.41  ? 160  ALA C C     1 
ATOM   4827  O  O     . ALA C 2  160  ? 0.826   -33.303 54.931  1.00 94.31  ? 160  ALA C O     1 
ATOM   4828  C  CB    . ALA C 2  160  ? 0.070   -36.257 55.479  1.00 90.85  ? 160  ALA C CB    1 
ATOM   4829  N  N     . SER C 2  161  ? 1.585   -33.669 57.016  1.00 88.78  ? 161  SER C N     1 
ATOM   4830  C  CA    . SER C 2  161  ? 2.577   -32.603 56.967  1.00 79.54  ? 161  SER C CA    1 
ATOM   4831  C  C     . SER C 2  161  ? 3.934   -33.169 57.345  1.00 82.54  ? 161  SER C C     1 
ATOM   4832  O  O     . SER C 2  161  ? 4.091   -33.748 58.424  1.00 81.32  ? 161  SER C O     1 
ATOM   4833  C  CB    . SER C 2  161  ? 2.194   -31.450 57.898  1.00 83.08  ? 161  SER C CB    1 
ATOM   4834  O  OG    . SER C 2  161  ? 0.891   -30.974 57.605  1.00 91.46  ? 161  SER C OG    1 
ATOM   4835  N  N     . ILE C 2  162  ? 4.904   -33.007 56.455  1.00 80.85  ? 162  ILE C N     1 
ATOM   4836  C  CA    . ILE C 2  162  ? 6.288   -33.379 56.707  1.00 74.35  ? 162  ILE C CA    1 
ATOM   4837  C  C     . ILE C 2  162  ? 7.057   -32.093 56.977  1.00 77.86  ? 162  ILE C C     1 
ATOM   4838  O  O     . ILE C 2  162  ? 7.097   -31.195 56.121  1.00 86.81  ? 162  ILE C O     1 
ATOM   4839  C  CB    . ILE C 2  162  ? 6.882   -34.156 55.523  1.00 79.94  ? 162  ILE C CB    1 
ATOM   4840  C  CG1   . ILE C 2  162  ? 6.014   -35.375 55.204  1.00 76.17  ? 162  ILE C CG1   1 
ATOM   4841  C  CG2   . ILE C 2  162  ? 8.316   -34.571 55.813  1.00 79.32  ? 162  ILE C CG2   1 
ATOM   4842  C  CD1   . ILE C 2  162  ? 6.542   -36.218 54.070  1.00 81.58  ? 162  ILE C CD1   1 
ATOM   4843  N  N     . ILE C 2  163  ? 7.653   -31.999 58.164  1.00 73.17  ? 163  ILE C N     1 
ATOM   4844  C  CA    . ILE C 2  163  ? 8.285   -30.782 58.654  1.00 76.99  ? 163  ILE C CA    1 
ATOM   4845  C  C     . ILE C 2  163  ? 9.733   -31.092 59.016  1.00 79.31  ? 163  ILE C C     1 
ATOM   4846  O  O     . ILE C 2  163  ? 9.982   -31.877 59.934  1.00 75.34  ? 163  ILE C O     1 
ATOM   4847  C  CB    . ILE C 2  163  ? 7.548   -30.202 59.874  1.00 81.18  ? 163  ILE C CB    1 
ATOM   4848  C  CG1   . ILE C 2  163  ? 6.093   -29.873 59.535  1.00 78.73  ? 163  ILE C CG1   1 
ATOM   4849  C  CG2   . ILE C 2  163  ? 8.268   -28.972 60.395  1.00 79.16  ? 163  ILE C CG2   1 
ATOM   4850  C  CD1   . ILE C 2  163  ? 5.345   -29.240 60.681  1.00 77.96  ? 163  ILE C CD1   1 
ATOM   4851  N  N     . PRO C 2  164  ? 10.719  -30.498 58.338  1.00 77.68  ? 164  PRO C N     1 
ATOM   4852  C  CA    . PRO C 2  164  ? 12.116  -30.634 58.771  1.00 81.52  ? 164  PRO C CA    1 
ATOM   4853  C  C     . PRO C 2  164  ? 12.513  -29.552 59.763  1.00 79.00  ? 164  PRO C C     1 
ATOM   4854  O  O     . PRO C 2  164  ? 11.664  -28.768 60.196  1.00 79.04  ? 164  PRO C O     1 
ATOM   4855  C  CB    . PRO C 2  164  ? 12.892  -30.503 57.460  1.00 84.97  ? 164  PRO C CB    1 
ATOM   4856  C  CG    . PRO C 2  164  ? 12.065  -29.524 56.678  1.00 86.70  ? 164  PRO C CG    1 
ATOM   4857  C  CD    . PRO C 2  164  ? 10.615  -29.777 57.058  1.00 83.10  ? 164  PRO C CD    1 
ATOM   4858  N  N     . LEU C 2  165  ? 13.792  -29.504 60.136  1.00 83.05  ? 165  LEU C N     1 
ATOM   4859  C  CA    . LEU C 2  165  ? 14.287  -28.439 60.996  1.00 81.38  ? 165  LEU C CA    1 
ATOM   4860  C  C     . LEU C 2  165  ? 14.152  -27.084 60.305  1.00 80.72  ? 165  LEU C C     1 
ATOM   4861  O  O     . LEU C 2  165  ? 14.104  -27.005 59.074  1.00 76.06  ? 165  LEU C O     1 
ATOM   4862  C  CB    . LEU C 2  165  ? 15.748  -28.678 61.359  1.00 79.00  ? 165  LEU C CB    1 
ATOM   4863  C  CG    . LEU C 2  165  ? 16.116  -29.940 62.124  1.00 83.85  ? 165  LEU C CG    1 
ATOM   4864  C  CD1   . LEU C 2  165  ? 17.499  -30.398 61.695  1.00 80.22  ? 165  LEU C CD1   1 
ATOM   4865  C  CD2   . LEU C 2  165  ? 16.064  -29.691 63.627  1.00 78.97  ? 165  LEU C CD2   1 
ATOM   4866  N  N     . PRO C 2  166  ? 14.076  -26.003 61.084  1.00 85.37  ? 166  PRO C N     1 
ATOM   4867  C  CA    . PRO C 2  166  ? 13.993  -24.663 60.488  1.00 82.47  ? 166  PRO C CA    1 
ATOM   4868  C  C     . PRO C 2  166  ? 15.148  -24.416 59.532  1.00 82.52  ? 166  PRO C C     1 
ATOM   4869  O  O     . PRO C 2  166  ? 16.300  -24.737 59.832  1.00 82.84  ? 166  PRO C O     1 
ATOM   4870  C  CB    . PRO C 2  166  ? 14.058  -23.732 61.703  1.00 81.82  ? 166  PRO C CB    1 
ATOM   4871  C  CG    . PRO C 2  166  ? 13.542  -24.547 62.828  1.00 75.43  ? 166  PRO C CG    1 
ATOM   4872  C  CD    . PRO C 2  166  ? 13.965  -25.959 62.554  1.00 80.02  ? 166  PRO C CD    1 
ATOM   4873  N  N     . LYS C 2  167  ? 14.821  -23.858 58.364  1.00 86.42  ? 167  LYS C N     1 
ATOM   4874  C  CA    . LYS C 2  167  ? 15.790  -23.534 57.318  1.00 88.17  ? 167  LYS C CA    1 
ATOM   4875  C  C     . LYS C 2  167  ? 16.615  -24.748 56.894  1.00 81.46  ? 167  LYS C C     1 
ATOM   4876  O  O     . LYS C 2  167  ? 17.749  -24.599 56.431  1.00 86.83  ? 167  LYS C O     1 
ATOM   4877  C  CB    . LYS C 2  167  ? 16.704  -22.375 57.745  1.00 84.46  ? 167  LYS C CB    1 
ATOM   4878  C  CG    . LYS C 2  167  ? 15.996  -21.024 57.813  1.00 88.10  ? 167  LYS C CG    1 
ATOM   4879  C  CD    . LYS C 2  167  ? 16.960  -19.886 58.147  1.00 94.31  ? 167  LYS C CD    1 
ATOM   4880  C  CE    . LYS C 2  167  ? 16.479  -18.543 57.588  1.00 101.47 ? 167  LYS C CE    1 
ATOM   4881  N  NZ    . LYS C 2  167  ? 16.645  -18.430 56.102  1.00 90.47  ? 167  LYS C NZ    1 
ATOM   4882  N  N     . ARG C 2  168  ? 16.062  -25.951 57.066  1.00 84.53  ? 168  ARG C N     1 
ATOM   4883  C  CA    . ARG C 2  168  ? 16.645  -27.184 56.556  1.00 83.17  ? 168  ARG C CA    1 
ATOM   4884  C  C     . ARG C 2  168  ? 15.734  -27.849 55.530  1.00 86.20  ? 168  ARG C C     1 
ATOM   4885  O  O     . ARG C 2  168  ? 15.673  -29.080 55.454  1.00 86.74  ? 168  ARG C O     1 
ATOM   4886  C  CB    . ARG C 2  168  ? 16.945  -28.158 57.694  1.00 83.15  ? 168  ARG C CB    1 
ATOM   4887  C  CG    . ARG C 2  168  ? 17.832  -27.595 58.779  1.00 87.62  ? 168  ARG C CG    1 
ATOM   4888  C  CD    . ARG C 2  168  ? 19.277  -27.993 58.593  1.00 92.07  ? 168  ARG C CD    1 
ATOM   4889  N  NE    . ARG C 2  168  ? 19.804  -27.523 57.319  1.00 99.01  ? 168  ARG C NE    1 
ATOM   4890  C  CZ    . ARG C 2  168  ? 21.020  -27.809 56.870  1.00 106.29 ? 168  ARG C CZ    1 
ATOM   4891  N  NH1   . ARG C 2  168  ? 21.833  -28.561 57.601  1.00 109.66 ? 168  ARG C NH1   1 
ATOM   4892  N  NH2   . ARG C 2  168  ? 21.420  -27.348 55.692  1.00 101.16 ? 168  ARG C NH2   1 
ATOM   4893  N  N     . GLY C 2  169  ? 15.006  -27.051 54.751  1.00 88.22  ? 169  GLY C N     1 
ATOM   4894  C  CA    . GLY C 2  169  ? 14.144  -27.577 53.721  1.00 81.42  ? 169  GLY C CA    1 
ATOM   4895  C  C     . GLY C 2  169  ? 12.699  -27.164 53.899  1.00 90.95  ? 169  GLY C C     1 
ATOM   4896  O  O     . GLY C 2  169  ? 12.281  -26.696 54.963  1.00 99.14  ? 169  GLY C O     1 
ATOM   4897  N  N     . PRO C 2  170  ? 11.901  -27.348 52.853  1.00 89.26  ? 170  PRO C N     1 
ATOM   4898  C  CA    . PRO C 2  170  ? 10.517  -26.875 52.875  1.00 90.63  ? 170  PRO C CA    1 
ATOM   4899  C  C     . PRO C 2  170  ? 9.595   -27.846 53.593  1.00 89.17  ? 170  PRO C C     1 
ATOM   4900  O  O     . PRO C 2  170  ? 9.872   -29.040 53.725  1.00 91.00  ? 170  PRO C O     1 
ATOM   4901  C  CB    . PRO C 2  170  ? 10.162  -26.801 51.387  1.00 90.09  ? 170  PRO C CB    1 
ATOM   4902  C  CG    . PRO C 2  170  ? 10.911  -27.961 50.822  1.00 83.86  ? 170  PRO C CG    1 
ATOM   4903  C  CD    . PRO C 2  170  ? 12.226  -28.003 51.576  1.00 90.53  ? 170  PRO C CD    1 
ATOM   4904  N  N     . TRP C 2  171  ? 8.475   -27.302 54.056  1.00 85.17  ? 171  TRP C N     1 
ATOM   4905  C  CA    . TRP C 2  171  ? 7.392   -28.125 54.566  1.00 86.97  ? 171  TRP C CA    1 
ATOM   4906  C  C     . TRP C 2  171  ? 6.628   -28.720 53.396  1.00 88.01  ? 171  TRP C C     1 
ATOM   4907  O  O     . TRP C 2  171  ? 6.467   -28.073 52.357  1.00 85.24  ? 171  TRP C O     1 
ATOM   4908  C  CB    . TRP C 2  171  ? 6.445   -27.300 55.437  1.00 81.44  ? 171  TRP C CB    1 
ATOM   4909  C  CG    . TRP C 2  171  ? 7.055   -26.783 56.700  1.00 82.86  ? 171  TRP C CG    1 
ATOM   4910  C  CD1   . TRP C 2  171  ? 8.383   -26.645 56.977  1.00 84.06  ? 171  TRP C CD1   1 
ATOM   4911  C  CD2   . TRP C 2  171  ? 6.355   -26.342 57.865  1.00 83.68  ? 171  TRP C CD2   1 
ATOM   4912  N  NE1   . TRP C 2  171  ? 8.553   -26.138 58.240  1.00 80.09  ? 171  TRP C NE1   1 
ATOM   4913  C  CE2   . TRP C 2  171  ? 7.322   -25.942 58.806  1.00 83.60  ? 171  TRP C CE2   1 
ATOM   4914  C  CE3   . TRP C 2  171  ? 5.006   -26.242 58.200  1.00 75.02  ? 171  TRP C CE3   1 
ATOM   4915  C  CZ2   . TRP C 2  171  ? 6.983   -25.457 60.060  1.00 86.78  ? 171  TRP C CZ2   1 
ATOM   4916  C  CZ3   . TRP C 2  171  ? 4.671   -25.760 59.443  1.00 90.08  ? 171  TRP C CZ3   1 
ATOM   4917  C  CH2   . TRP C 2  171  ? 5.654   -25.373 60.361  1.00 91.35  ? 171  TRP C CH2   1 
ATOM   4918  N  N     . ILE C 2  172  ? 6.158   -29.955 53.558  1.00 89.66  ? 172  ILE C N     1 
ATOM   4919  C  CA    . ILE C 2  172  ? 5.435   -30.645 52.493  1.00 88.52  ? 172  ILE C CA    1 
ATOM   4920  C  C     . ILE C 2  172  ? 4.071   -31.075 53.016  1.00 87.79  ? 172  ILE C C     1 
ATOM   4921  O  O     . ILE C 2  172  ? 3.962   -31.583 54.137  1.00 89.07  ? 172  ILE C O     1 
ATOM   4922  C  CB    . ILE C 2  172  ? 6.240   -31.840 51.946  1.00 88.74  ? 172  ILE C CB    1 
ATOM   4923  C  CG1   . ILE C 2  172  ? 7.451   -31.330 51.154  1.00 88.78  ? 172  ILE C CG1   1 
ATOM   4924  C  CG2   . ILE C 2  172  ? 5.372   -32.727 51.063  1.00 87.29  ? 172  ILE C CG2   1 
ATOM   4925  C  CD1   . ILE C 2  172  ? 8.389   -32.414 50.674  1.00 80.96  ? 172  ILE C CD1   1 
ATOM   4926  N  N     . ASP C 2  173  ? 3.031   -30.849 52.214  1.00 90.72  ? 173  ASP C N     1 
ATOM   4927  C  CA    . ASP C 2  173  ? 1.671   -31.249 52.548  1.00 89.78  ? 173  ASP C CA    1 
ATOM   4928  C  C     . ASP C 2  173  ? 1.174   -32.326 51.590  1.00 100.45 ? 173  ASP C C     1 
ATOM   4929  O  O     . ASP C 2  173  ? 1.442   -32.274 50.387  1.00 101.47 ? 173  ASP C O     1 
ATOM   4930  C  CB    . ASP C 2  173  ? 0.715   -30.051 52.508  1.00 93.12  ? 173  ASP C CB    1 
ATOM   4931  C  CG    . ASP C 2  173  ? 0.760   -29.220 53.777  1.00 95.21  ? 173  ASP C CG    1 
ATOM   4932  O  OD1   . ASP C 2  173  ? 1.725   -29.379 54.553  1.00 95.86  ? 173  ASP C OD1   1 
ATOM   4933  O  OD2   . ASP C 2  173  ? -0.176  -28.418 54.002  1.00 89.95  ? 173  ASP C OD2   1 
ATOM   4934  N  N     . LEU C 2  174  ? 0.443   -33.295 52.134  1.00 97.47  ? 174  LEU C N     1 
ATOM   4935  C  CA    . LEU C 2  174  ? -0.278  -34.303 51.365  1.00 99.12  ? 174  LEU C CA    1 
ATOM   4936  C  C     . LEU C 2  174  ? -1.755  -34.189 51.705  1.00 97.25  ? 174  LEU C C     1 
ATOM   4937  O  O     . LEU C 2  174  ? -2.139  -34.296 52.874  1.00 99.15  ? 174  LEU C O     1 
ATOM   4938  C  CB    . LEU C 2  174  ? 0.235   -35.718 51.658  1.00 97.82  ? 174  LEU C CB    1 
ATOM   4939  C  CG    . LEU C 2  174  ? 1.718   -36.032 51.464  1.00 95.62  ? 174  LEU C CG    1 
ATOM   4940  C  CD1   . LEU C 2  174  ? 1.937   -37.536 51.467  1.00 96.88  ? 174  LEU C CD1   1 
ATOM   4941  C  CD2   . LEU C 2  174  ? 2.255   -35.400 50.193  1.00 94.84  ? 174  LEU C CD2   1 
ATOM   4942  N  N     . GLU C 2  175  ? -2.571  -33.966 50.686  1.00 105.99 ? 175  GLU C N     1 
ATOM   4943  C  CA    . GLU C 2  175  ? -4.003  -33.787 50.844  1.00 103.72 ? 175  GLU C CA    1 
ATOM   4944  C  C     . GLU C 2  175  ? -4.701  -34.737 49.882  1.00 111.31 ? 175  GLU C C     1 
ATOM   4945  O  O     . GLU C 2  175  ? -4.100  -35.214 48.919  1.00 111.02 ? 175  GLU C O     1 
ATOM   4946  C  CB    . GLU C 2  175  ? -4.391  -32.317 50.579  1.00 108.77 ? 175  GLU C CB    1 
ATOM   4947  C  CG    . GLU C 2  175  ? -5.866  -31.957 50.713  1.00 113.68 ? 175  GLU C CG    1 
ATOM   4948  C  CD    . GLU C 2  175  ? -6.125  -30.467 50.515  1.00 113.17 ? 175  GLU C CD    1 
ATOM   4949  O  OE1   . GLU C 2  175  ? -5.180  -29.662 50.668  1.00 108.03 ? 175  GLU C OE1   1 
ATOM   4950  O  OE2   . GLU C 2  175  ? -7.275  -30.099 50.198  1.00 114.82 ? 175  GLU C OE2   1 
ATOM   4951  N  N     . VAL C 2  176  ? -5.965  -35.041 50.154  1.00 109.86 ? 176  VAL C N     1 
ATOM   4952  C  CA    . VAL C 2  176  ? -6.787  -35.808 49.224  1.00 113.59 ? 176  VAL C CA    1 
ATOM   4953  C  C     . VAL C 2  176  ? -7.827  -34.859 48.644  1.00 117.15 ? 176  VAL C C     1 
ATOM   4954  O  O     . VAL C 2  176  ? -8.768  -34.450 49.337  1.00 117.90 ? 176  VAL C O     1 
ATOM   4955  C  CB    . VAL C 2  176  ? -7.439  -37.023 49.892  1.00 112.77 ? 176  VAL C CB    1 
ATOM   4956  C  CG1   . VAL C 2  176  ? -8.357  -37.722 48.901  1.00 112.78 ? 176  VAL C CG1   1 
ATOM   4957  C  CG2   . VAL C 2  176  ? -6.365  -37.977 50.389  1.00 105.03 ? 176  VAL C CG2   1 
ATOM   4958  N  N     . GLU C 2  177  ? -7.654  -34.518 47.368  1.00 114.80 ? 177  GLU C N     1 
ATOM   4959  C  CA    . GLU C 2  177  ? -8.436  -33.475 46.733  1.00 112.38 ? 177  GLU C CA    1 
ATOM   4960  C  C     . GLU C 2  177  ? -9.903  -33.881 46.629  1.00 116.55 ? 177  GLU C C     1 
ATOM   4961  O  O     . GLU C 2  177  ? -10.231 -35.070 46.632  1.00 118.04 ? 177  GLU C O     1 
ATOM   4962  C  CB    . GLU C 2  177  ? -7.873  -33.174 45.347  1.00 115.63 ? 177  GLU C CB    1 
ATOM   4963  C  CG    . GLU C 2  177  ? -7.581  -31.708 45.088  1.00 116.24 ? 177  GLU C CG    1 
ATOM   4964  C  CD    . GLU C 2  177  ? -6.740  -31.083 46.180  1.00 115.26 ? 177  GLU C CD    1 
ATOM   4965  O  OE1   . GLU C 2  177  ? -7.194  -30.100 46.803  1.00 117.10 ? 177  GLU C OE1   1 
ATOM   4966  O  OE2   . GLU C 2  177  ? -5.626  -31.585 46.424  1.00 113.08 ? 177  GLU C OE2   1 
ATOM   4967  N  N     . PRO C 2  178  ? -10.808 -32.899 46.552  1.00 118.63 ? 178  PRO C N     1 
ATOM   4968  C  CA    . PRO C 2  178  ? -12.227 -33.229 46.347  1.00 118.94 ? 178  PRO C CA    1 
ATOM   4969  C  C     . PRO C 2  178  ? -12.479 -34.051 45.098  1.00 120.37 ? 178  PRO C C     1 
ATOM   4970  O  O     . PRO C 2  178  ? -13.470 -34.790 45.045  1.00 122.48 ? 178  PRO C O     1 
ATOM   4971  C  CB    . PRO C 2  178  ? -12.896 -31.849 46.261  1.00 113.63 ? 178  PRO C CB    1 
ATOM   4972  C  CG    . PRO C 2  178  ? -12.002 -30.956 47.037  1.00 113.34 ? 178  PRO C CG    1 
ATOM   4973  C  CD    . PRO C 2  178  ? -10.609 -31.459 46.797  1.00 115.66 ? 178  PRO C CD    1 
ATOM   4974  N  N     . ASN C 2  179  ? -11.612 -33.952 44.088  1.00 119.17 ? 179  ASN C N     1 
ATOM   4975  C  CA    . ASN C 2  179  ? -11.758 -34.777 42.898  1.00 120.43 ? 179  ASN C CA    1 
ATOM   4976  C  C     . ASN C 2  179  ? -11.224 -36.191 43.092  1.00 125.78 ? 179  ASN C C     1 
ATOM   4977  O  O     . ASN C 2  179  ? -11.368 -37.019 42.186  1.00 127.23 ? 179  ASN C O     1 
ATOM   4978  C  CB    . ASN C 2  179  ? -11.062 -34.114 41.702  1.00 117.06 ? 179  ASN C CB    1 
ATOM   4979  C  CG    . ASN C 2  179  ? -9.555  -34.283 41.729  1.00 118.82 ? 179  ASN C CG    1 
ATOM   4980  O  OD1   . ASN C 2  179  ? -9.028  -35.313 41.308  1.00 115.76 ? 179  ASN C OD1   1 
ATOM   4981  N  ND2   . ASN C 2  179  ? -8.853  -33.263 42.205  1.00 120.59 ? 179  ASN C ND2   1 
ATOM   4982  N  N     . GLY C 2  180  ? -10.615 -36.489 44.241  1.00 120.57 ? 180  GLY C N     1 
ATOM   4983  C  CA    . GLY C 2  180  ? -10.162 -37.822 44.562  1.00 116.44 ? 180  GLY C CA    1 
ATOM   4984  C  C     . GLY C 2  180  ? -8.669  -38.050 44.422  1.00 119.87 ? 180  GLY C C     1 
ATOM   4985  O  O     . GLY C 2  180  ? -8.164  -39.041 44.959  1.00 125.36 ? 180  GLY C O     1 
ATOM   4986  N  N     . VAL C 2  181  ? -7.946  -37.168 43.720  1.00 117.32 ? 181  VAL C N     1 
ATOM   4987  C  CA    . VAL C 2  181  ? -6.516  -37.354 43.490  1.00 115.54 ? 181  VAL C CA    1 
ATOM   4988  C  C     . VAL C 2  181  ? -5.733  -36.806 44.678  1.00 113.69 ? 181  VAL C C     1 
ATOM   4989  O  O     . VAL C 2  181  ? -6.110  -35.793 45.281  1.00 114.62 ? 181  VAL C O     1 
ATOM   4990  C  CB    . VAL C 2  181  ? -6.078  -36.693 42.167  1.00 114.34 ? 181  VAL C CB    1 
ATOM   4991  C  CG1   . VAL C 2  181  ? -6.065  -35.175 42.284  1.00 113.50 ? 181  VAL C CG1   1 
ATOM   4992  C  CG2   . VAL C 2  181  ? -4.712  -37.218 41.730  1.00 111.71 ? 181  VAL C CG2   1 
ATOM   4993  N  N     . VAL C 2  182  ? -4.644  -37.485 45.028  1.00 113.67 ? 182  VAL C N     1 
ATOM   4994  C  CA    . VAL C 2  182  ? -3.847  -37.128 46.198  1.00 114.15 ? 182  VAL C CA    1 
ATOM   4995  C  C     . VAL C 2  182  ? -2.768  -36.131 45.782  1.00 111.94 ? 182  VAL C C     1 
ATOM   4996  O  O     . VAL C 2  182  ? -1.914  -36.430 44.938  1.00 113.23 ? 182  VAL C O     1 
ATOM   4997  C  CB    . VAL C 2  182  ? -3.241  -38.375 46.863  1.00 111.01 ? 182  VAL C CB    1 
ATOM   4998  C  CG1   . VAL C 2  182  ? -2.596  -39.294 45.830  1.00 117.60 ? 182  VAL C CG1   1 
ATOM   4999  C  CG2   . VAL C 2  182  ? -2.243  -37.976 47.938  1.00 111.03 ? 182  VAL C CG2   1 
ATOM   5000  N  N     . SER C 2  183  ? -2.804  -34.946 46.384  1.00 112.49 ? 183  SER C N     1 
ATOM   5001  C  CA    . SER C 2  183  ? -1.953  -33.830 46.003  1.00 110.99 ? 183  SER C CA    1 
ATOM   5002  C  C     . SER C 2  183  ? -0.809  -33.637 46.987  1.00 109.12 ? 183  SER C C     1 
ATOM   5003  O  O     . SER C 2  183  ? -0.953  -33.849 48.197  1.00 109.59 ? 183  SER C O     1 
ATOM   5004  C  CB    . SER C 2  183  ? -2.759  -32.531 45.919  1.00 110.95 ? 183  SER C CB    1 
ATOM   5005  O  OG    . SER C 2  183  ? -3.171  -32.098 47.206  1.00 102.04 ? 183  SER C OG    1 
ATOM   5006  N  N     . MET C 2  184  ? 0.324   -33.199 46.445  1.00 105.06 ? 184  MET C N     1 
ATOM   5007  C  CA    . MET C 2  184  ? 1.490   -32.801 47.215  1.00 107.02 ? 184  MET C CA    1 
ATOM   5008  C  C     . MET C 2  184  ? 1.729   -31.312 47.011  1.00 107.11 ? 184  MET C C     1 
ATOM   5009  O  O     . MET C 2  184  ? 1.731   -30.827 45.873  1.00 108.42 ? 184  MET C O     1 
ATOM   5010  C  CB    . MET C 2  184  ? 2.720   -33.606 46.794  1.00 98.12  ? 184  MET C CB    1 
ATOM   5011  C  CG    . MET C 2  184  ? 4.019   -33.121 47.403  1.00 93.43  ? 184  MET C CG    1 
ATOM   5012  S  SD    . MET C 2  184  ? 5.331   -34.338 47.215  1.00 102.36 ? 184  MET C SD    1 
ATOM   5013  C  CE    . MET C 2  184  ? 6.775   -33.379 47.655  1.00 87.50  ? 184  MET C CE    1 
ATOM   5014  N  N     . LYS C 2  185  ? 1.914   -30.594 48.116  1.00 104.97 ? 185  LYS C N     1 
ATOM   5015  C  CA    . LYS C 2  185  ? 2.170   -29.159 48.117  1.00 100.96 ? 185  LYS C CA    1 
ATOM   5016  C  C     . LYS C 2  185  ? 3.554   -28.913 48.704  1.00 99.77  ? 185  LYS C C     1 
ATOM   5017  O  O     . LYS C 2  185  ? 3.830   -29.327 49.834  1.00 98.09  ? 185  LYS C O     1 
ATOM   5018  C  CB    . LYS C 2  185  ? 1.108   -28.408 48.924  1.00 94.58  ? 185  LYS C CB    1 
ATOM   5019  C  CG    . LYS C 2  185  ? 1.320   -26.901 48.984  1.00 98.23  ? 185  LYS C CG    1 
ATOM   5020  C  CD    . LYS C 2  185  ? 0.643   -26.290 50.206  1.00 103.17 ? 185  LYS C CD    1 
ATOM   5021  C  CE    . LYS C 2  185  ? -0.864  -26.453 50.156  1.00 97.87  ? 185  LYS C CE    1 
ATOM   5022  N  NZ    . LYS C 2  185  ? -1.470  -25.624 49.079  1.00 106.23 ? 185  LYS C NZ    1 
ATOM   5023  N  N     . VAL C 2  186  ? 4.415   -28.245 47.938  1.00 101.11 ? 186  VAL C N     1 
ATOM   5024  C  CA    . VAL C 2  186  ? 5.747   -27.848 48.389  1.00 100.99 ? 186  VAL C CA    1 
ATOM   5025  C  C     . VAL C 2  186  ? 6.061   -26.496 47.769  1.00 103.02 ? 186  VAL C C     1 
ATOM   5026  O  O     . VAL C 2  186  ? 5.892   -26.318 46.559  1.00 102.20 ? 186  VAL C O     1 
ATOM   5027  C  CB    . VAL C 2  186  ? 6.822   -28.897 48.016  1.00 94.12  ? 186  VAL C CB    1 
ATOM   5028  C  CG1   . VAL C 2  186  ? 6.456   -29.610 46.729  1.00 97.41  ? 186  VAL C CG1   1 
ATOM   5029  C  CG2   . VAL C 2  186  ? 8.194   -28.246 47.890  1.00 95.06  ? 186  VAL C CG2   1 
ATOM   5030  N  N     . ASN C 2  187  ? 6.499   -25.541 48.599  1.00 105.18 ? 187  ASN C N     1 
ATOM   5031  C  CA    . ASN C 2  187  ? 6.739   -24.161 48.169  1.00 105.79 ? 187  ASN C CA    1 
ATOM   5032  C  C     . ASN C 2  187  ? 5.485   -23.534 47.561  1.00 106.27 ? 187  ASN C C     1 
ATOM   5033  O  O     . ASN C 2  187  ? 5.573   -22.710 46.646  1.00 106.93 ? 187  ASN C O     1 
ATOM   5034  C  CB    . ASN C 2  187  ? 7.912   -24.076 47.188  1.00 96.73  ? 187  ASN C CB    1 
ATOM   5035  C  CG    . ASN C 2  187  ? 9.219   -24.550 47.800  1.00 99.75  ? 187  ASN C CG    1 
ATOM   5036  O  OD1   . ASN C 2  187  ? 9.839   -25.496 47.316  1.00 93.75  ? 187  ASN C OD1   1 
ATOM   5037  N  ND2   . ASN C 2  187  ? 9.638   -23.899 48.878  1.00 107.47 ? 187  ASN C ND2   1 
ATOM   5038  N  N     . LYS C 2  188  ? 4.317   -23.926 48.080  1.00 111.37 ? 188  LYS C N     1 
ATOM   5039  C  CA    . LYS C 2  188  ? 3.017   -23.481 47.573  1.00 115.18 ? 188  LYS C CA    1 
ATOM   5040  C  C     . LYS C 2  188  ? 2.818   -23.875 46.107  1.00 112.80 ? 188  LYS C C     1 
ATOM   5041  O  O     . LYS C 2  188  ? 2.437   -23.060 45.266  1.00 114.75 ? 188  LYS C O     1 
ATOM   5042  C  CB    . LYS C 2  188  ? 2.824   -21.976 47.774  1.00 111.59 ? 188  LYS C CB    1 
ATOM   5043  C  CG    . LYS C 2  188  ? 2.501   -21.593 49.211  1.00 104.69 ? 188  LYS C CG    1 
ATOM   5044  C  CD    . LYS C 2  188  ? 2.334   -20.092 49.369  1.00 101.71 ? 188  LYS C CD    1 
ATOM   5045  C  CE    . LYS C 2  188  ? 3.644   -19.362 49.122  1.00 107.43 ? 188  LYS C CE    1 
ATOM   5046  N  NZ    . LYS C 2  188  ? 4.712   -19.809 50.057  1.00 105.48 ? 188  LYS C NZ    1 
ATOM   5047  N  N     . ARG C 2  189  ? 3.057   -25.154 45.812  1.00 109.39 ? 189  ARG C N     1 
ATOM   5048  C  CA    . ARG C 2  189  ? 2.853   -25.717 44.480  1.00 108.24 ? 189  ARG C CA    1 
ATOM   5049  C  C     . ARG C 2  189  ? 2.161   -27.065 44.625  1.00 104.21 ? 189  ARG C C     1 
ATOM   5050  O  O     . ARG C 2  189  ? 2.773   -28.028 45.100  1.00 102.14 ? 189  ARG C O     1 
ATOM   5051  C  CB    . ARG C 2  189  ? 4.177   -25.881 43.738  1.00 111.06 ? 189  ARG C CB    1 
ATOM   5052  C  CG    . ARG C 2  189  ? 4.736   -24.617 43.134  1.00 114.33 ? 189  ARG C CG    1 
ATOM   5053  C  CD    . ARG C 2  189  ? 6.019   -24.921 42.368  1.00 128.96 ? 189  ARG C CD    1 
ATOM   5054  N  NE    . ARG C 2  189  ? 6.595   -23.723 41.766  1.00 138.14 ? 189  ARG C NE    1 
ATOM   5055  C  CZ    . ARG C 2  189  ? 6.485   -23.399 40.481  1.00 137.60 ? 189  ARG C CZ    1 
ATOM   5056  N  NH1   . ARG C 2  189  ? 5.825   -24.190 39.645  1.00 137.97 ? 189  ARG C NH1   1 
ATOM   5057  N  NH2   . ARG C 2  189  ? 7.042   -22.280 40.034  1.00 137.41 ? 189  ARG C NH2   1 
ATOM   5058  N  N     . LYS C 2  190  ? 0.901   -27.144 44.198  1.00 103.68 ? 190  LYS C N     1 
ATOM   5059  C  CA    . LYS C 2  190  ? 0.148   -28.392 44.234  1.00 110.12 ? 190  LYS C CA    1 
ATOM   5060  C  C     . LYS C 2  190  ? 0.405   -29.195 42.964  1.00 112.88 ? 190  LYS C C     1 
ATOM   5061  O  O     . LYS C 2  190  ? 0.273   -28.670 41.854  1.00 111.24 ? 190  LYS C O     1 
ATOM   5062  C  CB    . LYS C 2  190  ? -1.348  -28.120 44.379  1.00 110.62 ? 190  LYS C CB    1 
ATOM   5063  C  CG    . LYS C 2  190  ? -1.806  -27.776 45.782  1.00 108.31 ? 190  LYS C CG    1 
ATOM   5064  C  CD    . LYS C 2  190  ? -2.788  -28.817 46.295  1.00 113.30 ? 190  LYS C CD    1 
ATOM   5065  C  CE    . LYS C 2  190  ? -3.635  -28.274 47.439  1.00 120.09 ? 190  LYS C CE    1 
ATOM   5066  N  NZ    . LYS C 2  190  ? -4.569  -27.206 46.979  1.00 123.57 ? 190  LYS C NZ    1 
ATOM   5067  N  N     . PHE C 2  191  ? 0.769   -30.464 43.130  1.00 112.33 ? 191  PHE C N     1 
ATOM   5068  C  CA    . PHE C 2  191  ? 0.947   -31.350 41.989  1.00 110.92 ? 191  PHE C CA    1 
ATOM   5069  C  C     . PHE C 2  191  ? 0.571   -32.767 42.393  1.00 115.01 ? 191  PHE C C     1 
ATOM   5070  O  O     . PHE C 2  191  ? 0.635   -33.108 43.579  1.00 117.31 ? 191  PHE C O     1 
ATOM   5071  C  CB    . PHE C 2  191  ? 2.388   -31.303 41.458  1.00 110.17 ? 191  PHE C CB    1 
ATOM   5072  C  CG    . PHE C 2  191  ? 3.379   -32.049 42.301  1.00 115.51 ? 191  PHE C CG    1 
ATOM   5073  C  CD1   . PHE C 2  191  ? 3.914   -31.472 43.441  1.00 113.81 ? 191  PHE C CD1   1 
ATOM   5074  C  CD2   . PHE C 2  191  ? 3.797   -33.321 41.940  1.00 120.25 ? 191  PHE C CD2   1 
ATOM   5075  C  CE1   . PHE C 2  191  ? 4.840   -32.154 44.212  1.00 112.47 ? 191  PHE C CE1   1 
ATOM   5076  C  CE2   . PHE C 2  191  ? 4.719   -34.012 42.710  1.00 119.15 ? 191  PHE C CE2   1 
ATOM   5077  C  CZ    . PHE C 2  191  ? 5.241   -33.427 43.847  1.00 112.87 ? 191  PHE C CZ    1 
ATOM   5078  N  N     . PRO C 2  192  ? 0.162   -33.607 41.442  1.00 116.65 ? 192  PRO C N     1 
ATOM   5079  C  CA    . PRO C 2  192  ? -0.238  -34.978 41.792  1.00 118.49 ? 192  PRO C CA    1 
ATOM   5080  C  C     . PRO C 2  192  ? 0.926   -35.781 42.357  1.00 116.98 ? 192  PRO C C     1 
ATOM   5081  O  O     . PRO C 2  192  ? 2.007   -35.843 41.767  1.00 117.55 ? 192  PRO C O     1 
ATOM   5082  C  CB    . PRO C 2  192  ? -0.731  -35.555 40.459  1.00 119.79 ? 192  PRO C CB    1 
ATOM   5083  C  CG    . PRO C 2  192  ? -0.096  -34.701 39.413  1.00 114.79 ? 192  PRO C CG    1 
ATOM   5084  C  CD    . PRO C 2  192  ? -0.030  -33.330 40.009  1.00 113.97 ? 192  PRO C CD    1 
ATOM   5085  N  N     . LEU C 2  193  ? 0.680   -36.417 43.506  1.00 114.76 ? 193  LEU C N     1 
ATOM   5086  C  CA    . LEU C 2  193  ? 1.725   -37.170 44.194  1.00 115.04 ? 193  LEU C CA    1 
ATOM   5087  C  C     . LEU C 2  193  ? 2.231   -38.340 43.357  1.00 114.55 ? 193  LEU C C     1 
ATOM   5088  O  O     . LEU C 2  193  ? 3.403   -38.728 43.472  1.00 109.81 ? 193  LEU C O     1 
ATOM   5089  C  CB    . LEU C 2  193  ? 1.193   -37.658 45.542  1.00 107.60 ? 193  LEU C CB    1 
ATOM   5090  C  CG    . LEU C 2  193  ? 2.102   -38.495 46.437  1.00 100.24 ? 193  LEU C CG    1 
ATOM   5091  C  CD1   . LEU C 2  193  ? 3.337   -37.719 46.843  1.00 97.30  ? 193  LEU C CD1   1 
ATOM   5092  C  CD2   . LEU C 2  193  ? 1.332   -38.938 47.656  1.00 98.25  ? 193  LEU C CD2   1 
ATOM   5093  N  N     . VAL C 2  194  ? 1.368   -38.902 42.504  1.00 118.43 ? 194  VAL C N     1 
ATOM   5094  C  CA    . VAL C 2  194  ? 1.738   -40.056 41.688  1.00 121.30 ? 194  VAL C CA    1 
ATOM   5095  C  C     . VAL C 2  194  ? 2.962   -39.756 40.837  1.00 120.39 ? 194  VAL C C     1 
ATOM   5096  O  O     . VAL C 2  194  ? 3.774   -40.648 40.569  1.00 121.65 ? 194  VAL C O     1 
ATOM   5097  C  CB    . VAL C 2  194  ? 0.546   -40.490 40.814  1.00 122.26 ? 194  VAL C CB    1 
ATOM   5098  C  CG1   . VAL C 2  194  ? 0.743   -41.916 40.322  1.00 124.23 ? 194  VAL C CG1   1 
ATOM   5099  C  CG2   . VAL C 2  194  ? -0.755  -40.347 41.582  1.00 122.85 ? 194  VAL C CG2   1 
ATOM   5100  N  N     . LEU C 2  195  ? 3.122   -38.504 40.405  1.00 119.68 ? 195  LEU C N     1 
ATOM   5101  C  CA    . LEU C 2  195  ? 4.281   -38.137 39.600  1.00 119.19 ? 195  LEU C CA    1 
ATOM   5102  C  C     . LEU C 2  195  ? 5.577   -38.376 40.367  1.00 119.36 ? 195  LEU C C     1 
ATOM   5103  O  O     . LEU C 2  195  ? 6.485   -39.068 39.884  1.00 121.44 ? 195  LEU C O     1 
ATOM   5104  C  CB    . LEU C 2  195  ? 4.161   -36.675 39.167  1.00 118.02 ? 195  LEU C CB    1 
ATOM   5105  C  CG    . LEU C 2  195  ? 5.238   -36.103 38.245  1.00 127.53 ? 195  LEU C CG    1 
ATOM   5106  C  CD1   . LEU C 2  195  ? 5.362   -36.923 36.966  1.00 132.43 ? 195  LEU C CD1   1 
ATOM   5107  C  CD2   . LEU C 2  195  ? 4.922   -34.653 37.924  1.00 128.95 ? 195  LEU C CD2   1 
ATOM   5108  N  N     . LEU C 2  196  ? 5.675   -37.819 41.577  1.00 119.20 ? 196  LEU C N     1 
ATOM   5109  C  CA    . LEU C 2  196  ? 6.871   -38.026 42.384  1.00 116.89 ? 196  LEU C CA    1 
ATOM   5110  C  C     . LEU C 2  196  ? 7.033   -39.491 42.757  1.00 116.05 ? 196  LEU C C     1 
ATOM   5111  O  O     . LEU C 2  196  ? 8.156   -40.007 42.802  1.00 111.02 ? 196  LEU C O     1 
ATOM   5112  C  CB    . LEU C 2  196  ? 6.824   -37.157 43.639  1.00 115.90 ? 196  LEU C CB    1 
ATOM   5113  C  CG    . LEU C 2  196  ? 8.025   -37.333 44.569  1.00 109.40 ? 196  LEU C CG    1 
ATOM   5114  C  CD1   . LEU C 2  196  ? 9.320   -37.063 43.823  1.00 107.97 ? 196  LEU C CD1   1 
ATOM   5115  C  CD2   . LEU C 2  196  ? 7.905   -36.428 45.778  1.00 104.71 ? 196  LEU C CD2   1 
ATOM   5116  N  N     . LEU C 2  197  ? 5.920   -40.179 43.028  1.00 116.91 ? 197  LEU C N     1 
ATOM   5117  C  CA    . LEU C 2  197  ? 5.992   -41.614 43.283  1.00 119.62 ? 197  LEU C CA    1 
ATOM   5118  C  C     . LEU C 2  197  ? 6.638   -42.345 42.111  1.00 118.94 ? 197  LEU C C     1 
ATOM   5119  O  O     . LEU C 2  197  ? 7.418   -43.285 42.307  1.00 118.36 ? 197  LEU C O     1 
ATOM   5120  C  CB    . LEU C 2  197  ? 4.593   -42.162 43.564  1.00 118.70 ? 197  LEU C CB    1 
ATOM   5121  C  CG    . LEU C 2  197  ? 3.909   -41.618 44.819  1.00 114.46 ? 197  LEU C CG    1 
ATOM   5122  C  CD1   . LEU C 2  197  ? 2.487   -42.137 44.919  1.00 113.09 ? 197  LEU C CD1   1 
ATOM   5123  C  CD2   . LEU C 2  197  ? 4.702   -41.989 46.059  1.00 113.92 ? 197  LEU C CD2   1 
ATOM   5124  N  N     . ARG C 2  198  ? 6.336   -41.914 40.885  1.00 118.90 ? 198  ARG C N     1 
ATOM   5125  C  CA    . ARG C 2  198  ? 6.961   -42.510 39.710  1.00 123.94 ? 198  ARG C CA    1 
ATOM   5126  C  C     . ARG C 2  198  ? 8.444   -42.162 39.641  1.00 123.23 ? 198  ARG C C     1 
ATOM   5127  O  O     . ARG C 2  198  ? 9.272   -43.019 39.309  1.00 123.00 ? 198  ARG C O     1 
ATOM   5128  C  CB    . ARG C 2  198  ? 6.237   -42.052 38.443  1.00 126.80 ? 198  ARG C CB    1 
ATOM   5129  C  CG    . ARG C 2  198  ? 6.470   -42.935 37.225  1.00 134.58 ? 198  ARG C CG    1 
ATOM   5130  C  CD    . ARG C 2  198  ? 5.903   -44.331 37.437  1.00 137.17 ? 198  ARG C CD    1 
ATOM   5131  N  NE    . ARG C 2  198  ? 5.908   -45.120 36.207  1.00 140.65 ? 198  ARG C NE    1 
ATOM   5132  C  CZ    . ARG C 2  198  ? 6.912   -45.901 35.821  1.00 142.63 ? 198  ARG C CZ    1 
ATOM   5133  N  NH1   . ARG C 2  198  ? 6.824   -46.582 34.685  1.00 143.87 ? 198  ARG C NH1   1 
ATOM   5134  N  NH2   . ARG C 2  198  ? 8.003   -46.002 36.568  1.00 138.79 ? 198  ARG C NH2   1 
ATOM   5135  N  N     . VAL C 2  199  ? 8.800   -40.911 39.957  1.00 118.89 ? 199  VAL C N     1 
ATOM   5136  C  CA    . VAL C 2  199  ? 10.212  -40.525 39.988  1.00 112.56 ? 199  VAL C CA    1 
ATOM   5137  C  C     . VAL C 2  199  ? 10.979  -41.356 41.010  1.00 112.63 ? 199  VAL C C     1 
ATOM   5138  O  O     . VAL C 2  199  ? 12.161  -41.665 40.815  1.00 109.21 ? 199  VAL C O     1 
ATOM   5139  C  CB    . VAL C 2  199  ? 10.352  -39.017 40.271  1.00 110.35 ? 199  VAL C CB    1 
ATOM   5140  C  CG1   . VAL C 2  199  ? 11.819  -38.602 40.253  1.00 107.12 ? 199  VAL C CG1   1 
ATOM   5141  C  CG2   . VAL C 2  199  ? 9.548   -38.208 39.270  1.00 113.75 ? 199  VAL C CG2   1 
ATOM   5142  N  N     . LEU C 2  200  ? 10.325  -41.738 42.109  1.00 121.81 ? 200  LEU C N     1 
ATOM   5143  C  CA    . LEU C 2  200  ? 10.954  -42.598 43.104  1.00 123.43 ? 200  LEU C CA    1 
ATOM   5144  C  C     . LEU C 2  200  ? 11.209  -44.008 42.588  1.00 123.55 ? 200  LEU C C     1 
ATOM   5145  O  O     . LEU C 2  200  ? 11.912  -44.773 43.256  1.00 124.11 ? 200  LEU C O     1 
ATOM   5146  C  CB    . LEU C 2  200  ? 10.089  -42.666 44.369  1.00 124.00 ? 200  LEU C CB    1 
ATOM   5147  C  CG    . LEU C 2  200  ? 10.432  -41.743 45.544  1.00 116.00 ? 200  LEU C CG    1 
ATOM   5148  C  CD1   . LEU C 2  200  ? 11.889  -41.901 45.933  1.00 120.47 ? 200  LEU C CD1   1 
ATOM   5149  C  CD2   . LEU C 2  200  ? 10.119  -40.292 45.232  1.00 107.32 ? 200  LEU C CD2   1 
ATOM   5150  N  N     . GLY C 2  201  ? 10.658  -44.368 41.433  1.00 122.53 ? 201  GLY C N     1 
ATOM   5151  C  CA    . GLY C 2  201  ? 10.818  -45.706 40.906  1.00 124.85 ? 201  GLY C CA    1 
ATOM   5152  C  C     . GLY C 2  201  ? 9.718   -46.676 41.264  1.00 123.21 ? 201  GLY C C     1 
ATOM   5153  O  O     . GLY C 2  201  ? 9.916   -47.887 41.126  1.00 121.40 ? 201  GLY C O     1 
ATOM   5154  N  N     . TYR C 2  202  ? 8.570   -46.190 41.728  1.00 128.01 ? 202  TYR C N     1 
ATOM   5155  C  CA    . TYR C 2  202  ? 7.456   -47.069 42.050  1.00 134.00 ? 202  TYR C CA    1 
ATOM   5156  C  C     . TYR C 2  202  ? 6.675   -47.437 40.794  1.00 134.37 ? 202  TYR C C     1 
ATOM   5157  O  O     . TYR C 2  202  ? 6.667   -46.706 39.798  1.00 129.67 ? 202  TYR C O     1 
ATOM   5158  C  CB    . TYR C 2  202  ? 6.515   -46.414 43.064  1.00 131.87 ? 202  TYR C CB    1 
ATOM   5159  C  CG    . TYR C 2  202  ? 6.991   -46.470 44.499  1.00 129.16 ? 202  TYR C CG    1 
ATOM   5160  C  CD1   . TYR C 2  202  ? 7.284   -47.683 45.107  1.00 129.39 ? 202  TYR C CD1   1 
ATOM   5161  C  CD2   . TYR C 2  202  ? 7.122   -45.311 45.253  1.00 126.03 ? 202  TYR C CD2   1 
ATOM   5162  C  CE1   . TYR C 2  202  ? 7.711   -47.738 46.419  1.00 125.85 ? 202  TYR C CE1   1 
ATOM   5163  C  CE2   . TYR C 2  202  ? 7.547   -45.358 46.566  1.00 121.09 ? 202  TYR C CE2   1 
ATOM   5164  C  CZ    . TYR C 2  202  ? 7.840   -46.574 47.144  1.00 120.03 ? 202  TYR C CZ    1 
ATOM   5165  O  OH    . TYR C 2  202  ? 8.263   -46.627 48.451  1.00 116.65 ? 202  TYR C OH    1 
ATOM   5166  N  N     . ASP C 2  203  ? 6.006   -48.583 40.857  1.00 137.45 ? 203  ASP C N     1 
ATOM   5167  C  CA    . ASP C 2  203  ? 5.192   -49.085 39.764  1.00 144.86 ? 203  ASP C CA    1 
ATOM   5168  C  C     . ASP C 2  203  ? 3.760   -49.275 40.245  1.00 143.64 ? 203  ASP C C     1 
ATOM   5169  O  O     . ASP C 2  203  ? 3.506   -49.435 41.441  1.00 144.00 ? 203  ASP C O     1 
ATOM   5170  C  CB    . ASP C 2  203  ? 5.740   -50.411 39.225  1.00 146.85 ? 203  ASP C CB    1 
ATOM   5171  C  CG    . ASP C 2  203  ? 5.181   -50.755 37.865  1.00 150.88 ? 203  ASP C CG    1 
ATOM   5172  O  OD1   . ASP C 2  203  ? 4.002   -51.162 37.794  1.00 150.50 ? 203  ASP C OD1   1 
ATOM   5173  O  OD2   . ASP C 2  203  ? 5.916   -50.599 36.866  1.00 155.09 ? 203  ASP C OD2   1 
ATOM   5174  N  N     . GLN C 2  204  ? 2.821   -49.266 39.292  1.00 144.46 ? 204  GLN C N     1 
ATOM   5175  C  CA    . GLN C 2  204  ? 1.409   -49.383 39.647  1.00 143.83 ? 204  GLN C CA    1 
ATOM   5176  C  C     . GLN C 2  204  ? 1.115   -50.674 40.397  1.00 144.51 ? 204  GLN C C     1 
ATOM   5177  O  O     . GLN C 2  204  ? 0.212   -50.709 41.239  1.00 143.01 ? 204  GLN C O     1 
ATOM   5178  C  CB    . GLN C 2  204  ? 0.534   -49.295 38.398  1.00 143.60 ? 204  GLN C CB    1 
ATOM   5179  C  CG    . GLN C 2  204  ? -0.956  -49.342 38.703  1.00 142.60 ? 204  GLN C CG    1 
ATOM   5180  C  CD    . GLN C 2  204  ? -1.803  -49.477 37.459  1.00 147.21 ? 204  GLN C CD    1 
ATOM   5181  O  OE1   . GLN C 2  204  ? -1.284  -49.557 36.346  1.00 148.17 ? 204  GLN C OE1   1 
ATOM   5182  N  NE2   . GLN C 2  204  ? -3.119  -49.506 37.641  1.00 149.08 ? 204  GLN C NE2   1 
ATOM   5183  N  N     . GLU C 2  205  ? 1.868   -51.738 40.117  1.00 145.46 ? 205  GLU C N     1 
ATOM   5184  C  CA    . GLU C 2  205  ? 1.644   -53.006 40.804  1.00 146.90 ? 205  GLU C CA    1 
ATOM   5185  C  C     . GLU C 2  205  ? 1.991   -52.894 42.284  1.00 144.64 ? 205  GLU C C     1 
ATOM   5186  O  O     . GLU C 2  205  ? 1.218   -53.325 43.150  1.00 146.86 ? 205  GLU C O     1 
ATOM   5187  C  CB    . GLU C 2  205  ? 2.462   -54.108 40.129  1.00 155.45 ? 205  GLU C CB    1 
ATOM   5188  C  CG    . GLU C 2  205  ? 2.031   -55.524 40.478  1.00 164.19 ? 205  GLU C CG    1 
ATOM   5189  C  CD    . GLU C 2  205  ? 2.399   -56.529 39.394  1.00 166.10 ? 205  GLU C CD    1 
ATOM   5190  O  OE1   . GLU C 2  205  ? 2.929   -56.107 38.344  1.00 154.52 ? 205  GLU C OE1   1 
ATOM   5191  O  OE2   . GLU C 2  205  ? 2.154   -57.739 39.590  1.00 170.54 ? 205  GLU C OE2   1 
ATOM   5192  N  N     . THR C 2  206  ? 3.151   -52.304 42.590  1.00 144.25 ? 206  THR C N     1 
ATOM   5193  C  CA    . THR C 2  206  ? 3.576   -52.157 43.979  1.00 143.84 ? 206  THR C CA    1 
ATOM   5194  C  C     . THR C 2  206  ? 2.616   -51.270 44.765  1.00 141.99 ? 206  THR C C     1 
ATOM   5195  O  O     . THR C 2  206  ? 2.232   -51.603 45.893  1.00 138.68 ? 206  THR C O     1 
ATOM   5196  C  CB    . THR C 2  206  ? 4.994   -51.587 44.032  1.00 139.64 ? 206  THR C CB    1 
ATOM   5197  O  OG1   . THR C 2  206  ? 5.811   -52.248 43.058  1.00 132.22 ? 206  THR C OG1   1 
ATOM   5198  C  CG2   . THR C 2  206  ? 5.596   -51.788 45.414  1.00 134.49 ? 206  THR C CG2   1 
ATOM   5199  N  N     . LEU C 2  207  ? 2.210   -50.139 44.182  1.00 139.41 ? 207  LEU C N     1 
ATOM   5200  C  CA    . LEU C 2  207  ? 1.288   -49.244 44.875  1.00 138.73 ? 207  LEU C CA    1 
ATOM   5201  C  C     . LEU C 2  207  ? -0.111  -49.839 44.976  1.00 137.28 ? 207  LEU C C     1 
ATOM   5202  O  O     . LEU C 2  207  ? -0.841  -49.537 45.924  1.00 134.81 ? 207  LEU C O     1 
ATOM   5203  C  CB    . LEU C 2  207  ? 1.240   -47.885 44.174  1.00 133.15 ? 207  LEU C CB    1 
ATOM   5204  C  CG    . LEU C 2  207  ? 2.556   -47.103 44.114  1.00 128.96 ? 207  LEU C CG    1 
ATOM   5205  C  CD1   . LEU C 2  207  ? 2.328   -45.710 43.552  1.00 119.08 ? 207  LEU C CD1   1 
ATOM   5206  C  CD2   . LEU C 2  207  ? 3.218   -47.034 45.481  1.00 127.50 ? 207  LEU C CD2   1 
ATOM   5207  N  N     . ALA C 2  208  ? -0.496  -50.693 44.027  1.00 140.07 ? 208  ALA C N     1 
ATOM   5208  C  CA    . ALA C 2  208  ? -1.805  -51.329 44.100  1.00 137.65 ? 208  ALA C CA    1 
ATOM   5209  C  C     . ALA C 2  208  ? -1.841  -52.415 45.166  1.00 137.71 ? 208  ALA C C     1 
ATOM   5210  O  O     . ALA C 2  208  ? -2.878  -52.613 45.809  1.00 134.44 ? 208  ALA C O     1 
ATOM   5211  C  CB    . ALA C 2  208  ? -2.190  -51.904 42.738  1.00 140.02 ? 208  ALA C CB    1 
ATOM   5212  N  N     . ARG C 2  209  ? -0.730  -53.129 45.372  1.00 138.40 ? 209  ARG C N     1 
ATOM   5213  C  CA    . ARG C 2  209  ? -0.709  -54.114 46.451  1.00 141.13 ? 209  ARG C CA    1 
ATOM   5214  C  C     . ARG C 2  209  ? -0.479  -53.466 47.812  1.00 138.30 ? 209  ARG C C     1 
ATOM   5215  O  O     . ARG C 2  209  ? -0.938  -53.999 48.829  1.00 136.47 ? 209  ARG C O     1 
ATOM   5216  C  CB    . ARG C 2  209  ? 0.351   -55.190 46.188  1.00 146.36 ? 209  ARG C CB    1 
ATOM   5217  C  CG    . ARG C 2  209  ? 1.734   -54.663 45.843  1.00 148.06 ? 209  ARG C CG    1 
ATOM   5218  C  CD    . ARG C 2  209  ? 2.738   -55.789 45.623  1.00 148.74 ? 209  ARG C CD    1 
ATOM   5219  N  NE    . ARG C 2  209  ? 3.331   -56.231 46.881  1.00 152.76 ? 209  ARG C NE    1 
ATOM   5220  C  CZ    . ARG C 2  209  ? 4.446   -55.722 47.398  1.00 149.68 ? 209  ARG C CZ    1 
ATOM   5221  N  NH1   . ARG C 2  209  ? 5.095   -54.756 46.761  1.00 141.60 ? 209  ARG C NH1   1 
ATOM   5222  N  NH2   . ARG C 2  209  ? 4.912   -56.180 48.552  1.00 147.91 ? 209  ARG C NH2   1 
ATOM   5223  N  N     . GLU C 2  210  ? 0.207   -52.321 47.855  1.00 139.54 ? 210  GLU C N     1 
ATOM   5224  C  CA    . GLU C 2  210  ? 0.472   -51.662 49.129  1.00 135.78 ? 210  GLU C CA    1 
ATOM   5225  C  C     . GLU C 2  210  ? -0.736  -50.864 49.613  1.00 129.28 ? 210  GLU C C     1 
ATOM   5226  O  O     . GLU C 2  210  ? -1.142  -50.980 50.774  1.00 128.86 ? 210  GLU C O     1 
ATOM   5227  C  CB    . GLU C 2  210  ? 1.695   -50.753 48.997  1.00 133.16 ? 210  GLU C CB    1 
ATOM   5228  C  CG    . GLU C 2  210  ? 2.653   -50.824 50.170  1.00 131.04 ? 210  GLU C CG    1 
ATOM   5229  C  CD    . GLU C 2  210  ? 3.509   -52.076 50.147  1.00 131.99 ? 210  GLU C CD    1 
ATOM   5230  O  OE1   . GLU C 2  210  ? 3.857   -52.537 49.041  1.00 134.84 ? 210  GLU C OE1   1 
ATOM   5231  O  OE2   . GLU C 2  210  ? 3.833   -52.600 51.233  1.00 135.34 ? 210  GLU C OE2   1 
ATOM   5232  N  N     . LEU C 2  211  ? -1.320  -50.050 48.734  1.00 129.25 ? 211  LEU C N     1 
ATOM   5233  C  CA    . LEU C 2  211  ? -2.385  -49.122 49.087  1.00 127.26 ? 211  LEU C CA    1 
ATOM   5234  C  C     . LEU C 2  211  ? -3.768  -49.615 48.689  1.00 129.35 ? 211  LEU C C     1 
ATOM   5235  O  O     . LEU C 2  211  ? -4.745  -48.879 48.863  1.00 131.41 ? 211  LEU C O     1 
ATOM   5236  C  CB    . LEU C 2  211  ? -2.132  -47.759 48.432  1.00 123.70 ? 211  LEU C CB    1 
ATOM   5237  C  CG    . LEU C 2  211  ? -1.213  -46.731 49.097  1.00 120.29 ? 211  LEU C CG    1 
ATOM   5238  C  CD1   . LEU C 2  211  ? 0.085   -47.344 49.596  1.00 120.90 ? 211  LEU C CD1   1 
ATOM   5239  C  CD2   . LEU C 2  211  ? -0.920  -45.621 48.114  1.00 120.16 ? 211  LEU C CD2   1 
ATOM   5240  N  N     . GLY C 2  212  ? -3.876  -50.829 48.147  1.00 132.75 ? 212  GLY C N     1 
ATOM   5241  C  CA    . GLY C 2  212  ? -5.163  -51.304 47.672  1.00 131.49 ? 212  GLY C CA    1 
ATOM   5242  C  C     . GLY C 2  212  ? -6.142  -51.609 48.785  1.00 127.35 ? 212  GLY C C     1 
ATOM   5243  O  O     . GLY C 2  212  ? -7.354  -51.450 48.608  1.00 125.11 ? 212  GLY C O     1 
ATOM   5244  N  N     . ALA C 2  213  ? -5.640  -52.033 49.947  1.00 123.59 ? 213  ALA C N     1 
ATOM   5245  C  CA    . ALA C 2  213  ? -6.504  -52.450 51.045  1.00 122.12 ? 213  ALA C CA    1 
ATOM   5246  C  C     . ALA C 2  213  ? -7.459  -51.354 51.503  1.00 125.86 ? 213  ALA C C     1 
ATOM   5247  O  O     . ALA C 2  213  ? -8.422  -51.655 52.219  1.00 126.16 ? 213  ALA C O     1 
ATOM   5248  C  CB    . ALA C 2  213  ? -5.650  -52.923 52.222  1.00 118.70 ? 213  ALA C CB    1 
ATOM   5249  N  N     . TYR C 2  214  ? -7.230  -50.106 51.106  1.00 128.51 ? 214  TYR C N     1 
ATOM   5250  C  CA    . TYR C 2  214  ? -8.047  -48.979 51.538  1.00 133.10 ? 214  TYR C CA    1 
ATOM   5251  C  C     . TYR C 2  214  ? -9.091  -48.677 50.470  1.00 138.22 ? 214  TYR C C     1 
ATOM   5252  O  O     . TYR C 2  214  ? -8.751  -48.468 49.299  1.00 132.55 ? 214  TYR C O     1 
ATOM   5253  C  CB    . TYR C 2  214  ? -7.166  -47.764 51.825  1.00 123.47 ? 214  TYR C CB    1 
ATOM   5254  C  CG    . TYR C 2  214  ? -6.026  -48.122 52.748  1.00 116.67 ? 214  TYR C CG    1 
ATOM   5255  C  CD1   . TYR C 2  214  ? -6.249  -48.317 54.103  1.00 112.67 ? 214  TYR C CD1   1 
ATOM   5256  C  CD2   . TYR C 2  214  ? -4.735  -48.300 52.263  1.00 120.75 ? 214  TYR C CD2   1 
ATOM   5257  C  CE1   . TYR C 2  214  ? -5.220  -48.659 54.954  1.00 109.53 ? 214  TYR C CE1   1 
ATOM   5258  C  CE2   . TYR C 2  214  ? -3.695  -48.643 53.109  1.00 116.19 ? 214  TYR C CE2   1 
ATOM   5259  C  CZ    . TYR C 2  214  ? -3.946  -48.820 54.455  1.00 111.97 ? 214  TYR C CZ    1 
ATOM   5260  O  OH    . TYR C 2  214  ? -2.928  -49.162 55.312  1.00 111.51 ? 214  TYR C OH    1 
ATOM   5261  N  N     . GLY C 2  215  ? -10.357 -48.659 50.881  1.00 137.18 ? 215  GLY C N     1 
ATOM   5262  C  CA    . GLY C 2  215  ? -11.449 -48.619 49.933  1.00 144.12 ? 215  GLY C CA    1 
ATOM   5263  C  C     . GLY C 2  215  ? -11.492 -47.313 49.170  1.00 145.75 ? 215  GLY C C     1 
ATOM   5264  O  O     . GLY C 2  215  ? -11.574 -46.231 49.779  1.00 145.76 ? 215  GLY C O     1 
ATOM   5265  N  N     . GLU C 2  216  ? -11.415 -47.396 47.840  1.00 145.75 ? 216  GLU C N     1 
ATOM   5266  C  CA    . GLU C 2  216  ? -11.642 -46.299 46.902  1.00 149.80 ? 216  GLU C CA    1 
ATOM   5267  C  C     . GLU C 2  216  ? -10.568 -45.221 46.982  1.00 148.41 ? 216  GLU C C     1 
ATOM   5268  O  O     . GLU C 2  216  ? -10.548 -44.298 46.161  1.00 149.43 ? 216  GLU C O     1 
ATOM   5269  C  CB    . GLU C 2  216  ? -13.046 -45.697 47.112  1.00 149.50 ? 216  GLU C CB    1 
ATOM   5270  C  CG    . GLU C 2  216  ? -13.168 -44.480 48.059  1.00 149.95 ? 216  GLU C CG    1 
ATOM   5271  C  CD    . GLU C 2  216  ? -13.056 -43.137 47.360  1.00 153.37 ? 216  GLU C CD    1 
ATOM   5272  O  OE1   . GLU C 2  216  ? -13.142 -43.102 46.116  1.00 152.15 ? 216  GLU C OE1   1 
ATOM   5273  O  OE2   . GLU C 2  216  ? -12.876 -42.116 48.060  1.00 152.31 ? 216  GLU C OE2   1 
ATOM   5274  N  N     . LEU C 2  217  ? -9.634  -45.362 47.916  1.00 143.21 ? 217  LEU C N     1 
ATOM   5275  C  CA    . LEU C 2  217  ? -8.611  -44.339 48.071  1.00 136.99 ? 217  LEU C CA    1 
ATOM   5276  C  C     . LEU C 2  217  ? -7.520  -44.484 47.019  1.00 135.83 ? 217  LEU C C     1 
ATOM   5277  O  O     . LEU C 2  217  ? -7.156  -43.508 46.351  1.00 135.17 ? 217  LEU C O     1 
ATOM   5278  C  CB    . LEU C 2  217  ? -8.038  -44.395 49.486  1.00 134.23 ? 217  LEU C CB    1 
ATOM   5279  C  CG    . LEU C 2  217  ? -9.056  -44.002 50.564  1.00 136.64 ? 217  LEU C CG    1 
ATOM   5280  C  CD1   . LEU C 2  217  ? -8.495  -44.244 51.945  1.00 125.20 ? 217  LEU C CD1   1 
ATOM   5281  C  CD2   . LEU C 2  217  ? -9.483  -42.550 50.396  1.00 131.39 ? 217  LEU C CD2   1 
ATOM   5282  N  N     . VAL C 2  218  ? -6.999  -45.700 46.850  1.00 136.43 ? 218  VAL C N     1 
ATOM   5283  C  CA    . VAL C 2  218  ? -5.946  -45.944 45.875  1.00 134.35 ? 218  VAL C CA    1 
ATOM   5284  C  C     . VAL C 2  218  ? -6.394  -45.600 44.459  1.00 135.95 ? 218  VAL C C     1 
ATOM   5285  O  O     . VAL C 2  218  ? -5.551  -45.336 43.594  1.00 133.56 ? 218  VAL C O     1 
ATOM   5286  C  CB    . VAL C 2  218  ? -5.471  -47.410 45.981  1.00 133.38 ? 218  VAL C CB    1 
ATOM   5287  C  CG1   . VAL C 2  218  ? -6.564  -48.367 45.524  1.00 132.84 ? 218  VAL C CG1   1 
ATOM   5288  C  CG2   . VAL C 2  218  ? -4.179  -47.617 45.197  1.00 135.60 ? 218  VAL C CG2   1 
ATOM   5289  N  N     . GLN C 2  219  ? -7.708  -45.570 44.206  1.00 140.66 ? 219  GLN C N     1 
ATOM   5290  C  CA    . GLN C 2  219  ? -8.203  -45.226 42.876  1.00 141.80 ? 219  GLN C CA    1 
ATOM   5291  C  C     . GLN C 2  219  ? -7.858  -43.791 42.495  1.00 140.51 ? 219  GLN C C     1 
ATOM   5292  O  O     . GLN C 2  219  ? -7.582  -43.513 41.321  1.00 139.69 ? 219  GLN C O     1 
ATOM   5293  C  CB    . GLN C 2  219  ? -9.715  -45.451 42.796  1.00 140.41 ? 219  GLN C CB    1 
ATOM   5294  C  CG    . GLN C 2  219  ? -10.100 -46.887 42.484  1.00 141.36 ? 219  GLN C CG    1 
ATOM   5295  C  CD    . GLN C 2  219  ? -9.406  -47.412 41.237  1.00 143.56 ? 219  GLN C CD    1 
ATOM   5296  O  OE1   . GLN C 2  219  ? -8.835  -48.502 41.244  1.00 143.76 ? 219  GLN C OE1   1 
ATOM   5297  N  NE2   . GLN C 2  219  ? -9.455  -46.636 40.157  1.00 139.26 ? 219  GLN C NE2   1 
ATOM   5298  N  N     . GLY C 2  220  ? -7.865  -42.872 43.461  1.00 137.59 ? 220  GLY C N     1 
ATOM   5299  C  CA    . GLY C 2  220  ? -7.398  -41.521 43.203  1.00 131.72 ? 220  GLY C CA    1 
ATOM   5300  C  C     . GLY C 2  220  ? -5.908  -41.415 42.953  1.00 132.59 ? 220  GLY C C     1 
ATOM   5301  O  O     . GLY C 2  220  ? -5.442  -40.360 42.508  1.00 128.60 ? 220  GLY C O     1 
ATOM   5302  N  N     . LEU C 2  221  ? -5.156  -42.478 43.230  1.00 136.95 ? 221  LEU C N     1 
ATOM   5303  C  CA    . LEU C 2  221  ? -3.726  -42.525 42.974  1.00 130.93 ? 221  LEU C CA    1 
ATOM   5304  C  C     . LEU C 2  221  ? -3.395  -43.097 41.600  1.00 135.56 ? 221  LEU C C     1 
ATOM   5305  O  O     . LEU C 2  221  ? -2.239  -43.021 41.173  1.00 135.31 ? 221  LEU C O     1 
ATOM   5306  C  CB    . LEU C 2  221  ? -3.044  -43.346 44.077  1.00 126.10 ? 221  LEU C CB    1 
ATOM   5307  C  CG    . LEU C 2  221  ? -1.539  -43.594 44.046  1.00 124.67 ? 221  LEU C CG    1 
ATOM   5308  C  CD1   . LEU C 2  221  ? -0.939  -43.276 45.384  1.00 116.55 ? 221  LEU C CD1   1 
ATOM   5309  C  CD2   . LEU C 2  221  ? -1.270  -45.039 43.672  1.00 133.00 ? 221  LEU C CD2   1 
ATOM   5310  N  N     . MET C 2  222  ? -4.378  -43.643 40.887  1.00 139.27 ? 222  MET C N     1 
ATOM   5311  C  CA    . MET C 2  222  ? -4.135  -44.308 39.611  1.00 139.51 ? 222  MET C CA    1 
ATOM   5312  C  C     . MET C 2  222  ? -4.301  -43.308 38.471  1.00 140.48 ? 222  MET C C     1 
ATOM   5313  O  O     . MET C 2  222  ? -5.413  -42.846 38.193  1.00 138.16 ? 222  MET C O     1 
ATOM   5314  C  CB    . MET C 2  222  ? -5.071  -45.500 39.439  1.00 138.12 ? 222  MET C CB    1 
ATOM   5315  C  CG    . MET C 2  222  ? -4.839  -46.612 40.452  1.00 143.64 ? 222  MET C CG    1 
ATOM   5316  S  SD    . MET C 2  222  ? -3.118  -47.157 40.510  1.00 146.88 ? 222  MET C SD    1 
ATOM   5317  C  CE    . MET C 2  222  ? -3.201  -48.420 41.776  1.00 140.43 ? 222  MET C CE    1 
ATOM   5318  N  N     . ASP C 2  223  ? -3.192  -42.979 37.813  1.00 144.58 ? 223  ASP C N     1 
ATOM   5319  C  CA    . ASP C 2  223  ? -3.199  -42.176 36.597  1.00 147.40 ? 223  ASP C CA    1 
ATOM   5320  C  C     . ASP C 2  223  ? -2.277  -42.844 35.591  1.00 144.81 ? 223  ASP C C     1 
ATOM   5321  O  O     . ASP C 2  223  ? -1.071  -42.961 35.829  1.00 142.16 ? 223  ASP C O     1 
ATOM   5322  C  CB    . ASP C 2  223  ? -2.764  -40.734 36.869  1.00 147.34 ? 223  ASP C CB    1 
ATOM   5323  C  CG    . ASP C 2  223  ? -2.981  -39.828 35.672  1.00 145.94 ? 223  ASP C CG    1 
ATOM   5324  O  OD1   . ASP C 2  223  ? -4.097  -39.283 35.543  1.00 146.01 ? 223  ASP C OD1   1 
ATOM   5325  O  OD2   . ASP C 2  223  ? -2.051  -39.683 34.849  1.00 142.01 ? 223  ASP C OD2   1 
ATOM   5326  N  N     . GLU C 2  224  ? -2.850  -43.281 34.470  1.00 147.41 ? 224  GLU C N     1 
ATOM   5327  C  CA    . GLU C 2  224  ? -2.121  -44.117 33.522  1.00 149.91 ? 224  GLU C CA    1 
ATOM   5328  C  C     . GLU C 2  224  ? -1.044  -43.338 32.775  1.00 147.49 ? 224  GLU C C     1 
ATOM   5329  O  O     . GLU C 2  224  ? 0.001   -43.906 32.438  1.00 146.53 ? 224  GLU C O     1 
ATOM   5330  C  CB    . GLU C 2  224  ? -3.102  -44.763 32.540  1.00 150.30 ? 224  GLU C CB    1 
ATOM   5331  C  CG    . GLU C 2  224  ? -4.234  -43.844 32.079  1.00 153.80 ? 224  GLU C CG    1 
ATOM   5332  C  CD    . GLU C 2  224  ? -5.336  -43.690 33.119  1.00 153.84 ? 224  GLU C CD    1 
ATOM   5333  O  OE1   . GLU C 2  224  ? -6.015  -44.692 33.424  1.00 150.80 ? 224  GLU C OE1   1 
ATOM   5334  O  OE2   . GLU C 2  224  ? -5.503  -42.568 33.647  1.00 151.13 ? 224  GLU C OE2   1 
ATOM   5335  N  N     . SER C 2  225  ? -1.270  -42.048 32.507  1.00 147.28 ? 225  SER C N     1 
ATOM   5336  C  CA    . SER C 2  225  ? -0.252  -41.244 31.837  1.00 145.15 ? 225  SER C CA    1 
ATOM   5337  C  C     . SER C 2  225  ? 1.035   -41.159 32.647  1.00 144.58 ? 225  SER C C     1 
ATOM   5338  O  O     . SER C 2  225  ? 2.099   -40.883 32.080  1.00 141.52 ? 225  SER C O     1 
ATOM   5339  C  CB    . SER C 2  225  ? -0.788  -39.836 31.554  1.00 139.48 ? 225  SER C CB    1 
ATOM   5340  O  OG    . SER C 2  225  ? -1.139  -39.161 32.750  1.00 137.61 ? 225  SER C OG    1 
ATOM   5341  N  N     . VAL C 2  226  ? 0.960   -41.404 33.955  1.00 146.76 ? 226  VAL C N     1 
ATOM   5342  C  CA    . VAL C 2  226  ? 2.146   -41.358 34.801  1.00 144.80 ? 226  VAL C CA    1 
ATOM   5343  C  C     . VAL C 2  226  ? 2.929   -42.662 34.710  1.00 146.41 ? 226  VAL C C     1 
ATOM   5344  O  O     . VAL C 2  226  ? 4.162   -42.654 34.621  1.00 144.99 ? 226  VAL C O     1 
ATOM   5345  C  CB    . VAL C 2  226  ? 1.741   -41.039 36.249  1.00 138.65 ? 226  VAL C CB    1 
ATOM   5346  C  CG1   . VAL C 2  226  ? 2.970   -40.969 37.141  1.00 134.41 ? 226  VAL C CG1   1 
ATOM   5347  C  CG2   . VAL C 2  226  ? 0.951   -39.739 36.299  1.00 134.62 ? 226  VAL C CG2   1 
ATOM   5348  N  N     . PHE C 2  227  ? 2.236   -43.802 34.734  1.00 144.61 ? 227  PHE C N     1 
ATOM   5349  C  CA    . PHE C 2  227  ? 2.923   -45.084 34.651  1.00 144.11 ? 227  PHE C CA    1 
ATOM   5350  C  C     . PHE C 2  227  ? 3.410   -45.399 33.245  1.00 144.93 ? 227  PHE C C     1 
ATOM   5351  O  O     . PHE C 2  227  ? 4.184   -46.348 33.076  1.00 142.93 ? 227  PHE C O     1 
ATOM   5352  C  CB    . PHE C 2  227  ? 2.005   -46.200 35.152  1.00 141.97 ? 227  PHE C CB    1 
ATOM   5353  C  CG    . PHE C 2  227  ? 1.549   -46.006 36.564  1.00 145.30 ? 227  PHE C CG    1 
ATOM   5354  C  CD1   . PHE C 2  227  ? 2.414   -46.242 37.620  1.00 143.93 ? 227  PHE C CD1   1 
ATOM   5355  C  CD2   . PHE C 2  227  ? 0.262   -45.577 36.838  1.00 146.46 ? 227  PHE C CD2   1 
ATOM   5356  C  CE1   . PHE C 2  227  ? 2.001   -46.056 38.923  1.00 143.10 ? 227  PHE C CE1   1 
ATOM   5357  C  CE2   . PHE C 2  227  ? -0.161  -45.390 38.139  1.00 142.20 ? 227  PHE C CE2   1 
ATOM   5358  C  CZ    . PHE C 2  227  ? 0.709   -45.632 39.184  1.00 143.55 ? 227  PHE C CZ    1 
ATOM   5359  N  N     . ALA C 2  228  ? 2.986   -44.630 32.244  1.00 143.25 ? 228  ALA C N     1 
ATOM   5360  C  CA    . ALA C 2  228  ? 3.418   -44.836 30.869  1.00 142.49 ? 228  ALA C CA    1 
ATOM   5361  C  C     . ALA C 2  228  ? 4.783   -44.228 30.576  1.00 144.42 ? 228  ALA C C     1 
ATOM   5362  O  O     . ALA C 2  228  ? 5.251   -44.324 29.436  1.00 143.47 ? 228  ALA C O     1 
ATOM   5363  C  CB    . ALA C 2  228  ? 2.378   -44.261 29.903  1.00 141.80 ? 228  ALA C CB    1 
ATOM   5364  N  N     . MET C 2  229  ? 5.430   -43.612 31.564  1.00 144.79 ? 229  MET C N     1 
ATOM   5365  C  CA    . MET C 2  229  ? 6.738   -43.001 31.382  1.00 143.93 ? 229  MET C CA    1 
ATOM   5366  C  C     . MET C 2  229  ? 7.700   -43.500 32.448  1.00 142.52 ? 229  MET C C     1 
ATOM   5367  O  O     . MET C 2  229  ? 7.323   -43.663 33.613  1.00 141.86 ? 229  MET C O     1 
ATOM   5368  C  CB    . MET C 2  229  ? 6.650   -41.471 31.429  1.00 143.18 ? 229  MET C CB    1 
ATOM   5369  C  CG    . MET C 2  229  ? 5.780   -40.928 32.547  1.00 142.48 ? 229  MET C CG    1 
ATOM   5370  S  SD    . MET C 2  229  ? 5.719   -39.127 32.530  1.00 149.25 ? 229  MET C SD    1 
ATOM   5371  C  CE    . MET C 2  229  ? 4.426   -38.798 33.722  1.00 139.98 ? 229  MET C CE    1 
ATOM   5372  N  N     . ARG C 2  230  ? 8.946   -43.737 32.037  1.00 145.05 ? 230  ARG C N     1 
ATOM   5373  C  CA    . ARG C 2  230  ? 9.978   -44.205 32.945  1.00 145.47 ? 230  ARG C CA    1 
ATOM   5374  C  C     . ARG C 2  230  ? 10.368  -43.095 33.921  1.00 144.35 ? 230  ARG C C     1 
ATOM   5375  O  O     . ARG C 2  230  ? 10.023  -41.929 33.714  1.00 142.48 ? 230  ARG C O     1 
ATOM   5376  C  CB    . ARG C 2  230  ? 11.195  -44.683 32.153  1.00 146.68 ? 230  ARG C CB    1 
ATOM   5377  C  CG    . ARG C 2  230  ? 11.263  -44.167 30.731  1.00 148.15 ? 230  ARG C CG    1 
ATOM   5378  C  CD    . ARG C 2  230  ? 12.518  -44.658 30.032  1.00 151.35 ? 230  ARG C CD    1 
ATOM   5379  N  NE    . ARG C 2  230  ? 12.360  -44.655 28.581  1.00 156.58 ? 230  ARG C NE    1 
ATOM   5380  C  CZ    . ARG C 2  230  ? 12.453  -43.567 27.823  1.00 158.45 ? 230  ARG C CZ    1 
ATOM   5381  N  NH1   . ARG C 2  230  ? 12.292  -43.656 26.509  1.00 159.88 ? 230  ARG C NH1   1 
ATOM   5382  N  NH2   . ARG C 2  230  ? 12.702  -42.389 28.381  1.00 154.05 ? 230  ARG C NH2   1 
ATOM   5383  N  N     . PRO C 2  231  ? 11.072  -43.441 35.010  1.00 143.62 ? 231  PRO C N     1 
ATOM   5384  C  CA    . PRO C 2  231  ? 11.472  -42.415 35.991  1.00 138.02 ? 231  PRO C CA    1 
ATOM   5385  C  C     . PRO C 2  231  ? 12.136  -41.181 35.394  1.00 139.81 ? 231  PRO C C     1 
ATOM   5386  O  O     . PRO C 2  231  ? 11.964  -40.081 35.931  1.00 135.61 ? 231  PRO C O     1 
ATOM   5387  C  CB    . PRO C 2  231  ? 12.436  -43.183 36.905  1.00 134.33 ? 231  PRO C CB    1 
ATOM   5388  C  CG    . PRO C 2  231  ? 11.910  -44.575 36.889  1.00 135.89 ? 231  PRO C CG    1 
ATOM   5389  C  CD    . PRO C 2  231  ? 11.367  -44.804 35.499  1.00 141.87 ? 231  PRO C CD    1 
ATOM   5390  N  N     . GLU C 2  232  ? 12.882  -41.325 34.298  1.00 140.21 ? 232  GLU C N     1 
ATOM   5391  C  CA    . GLU C 2  232  ? 13.552  -40.176 33.695  1.00 138.46 ? 232  GLU C CA    1 
ATOM   5392  C  C     . GLU C 2  232  ? 12.546  -39.144 33.190  1.00 139.29 ? 232  GLU C C     1 
ATOM   5393  O  O     . GLU C 2  232  ? 12.645  -37.946 33.500  1.00 140.60 ? 232  GLU C O     1 
ATOM   5394  C  CB    . GLU C 2  232  ? 14.460  -40.656 32.562  1.00 139.75 ? 232  GLU C CB    1 
ATOM   5395  C  CG    . GLU C 2  232  ? 14.964  -39.557 31.647  1.00 140.93 ? 232  GLU C CG    1 
ATOM   5396  C  CD    . GLU C 2  232  ? 15.784  -38.523 32.382  1.00 140.16 ? 232  GLU C CD    1 
ATOM   5397  O  OE1   . GLU C 2  232  ? 15.696  -37.332 32.016  1.00 136.37 ? 232  GLU C OE1   1 
ATOM   5398  O  OE2   . GLU C 2  232  ? 16.509  -38.901 33.328  1.00 142.10 ? 232  GLU C OE2   1 
ATOM   5399  N  N     . GLU C 2  233  ? 11.567  -39.594 32.401  1.00 139.09 ? 233  GLU C N     1 
ATOM   5400  C  CA    . GLU C 2  233  ? 10.603  -38.666 31.820  1.00 140.80 ? 233  GLU C CA    1 
ATOM   5401  C  C     . GLU C 2  233  ? 9.713   -38.047 32.892  1.00 140.03 ? 233  GLU C C     1 
ATOM   5402  O  O     . GLU C 2  233  ? 9.386   -36.857 32.821  1.00 139.26 ? 233  GLU C O     1 
ATOM   5403  C  CB    . GLU C 2  233  ? 9.769   -39.379 30.757  1.00 147.38 ? 233  GLU C CB    1 
ATOM   5404  C  CG    . GLU C 2  233  ? 10.595  -39.981 29.629  1.00 146.77 ? 233  GLU C CG    1 
ATOM   5405  C  CD    . GLU C 2  233  ? 9.738   -40.671 28.590  1.00 148.18 ? 233  GLU C CD    1 
ATOM   5406  O  OE1   . GLU C 2  233  ? 8.508   -40.461 28.601  1.00 145.44 ? 233  GLU C OE1   1 
ATOM   5407  O  OE2   . GLU C 2  233  ? 10.293  -41.426 27.765  1.00 152.35 ? 233  GLU C OE2   1 
ATOM   5408  N  N     . ALA C 2  234  ? 9.321   -38.832 33.899  1.00 141.36 ? 234  ALA C N     1 
ATOM   5409  C  CA    . ALA C 2  234  ? 8.534   -38.279 34.998  1.00 136.38 ? 234  ALA C CA    1 
ATOM   5410  C  C     . ALA C 2  234  ? 9.341   -37.259 35.792  1.00 132.93 ? 234  ALA C C     1 
ATOM   5411  O  O     . ALA C 2  234  ? 8.794   -36.259 36.272  1.00 129.56 ? 234  ALA C O     1 
ATOM   5412  C  CB    . ALA C 2  234  ? 8.038   -39.402 35.910  1.00 133.51 ? 234  ALA C CB    1 
ATOM   5413  N  N     . LEU C 2  235  ? 10.648  -37.494 35.935  1.00 133.54 ? 235  LEU C N     1 
ATOM   5414  C  CA    . LEU C 2  235  ? 11.507  -36.537 36.625  1.00 130.25 ? 235  LEU C CA    1 
ATOM   5415  C  C     . LEU C 2  235  ? 11.563  -35.214 35.874  1.00 131.18 ? 235  LEU C C     1 
ATOM   5416  O  O     . LEU C 2  235  ? 11.455  -34.140 36.477  1.00 134.18 ? 235  LEU C O     1 
ATOM   5417  C  CB    . LEU C 2  235  ? 12.910  -37.127 36.798  1.00 132.02 ? 235  LEU C CB    1 
ATOM   5418  C  CG    . LEU C 2  235  ? 14.022  -36.218 37.328  1.00 130.06 ? 235  LEU C CG    1 
ATOM   5419  C  CD1   . LEU C 2  235  ? 13.629  -35.606 38.657  1.00 129.65 ? 235  LEU C CD1   1 
ATOM   5420  C  CD2   . LEU C 2  235  ? 15.319  -36.997 37.466  1.00 128.83 ? 235  LEU C CD2   1 
ATOM   5421  N  N     . ILE C 2  236  ? 11.735  -35.273 34.550  1.00 135.19 ? 236  ILE C N     1 
ATOM   5422  C  CA    . ILE C 2  236  ? 11.735  -34.040 33.758  1.00 137.20 ? 236  ILE C CA    1 
ATOM   5423  C  C     . ILE C 2  236  ? 10.367  -33.359 33.829  1.00 135.28 ? 236  ILE C C     1 
ATOM   5424  O  O     . ILE C 2  236  ? 10.270  -32.125 33.891  1.00 132.17 ? 236  ILE C O     1 
ATOM   5425  C  CB    . ILE C 2  236  ? 12.166  -34.323 32.304  1.00 135.58 ? 236  ILE C CB    1 
ATOM   5426  C  CG1   . ILE C 2  236  ? 13.656  -34.683 32.238  1.00 129.87 ? 236  ILE C CG1   1 
ATOM   5427  C  CG2   . ILE C 2  236  ? 11.889  -33.121 31.409  1.00 129.43 ? 236  ILE C CG2   1 
ATOM   5428  C  CD1   . ILE C 2  236  ? 14.202  -34.800 30.827  1.00 135.45 ? 236  ILE C CD1   1 
ATOM   5429  N  N     . ARG C 2  237  ? 9.292   -34.155 33.840  1.00 134.91 ? 237  ARG C N     1 
ATOM   5430  C  CA    . ARG C 2  237  ? 7.942   -33.611 33.966  1.00 132.20 ? 237  ARG C CA    1 
ATOM   5431  C  C     . ARG C 2  237  ? 7.776   -32.839 35.270  1.00 133.20 ? 237  ARG C C     1 
ATOM   5432  O  O     . ARG C 2  237  ? 7.253   -31.716 35.288  1.00 135.79 ? 237  ARG C O     1 
ATOM   5433  C  CB    . ARG C 2  237  ? 6.928   -34.752 33.884  1.00 133.36 ? 237  ARG C CB    1 
ATOM   5434  C  CG    . ARG C 2  237  ? 5.515   -34.356 34.243  1.00 130.50 ? 237  ARG C CG    1 
ATOM   5435  C  CD    . ARG C 2  237  ? 4.990   -33.317 33.280  1.00 129.88 ? 237  ARG C CD    1 
ATOM   5436  N  NE    . ARG C 2  237  ? 3.628   -32.917 33.608  1.00 131.10 ? 237  ARG C NE    1 
ATOM   5437  C  CZ    . ARG C 2  237  ? 2.914   -32.053 32.896  1.00 132.83 ? 237  ARG C CZ    1 
ATOM   5438  N  NH1   . ARG C 2  237  ? 1.679   -31.745 33.268  1.00 130.36 ? 237  ARG C NH1   1 
ATOM   5439  N  NH2   . ARG C 2  237  ? 3.435   -31.499 31.809  1.00 130.94 ? 237  ARG C NH2   1 
ATOM   5440  N  N     . LEU C 2  238  ? 8.217   -33.433 36.378  1.00 130.67 ? 238  LEU C N     1 
ATOM   5441  C  CA    . LEU C 2  238  ? 8.122   -32.757 37.666  1.00 133.09 ? 238  LEU C CA    1 
ATOM   5442  C  C     . LEU C 2  238  ? 9.003   -31.514 37.703  1.00 133.17 ? 238  LEU C C     1 
ATOM   5443  O  O     . LEU C 2  238  ? 8.607   -30.483 38.261  1.00 133.59 ? 238  LEU C O     1 
ATOM   5444  C  CB    . LEU C 2  238  ? 8.493   -33.725 38.790  1.00 131.26 ? 238  LEU C CB    1 
ATOM   5445  C  CG    . LEU C 2  238  ? 8.382   -33.182 40.214  1.00 125.14 ? 238  LEU C CG    1 
ATOM   5446  C  CD1   . LEU C 2  238  ? 7.014   -32.555 40.445  1.00 120.40 ? 238  LEU C CD1   1 
ATOM   5447  C  CD2   . LEU C 2  238  ? 8.646   -34.293 41.214  1.00 115.36 ? 238  LEU C CD2   1 
ATOM   5448  N  N     . PHE C 2  239  ? 10.198  -31.589 37.104  1.00 131.51 ? 239  PHE C N     1 
ATOM   5449  C  CA    . PHE C 2  239  ? 11.091  -30.434 37.077  1.00 128.87 ? 239  PHE C CA    1 
ATOM   5450  C  C     . PHE C 2  239  ? 10.487  -29.279 36.295  1.00 131.16 ? 239  PHE C C     1 
ATOM   5451  O  O     . PHE C 2  239  ? 10.727  -28.113 36.627  1.00 129.76 ? 239  PHE C O     1 
ATOM   5452  C  CB    . PHE C 2  239  ? 12.445  -30.828 36.484  1.00 126.67 ? 239  PHE C CB    1 
ATOM   5453  C  CG    . PHE C 2  239  ? 13.436  -29.698 36.423  1.00 130.74 ? 239  PHE C CG    1 
ATOM   5454  C  CD1   . PHE C 2  239  ? 14.165  -29.338 37.542  1.00 131.16 ? 239  PHE C CD1   1 
ATOM   5455  C  CD2   . PHE C 2  239  ? 13.636  -28.993 35.247  1.00 133.21 ? 239  PHE C CD2   1 
ATOM   5456  C  CE1   . PHE C 2  239  ? 15.080  -28.301 37.488  1.00 131.79 ? 239  PHE C CE1   1 
ATOM   5457  C  CE2   . PHE C 2  239  ? 14.547  -27.953 35.190  1.00 132.69 ? 239  PHE C CE2   1 
ATOM   5458  C  CZ    . PHE C 2  239  ? 15.270  -27.608 36.311  1.00 133.89 ? 239  PHE C CZ    1 
ATOM   5459  N  N     . THR C 2  240  ? 9.714   -29.580 35.249  1.00 136.86 ? 240  THR C N     1 
ATOM   5460  C  CA    . THR C 2  240  ? 8.999   -28.522 34.539  1.00 137.01 ? 240  THR C CA    1 
ATOM   5461  C  C     . THR C 2  240  ? 7.831   -27.994 35.365  1.00 136.25 ? 240  THR C C     1 
ATOM   5462  O  O     . THR C 2  240  ? 7.532   -26.793 35.334  1.00 132.49 ? 240  THR C O     1 
ATOM   5463  C  CB    . THR C 2  240  ? 8.503   -29.027 33.184  1.00 134.86 ? 240  THR C CB    1 
ATOM   5464  O  OG1   . THR C 2  240  ? 7.621   -30.140 33.378  1.00 135.75 ? 240  THR C OG1   1 
ATOM   5465  C  CG2   . THR C 2  240  ? 9.672   -29.455 32.310  1.00 135.57 ? 240  THR C CG2   1 
ATOM   5466  N  N     . LEU C 2  241  ? 7.151   -28.880 36.101  1.00 135.61 ? 241  LEU C N     1 
ATOM   5467  C  CA    . LEU C 2  241  ? 6.035   -28.445 36.936  1.00 133.20 ? 241  LEU C CA    1 
ATOM   5468  C  C     . LEU C 2  241  ? 6.495   -27.560 38.087  1.00 135.67 ? 241  LEU C C     1 
ATOM   5469  O  O     . LEU C 2  241  ? 5.713   -26.740 38.584  1.00 132.49 ? 241  LEU C O     1 
ATOM   5470  C  CB    . LEU C 2  241  ? 5.279   -29.653 37.481  1.00 131.40 ? 241  LEU C CB    1 
ATOM   5471  C  CG    . LEU C 2  241  ? 4.079   -30.119 36.662  1.00 131.36 ? 241  LEU C CG    1 
ATOM   5472  C  CD1   . LEU C 2  241  ? 3.437   -31.331 37.312  1.00 129.94 ? 241  LEU C CD1   1 
ATOM   5473  C  CD2   . LEU C 2  241  ? 3.069   -28.991 36.508  1.00 123.01 ? 241  LEU C CD2   1 
ATOM   5474  N  N     . LEU C 2  242  ? 7.746   -27.717 38.530  1.00 136.67 ? 242  LEU C N     1 
ATOM   5475  C  CA    . LEU C 2  242  ? 8.285   -26.967 39.659  1.00 134.98 ? 242  LEU C CA    1 
ATOM   5476  C  C     . LEU C 2  242  ? 9.127   -25.763 39.246  1.00 133.80 ? 242  LEU C C     1 
ATOM   5477  O  O     . LEU C 2  242  ? 9.423   -24.919 40.098  1.00 131.08 ? 242  LEU C O     1 
ATOM   5478  C  CB    . LEU C 2  242  ? 9.129   -27.890 40.559  1.00 130.87 ? 242  LEU C CB    1 
ATOM   5479  C  CG    . LEU C 2  242  ? 8.482   -28.547 41.785  1.00 129.83 ? 242  LEU C CG    1 
ATOM   5480  C  CD1   . LEU C 2  242  ? 6.967   -28.614 41.670  1.00 125.90 ? 242  LEU C CD1   1 
ATOM   5481  C  CD2   . LEU C 2  242  ? 9.068   -29.935 41.980  1.00 123.70 ? 242  LEU C CD2   1 
ATOM   5482  N  N     . ARG C 2  243  ? 9.525   -25.660 37.980  1.00 135.45 ? 243  ARG C N     1 
ATOM   5483  C  CA    . ARG C 2  243  ? 10.414  -24.591 37.519  1.00 133.43 ? 243  ARG C CA    1 
ATOM   5484  C  C     . ARG C 2  243  ? 9.982   -24.121 36.138  1.00 135.35 ? 243  ARG C C     1 
ATOM   5485  O  O     . ARG C 2  243  ? 10.555  -24.525 35.118  1.00 137.78 ? 243  ARG C O     1 
ATOM   5486  C  CB    . ARG C 2  243  ? 11.875  -25.056 37.491  1.00 132.05 ? 243  ARG C CB    1 
ATOM   5487  C  CG    . ARG C 2  243  ? 12.417  -25.573 38.820  1.00 133.86 ? 243  ARG C CG    1 
ATOM   5488  C  CD    . ARG C 2  243  ? 12.605  -24.461 39.847  1.00 131.99 ? 243  ARG C CD    1 
ATOM   5489  N  NE    . ARG C 2  243  ? 13.616  -23.490 39.434  1.00 133.78 ? 243  ARG C NE    1 
ATOM   5490  C  CZ    . ARG C 2  243  ? 14.387  -22.812 40.278  1.00 125.44 ? 243  ARG C CZ    1 
ATOM   5491  N  NH1   . ARG C 2  243  ? 15.281  -21.946 39.819  1.00 119.06 ? 243  ARG C NH1   1 
ATOM   5492  N  NH2   . ARG C 2  243  ? 14.275  -23.013 41.584  1.00 123.87 ? 243  ARG C NH2   1 
ATOM   5493  N  N     . PRO C 2  244  ? 8.963   -23.265 36.064  1.00 134.09 ? 244  PRO C N     1 
ATOM   5494  C  CA    . PRO C 2  244  ? 8.611   -22.655 34.776  1.00 133.41 ? 244  PRO C CA    1 
ATOM   5495  C  C     . PRO C 2  244  ? 9.733   -21.754 34.279  1.00 131.59 ? 244  PRO C C     1 
ATOM   5496  O  O     . PRO C 2  244  ? 10.301  -20.963 35.036  1.00 128.36 ? 244  PRO C O     1 
ATOM   5497  C  CB    . PRO C 2  244  ? 7.342   -21.855 35.096  1.00 125.78 ? 244  PRO C CB    1 
ATOM   5498  C  CG    . PRO C 2  244  ? 6.804   -22.468 36.341  1.00 124.86 ? 244  PRO C CG    1 
ATOM   5499  C  CD    . PRO C 2  244  ? 8.000   -22.913 37.119  1.00 128.26 ? 244  PRO C CD    1 
ATOM   5500  N  N     . GLY C 2  245  ? 10.056  -21.884 32.993  1.00 134.27 ? 245  GLY C N     1 
ATOM   5501  C  CA    . GLY C 2  245  ? 11.050  -21.052 32.354  1.00 141.51 ? 245  GLY C CA    1 
ATOM   5502  C  C     . GLY C 2  245  ? 12.468  -21.584 32.397  1.00 142.17 ? 245  GLY C C     1 
ATOM   5503  O  O     . GLY C 2  245  ? 13.289  -21.185 31.562  1.00 142.40 ? 245  GLY C O     1 
ATOM   5504  N  N     . ASP C 2  246  ? 12.780  -22.464 33.337  1.00 137.70 ? 246  ASP C N     1 
ATOM   5505  C  CA    . ASP C 2  246  ? 14.125  -23.020 33.420  1.00 139.92 ? 246  ASP C CA    1 
ATOM   5506  C  C     . ASP C 2  246  ? 14.248  -24.207 32.468  1.00 141.14 ? 246  ASP C C     1 
ATOM   5507  O  O     . ASP C 2  246  ? 13.375  -25.082 32.466  1.00 140.02 ? 246  ASP C O     1 
ATOM   5508  C  CB    . ASP C 2  246  ? 14.434  -23.444 34.856  1.00 142.17 ? 246  ASP C CB    1 
ATOM   5509  C  CG    . ASP C 2  246  ? 15.925  -23.454 35.160  1.00 144.12 ? 246  ASP C CG    1 
ATOM   5510  O  OD1   . ASP C 2  246  ? 16.679  -24.154 34.451  1.00 143.33 ? 246  ASP C OD1   1 
ATOM   5511  O  OD2   . ASP C 2  246  ? 16.343  -22.757 36.111  1.00 140.22 ? 246  ASP C OD2   1 
ATOM   5512  N  N     . PRO C 2  247  ? 15.290  -24.262 31.641  1.00 145.73 ? 247  PRO C N     1 
ATOM   5513  C  CA    . PRO C 2  247  ? 15.417  -25.353 30.655  1.00 145.17 ? 247  PRO C CA    1 
ATOM   5514  C  C     . PRO C 2  247  ? 15.503  -26.713 31.327  1.00 138.62 ? 247  PRO C C     1 
ATOM   5515  O  O     . PRO C 2  247  ? 16.331  -26.929 32.225  1.00 139.22 ? 247  PRO C O     1 
ATOM   5516  C  CB    . PRO C 2  247  ? 16.720  -25.013 29.910  1.00 142.65 ? 247  PRO C CB    1 
ATOM   5517  C  CG    . PRO C 2  247  ? 17.424  -23.993 30.765  1.00 139.15 ? 247  PRO C CG    1 
ATOM   5518  C  CD    . PRO C 2  247  ? 16.334  -23.238 31.465  1.00 141.83 ? 247  PRO C CD    1 
ATOM   5519  N  N     . PRO C 2  248  ? 14.662  -27.663 30.911  1.00 131.86 ? 248  PRO C N     1 
ATOM   5520  C  CA    . PRO C 2  248  ? 14.628  -29.012 31.519  1.00 130.74 ? 248  PRO C CA    1 
ATOM   5521  C  C     . PRO C 2  248  ? 15.755  -29.916 31.032  1.00 133.27 ? 248  PRO C C     1 
ATOM   5522  O  O     . PRO C 2  248  ? 15.568  -30.836 30.229  1.00 135.51 ? 248  PRO C O     1 
ATOM   5523  C  CB    . PRO C 2  248  ? 13.243  -29.528 31.100  1.00 132.68 ? 248  PRO C CB    1 
ATOM   5524  C  CG    . PRO C 2  248  ? 12.499  -28.335 30.546  1.00 133.68 ? 248  PRO C CG    1 
ATOM   5525  C  CD    . PRO C 2  248  ? 13.544  -27.453 29.980  1.00 135.97 ? 248  PRO C CD    1 
ATOM   5526  N  N     . LYS C 2  249  ? 16.963  -29.660 31.527  1.00 134.28 ? 249  LYS C N     1 
ATOM   5527  C  CA    . LYS C 2  249  ? 18.099  -30.531 31.260  1.00 137.10 ? 249  LYS C CA    1 
ATOM   5528  C  C     . LYS C 2  249  ? 18.163  -31.607 32.335  1.00 134.88 ? 249  LYS C C     1 
ATOM   5529  O  O     . LYS C 2  249  ? 17.897  -31.338 33.509  1.00 133.76 ? 249  LYS C O     1 
ATOM   5530  C  CB    . LYS C 2  249  ? 19.406  -29.736 31.220  1.00 139.42 ? 249  LYS C CB    1 
ATOM   5531  C  CG    . LYS C 2  249  ? 20.605  -30.515 30.676  1.00 138.90 ? 249  LYS C CG    1 
ATOM   5532  C  CD    . LYS C 2  249  ? 21.860  -29.645 30.641  1.00 143.32 ? 249  LYS C CD    1 
ATOM   5533  C  CE    . LYS C 2  249  ? 23.093  -30.415 30.176  1.00 132.90 ? 249  LYS C CE    1 
ATOM   5534  N  NZ    . LYS C 2  249  ? 23.059  -30.731 28.725  1.00 130.54 ? 249  LYS C NZ    1 
ATOM   5535  N  N     . ARG C 2  250  ? 18.513  -32.829 31.920  1.00 135.46 ? 250  ARG C N     1 
ATOM   5536  C  CA    . ARG C 2  250  ? 18.424  -33.987 32.808  1.00 134.42 ? 250  ARG C CA    1 
ATOM   5537  C  C     . ARG C 2  250  ? 19.231  -33.779 34.084  1.00 137.81 ? 250  ARG C C     1 
ATOM   5538  O  O     . ARG C 2  250  ? 18.724  -33.992 35.194  1.00 142.60 ? 250  ARG C O     1 
ATOM   5539  C  CB    . ARG C 2  250  ? 18.894  -35.245 32.074  1.00 136.81 ? 250  ARG C CB    1 
ATOM   5540  C  CG    . ARG C 2  250  ? 18.628  -36.548 32.813  1.00 133.01 ? 250  ARG C CG    1 
ATOM   5541  C  CD    . ARG C 2  250  ? 19.828  -37.022 33.622  1.00 130.87 ? 250  ARG C CD    1 
ATOM   5542  N  NE    . ARG C 2  250  ? 19.571  -38.316 34.247  1.00 131.58 ? 250  ARG C NE    1 
ATOM   5543  C  CZ    . ARG C 2  250  ? 20.395  -38.912 35.102  1.00 135.11 ? 250  ARG C CZ    1 
ATOM   5544  N  NH1   . ARG C 2  250  ? 21.538  -38.329 35.444  1.00 129.69 ? 250  ARG C NH1   1 
ATOM   5545  N  NH2   . ARG C 2  250  ? 20.074  -40.092 35.619  1.00 133.63 ? 250  ARG C NH2   1 
ATOM   5546  N  N     . ASP C 2  251  ? 20.498  -33.375 33.948  1.00 138.38 ? 251  ASP C N     1 
ATOM   5547  C  CA    . ASP C 2  251  ? 21.331  -33.178 35.130  1.00 142.78 ? 251  ASP C CA    1 
ATOM   5548  C  C     . ASP C 2  251  ? 20.787  -32.065 36.023  1.00 140.15 ? 251  ASP C C     1 
ATOM   5549  O  O     . ASP C 2  251  ? 20.880  -32.157 37.253  1.00 137.44 ? 251  ASP C O     1 
ATOM   5550  C  CB    . ASP C 2  251  ? 22.781  -32.896 34.721  1.00 142.81 ? 251  ASP C CB    1 
ATOM   5551  C  CG    . ASP C 2  251  ? 22.893  -32.221 33.366  1.00 139.53 ? 251  ASP C CG    1 
ATOM   5552  O  OD1   . ASP C 2  251  ? 22.321  -32.745 32.385  1.00 138.42 ? 251  ASP C OD1   1 
ATOM   5553  O  OD2   . ASP C 2  251  ? 23.554  -31.164 33.285  1.00 134.91 ? 251  ASP C OD2   1 
ATOM   5554  N  N     . LYS C 2  252  ? 20.181  -31.030 35.431  1.00 136.95 ? 252  LYS C N     1 
ATOM   5555  C  CA    . LYS C 2  252  ? 19.591  -29.963 36.237  1.00 136.90 ? 252  LYS C CA    1 
ATOM   5556  C  C     . LYS C 2  252  ? 18.391  -30.462 37.040  1.00 134.88 ? 252  LYS C C     1 
ATOM   5557  O  O     . LYS C 2  252  ? 18.219  -30.085 38.206  1.00 131.22 ? 252  LYS C O     1 
ATOM   5558  C  CB    . LYS C 2  252  ? 19.196  -28.784 35.346  1.00 136.76 ? 252  LYS C CB    1 
ATOM   5559  C  CG    . LYS C 2  252  ? 20.144  -27.598 35.444  1.00 136.27 ? 252  LYS C CG    1 
ATOM   5560  C  CD    . LYS C 2  252  ? 19.417  -26.290 35.180  1.00 139.51 ? 252  LYS C CD    1 
ATOM   5561  C  CE    . LYS C 2  252  ? 20.223  -25.101 35.685  1.00 139.11 ? 252  LYS C CE    1 
ATOM   5562  N  NZ    . LYS C 2  252  ? 19.439  -23.833 35.663  1.00 135.03 ? 252  LYS C NZ    1 
ATOM   5563  N  N     . ALA C 2  253  ? 17.558  -31.322 36.442  1.00 135.53 ? 253  ALA C N     1 
ATOM   5564  C  CA    . ALA C 2  253  ? 16.412  -31.875 37.162  1.00 129.95 ? 253  ALA C CA    1 
ATOM   5565  C  C     . ALA C 2  253  ? 16.858  -32.806 38.281  1.00 130.24 ? 253  ALA C C     1 
ATOM   5566  O  O     . ALA C 2  253  ? 16.314  -32.754 39.396  1.00 127.81 ? 253  ALA C O     1 
ATOM   5567  C  CB    . ALA C 2  253  ? 15.487  -32.615 36.198  1.00 127.58 ? 253  ALA C CB    1 
ATOM   5568  N  N     . VAL C 2  254  ? 17.839  -33.672 38.001  1.00 131.88 ? 254  VAL C N     1 
ATOM   5569  C  CA    . VAL C 2  254  ? 18.396  -34.523 39.051  1.00 132.14 ? 254  VAL C CA    1 
ATOM   5570  C  C     . VAL C 2  254  ? 18.933  -33.667 40.193  1.00 128.10 ? 254  VAL C C     1 
ATOM   5571  O  O     . VAL C 2  254  ? 18.672  -33.940 41.370  1.00 124.18 ? 254  VAL C O     1 
ATOM   5572  C  CB    . VAL C 2  254  ? 19.483  -35.454 38.483  1.00 132.93 ? 254  VAL C CB    1 
ATOM   5573  C  CG1   . VAL C 2  254  ? 20.170  -36.231 39.607  1.00 128.44 ? 254  VAL C CG1   1 
ATOM   5574  C  CG2   . VAL C 2  254  ? 18.887  -36.410 37.465  1.00 134.76 ? 254  VAL C CG2   1 
ATOM   5575  N  N     . ALA C 2  255  ? 19.665  -32.598 39.859  1.00 128.21 ? 255  ALA C N     1 
ATOM   5576  C  CA    . ALA C 2  255  ? 20.240  -31.729 40.881  1.00 126.19 ? 255  ALA C CA    1 
ATOM   5577  C  C     . ALA C 2  255  ? 19.155  -31.088 41.742  1.00 125.06 ? 255  ALA C C     1 
ATOM   5578  O  O     . ALA C 2  255  ? 19.223  -31.124 42.978  1.00 117.36 ? 255  ALA C O     1 
ATOM   5579  C  CB    . ALA C 2  255  ? 21.112  -30.659 40.220  1.00 119.53 ? 255  ALA C CB    1 
ATOM   5580  N  N     . TYR C 2  256  ? 18.145  -30.488 41.104  1.00 126.22 ? 256  TYR C N     1 
ATOM   5581  C  CA    . TYR C 2  256  ? 17.090  -29.809 41.851  1.00 115.85 ? 256  TYR C CA    1 
ATOM   5582  C  C     . TYR C 2  256  ? 16.349  -30.778 42.762  1.00 116.35 ? 256  TYR C C     1 
ATOM   5583  O  O     . TYR C 2  256  ? 16.170  -30.511 43.958  1.00 112.69 ? 256  TYR C O     1 
ATOM   5584  C  CB    . TYR C 2  256  ? 16.118  -29.129 40.887  1.00 119.25 ? 256  TYR C CB    1 
ATOM   5585  C  CG    . TYR C 2  256  ? 14.952  -28.446 41.565  1.00 120.08 ? 256  TYR C CG    1 
ATOM   5586  C  CD1   . TYR C 2  256  ? 13.769  -29.133 41.818  1.00 122.91 ? 256  TYR C CD1   1 
ATOM   5587  C  CD2   . TYR C 2  256  ? 15.027  -27.112 41.943  1.00 121.69 ? 256  TYR C CD2   1 
ATOM   5588  C  CE1   . TYR C 2  256  ? 12.696  -28.512 42.437  1.00 124.57 ? 256  TYR C CE1   1 
ATOM   5589  C  CE2   . TYR C 2  256  ? 13.958  -26.480 42.561  1.00 128.56 ? 256  TYR C CE2   1 
ATOM   5590  C  CZ    . TYR C 2  256  ? 12.795  -27.186 42.807  1.00 128.21 ? 256  TYR C CZ    1 
ATOM   5591  O  OH    . TYR C 2  256  ? 11.730  -26.565 43.425  1.00 121.11 ? 256  TYR C OH    1 
ATOM   5592  N  N     . VAL C 2  257  ? 15.903  -31.911 42.214  1.00 117.23 ? 257  VAL C N     1 
ATOM   5593  C  CA    . VAL C 2  257  ? 15.118  -32.838 43.021  1.00 113.12 ? 257  VAL C CA    1 
ATOM   5594  C  C     . VAL C 2  257  ? 15.972  -33.444 44.132  1.00 112.35 ? 257  VAL C C     1 
ATOM   5595  O  O     . VAL C 2  257  ? 15.497  -33.630 45.258  1.00 109.12 ? 257  VAL C O     1 
ATOM   5596  C  CB    . VAL C 2  257  ? 14.472  -33.911 42.126  1.00 113.72 ? 257  VAL C CB    1 
ATOM   5597  C  CG1   . VAL C 2  257  ? 14.306  -35.218 42.879  1.00 114.26 ? 257  VAL C CG1   1 
ATOM   5598  C  CG2   . VAL C 2  257  ? 13.123  -33.418 41.641  1.00 107.12 ? 257  VAL C CG2   1 
ATOM   5599  N  N     . TYR C 2  258  ? 17.249  -33.731 43.854  1.00 111.95 ? 258  TYR C N     1 
ATOM   5600  C  CA    . TYR C 2  258  ? 18.134  -34.235 44.898  1.00 109.70 ? 258  TYR C CA    1 
ATOM   5601  C  C     . TYR C 2  258  ? 18.294  -33.219 46.020  1.00 111.74 ? 258  TYR C C     1 
ATOM   5602  O  O     . TYR C 2  258  ? 18.237  -33.576 47.204  1.00 105.50 ? 258  TYR C O     1 
ATOM   5603  C  CB    . TYR C 2  258  ? 19.492  -34.593 44.300  1.00 103.31 ? 258  TYR C CB    1 
ATOM   5604  C  CG    . TYR C 2  258  ? 20.528  -35.051 45.303  1.00 99.11  ? 258  TYR C CG    1 
ATOM   5605  C  CD1   . TYR C 2  258  ? 20.517  -36.349 45.804  1.00 99.62  ? 258  TYR C CD1   1 
ATOM   5606  C  CD2   . TYR C 2  258  ? 21.531  -34.190 45.737  1.00 99.44  ? 258  TYR C CD2   1 
ATOM   5607  C  CE1   . TYR C 2  258  ? 21.472  -36.775 46.717  1.00 94.68  ? 258  TYR C CE1   1 
ATOM   5608  C  CE2   . TYR C 2  258  ? 22.492  -34.607 46.647  1.00 95.48  ? 258  TYR C CE2   1 
ATOM   5609  C  CZ    . TYR C 2  258  ? 22.457  -35.898 47.133  1.00 93.19  ? 258  TYR C CZ    1 
ATOM   5610  O  OH    . TYR C 2  258  ? 23.413  -36.309 48.034  1.00 85.42  ? 258  TYR C OH    1 
ATOM   5611  N  N     . GLY C 2  259  ? 18.488  -31.946 45.666  1.00 113.36 ? 259  GLY C N     1 
ATOM   5612  C  CA    . GLY C 2  259  ? 18.588  -30.912 46.680  1.00 111.88 ? 259  GLY C CA    1 
ATOM   5613  C  C     . GLY C 2  259  ? 17.301  -30.712 47.456  1.00 111.63 ? 259  GLY C C     1 
ATOM   5614  O  O     . GLY C 2  259  ? 17.329  -30.276 48.611  1.00 108.83 ? 259  GLY C O     1 
ATOM   5615  N  N     . LEU C 2  260  ? 16.160  -31.040 46.847  1.00 109.05 ? 260  LEU C N     1 
ATOM   5616  C  CA    . LEU C 2  260  ? 14.886  -30.815 47.520  1.00 103.95 ? 260  LEU C CA    1 
ATOM   5617  C  C     . LEU C 2  260  ? 14.581  -31.887 48.561  1.00 103.55 ? 260  LEU C C     1 
ATOM   5618  O  O     . LEU C 2  260  ? 13.991  -31.585 49.605  1.00 105.01 ? 260  LEU C O     1 
ATOM   5619  C  CB    . LEU C 2  260  ? 13.757  -30.745 46.494  1.00 104.85 ? 260  LEU C CB    1 
ATOM   5620  C  CG    . LEU C 2  260  ? 12.443  -30.126 46.971  1.00 99.93  ? 260  LEU C CG    1 
ATOM   5621  C  CD1   . LEU C 2  260  ? 12.577  -28.613 47.084  1.00 102.93 ? 260  LEU C CD1   1 
ATOM   5622  C  CD2   . LEU C 2  260  ? 11.293  -30.504 46.052  1.00 97.99  ? 260  LEU C CD2   1 
ATOM   5623  N  N     . ILE C 2  261  ? 14.958  -33.142 48.309  1.00 100.07 ? 261  ILE C N     1 
ATOM   5624  C  CA    . ILE C 2  261  ? 14.513  -34.268 49.122  1.00 94.99  ? 261  ILE C CA    1 
ATOM   5625  C  C     . ILE C 2  261  ? 15.685  -35.064 49.690  1.00 99.90  ? 261  ILE C C     1 
ATOM   5626  O  O     . ILE C 2  261  ? 15.720  -35.361 50.887  1.00 106.42 ? 261  ILE C O     1 
ATOM   5627  C  CB    . ILE C 2  261  ? 13.557  -35.191 48.332  1.00 96.44  ? 261  ILE C CB    1 
ATOM   5628  C  CG1   . ILE C 2  261  ? 12.099  -34.831 48.620  1.00 97.12  ? 261  ILE C CG1   1 
ATOM   5629  C  CG2   . ILE C 2  261  ? 13.776  -36.649 48.703  1.00 102.22 ? 261  ILE C CG2   1 
ATOM   5630  C  CD1   . ILE C 2  261  ? 11.676  -33.483 48.120  1.00 97.00  ? 261  ILE C CD1   1 
ATOM   5631  N  N     . ALA C 2  262  ? 16.647  -35.433 48.844  1.00 102.89 ? 262  ALA C N     1 
ATOM   5632  C  CA    . ALA C 2  262  ? 17.635  -36.435 49.218  1.00 101.69 ? 262  ALA C CA    1 
ATOM   5633  C  C     . ALA C 2  262  ? 18.950  -35.855 49.721  1.00 97.56  ? 262  ALA C C     1 
ATOM   5634  O  O     . ALA C 2  262  ? 19.738  -36.594 50.319  1.00 93.24  ? 262  ALA C O     1 
ATOM   5635  C  CB    . ALA C 2  262  ? 17.917  -37.360 48.029  1.00 102.29 ? 262  ALA C CB    1 
ATOM   5636  N  N     . ASP C 2  263  ? 19.200  -34.564 49.511  1.00 96.74  ? 263  ASP C N     1 
ATOM   5637  C  CA    . ASP C 2  263  ? 20.492  -33.963 49.825  1.00 97.86  ? 263  ASP C CA    1 
ATOM   5638  C  C     . ASP C 2  263  ? 20.607  -33.669 51.316  1.00 99.73  ? 263  ASP C C     1 
ATOM   5639  O  O     . ASP C 2  263  ? 19.972  -32.728 51.809  1.00 100.63 ? 263  ASP C O     1 
ATOM   5640  C  CB    . ASP C 2  263  ? 20.687  -32.678 49.014  1.00 101.33 ? 263  ASP C CB    1 
ATOM   5641  C  CG    . ASP C 2  263  ? 22.112  -32.151 49.070  1.00 105.64 ? 263  ASP C CG    1 
ATOM   5642  O  OD1   . ASP C 2  263  ? 22.958  -32.761 49.762  1.00 106.30 ? 263  ASP C OD1   1 
ATOM   5643  O  OD2   . ASP C 2  263  ? 22.387  -31.123 48.412  1.00 105.46 ? 263  ASP C OD2   1 
ATOM   5644  N  N     . PRO C 2  264  ? 21.421  -34.428 52.059  1.00 101.94 ? 264  PRO C N     1 
ATOM   5645  C  CA    . PRO C 2  264  ? 21.543  -34.176 53.504  1.00 97.38  ? 264  PRO C CA    1 
ATOM   5646  C  C     . PRO C 2  264  ? 22.225  -32.861 53.830  1.00 99.14  ? 264  PRO C C     1 
ATOM   5647  O  O     . PRO C 2  264  ? 22.130  -32.395 54.972  1.00 105.75 ? 264  PRO C O     1 
ATOM   5648  C  CB    . PRO C 2  264  ? 22.367  -35.371 53.999  1.00 90.53  ? 264  PRO C CB    1 
ATOM   5649  C  CG    . PRO C 2  264  ? 23.195  -35.744 52.820  1.00 101.81 ? 264  PRO C CG    1 
ATOM   5650  C  CD    . PRO C 2  264  ? 22.337  -35.489 51.606  1.00 98.97  ? 264  PRO C CD    1 
ATOM   5651  N  N     . ARG C 2  265  ? 22.909  -32.252 52.865  1.00 102.56 ? 265  ARG C N     1 
ATOM   5652  C  CA    . ARG C 2  265  ? 23.488  -30.932 53.052  1.00 105.71 ? 265  ARG C CA    1 
ATOM   5653  C  C     . ARG C 2  265  ? 22.457  -29.823 52.917  1.00 102.52 ? 265  ARG C C     1 
ATOM   5654  O  O     . ARG C 2  265  ? 22.764  -28.674 53.251  1.00 103.99 ? 265  ARG C O     1 
ATOM   5655  C  CB    . ARG C 2  265  ? 24.634  -30.725 52.050  1.00 107.53 ? 265  ARG C CB    1 
ATOM   5656  C  CG    . ARG C 2  265  ? 25.798  -31.691 52.260  1.00 107.66 ? 265  ARG C CG    1 
ATOM   5657  C  CD    . ARG C 2  265  ? 26.432  -32.160 50.953  1.00 114.08 ? 265  ARG C CD    1 
ATOM   5658  N  NE    . ARG C 2  265  ? 27.596  -31.362 50.573  1.00 120.00 ? 265  ARG C NE    1 
ATOM   5659  C  CZ    . ARG C 2  265  ? 28.821  -31.534 51.068  1.00 113.09 ? 265  ARG C CZ    1 
ATOM   5660  N  NH1   . ARG C 2  265  ? 29.052  -32.476 51.978  1.00 104.65 ? 265  ARG C NH1   1 
ATOM   5661  N  NH2   . ARG C 2  265  ? 29.816  -30.758 50.657  1.00 100.04 ? 265  ARG C NH2   1 
ATOM   5662  N  N     . ARG C 2  266  ? 21.253  -30.134 52.434  1.00 100.59 ? 266  ARG C N     1 
ATOM   5663  C  CA    . ARG C 2  266  ? 20.187  -29.146 52.305  1.00 102.61 ? 266  ARG C CA    1 
ATOM   5664  C  C     . ARG C 2  266  ? 18.918  -29.516 53.058  1.00 98.90  ? 266  ARG C C     1 
ATOM   5665  O  O     . ARG C 2  266  ? 18.343  -28.658 53.738  1.00 96.47  ? 266  ARG C O     1 
ATOM   5666  C  CB    . ARG C 2  266  ? 19.863  -28.918 50.824  1.00 104.78 ? 266  ARG C CB    1 
ATOM   5667  C  CG    . ARG C 2  266  ? 20.749  -27.906 50.140  1.00 103.93 ? 266  ARG C CG    1 
ATOM   5668  C  CD    . ARG C 2  266  ? 20.194  -27.588 48.764  1.00 114.06 ? 266  ARG C CD    1 
ATOM   5669  N  NE    . ARG C 2  266  ? 18.795  -27.175 48.841  1.00 111.44 ? 266  ARG C NE    1 
ATOM   5670  C  CZ    . ARG C 2  266  ? 17.945  -27.214 47.819  1.00 113.83 ? 266  ARG C CZ    1 
ATOM   5671  N  NH1   . ARG C 2  266  ? 16.690  -26.818 47.978  1.00 116.38 ? 266  ARG C NH1   1 
ATOM   5672  N  NH2   . ARG C 2  266  ? 18.348  -27.650 46.634  1.00 118.48 ? 266  ARG C NH2   1 
ATOM   5673  N  N     . TYR C 2  267  ? 18.438  -30.754 52.928  1.00 97.90  ? 267  TYR C N     1 
ATOM   5674  C  CA    . TYR C 2  267  ? 17.260  -31.220 53.653  1.00 94.20  ? 267  TYR C CA    1 
ATOM   5675  C  C     . TYR C 2  267  ? 17.682  -32.017 54.879  1.00 93.58  ? 267  TYR C C     1 
ATOM   5676  O  O     . TYR C 2  267  ? 18.463  -32.968 54.769  1.00 93.87  ? 267  TYR C O     1 
ATOM   5677  C  CB    . TYR C 2  267  ? 16.353  -32.075 52.769  1.00 92.94  ? 267  TYR C CB    1 
ATOM   5678  C  CG    . TYR C 2  267  ? 14.985  -32.320 53.378  1.00 91.82  ? 267  TYR C CG    1 
ATOM   5679  C  CD1   . TYR C 2  267  ? 14.783  -33.328 54.314  1.00 92.26  ? 267  TYR C CD1   1 
ATOM   5680  C  CD2   . TYR C 2  267  ? 13.899  -31.533 53.023  1.00 92.66  ? 267  TYR C CD2   1 
ATOM   5681  C  CE1   . TYR C 2  267  ? 13.533  -33.546 54.877  1.00 90.93  ? 267  TYR C CE1   1 
ATOM   5682  C  CE2   . TYR C 2  267  ? 12.647  -31.744 53.577  1.00 93.78  ? 267  TYR C CE2   1 
ATOM   5683  C  CZ    . TYR C 2  267  ? 12.466  -32.753 54.504  1.00 92.09  ? 267  TYR C CZ    1 
ATOM   5684  O  OH    . TYR C 2  267  ? 11.214  -32.959 55.053  1.00 86.24  ? 267  TYR C OH    1 
ATOM   5685  N  N     . ASP C 2  268  ? 17.151  -31.642 56.039  1.00 86.93  ? 268  ASP C N     1 
ATOM   5686  C  CA    . ASP C 2  268  ? 17.519  -32.294 57.291  1.00 89.01  ? 268  ASP C CA    1 
ATOM   5687  C  C     . ASP C 2  268  ? 16.318  -32.295 58.225  1.00 91.76  ? 268  ASP C C     1 
ATOM   5688  O  O     . ASP C 2  268  ? 15.910  -31.237 58.715  1.00 92.93  ? 268  ASP C O     1 
ATOM   5689  C  CB    . ASP C 2  268  ? 18.711  -31.591 57.944  1.00 89.68  ? 268  ASP C CB    1 
ATOM   5690  C  CG    . ASP C 2  268  ? 19.337  -32.412 59.057  1.00 90.05  ? 268  ASP C CG    1 
ATOM   5691  O  OD1   . ASP C 2  268  ? 19.134  -33.647 59.084  1.00 91.06  ? 268  ASP C OD1   1 
ATOM   5692  O  OD2   . ASP C 2  268  ? 20.040  -31.825 59.906  1.00 83.50  ? 268  ASP C OD2   1 
ATOM   5693  N  N     . LEU C 2  269  ? 15.744  -33.473 58.461  1.00 87.37  ? 269  LEU C N     1 
ATOM   5694  C  CA    . LEU C 2  269  ? 14.962  -33.656 59.669  1.00 82.23  ? 269  LEU C CA    1 
ATOM   5695  C  C     . LEU C 2  269  ? 15.907  -33.596 60.861  1.00 87.57  ? 269  LEU C C     1 
ATOM   5696  O  O     . LEU C 2  269  ? 17.118  -33.766 60.728  1.00 99.50  ? 269  LEU C O     1 
ATOM   5697  C  CB    . LEU C 2  269  ? 14.228  -34.999 59.661  1.00 79.45  ? 269  LEU C CB    1 
ATOM   5698  C  CG    . LEU C 2  269  ? 13.277  -35.321 58.510  1.00 78.53  ? 269  LEU C CG    1 
ATOM   5699  C  CD1   . LEU C 2  269  ? 12.814  -36.759 58.594  1.00 77.12  ? 269  LEU C CD1   1 
ATOM   5700  C  CD2   . LEU C 2  269  ? 12.089  -34.385 58.515  1.00 80.49  ? 269  LEU C CD2   1 
ATOM   5701  N  N     . GLY C 2  270  ? 15.361  -33.350 62.031  1.00 91.80  ? 270  GLY C N     1 
ATOM   5702  C  CA    . GLY C 2  270  ? 16.178  -33.466 63.215  1.00 99.40  ? 270  GLY C CA    1 
ATOM   5703  C  C     . GLY C 2  270  ? 16.591  -34.906 63.428  1.00 93.26  ? 270  GLY C C     1 
ATOM   5704  O  O     . GLY C 2  270  ? 16.139  -35.825 62.742  1.00 88.78  ? 270  GLY C O     1 
ATOM   5705  N  N     . GLU C 2  271  ? 17.494  -35.112 64.384  1.00 87.59  ? 271  GLU C N     1 
ATOM   5706  C  CA    . GLU C 2  271  ? 17.597  -36.448 64.946  1.00 87.46  ? 271  GLU C CA    1 
ATOM   5707  C  C     . GLU C 2  271  ? 16.276  -36.815 65.598  1.00 94.12  ? 271  GLU C C     1 
ATOM   5708  O  O     . GLU C 2  271  ? 15.777  -37.941 65.448  1.00 97.06  ? 271  GLU C O     1 
ATOM   5709  C  CB    . GLU C 2  271  ? 18.751  -36.519 65.944  1.00 91.70  ? 271  GLU C CB    1 
ATOM   5710  C  CG    . GLU C 2  271  ? 19.174  -37.935 66.281  1.00 96.28  ? 271  GLU C CG    1 
ATOM   5711  C  CD    . GLU C 2  271  ? 19.471  -38.762 65.038  1.00 112.82 ? 271  GLU C CD    1 
ATOM   5712  O  OE1   . GLU C 2  271  ? 20.114  -38.239 64.097  1.00 114.66 ? 271  GLU C OE1   1 
ATOM   5713  O  OE2   . GLU C 2  271  ? 19.052  -39.940 65.000  1.00 117.07 ? 271  GLU C OE2   1 
ATOM   5714  N  N     . ALA C 2  272  ? 15.665  -35.835 66.269  1.00 95.09  ? 272  ALA C N     1 
ATOM   5715  C  CA    . ALA C 2  272  ? 14.327  -35.997 66.818  1.00 90.64  ? 272  ALA C CA    1 
ATOM   5716  C  C     . ALA C 2  272  ? 13.287  -36.096 65.712  1.00 92.27  ? 272  ALA C C     1 
ATOM   5717  O  O     . ALA C 2  272  ? 12.304  -36.833 65.846  1.00 95.22  ? 272  ALA C O     1 
ATOM   5718  C  CB    . ALA C 2  272  ? 14.005  -34.834 67.756  1.00 81.34  ? 272  ALA C CB    1 
ATOM   5719  N  N     . GLY C 2  273  ? 13.475  -35.357 64.616  1.00 84.98  ? 273  GLY C N     1 
ATOM   5720  C  CA    . GLY C 2  273  ? 12.567  -35.501 63.489  1.00 86.32  ? 273  GLY C CA    1 
ATOM   5721  C  C     . GLY C 2  273  ? 12.560  -36.914 62.940  1.00 90.97  ? 273  GLY C C     1 
ATOM   5722  O  O     . GLY C 2  273  ? 11.498  -37.484 62.666  1.00 90.52  ? 273  GLY C O     1 
ATOM   5723  N  N     . ARG C 2  274  ? 13.746  -37.509 62.807  1.00 97.52  ? 274  ARG C N     1 
ATOM   5724  C  CA    . ARG C 2  274  ? 13.849  -38.891 62.356  1.00 95.90  ? 274  ARG C CA    1 
ATOM   5725  C  C     . ARG C 2  274  ? 13.217  -39.843 63.360  1.00 96.85  ? 274  ARG C C     1 
ATOM   5726  O  O     . ARG C 2  274  ? 12.459  -40.744 62.980  1.00 94.13  ? 274  ARG C O     1 
ATOM   5727  C  CB    . ARG C 2  274  ? 15.313  -39.256 62.119  1.00 99.39  ? 274  ARG C CB    1 
ATOM   5728  C  CG    . ARG C 2  274  ? 15.517  -40.664 61.579  1.00 108.25 ? 274  ARG C CG    1 
ATOM   5729  C  CD    . ARG C 2  274  ? 16.192  -41.585 62.589  1.00 109.78 ? 274  ARG C CD    1 
ATOM   5730  N  NE    . ARG C 2  274  ? 17.594  -41.235 62.799  1.00 110.49 ? 274  ARG C NE    1 
ATOM   5731  C  CZ    . ARG C 2  274  ? 18.591  -41.640 62.020  1.00 112.96 ? 274  ARG C CZ    1 
ATOM   5732  N  NH1   . ARG C 2  274  ? 19.836  -41.269 62.288  1.00 118.83 ? 274  ARG C NH1   1 
ATOM   5733  N  NH2   . ARG C 2  274  ? 18.346  -42.412 60.970  1.00 110.81 ? 274  ARG C NH2   1 
ATOM   5734  N  N     . TYR C 2  275  ? 13.529  -39.669 64.648  1.00 94.40  ? 275  TYR C N     1 
ATOM   5735  C  CA    . TYR C 2  275  ? 12.954  -40.551 65.660  1.00 99.99  ? 275  TYR C CA    1 
ATOM   5736  C  C     . TYR C 2  275  ? 11.429  -40.515 65.619  1.00 100.79 ? 275  TYR C C     1 
ATOM   5737  O  O     . TYR C 2  275  ? 10.769  -41.560 65.670  1.00 101.94 ? 275  TYR C O     1 
ATOM   5738  C  CB    . TYR C 2  275  ? 13.457  -40.176 67.055  1.00 101.01 ? 275  TYR C CB    1 
ATOM   5739  C  CG    . TYR C 2  275  ? 12.582  -40.740 68.162  1.00 115.74 ? 275  TYR C CG    1 
ATOM   5740  C  CD1   . TYR C 2  275  ? 12.655  -42.086 68.517  1.00 117.42 ? 275  TYR C CD1   1 
ATOM   5741  C  CD2   . TYR C 2  275  ? 11.670  -39.931 68.842  1.00 109.72 ? 275  TYR C CD2   1 
ATOM   5742  C  CE1   . TYR C 2  275  ? 11.848  -42.611 69.522  1.00 111.85 ? 275  TYR C CE1   1 
ATOM   5743  C  CE2   . TYR C 2  275  ? 10.861  -40.448 69.848  1.00 109.25 ? 275  TYR C CE2   1 
ATOM   5744  C  CZ    . TYR C 2  275  ? 10.955  -41.788 70.182  1.00 112.26 ? 275  TYR C CZ    1 
ATOM   5745  O  OH    . TYR C 2  275  ? 10.156  -42.304 71.180  1.00 115.84 ? 275  TYR C OH    1 
ATOM   5746  N  N     . LYS C 2  276  ? 10.852  -39.315 65.520  1.00 97.72  ? 276  LYS C N     1 
ATOM   5747  C  CA    . LYS C 2  276  ? 9.400   -39.194 65.548  1.00 95.25  ? 276  LYS C CA    1 
ATOM   5748  C  C     . LYS C 2  276  ? 8.769   -39.741 64.277  1.00 94.32  ? 276  LYS C C     1 
ATOM   5749  O  O     . LYS C 2  276  ? 7.720   -40.393 64.335  1.00 92.95  ? 276  LYS C O     1 
ATOM   5750  C  CB    . LYS C 2  276  ? 8.994   -37.740 65.770  1.00 93.75  ? 276  LYS C CB    1 
ATOM   5751  C  CG    . LYS C 2  276  ? 8.812   -37.375 67.234  1.00 91.54  ? 276  LYS C CG    1 
ATOM   5752  C  CD    . LYS C 2  276  ? 8.162   -36.011 67.357  1.00 87.77  ? 276  LYS C CD    1 
ATOM   5753  C  CE    . LYS C 2  276  ? 6.873   -35.946 66.546  1.00 84.57  ? 276  LYS C CE    1 
ATOM   5754  N  NZ    . LYS C 2  276  ? 5.780   -36.769 67.145  1.00 87.55  ? 276  LYS C NZ    1 
ATOM   5755  N  N     . ALA C 2  277  ? 9.384   -39.491 63.117  1.00 96.85  ? 277  ALA C N     1 
ATOM   5756  C  CA    . ALA C 2  277  ? 8.880   -40.099 61.890  1.00 94.22  ? 277  ALA C CA    1 
ATOM   5757  C  C     . ALA C 2  277  ? 8.891   -41.620 61.993  1.00 96.84  ? 277  ALA C C     1 
ATOM   5758  O  O     . ALA C 2  277  ? 7.920   -42.287 61.609  1.00 91.77  ? 277  ALA C O     1 
ATOM   5759  C  CB    . ALA C 2  277  ? 9.705   -39.629 60.695  1.00 87.31  ? 277  ALA C CB    1 
ATOM   5760  N  N     . GLU C 2  278  ? 9.972   -42.182 62.540  1.00 98.38  ? 278  GLU C N     1 
ATOM   5761  C  CA    . GLU C 2  278  ? 10.072  -43.630 62.680  1.00 98.09  ? 278  GLU C CA    1 
ATOM   5762  C  C     . GLU C 2  278  ? 8.993   -44.168 63.608  1.00 100.53 ? 278  GLU C C     1 
ATOM   5763  O  O     . GLU C 2  278  ? 8.296   -45.134 63.276  1.00 102.12 ? 278  GLU C O     1 
ATOM   5764  C  CB    . GLU C 2  278  ? 11.465  -44.011 63.187  1.00 101.10 ? 278  GLU C CB    1 
ATOM   5765  C  CG    . GLU C 2  278  ? 12.544  -43.913 62.116  1.00 105.68 ? 278  GLU C CG    1 
ATOM   5766  C  CD    . GLU C 2  278  ? 13.924  -44.297 62.618  1.00 110.20 ? 278  GLU C CD    1 
ATOM   5767  O  OE1   . GLU C 2  278  ? 14.078  -44.539 63.836  1.00 106.71 ? 278  GLU C OE1   1 
ATOM   5768  O  OE2   . GLU C 2  278  ? 14.857  -44.355 61.786  1.00 111.91 ? 278  GLU C OE2   1 
ATOM   5769  N  N     . GLU C 2  279  ? 8.835   -43.546 64.779  1.00 105.34 ? 279  GLU C N     1 
ATOM   5770  C  CA    . GLU C 2  279  ? 7.870   -44.043 65.755  1.00 100.26 ? 279  GLU C CA    1 
ATOM   5771  C  C     . GLU C 2  279  ? 6.440   -43.909 65.241  1.00 95.57  ? 279  GLU C C     1 
ATOM   5772  O  O     . GLU C 2  279  ? 5.604   -44.787 65.485  1.00 100.25 ? 279  GLU C O     1 
ATOM   5773  C  CB    . GLU C 2  279  ? 8.048   -43.306 67.084  1.00 99.90  ? 279  GLU C CB    1 
ATOM   5774  C  CG    . GLU C 2  279  ? 7.588   -44.089 68.312  1.00 117.36 ? 279  GLU C CG    1 
ATOM   5775  C  CD    . GLU C 2  279  ? 8.530   -45.232 68.686  1.00 126.14 ? 279  GLU C CD    1 
ATOM   5776  O  OE1   . GLU C 2  279  ? 8.157   -46.047 69.561  1.00 123.67 ? 279  GLU C OE1   1 
ATOM   5777  O  OE2   . GLU C 2  279  ? 9.641   -45.315 68.112  1.00 110.88 ? 279  GLU C OE2   1 
ATOM   5778  N  N     . LYS C 2  280  ? 6.141   -42.830 64.511  1.00 92.18  ? 280  LYS C N     1 
ATOM   5779  C  CA    . LYS C 2  280  ? 4.785   -42.618 64.016  1.00 85.79  ? 280  LYS C CA    1 
ATOM   5780  C  C     . LYS C 2  280  ? 4.451   -43.577 62.884  1.00 94.71  ? 280  LYS C C     1 
ATOM   5781  O  O     . LYS C 2  280  ? 3.445   -44.293 62.942  1.00 89.95  ? 280  LYS C O     1 
ATOM   5782  C  CB    . LYS C 2  280  ? 4.616   -41.173 63.546  1.00 89.44  ? 280  LYS C CB    1 
ATOM   5783  C  CG    . LYS C 2  280  ? 3.234   -40.845 62.979  1.00 88.00  ? 280  LYS C CG    1 
ATOM   5784  C  CD    . LYS C 2  280  ? 2.171   -40.816 64.075  1.00 87.72  ? 280  LYS C CD    1 
ATOM   5785  C  CE    . LYS C 2  280  ? 0.851   -40.241 63.571  1.00 88.91  ? 280  LYS C CE    1 
ATOM   5786  N  NZ    . LYS C 2  280  ? -0.172  -40.084 64.654  1.00 87.84  ? 280  LYS C NZ    1 
ATOM   5787  N  N     . LEU C 2  281  ? 5.284   -43.600 61.840  1.00 102.42 ? 281  LEU C N     1 
ATOM   5788  C  CA    . LEU C 2  281  ? 4.992   -44.365 60.634  1.00 94.77  ? 281  LEU C CA    1 
ATOM   5789  C  C     . LEU C 2  281  ? 5.407   -45.829 60.728  1.00 98.50  ? 281  LEU C C     1 
ATOM   5790  O  O     . LEU C 2  281  ? 5.183   -46.578 59.768  1.00 94.88  ? 281  LEU C O     1 
ATOM   5791  C  CB    . LEU C 2  281  ? 5.673   -43.711 59.433  1.00 97.45  ? 281  LEU C CB    1 
ATOM   5792  C  CG    . LEU C 2  281  ? 5.293   -42.247 59.220  1.00 95.60  ? 281  LEU C CG    1 
ATOM   5793  C  CD1   . LEU C 2  281  ? 5.958   -41.707 57.964  1.00 93.53  ? 281  LEU C CD1   1 
ATOM   5794  C  CD2   . LEU C 2  281  ? 3.781   -42.102 59.149  1.00 94.53  ? 281  LEU C CD2   1 
ATOM   5795  N  N     . GLY C 2  282  ? 5.998   -46.249 61.846  1.00 100.55 ? 282  GLY C N     1 
ATOM   5796  C  CA    . GLY C 2  282  ? 6.376   -47.641 62.026  1.00 101.03 ? 282  GLY C CA    1 
ATOM   5797  C  C     . GLY C 2  282  ? 7.460   -48.114 61.086  1.00 100.58 ? 282  GLY C C     1 
ATOM   5798  O  O     . GLY C 2  282  ? 7.442   -49.274 60.660  1.00 103.71 ? 282  GLY C O     1 
ATOM   5799  N  N     . ILE C 2  283  ? 8.408   -47.243 60.748  1.00 97.42  ? 283  ILE C N     1 
ATOM   5800  C  CA    . ILE C 2  283  ? 9.464   -47.541 59.797  1.00 100.16 ? 283  ILE C CA    1 
ATOM   5801  C  C     . ILE C 2  283  ? 10.808  -47.193 60.433  1.00 103.35 ? 283  ILE C C     1 
ATOM   5802  O  O     . ILE C 2  283  ? 10.880  -46.754 61.580  1.00 105.49 ? 283  ILE C O     1 
ATOM   5803  C  CB    . ILE C 2  283  ? 9.270   -46.790 58.465  1.00 101.21 ? 283  ILE C CB    1 
ATOM   5804  C  CG1   . ILE C 2  283  ? 9.539   -45.294 58.649  1.00 97.76  ? 283  ILE C CG1   1 
ATOM   5805  C  CG2   . ILE C 2  283  ? 7.858   -47.020 57.934  1.00 97.70  ? 283  ILE C CG2   1 
ATOM   5806  C  CD1   . ILE C 2  283  ? 9.341   -44.475 57.390  1.00 90.45  ? 283  ILE C CD1   1 
ATOM   5807  N  N     . ARG C 2  284  ? 11.881  -47.404 59.674  1.00 99.96  ? 284  ARG C N     1 
ATOM   5808  C  CA    . ARG C 2  284  ? 13.228  -47.090 60.130  1.00 106.14 ? 284  ARG C CA    1 
ATOM   5809  C  C     . ARG C 2  284  ? 13.946  -46.324 59.031  1.00 106.02 ? 284  ARG C C     1 
ATOM   5810  O  O     . ARG C 2  284  ? 13.875  -46.703 57.858  1.00 104.93 ? 284  ARG C O     1 
ATOM   5811  C  CB    . ARG C 2  284  ? 14.000  -48.362 60.506  1.00 103.27 ? 284  ARG C CB    1 
ATOM   5812  C  CG    . ARG C 2  284  ? 14.852  -48.224 61.767  1.00 108.82 ? 284  ARG C CG    1 
ATOM   5813  C  CD    . ARG C 2  284  ? 16.155  -47.462 61.513  1.00 108.93 ? 284  ARG C CD    1 
ATOM   5814  N  NE    . ARG C 2  284  ? 16.408  -46.435 62.525  1.00 118.49 ? 284  ARG C NE    1 
ATOM   5815  C  CZ    . ARG C 2  284  ? 16.935  -46.666 63.726  1.00 117.69 ? 284  ARG C CZ    1 
ATOM   5816  N  NH1   . ARG C 2  284  ? 17.125  -45.663 64.575  1.00 108.07 ? 284  ARG C NH1   1 
ATOM   5817  N  NH2   . ARG C 2  284  ? 17.268  -47.900 64.082  1.00 119.94 ? 284  ARG C NH2   1 
ATOM   5818  N  N     . LEU C 2  285  ? 14.632  -45.250 59.411  1.00 106.81 ? 285  LEU C N     1 
ATOM   5819  C  CA    . LEU C 2  285  ? 15.295  -44.361 58.466  1.00 111.04 ? 285  LEU C CA    1 
ATOM   5820  C  C     . LEU C 2  285  ? 16.798  -44.607 58.486  1.00 112.05 ? 285  LEU C C     1 
ATOM   5821  O  O     . LEU C 2  285  ? 17.407  -44.675 59.560  1.00 112.28 ? 285  LEU C O     1 
ATOM   5822  C  CB    . LEU C 2  285  ? 14.999  -42.898 58.801  1.00 110.35 ? 285  LEU C CB    1 
ATOM   5823  C  CG    . LEU C 2  285  ? 13.804  -42.193 58.148  1.00 104.88 ? 285  LEU C CG    1 
ATOM   5824  C  CD1   . LEU C 2  285  ? 14.148  -41.732 56.740  1.00 110.18 ? 285  LEU C CD1   1 
ATOM   5825  C  CD2   . LEU C 2  285  ? 12.573  -43.085 58.137  1.00 101.65 ? 285  LEU C CD2   1 
ATOM   5826  N  N     . SER C 2  286  ? 17.392  -44.739 57.296  1.00 110.84 ? 286  SER C N     1 
ATOM   5827  C  CA    . SER C 2  286  ? 18.844  -44.868 57.208  1.00 111.37 ? 286  SER C CA    1 
ATOM   5828  C  C     . SER C 2  286  ? 19.520  -43.530 57.472  1.00 111.44 ? 286  SER C C     1 
ATOM   5829  O  O     . SER C 2  286  ? 20.426  -43.430 58.308  1.00 112.15 ? 286  SER C O     1 
ATOM   5830  C  CB    . SER C 2  286  ? 19.247  -45.418 55.838  1.00 112.55 ? 286  SER C CB    1 
ATOM   5831  O  OG    . SER C 2  286  ? 18.940  -44.502 54.799  1.00 115.46 ? 286  SER C OG    1 
ATOM   5832  N  N     . GLY C 2  287  ? 19.087  -42.487 56.760  1.00 114.08 ? 287  GLY C N     1 
ATOM   5833  C  CA    . GLY C 2  287  ? 19.526  -41.138 56.995  1.00 110.08 ? 287  GLY C CA    1 
ATOM   5834  C  C     . GLY C 2  287  ? 18.429  -40.262 57.565  1.00 109.09 ? 287  GLY C C     1 
ATOM   5835  O  O     . GLY C 2  287  ? 17.454  -40.736 58.166  1.00 103.22 ? 287  GLY C O     1 
ATOM   5836  N  N     . ARG C 2  288  ? 18.595  -38.957 57.380  1.00 101.42 ? 288  ARG C N     1 
ATOM   5837  C  CA    . ARG C 2  288  ? 17.616  -37.984 57.832  1.00 90.94  ? 288  ARG C CA    1 
ATOM   5838  C  C     . ARG C 2  288  ? 16.920  -37.270 56.682  1.00 94.94  ? 288  ARG C C     1 
ATOM   5839  O  O     . ARG C 2  288  ? 16.317  -36.215 56.897  1.00 97.12  ? 288  ARG C O     1 
ATOM   5840  C  CB    . ARG C 2  288  ? 18.280  -36.972 58.762  1.00 85.18  ? 288  ARG C CB    1 
ATOM   5841  C  CG    . ARG C 2  288  ? 18.663  -37.558 60.098  1.00 92.74  ? 288  ARG C CG    1 
ATOM   5842  C  CD    . ARG C 2  288  ? 19.063  -36.456 61.036  1.00 88.29  ? 288  ARG C CD    1 
ATOM   5843  N  NE    . ARG C 2  288  ? 20.321  -35.849 60.634  1.00 90.65  ? 288  ARG C NE    1 
ATOM   5844  C  CZ    . ARG C 2  288  ? 21.423  -35.886 61.374  1.00 106.00 ? 288  ARG C CZ    1 
ATOM   5845  N  NH1   . ARG C 2  288  ? 21.400  -36.487 62.561  1.00 89.90  ? 288  ARG C NH1   1 
ATOM   5846  N  NH2   . ARG C 2  288  ? 22.539  -35.314 60.934  1.00 109.48 ? 288  ARG C NH2   1 
ATOM   5847  N  N     . THR C 2  289  ? 17.002  -37.803 55.470  1.00 97.97  ? 289  THR C N     1 
ATOM   5848  C  CA    . THR C 2  289  ? 16.286  -37.245 54.337  1.00 100.58 ? 289  THR C CA    1 
ATOM   5849  C  C     . THR C 2  289  ? 15.016  -38.054 54.087  1.00 97.95  ? 289  THR C C     1 
ATOM   5850  O  O     . THR C 2  289  ? 14.750  -39.061 54.746  1.00 103.47 ? 289  THR C O     1 
ATOM   5851  C  CB    . THR C 2  289  ? 17.182  -37.205 53.095  1.00 107.27 ? 289  THR C CB    1 
ATOM   5852  O  OG1   . THR C 2  289  ? 17.880  -38.451 52.951  1.00 105.40 ? 289  THR C OG1   1 
ATOM   5853  C  CG2   . THR C 2  289  ? 18.189  -36.063 53.189  1.00 102.57 ? 289  THR C CG2   1 
ATOM   5854  N  N     . LEU C 2  290  ? 14.216  -37.600 53.122  1.00 93.31  ? 290  LEU C N     1 
ATOM   5855  C  CA    . LEU C 2  290  ? 12.989  -38.297 52.753  1.00 100.06 ? 290  LEU C CA    1 
ATOM   5856  C  C     . LEU C 2  290  ? 13.219  -39.401 51.731  1.00 106.64 ? 290  LEU C C     1 
ATOM   5857  O  O     . LEU C 2  290  ? 12.356  -40.275 51.576  1.00 106.24 ? 290  LEU C O     1 
ATOM   5858  C  CB    . LEU C 2  290  ? 11.961  -37.310 52.192  1.00 101.81 ? 290  LEU C CB    1 
ATOM   5859  C  CG    . LEU C 2  290  ? 11.683  -36.029 52.981  1.00 95.26  ? 290  LEU C CG    1 
ATOM   5860  C  CD1   . LEU C 2  290  ? 10.676  -35.168 52.232  1.00 87.30  ? 290  LEU C CD1   1 
ATOM   5861  C  CD2   . LEU C 2  290  ? 11.197  -36.345 54.393  1.00 89.38  ? 290  LEU C CD2   1 
ATOM   5862  N  N     . ALA C 2  291  ? 14.349  -39.373 51.030  1.00 111.54 ? 291  ALA C N     1 
ATOM   5863  C  CA    . ALA C 2  291  ? 14.708  -40.394 50.055  1.00 110.32 ? 291  ALA C CA    1 
ATOM   5864  C  C     . ALA C 2  291  ? 16.217  -40.339 49.852  1.00 110.48 ? 291  ALA C C     1 
ATOM   5865  O  O     . ALA C 2  291  ? 16.916  -39.522 50.458  1.00 107.95 ? 291  ALA C O     1 
ATOM   5866  C  CB    . ALA C 2  291  ? 13.950  -40.199 48.739  1.00 108.66 ? 291  ALA C CB    1 
ATOM   5867  N  N     . ARG C 2  292  ? 16.717  -41.216 48.984  1.00 118.82 ? 292  ARG C N     1 
ATOM   5868  C  CA    . ARG C 2  292  ? 18.145  -41.333 48.729  1.00 117.80 ? 292  ARG C CA    1 
ATOM   5869  C  C     . ARG C 2  292  ? 18.424  -41.347 47.234  1.00 117.15 ? 292  ARG C C     1 
ATOM   5870  O  O     . ARG C 2  292  ? 17.549  -41.633 46.415  1.00 114.81 ? 292  ARG C O     1 
ATOM   5871  C  CB    . ARG C 2  292  ? 18.735  -42.609 49.339  1.00 113.91 ? 292  ARG C CB    1 
ATOM   5872  C  CG    . ARG C 2  292  ? 18.740  -42.662 50.841  1.00 116.27 ? 292  ARG C CG    1 
ATOM   5873  C  CD    . ARG C 2  292  ? 19.145  -44.047 51.289  1.00 120.46 ? 292  ARG C CD    1 
ATOM   5874  N  NE    . ARG C 2  292  ? 18.355  -45.064 50.604  1.00 121.48 ? 292  ARG C NE    1 
ATOM   5875  C  CZ    . ARG C 2  292  ? 18.443  -46.366 50.845  1.00 125.13 ? 292  ARG C CZ    1 
ATOM   5876  N  NH1   . ARG C 2  292  ? 19.289  -46.817 51.761  1.00 122.69 ? 292  ARG C NH1   1 
ATOM   5877  N  NH2   . ARG C 2  292  ? 17.683  -47.217 50.170  1.00 127.61 ? 292  ARG C NH2   1 
ATOM   5878  N  N     . PHE C 2  293  ? 19.676  -41.049 46.901  1.00 120.24 ? 293  PHE C N     1 
ATOM   5879  C  CA    . PHE C 2  293  ? 20.235  -41.287 45.575  1.00 125.40 ? 293  PHE C CA    1 
ATOM   5880  C  C     . PHE C 2  293  ? 21.137  -42.511 45.699  1.00 127.80 ? 293  PHE C C     1 
ATOM   5881  O  O     . PHE C 2  293  ? 22.203  -42.444 46.323  1.00 123.99 ? 293  PHE C O     1 
ATOM   5882  C  CB    . PHE C 2  293  ? 21.012  -40.064 45.085  1.00 124.63 ? 293  PHE C CB    1 
ATOM   5883  C  CG    . PHE C 2  293  ? 21.521  -40.172 43.665  1.00 127.91 ? 293  PHE C CG    1 
ATOM   5884  C  CD1   . PHE C 2  293  ? 22.755  -40.751 43.392  1.00 128.65 ? 293  PHE C CD1   1 
ATOM   5885  C  CD2   . PHE C 2  293  ? 20.781  -39.661 42.609  1.00 126.00 ? 293  PHE C CD2   1 
ATOM   5886  C  CE1   . PHE C 2  293  ? 23.227  -40.837 42.096  1.00 118.51 ? 293  PHE C CE1   1 
ATOM   5887  C  CE2   . PHE C 2  293  ? 21.251  -39.744 41.313  1.00 119.55 ? 293  PHE C CE2   1 
ATOM   5888  C  CZ    . PHE C 2  293  ? 22.476  -40.329 41.059  1.00 120.15 ? 293  PHE C CZ    1 
ATOM   5889  N  N     . GLU C 2  294  ? 20.698  -43.638 45.139  1.00 130.67 ? 294  GLU C N     1 
ATOM   5890  C  CA    . GLU C 2  294  ? 21.435  -44.892 45.216  1.00 135.97 ? 294  GLU C CA    1 
ATOM   5891  C  C     . GLU C 2  294  ? 21.577  -45.469 43.814  1.00 142.17 ? 294  GLU C C     1 
ATOM   5892  O  O     . GLU C 2  294  ? 20.574  -45.654 43.113  1.00 140.32 ? 294  GLU C O     1 
ATOM   5893  C  CB    . GLU C 2  294  ? 20.730  -45.885 46.144  1.00 133.17 ? 294  GLU C CB    1 
ATOM   5894  C  CG    . GLU C 2  294  ? 21.552  -47.112 46.481  1.00 136.49 ? 294  GLU C CG    1 
ATOM   5895  C  CD    . GLU C 2  294  ? 20.829  -48.045 47.427  1.00 138.17 ? 294  GLU C CD    1 
ATOM   5896  O  OE1   . GLU C 2  294  ? 20.559  -49.198 47.032  1.00 141.86 ? 294  GLU C OE1   1 
ATOM   5897  O  OE2   . GLU C 2  294  ? 20.521  -47.618 48.561  1.00 130.51 ? 294  GLU C OE2   1 
ATOM   5898  N  N     . ASP C 2  295  ? 22.823  -45.735 43.410  1.00 143.03 ? 295  ASP C N     1 
ATOM   5899  C  CA    . ASP C 2  295  ? 23.141  -46.355 42.122  1.00 136.25 ? 295  ASP C CA    1 
ATOM   5900  C  C     . ASP C 2  295  ? 22.465  -45.623 40.966  1.00 136.16 ? 295  ASP C C     1 
ATOM   5901  O  O     . ASP C 2  295  ? 21.958  -46.236 40.024  1.00 137.95 ? 295  ASP C O     1 
ATOM   5902  C  CB    . ASP C 2  295  ? 22.772  -47.841 42.120  1.00 138.20 ? 295  ASP C CB    1 
ATOM   5903  C  CG    . ASP C 2  295  ? 23.356  -48.589 43.306  1.00 142.66 ? 295  ASP C CG    1 
ATOM   5904  O  OD1   . ASP C 2  295  ? 24.560  -48.411 43.589  1.00 146.34 ? 295  ASP C OD1   1 
ATOM   5905  O  OD2   . ASP C 2  295  ? 22.606  -49.340 43.967  1.00 141.95 ? 295  ASP C OD2   1 
ATOM   5906  N  N     . GLY C 2  296  ? 22.444  -44.293 41.048  1.00 130.50 ? 296  GLY C N     1 
ATOM   5907  C  CA    . GLY C 2  296  ? 21.889  -43.473 39.995  1.00 130.75 ? 296  GLY C CA    1 
ATOM   5908  C  C     . GLY C 2  296  ? 20.393  -43.243 40.050  1.00 133.34 ? 296  GLY C C     1 
ATOM   5909  O  O     . GLY C 2  296  ? 19.893  -42.390 39.304  1.00 128.43 ? 296  GLY C O     1 
ATOM   5910  N  N     . GLU C 2  297  ? 19.654  -43.961 40.897  1.00 137.70 ? 297  GLU C N     1 
ATOM   5911  C  CA    . GLU C 2  297  ? 18.204  -43.826 40.955  1.00 139.18 ? 297  GLU C CA    1 
ATOM   5912  C  C     . GLU C 2  297  ? 17.749  -43.417 42.354  1.00 135.99 ? 297  GLU C C     1 
ATOM   5913  O  O     . GLU C 2  297  ? 18.426  -43.684 43.352  1.00 133.39 ? 297  GLU C O     1 
ATOM   5914  C  CB    . GLU C 2  297  ? 17.506  -45.132 40.529  1.00 141.05 ? 297  GLU C CB    1 
ATOM   5915  C  CG    . GLU C 2  297  ? 17.994  -46.387 41.246  1.00 142.57 ? 297  GLU C CG    1 
ATOM   5916  C  CD    . GLU C 2  297  ? 17.242  -47.637 40.819  1.00 143.63 ? 297  GLU C CD    1 
ATOM   5917  O  OE1   . GLU C 2  297  ? 17.294  -48.644 41.556  1.00 149.12 ? 297  GLU C OE1   1 
ATOM   5918  O  OE2   . GLU C 2  297  ? 16.597  -47.613 39.750  1.00 138.00 ? 297  GLU C OE2   1 
ATOM   5919  N  N     . PHE C 2  298  ? 16.595  -42.754 42.418  1.00 131.58 ? 298  PHE C N     1 
ATOM   5920  C  CA    . PHE C 2  298  ? 16.041  -42.317 43.693  1.00 124.83 ? 298  PHE C CA    1 
ATOM   5921  C  C     . PHE C 2  298  ? 15.314  -43.464 44.382  1.00 125.11 ? 298  PHE C C     1 
ATOM   5922  O  O     . PHE C 2  298  ? 14.542  -44.194 43.756  1.00 130.07 ? 298  PHE C O     1 
ATOM   5923  C  CB    . PHE C 2  298  ? 15.091  -41.137 43.492  1.00 119.41 ? 298  PHE C CB    1 
ATOM   5924  C  CG    . PHE C 2  298  ? 15.784  -39.857 43.115  1.00 124.69 ? 298  PHE C CG    1 
ATOM   5925  C  CD1   . PHE C 2  298  ? 16.752  -39.306 43.942  1.00 123.58 ? 298  PHE C CD1   1 
ATOM   5926  C  CD2   . PHE C 2  298  ? 15.474  -39.206 41.931  1.00 125.10 ? 298  PHE C CD2   1 
ATOM   5927  C  CE1   . PHE C 2  298  ? 17.396  -38.128 43.598  1.00 118.80 ? 298  PHE C CE1   1 
ATOM   5928  C  CE2   . PHE C 2  298  ? 16.113  -38.026 41.582  1.00 125.10 ? 298  PHE C CE2   1 
ATOM   5929  C  CZ    . PHE C 2  298  ? 17.075  -37.487 42.417  1.00 119.46 ? 298  PHE C CZ    1 
ATOM   5930  N  N     . LYS C 2  299  ? 15.565  -43.614 45.680  1.00 122.67 ? 299  LYS C N     1 
ATOM   5931  C  CA    . LYS C 2  299  ? 15.009  -44.697 46.483  1.00 128.27 ? 299  LYS C CA    1 
ATOM   5932  C  C     . LYS C 2  299  ? 14.226  -44.108 47.649  1.00 123.91 ? 299  LYS C C     1 
ATOM   5933  O  O     . LYS C 2  299  ? 14.726  -43.222 48.349  1.00 122.01 ? 299  LYS C O     1 
ATOM   5934  C  CB    . LYS C 2  299  ? 16.122  -45.620 46.991  1.00 130.54 ? 299  LYS C CB    1 
ATOM   5935  C  CG    . LYS C 2  299  ? 15.791  -47.100 46.909  1.00 131.11 ? 299  LYS C CG    1 
ATOM   5936  C  CD    . LYS C 2  299  ? 17.025  -47.907 46.534  1.00 131.80 ? 299  LYS C CD    1 
ATOM   5937  C  CE    . LYS C 2  299  ? 17.571  -47.474 45.176  1.00 136.14 ? 299  LYS C CE    1 
ATOM   5938  N  NZ    . LYS C 2  299  ? 18.765  -48.262 44.754  1.00 132.27 ? 299  LYS C NZ    1 
ATOM   5939  N  N     . ASP C 2  300  ? 13.013  -44.613 47.869  1.00 123.49 ? 300  ASP C N     1 
ATOM   5940  C  CA    . ASP C 2  300  ? 12.076  -43.967 48.783  1.00 122.42 ? 300  ASP C CA    1 
ATOM   5941  C  C     . ASP C 2  300  ? 12.276  -44.399 50.231  1.00 117.26 ? 300  ASP C C     1 
ATOM   5942  O  O     . ASP C 2  300  ? 12.449  -45.584 50.531  1.00 116.50 ? 300  ASP C O     1 
ATOM   5943  C  CB    . ASP C 2  300  ? 10.636  -44.259 48.361  1.00 121.83 ? 300  ASP C CB    1 
ATOM   5944  C  CG    . ASP C 2  300  ? 9.623   -43.822 49.405  1.00 113.05 ? 300  ASP C CG    1 
ATOM   5945  O  OD1   . ASP C 2  300  ? 9.337   -44.608 50.334  1.00 113.14 ? 300  ASP C OD1   1 
ATOM   5946  O  OD2   . ASP C 2  300  ? 9.127   -42.681 49.310  1.00 111.81 ? 300  ASP C OD2   1 
ATOM   5947  N  N     . GLU C 2  301  ? 12.219  -43.421 51.136  1.00 115.55 ? 301  GLU C N     1 
ATOM   5948  C  CA    . GLU C 2  301  ? 12.248  -43.679 52.569  1.00 115.40 ? 301  GLU C CA    1 
ATOM   5949  C  C     . GLU C 2  301  ? 10.936  -43.304 53.245  1.00 109.57 ? 301  GLU C C     1 
ATOM   5950  O  O     . GLU C 2  301  ? 10.322  -44.149 53.905  1.00 113.05 ? 301  GLU C O     1 
ATOM   5951  C  CB    . GLU C 2  301  ? 13.415  -42.927 53.223  1.00 111.27 ? 301  GLU C CB    1 
ATOM   5952  C  CG    . GLU C 2  301  ? 14.795  -43.310 52.708  1.00 112.82 ? 301  GLU C CG    1 
ATOM   5953  C  CD    . GLU C 2  301  ? 15.652  -43.989 53.765  1.00 116.53 ? 301  GLU C CD    1 
ATOM   5954  O  OE1   . GLU C 2  301  ? 15.134  -44.266 54.867  1.00 109.77 ? 301  GLU C OE1   1 
ATOM   5955  O  OE2   . GLU C 2  301  ? 16.845  -44.244 53.497  1.00 118.57 ? 301  GLU C OE2   1 
ATOM   5956  N  N     . VAL C 2  302  ? 10.472  -42.068 53.080  1.00 109.87 ? 302  VAL C N     1 
ATOM   5957  C  CA    . VAL C 2  302  ? 9.420   -41.510 53.929  1.00 105.39 ? 302  VAL C CA    1 
ATOM   5958  C  C     . VAL C 2  302  ? 8.058   -41.534 53.244  1.00 102.05 ? 302  VAL C C     1 
ATOM   5959  O  O     . VAL C 2  302  ? 7.045   -41.844 53.872  1.00 103.01 ? 302  VAL C O     1 
ATOM   5960  C  CB    . VAL C 2  302  ? 9.794   -40.077 54.372  1.00 102.13 ? 302  VAL C CB    1 
ATOM   5961  C  CG1   . VAL C 2  302  ? 8.572   -39.335 54.881  1.00 90.32  ? 302  VAL C CG1   1 
ATOM   5962  C  CG2   . VAL C 2  302  ? 10.863  -40.123 55.440  1.00 100.36 ? 302  VAL C CG2   1 
ATOM   5963  N  N     . PHE C 2  303  ? 8.015   -41.194 51.952  1.00 100.57 ? 303  PHE C N     1 
ATOM   5964  C  CA    . PHE C 2  303  ? 6.755   -40.808 51.316  1.00 97.63  ? 303  PHE C CA    1 
ATOM   5965  C  C     . PHE C 2  303  ? 5.708   -41.916 51.380  1.00 102.38 ? 303  PHE C C     1 
ATOM   5966  O  O     . PHE C 2  303  ? 4.553   -41.669 51.750  1.00 103.46 ? 303  PHE C O     1 
ATOM   5967  C  CB    . PHE C 2  303  ? 7.006   -40.397 49.868  1.00 91.53  ? 303  PHE C CB    1 
ATOM   5968  C  CG    . PHE C 2  303  ? 7.593   -39.031 49.724  1.00 84.74  ? 303  PHE C CG    1 
ATOM   5969  C  CD1   . PHE C 2  303  ? 8.948   -38.819 49.909  1.00 88.67  ? 303  PHE C CD1   1 
ATOM   5970  C  CD2   . PHE C 2  303  ? 6.787   -37.954 49.397  1.00 82.00  ? 303  PHE C CD2   1 
ATOM   5971  C  CE1   . PHE C 2  303  ? 9.491   -37.554 49.771  1.00 87.74  ? 303  PHE C CE1   1 
ATOM   5972  C  CE2   . PHE C 2  303  ? 7.323   -36.686 49.257  1.00 82.89  ? 303  PHE C CE2   1 
ATOM   5973  C  CZ    . PHE C 2  303  ? 8.677   -36.486 49.445  1.00 85.78  ? 303  PHE C CZ    1 
ATOM   5974  N  N     . LEU C 2  304  ? 6.078   -43.139 50.993  1.00 103.98 ? 304  LEU C N     1 
ATOM   5975  C  CA    . LEU C 2  304  ? 5.073   -44.198 50.890  1.00 107.20 ? 304  LEU C CA    1 
ATOM   5976  C  C     . LEU C 2  304  ? 4.490   -44.556 52.255  1.00 104.94 ? 304  LEU C C     1 
ATOM   5977  O  O     . LEU C 2  304  ? 3.266   -44.725 52.362  1.00 103.47 ? 304  LEU C O     1 
ATOM   5978  C  CB    . LEU C 2  304  ? 5.648   -45.443 50.198  1.00 109.50 ? 304  LEU C CB    1 
ATOM   5979  C  CG    . LEU C 2  304  ? 4.636   -46.565 49.920  1.00 114.10 ? 304  LEU C CG    1 
ATOM   5980  C  CD1   . LEU C 2  304  ? 3.459   -46.054 49.097  1.00 111.63 ? 304  LEU C CD1   1 
ATOM   5981  C  CD2   . LEU C 2  304  ? 5.302   -47.746 49.230  1.00 112.46 ? 304  LEU C CD2   1 
ATOM   5982  N  N     . PRO C 2  305  ? 5.309   -44.704 53.311  1.00 101.91 ? 305  PRO C N     1 
ATOM   5983  C  CA    . PRO C 2  305  ? 4.714   -44.876 54.650  1.00 99.37  ? 305  PRO C CA    1 
ATOM   5984  C  C     . PRO C 2  305  ? 3.788   -43.743 55.051  1.00 100.14 ? 305  PRO C C     1 
ATOM   5985  O  O     . PRO C 2  305  ? 2.736   -43.988 55.658  1.00 100.93 ? 305  PRO C O     1 
ATOM   5986  C  CB    . PRO C 2  305  ? 5.943   -44.957 55.562  1.00 99.41  ? 305  PRO C CB    1 
ATOM   5987  C  CG    . PRO C 2  305  ? 6.993   -45.531 54.690  1.00 102.18 ? 305  PRO C CG    1 
ATOM   5988  C  CD    . PRO C 2  305  ? 6.768   -44.948 53.333  1.00 101.58 ? 305  PRO C CD    1 
ATOM   5989  N  N     . THR C 2  306  ? 4.153   -42.503 54.718  1.00 96.45  ? 306  THR C N     1 
ATOM   5990  C  CA    . THR C 2  306  ? 3.306   -41.363 55.050  1.00 95.47  ? 306  THR C CA    1 
ATOM   5991  C  C     . THR C 2  306  ? 1.957   -41.468 54.353  1.00 98.64  ? 306  THR C C     1 
ATOM   5992  O  O     . THR C 2  306  ? 0.906   -41.258 54.970  1.00 97.74  ? 306  THR C O     1 
ATOM   5993  C  CB    . THR C 2  306  ? 4.008   -40.056 54.671  1.00 94.06  ? 306  THR C CB    1 
ATOM   5994  O  OG1   . THR C 2  306  ? 5.120   -39.829 55.546  1.00 85.98  ? 306  THR C OG1   1 
ATOM   5995  C  CG2   . THR C 2  306  ? 3.047   -38.878 54.777  1.00 86.15  ? 306  THR C CG2   1 
ATOM   5996  N  N     . LEU C 2  307  ? 1.967   -41.800 53.059  1.00 103.82 ? 307  LEU C N     1 
ATOM   5997  C  CA    . LEU C 2  307  ? 0.718   -41.923 52.314  1.00 105.55 ? 307  LEU C CA    1 
ATOM   5998  C  C     . LEU C 2  307  ? -0.114  -43.098 52.817  1.00 104.18 ? 307  LEU C C     1 
ATOM   5999  O  O     . LEU C 2  307  ? -1.349  -43.020 52.862  1.00 102.05 ? 307  LEU C O     1 
ATOM   6000  C  CB    . LEU C 2  307  ? 1.015   -42.071 50.825  1.00 105.40 ? 307  LEU C CB    1 
ATOM   6001  C  CG    . LEU C 2  307  ? -0.207  -42.191 49.918  1.00 108.59 ? 307  LEU C CG    1 
ATOM   6002  C  CD1   . LEU C 2  307  ? -1.149  -41.020 50.127  1.00 103.17 ? 307  LEU C CD1   1 
ATOM   6003  C  CD2   . LEU C 2  307  ? 0.248   -42.259 48.483  1.00 109.74 ? 307  LEU C CD2   1 
ATOM   6004  N  N     . ARG C 2  308  ? 0.548   -44.194 53.192  1.00 106.11 ? 308  ARG C N     1 
ATOM   6005  C  CA    . ARG C 2  308  ? -0.148  -45.330 53.786  1.00 104.35 ? 308  ARG C CA    1 
ATOM   6006  C  C     . ARG C 2  308  ? -0.870  -44.910 55.060  1.00 102.35 ? 308  ARG C C     1 
ATOM   6007  O  O     . ARG C 2  308  ? -2.063  -45.190 55.238  1.00 101.33 ? 308  ARG C O     1 
ATOM   6008  C  CB    . ARG C 2  308  ? 0.859   -46.451 54.058  1.00 103.04 ? 308  ARG C CB    1 
ATOM   6009  C  CG    . ARG C 2  308  ? 0.272   -47.835 54.268  1.00 102.49 ? 308  ARG C CG    1 
ATOM   6010  C  CD    . ARG C 2  308  ? -0.070  -48.054 55.721  1.00 103.53 ? 308  ARG C CD    1 
ATOM   6011  N  NE    . ARG C 2  308  ? 0.940   -47.480 56.602  1.00 110.97 ? 308  ARG C NE    1 
ATOM   6012  C  CZ    . ARG C 2  308  ? 0.712   -47.137 57.866  1.00 109.57 ? 308  ARG C CZ    1 
ATOM   6013  N  NH1   . ARG C 2  308  ? -0.498  -47.307 58.386  1.00 101.05 ? 308  ARG C NH1   1 
ATOM   6014  N  NH2   . ARG C 2  308  ? 1.686   -46.618 58.605  1.00 103.93 ? 308  ARG C NH2   1 
ATOM   6015  N  N     . TYR C 2  309  ? -0.158  -44.214 55.952  1.00 101.45 ? 309  TYR C N     1 
ATOM   6016  C  CA    . TYR C 2  309  ? -0.773  -43.738 57.186  1.00 92.93  ? 309  TYR C CA    1 
ATOM   6017  C  C     . TYR C 2  309  ? -1.924  -42.784 56.894  1.00 93.57  ? 309  TYR C C     1 
ATOM   6018  O  O     . TYR C 2  309  ? -2.957  -42.831 57.566  1.00 101.07 ? 309  TYR C O     1 
ATOM   6019  C  CB    . TYR C 2  309  ? 0.275   -43.062 58.075  1.00 90.98  ? 309  TYR C CB    1 
ATOM   6020  C  CG    . TYR C 2  309  ? -0.111  -42.987 59.544  1.00 94.56  ? 309  TYR C CG    1 
ATOM   6021  C  CD1   . TYR C 2  309  ? -1.120  -42.133 59.980  1.00 94.90  ? 309  TYR C CD1   1 
ATOM   6022  C  CD2   . TYR C 2  309  ? 0.531   -43.774 60.495  1.00 95.79  ? 309  TYR C CD2   1 
ATOM   6023  C  CE1   . TYR C 2  309  ? -1.480  -42.065 61.322  1.00 94.51  ? 309  TYR C CE1   1 
ATOM   6024  C  CE2   . TYR C 2  309  ? 0.180   -43.709 61.842  1.00 93.23  ? 309  TYR C CE2   1 
ATOM   6025  C  CZ    . TYR C 2  309  ? -0.829  -42.854 62.246  1.00 93.96  ? 309  TYR C CZ    1 
ATOM   6026  O  OH    . TYR C 2  309  ? -1.191  -42.781 63.574  1.00 90.55  ? 309  TYR C OH    1 
ATOM   6027  N  N     . LEU C 2  310  ? -1.768  -41.909 55.897  1.00 95.56  ? 310  LEU C N     1 
ATOM   6028  C  CA    . LEU C 2  310  ? -2.819  -40.938 55.601  1.00 98.62  ? 310  LEU C CA    1 
ATOM   6029  C  C     . LEU C 2  310  ? -4.084  -41.628 55.102  1.00 101.89 ? 310  LEU C C     1 
ATOM   6030  O  O     . LEU C 2  310  ? -5.195  -41.327 55.563  1.00 100.06 ? 310  LEU C O     1 
ATOM   6031  C  CB    . LEU C 2  310  ? -2.327  -39.916 54.575  1.00 98.52  ? 310  LEU C CB    1 
ATOM   6032  C  CG    . LEU C 2  310  ? -3.396  -38.919 54.108  1.00 100.05 ? 310  LEU C CG    1 
ATOM   6033  C  CD1   . LEU C 2  310  ? -3.894  -38.070 55.275  1.00 101.63 ? 310  LEU C CD1   1 
ATOM   6034  C  CD2   . LEU C 2  310  ? -2.891  -38.034 52.972  1.00 96.96  ? 310  LEU C CD2   1 
ATOM   6035  N  N     . PHE C 2  311  ? -3.933  -42.547 54.141  1.00 104.53 ? 311  PHE C N     1 
ATOM   6036  C  CA    . PHE C 2  311  ? -5.078  -43.319 53.664  1.00 107.90 ? 311  PHE C CA    1 
ATOM   6037  C  C     . PHE C 2  311  ? -5.744  -44.071 54.809  1.00 108.02 ? 311  PHE C C     1 
ATOM   6038  O  O     . PHE C 2  311  ? -6.978  -44.108 54.907  1.00 105.76 ? 311  PHE C O     1 
ATOM   6039  C  CB    . PHE C 2  311  ? -4.645  -44.296 52.565  1.00 114.30 ? 311  PHE C CB    1 
ATOM   6040  C  CG    . PHE C 2  311  ? -4.456  -43.662 51.206  1.00 116.29 ? 311  PHE C CG    1 
ATOM   6041  C  CD1   . PHE C 2  311  ? -4.730  -42.319 51.000  1.00 113.83 ? 311  PHE C CD1   1 
ATOM   6042  C  CD2   . PHE C 2  311  ? -4.016  -44.420 50.132  1.00 117.57 ? 311  PHE C CD2   1 
ATOM   6043  C  CE1   . PHE C 2  311  ? -4.558  -41.742 49.754  1.00 113.70 ? 311  PHE C CE1   1 
ATOM   6044  C  CE2   . PHE C 2  311  ? -3.842  -43.851 48.885  1.00 116.96 ? 311  PHE C CE2   1 
ATOM   6045  C  CZ    . PHE C 2  311  ? -4.111  -42.510 48.695  1.00 119.57 ? 311  PHE C CZ    1 
ATOM   6046  N  N     . ALA C 2  312  ? -4.939  -44.671 55.693  1.00 106.79 ? 312  ALA C N     1 
ATOM   6047  C  CA    . ALA C 2  312  ? -5.499  -45.432 56.803  1.00 103.52 ? 312  ALA C CA    1 
ATOM   6048  C  C     . ALA C 2  312  ? -6.257  -44.532 57.771  1.00 103.06 ? 312  ALA C C     1 
ATOM   6049  O  O     . ALA C 2  312  ? -7.296  -44.927 58.313  1.00 105.49 ? 312  ALA C O     1 
ATOM   6050  C  CB    . ALA C 2  312  ? -4.388  -46.190 57.526  1.00 104.18 ? 312  ALA C CB    1 
ATOM   6051  N  N     . LEU C 2  313  ? -5.754  -43.321 58.004  1.00 100.56 ? 313  LEU C N     1 
ATOM   6052  C  CA    . LEU C 2  313  ? -6.469  -42.392 58.870  1.00 102.96 ? 313  LEU C CA    1 
ATOM   6053  C  C     . LEU C 2  313  ? -7.773  -41.943 58.222  1.00 102.80 ? 313  LEU C C     1 
ATOM   6054  O  O     . LEU C 2  313  ? -8.779  -41.748 58.912  1.00 95.02  ? 313  LEU C O     1 
ATOM   6055  C  CB    . LEU C 2  313  ? -5.579  -41.193 59.204  1.00 102.05 ? 313  LEU C CB    1 
ATOM   6056  C  CG    . LEU C 2  313  ? -6.171  -40.082 60.077  1.00 97.48  ? 313  LEU C CG    1 
ATOM   6057  C  CD1   . LEU C 2  313  ? -6.687  -40.628 61.396  1.00 94.18  ? 313  LEU C CD1   1 
ATOM   6058  C  CD2   . LEU C 2  313  ? -5.144  -38.991 60.323  1.00 97.98  ? 313  LEU C CD2   1 
ATOM   6059  N  N     . THR C 2  314  ? -7.779  -41.792 56.894  1.00 106.11 ? 314  THR C N     1 
ATOM   6060  C  CA    . THR C 2  314  ? -9.003  -41.368 56.216  1.00 107.27 ? 314  THR C CA    1 
ATOM   6061  C  C     . THR C 2  314  ? -10.065 -42.464 56.247  1.00 109.13 ? 314  THR C C     1 
ATOM   6062  O  O     . THR C 2  314  ? -11.236 -42.193 56.544  1.00 106.36 ? 314  THR C O     1 
ATOM   6063  C  CB    . THR C 2  314  ? -8.695  -40.955 54.775  1.00 102.78 ? 314  THR C CB    1 
ATOM   6064  O  OG1   . THR C 2  314  ? -7.663  -39.963 54.776  1.00 103.95 ? 314  THR C OG1   1 
ATOM   6065  C  CG2   . THR C 2  314  ? -9.935  -40.376 54.105  1.00 98.16  ? 314  THR C CG2   1 
ATOM   6066  N  N     . ALA C 2  315  ? -9.674  -43.708 55.955  1.00 110.54 ? 315  ALA C N     1 
ATOM   6067  C  CA    . ALA C 2  315  ? -10.639 -44.806 55.944  1.00 108.83 ? 315  ALA C CA    1 
ATOM   6068  C  C     . ALA C 2  315  ? -11.192 -45.097 57.335  1.00 106.21 ? 315  ALA C C     1 
ATOM   6069  O  O     . ALA C 2  315  ? -12.321 -45.585 57.462  1.00 107.18 ? 315  ALA C O     1 
ATOM   6070  C  CB    . ALA C 2  315  ? -9.997  -46.063 55.356  1.00 106.92 ? 315  ALA C CB    1 
ATOM   6071  N  N     . GLY C 2  316  ? -10.427 -44.803 58.378  1.00 102.17 ? 316  GLY C N     1 
ATOM   6072  C  CA    . GLY C 2  316  ? -10.843 -45.085 59.730  1.00 105.00 ? 316  GLY C CA    1 
ATOM   6073  C  C     . GLY C 2  316  ? -10.300 -46.373 60.303  1.00 106.67 ? 316  GLY C C     1 
ATOM   6074  O  O     . GLY C 2  316  ? -10.839 -46.855 61.305  1.00 107.16 ? 316  GLY C O     1 
ATOM   6075  N  N     . VAL C 2  317  ? -9.263  -46.943 59.702  1.00 100.31 ? 317  VAL C N     1 
ATOM   6076  C  CA    . VAL C 2  317  ? -8.738  -48.220 60.192  1.00 98.55  ? 317  VAL C CA    1 
ATOM   6077  C  C     . VAL C 2  317  ? -8.055  -47.997 61.537  1.00 99.21  ? 317  VAL C C     1 
ATOM   6078  O  O     . VAL C 2  317  ? -7.431  -46.941 61.751  1.00 99.36  ? 317  VAL C O     1 
ATOM   6079  C  CB    . VAL C 2  317  ? -7.796  -48.857 59.156  1.00 101.20 ? 317  VAL C CB    1 
ATOM   6080  C  CG1   . VAL C 2  317  ? -7.758  -48.032 57.868  1.00 101.93 ? 317  VAL C CG1   1 
ATOM   6081  C  CG2   . VAL C 2  317  ? -6.398  -49.098 59.717  1.00 98.27  ? 317  VAL C CG2   1 
ATOM   6082  N  N     . PRO C 2  318  ? -8.176  -48.935 62.471  1.00 99.25  ? 318  PRO C N     1 
ATOM   6083  C  CA    . PRO C 2  318  ? -7.759  -48.680 63.854  1.00 101.29 ? 318  PRO C CA    1 
ATOM   6084  C  C     . PRO C 2  318  ? -6.255  -48.492 63.983  1.00 100.08 ? 318  PRO C C     1 
ATOM   6085  O  O     . PRO C 2  318  ? -5.466  -48.923 63.138  1.00 100.30 ? 318  PRO C O     1 
ATOM   6086  C  CB    . PRO C 2  318  ? -8.217  -49.939 64.595  1.00 105.75 ? 318  PRO C CB    1 
ATOM   6087  C  CG    . PRO C 2  318  ? -9.282  -50.529 63.720  1.00 106.06 ? 318  PRO C CG    1 
ATOM   6088  C  CD    . PRO C 2  318  ? -8.879  -50.217 62.324  1.00 103.71 ? 318  PRO C CD    1 
ATOM   6089  N  N     . GLY C 2  319  ? -5.865  -47.844 65.081  1.00 96.65  ? 319  GLY C N     1 
ATOM   6090  C  CA    . GLY C 2  319  ? -4.464  -47.564 65.328  1.00 99.46  ? 319  GLY C CA    1 
ATOM   6091  C  C     . GLY C 2  319  ? -3.901  -46.411 64.525  1.00 105.46 ? 319  GLY C C     1 
ATOM   6092  O  O     . GLY C 2  319  ? -2.691  -46.373 64.257  1.00 97.75  ? 319  GLY C O     1 
ATOM   6093  N  N     . HIS C 2  320  ? -4.751  -45.474 64.116  1.00 108.23 ? 320  HIS C N     1 
ATOM   6094  C  CA    . HIS C 2  320  ? -4.325  -44.302 63.363  1.00 99.41  ? 320  HIS C CA    1 
ATOM   6095  C  C     . HIS C 2  320  ? -5.086  -43.093 63.886  1.00 101.09 ? 320  HIS C C     1 
ATOM   6096  O  O     . HIS C 2  320  ? -6.322  -43.086 63.911  1.00 99.04  ? 320  HIS C O     1 
ATOM   6097  C  CB    . HIS C 2  320  ? -4.543  -44.503 61.862  1.00 97.40  ? 320  HIS C CB    1 
ATOM   6098  C  CG    . HIS C 2  320  ? -3.797  -45.673 61.305  1.00 97.51  ? 320  HIS C CG    1 
ATOM   6099  N  ND1   . HIS C 2  320  ? -4.431  -46.779 60.784  1.00 99.11  ? 320  HIS C ND1   1 
ATOM   6100  C  CD2   . HIS C 2  320  ? -2.470  -45.920 61.209  1.00 98.58  ? 320  HIS C CD2   1 
ATOM   6101  C  CE1   . HIS C 2  320  ? -3.526  -47.653 60.381  1.00 99.29  ? 320  HIS C CE1   1 
ATOM   6102  N  NE2   . HIS C 2  320  ? -2.329  -47.155 60.625  1.00 100.85 ? 320  HIS C NE2   1 
ATOM   6103  N  N     . GLU C 2  321  ? -4.341  -42.084 64.323  1.00 99.67  ? 321  GLU C N     1 
ATOM   6104  C  CA    . GLU C 2  321  ? -4.910  -40.969 65.055  1.00 93.56  ? 321  GLU C CA    1 
ATOM   6105  C  C     . GLU C 2  321  ? -4.263  -39.672 64.599  1.00 97.20  ? 321  GLU C C     1 
ATOM   6106  O  O     . GLU C 2  321  ? -3.125  -39.646 64.124  1.00 93.98  ? 321  GLU C O     1 
ATOM   6107  C  CB    . GLU C 2  321  ? -4.725  -41.137 66.568  1.00 87.53  ? 321  GLU C CB    1 
ATOM   6108  C  CG    . GLU C 2  321  ? -3.273  -41.339 66.982  1.00 93.70  ? 321  GLU C CG    1 
ATOM   6109  C  CD    . GLU C 2  321  ? -3.109  -41.574 68.473  1.00 110.70 ? 321  GLU C CD    1 
ATOM   6110  O  OE1   . GLU C 2  321  ? -4.094  -41.387 69.219  1.00 118.71 ? 321  GLU C OE1   1 
ATOM   6111  O  OE2   . GLU C 2  321  ? -1.992  -41.945 68.897  1.00 108.11 ? 321  GLU C OE2   1 
ATOM   6112  N  N     . VAL C 2  322  ? -5.018  -38.591 64.767  1.00 96.06  ? 322  VAL C N     1 
ATOM   6113  C  CA    . VAL C 2  322  ? -4.587  -37.240 64.435  1.00 87.39  ? 322  VAL C CA    1 
ATOM   6114  C  C     . VAL C 2  322  ? -3.566  -36.802 65.486  1.00 85.02  ? 322  VAL C C     1 
ATOM   6115  O  O     . VAL C 2  322  ? -3.366  -37.501 66.485  1.00 88.29  ? 322  VAL C O     1 
ATOM   6116  C  CB    . VAL C 2  322  ? -5.822  -36.314 64.336  1.00 90.59  ? 322  VAL C CB    1 
ATOM   6117  C  CG1   . VAL C 2  322  ? -5.915  -35.341 65.512  1.00 90.16  ? 322  VAL C CG1   1 
ATOM   6118  C  CG2   . VAL C 2  322  ? -5.863  -35.606 62.979  1.00 94.06  ? 322  VAL C CG2   1 
ATOM   6119  N  N     . ASP C 2  323  ? -2.861  -35.692 65.254  1.00 82.30  ? 323  ASP C N     1 
ATOM   6120  C  CA    . ASP C 2  323  ? -1.815  -35.245 66.170  1.00 77.67  ? 323  ASP C CA    1 
ATOM   6121  C  C     . ASP C 2  323  ? -2.157  -33.906 66.815  1.00 77.55  ? 323  ASP C C     1 
ATOM   6122  O  O     . ASP C 2  323  ? -2.722  -33.014 66.173  1.00 80.79  ? 323  ASP C O     1 
ATOM   6123  C  CB    . ASP C 2  323  ? -0.470  -35.141 65.460  1.00 73.07  ? 323  ASP C CB    1 
ATOM   6124  C  CG    . ASP C 2  323  ? 0.250   -36.459 65.413  1.00 83.57  ? 323  ASP C CG    1 
ATOM   6125  O  OD1   . ASP C 2  323  ? 0.515   -37.014 66.503  1.00 79.96  ? 323  ASP C OD1   1 
ATOM   6126  O  OD2   . ASP C 2  323  ? 0.519   -36.946 64.292  1.00 83.73  ? 323  ASP C OD2   1 
ATOM   6127  N  N     . ASP C 2  324  ? -1.805  -33.778 68.094  1.00 70.36  ? 324  ASP C N     1 
ATOM   6128  C  CA    . ASP C 2  324  ? -1.940  -32.527 68.831  1.00 72.69  ? 324  ASP C CA    1 
ATOM   6129  C  C     . ASP C 2  324  ? -0.600  -31.810 68.744  1.00 73.90  ? 324  ASP C C     1 
ATOM   6130  O  O     . ASP C 2  324  ? 0.369   -32.219 69.388  1.00 77.36  ? 324  ASP C O     1 
ATOM   6131  C  CB    . ASP C 2  324  ? -2.345  -32.808 70.278  1.00 73.51  ? 324  ASP C CB    1 
ATOM   6132  C  CG    . ASP C 2  324  ? -2.697  -31.547 71.061  1.00 78.67  ? 324  ASP C CG    1 
ATOM   6133  O  OD1   . ASP C 2  324  ? -2.521  -30.432 70.520  1.00 79.31  ? 324  ASP C OD1   1 
ATOM   6134  O  OD2   . ASP C 2  324  ? -3.152  -31.681 72.224  1.00 72.55  ? 324  ASP C OD2   1 
ATOM   6135  N  N     . ILE C 2  325  ? -0.534  -30.751 67.931  1.00 68.46  ? 325  ILE C N     1 
ATOM   6136  C  CA    . ILE C 2  325  ? 0.736   -30.078 67.672  1.00 70.10  ? 325  ILE C CA    1 
ATOM   6137  C  C     . ILE C 2  325  ? 1.224   -29.232 68.839  1.00 72.87  ? 325  ILE C C     1 
ATOM   6138  O  O     . ILE C 2  325  ? 2.377   -28.786 68.830  1.00 72.39  ? 325  ILE C O     1 
ATOM   6139  C  CB    . ILE C 2  325  ? 0.639   -29.198 66.409  1.00 73.28  ? 325  ILE C CB    1 
ATOM   6140  C  CG1   . ILE C 2  325  ? -0.065  -27.881 66.724  1.00 73.76  ? 325  ILE C CG1   1 
ATOM   6141  C  CG2   . ILE C 2  325  ? -0.090  -29.937 65.300  1.00 74.93  ? 325  ILE C CG2   1 
ATOM   6142  C  CD1   . ILE C 2  325  ? -0.101  -26.927 65.555  1.00 74.68  ? 325  ILE C CD1   1 
ATOM   6143  N  N     . ASP C 2  326  ? 0.381   -28.983 69.837  1.00 74.82  ? 326  ASP C N     1 
ATOM   6144  C  CA    . ASP C 2  326  ? 0.814   -28.261 71.023  1.00 73.69  ? 326  ASP C CA    1 
ATOM   6145  C  C     . ASP C 2  326  ? 1.260   -29.191 72.142  1.00 74.85  ? 326  ASP C C     1 
ATOM   6146  O  O     . ASP C 2  326  ? 1.820   -28.716 73.138  1.00 70.40  ? 326  ASP C O     1 
ATOM   6147  C  CB    . ASP C 2  326  ? -0.303  -27.333 71.500  1.00 71.88  ? 326  ASP C CB    1 
ATOM   6148  C  CG    . ASP C 2  326  ? -0.537  -26.188 70.537  1.00 80.23  ? 326  ASP C CG    1 
ATOM   6149  O  OD1   . ASP C 2  326  ? 0.468   -25.613 70.065  1.00 82.64  ? 326  ASP C OD1   1 
ATOM   6150  O  OD2   . ASP C 2  326  ? -1.710  -25.877 70.236  1.00 86.67  ? 326  ASP C OD2   1 
ATOM   6151  N  N     . HIS C 2  327  ? 1.030   -30.496 71.984  1.00 72.25  ? 327  HIS C N     1 
ATOM   6152  C  CA    . HIS C 2  327  ? 1.577   -31.509 72.879  1.00 72.17  ? 327  HIS C CA    1 
ATOM   6153  C  C     . HIS C 2  327  ? 3.079   -31.313 73.046  1.00 62.79  ? 327  HIS C C     1 
ATOM   6154  O  O     . HIS C 2  327  ? 3.793   -31.051 72.080  1.00 66.33  ? 327  HIS C O     1 
ATOM   6155  C  CB    . HIS C 2  327  ? 1.280   -32.895 72.293  1.00 75.76  ? 327  HIS C CB    1 
ATOM   6156  C  CG    . HIS C 2  327  ? 1.237   -34.008 73.294  1.00 66.12  ? 327  HIS C CG    1 
ATOM   6157  N  ND1   . HIS C 2  327  ? 2.367   -34.519 73.896  1.00 68.63  ? 327  HIS C ND1   1 
ATOM   6158  C  CD2   . HIS C 2  327  ? 0.200   -34.750 73.749  1.00 64.83  ? 327  HIS C CD2   1 
ATOM   6159  C  CE1   . HIS C 2  327  ? 2.024   -35.510 74.699  1.00 70.67  ? 327  HIS C CE1   1 
ATOM   6160  N  NE2   . HIS C 2  327  ? 0.714   -35.667 74.631  1.00 71.82  ? 327  HIS C NE2   1 
ATOM   6161  N  N     . LEU C 2  328  ? 3.560   -31.437 74.274  1.00 63.57  ? 328  LEU C N     1 
ATOM   6162  C  CA    . LEU C 2  328  ? 4.988   -31.215 74.472  1.00 66.34  ? 328  LEU C CA    1 
ATOM   6163  C  C     . LEU C 2  328  ? 5.836   -32.382 74.014  1.00 67.94  ? 328  LEU C C     1 
ATOM   6164  O  O     . LEU C 2  328  ? 7.054   -32.391 74.281  1.00 62.38  ? 328  LEU C O     1 
ATOM   6165  C  CB    . LEU C 2  328  ? 5.279   -30.893 75.938  1.00 58.22  ? 328  LEU C CB    1 
ATOM   6166  C  CG    . LEU C 2  328  ? 5.081   -29.418 76.294  1.00 59.76  ? 328  LEU C CG    1 
ATOM   6167  C  CD1   . LEU C 2  328  ? 5.676   -29.117 77.640  1.00 60.28  ? 328  LEU C CD1   1 
ATOM   6168  C  CD2   . LEU C 2  328  ? 5.696   -28.521 75.228  1.00 57.95  ? 328  LEU C CD2   1 
ATOM   6169  N  N     . GLY C 2  329  ? 5.201   -33.345 73.348  1.00 65.43  ? 329  GLY C N     1 
ATOM   6170  C  CA    . GLY C 2  329  ? 5.904   -34.415 72.672  1.00 68.74  ? 329  GLY C CA    1 
ATOM   6171  C  C     . GLY C 2  329  ? 6.065   -34.105 71.197  1.00 74.35  ? 329  GLY C C     1 
ATOM   6172  O  O     . GLY C 2  329  ? 6.792   -34.794 70.471  1.00 77.28  ? 329  GLY C O     1 
ATOM   6173  N  N     . ASN C 2  330  ? 5.382   -33.051 70.746  1.00 74.15  ? 330  ASN C N     1 
ATOM   6174  C  CA    . ASN C 2  330  ? 5.510   -32.554 69.381  1.00 68.54  ? 330  ASN C CA    1 
ATOM   6175  C  C     . ASN C 2  330  ? 5.993   -31.106 69.331  1.00 65.89  ? 330  ASN C C     1 
ATOM   6176  O  O     . ASN C 2  330  ? 6.005   -30.501 68.252  1.00 67.44  ? 330  ASN C O     1 
ATOM   6177  C  CB    . ASN C 2  330  ? 4.175   -32.717 68.644  1.00 68.53  ? 330  ASN C CB    1 
ATOM   6178  C  CG    . ASN C 2  330  ? 3.670   -34.155 68.665  1.00 75.34  ? 330  ASN C CG    1 
ATOM   6179  O  OD1   . ASN C 2  330  ? 4.459   -35.101 68.725  1.00 79.02  ? 330  ASN C OD1   1 
ATOM   6180  N  ND2   . ASN C 2  330  ? 2.356   -34.325 68.617  1.00 72.28  ? 330  ASN C ND2   1 
ATOM   6181  N  N     . ARG C 2  331  ? 6.375   -30.536 70.475  1.00 68.77  ? 331  ARG C N     1 
ATOM   6182  C  CA    . ARG C 2  331  ? 7.109   -29.279 70.566  1.00 64.99  ? 331  ARG C CA    1 
ATOM   6183  C  C     . ARG C 2  331  ? 8.424   -29.546 71.281  1.00 63.42  ? 331  ARG C C     1 
ATOM   6184  O  O     . ARG C 2  331  ? 8.452   -30.263 72.284  1.00 72.82  ? 331  ARG C O     1 
ATOM   6185  C  CB    . ARG C 2  331  ? 6.336   -28.200 71.342  1.00 59.69  ? 331  ARG C CB    1 
ATOM   6186  C  CG    . ARG C 2  331  ? 4.964   -27.835 70.791  1.00 63.59  ? 331  ARG C CG    1 
ATOM   6187  C  CD    . ARG C 2  331  ? 4.340   -26.690 71.605  1.00 68.35  ? 331  ARG C CD    1 
ATOM   6188  N  NE    . ARG C 2  331  ? 4.890   -25.388 71.236  1.00 66.16  ? 331  ARG C NE    1 
ATOM   6189  C  CZ    . ARG C 2  331  ? 4.739   -24.268 71.938  1.00 64.10  ? 331  ARG C CZ    1 
ATOM   6190  N  NH1   . ARG C 2  331  ? 4.063   -24.267 73.075  1.00 61.33  ? 331  ARG C NH1   1 
ATOM   6191  N  NH2   . ARG C 2  331  ? 5.280   -23.142 71.501  1.00 70.92  ? 331  ARG C NH2   1 
ATOM   6192  N  N     . ARG C 2  332  ? 9.510   -28.969 70.775  1.00 60.34  ? 332  ARG C N     1 
ATOM   6193  C  CA    . ARG C 2  332  ? 10.838  -29.215 71.322  1.00 60.49  ? 332  ARG C CA    1 
ATOM   6194  C  C     . ARG C 2  332  ? 11.573  -27.898 71.534  1.00 56.63  ? 332  ARG C C     1 
ATOM   6195  O  O     . ARG C 2  332  ? 11.176  -26.843 71.027  1.00 59.24  ? 332  ARG C O     1 
ATOM   6196  C  CB    . ARG C 2  332  ? 11.662  -30.146 70.413  1.00 69.83  ? 332  ARG C CB    1 
ATOM   6197  C  CG    . ARG C 2  332  ? 11.962  -29.587 69.012  1.00 68.10  ? 332  ARG C CG    1 
ATOM   6198  C  CD    . ARG C 2  332  ? 12.837  -30.530 68.194  1.00 65.25  ? 332  ARG C CD    1 
ATOM   6199  N  NE    . ARG C 2  332  ? 14.173  -30.652 68.769  1.00 67.77  ? 332  ARG C NE    1 
ATOM   6200  C  CZ    . ARG C 2  332  ? 15.219  -29.925 68.389  1.00 66.57  ? 332  ARG C CZ    1 
ATOM   6201  N  NH1   . ARG C 2  332  ? 15.089  -29.028 67.425  1.00 64.24  ? 332  ARG C NH1   1 
ATOM   6202  N  NH2   . ARG C 2  332  ? 16.397  -30.097 68.973  1.00 64.25  ? 332  ARG C NH2   1 
ATOM   6203  N  N     . ILE C 2  333  ? 12.677  -27.981 72.274  1.00 54.54  ? 333  ILE C N     1 
ATOM   6204  C  CA    . ILE C 2  333  ? 13.473  -26.823 72.662  1.00 59.18  ? 333  ILE C CA    1 
ATOM   6205  C  C     . ILE C 2  333  ? 14.788  -26.809 71.895  1.00 69.59  ? 333  ILE C C     1 
ATOM   6206  O  O     . ILE C 2  333  ? 15.515  -27.809 71.872  1.00 75.35  ? 333  ILE C O     1 
ATOM   6207  C  CB    . ILE C 2  333  ? 13.752  -26.815 74.170  1.00 62.19  ? 333  ILE C CB    1 
ATOM   6208  C  CG1   . ILE C 2  333  ? 12.438  -26.858 74.943  1.00 61.19  ? 333  ILE C CG1   1 
ATOM   6209  C  CG2   . ILE C 2  333  ? 14.562  -25.587 74.531  1.00 65.00  ? 333  ILE C CG2   1 
ATOM   6210  C  CD1   . ILE C 2  333  ? 11.489  -25.751 74.545  1.00 66.59  ? 333  ILE C CD1   1 
ATOM   6211  N  N     . ARG C 2  334  ? 15.097  -25.663 71.289  1.00 65.48  ? 334  ARG C N     1 
ATOM   6212  C  CA    . ARG C 2  334  ? 16.392  -25.379 70.687  1.00 59.92  ? 334  ARG C CA    1 
ATOM   6213  C  C     . ARG C 2  334  ? 17.202  -24.575 71.693  1.00 62.67  ? 334  ARG C C     1 
ATOM   6214  O  O     . ARG C 2  334  ? 16.934  -23.386 71.904  1.00 67.70  ? 334  ARG C O     1 
ATOM   6215  C  CB    . ARG C 2  334  ? 16.235  -24.589 69.390  1.00 66.42  ? 334  ARG C CB    1 
ATOM   6216  C  CG    . ARG C 2  334  ? 15.087  -25.014 68.497  1.00 67.48  ? 334  ARG C CG    1 
ATOM   6217  C  CD    . ARG C 2  334  ? 15.166  -24.296 67.161  1.00 63.73  ? 334  ARG C CD    1 
ATOM   6218  N  NE    . ARG C 2  334  ? 16.280  -24.803 66.368  1.00 72.23  ? 334  ARG C NE    1 
ATOM   6219  C  CZ    . ARG C 2  334  ? 16.833  -24.161 65.344  1.00 82.90  ? 334  ARG C CZ    1 
ATOM   6220  N  NH1   . ARG C 2  334  ? 16.383  -22.964 64.988  1.00 87.18  ? 334  ARG C NH1   1 
ATOM   6221  N  NH2   . ARG C 2  334  ? 17.843  -24.713 64.680  1.00 81.95  ? 334  ARG C NH2   1 
ATOM   6222  N  N     . THR C 2  335  ? 18.193  -25.217 72.304  1.00 61.15  ? 335  THR C N     1 
ATOM   6223  C  CA    . THR C 2  335  ? 19.007  -24.587 73.328  1.00 59.79  ? 335  THR C CA    1 
ATOM   6224  C  C     . THR C 2  335  ? 20.145  -23.799 72.683  1.00 61.62  ? 335  THR C C     1 
ATOM   6225  O  O     . THR C 2  335  ? 20.290  -23.765 71.461  1.00 65.81  ? 335  THR C O     1 
ATOM   6226  C  CB    . THR C 2  335  ? 19.532  -25.640 74.300  1.00 67.95  ? 335  THR C CB    1 
ATOM   6227  O  OG1   . THR C 2  335  ? 19.850  -26.840 73.579  1.00 73.33  ? 335  THR C OG1   1 
ATOM   6228  C  CG2   . THR C 2  335  ? 18.486  -25.958 75.350  1.00 68.82  ? 335  THR C CG2   1 
ATOM   6229  N  N     . VAL C 2  336  ? 20.973  -23.167 73.521  1.00 60.27  ? 336  VAL C N     1 
ATOM   6230  C  CA    . VAL C 2  336  ? 21.993  -22.244 73.026  1.00 52.47  ? 336  VAL C CA    1 
ATOM   6231  C  C     . VAL C 2  336  ? 22.951  -22.950 72.071  1.00 68.36  ? 336  VAL C C     1 
ATOM   6232  O  O     . VAL C 2  336  ? 23.321  -22.406 71.018  1.00 77.08  ? 336  VAL C O     1 
ATOM   6233  C  CB    . VAL C 2  336  ? 22.735  -21.590 74.208  1.00 54.14  ? 336  VAL C CB    1 
ATOM   6234  C  CG1   . VAL C 2  336  ? 23.098  -22.616 75.258  1.00 60.21  ? 336  VAL C CG1   1 
ATOM   6235  C  CG2   . VAL C 2  336  ? 23.973  -20.865 73.736  1.00 51.84  ? 336  VAL C CG2   1 
ATOM   6236  N  N     . GLY C 2  337  ? 23.354  -24.175 72.410  1.00 64.51  ? 337  GLY C N     1 
ATOM   6237  C  CA    . GLY C 2  337  ? 24.287  -24.897 71.560  1.00 60.36  ? 337  GLY C CA    1 
ATOM   6238  C  C     . GLY C 2  337  ? 23.750  -25.130 70.161  1.00 60.99  ? 337  GLY C C     1 
ATOM   6239  O  O     . GLY C 2  337  ? 24.474  -24.987 69.178  1.00 67.53  ? 337  GLY C O     1 
ATOM   6240  N  N     . GLU C 2  338  ? 22.461  -25.454 70.051  1.00 64.96  ? 338  GLU C N     1 
ATOM   6241  C  CA    . GLU C 2  338  ? 21.875  -25.744 68.746  1.00 63.56  ? 338  GLU C CA    1 
ATOM   6242  C  C     . GLU C 2  338  ? 21.744  -24.484 67.894  1.00 68.61  ? 338  GLU C C     1 
ATOM   6243  O  O     . GLU C 2  338  ? 22.059  -24.505 66.698  1.00 77.38  ? 338  GLU C O     1 
ATOM   6244  C  CB    . GLU C 2  338  ? 20.520  -26.423 68.933  1.00 55.84  ? 338  GLU C CB    1 
ATOM   6245  C  CG    . GLU C 2  338  ? 19.732  -26.612 67.662  1.00 66.08  ? 338  GLU C CG    1 
ATOM   6246  C  CD    . GLU C 2  338  ? 18.416  -27.331 67.900  1.00 69.41  ? 338  GLU C CD    1 
ATOM   6247  O  OE1   . GLU C 2  338  ? 18.262  -27.958 68.972  1.00 72.33  ? 338  GLU C OE1   1 
ATOM   6248  O  OE2   . GLU C 2  338  ? 17.533  -27.264 67.017  1.00 71.86  ? 338  GLU C OE2   1 
ATOM   6249  N  N     . LEU C 2  339  ? 21.303  -23.374 68.492  1.00 65.36  ? 339  LEU C N     1 
ATOM   6250  C  CA    . LEU C 2  339  ? 21.153  -22.125 67.748  1.00 63.94  ? 339  LEU C CA    1 
ATOM   6251  C  C     . LEU C 2  339  ? 22.506  -21.602 67.280  1.00 69.87  ? 339  LEU C C     1 
ATOM   6252  O  O     . LEU C 2  339  ? 22.668  -21.185 66.118  1.00 76.83  ? 339  LEU C O     1 
ATOM   6253  C  CB    . LEU C 2  339  ? 20.443  -21.090 68.622  1.00 68.16  ? 339  LEU C CB    1 
ATOM   6254  C  CG    . LEU C 2  339  ? 19.129  -21.568 69.262  1.00 75.45  ? 339  LEU C CG    1 
ATOM   6255  C  CD1   . LEU C 2  339  ? 18.688  -20.698 70.449  1.00 63.44  ? 339  LEU C CD1   1 
ATOM   6256  C  CD2   . LEU C 2  339  ? 18.020  -21.654 68.217  1.00 75.95  ? 339  LEU C CD2   1 
ATOM   6257  N  N     . MET C 2  340  ? 23.501  -21.629 68.173  1.00 65.05  ? 340  MET C N     1 
ATOM   6258  C  CA    . MET C 2  340  ? 24.842  -21.222 67.771  1.00 73.45  ? 340  MET C CA    1 
ATOM   6259  C  C     . MET C 2  340  ? 25.406  -22.147 66.690  1.00 70.90  ? 340  MET C C     1 
ATOM   6260  O  O     . MET C 2  340  ? 26.035  -21.675 65.738  1.00 68.90  ? 340  MET C O     1 
ATOM   6261  C  CB    . MET C 2  340  ? 25.767  -21.169 68.987  1.00 72.63  ? 340  MET C CB    1 
ATOM   6262  C  CG    . MET C 2  340  ? 27.168  -20.644 68.676  1.00 70.24  ? 340  MET C CG    1 
ATOM   6263  S  SD    . MET C 2  340  ? 28.274  -21.860 67.902  1.00 67.19  ? 340  MET C SD    1 
ATOM   6264  C  CE    . MET C 2  340  ? 28.620  -22.941 69.295  1.00 67.01  ? 340  MET C CE    1 
ATOM   6265  N  N     . THR C 2  341  ? 25.213  -23.463 66.822  1.00 70.83  ? 341  THR C N     1 
ATOM   6266  C  CA    . THR C 2  341  ? 25.666  -24.373 65.777  1.00 71.02  ? 341  THR C CA    1 
ATOM   6267  C  C     . THR C 2  341  ? 25.006  -24.053 64.444  1.00 75.72  ? 341  THR C C     1 
ATOM   6268  O  O     . THR C 2  341  ? 25.640  -24.167 63.390  1.00 74.66  ? 341  THR C O     1 
ATOM   6269  C  CB    . THR C 2  341  ? 25.387  -25.819 66.180  1.00 64.35  ? 341  THR C CB    1 
ATOM   6270  O  OG1   . THR C 2  341  ? 26.140  -26.132 67.355  1.00 62.74  ? 341  THR C OG1   1 
ATOM   6271  C  CG2   . THR C 2  341  ? 25.788  -26.779 65.064  1.00 67.77  ? 341  THR C CG2   1 
ATOM   6272  N  N     . ASP C 2  342  ? 23.736  -23.645 64.466  1.00 71.48  ? 342  ASP C N     1 
ATOM   6273  C  CA    . ASP C 2  342  ? 23.063  -23.292 63.219  1.00 74.06  ? 342  ASP C CA    1 
ATOM   6274  C  C     . ASP C 2  342  ? 23.727  -22.091 62.557  1.00 76.10  ? 342  ASP C C     1 
ATOM   6275  O  O     . ASP C 2  342  ? 23.990  -22.097 61.344  1.00 80.85  ? 342  ASP C O     1 
ATOM   6276  C  CB    . ASP C 2  342  ? 21.585  -23.016 63.474  1.00 75.09  ? 342  ASP C CB    1 
ATOM   6277  C  CG    . ASP C 2  342  ? 20.691  -23.929 62.676  1.00 91.26  ? 342  ASP C CG    1 
ATOM   6278  O  OD1   . ASP C 2  342  ? 20.729  -25.151 62.931  1.00 99.77  ? 342  ASP C OD1   1 
ATOM   6279  O  OD2   . ASP C 2  342  ? 19.962  -23.435 61.788  1.00 94.00  ? 342  ASP C OD2   1 
ATOM   6280  N  N     . GLN C 2  343  ? 24.001  -21.042 63.335  1.00 71.07  ? 343  GLN C N     1 
ATOM   6281  C  CA    . GLN C 2  343  ? 24.670  -19.892 62.722  1.00 73.10  ? 343  GLN C CA    1 
ATOM   6282  C  C     . GLN C 2  343  ? 26.091  -20.234 62.287  1.00 77.52  ? 343  GLN C C     1 
ATOM   6283  O  O     . GLN C 2  343  ? 26.587  -19.689 61.289  1.00 83.21  ? 343  GLN C O     1 
ATOM   6284  C  CB    . GLN C 2  343  ? 24.669  -18.699 63.667  1.00 75.52  ? 343  GLN C CB    1 
ATOM   6285  C  CG    . GLN C 2  343  ? 23.284  -18.134 63.861  1.00 79.84  ? 343  GLN C CG    1 
ATOM   6286  C  CD    . GLN C 2  343  ? 22.541  -18.004 62.554  1.00 78.69  ? 343  GLN C CD    1 
ATOM   6287  O  OE1   . GLN C 2  343  ? 21.566  -18.715 62.310  1.00 77.90  ? 343  GLN C OE1   1 
ATOM   6288  N  NE2   . GLN C 2  343  ? 23.003  -17.095 61.698  1.00 76.81  ? 343  GLN C NE2   1 
ATOM   6289  N  N     . PHE C 2  344  ? 26.749  -21.138 63.012  1.00 75.38  ? 344  PHE C N     1 
ATOM   6290  C  CA    . PHE C 2  344  ? 28.044  -21.660 62.588  1.00 78.06  ? 344  PHE C CA    1 
ATOM   6291  C  C     . PHE C 2  344  ? 27.932  -22.340 61.224  1.00 77.15  ? 344  PHE C C     1 
ATOM   6292  O  O     . PHE C 2  344  ? 28.773  -22.136 60.341  1.00 76.19  ? 344  PHE C O     1 
ATOM   6293  C  CB    . PHE C 2  344  ? 28.566  -22.635 63.651  1.00 75.10  ? 344  PHE C CB    1 
ATOM   6294  C  CG    . PHE C 2  344  ? 30.039  -22.913 63.560  1.00 78.20  ? 344  PHE C CG    1 
ATOM   6295  C  CD1   . PHE C 2  344  ? 30.527  -23.872 62.686  1.00 77.17  ? 344  PHE C CD1   1 
ATOM   6296  C  CD2   . PHE C 2  344  ? 30.935  -22.223 64.358  1.00 74.99  ? 344  PHE C CD2   1 
ATOM   6297  C  CE1   . PHE C 2  344  ? 31.883  -24.131 62.602  1.00 77.48  ? 344  PHE C CE1   1 
ATOM   6298  C  CE2   . PHE C 2  344  ? 32.289  -22.476 64.280  1.00 71.27  ? 344  PHE C CE2   1 
ATOM   6299  C  CZ    . PHE C 2  344  ? 32.766  -23.434 63.403  1.00 76.16  ? 344  PHE C CZ    1 
ATOM   6300  N  N     . ARG C 2  345  ? 26.889  -23.154 61.044  1.00 75.16  ? 345  ARG C N     1 
ATOM   6301  C  CA    . ARG C 2  345  ? 26.654  -23.841 59.778  1.00 74.02  ? 345  ARG C CA    1 
ATOM   6302  C  C     . ARG C 2  345  ? 26.455  -22.849 58.639  1.00 73.25  ? 345  ARG C C     1 
ATOM   6303  O  O     . ARG C 2  345  ? 26.961  -23.051 57.528  1.00 79.04  ? 345  ARG C O     1 
ATOM   6304  C  CB    . ARG C 2  345  ? 25.435  -24.755 59.916  1.00 74.06  ? 345  ARG C CB    1 
ATOM   6305  C  CG    . ARG C 2  345  ? 25.300  -25.805 58.835  1.00 88.21  ? 345  ARG C CG    1 
ATOM   6306  C  CD    . ARG C 2  345  ? 23.840  -26.060 58.483  1.00 96.80  ? 345  ARG C CD    1 
ATOM   6307  N  NE    . ARG C 2  345  ? 23.344  -25.096 57.500  1.00 100.64 ? 345  ARG C NE    1 
ATOM   6308  C  CZ    . ARG C 2  345  ? 22.266  -24.333 57.664  1.00 100.19 ? 345  ARG C CZ    1 
ATOM   6309  N  NH1   . ARG C 2  345  ? 21.545  -24.427 58.777  1.00 97.07  ? 345  ARG C NH1   1 
ATOM   6310  N  NH2   . ARG C 2  345  ? 21.901  -23.486 56.705  1.00 93.09  ? 345  ARG C NH2   1 
ATOM   6311  N  N     . VAL C 2  346  ? 25.728  -21.764 58.902  1.00 77.11  ? 346  VAL C N     1 
ATOM   6312  C  CA    . VAL C 2  346  ? 25.486  -20.765 57.860  1.00 76.48  ? 346  VAL C CA    1 
ATOM   6313  C  C     . VAL C 2  346  ? 26.788  -20.057 57.472  1.00 78.90  ? 346  VAL C C     1 
ATOM   6314  O  O     . VAL C 2  346  ? 27.108  -19.905 56.279  1.00 77.74  ? 346  VAL C O     1 
ATOM   6315  C  CB    . VAL C 2  346  ? 24.400  -19.779 58.325  1.00 71.29  ? 346  VAL C CB    1 
ATOM   6316  C  CG1   . VAL C 2  346  ? 24.528  -18.452 57.611  1.00 68.23  ? 346  VAL C CG1   1 
ATOM   6317  C  CG2   . VAL C 2  346  ? 23.032  -20.380 58.086  1.00 69.05  ? 346  VAL C CG2   1 
ATOM   6318  N  N     . GLY C 2  347  ? 27.557  -19.608 58.471  1.00 77.47  ? 347  GLY C N     1 
ATOM   6319  C  CA    . GLY C 2  347  ? 28.842  -18.983 58.177  1.00 76.81  ? 347  GLY C CA    1 
ATOM   6320  C  C     . GLY C 2  347  ? 29.790  -19.907 57.429  1.00 75.63  ? 347  GLY C C     1 
ATOM   6321  O  O     . GLY C 2  347  ? 30.533  -19.471 56.543  1.00 78.94  ? 347  GLY C O     1 
ATOM   6322  N  N     . LEU C 2  348  ? 29.770  -21.198 57.772  1.00 73.76  ? 348  LEU C N     1 
ATOM   6323  C  CA    . LEU C 2  348  ? 30.581  -22.181 57.062  1.00 76.48  ? 348  LEU C CA    1 
ATOM   6324  C  C     . LEU C 2  348  ? 30.132  -22.331 55.615  1.00 83.11  ? 348  LEU C C     1 
ATOM   6325  O  O     . LEU C 2  348  ? 30.966  -22.480 54.713  1.00 75.86  ? 348  LEU C O     1 
ATOM   6326  C  CB    . LEU C 2  348  ? 30.510  -23.529 57.778  1.00 70.29  ? 348  LEU C CB    1 
ATOM   6327  C  CG    . LEU C 2  348  ? 31.815  -24.113 58.312  1.00 71.06  ? 348  LEU C CG    1 
ATOM   6328  C  CD1   . LEU C 2  348  ? 32.547  -23.082 59.156  1.00 76.08  ? 348  LEU C CD1   1 
ATOM   6329  C  CD2   . LEU C 2  348  ? 31.546  -25.372 59.119  1.00 70.59  ? 348  LEU C CD2   1 
ATOM   6330  N  N     . ALA C 2  349  ? 28.817  -22.326 55.377  1.00 83.74  ? 349  ALA C N     1 
ATOM   6331  C  CA    . ALA C 2  349  ? 28.327  -22.385 54.003  1.00 80.04  ? 349  ALA C CA    1 
ATOM   6332  C  C     . ALA C 2  349  ? 28.862  -21.217 53.183  1.00 76.33  ? 349  ALA C C     1 
ATOM   6333  O  O     . ALA C 2  349  ? 29.277  -21.391 52.028  1.00 84.29  ? 349  ALA C O     1 
ATOM   6334  C  CB    . ALA C 2  349  ? 26.799  -22.401 53.985  1.00 66.20  ? 349  ALA C CB    1 
ATOM   6335  N  N     . ARG C 2  350  ? 28.866  -20.015 53.769  1.00 77.06  ? 350  ARG C N     1 
ATOM   6336  C  CA    . ARG C 2  350  ? 29.425  -18.867 53.054  1.00 77.60  ? 350  ARG C CA    1 
ATOM   6337  C  C     . ARG C 2  350  ? 30.920  -19.042 52.806  1.00 85.44  ? 350  ARG C C     1 
ATOM   6338  O  O     . ARG C 2  350  ? 31.417  -18.742 51.708  1.00 85.15  ? 350  ARG C O     1 
ATOM   6339  C  CB    . ARG C 2  350  ? 29.158  -17.576 53.818  1.00 68.68  ? 350  ARG C CB    1 
ATOM   6340  C  CG    . ARG C 2  350  ? 27.715  -17.131 53.755  1.00 77.24  ? 350  ARG C CG    1 
ATOM   6341  C  CD    . ARG C 2  350  ? 27.420  -16.120 54.844  1.00 87.78  ? 350  ARG C CD    1 
ATOM   6342  N  NE    . ARG C 2  350  ? 25.997  -16.059 55.164  1.00 86.82  ? 350  ARG C NE    1 
ATOM   6343  C  CZ    . ARG C 2  350  ? 25.490  -15.397 56.200  1.00 78.78  ? 350  ARG C CZ    1 
ATOM   6344  N  NH1   . ARG C 2  350  ? 26.292  -14.732 57.028  1.00 76.80  ? 350  ARG C NH1   1 
ATOM   6345  N  NH2   . ARG C 2  350  ? 24.181  -15.405 56.405  1.00 66.65  ? 350  ARG C NH2   1 
ATOM   6346  N  N     . LEU C 2  351  ? 31.655  -19.515 53.820  1.00 81.23  ? 351  LEU C N     1 
ATOM   6347  C  CA    . LEU C 2  351  ? 33.085  -19.765 53.652  1.00 82.00  ? 351  LEU C CA    1 
ATOM   6348  C  C     . LEU C 2  351  ? 33.348  -20.748 52.513  1.00 85.88  ? 351  LEU C C     1 
ATOM   6349  O  O     . LEU C 2  351  ? 34.307  -20.589 51.751  1.00 85.09  ? 351  LEU C O     1 
ATOM   6350  C  CB    . LEU C 2  351  ? 33.683  -20.277 54.965  1.00 82.03  ? 351  LEU C CB    1 
ATOM   6351  C  CG    . LEU C 2  351  ? 35.191  -20.545 55.031  1.00 79.08  ? 351  LEU C CG    1 
ATOM   6352  C  CD1   . LEU C 2  351  ? 35.739  -20.147 56.384  1.00 77.85  ? 351  LEU C CD1   1 
ATOM   6353  C  CD2   . LEU C 2  351  ? 35.495  -22.004 54.765  1.00 75.84  ? 351  LEU C CD2   1 
ATOM   6354  N  N     . ALA C 2  352  ? 32.483  -21.754 52.363  1.00 87.71  ? 352  ALA C N     1 
ATOM   6355  C  CA    . ALA C 2  352  ? 32.668  -22.756 51.314  1.00 87.60  ? 352  ALA C CA    1 
ATOM   6356  C  C     . ALA C 2  352  ? 32.319  -22.202 49.934  1.00 92.85  ? 352  ALA C C     1 
ATOM   6357  O  O     . ALA C 2  352  ? 32.963  -22.556 48.936  1.00 96.02  ? 352  ALA C O     1 
ATOM   6358  C  CB    . ALA C 2  352  ? 31.828  -23.995 51.622  1.00 87.96  ? 352  ALA C CB    1 
ATOM   6359  N  N     . ARG C 2  353  ? 31.288  -21.355 49.847  1.00 94.96  ? 353  ARG C N     1 
ATOM   6360  C  CA    . ARG C 2  353  ? 31.010  -20.685 48.577  1.00 98.42  ? 353  ARG C CA    1 
ATOM   6361  C  C     . ARG C 2  353  ? 32.209  -19.849 48.138  1.00 93.55  ? 353  ARG C C     1 
ATOM   6362  O  O     . ARG C 2  353  ? 32.617  -19.892 46.969  1.00 104.46 ? 353  ARG C O     1 
ATOM   6363  C  CB    . ARG C 2  353  ? 29.753  -19.817 48.694  1.00 99.08  ? 353  ARG C CB    1 
ATOM   6364  C  CG    . ARG C 2  353  ? 28.990  -19.614 47.382  1.00 100.73 ? 353  ARG C CG    1 
ATOM   6365  C  CD    . ARG C 2  353  ? 28.315  -18.243 47.333  1.00 110.05 ? 353  ARG C CD    1 
ATOM   6366  N  NE    . ARG C 2  353  ? 29.253  -17.177 46.979  1.00 123.41 ? 353  ARG C NE    1 
ATOM   6367  C  CZ    . ARG C 2  353  ? 29.137  -16.393 45.907  1.00 128.36 ? 353  ARG C CZ    1 
ATOM   6368  N  NH1   . ARG C 2  353  ? 30.047  -15.454 45.665  1.00 116.90 ? 353  ARG C NH1   1 
ATOM   6369  N  NH2   . ARG C 2  353  ? 28.105  -16.535 45.084  1.00 125.71 ? 353  ARG C NH2   1 
ATOM   6370  N  N     . GLY C 2  354  ? 32.802  -19.103 49.075  1.00 94.13  ? 354  GLY C N     1 
ATOM   6371  C  CA    . GLY C 2  354  ? 34.031  -18.384 48.772  1.00 92.16  ? 354  GLY C CA    1 
ATOM   6372  C  C     . GLY C 2  354  ? 35.193  -19.298 48.422  1.00 103.90 ? 354  GLY C C     1 
ATOM   6373  O  O     . GLY C 2  354  ? 36.033  -18.949 47.587  1.00 100.52 ? 354  GLY C O     1 
ATOM   6374  N  N     . VAL C 2  355  ? 35.251  -20.482 49.039  1.00 104.93 ? 355  VAL C N     1 
ATOM   6375  C  CA    . VAL C 2  355  ? 36.324  -21.432 48.743  1.00 99.07  ? 355  VAL C CA    1 
ATOM   6376  C  C     . VAL C 2  355  ? 36.231  -21.912 47.299  1.00 102.98 ? 355  VAL C C     1 
ATOM   6377  O  O     . VAL C 2  355  ? 37.236  -21.976 46.584  1.00 108.11 ? 355  VAL C O     1 
ATOM   6378  C  CB    . VAL C 2  355  ? 36.295  -22.610 49.734  1.00 88.65  ? 355  VAL C CB    1 
ATOM   6379  C  CG1   . VAL C 2  355  ? 37.001  -23.818 49.142  1.00 92.52  ? 355  VAL C CG1   1 
ATOM   6380  C  CG2   . VAL C 2  355  ? 36.958  -22.208 51.036  1.00 89.23  ? 355  VAL C CG2   1 
ATOM   6381  N  N     . ARG C 2  356  ? 35.024  -22.265 46.848  1.00 103.81 ? 356  ARG C N     1 
ATOM   6382  C  CA    . ARG C 2  356  ? 34.860  -22.697 45.458  1.00 104.63 ? 356  ARG C CA    1 
ATOM   6383  C  C     . ARG C 2  356  ? 35.104  -21.543 44.483  1.00 106.17 ? 356  ARG C C     1 
ATOM   6384  O  O     . ARG C 2  356  ? 35.727  -21.731 43.423  1.00 99.81  ? 356  ARG C O     1 
ATOM   6385  C  CB    . ARG C 2  356  ? 33.470  -23.303 45.258  1.00 98.34  ? 356  ARG C CB    1 
ATOM   6386  C  CG    . ARG C 2  356  ? 33.316  -24.695 45.857  1.00 97.54  ? 356  ARG C CG    1 
ATOM   6387  C  CD    . ARG C 2  356  ? 31.886  -25.212 45.760  1.00 103.53 ? 356  ARG C CD    1 
ATOM   6388  N  NE    . ARG C 2  356  ? 30.981  -24.516 46.675  1.00 113.83 ? 356  ARG C NE    1 
ATOM   6389  C  CZ    . ARG C 2  356  ? 30.566  -25.002 47.843  1.00 107.79 ? 356  ARG C CZ    1 
ATOM   6390  N  NH1   . ARG C 2  356  ? 29.744  -24.292 48.603  1.00 99.53  ? 356  ARG C NH1   1 
ATOM   6391  N  NH2   . ARG C 2  356  ? 30.966  -26.200 48.252  1.00 106.79 ? 356  ARG C NH2   1 
ATOM   6392  N  N     . GLU C 2  357  ? 34.636  -20.339 44.836  1.00 104.19 ? 357  GLU C N     1 
ATOM   6393  C  CA    . GLU C 2  357  ? 34.900  -19.160 44.016  1.00 109.05 ? 357  GLU C CA    1 
ATOM   6394  C  C     . GLU C 2  357  ? 36.395  -18.889 43.880  1.00 110.66 ? 357  GLU C C     1 
ATOM   6395  O  O     . GLU C 2  357  ? 36.845  -18.410 42.833  1.00 118.44 ? 357  GLU C O     1 
ATOM   6396  C  CB    . GLU C 2  357  ? 34.186  -17.949 44.620  1.00 113.51 ? 357  GLU C CB    1 
ATOM   6397  C  CG    . GLU C 2  357  ? 34.234  -16.684 43.780  1.00 118.61 ? 357  GLU C CG    1 
ATOM   6398  C  CD    . GLU C 2  357  ? 33.233  -15.645 44.254  1.00 119.71 ? 357  GLU C CD    1 
ATOM   6399  O  OE1   . GLU C 2  357  ? 33.175  -15.382 45.476  1.00 116.31 ? 357  GLU C OE1   1 
ATOM   6400  O  OE2   . GLU C 2  357  ? 32.492  -15.108 43.405  1.00 115.84 ? 357  GLU C OE2   1 
ATOM   6401  N  N     . ARG C 2  358  ? 37.173  -19.183 44.926  1.00 112.73 ? 358  ARG C N     1 
ATOM   6402  C  CA    . ARG C 2  358  ? 38.626  -19.061 44.853  1.00 112.09 ? 358  ARG C CA    1 
ATOM   6403  C  C     . ARG C 2  358  ? 39.260  -20.224 44.093  1.00 111.38 ? 358  ARG C C     1 
ATOM   6404  O  O     . ARG C 2  358  ? 40.301  -20.046 43.450  1.00 111.16 ? 358  ARG C O     1 
ATOM   6405  C  CB    . ARG C 2  358  ? 39.216  -18.976 46.265  1.00 103.85 ? 358  ARG C CB    1 
ATOM   6406  C  CG    . ARG C 2  358  ? 40.105  -17.766 46.521  1.00 96.86  ? 358  ARG C CG    1 
ATOM   6407  C  CD    . ARG C 2  358  ? 39.342  -16.652 47.215  1.00 99.38  ? 358  ARG C CD    1 
ATOM   6408  N  NE    . ARG C 2  358  ? 38.591  -17.145 48.367  1.00 103.80 ? 358  ARG C NE    1 
ATOM   6409  C  CZ    . ARG C 2  358  ? 37.809  -16.390 49.134  1.00 103.38 ? 358  ARG C CZ    1 
ATOM   6410  N  NH1   . ARG C 2  358  ? 37.678  -15.094 48.882  1.00 101.92 ? 358  ARG C NH1   1 
ATOM   6411  N  NH2   . ARG C 2  358  ? 37.157  -16.930 50.157  1.00 103.29 ? 358  ARG C NH2   1 
ATOM   6412  N  N     . MET C 2  359  ? 38.656  -21.413 44.165  1.00 108.64 ? 359  MET C N     1 
ATOM   6413  C  CA    . MET C 2  359  ? 39.187  -22.562 43.441  1.00 110.47 ? 359  MET C CA    1 
ATOM   6414  C  C     . MET C 2  359  ? 39.046  -22.390 41.939  1.00 120.30 ? 359  MET C C     1 
ATOM   6415  O  O     . MET C 2  359  ? 39.844  -22.946 41.176  1.00 125.00 ? 359  MET C O     1 
ATOM   6416  C  CB    . MET C 2  359  ? 38.489  -23.851 43.877  1.00 109.87 ? 359  MET C CB    1 
ATOM   6417  C  CG    . MET C 2  359  ? 38.923  -24.376 45.239  1.00 115.40 ? 359  MET C CG    1 
ATOM   6418  S  SD    . MET C 2  359  ? 38.454  -26.098 45.552  1.00 119.45 ? 359  MET C SD    1 
ATOM   6419  C  CE    . MET C 2  359  ? 36.671  -25.997 45.463  1.00 114.07 ? 359  MET C CE    1 
ATOM   6420  N  N     . LEU C 2  360  ? 38.045  -21.641 41.488  1.00 120.47 ? 360  LEU C N     1 
ATOM   6421  C  CA    . LEU C 2  360  ? 37.954  -21.422 40.048  1.00 117.19 ? 360  LEU C CA    1 
ATOM   6422  C  C     . LEU C 2  360  ? 38.957  -20.376 39.566  1.00 123.85 ? 360  LEU C C     1 
ATOM   6423  O  O     . LEU C 2  360  ? 39.623  -20.574 38.545  1.00 119.85 ? 360  LEU C O     1 
ATOM   6424  C  CB    . LEU C 2  360  ? 36.526  -21.052 39.660  1.00 111.58 ? 360  LEU C CB    1 
ATOM   6425  C  CG    . LEU C 2  360  ? 35.736  -22.329 39.380  1.00 111.69 ? 360  LEU C CG    1 
ATOM   6426  C  CD1   . LEU C 2  360  ? 34.451  -22.363 40.178  1.00 122.00 ? 360  LEU C CD1   1 
ATOM   6427  C  CD2   . LEU C 2  360  ? 35.463  -22.472 37.897  1.00 116.38 ? 360  LEU C CD2   1 
ATOM   6428  N  N     . MET C 2  361  ? 39.094  -19.267 40.290  1.00 126.66 ? 361  MET C N     1 
ATOM   6429  C  CA    . MET C 2  361  ? 40.084  -18.256 39.943  1.00 132.36 ? 361  MET C CA    1 
ATOM   6430  C  C     . MET C 2  361  ? 41.495  -18.751 40.279  1.00 138.31 ? 361  MET C C     1 
ATOM   6431  O  O     . MET C 2  361  ? 41.709  -19.899 40.681  1.00 137.90 ? 361  MET C O     1 
ATOM   6432  C  CB    . MET C 2  361  ? 39.789  -16.946 40.675  1.00 128.69 ? 361  MET C CB    1 
ATOM   6433  C  CG    . MET C 2  361  ? 38.525  -16.219 40.238  1.00 131.45 ? 361  MET C CG    1 
ATOM   6434  S  SD    . MET C 2  361  ? 38.679  -15.369 38.652  1.00 142.44 ? 361  MET C SD    1 
ATOM   6435  C  CE    . MET C 2  361  ? 37.257  -14.277 38.722  1.00 118.47 ? 361  MET C CE    1 
ATOM   6436  N  N     . GLY C 2  362  ? 42.475  -17.865 40.087  1.00 140.99 ? 362  GLY C N     1 
ATOM   6437  C  CA    . GLY C 2  362  ? 43.813  -18.040 40.628  1.00 139.30 ? 362  GLY C CA    1 
ATOM   6438  C  C     . GLY C 2  362  ? 44.651  -19.170 40.064  1.00 139.72 ? 362  GLY C C     1 
ATOM   6439  O  O     . GLY C 2  362  ? 44.161  -19.996 39.288  1.00 140.35 ? 362  GLY C O     1 
ATOM   6440  N  N     . SER C 2  363  ? 45.924  -19.211 40.459  1.00 142.04 ? 363  SER C N     1 
ATOM   6441  C  CA    . SER C 2  363  ? 46.827  -20.260 40.002  1.00 143.16 ? 363  SER C CA    1 
ATOM   6442  C  C     . SER C 2  363  ? 46.302  -21.628 40.420  1.00 143.88 ? 363  SER C C     1 
ATOM   6443  O  O     . SER C 2  363  ? 46.002  -21.857 41.594  1.00 140.48 ? 363  SER C O     1 
ATOM   6444  C  CB    . SER C 2  363  ? 48.229  -20.037 40.575  1.00 134.79 ? 363  SER C CB    1 
ATOM   6445  O  OG    . SER C 2  363  ? 48.728  -18.752 40.248  1.00 126.35 ? 363  SER C OG    1 
ATOM   6446  N  N     . GLU C 2  364  ? 46.183  -22.537 39.449  1.00 148.63 ? 364  GLU C N     1 
ATOM   6447  C  CA    . GLU C 2  364  ? 45.725  -23.892 39.737  1.00 150.01 ? 364  GLU C CA    1 
ATOM   6448  C  C     . GLU C 2  364  ? 46.808  -24.765 40.355  1.00 153.69 ? 364  GLU C C     1 
ATOM   6449  O  O     . GLU C 2  364  ? 46.483  -25.750 41.031  1.00 146.84 ? 364  GLU C O     1 
ATOM   6450  C  CB    . GLU C 2  364  ? 45.209  -24.555 38.459  1.00 148.98 ? 364  GLU C CB    1 
ATOM   6451  C  CG    . GLU C 2  364  ? 43.830  -24.086 38.020  1.00 152.70 ? 364  GLU C CG    1 
ATOM   6452  C  CD    . GLU C 2  364  ? 42.755  -24.423 39.034  1.00 148.25 ? 364  GLU C CD    1 
ATOM   6453  O  OE1   . GLU C 2  364  ? 41.852  -23.584 39.244  1.00 137.87 ? 364  GLU C OE1   1 
ATOM   6454  O  OE2   . GLU C 2  364  ? 42.820  -25.524 39.627  1.00 142.46 ? 364  GLU C OE2   1 
ATOM   6455  N  N     . ASP C 2  365  ? 48.081  -24.422 40.143  1.00 154.90 ? 365  ASP C N     1 
ATOM   6456  C  CA    . ASP C 2  365  ? 49.190  -25.226 40.648  1.00 152.08 ? 365  ASP C CA    1 
ATOM   6457  C  C     . ASP C 2  365  ? 49.510  -24.891 42.103  1.00 144.85 ? 365  ASP C C     1 
ATOM   6458  O  O     . ASP C 2  365  ? 49.697  -25.794 42.927  1.00 140.41 ? 365  ASP C O     1 
ATOM   6459  C  CB    . ASP C 2  365  ? 50.423  -25.020 39.757  1.00 151.85 ? 365  ASP C CB    1 
ATOM   6460  C  CG    . ASP C 2  365  ? 51.640  -25.800 40.234  1.00 148.43 ? 365  ASP C CG    1 
ATOM   6461  O  OD1   . ASP C 2  365  ? 51.496  -26.999 40.563  1.00 146.99 ? 365  ASP C OD1   1 
ATOM   6462  O  OD2   . ASP C 2  365  ? 52.750  -25.221 40.258  1.00 142.16 ? 365  ASP C OD2   1 
ATOM   6463  N  N     . SER C 2  366  ? 49.564  -23.598 42.436  1.00 140.70 ? 366  SER C N     1 
ATOM   6464  C  CA    . SER C 2  366  ? 49.975  -23.129 43.759  1.00 137.48 ? 366  SER C CA    1 
ATOM   6465  C  C     . SER C 2  366  ? 48.753  -22.624 44.525  1.00 132.44 ? 366  SER C C     1 
ATOM   6466  O  O     . SER C 2  366  ? 48.339  -21.472 44.361  1.00 127.71 ? 366  SER C O     1 
ATOM   6467  C  CB    . SER C 2  366  ? 51.039  -22.038 43.640  1.00 134.85 ? 366  SER C CB    1 
ATOM   6468  O  OG    . SER C 2  366  ? 50.585  -20.942 42.862  1.00 129.06 ? 366  SER C OG    1 
ATOM   6469  N  N     . LEU C 2  367  ? 48.191  -23.488 45.371  1.00 125.26 ? 367  LEU C N     1 
ATOM   6470  C  CA    . LEU C 2  367  ? 47.116  -23.108 46.281  1.00 118.77 ? 367  LEU C CA    1 
ATOM   6471  C  C     . LEU C 2  367  ? 47.295  -23.864 47.588  1.00 116.17 ? 367  LEU C C     1 
ATOM   6472  O  O     . LEU C 2  367  ? 47.463  -25.087 47.580  1.00 114.99 ? 367  LEU C O     1 
ATOM   6473  C  CB    . LEU C 2  367  ? 45.733  -23.401 45.684  1.00 113.41 ? 367  LEU C CB    1 
ATOM   6474  C  CG    . LEU C 2  367  ? 45.201  -22.464 44.597  1.00 116.48 ? 367  LEU C CG    1 
ATOM   6475  C  CD1   . LEU C 2  367  ? 43.812  -22.894 44.157  1.00 110.08 ? 367  LEU C CD1   1 
ATOM   6476  C  CD2   . LEU C 2  367  ? 45.194  -21.007 45.050  1.00 114.77 ? 367  LEU C CD2   1 
ATOM   6477  N  N     . THR C 2  368  ? 47.281  -23.134 48.695  1.00 110.26 ? 368  THR C N     1 
ATOM   6478  C  CA    . THR C 2  368  ? 47.336  -23.690 50.039  1.00 106.13 ? 368  THR C CA    1 
ATOM   6479  C  C     . THR C 2  368  ? 45.940  -23.723 50.639  1.00 101.43 ? 368  THR C C     1 
ATOM   6480  O  O     . THR C 2  368  ? 44.982  -23.218 50.046  1.00 101.00 ? 368  THR C O     1 
ATOM   6481  C  CB    . THR C 2  368  ? 48.279  -22.861 50.922  1.00 104.09 ? 368  THR C CB    1 
ATOM   6482  O  OG1   . THR C 2  368  ? 48.060  -21.460 50.704  1.00 98.11  ? 368  THR C OG1   1 
ATOM   6483  C  CG2   . THR C 2  368  ? 49.735  -23.200 50.634  1.00 97.33  ? 368  THR C CG2   1 
ATOM   6484  N  N     . PRO C 2  369  ? 45.770  -24.340 51.813  1.00 100.17 ? 369  PRO C N     1 
ATOM   6485  C  CA    . PRO C 2  369  ? 44.533  -24.083 52.562  1.00 91.64  ? 369  PRO C CA    1 
ATOM   6486  C  C     . PRO C 2  369  ? 44.375  -22.621 52.930  1.00 90.19  ? 369  PRO C C     1 
ATOM   6487  O  O     . PRO C 2  369  ? 43.255  -22.099 52.911  1.00 90.95  ? 369  PRO C O     1 
ATOM   6488  C  CB    . PRO C 2  369  ? 44.684  -24.978 53.797  1.00 88.29  ? 369  PRO C CB    1 
ATOM   6489  C  CG    . PRO C 2  369  ? 45.548  -26.091 53.338  1.00 94.30  ? 369  PRO C CG    1 
ATOM   6490  C  CD    . PRO C 2  369  ? 46.528  -25.467 52.385  1.00 102.16 ? 369  PRO C CD    1 
ATOM   6491  N  N     . ALA C 2  370  ? 45.480  -21.933 53.232  1.00 90.32  ? 370  ALA C N     1 
ATOM   6492  C  CA    . ALA C 2  370  ? 45.400  -20.536 53.652  1.00 88.82  ? 370  ALA C CA    1 
ATOM   6493  C  C     . ALA C 2  370  ? 45.013  -19.613 52.496  1.00 94.22  ? 370  ALA C C     1 
ATOM   6494  O  O     . ALA C 2  370  ? 44.279  -18.638 52.695  1.00 99.89  ? 370  ALA C O     1 
ATOM   6495  C  CB    . ALA C 2  370  ? 46.730  -20.100 54.271  1.00 84.62  ? 370  ALA C CB    1 
ATOM   6496  N  N     . LYS C 2  371  ? 45.508  -19.884 51.287  1.00 99.23  ? 371  LYS C N     1 
ATOM   6497  C  CA    . LYS C 2  371  ? 45.152  -19.042 50.147  1.00 103.66 ? 371  LYS C CA    1 
ATOM   6498  C  C     . LYS C 2  371  ? 43.690  -19.208 49.757  1.00 103.62 ? 371  LYS C C     1 
ATOM   6499  O  O     . LYS C 2  371  ? 43.102  -18.298 49.154  1.00 105.36 ? 371  LYS C O     1 
ATOM   6500  C  CB    . LYS C 2  371  ? 46.042  -19.365 48.946  1.00 101.48 ? 371  LYS C CB    1 
ATOM   6501  C  CG    . LYS C 2  371  ? 47.420  -18.735 48.961  1.00 106.05 ? 371  LYS C CG    1 
ATOM   6502  C  CD    . LYS C 2  371  ? 48.111  -19.019 47.635  1.00 119.21 ? 371  LYS C CD    1 
ATOM   6503  C  CE    . LYS C 2  371  ? 49.501  -18.425 47.563  1.00 116.39 ? 371  LYS C CE    1 
ATOM   6504  N  NZ    . LYS C 2  371  ? 50.118  -18.697 46.234  1.00 111.90 ? 371  LYS C NZ    1 
ATOM   6505  N  N     . LEU C 2  372  ? 43.098  -20.360 50.086  1.00 96.64  ? 372  LEU C N     1 
ATOM   6506  C  CA    . LEU C 2  372  ? 41.751  -20.715 49.657  1.00 94.32  ? 372  LEU C CA    1 
ATOM   6507  C  C     . LEU C 2  372  ? 40.679  -20.176 50.595  1.00 96.80  ? 372  LEU C C     1 
ATOM   6508  O  O     . LEU C 2  372  ? 39.621  -19.741 50.131  1.00 97.75  ? 372  LEU C O     1 
ATOM   6509  C  CB    . LEU C 2  372  ? 41.621  -22.238 49.544  1.00 92.50  ? 372  LEU C CB    1 
ATOM   6510  C  CG    . LEU C 2  372  ? 41.033  -22.833 48.267  1.00 99.70  ? 372  LEU C CG    1 
ATOM   6511  C  CD1   . LEU C 2  372  ? 41.499  -22.051 47.057  1.00 99.48  ? 372  LEU C CD1   1 
ATOM   6512  C  CD2   . LEU C 2  372  ? 41.423  -24.299 48.132  1.00 94.21  ? 372  LEU C CD2   1 
ATOM   6513  N  N     . VAL C 2  373  ? 40.949  -20.167 51.898  1.00 92.54  ? 373  VAL C N     1 
ATOM   6514  C  CA    . VAL C 2  373  ? 39.944  -19.937 52.931  1.00 79.76  ? 373  VAL C CA    1 
ATOM   6515  C  C     . VAL C 2  373  ? 40.030  -18.491 53.408  1.00 84.08  ? 373  VAL C C     1 
ATOM   6516  O  O     . VAL C 2  373  ? 41.077  -18.051 53.899  1.00 87.37  ? 373  VAL C O     1 
ATOM   6517  C  CB    . VAL C 2  373  ? 40.128  -20.911 54.109  1.00 79.76  ? 373  VAL C CB    1 
ATOM   6518  C  CG1   . VAL C 2  373  ? 39.412  -20.408 55.349  1.00 79.16  ? 373  VAL C CG1   1 
ATOM   6519  C  CG2   . VAL C 2  373  ? 39.629  -22.295 53.736  1.00 73.10  ? 373  VAL C CG2   1 
ATOM   6520  N  N     . ASN C 2  374  ? 38.920  -17.753 53.275  1.00 88.20  ? 374  ASN C N     1 
ATOM   6521  C  CA    . ASN C 2  374  ? 38.725  -16.457 53.927  1.00 90.21  ? 374  ASN C CA    1 
ATOM   6522  C  C     . ASN C 2  374  ? 37.734  -16.661 55.071  1.00 83.88  ? 374  ASN C C     1 
ATOM   6523  O  O     . ASN C 2  374  ? 36.566  -16.990 54.834  1.00 82.10  ? 374  ASN C O     1 
ATOM   6524  C  CB    . ASN C 2  374  ? 38.214  -15.402 52.945  1.00 87.23  ? 374  ASN C CB    1 
ATOM   6525  C  CG    . ASN C 2  374  ? 37.864  -14.086 53.629  1.00 89.24  ? 374  ASN C CG    1 
ATOM   6526  O  OD1   . ASN C 2  374  ? 38.338  -13.800 54.729  1.00 89.72  ? 374  ASN C OD1   1 
ATOM   6527  N  ND2   . ASN C 2  374  ? 37.032  -13.280 52.978  1.00 84.38  ? 374  ASN C ND2   1 
ATOM   6528  N  N     . SER C 2  375  ? 38.196  -16.456 56.309  1.00 81.29  ? 375  SER C N     1 
ATOM   6529  C  CA    . SER C 2  375  ? 37.367  -16.764 57.474  1.00 84.20  ? 375  SER C CA    1 
ATOM   6530  C  C     . SER C 2  375  ? 36.277  -15.724 57.721  1.00 84.45  ? 375  SER C C     1 
ATOM   6531  O  O     . SER C 2  375  ? 35.301  -16.027 58.416  1.00 79.72  ? 375  SER C O     1 
ATOM   6532  C  CB    . SER C 2  375  ? 38.242  -16.905 58.729  1.00 81.67  ? 375  SER C CB    1 
ATOM   6533  O  OG    . SER C 2  375  ? 38.860  -15.680 59.094  1.00 83.43  ? 375  SER C OG    1 
ATOM   6534  N  N     . ARG C 2  376  ? 36.411  -14.524 57.150  1.00 89.11  ? 376  ARG C N     1 
ATOM   6535  C  CA    . ARG C 2  376  ? 35.562  -13.381 57.493  1.00 86.33  ? 376  ARG C CA    1 
ATOM   6536  C  C     . ARG C 2  376  ? 34.061  -13.664 57.493  1.00 82.62  ? 376  ARG C C     1 
ATOM   6537  O  O     . ARG C 2  376  ? 33.383  -13.209 58.426  1.00 73.66  ? 376  ARG C O     1 
ATOM   6538  C  CB    . ARG C 2  376  ? 35.897  -12.210 56.557  1.00 77.85  ? 376  ARG C CB    1 
ATOM   6539  C  CG    . ARG C 2  376  ? 36.846  -11.167 57.157  1.00 80.13  ? 376  ARG C CG    1 
ATOM   6540  C  CD    . ARG C 2  376  ? 38.183  -11.771 57.614  1.00 87.11  ? 376  ARG C CD    1 
ATOM   6541  N  NE    . ARG C 2  376  ? 39.167  -10.742 57.958  1.00 90.52  ? 376  ARG C NE    1 
ATOM   6542  C  CZ    . ARG C 2  376  ? 39.617  -10.499 59.189  1.00 93.29  ? 376  ARG C CZ    1 
ATOM   6543  N  NH1   . ARG C 2  376  ? 39.185  -11.222 60.216  1.00 93.89  ? 376  ARG C NH1   1 
ATOM   6544  N  NH2   . ARG C 2  376  ? 40.509  -9.536  59.392  1.00 89.46  ? 376  ARG C NH2   1 
ATOM   6545  N  N     . PRO C 2  377  ? 33.473  -14.360 56.505  1.00 81.90  ? 377  PRO C N     1 
ATOM   6546  C  CA    . PRO C 2  377  ? 32.019  -14.607 56.574  1.00 72.61  ? 377  PRO C CA    1 
ATOM   6547  C  C     . PRO C 2  377  ? 31.591  -15.441 57.768  1.00 73.68  ? 377  PRO C C     1 
ATOM   6548  O  O     . PRO C 2  377  ? 30.540  -15.164 58.362  1.00 85.68  ? 377  PRO C O     1 
ATOM   6549  C  CB    . PRO C 2  377  ? 31.717  -15.314 55.244  1.00 77.59  ? 377  PRO C CB    1 
ATOM   6550  C  CG    . PRO C 2  377  ? 33.022  -15.818 54.755  1.00 76.70  ? 377  PRO C CG    1 
ATOM   6551  C  CD    . PRO C 2  377  ? 34.032  -14.819 55.219  1.00 81.55  ? 377  PRO C CD    1 
ATOM   6552  N  N     . LEU C 2  378  ? 32.369  -16.462 58.137  1.00 78.47  ? 378  LEU C N     1 
ATOM   6553  C  CA    . LEU C 2  378  ? 32.060  -17.240 59.337  1.00 76.38  ? 378  LEU C CA    1 
ATOM   6554  C  C     . LEU C 2  378  ? 32.111  -16.367 60.589  1.00 72.21  ? 378  LEU C C     1 
ATOM   6555  O  O     . LEU C 2  378  ? 31.206  -16.415 61.439  1.00 76.54  ? 378  LEU C O     1 
ATOM   6556  C  CB    . LEU C 2  378  ? 33.037  -18.406 59.461  1.00 70.78  ? 378  LEU C CB    1 
ATOM   6557  C  CG    . LEU C 2  378  ? 33.074  -19.101 60.818  1.00 72.91  ? 378  LEU C CG    1 
ATOM   6558  C  CD1   . LEU C 2  378  ? 31.788  -19.881 61.043  1.00 82.37  ? 378  LEU C CD1   1 
ATOM   6559  C  CD2   . LEU C 2  378  ? 34.281  -20.005 60.921  1.00 72.17  ? 378  LEU C CD2   1 
ATOM   6560  N  N     . GLU C 2  379  ? 33.196  -15.599 60.740  1.00 73.02  ? 379  GLU C N     1 
ATOM   6561  C  CA    . GLU C 2  379  ? 33.287  -14.601 61.801  1.00 75.33  ? 379  GLU C CA    1 
ATOM   6562  C  C     . GLU C 2  379  ? 32.039  -13.736 61.852  1.00 77.63  ? 379  GLU C C     1 
ATOM   6563  O  O     . GLU C 2  379  ? 31.483  -13.492 62.927  1.00 79.81  ? 379  GLU C O     1 
ATOM   6564  C  CB    . GLU C 2  379  ? 34.509  -13.711 61.593  1.00 83.20  ? 379  GLU C CB    1 
ATOM   6565  C  CG    . GLU C 2  379  ? 35.849  -14.344 61.850  1.00 83.09  ? 379  GLU C CG    1 
ATOM   6566  C  CD    . GLU C 2  379  ? 36.971  -13.321 61.747  1.00 92.83  ? 379  GLU C CD    1 
ATOM   6567  O  OE1   . GLU C 2  379  ? 37.655  -13.284 60.701  1.00 90.38  ? 379  GLU C OE1   1 
ATOM   6568  O  OE2   . GLU C 2  379  ? 37.150  -12.537 62.708  1.00 100.07 ? 379  GLU C OE2   1 
ATOM   6569  N  N     . ALA C 2  380  ? 31.618  -13.221 60.695  1.00 78.37  ? 380  ALA C N     1 
ATOM   6570  C  CA    . ALA C 2  380  ? 30.447  -12.356 60.638  1.00 71.56  ? 380  ALA C CA    1 
ATOM   6571  C  C     . ALA C 2  380  ? 29.212  -13.067 61.168  1.00 73.49  ? 380  ALA C C     1 
ATOM   6572  O  O     . ALA C 2  380  ? 28.442  -12.488 61.935  1.00 75.61  ? 380  ALA C O     1 
ATOM   6573  C  CB    . ALA C 2  380  ? 30.212  -11.875 59.210  1.00 56.22  ? 380  ALA C CB    1 
ATOM   6574  N  N     . ALA C 2  381  ? 29.000  -14.322 60.754  1.00 71.39  ? 381  ALA C N     1 
ATOM   6575  C  CA    . ALA C 2  381  ? 27.825  -15.069 61.203  1.00 66.41  ? 381  ALA C CA    1 
ATOM   6576  C  C     . ALA C 2  381  ? 27.813  -15.222 62.723  1.00 77.77  ? 381  ALA C C     1 
ATOM   6577  O  O     . ALA C 2  381  ? 26.778  -15.019 63.382  1.00 76.78  ? 381  ALA C O     1 
ATOM   6578  C  CB    . ALA C 2  381  ? 27.783  -16.437 60.525  1.00 67.31  ? 381  ALA C CB    1 
ATOM   6579  N  N     . ILE C 2  382  ? 28.959  -15.586 63.302  1.00 76.26  ? 382  ILE C N     1 
ATOM   6580  C  CA    . ILE C 2  382  ? 29.017  -15.713 64.757  1.00 73.39  ? 382  ILE C CA    1 
ATOM   6581  C  C     . ILE C 2  382  ? 28.762  -14.362 65.418  1.00 68.72  ? 382  ILE C C     1 
ATOM   6582  O  O     . ILE C 2  382  ? 27.996  -14.255 66.391  1.00 72.52  ? 382  ILE C O     1 
ATOM   6583  C  CB    . ILE C 2  382  ? 30.368  -16.316 65.178  1.00 72.69  ? 382  ILE C CB    1 
ATOM   6584  C  CG1   . ILE C 2  382  ? 30.408  -17.804 64.831  1.00 71.44  ? 382  ILE C CG1   1 
ATOM   6585  C  CG2   . ILE C 2  382  ? 30.611  -16.108 66.652  1.00 57.58  ? 382  ILE C CG2   1 
ATOM   6586  C  CD1   . ILE C 2  382  ? 31.755  -18.444 65.100  1.00 83.15  ? 382  ILE C CD1   1 
ATOM   6587  N  N     . ARG C 2  383  ? 29.382  -13.308 64.881  1.00 68.84  ? 383  ARG C N     1 
ATOM   6588  C  CA    . ARG C 2  383  ? 29.257  -11.974 65.458  1.00 74.51  ? 383  ARG C CA    1 
ATOM   6589  C  C     . ARG C 2  383  ? 27.807  -11.504 65.451  1.00 75.63  ? 383  ARG C C     1 
ATOM   6590  O  O     . ARG C 2  383  ? 27.330  -10.937 66.442  1.00 70.50  ? 383  ARG C O     1 
ATOM   6591  C  CB    . ARG C 2  383  ? 30.161  -10.998 64.693  1.00 72.38  ? 383  ARG C CB    1 
ATOM   6592  C  CG    . ARG C 2  383  ? 30.262  -9.588  65.275  1.00 75.39  ? 383  ARG C CG    1 
ATOM   6593  C  CD    . ARG C 2  383  ? 31.507  -8.844  64.779  1.00 73.61  ? 383  ARG C CD    1 
ATOM   6594  N  NE    . ARG C 2  383  ? 31.630  -8.849  63.318  1.00 97.85  ? 383  ARG C NE    1 
ATOM   6595  C  CZ    . ARG C 2  383  ? 32.602  -9.458  62.632  1.00 90.32  ? 383  ARG C CZ    1 
ATOM   6596  N  NH1   . ARG C 2  383  ? 33.571  -10.119 63.258  1.00 84.71  ? 383  ARG C NH1   1 
ATOM   6597  N  NH2   . ARG C 2  383  ? 32.610  -9.399  61.308  1.00 86.52  ? 383  ARG C NH2   1 
ATOM   6598  N  N     . GLU C 2  384  ? 27.083  -11.752 64.352  1.00 75.97  ? 384  GLU C N     1 
ATOM   6599  C  CA    . GLU C 2  384  ? 25.690  -11.320 64.280  1.00 77.33  ? 384  GLU C CA    1 
ATOM   6600  C  C     . GLU C 2  384  ? 24.810  -12.151 65.204  1.00 73.01  ? 384  GLU C C     1 
ATOM   6601  O  O     . GLU C 2  384  ? 23.934  -11.598 65.878  1.00 76.16  ? 384  GLU C O     1 
ATOM   6602  C  CB    . GLU C 2  384  ? 25.157  -11.371 62.837  1.00 70.09  ? 384  GLU C CB    1 
ATOM   6603  C  CG    . GLU C 2  384  ? 25.529  -12.618 62.060  1.00 86.46  ? 384  GLU C CG    1 
ATOM   6604  C  CD    . GLU C 2  384  ? 24.352  -13.412 61.494  1.00 97.88  ? 384  GLU C CD    1 
ATOM   6605  O  OE1   . GLU C 2  384  ? 23.790  -12.989 60.457  1.00 107.43 ? 384  GLU C OE1   1 
ATOM   6606  O  OE2   . GLU C 2  384  ? 24.010  -14.477 62.070  1.00 86.20  ? 384  GLU C OE2   1 
ATOM   6607  N  N     . PHE C 2  385  ? 25.031  -13.471 65.267  1.00 71.46  ? 385  PHE C N     1 
ATOM   6608  C  CA    . PHE C 2  385  ? 24.240  -14.275 66.192  1.00 65.40  ? 385  PHE C CA    1 
ATOM   6609  C  C     . PHE C 2  385  ? 24.384  -13.772 67.619  1.00 70.65  ? 385  PHE C C     1 
ATOM   6610  O  O     . PHE C 2  385  ? 23.394  -13.680 68.353  1.00 69.57  ? 385  PHE C O     1 
ATOM   6611  C  CB    . PHE C 2  385  ? 24.639  -15.742 66.122  1.00 65.18  ? 385  PHE C CB    1 
ATOM   6612  C  CG    . PHE C 2  385  ? 23.962  -16.594 67.161  1.00 63.97  ? 385  PHE C CG    1 
ATOM   6613  C  CD1   . PHE C 2  385  ? 22.645  -16.988 67.002  1.00 69.57  ? 385  PHE C CD1   1 
ATOM   6614  C  CD2   . PHE C 2  385  ? 24.638  -16.993 68.301  1.00 67.22  ? 385  PHE C CD2   1 
ATOM   6615  C  CE1   . PHE C 2  385  ? 22.014  -17.770 67.952  1.00 72.78  ? 385  PHE C CE1   1 
ATOM   6616  C  CE2   . PHE C 2  385  ? 24.015  -17.778 69.259  1.00 67.68  ? 385  PHE C CE2   1 
ATOM   6617  C  CZ    . PHE C 2  385  ? 22.698  -18.167 69.084  1.00 64.40  ? 385  PHE C CZ    1 
ATOM   6618  N  N     . PHE C 2  386  ? 25.599  -13.426 68.031  1.00 65.81  ? 386  PHE C N     1 
ATOM   6619  C  CA    . PHE C 2  386  ? 25.753  -13.045 69.429  1.00 65.52  ? 386  PHE C CA    1 
ATOM   6620  C  C     . PHE C 2  386  ? 25.425  -11.581 69.699  1.00 76.32  ? 386  PHE C C     1 
ATOM   6621  O  O     . PHE C 2  386  ? 25.048  -11.245 70.829  1.00 76.20  ? 386  PHE C O     1 
ATOM   6622  C  CB    . PHE C 2  386  ? 27.158  -13.385 69.913  1.00 68.51  ? 386  PHE C CB    1 
ATOM   6623  C  CG    . PHE C 2  386  ? 27.315  -14.823 70.283  1.00 69.06  ? 386  PHE C CG    1 
ATOM   6624  C  CD1   . PHE C 2  386  ? 26.856  -15.288 71.503  1.00 59.74  ? 386  PHE C CD1   1 
ATOM   6625  C  CD2   . PHE C 2  386  ? 27.881  -15.721 69.399  1.00 64.69  ? 386  PHE C CD2   1 
ATOM   6626  C  CE1   . PHE C 2  386  ? 26.983  -16.616 71.842  1.00 60.98  ? 386  PHE C CE1   1 
ATOM   6627  C  CE2   . PHE C 2  386  ? 28.011  -17.049 69.733  1.00 64.20  ? 386  PHE C CE2   1 
ATOM   6628  C  CZ    . PHE C 2  386  ? 27.559  -17.501 70.956  1.00 65.81  ? 386  PHE C CZ    1 
ATOM   6629  N  N     . SER C 2  387  ? 25.547  -10.699 68.706  1.00 84.59  ? 387  SER C N     1 
ATOM   6630  C  CA    . SER C 2  387  ? 25.290  -9.283  68.954  1.00 84.53  ? 387  SER C CA    1 
ATOM   6631  C  C     . SER C 2  387  ? 23.845  -8.880  68.678  1.00 86.48  ? 387  SER C C     1 
ATOM   6632  O  O     . SER C 2  387  ? 23.253  -8.126  69.456  1.00 87.49  ? 387  SER C O     1 
ATOM   6633  C  CB    . SER C 2  387  ? 26.236  -8.420  68.114  1.00 76.24  ? 387  SER C CB    1 
ATOM   6634  O  OG    . SER C 2  387  ? 27.502  -8.314  68.725  1.00 84.12  ? 387  SER C OG    1 
ATOM   6635  N  N     . ARG C 2  388  ? 23.262  -9.359  67.580  1.00 79.72  ? 388  ARG C N     1 
ATOM   6636  C  CA    . ARG C 2  388  ? 22.005  -8.805  67.103  1.00 80.43  ? 388  ARG C CA    1 
ATOM   6637  C  C     . ARG C 2  388  ? 20.890  -9.831  66.947  1.00 77.32  ? 388  ARG C C     1 
ATOM   6638  O  O     . ARG C 2  388  ? 19.832  -9.486  66.414  1.00 88.96  ? 388  ARG C O     1 
ATOM   6639  C  CB    . ARG C 2  388  ? 22.238  -8.067  65.783  1.00 86.18  ? 388  ARG C CB    1 
ATOM   6640  C  CG    . ARG C 2  388  ? 22.097  -6.558  65.912  1.00 93.59  ? 388  ARG C CG    1 
ATOM   6641  C  CD    . ARG C 2  388  ? 22.960  -5.815  64.904  1.00 103.37 ? 388  ARG C CD    1 
ATOM   6642  N  NE    . ARG C 2  388  ? 24.382  -6.007  65.176  1.00 112.37 ? 388  ARG C NE    1 
ATOM   6643  C  CZ    . ARG C 2  388  ? 25.043  -5.418  66.172  1.00 114.29 ? 388  ARG C CZ    1 
ATOM   6644  N  NH1   . ARG C 2  388  ? 24.413  -4.595  67.003  1.00 104.17 ? 388  ARG C NH1   1 
ATOM   6645  N  NH2   . ARG C 2  388  ? 26.339  -5.656  66.340  1.00 116.91 ? 388  ARG C NH2   1 
ATOM   6646  N  N     . SER C 2  389  ? 21.073  -11.064 67.405  1.00 71.53  ? 389  SER C N     1 
ATOM   6647  C  CA    . SER C 2  389  ? 19.974  -12.016 67.319  1.00 69.52  ? 389  SER C CA    1 
ATOM   6648  C  C     . SER C 2  389  ? 18.909  -11.719 68.376  1.00 76.42  ? 389  SER C C     1 
ATOM   6649  O  O     . SER C 2  389  ? 19.172  -11.104 69.416  1.00 72.50  ? 389  SER C O     1 
ATOM   6650  C  CB    . SER C 2  389  ? 20.468  -13.453 67.476  1.00 63.26  ? 389  SER C CB    1 
ATOM   6651  O  OG    . SER C 2  389  ? 19.377  -14.360 67.473  1.00 75.96  ? 389  SER C OG    1 
ATOM   6652  N  N     . GLN C 2  390  ? 17.685  -12.173 68.095  1.00 77.36  ? 390  GLN C N     1 
ATOM   6653  C  CA    . GLN C 2  390  ? 16.583  -11.900 69.008  1.00 71.40  ? 390  GLN C CA    1 
ATOM   6654  C  C     . GLN C 2  390  ? 16.711  -12.704 70.291  1.00 68.49  ? 390  GLN C C     1 
ATOM   6655  O  O     . GLN C 2  390  ? 16.395  -12.202 71.374  1.00 70.97  ? 390  GLN C O     1 
ATOM   6656  C  CB    . GLN C 2  390  ? 15.250  -12.177 68.319  1.00 84.57  ? 390  GLN C CB    1 
ATOM   6657  C  CG    . GLN C 2  390  ? 14.742  -10.973 67.549  1.00 100.51 ? 390  GLN C CG    1 
ATOM   6658  C  CD    . GLN C 2  390  ? 13.843  -11.349 66.394  1.00 112.33 ? 390  GLN C CD    1 
ATOM   6659  O  OE1   . GLN C 2  390  ? 13.040  -12.278 66.497  1.00 113.86 ? 390  GLN C OE1   1 
ATOM   6660  N  NE2   . GLN C 2  390  ? 13.976  -10.631 65.278  1.00 102.31 ? 390  GLN C NE2   1 
ATOM   6661  N  N     . LEU C 2  391  ? 17.187  -13.944 70.197  1.00 68.92  ? 391  LEU C N     1 
ATOM   6662  C  CA    . LEU C 2  391  ? 17.356  -14.768 71.386  1.00 54.75  ? 391  LEU C CA    1 
ATOM   6663  C  C     . LEU C 2  391  ? 18.601  -14.405 72.190  1.00 58.62  ? 391  LEU C C     1 
ATOM   6664  O  O     . LEU C 2  391  ? 18.786  -14.942 73.287  1.00 54.21  ? 391  LEU C O     1 
ATOM   6665  C  CB    . LEU C 2  391  ? 17.397  -16.244 70.988  1.00 56.83  ? 391  LEU C CB    1 
ATOM   6666  C  CG    . LEU C 2  391  ? 16.128  -16.751 70.293  1.00 64.88  ? 391  LEU C CG    1 
ATOM   6667  C  CD1   . LEU C 2  391  ? 16.400  -17.982 69.464  1.00 70.04  ? 391  LEU C CD1   1 
ATOM   6668  C  CD2   . LEU C 2  391  ? 15.053  -17.050 71.317  1.00 71.09  ? 391  LEU C CD2   1 
ATOM   6669  N  N     . SER C 2  392  ? 19.452  -13.510 71.686  1.00 64.78  ? 392  SER C N     1 
ATOM   6670  C  CA    . SER C 2  392  ? 20.661  -13.095 72.392  1.00 58.50  ? 392  SER C CA    1 
ATOM   6671  C  C     . SER C 2  392  ? 20.358  -11.781 73.092  1.00 60.33  ? 392  SER C C     1 
ATOM   6672  O  O     . SER C 2  392  ? 20.383  -10.717 72.469  1.00 63.89  ? 392  SER C O     1 
ATOM   6673  C  CB    . SER C 2  392  ? 21.836  -12.942 71.436  1.00 62.12  ? 392  SER C CB    1 
ATOM   6674  O  OG    . SER C 2  392  ? 23.021  -12.592 72.139  1.00 62.23  ? 392  SER C OG    1 
ATOM   6675  N  N     . GLN C 2  393  ? 20.107  -11.851 74.393  1.00 63.49  ? 393  GLN C N     1 
ATOM   6676  C  CA    . GLN C 2  393  ? 19.509  -10.750 75.129  1.00 62.78  ? 393  GLN C CA    1 
ATOM   6677  C  C     . GLN C 2  393  ? 20.481  -10.189 76.151  1.00 63.78  ? 393  GLN C C     1 
ATOM   6678  O  O     . GLN C 2  393  ? 21.247  -10.931 76.776  1.00 63.41  ? 393  GLN C O     1 
ATOM   6679  C  CB    . GLN C 2  393  ? 18.225  -11.203 75.816  1.00 53.89  ? 393  GLN C CB    1 
ATOM   6680  C  CG    . GLN C 2  393  ? 17.110  -11.487 74.832  1.00 55.83  ? 393  GLN C CG    1 
ATOM   6681  C  CD    . GLN C 2  393  ? 15.961  -12.248 75.446  1.00 59.74  ? 393  GLN C CD    1 
ATOM   6682  O  OE1   . GLN C 2  393  ? 15.856  -12.365 76.673  1.00 63.94  ? 393  GLN C OE1   1 
ATOM   6683  N  NE2   . GLN C 2  393  ? 15.085  -12.776 74.593  1.00 54.30  ? 393  GLN C NE2   1 
ATOM   6684  N  N     . PHE C 2  394  ? 20.451  -8.868  76.291  1.00 63.13  ? 394  PHE C N     1 
ATOM   6685  C  CA    . PHE C 2  394  ? 21.156  -8.202  77.373  1.00 65.30  ? 394  PHE C CA    1 
ATOM   6686  C  C     . PHE C 2  394  ? 20.762  -8.854  78.693  1.00 71.68  ? 394  PHE C C     1 
ATOM   6687  O  O     . PHE C 2  394  ? 19.586  -8.859  79.068  1.00 66.11  ? 394  PHE C O     1 
ATOM   6688  C  CB    . PHE C 2  394  ? 20.804  -6.714  77.355  1.00 65.19  ? 394  PHE C CB    1 
ATOM   6689  C  CG    . PHE C 2  394  ? 21.723  -5.852  78.167  1.00 73.79  ? 394  PHE C CG    1 
ATOM   6690  C  CD1   . PHE C 2  394  ? 23.058  -5.739  77.837  1.00 66.84  ? 394  PHE C CD1   1 
ATOM   6691  C  CD2   . PHE C 2  394  ? 21.240  -5.126  79.246  1.00 77.06  ? 394  PHE C CD2   1 
ATOM   6692  C  CE1   . PHE C 2  394  ? 23.908  -4.936  78.579  1.00 70.97  ? 394  PHE C CE1   1 
ATOM   6693  C  CE2   . PHE C 2  394  ? 22.082  -4.316  79.993  1.00 75.95  ? 394  PHE C CE2   1 
ATOM   6694  C  CZ    . PHE C 2  394  ? 23.419  -4.221  79.658  1.00 80.62  ? 394  PHE C CZ    1 
ATOM   6695  N  N     . LYS C 2  395  ? 21.737  -9.451  79.371  1.00 72.32  ? 395  LYS C N     1 
ATOM   6696  C  CA    . LYS C 2  395  ? 21.437  -10.277 80.532  1.00 64.80  ? 395  LYS C CA    1 
ATOM   6697  C  C     . LYS C 2  395  ? 20.843  -9.438  81.649  1.00 66.37  ? 395  LYS C C     1 
ATOM   6698  O  O     . LYS C 2  395  ? 21.367  -8.372  81.985  1.00 69.64  ? 395  LYS C O     1 
ATOM   6699  C  CB    . LYS C 2  395  ? 22.700  -10.980 81.025  1.00 68.55  ? 395  LYS C CB    1 
ATOM   6700  C  CG    . LYS C 2  395  ? 22.470  -11.905 82.205  1.00 63.67  ? 395  LYS C CG    1 
ATOM   6701  C  CD    . LYS C 2  395  ? 23.511  -11.696 83.285  1.00 64.89  ? 395  LYS C CD    1 
ATOM   6702  C  CE    . LYS C 2  395  ? 24.485  -12.848 83.341  1.00 62.07  ? 395  LYS C CE    1 
ATOM   6703  N  NZ    . LYS C 2  395  ? 25.523  -12.617 84.380  1.00 69.54  ? 395  LYS C NZ    1 
ATOM   6704  N  N     . ASP C 2  396  ? 19.750  -9.931  82.227  1.00 69.02  ? 396  ASP C N     1 
ATOM   6705  C  CA    . ASP C 2  396  ? 19.142  -9.339  83.415  1.00 64.17  ? 396  ASP C CA    1 
ATOM   6706  C  C     . ASP C 2  396  ? 19.891  -9.852  84.638  1.00 64.73  ? 396  ASP C C     1 
ATOM   6707  O  O     . ASP C 2  396  ? 19.748  -11.019 85.012  1.00 64.11  ? 396  ASP C O     1 
ATOM   6708  C  CB    . ASP C 2  396  ? 17.660  -9.701  83.495  1.00 67.18  ? 396  ASP C CB    1 
ATOM   6709  C  CG    . ASP C 2  396  ? 16.976  -9.151  84.757  1.00 77.74  ? 396  ASP C CG    1 
ATOM   6710  O  OD1   . ASP C 2  396  ? 17.498  -8.183  85.365  1.00 73.36  ? 396  ASP C OD1   1 
ATOM   6711  O  OD2   . ASP C 2  396  ? 15.911  -9.700  85.137  1.00 76.47  ? 396  ASP C OD2   1 
ATOM   6712  N  N     . GLU C 2  397  ? 20.708  -8.994  85.244  1.00 63.95  ? 397  GLU C N     1 
ATOM   6713  C  CA    . GLU C 2  397  ? 21.420  -9.336  86.468  1.00 64.66  ? 397  GLU C CA    1 
ATOM   6714  C  C     . GLU C 2  397  ? 21.110  -8.330  87.577  1.00 68.16  ? 397  GLU C C     1 
ATOM   6715  O  O     . GLU C 2  397  ? 21.989  -7.958  88.361  1.00 70.07  ? 397  GLU C O     1 
ATOM   6716  C  CB    . GLU C 2  397  ? 22.928  -9.443  86.216  1.00 61.59  ? 397  GLU C CB    1 
ATOM   6717  C  CG    . GLU C 2  397  ? 23.575  -8.272  85.495  1.00 69.80  ? 397  GLU C CG    1 
ATOM   6718  C  CD    . GLU C 2  397  ? 25.067  -8.493  85.269  1.00 81.17  ? 397  GLU C CD    1 
ATOM   6719  O  OE1   . GLU C 2  397  ? 25.632  -9.419  85.894  1.00 82.59  ? 397  GLU C OE1   1 
ATOM   6720  O  OE2   . GLU C 2  397  ? 25.678  -7.756  84.465  1.00 83.14  ? 397  GLU C OE2   1 
ATOM   6721  N  N     . THR C 2  398  ? 19.852  -7.889  87.654  1.00 65.09  ? 398  THR C N     1 
ATOM   6722  C  CA    . THR C 2  398  ? 19.430  -7.021  88.746  1.00 62.02  ? 398  THR C CA    1 
ATOM   6723  C  C     . THR C 2  398  ? 19.770  -7.647  90.092  1.00 62.58  ? 398  THR C C     1 
ATOM   6724  O  O     . THR C 2  398  ? 20.366  -6.998  90.960  1.00 65.38  ? 398  THR C O     1 
ATOM   6725  C  CB    . THR C 2  398  ? 17.933  -6.738  88.636  1.00 63.19  ? 398  THR C CB    1 
ATOM   6726  O  OG1   . THR C 2  398  ? 17.643  -6.174  87.351  1.00 62.80  ? 398  THR C OG1   1 
ATOM   6727  C  CG2   . THR C 2  398  ? 17.506  -5.769  89.712  1.00 62.79  ? 398  THR C CG2   1 
ATOM   6728  N  N     . ASN C 2  399  ? 19.408  -8.920  90.272  1.00 59.73  ? 399  ASN C N     1 
ATOM   6729  C  CA    . ASN C 2  399  ? 19.829  -9.745  91.397  1.00 65.53  ? 399  ASN C CA    1 
ATOM   6730  C  C     . ASN C 2  399  ? 20.164  -11.135 90.860  1.00 65.91  ? 399  ASN C C     1 
ATOM   6731  O  O     . ASN C 2  399  ? 19.846  -11.433 89.704  1.00 66.14  ? 399  ASN C O     1 
ATOM   6732  C  CB    . ASN C 2  399  ? 18.746  -9.793  92.485  1.00 57.44  ? 399  ASN C CB    1 
ATOM   6733  C  CG    . ASN C 2  399  ? 17.461  -10.438 92.016  1.00 63.04  ? 399  ASN C CG    1 
ATOM   6734  O  OD1   . ASN C 2  399  ? 17.430  -11.622 91.679  1.00 60.82  ? 399  ASN C OD1   1 
ATOM   6735  N  ND2   . ASN C 2  399  ? 16.381  -9.665  92.014  1.00 60.03  ? 399  ASN C ND2   1 
ATOM   6736  N  N     . PRO C 2  400  ? 20.820  -12.004 91.644  1.00 63.03  ? 400  PRO C N     1 
ATOM   6737  C  CA    . PRO C 2  400  ? 21.220  -13.318 91.093  1.00 60.99  ? 400  PRO C CA    1 
ATOM   6738  C  C     . PRO C 2  400  ? 20.062  -14.128 90.534  1.00 63.58  ? 400  PRO C C     1 
ATOM   6739  O  O     . PRO C 2  400  ? 20.216  -14.820 89.508  1.00 68.42  ? 400  PRO C O     1 
ATOM   6740  C  CB    . PRO C 2  400  ? 21.874  -14.008 92.298  1.00 65.02  ? 400  PRO C CB    1 
ATOM   6741  C  CG    . PRO C 2  400  ? 22.369  -12.881 93.149  1.00 71.42  ? 400  PRO C CG    1 
ATOM   6742  C  CD    . PRO C 2  400  ? 21.360  -11.789 93.001  1.00 64.41  ? 400  PRO C CD    1 
ATOM   6743  N  N     . LEU C 2  401  ? 18.898  -14.056 91.185  1.00 57.30  ? 401  LEU C N     1 
ATOM   6744  C  CA    . LEU C 2  401  ? 17.722  -14.755 90.679  1.00 60.58  ? 401  LEU C CA    1 
ATOM   6745  C  C     . LEU C 2  401  ? 17.301  -14.221 89.317  1.00 66.87  ? 401  LEU C C     1 
ATOM   6746  O  O     . LEU C 2  401  ? 16.804  -14.987 88.481  1.00 62.00  ? 401  LEU C O     1 
ATOM   6747  C  CB    . LEU C 2  401  ? 16.571  -14.641 91.675  1.00 56.56  ? 401  LEU C CB    1 
ATOM   6748  C  CG    . LEU C 2  401  ? 15.221  -15.201 91.231  1.00 56.08  ? 401  LEU C CG    1 
ATOM   6749  C  CD1   . LEU C 2  401  ? 15.275  -16.711 91.113  1.00 60.96  ? 401  LEU C CD1   1 
ATOM   6750  C  CD2   . LEU C 2  401  ? 14.141  -14.781 92.202  1.00 66.54  ? 401  LEU C CD2   1 
ATOM   6751  N  N     . SER C 2  402  ? 17.489  -12.919 89.071  1.00 69.54  ? 402  SER C N     1 
ATOM   6752  C  CA    . SER C 2  402  ? 17.211  -12.374 87.744  1.00 63.58  ? 402  SER C CA    1 
ATOM   6753  C  C     . SER C 2  402  ? 17.957  -13.161 86.679  1.00 57.70  ? 402  SER C C     1 
ATOM   6754  O  O     . SER C 2  402  ? 17.356  -13.636 85.711  1.00 64.08  ? 402  SER C O     1 
ATOM   6755  C  CB    . SER C 2  402  ? 17.593  -10.891 87.660  1.00 67.04  ? 402  SER C CB    1 
ATOM   6756  O  OG    . SER C 2  402  ? 17.763  -10.289 88.932  1.00 66.59  ? 402  SER C OG    1 
ATOM   6757  N  N     . SER C 2  403  ? 19.276  -13.316 86.857  1.00 63.93  ? 403  SER C N     1 
ATOM   6758  C  CA    . SER C 2  403  ? 20.096  -14.007 85.863  1.00 62.68  ? 403  SER C CA    1 
ATOM   6759  C  C     . SER C 2  403  ? 19.706  -15.469 85.749  1.00 62.05  ? 403  SER C C     1 
ATOM   6760  O  O     . SER C 2  403  ? 19.627  -16.010 84.639  1.00 68.09  ? 403  SER C O     1 
ATOM   6761  C  CB    . SER C 2  403  ? 21.576  -13.893 86.213  1.00 56.87  ? 403  SER C CB    1 
ATOM   6762  O  OG    . SER C 2  403  ? 21.957  -12.544 86.352  1.00 70.47  ? 403  SER C OG    1 
ATOM   6763  N  N     . LEU C 2  404  ? 19.471  -16.133 86.883  1.00 57.69  ? 404  LEU C N     1 
ATOM   6764  C  CA    . LEU C 2  404  ? 19.091  -17.542 86.821  1.00 60.36  ? 404  LEU C CA    1 
ATOM   6765  C  C     . LEU C 2  404  ? 17.777  -17.729 86.060  1.00 57.17  ? 404  LEU C C     1 
ATOM   6766  O  O     . LEU C 2  404  ? 17.661  -18.622 85.203  1.00 59.85  ? 404  LEU C O     1 
ATOM   6767  C  CB    . LEU C 2  404  ? 19.010  -18.115 88.235  1.00 59.06  ? 404  LEU C CB    1 
ATOM   6768  C  CG    . LEU C 2  404  ? 18.674  -19.593 88.376  1.00 57.26  ? 404  LEU C CG    1 
ATOM   6769  C  CD1   . LEU C 2  404  ? 19.650  -20.439 87.597  1.00 70.89  ? 404  LEU C CD1   1 
ATOM   6770  C  CD2   . LEU C 2  404  ? 18.693  -19.984 89.834  1.00 69.65  ? 404  LEU C CD2   1 
ATOM   6771  N  N     . ARG C 2  405  ? 16.791  -16.863 86.315  1.00 61.41  ? 405  ARG C N     1 
ATOM   6772  C  CA    . ARG C 2  405  ? 15.527  -16.956 85.590  1.00 65.29  ? 405  ARG C CA    1 
ATOM   6773  C  C     . ARG C 2  405  ? 15.714  -16.662 84.107  1.00 62.51  ? 405  ARG C C     1 
ATOM   6774  O  O     . ARG C 2  405  ? 15.162  -17.370 83.256  1.00 64.08  ? 405  ARG C O     1 
ATOM   6775  C  CB    . ARG C 2  405  ? 14.489  -16.001 86.174  1.00 62.41  ? 405  ARG C CB    1 
ATOM   6776  C  CG    . ARG C 2  405  ? 13.119  -16.223 85.542  1.00 72.65  ? 405  ARG C CG    1 
ATOM   6777  C  CD    . ARG C 2  405  ? 12.256  -14.981 85.547  1.00 71.86  ? 405  ARG C CD    1 
ATOM   6778  N  NE    . ARG C 2  405  ? 12.816  -13.936 84.700  1.00 80.24  ? 405  ARG C NE    1 
ATOM   6779  C  CZ    . ARG C 2  405  ? 12.167  -12.829 84.358  1.00 84.14  ? 405  ARG C CZ    1 
ATOM   6780  N  NH1   . ARG C 2  405  ? 10.925  -12.631 84.789  1.00 71.37  ? 405  ARG C NH1   1 
ATOM   6781  N  NH2   . ARG C 2  405  ? 12.759  -11.924 83.584  1.00 82.72  ? 405  ARG C NH2   1 
ATOM   6782  N  N     . HIS C 2  406  ? 16.466  -15.607 83.783  1.00 60.28  ? 406  HIS C N     1 
ATOM   6783  C  CA    . HIS C 2  406  ? 16.764  -15.304 82.390  1.00 61.18  ? 406  HIS C CA    1 
ATOM   6784  C  C     . HIS C 2  406  ? 17.357  -16.515 81.691  1.00 59.28  ? 406  HIS C C     1 
ATOM   6785  O  O     . HIS C 2  406  ? 16.979  -16.845 80.562  1.00 52.37  ? 406  HIS C O     1 
ATOM   6786  C  CB    . HIS C 2  406  ? 17.724  -14.118 82.306  1.00 56.65  ? 406  HIS C CB    1 
ATOM   6787  C  CG    . HIS C 2  406  ? 17.688  -13.408 80.989  1.00 57.47  ? 406  HIS C CG    1 
ATOM   6788  N  ND1   . HIS C 2  406  ? 18.480  -12.315 80.708  1.00 57.12  ? 406  HIS C ND1   1 
ATOM   6789  C  CD2   . HIS C 2  406  ? 16.947  -13.632 79.878  1.00 50.56  ? 406  HIS C CD2   1 
ATOM   6790  C  CE1   . HIS C 2  406  ? 18.225  -11.893 79.484  1.00 57.57  ? 406  HIS C CE1   1 
ATOM   6791  N  NE2   . HIS C 2  406  ? 17.295  -12.673 78.959  1.00 50.78  ? 406  HIS C NE2   1 
ATOM   6792  N  N     . LYS C 2  407  ? 18.272  -17.206 82.364  1.00 55.93  ? 407  LYS C N     1 
ATOM   6793  C  CA    . LYS C 2  407  ? 18.885  -18.387 81.781  1.00 57.65  ? 407  LYS C CA    1 
ATOM   6794  C  C     . LYS C 2  407  ? 17.914  -19.555 81.653  1.00 61.58  ? 407  LYS C C     1 
ATOM   6795  O  O     . LYS C 2  407  ? 18.149  -20.442 80.826  1.00 64.34  ? 407  LYS C O     1 
ATOM   6796  C  CB    . LYS C 2  407  ? 20.106  -18.782 82.606  1.00 56.61  ? 407  LYS C CB    1 
ATOM   6797  C  CG    . LYS C 2  407  ? 21.251  -17.809 82.437  1.00 59.29  ? 407  LYS C CG    1 
ATOM   6798  C  CD    . LYS C 2  407  ? 22.242  -17.896 83.570  1.00 59.41  ? 407  LYS C CD    1 
ATOM   6799  C  CE    . LYS C 2  407  ? 23.253  -16.770 83.462  1.00 62.68  ? 407  LYS C CE    1 
ATOM   6800  N  NZ    . LYS C 2  407  ? 24.039  -16.598 84.712  1.00 71.89  ? 407  LYS C NZ    1 
ATOM   6801  N  N     . ARG C 2  408  ? 16.835  -19.593 82.434  1.00 57.22  ? 408  ARG C N     1 
ATOM   6802  C  CA    . ARG C 2  408  ? 15.879  -20.684 82.282  1.00 55.50  ? 408  ARG C CA    1 
ATOM   6803  C  C     . ARG C 2  408  ? 14.644  -20.311 81.461  1.00 61.27  ? 408  ARG C C     1 
ATOM   6804  O  O     . ARG C 2  408  ? 13.624  -21.002 81.567  1.00 56.25  ? 408  ARG C O     1 
ATOM   6805  C  CB    . ARG C 2  408  ? 15.454  -21.210 83.648  1.00 58.73  ? 408  ARG C CB    1 
ATOM   6806  C  CG    . ARG C 2  408  ? 16.596  -21.742 84.476  1.00 59.81  ? 408  ARG C CG    1 
ATOM   6807  C  CD    . ARG C 2  408  ? 16.133  -22.049 85.888  1.00 61.46  ? 408  ARG C CD    1 
ATOM   6808  N  NE    . ARG C 2  408  ? 14.978  -22.939 85.893  1.00 64.49  ? 408  ARG C NE    1 
ATOM   6809  C  CZ    . ARG C 2  408  ? 15.058  -24.263 85.948  1.00 65.84  ? 408  ARG C CZ    1 
ATOM   6810  N  NH1   . ARG C 2  408  ? 13.957  -24.998 85.947  1.00 66.09  ? 408  ARG C NH1   1 
ATOM   6811  N  NH2   . ARG C 2  408  ? 16.242  -24.851 86.007  1.00 68.11  ? 408  ARG C NH2   1 
ATOM   6812  N  N     . ARG C 2  409  ? 14.723  -19.273 80.621  1.00 57.48  ? 409  ARG C N     1 
ATOM   6813  C  CA    . ARG C 2  409  ? 13.584  -18.813 79.828  1.00 56.75  ? 409  ARG C CA    1 
ATOM   6814  C  C     . ARG C 2  409  ? 13.368  -19.674 78.586  1.00 60.01  ? 409  ARG C C     1 
ATOM   6815  O  O     . ARG C 2  409  ? 14.286  -20.320 78.080  1.00 65.06  ? 409  ARG C O     1 
ATOM   6816  C  CB    . ARG C 2  409  ? 13.779  -17.369 79.368  1.00 64.63  ? 409  ARG C CB    1 
ATOM   6817  C  CG    . ARG C 2  409  ? 13.819  -16.321 80.456  1.00 68.07  ? 409  ARG C CG    1 
ATOM   6818  C  CD    . ARG C 2  409  ? 12.587  -15.434 80.413  1.00 72.80  ? 409  ARG C CD    1 
ATOM   6819  N  NE    . ARG C 2  409  ? 11.473  -16.028 81.145  1.00 87.89  ? 409  ARG C NE    1 
ATOM   6820  C  CZ    . ARG C 2  409  ? 10.374  -15.365 81.487  1.00 84.76  ? 409  ARG C CZ    1 
ATOM   6821  N  NH1   . ARG C 2  409  ? 10.251  -14.083 81.153  1.00 86.29  ? 409  ARG C NH1   1 
ATOM   6822  N  NH2   . ARG C 2  409  ? 9.404   -15.981 82.153  1.00 68.90  ? 409  ARG C NH2   1 
ATOM   6823  N  N     . ILE C 2  410  ? 12.140  -19.628 78.064  1.00 61.56  ? 410  ILE C N     1 
ATOM   6824  C  CA    . ILE C 2  410  ? 11.760  -20.314 76.828  1.00 56.55  ? 410  ILE C CA    1 
ATOM   6825  C  C     . ILE C 2  410  ? 10.899  -19.366 76.003  1.00 66.15  ? 410  ILE C C     1 
ATOM   6826  O  O     . ILE C 2  410  ? 9.804   -18.992 76.439  1.00 63.65  ? 410  ILE C O     1 
ATOM   6827  C  CB    . ILE C 2  410  ? 10.973  -21.608 77.096  1.00 56.29  ? 410  ILE C CB    1 
ATOM   6828  C  CG1   . ILE C 2  410  ? 11.737  -22.546 78.027  1.00 66.97  ? 410  ILE C CG1   1 
ATOM   6829  C  CG2   . ILE C 2  410  ? 10.620  -22.293 75.795  1.00 56.46  ? 410  ILE C CG2   1 
ATOM   6830  C  CD1   . ILE C 2  410  ? 10.886  -23.693 78.560  1.00 65.72  ? 410  ILE C CD1   1 
ATOM   6831  N  N     . SER C 2  411  ? 11.361  -19.004 74.803  1.00 57.17  ? 411  SER C N     1 
ATOM   6832  C  CA    . SER C 2  411  ? 10.635  -18.081 73.938  1.00 57.26  ? 411  SER C CA    1 
ATOM   6833  C  C     . SER C 2  411  ? 10.112  -18.799 72.699  1.00 63.00  ? 411  SER C C     1 
ATOM   6834  O  O     . SER C 2  411  ? 10.779  -19.685 72.158  1.00 68.22  ? 411  SER C O     1 
ATOM   6835  C  CB    . SER C 2  411  ? 11.520  -16.902 73.520  1.00 59.27  ? 411  SER C CB    1 
ATOM   6836  O  OG    . SER C 2  411  ? 10.822  -16.026 72.647  1.00 66.16  ? 411  SER C OG    1 
ATOM   6837  N  N     . ALA C 2  412  ? 8.915   -18.417 72.255  1.00 61.83  ? 412  ALA C N     1 
ATOM   6838  C  CA    . ALA C 2  412  ? 8.311   -18.973 71.051  1.00 61.81  ? 412  ALA C CA    1 
ATOM   6839  C  C     . ALA C 2  412  ? 8.446   -18.054 69.848  1.00 73.16  ? 412  ALA C C     1 
ATOM   6840  O  O     . ALA C 2  412  ? 8.030   -18.429 68.746  1.00 72.72  ? 412  ALA C O     1 
ATOM   6841  C  CB    . ALA C 2  412  ? 6.834   -19.292 71.289  1.00 65.58  ? 412  ALA C CB    1 
ATOM   6842  N  N     . LEU C 2  413  ? 9.004   -16.863 70.039  1.00 75.55  ? 413  LEU C N     1 
ATOM   6843  C  CA    . LEU C 2  413  ? 9.328   -15.956 68.952  1.00 82.54  ? 413  LEU C CA    1 
ATOM   6844  C  C     . LEU C 2  413  ? 10.773  -16.194 68.516  1.00 84.03  ? 413  LEU C C     1 
ATOM   6845  O  O     . LEU C 2  413  ? 11.402  -17.183 68.899  1.00 86.01  ? 413  LEU C O     1 
ATOM   6846  C  CB    . LEU C 2  413  ? 9.092   -14.518 69.395  1.00 81.19  ? 413  LEU C CB    1 
ATOM   6847  C  CG    . LEU C 2  413  ? 7.737   -14.315 70.064  1.00 87.85  ? 413  LEU C CG    1 
ATOM   6848  C  CD1   . LEU C 2  413  ? 7.891   -13.865 71.531  1.00 83.95  ? 413  LEU C CD1   1 
ATOM   6849  C  CD2   . LEU C 2  413  ? 6.899   -13.336 69.250  1.00 86.13  ? 413  LEU C CD2   1 
ATOM   6850  N  N     . GLY C 2  414  ? 11.319  -15.288 67.710  1.00 98.32  ? 414  GLY C N     1 
ATOM   6851  C  CA    . GLY C 2  414  ? 12.700  -15.375 67.290  1.00 100.67 ? 414  GLY C CA    1 
ATOM   6852  C  C     . GLY C 2  414  ? 12.854  -15.886 65.869  1.00 108.02 ? 414  GLY C C     1 
ATOM   6853  O  O     . GLY C 2  414  ? 11.870  -16.108 65.153  1.00 110.42 ? 414  GLY C O     1 
ATOM   6854  N  N     . PRO C 2  415  ? 14.101  -16.074 65.431  1.00 109.82 ? 415  PRO C N     1 
ATOM   6855  C  CA    . PRO C 2  415  ? 14.342  -16.600 64.078  1.00 107.56 ? 415  PRO C CA    1 
ATOM   6856  C  C     . PRO C 2  415  ? 13.723  -17.982 63.910  1.00 107.33 ? 415  PRO C C     1 
ATOM   6857  O  O     . PRO C 2  415  ? 14.007  -18.904 64.679  1.00 112.11 ? 415  PRO C O     1 
ATOM   6858  C  CB    . PRO C 2  415  ? 15.873  -16.649 63.986  1.00 105.76 ? 415  PRO C CB    1 
ATOM   6859  C  CG    . PRO C 2  415  ? 16.354  -15.667 65.012  1.00 97.97  ? 415  PRO C CG    1 
ATOM   6860  C  CD    . PRO C 2  415  ? 15.353  -15.724 66.126  1.00 104.85 ? 415  PRO C CD    1 
ATOM   6861  N  N     . GLY C 2  416  ? 12.876  -18.122 62.889  1.00 104.04 ? 416  GLY C N     1 
ATOM   6862  C  CA    . GLY C 2  416  ? 12.066  -19.315 62.722  1.00 109.08 ? 416  GLY C CA    1 
ATOM   6863  C  C     . GLY C 2  416  ? 10.939  -19.467 63.720  1.00 101.01 ? 416  GLY C C     1 
ATOM   6864  O  O     . GLY C 2  416  ? 10.186  -20.448 63.645  1.00 89.97  ? 416  GLY C O     1 
ATOM   6865  N  N     . GLY C 2  417  ? 10.803  -18.535 64.655  1.00 94.85  ? 417  GLY C N     1 
ATOM   6866  C  CA    . GLY C 2  417  ? 9.740   -18.596 65.629  1.00 96.97  ? 417  GLY C CA    1 
ATOM   6867  C  C     . GLY C 2  417  ? 8.490   -17.904 65.146  1.00 101.18 ? 417  GLY C C     1 
ATOM   6868  O  O     . GLY C 2  417  ? 8.478   -17.250 64.105  1.00 111.15 ? 417  GLY C O     1 
ATOM   6869  N  N     . LEU C 2  418  ? 7.423   -18.073 65.921  1.00 102.39 ? 418  LEU C N     1 
ATOM   6870  C  CA    . LEU C 2  418  ? 6.142   -17.473 65.577  1.00 98.94  ? 418  LEU C CA    1 
ATOM   6871  C  C     . LEU C 2  418  ? 6.262   -15.960 65.547  1.00 103.15 ? 418  LEU C C     1 
ATOM   6872  O  O     . LEU C 2  418  ? 6.659   -15.339 66.540  1.00 100.39 ? 418  LEU C O     1 
ATOM   6873  C  CB    . LEU C 2  418  ? 5.071   -17.883 66.585  1.00 94.54  ? 418  LEU C CB    1 
ATOM   6874  C  CG    . LEU C 2  418  ? 4.649   -19.344 66.675  1.00 87.22  ? 418  LEU C CG    1 
ATOM   6875  C  CD1   . LEU C 2  418  ? 4.877   -19.852 68.089  1.00 82.71  ? 418  LEU C CD1   1 
ATOM   6876  C  CD2   . LEU C 2  418  ? 3.193   -19.483 66.271  1.00 84.09  ? 418  LEU C CD2   1 
ATOM   6877  N  N     . THR C 2  419  ? 5.930   -15.368 64.404  1.00 109.68 ? 419  THR C N     1 
ATOM   6878  C  CA    . THR C 2  419  ? 5.729   -13.930 64.367  1.00 110.78 ? 419  THR C CA    1 
ATOM   6879  C  C     . THR C 2  419  ? 4.480   -13.603 65.173  1.00 98.98  ? 419  THR C C     1 
ATOM   6880  O  O     . THR C 2  419  ? 3.505   -14.359 65.167  1.00 97.27  ? 419  THR C O     1 
ATOM   6881  C  CB    . THR C 2  419  ? 5.597   -13.430 62.924  1.00 108.32 ? 419  THR C CB    1 
ATOM   6882  O  OG1   . THR C 2  419  ? 4.358   -13.879 62.359  1.00 101.71 ? 419  THR C OG1   1 
ATOM   6883  C  CG2   . THR C 2  419  ? 6.750   -13.950 62.072  1.00 97.38  ? 419  THR C CG2   1 
ATOM   6884  N  N     . ARG C 2  420  ? 4.526   -12.499 65.908  1.00 97.75  ? 420  ARG C N     1 
ATOM   6885  C  CA    . ARG C 2  420  ? 3.366   -12.120 66.695  1.00 95.06  ? 420  ARG C CA    1 
ATOM   6886  C  C     . ARG C 2  420  ? 2.196   -11.795 65.770  1.00 103.45 ? 420  ARG C C     1 
ATOM   6887  O  O     . ARG C 2  420  ? 2.365   -11.561 64.568  1.00 107.16 ? 420  ARG C O     1 
ATOM   6888  C  CB    . ARG C 2  420  ? 3.699   -10.934 67.592  1.00 89.56  ? 420  ARG C CB    1 
ATOM   6889  C  CG    . ARG C 2  420  ? 3.050   -11.008 68.945  1.00 91.83  ? 420  ARG C CG    1 
ATOM   6890  C  CD    . ARG C 2  420  ? 3.616   -9.955  69.863  1.00 90.92  ? 420  ARG C CD    1 
ATOM   6891  N  NE    . ARG C 2  420  ? 5.068   -10.052 69.962  1.00 84.50  ? 420  ARG C NE    1 
ATOM   6892  C  CZ    . ARG C 2  420  ? 5.801   -9.319  70.791  1.00 87.44  ? 420  ARG C CZ    1 
ATOM   6893  N  NH1   . ARG C 2  420  ? 7.121   -9.460  70.828  1.00 85.56  ? 420  ARG C NH1   1 
ATOM   6894  N  NH2   . ARG C 2  420  ? 5.206   -8.443  71.588  1.00 97.31  ? 420  ARG C NH2   1 
ATOM   6895  N  N     . GLU C 2  421  ? 0.990   -11.845 66.340  1.00 105.71 ? 421  GLU C N     1 
ATOM   6896  C  CA    . GLU C 2  421  ? -0.276  -11.662 65.628  1.00 113.95 ? 421  GLU C CA    1 
ATOM   6897  C  C     . GLU C 2  421  ? -0.551  -12.871 64.738  1.00 108.53 ? 421  GLU C C     1 
ATOM   6898  O  O     . GLU C 2  421  ? -1.645  -13.011 64.182  1.00 110.48 ? 421  GLU C O     1 
ATOM   6899  C  CB    . GLU C 2  421  ? -0.294  -10.364 64.803  1.00 116.22 ? 421  GLU C CB    1 
ATOM   6900  C  CG    . GLU C 2  421  ? -0.576  -9.075  65.592  1.00 111.29 ? 421  GLU C CG    1 
ATOM   6901  C  CD    . GLU C 2  421  ? 0.652   -8.524  66.309  1.00 108.49 ? 421  GLU C CD    1 
ATOM   6902  O  OE1   . GLU C 2  421  ? 1.120   -9.168  67.270  1.00 107.01 ? 421  GLU C OE1   1 
ATOM   6903  O  OE2   . GLU C 2  421  ? 1.153   -7.448  65.908  1.00 103.76 ? 421  GLU C OE2   1 
ATOM   6904  N  N     . ARG C 2  422  ? 0.438   -13.752 64.618  1.00 101.52 ? 422  ARG C N     1 
ATOM   6905  C  CA    . ARG C 2  422  ? 0.246   -15.127 64.189  1.00 99.79  ? 422  ARG C CA    1 
ATOM   6906  C  C     . ARG C 2  422  ? 0.143   -16.061 65.386  1.00 99.26  ? 422  ARG C C     1 
ATOM   6907  O  O     . ARG C 2  422  ? -0.014  -17.274 65.212  1.00 87.58  ? 422  ARG C O     1 
ATOM   6908  C  CB    . ARG C 2  422  ? 1.401   -15.558 63.280  1.00 99.82  ? 422  ARG C CB    1 
ATOM   6909  C  CG    . ARG C 2  422  ? 0.998   -16.297 62.013  1.00 99.64  ? 422  ARG C CG    1 
ATOM   6910  C  CD    . ARG C 2  422  ? 2.201   -16.465 61.091  1.00 100.67 ? 422  ARG C CD    1 
ATOM   6911  N  NE    . ARG C 2  422  ? 1.862   -17.105 59.823  1.00 108.78 ? 422  ARG C NE    1 
ATOM   6912  C  CZ    . ARG C 2  422  ? 2.719   -17.268 58.816  1.00 109.29 ? 422  ARG C CZ    1 
ATOM   6913  N  NH1   . ARG C 2  422  ? 2.324   -17.863 57.697  1.00 103.94 ? 422  ARG C NH1   1 
ATOM   6914  N  NH2   . ARG C 2  422  ? 3.969   -16.832 58.923  1.00 102.73 ? 422  ARG C NH2   1 
ATOM   6915  N  N     . ALA C 2  423  ? 0.228   -15.510 66.595  1.00 97.57  ? 423  ALA C N     1 
ATOM   6916  C  CA    . ALA C 2  423  ? 0.193   -16.275 67.833  1.00 92.54  ? 423  ALA C CA    1 
ATOM   6917  C  C     . ALA C 2  423  ? -1.187  -16.113 68.459  1.00 91.22  ? 423  ALA C C     1 
ATOM   6918  O  O     . ALA C 2  423  ? -1.472  -15.102 69.109  1.00 90.30  ? 423  ALA C O     1 
ATOM   6919  C  CB    . ALA C 2  423  ? 1.290   -15.805 68.781  1.00 85.75  ? 423  ALA C CB    1 
ATOM   6920  N  N     . GLY C 2  424  ? -2.033  -17.118 68.274  1.00 91.36  ? 424  GLY C N     1 
ATOM   6921  C  CA    . GLY C 2  424  ? -3.388  -17.109 68.790  1.00 84.24  ? 424  GLY C CA    1 
ATOM   6922  C  C     . GLY C 2  424  ? -3.451  -17.633 70.204  1.00 90.39  ? 424  GLY C C     1 
ATOM   6923  O  O     . GLY C 2  424  ? -2.506  -17.496 70.985  1.00 88.00  ? 424  GLY C O     1 
ATOM   6924  N  N     . PHE C 2  425  ? -4.577  -18.265 70.538  1.00 93.22  ? 425  PHE C N     1 
ATOM   6925  C  CA    . PHE C 2  425  ? -4.759  -18.769 71.894  1.00 83.37  ? 425  PHE C CA    1 
ATOM   6926  C  C     . PHE C 2  425  ? -4.063  -20.106 72.124  1.00 81.42  ? 425  PHE C C     1 
ATOM   6927  O  O     . PHE C 2  425  ? -3.642  -20.393 73.250  1.00 82.99  ? 425  PHE C O     1 
ATOM   6928  C  CB    . PHE C 2  425  ? -6.247  -18.893 72.207  1.00 83.60  ? 425  PHE C CB    1 
ATOM   6929  C  CG    . PHE C 2  425  ? -6.972  -17.579 72.232  1.00 86.56  ? 425  PHE C CG    1 
ATOM   6930  C  CD1   . PHE C 2  425  ? -6.880  -16.740 73.332  1.00 94.71  ? 425  PHE C CD1   1 
ATOM   6931  C  CD2   . PHE C 2  425  ? -7.765  -17.193 71.167  1.00 82.32  ? 425  PHE C CD2   1 
ATOM   6932  C  CE1   . PHE C 2  425  ? -7.556  -15.534 73.363  1.00 90.36  ? 425  PHE C CE1   1 
ATOM   6933  C  CE2   . PHE C 2  425  ? -8.445  -15.992 71.191  1.00 82.05  ? 425  PHE C CE2   1 
ATOM   6934  C  CZ    . PHE C 2  425  ? -8.339  -15.160 72.288  1.00 87.07  ? 425  PHE C CZ    1 
ATOM   6935  N  N     . ASP C 2  426  ? -3.921  -20.929 71.085  1.00 83.75  ? 426  ASP C N     1 
ATOM   6936  C  CA    . ASP C 2  426  ? -3.381  -22.270 71.278  1.00 76.30  ? 426  ASP C CA    1 
ATOM   6937  C  C     . ASP C 2  426  ? -1.919  -22.229 71.707  1.00 80.61  ? 426  ASP C C     1 
ATOM   6938  O  O     . ASP C 2  426  ? -1.532  -22.896 72.673  1.00 83.76  ? 426  ASP C O     1 
ATOM   6939  C  CB    . ASP C 2  426  ? -3.543  -23.087 69.999  1.00 86.06  ? 426  ASP C CB    1 
ATOM   6940  C  CG    . ASP C 2  426  ? -4.961  -23.076 69.487  1.00 90.79  ? 426  ASP C CG    1 
ATOM   6941  O  OD1   . ASP C 2  426  ? -5.881  -22.862 70.304  1.00 87.69  ? 426  ASP C OD1   1 
ATOM   6942  O  OD2   . ASP C 2  426  ? -5.154  -23.274 68.269  1.00 99.48  ? 426  ASP C OD2   1 
ATOM   6943  N  N     . VAL C 2  427  ? -1.085  -21.465 70.990  1.00 79.16  ? 427  VAL C N     1 
ATOM   6944  C  CA    . VAL C 2  427  ? 0.330   -21.373 71.348  1.00 71.34  ? 427  VAL C CA    1 
ATOM   6945  C  C     . VAL C 2  427  ? 0.489   -20.848 72.765  1.00 75.81  ? 427  VAL C C     1 
ATOM   6946  O  O     . VAL C 2  427  ? 1.368   -21.292 73.514  1.00 70.15  ? 427  VAL C O     1 
ATOM   6947  C  CB    . VAL C 2  427  ? 1.089   -20.482 70.347  1.00 73.82  ? 427  VAL C CB    1 
ATOM   6948  C  CG1   . VAL C 2  427  ? 1.725   -21.319 69.288  1.00 81.24  ? 427  VAL C CG1   1 
ATOM   6949  C  CG2   . VAL C 2  427  ? 0.156   -19.456 69.729  1.00 78.78  ? 427  VAL C CG2   1 
ATOM   6950  N  N     . ARG C 2  428  ? -0.349  -19.887 73.154  1.00 75.04  ? 428  ARG C N     1 
ATOM   6951  C  CA    . ARG C 2  428  ? -0.195  -19.244 74.450  1.00 67.07  ? 428  ARG C CA    1 
ATOM   6952  C  C     . ARG C 2  428  ? -0.828  -20.047 75.576  1.00 62.66  ? 428  ARG C C     1 
ATOM   6953  O  O     . ARG C 2  428  ? -0.506  -19.803 76.744  1.00 63.02  ? 428  ARG C O     1 
ATOM   6954  C  CB    . ARG C 2  428  ? -0.785  -17.833 74.405  1.00 64.76  ? 428  ARG C CB    1 
ATOM   6955  C  CG    . ARG C 2  428  ? -0.218  -16.970 73.288  1.00 64.94  ? 428  ARG C CG    1 
ATOM   6956  C  CD    . ARG C 2  428  ? -1.058  -15.718 73.064  1.00 62.53  ? 428  ARG C CD    1 
ATOM   6957  N  NE    . ARG C 2  428  ? -0.294  -14.499 73.295  1.00 60.49  ? 428  ARG C NE    1 
ATOM   6958  C  CZ    . ARG C 2  428  ? 0.046   -13.634 72.346  1.00 65.43  ? 428  ARG C CZ    1 
ATOM   6959  N  NH1   . ARG C 2  428  ? -0.312  -13.830 71.083  1.00 66.95  ? 428  ARG C NH1   1 
ATOM   6960  N  NH2   . ARG C 2  428  ? 0.745   -12.561 72.668  1.00 70.84  ? 428  ARG C NH2   1 
ATOM   6961  N  N     . ASP C 2  429  ? -1.708  -20.996 75.259  1.00 61.05  ? 429  ASP C N     1 
ATOM   6962  C  CA    . ASP C 2  429  ? -2.335  -21.810 76.292  1.00 66.83  ? 429  ASP C CA    1 
ATOM   6963  C  C     . ASP C 2  429  ? -1.282  -22.568 77.096  1.00 63.97  ? 429  ASP C C     1 
ATOM   6964  O  O     . ASP C 2  429  ? -0.160  -22.795 76.642  1.00 73.17  ? 429  ASP C O     1 
ATOM   6965  C  CB    . ASP C 2  429  ? -3.310  -22.813 75.670  1.00 67.48  ? 429  ASP C CB    1 
ATOM   6966  C  CG    . ASP C 2  429  ? -4.722  -22.273 75.553  1.00 79.05  ? 429  ASP C CG    1 
ATOM   6967  O  OD1   . ASP C 2  429  ? -5.089  -21.383 76.348  1.00 82.03  ? 429  ASP C OD1   1 
ATOM   6968  O  OD2   . ASP C 2  429  ? -5.474  -22.755 74.678  1.00 78.66  ? 429  ASP C OD2   1 
ATOM   6969  N  N     . VAL C 2  430  ? -1.647  -22.963 78.310  1.00 66.00  ? 430  VAL C N     1 
ATOM   6970  C  CA    . VAL C 2  430  ? -0.884  -23.976 79.029  1.00 70.32  ? 430  VAL C CA    1 
ATOM   6971  C  C     . VAL C 2  430  ? -1.531  -25.313 78.678  1.00 69.31  ? 430  VAL C C     1 
ATOM   6972  O  O     . VAL C 2  430  ? -2.715  -25.534 78.945  1.00 65.79  ? 430  VAL C O     1 
ATOM   6973  C  CB    . VAL C 2  430  ? -0.818  -23.706 80.545  1.00 63.62  ? 430  VAL C CB    1 
ATOM   6974  C  CG1   . VAL C 2  430  ? -1.560  -22.429 80.918  1.00 62.79  ? 430  VAL C CG1   1 
ATOM   6975  C  CG2   . VAL C 2  430  ? -1.281  -24.899 81.382  1.00 61.62  ? 430  VAL C CG2   1 
ATOM   6976  N  N     . HIS C 2  431  ? -0.783  -26.146 77.957  1.00 66.96  ? 431  HIS C N     1 
ATOM   6977  C  CA    . HIS C 2  431  ? -1.227  -27.469 77.553  1.00 63.19  ? 431  HIS C CA    1 
ATOM   6978  C  C     . HIS C 2  431  ? -1.115  -28.397 78.748  1.00 66.11  ? 431  HIS C C     1 
ATOM   6979  O  O     . HIS C 2  431  ? -0.256  -28.207 79.611  1.00 68.37  ? 431  HIS C O     1 
ATOM   6980  C  CB    . HIS C 2  431  ? -0.365  -27.980 76.395  1.00 68.65  ? 431  HIS C CB    1 
ATOM   6981  C  CG    . HIS C 2  431  ? -0.996  -29.070 75.588  1.00 67.98  ? 431  HIS C CG    1 
ATOM   6982  N  ND1   . HIS C 2  431  ? -1.029  -30.383 76.005  1.00 64.13  ? 431  HIS C ND1   1 
ATOM   6983  C  CD2   . HIS C 2  431  ? -1.600  -29.044 74.376  1.00 66.61  ? 431  HIS C CD2   1 
ATOM   6984  C  CE1   . HIS C 2  431  ? -1.638  -31.116 75.089  1.00 68.65  ? 431  HIS C CE1   1 
ATOM   6985  N  NE2   . HIS C 2  431  ? -1.996  -30.327 74.092  1.00 63.32  ? 431  HIS C NE2   1 
ATOM   6986  N  N     . ARG C 2  432  ? -2.008  -29.390 78.813  1.00 65.21  ? 432  ARG C N     1 
ATOM   6987  C  CA    . ARG C 2  432  ? -1.970  -30.331 79.929  1.00 64.24  ? 432  ARG C CA    1 
ATOM   6988  C  C     . ARG C 2  432  ? -0.572  -30.910 80.111  1.00 65.59  ? 432  ARG C C     1 
ATOM   6989  O  O     . ARG C 2  432  ? -0.112  -31.102 81.244  1.00 63.35  ? 432  ARG C O     1 
ATOM   6990  C  CB    . ARG C 2  432  ? -3.000  -31.444 79.714  1.00 62.84  ? 432  ARG C CB    1 
ATOM   6991  C  CG    . ARG C 2  432  ? -2.740  -32.328 78.505  1.00 66.11  ? 432  ARG C CG    1 
ATOM   6992  C  CD    . ARG C 2  432  ? -3.793  -33.417 78.372  1.00 65.53  ? 432  ARG C CD    1 
ATOM   6993  N  NE    . ARG C 2  432  ? -3.573  -34.261 77.199  1.00 67.68  ? 432  ARG C NE    1 
ATOM   6994  C  CZ    . ARG C 2  432  ? -2.723  -35.284 77.166  1.00 67.85  ? 432  ARG C CZ    1 
ATOM   6995  N  NH1   . ARG C 2  432  ? -2.005  -35.591 78.238  1.00 66.07  ? 432  ARG C NH1   1 
ATOM   6996  N  NH2   . ARG C 2  432  ? -2.587  -35.999 76.059  1.00 67.39  ? 432  ARG C NH2   1 
ATOM   6997  N  N     . THR C 2  433  ? 0.136   -31.129 79.004  1.00 60.33  ? 433  THR C N     1 
ATOM   6998  C  CA    . THR C 2  433  ? 1.487   -31.660 79.021  1.00 58.40  ? 433  THR C CA    1 
ATOM   6999  C  C     . THR C 2  433  ? 2.506   -30.678 79.577  1.00 64.17  ? 433  THR C C     1 
ATOM   7000  O  O     . THR C 2  433  ? 3.668   -31.061 79.742  1.00 64.65  ? 433  THR C O     1 
ATOM   7001  C  CB    . THR C 2  433  ? 1.888   -32.065 77.606  1.00 67.31  ? 433  THR C CB    1 
ATOM   7002  O  OG1   . THR C 2  433  ? 1.625   -30.974 76.714  1.00 70.80  ? 433  THR C OG1   1 
ATOM   7003  C  CG2   . THR C 2  433  ? 1.097   -33.285 77.150  1.00 66.10  ? 433  THR C CG2   1 
ATOM   7004  N  N     . HIS C 2  434  ? 2.117   -29.430 79.859  1.00 66.11  ? 434  HIS C N     1 
ATOM   7005  C  CA    . HIS C 2  434  ? 3.042   -28.516 80.521  1.00 65.63  ? 434  HIS C CA    1 
ATOM   7006  C  C     . HIS C 2  434  ? 3.395   -28.996 81.920  1.00 66.21  ? 434  HIS C C     1 
ATOM   7007  O  O     . HIS C 2  434  ? 4.426   -28.582 82.463  1.00 71.83  ? 434  HIS C O     1 
ATOM   7008  C  CB    . HIS C 2  434  ? 2.456   -27.103 80.609  1.00 67.19  ? 434  HIS C CB    1 
ATOM   7009  C  CG    . HIS C 2  434  ? 2.518   -26.326 79.332  1.00 61.96  ? 434  HIS C CG    1 
ATOM   7010  N  ND1   . HIS C 2  434  ? 2.308   -26.899 78.098  1.00 70.25  ? 434  HIS C ND1   1 
ATOM   7011  C  CD2   . HIS C 2  434  ? 2.745   -25.012 79.102  1.00 63.33  ? 434  HIS C CD2   1 
ATOM   7012  C  CE1   . HIS C 2  434  ? 2.416   -25.975 77.160  1.00 65.28  ? 434  HIS C CE1   1 
ATOM   7013  N  NE2   . HIS C 2  434  ? 2.680   -24.821 77.744  1.00 69.41  ? 434  HIS C NE2   1 
ATOM   7014  N  N     . TYR C 2  435  ? 2.563   -29.860 82.500  1.00 58.39  ? 435  TYR C N     1 
ATOM   7015  C  CA    . TYR C 2  435  ? 2.759   -30.374 83.850  1.00 60.50  ? 435  TYR C CA    1 
ATOM   7016  C  C     . TYR C 2  435  ? 4.177   -30.887 84.056  1.00 61.31  ? 435  TYR C C     1 
ATOM   7017  O  O     . TYR C 2  435  ? 4.618   -31.816 83.375  1.00 68.80  ? 435  TYR C O     1 
ATOM   7018  C  CB    . TYR C 2  435  ? 1.753   -31.497 84.107  1.00 64.87  ? 435  TYR C CB    1 
ATOM   7019  C  CG    . TYR C 2  435  ? 1.613   -31.893 85.555  1.00 70.38  ? 435  TYR C CG    1 
ATOM   7020  C  CD1   . TYR C 2  435  ? 2.578   -32.670 86.186  1.00 72.10  ? 435  TYR C CD1   1 
ATOM   7021  C  CD2   . TYR C 2  435  ? 0.508   -31.498 86.292  1.00 71.26  ? 435  TYR C CD2   1 
ATOM   7022  C  CE1   . TYR C 2  435  ? 2.445   -33.034 87.511  1.00 69.64  ? 435  TYR C CE1   1 
ATOM   7023  C  CE2   . TYR C 2  435  ? 0.364   -31.862 87.615  1.00 70.42  ? 435  TYR C CE2   1 
ATOM   7024  C  CZ    . TYR C 2  435  ? 1.336   -32.629 88.219  1.00 71.93  ? 435  TYR C CZ    1 
ATOM   7025  O  OH    . TYR C 2  435  ? 1.197   -32.992 89.539  1.00 76.23  ? 435  TYR C OH    1 
ATOM   7026  N  N     . GLY C 2  436  ? 4.885   -30.291 85.009  1.00 63.22  ? 436  GLY C N     1 
ATOM   7027  C  CA    . GLY C 2  436  ? 6.217   -30.734 85.343  1.00 69.27  ? 436  GLY C CA    1 
ATOM   7028  C  C     . GLY C 2  436  ? 7.311   -30.259 84.414  1.00 71.00  ? 436  GLY C C     1 
ATOM   7029  O  O     . GLY C 2  436  ? 8.491   -30.517 84.694  1.00 72.76  ? 436  GLY C O     1 
ATOM   7030  N  N     . ARG C 2  437  ? 6.971   -29.565 83.327  1.00 61.87  ? 437  ARG C N     1 
ATOM   7031  C  CA    . ARG C 2  437  ? 7.947   -29.144 82.329  1.00 68.18  ? 437  ARG C CA    1 
ATOM   7032  C  C     . ARG C 2  437  ? 8.041   -27.634 82.188  1.00 66.59  ? 437  ARG C C     1 
ATOM   7033  O  O     . ARG C 2  437  ? 9.137   -27.071 82.278  1.00 60.30  ? 437  ARG C O     1 
ATOM   7034  C  CB    . ARG C 2  437  ? 7.588   -29.785 80.979  1.00 70.38  ? 437  ARG C CB    1 
ATOM   7035  C  CG    . ARG C 2  437  ? 7.624   -31.304 81.009  1.00 66.11  ? 437  ARG C CG    1 
ATOM   7036  C  CD    . ARG C 2  437  ? 6.916   -31.916 79.817  1.00 63.03  ? 437  ARG C CD    1 
ATOM   7037  N  NE    . ARG C 2  437  ? 6.943   -33.377 79.867  1.00 68.46  ? 437  ARG C NE    1 
ATOM   7038  C  CZ    . ARG C 2  437  ? 6.078   -34.125 80.547  1.00 71.38  ? 437  ARG C CZ    1 
ATOM   7039  N  NH1   . ARG C 2  437  ? 5.104   -33.559 81.246  1.00 73.96  ? 437  ARG C NH1   1 
ATOM   7040  N  NH2   . ARG C 2  437  ? 6.188   -35.443 80.532  1.00 70.86  ? 437  ARG C NH2   1 
ATOM   7041  N  N     . ILE C 2  438  ? 6.918   -26.965 81.972  1.00 70.03  ? 438  ILE C N     1 
ATOM   7042  C  CA    . ILE C 2  438  ? 6.867   -25.523 81.777  1.00 67.35  ? 438  ILE C CA    1 
ATOM   7043  C  C     . ILE C 2  438  ? 5.923   -24.940 82.812  1.00 56.62  ? 438  ILE C C     1 
ATOM   7044  O  O     . ILE C 2  438  ? 4.756   -25.340 82.879  1.00 62.30  ? 438  ILE C O     1 
ATOM   7045  C  CB    . ILE C 2  438  ? 6.393   -25.171 80.360  1.00 65.71  ? 438  ILE C CB    1 
ATOM   7046  C  CG1   . ILE C 2  438  ? 7.424   -25.627 79.328  1.00 56.25  ? 438  ILE C CG1   1 
ATOM   7047  C  CG2   . ILE C 2  438  ? 6.106   -23.697 80.264  1.00 56.05  ? 438  ILE C CG2   1 
ATOM   7048  C  CD1   . ILE C 2  438  ? 6.856   -25.725 77.948  1.00 61.28  ? 438  ILE C CD1   1 
ATOM   7049  N  N     . CYS C 2  439  ? 6.413   -23.984 83.594  1.00 59.01  ? 439  CYS C N     1 
ATOM   7050  C  CA    . CYS C 2  439  ? 5.629   -23.469 84.711  1.00 62.41  ? 439  CYS C CA    1 
ATOM   7051  C  C     . CYS C 2  439  ? 4.324   -22.860 84.213  1.00 57.77  ? 439  CYS C C     1 
ATOM   7052  O  O     . CYS C 2  439  ? 4.328   -22.090 83.242  1.00 57.94  ? 439  CYS C O     1 
ATOM   7053  C  CB    . CYS C 2  439  ? 6.396   -22.420 85.509  1.00 60.88  ? 439  CYS C CB    1 
ATOM   7054  S  SG    . CYS C 2  439  ? 5.336   -21.647 86.765  1.00 68.43  ? 439  CYS C SG    1 
ATOM   7055  N  N     . PRO C 2  440  ? 3.193   -23.171 84.845  1.00 60.98  ? 440  PRO C N     1 
ATOM   7056  C  CA    . PRO C 2  440  ? 1.932   -22.573 84.410  1.00 64.36  ? 440  PRO C CA    1 
ATOM   7057  C  C     . PRO C 2  440  ? 1.698   -21.151 84.899  1.00 62.86  ? 440  PRO C C     1 
ATOM   7058  O  O     . PRO C 2  440  ? 0.713   -20.554 84.446  1.00 67.40  ? 440  PRO C O     1 
ATOM   7059  C  CB    . PRO C 2  440  ? 0.882   -23.531 84.983  1.00 54.24  ? 440  PRO C CB    1 
ATOM   7060  C  CG    . PRO C 2  440  ? 1.532   -24.093 86.194  1.00 56.21  ? 440  PRO C CG    1 
ATOM   7061  C  CD    . PRO C 2  440  ? 2.994   -24.193 85.886  1.00 56.81  ? 440  PRO C CD    1 
ATOM   7062  N  N     . VAL C 2  441  ? 2.525   -20.581 85.781  1.00 59.83  ? 441  VAL C N     1 
ATOM   7063  C  CA    . VAL C 2  441  ? 2.260   -19.231 86.275  1.00 62.99  ? 441  VAL C CA    1 
ATOM   7064  C  C     . VAL C 2  441  ? 3.259   -18.208 85.740  1.00 61.76  ? 441  VAL C C     1 
ATOM   7065  O  O     . VAL C 2  441  ? 2.881   -17.063 85.488  1.00 67.82  ? 441  VAL C O     1 
ATOM   7066  C  CB    . VAL C 2  441  ? 2.164   -19.169 87.820  1.00 61.48  ? 441  VAL C CB    1 
ATOM   7067  C  CG1   . VAL C 2  441  ? 2.000   -20.553 88.442  1.00 70.75  ? 441  VAL C CG1   1 
ATOM   7068  C  CG2   . VAL C 2  441  ? 3.333   -18.403 88.427  1.00 62.75  ? 441  VAL C CG2   1 
ATOM   7069  N  N     . GLU C 2  442  ? 4.533   -18.556 85.569  1.00 57.96  ? 442  GLU C N     1 
ATOM   7070  C  CA    . GLU C 2  442  ? 5.512   -17.512 85.260  1.00 64.21  ? 442  GLU C CA    1 
ATOM   7071  C  C     . GLU C 2  442  ? 5.513   -17.208 83.768  1.00 63.92  ? 442  GLU C C     1 
ATOM   7072  O  O     . GLU C 2  442  ? 6.161   -17.896 82.978  1.00 63.17  ? 442  GLU C O     1 
ATOM   7073  C  CB    . GLU C 2  442  ? 6.914   -17.884 85.717  1.00 65.89  ? 442  GLU C CB    1 
ATOM   7074  C  CG    . GLU C 2  442  ? 7.842   -16.686 85.565  1.00 63.71  ? 442  GLU C CG    1 
ATOM   7075  C  CD    . GLU C 2  442  ? 9.303   -17.045 85.590  1.00 69.35  ? 442  GLU C CD    1 
ATOM   7076  O  OE1   . GLU C 2  442  ? 9.790   -17.552 86.623  1.00 70.37  ? 442  GLU C OE1   1 
ATOM   7077  O  OE2   . GLU C 2  442  ? 9.962   -16.826 84.554  1.00 90.81  ? 442  GLU C OE2   1 
ATOM   7078  N  N     . THR C 2  443  ? 4.820   -16.141 83.398  1.00 61.14  ? 443  THR C N     1 
ATOM   7079  C  CA    . THR C 2  443  ? 4.762   -15.631 82.039  1.00 64.27  ? 443  THR C CA    1 
ATOM   7080  C  C     . THR C 2  443  ? 4.535   -14.130 82.145  1.00 62.34  ? 443  THR C C     1 
ATOM   7081  O  O     . THR C 2  443  ? 4.084   -13.645 83.187  1.00 57.53  ? 443  THR C O     1 
ATOM   7082  C  CB    . THR C 2  443  ? 3.647   -16.331 81.239  1.00 60.53  ? 443  THR C CB    1 
ATOM   7083  O  OG1   . THR C 2  443  ? 3.759   -16.032 79.845  1.00 64.12  ? 443  THR C OG1   1 
ATOM   7084  C  CG2   . THR C 2  443  ? 2.282   -15.913 81.721  1.00 57.20  ? 443  THR C CG2   1 
ATOM   7085  N  N     . PRO C 2  444  ? 4.894   -13.363 81.123  1.00 63.23  ? 444  PRO C N     1 
ATOM   7086  C  CA    . PRO C 2  444  ? 4.675   -11.915 81.208  1.00 64.47  ? 444  PRO C CA    1 
ATOM   7087  C  C     . PRO C 2  444  ? 3.201   -11.584 81.069  1.00 64.15  ? 444  PRO C C     1 
ATOM   7088  O  O     . PRO C 2  444  ? 2.442   -12.299 80.411  1.00 65.82  ? 444  PRO C O     1 
ATOM   7089  C  CB    . PRO C 2  444  ? 5.479   -11.356 80.027  1.00 66.48  ? 444  PRO C CB    1 
ATOM   7090  C  CG    . PRO C 2  444  ? 6.351   -12.469 79.566  1.00 65.99  ? 444  PRO C CG    1 
ATOM   7091  C  CD    . PRO C 2  444  ? 5.637   -13.730 79.911  1.00 62.29  ? 444  PRO C CD    1 
ATOM   7092  N  N     . GLU C 2  445  ? 2.788   -10.496 81.707  1.00 65.87  ? 445  GLU C N     1 
ATOM   7093  C  CA    . GLU C 2  445  ? 1.460   -9.967  81.440  1.00 64.18  ? 445  GLU C CA    1 
ATOM   7094  C  C     . GLU C 2  445  ? 1.535   -9.005  80.263  1.00 74.12  ? 445  GLU C C     1 
ATOM   7095  O  O     . GLU C 2  445  ? 2.537   -8.308  80.066  1.00 70.28  ? 445  GLU C O     1 
ATOM   7096  C  CB    . GLU C 2  445  ? 0.871   -9.264  82.662  1.00 65.63  ? 445  GLU C CB    1 
ATOM   7097  C  CG    . GLU C 2  445  ? 1.851   -8.973  83.785  1.00 70.97  ? 445  GLU C CG    1 
ATOM   7098  C  CD    . GLU C 2  445  ? 1.193   -8.247  84.952  1.00 74.85  ? 445  GLU C CD    1 
ATOM   7099  O  OE1   . GLU C 2  445  ? -0.033  -7.994  84.885  1.00 72.32  ? 445  GLU C OE1   1 
ATOM   7100  O  OE2   . GLU C 2  445  ? 1.900   -7.929  85.932  1.00 77.02  ? 445  GLU C OE2   1 
ATOM   7101  N  N     . GLY C 2  446  ? 0.474   -8.989  79.462  1.00 68.84  ? 446  GLY C N     1 
ATOM   7102  C  CA    . GLY C 2  446  ? 0.478   -8.153  78.276  1.00 59.80  ? 446  GLY C CA    1 
ATOM   7103  C  C     . GLY C 2  446  ? 0.738   -8.903  76.986  1.00 67.95  ? 446  GLY C C     1 
ATOM   7104  O  O     . GLY C 2  446  ? 0.369   -10.073 76.860  1.00 65.59  ? 446  GLY C O     1 
ATOM   7105  N  N     . ALA C 2  447  ? 1.396   -8.245  76.027  1.00 75.94  ? 447  ALA C N     1 
ATOM   7106  C  CA    . ALA C 2  447  ? 1.497   -8.797  74.679  1.00 61.39  ? 447  ALA C CA    1 
ATOM   7107  C  C     . ALA C 2  447  ? 2.211   -10.143 74.664  1.00 61.99  ? 447  ALA C C     1 
ATOM   7108  O  O     . ALA C 2  447  ? 1.830   -11.047 73.913  1.00 64.28  ? 447  ALA C O     1 
ATOM   7109  C  CB    . ALA C 2  447  ? 2.208   -7.806  73.761  1.00 73.90  ? 447  ALA C CB    1 
ATOM   7110  N  N     . ASN C 2  448  ? 3.244   -10.302 75.477  1.00 66.57  ? 448  ASN C N     1 
ATOM   7111  C  CA    . ASN C 2  448  ? 4.048   -11.515 75.409  1.00 62.71  ? 448  ASN C CA    1 
ATOM   7112  C  C     . ASN C 2  448  ? 3.460   -12.689 76.188  1.00 68.71  ? 448  ASN C C     1 
ATOM   7113  O  O     . ASN C 2  448  ? 4.149   -13.704 76.335  1.00 69.49  ? 448  ASN C O     1 
ATOM   7114  C  CB    . ASN C 2  448  ? 5.461   -11.233 75.916  1.00 62.98  ? 448  ASN C CB    1 
ATOM   7115  C  CG    . ASN C 2  448  ? 6.314   -10.537 74.889  1.00 62.40  ? 448  ASN C CG    1 
ATOM   7116  O  OD1   . ASN C 2  448  ? 6.078   -10.660 73.689  1.00 69.92  ? 448  ASN C OD1   1 
ATOM   7117  N  ND2   . ASN C 2  448  ? 7.323   -9.805  75.353  1.00 67.18  ? 448  ASN C ND2   1 
ATOM   7118  N  N     . ILE C 2  449  ? 2.225   -12.596 76.690  1.00 69.92  ? 449  ILE C N     1 
ATOM   7119  C  CA    . ILE C 2  449  ? 1.725   -13.637 77.579  1.00 62.24  ? 449  ILE C CA    1 
ATOM   7120  C  C     . ILE C 2  449  ? 1.623   -14.957 76.825  1.00 63.87  ? 449  ILE C C     1 
ATOM   7121  O  O     . ILE C 2  449  ? 1.143   -15.012 75.683  1.00 65.72  ? 449  ILE C O     1 
ATOM   7122  C  CB    . ILE C 2  449  ? 0.380   -13.227 78.195  1.00 54.99  ? 449  ILE C CB    1 
ATOM   7123  C  CG1   . ILE C 2  449  ? -0.075  -14.301 79.184  1.00 56.19  ? 449  ILE C CG1   1 
ATOM   7124  C  CG2   . ILE C 2  449  ? -0.664  -12.980 77.124  1.00 58.29  ? 449  ILE C CG2   1 
ATOM   7125  C  CD1   . ILE C 2  449  ? -1.541  -14.284 79.480  1.00 66.30  ? 449  ILE C CD1   1 
ATOM   7126  N  N     . GLY C 2  450  ? 2.100   -16.030 77.460  1.00 60.70  ? 450  GLY C N     1 
ATOM   7127  C  CA    . GLY C 2  450  ? 2.115   -17.344 76.857  1.00 63.40  ? 450  GLY C CA    1 
ATOM   7128  C  C     . GLY C 2  450  ? 3.260   -17.614 75.900  1.00 65.35  ? 450  GLY C C     1 
ATOM   7129  O  O     . GLY C 2  450  ? 3.548   -18.784 75.630  1.00 68.67  ? 450  GLY C O     1 
ATOM   7130  N  N     . LEU C 2  451  ? 3.921   -16.574 75.371  1.00 59.96  ? 451  LEU C N     1 
ATOM   7131  C  CA    . LEU C 2  451  ? 5.013   -16.739 74.418  1.00 61.19  ? 451  LEU C CA    1 
ATOM   7132  C  C     . LEU C 2  451  ? 6.386   -16.789 75.073  1.00 66.33  ? 451  LEU C C     1 
ATOM   7133  O  O     . LEU C 2  451  ? 7.324   -17.323 74.466  1.00 61.46  ? 451  LEU C O     1 
ATOM   7134  C  CB    . LEU C 2  451  ? 5.001   -15.607 73.391  1.00 62.82  ? 451  LEU C CB    1 
ATOM   7135  C  CG    . LEU C 2  451  ? 3.671   -15.353 72.690  1.00 61.84  ? 451  LEU C CG    1 
ATOM   7136  C  CD1   . LEU C 2  451  ? 3.826   -14.199 71.721  1.00 62.68  ? 451  LEU C CD1   1 
ATOM   7137  C  CD2   . LEU C 2  451  ? 3.187   -16.605 71.984  1.00 60.18  ? 451  LEU C CD2   1 
ATOM   7138  N  N     . ILE C 2  452  ? 6.535   -16.230 76.274  1.00 56.57  ? 452  ILE C N     1 
ATOM   7139  C  CA    . ILE C 2  452  ? 7.737   -16.384 77.085  1.00 55.21  ? 452  ILE C CA    1 
ATOM   7140  C  C     . ILE C 2  452  ? 7.335   -17.175 78.318  1.00 62.21  ? 452  ILE C C     1 
ATOM   7141  O  O     . ILE C 2  452  ? 6.419   -16.770 79.041  1.00 68.40  ? 452  ILE C O     1 
ATOM   7142  C  CB    . ILE C 2  452  ? 8.353   -15.038 77.495  1.00 56.72  ? 452  ILE C CB    1 
ATOM   7143  C  CG1   . ILE C 2  452  ? 8.402   -14.055 76.323  1.00 57.91  ? 452  ILE C CG1   1 
ATOM   7144  C  CG2   . ILE C 2  452  ? 9.733   -15.257 78.090  1.00 55.63  ? 452  ILE C CG2   1 
ATOM   7145  C  CD1   . ILE C 2  452  ? 9.197   -14.530 75.148  1.00 68.00  ? 452  ILE C CD1   1 
ATOM   7146  N  N     . THR C 2  453  ? 8.008   -18.299 78.558  1.00 63.63  ? 453  THR C N     1 
ATOM   7147  C  CA    . THR C 2  453  ? 7.673   -19.204 79.653  1.00 62.60  ? 453  THR C CA    1 
ATOM   7148  C  C     . THR C 2  453  ? 8.954   -19.622 80.370  1.00 60.81  ? 453  THR C C     1 
ATOM   7149  O  O     . THR C 2  453  ? 10.053  -19.172 80.031  1.00 65.98  ? 453  THR C O     1 
ATOM   7150  C  CB    . THR C 2  453  ? 6.894   -20.426 79.144  1.00 64.31  ? 453  THR C CB    1 
ATOM   7151  O  OG1   . THR C 2  453  ? 7.712   -21.188 78.245  1.00 60.57  ? 453  THR C OG1   1 
ATOM   7152  C  CG2   . THR C 2  453  ? 5.614   -19.994 78.418  1.00 60.97  ? 453  THR C CG2   1 
ATOM   7153  N  N     . SER C 2  454  ? 8.816   -20.502 81.367  1.00 60.65  ? 454  SER C N     1 
ATOM   7154  C  CA    . SER C 2  454  ? 9.943   -20.893 82.204  1.00 57.45  ? 454  SER C CA    1 
ATOM   7155  C  C     . SER C 2  454  ? 9.994   -22.400 82.420  1.00 60.48  ? 454  SER C C     1 
ATOM   7156  O  O     . SER C 2  454  ? 8.963   -23.053 82.620  1.00 59.21  ? 454  SER C O     1 
ATOM   7157  C  CB    . SER C 2  454  ? 9.904   -20.185 83.553  1.00 55.40  ? 454  SER C CB    1 
ATOM   7158  O  OG    . SER C 2  454  ? 10.960  -19.244 83.643  1.00 68.28  ? 454  SER C OG    1 
ATOM   7159  N  N     . LEU C 2  455  ? 11.217  -22.932 82.366  1.00 63.00  ? 455  LEU C N     1 
ATOM   7160  C  CA    . LEU C 2  455  ? 11.487  -24.338 82.635  1.00 59.50  ? 455  LEU C CA    1 
ATOM   7161  C  C     . LEU C 2  455  ? 11.091  -24.667 84.062  1.00 61.64  ? 455  LEU C C     1 
ATOM   7162  O  O     . LEU C 2  455  ? 11.500  -23.973 84.997  1.00 59.30  ? 455  LEU C O     1 
ATOM   7163  C  CB    . LEU C 2  455  ? 12.980  -24.619 82.438  1.00 63.66  ? 455  LEU C CB    1 
ATOM   7164  C  CG    . LEU C 2  455  ? 13.565  -25.808 81.669  1.00 67.08  ? 455  LEU C CG    1 
ATOM   7165  C  CD1   . LEU C 2  455  ? 14.644  -26.467 82.517  1.00 61.66  ? 455  LEU C CD1   1 
ATOM   7166  C  CD2   . LEU C 2  455  ? 12.516  -26.815 81.202  1.00 65.83  ? 455  LEU C CD2   1 
ATOM   7167  N  N     . ALA C 2  456  ? 10.305  -25.729 84.236  1.00 60.27  ? 456  ALA C N     1 
ATOM   7168  C  CA    . ALA C 2  456  ? 9.939   -26.152 85.581  1.00 63.41  ? 456  ALA C CA    1 
ATOM   7169  C  C     . ALA C 2  456  ? 11.184  -26.584 86.362  1.00 66.77  ? 456  ALA C C     1 
ATOM   7170  O  O     . ALA C 2  456  ? 12.205  -26.978 85.791  1.00 72.21  ? 456  ALA C O     1 
ATOM   7171  C  CB    . ALA C 2  456  ? 8.911   -27.283 85.532  1.00 69.47  ? 456  ALA C CB    1 
ATOM   7172  N  N     . ALA C 2  457  ? 11.075  -26.524 87.694  1.00 58.54  ? 457  ALA C N     1 
ATOM   7173  C  CA    . ALA C 2  457  ? 12.256  -26.597 88.553  1.00 65.39  ? 457  ALA C CA    1 
ATOM   7174  C  C     . ALA C 2  457  ? 12.986  -27.934 88.426  1.00 66.71  ? 457  ALA C C     1 
ATOM   7175  O  O     . ALA C 2  457  ? 14.223  -27.973 88.434  1.00 65.15  ? 457  ALA C O     1 
ATOM   7176  C  CB    . ALA C 2  457  ? 11.854  -26.336 90.005  1.00 63.19  ? 457  ALA C CB    1 
ATOM   7177  N  N     . TYR C 2  458  ? 12.247  -29.038 88.329  1.00 67.55  ? 458  TYR C N     1 
ATOM   7178  C  CA    . TYR C 2  458  ? 12.842  -30.360 88.154  1.00 72.89  ? 458  TYR C CA    1 
ATOM   7179  C  C     . TYR C 2  458  ? 13.035  -30.738 86.692  1.00 73.01  ? 458  TYR C C     1 
ATOM   7180  O  O     . TYR C 2  458  ? 13.606  -31.797 86.413  1.00 72.57  ? 458  TYR C O     1 
ATOM   7181  C  CB    . TYR C 2  458  ? 11.976  -31.432 88.826  1.00 76.95  ? 458  TYR C CB    1 
ATOM   7182  C  CG    . TYR C 2  458  ? 12.271  -31.666 90.290  1.00 74.39  ? 458  TYR C CG    1 
ATOM   7183  C  CD1   . TYR C 2  458  ? 13.367  -32.421 90.687  1.00 72.88  ? 458  TYR C CD1   1 
ATOM   7184  C  CD2   . TYR C 2  458  ? 11.444  -31.144 91.274  1.00 75.25  ? 458  TYR C CD2   1 
ATOM   7185  C  CE1   . TYR C 2  458  ? 13.632  -32.640 92.025  1.00 76.51  ? 458  TYR C CE1   1 
ATOM   7186  C  CE2   . TYR C 2  458  ? 11.700  -31.357 92.613  1.00 75.09  ? 458  TYR C CE2   1 
ATOM   7187  C  CZ    . TYR C 2  458  ? 12.792  -32.106 92.981  1.00 74.86  ? 458  TYR C CZ    1 
ATOM   7188  O  OH    . TYR C 2  458  ? 13.045  -32.314 94.312  1.00 75.81  ? 458  TYR C OH    1 
ATOM   7189  N  N     . ALA C 2  459  ? 12.579  -29.903 85.764  1.00 70.19  ? 459  ALA C N     1 
ATOM   7190  C  CA    . ALA C 2  459  ? 12.488  -30.299 84.370  1.00 69.45  ? 459  ALA C CA    1 
ATOM   7191  C  C     . ALA C 2  459  ? 13.864  -30.359 83.713  1.00 75.56  ? 459  ALA C C     1 
ATOM   7192  O  O     . ALA C 2  459  ? 14.816  -29.692 84.133  1.00 75.73  ? 459  ALA C O     1 
ATOM   7193  C  CB    . ALA C 2  459  ? 11.579  -29.334 83.610  1.00 67.30  ? 459  ALA C CB    1 
ATOM   7194  N  N     . ARG C 2  460  ? 13.951  -31.170 82.660  1.00 69.64  ? 460  ARG C N     1 
ATOM   7195  C  CA    . ARG C 2  460  ? 15.182  -31.386 81.922  1.00 66.89  ? 460  ARG C CA    1 
ATOM   7196  C  C     . ARG C 2  460  ? 14.881  -31.481 80.434  1.00 71.29  ? 460  ARG C C     1 
ATOM   7197  O  O     . ARG C 2  460  ? 13.840  -32.006 80.025  1.00 65.33  ? 460  ARG C O     1 
ATOM   7198  C  CB    . ARG C 2  460  ? 15.896  -32.666 82.361  1.00 72.90  ? 460  ARG C CB    1 
ATOM   7199  C  CG    . ARG C 2  460  ? 16.826  -32.503 83.528  1.00 78.30  ? 460  ARG C CG    1 
ATOM   7200  C  CD    . ARG C 2  460  ? 17.689  -33.743 83.681  1.00 80.06  ? 460  ARG C CD    1 
ATOM   7201  N  NE    . ARG C 2  460  ? 18.616  -33.611 84.798  1.00 85.49  ? 460  ARG C NE    1 
ATOM   7202  C  CZ    . ARG C 2  460  ? 19.122  -34.641 85.463  1.00 91.13  ? 460  ARG C CZ    1 
ATOM   7203  N  NH1   . ARG C 2  460  ? 18.779  -35.875 85.122  1.00 100.35 ? 460  ARG C NH1   1 
ATOM   7204  N  NH2   . ARG C 2  460  ? 19.959  -34.437 86.474  1.00 92.83  ? 460  ARG C NH2   1 
ATOM   7205  N  N     . VAL C 2  461  ? 15.818  -30.983 79.633  1.00 64.98  ? 461  VAL C N     1 
ATOM   7206  C  CA    . VAL C 2  461  ? 15.758  -31.076 78.181  1.00 68.15  ? 461  VAL C CA    1 
ATOM   7207  C  C     . VAL C 2  461  ? 16.699  -32.189 77.744  1.00 69.75  ? 461  VAL C C     1 
ATOM   7208  O  O     . VAL C 2  461  ? 17.908  -32.122 77.995  1.00 75.07  ? 461  VAL C O     1 
ATOM   7209  C  CB    . VAL C 2  461  ? 16.139  -29.746 77.513  1.00 68.16  ? 461  VAL C CB    1 
ATOM   7210  C  CG1   . VAL C 2  461  ? 15.790  -29.793 76.038  1.00 65.39  ? 461  VAL C CG1   1 
ATOM   7211  C  CG2   . VAL C 2  461  ? 15.459  -28.575 78.210  1.00 66.64  ? 461  VAL C CG2   1 
ATOM   7212  N  N     . ASP C 2  462  ? 16.153  -33.204 77.079  1.00 67.60  ? 462  ASP C N     1 
ATOM   7213  C  CA    . ASP C 2  462  ? 16.950  -34.340 76.646  1.00 73.02  ? 462  ASP C CA    1 
ATOM   7214  C  C     . ASP C 2  462  ? 17.721  -34.016 75.364  1.00 76.29  ? 462  ASP C C     1 
ATOM   7215  O  O     . ASP C 2  462  ? 17.648  -32.913 74.812  1.00 74.01  ? 462  ASP C O     1 
ATOM   7216  C  CB    . ASP C 2  462  ? 16.064  -35.575 76.468  1.00 74.61  ? 462  ASP C CB    1 
ATOM   7217  C  CG    . ASP C 2  462  ? 14.910  -35.363 75.486  1.00 74.51  ? 462  ASP C CG    1 
ATOM   7218  O  OD1   . ASP C 2  462  ? 14.976  -34.467 74.618  1.00 71.93  ? 462  ASP C OD1   1 
ATOM   7219  O  OD2   . ASP C 2  462  ? 13.921  -36.122 75.580  1.00 78.33  ? 462  ASP C OD2   1 
ATOM   7220  N  N     . GLU C 2  463  ? 18.466  -35.010 74.877  1.00 84.93  ? 463  GLU C N     1 
ATOM   7221  C  CA    . GLU C 2  463  ? 19.301  -34.830 73.694  1.00 79.79  ? 463  GLU C CA    1 
ATOM   7222  C  C     . GLU C 2  463  ? 18.484  -34.585 72.432  1.00 77.78  ? 463  GLU C C     1 
ATOM   7223  O  O     . GLU C 2  463  ? 18.997  -33.973 71.487  1.00 75.93  ? 463  GLU C O     1 
ATOM   7224  C  CB    . GLU C 2  463  ? 20.195  -36.054 73.514  1.00 84.84  ? 463  GLU C CB    1 
ATOM   7225  C  CG    . GLU C 2  463  ? 20.936  -36.437 74.782  1.00 89.80  ? 463  GLU C CG    1 
ATOM   7226  C  CD    . GLU C 2  463  ? 21.637  -37.768 74.660  1.00 101.89 ? 463  GLU C CD    1 
ATOM   7227  O  OE1   . GLU C 2  463  ? 21.702  -38.500 75.674  1.00 96.45  ? 463  GLU C OE1   1 
ATOM   7228  O  OE2   . GLU C 2  463  ? 22.115  -38.083 73.548  1.00 107.94 ? 463  GLU C OE2   1 
ATOM   7229  N  N     . LEU C 2  464  ? 17.232  -35.040 72.390  1.00 73.97  ? 464  LEU C N     1 
ATOM   7230  C  CA    . LEU C 2  464  ? 16.366  -34.727 71.263  1.00 71.13  ? 464  LEU C CA    1 
ATOM   7231  C  C     . LEU C 2  464  ? 15.678  -33.374 71.407  1.00 69.43  ? 464  LEU C C     1 
ATOM   7232  O  O     . LEU C 2  464  ? 14.994  -32.946 70.472  1.00 71.98  ? 464  LEU C O     1 
ATOM   7233  C  CB    . LEU C 2  464  ? 15.312  -35.823 71.071  1.00 65.39  ? 464  LEU C CB    1 
ATOM   7234  C  CG    . LEU C 2  464  ? 15.759  -37.259 70.786  1.00 66.14  ? 464  LEU C CG    1 
ATOM   7235  C  CD1   . LEU C 2  464  ? 14.665  -38.020 70.050  1.00 70.12  ? 464  LEU C CD1   1 
ATOM   7236  C  CD2   . LEU C 2  464  ? 17.061  -37.297 70.012  1.00 77.15  ? 464  LEU C CD2   1 
ATOM   7237  N  N     . GLY C 2  465  ? 15.836  -32.695 72.541  1.00 67.83  ? 465  GLY C N     1 
ATOM   7238  C  CA    . GLY C 2  465  ? 15.253  -31.379 72.725  1.00 71.93  ? 465  GLY C CA    1 
ATOM   7239  C  C     . GLY C 2  465  ? 13.852  -31.350 73.302  1.00 67.63  ? 465  GLY C C     1 
ATOM   7240  O  O     . GLY C 2  465  ? 13.243  -30.275 73.345  1.00 63.86  ? 465  GLY C O     1 
ATOM   7241  N  N     . PHE C 2  466  ? 13.318  -32.491 73.727  1.00 63.78  ? 466  PHE C N     1 
ATOM   7242  C  CA    . PHE C 2  466  ? 12.052  -32.546 74.434  1.00 63.73  ? 466  PHE C CA    1 
ATOM   7243  C  C     . PHE C 2  466  ? 12.287  -32.368 75.929  1.00 67.70  ? 466  PHE C C     1 
ATOM   7244  O  O     . PHE C 2  466  ? 13.349  -32.713 76.452  1.00 72.42  ? 466  PHE C O     1 
ATOM   7245  C  CB    . PHE C 2  466  ? 11.349  -33.874 74.167  1.00 59.93  ? 466  PHE C CB    1 
ATOM   7246  C  CG    . PHE C 2  466  ? 11.114  -34.145 72.722  1.00 64.24  ? 466  PHE C CG    1 
ATOM   7247  C  CD1   . PHE C 2  466  ? 10.028  -33.587 72.071  1.00 64.38  ? 466  PHE C CD1   1 
ATOM   7248  C  CD2   . PHE C 2  466  ? 11.982  -34.953 72.005  1.00 73.73  ? 466  PHE C CD2   1 
ATOM   7249  C  CE1   . PHE C 2  466  ? 9.805   -33.835 70.729  1.00 73.10  ? 466  PHE C CE1   1 
ATOM   7250  C  CE2   . PHE C 2  466  ? 11.770  -35.210 70.656  1.00 63.06  ? 466  PHE C CE2   1 
ATOM   7251  C  CZ    . PHE C 2  466  ? 10.679  -34.650 70.017  1.00 70.07  ? 466  PHE C CZ    1 
ATOM   7252  N  N     . ILE C 2  467  ? 11.290  -31.822 76.620  1.00 65.21  ? 467  ILE C N     1 
ATOM   7253  C  CA    . ILE C 2  467  ? 11.397  -31.584 78.055  1.00 65.28  ? 467  ILE C CA    1 
ATOM   7254  C  C     . ILE C 2  467  ? 10.873  -32.805 78.797  1.00 70.57  ? 467  ILE C C     1 
ATOM   7255  O  O     . ILE C 2  467  ? 9.804   -33.335 78.470  1.00 62.99  ? 467  ILE C O     1 
ATOM   7256  C  CB    . ILE C 2  467  ? 10.632  -30.318 78.468  1.00 64.54  ? 467  ILE C CB    1 
ATOM   7257  C  CG1   . ILE C 2  467  ? 11.037  -29.135 77.597  1.00 66.19  ? 467  ILE C CG1   1 
ATOM   7258  C  CG2   . ILE C 2  467  ? 10.921  -29.986 79.918  1.00 70.15  ? 467  ILE C CG2   1 
ATOM   7259  C  CD1   . ILE C 2  467  ? 10.308  -27.861 77.963  1.00 57.28  ? 467  ILE C CD1   1 
ATOM   7260  N  N     . ARG C 2  468  ? 11.626  -33.250 79.800  1.00 70.88  ? 468  ARG C N     1 
ATOM   7261  C  CA    . ARG C 2  468  ? 11.277  -34.423 80.585  1.00 69.97  ? 468  ARG C CA    1 
ATOM   7262  C  C     . ARG C 2  468  ? 11.144  -34.046 82.050  1.00 67.34  ? 468  ARG C C     1 
ATOM   7263  O  O     . ARG C 2  468  ? 11.854  -33.165 82.548  1.00 68.19  ? 468  ARG C O     1 
ATOM   7264  C  CB    . ARG C 2  468  ? 12.331  -35.528 80.437  1.00 69.14  ? 468  ARG C CB    1 
ATOM   7265  C  CG    . ARG C 2  468  ? 12.337  -36.187 79.085  1.00 71.75  ? 468  ARG C CG    1 
ATOM   7266  C  CD    . ARG C 2  468  ? 13.716  -36.734 78.758  1.00 84.22  ? 468  ARG C CD    1 
ATOM   7267  N  NE    . ARG C 2  468  ? 13.860  -38.155 79.063  1.00 89.46  ? 468  ARG C NE    1 
ATOM   7268  C  CZ    . ARG C 2  468  ? 13.967  -39.109 78.143  1.00 75.10  ? 468  ARG C CZ    1 
ATOM   7269  N  NH1   . ARG C 2  468  ? 13.949  -38.795 76.856  1.00 55.88  ? 468  ARG C NH1   1 
ATOM   7270  N  NH2   . ARG C 2  468  ? 14.097  -40.375 78.512  1.00 82.94  ? 468  ARG C NH2   1 
ATOM   7271  N  N     . THR C 2  469  ? 10.240  -34.735 82.739  1.00 70.41  ? 469  THR C N     1 
ATOM   7272  C  CA    . THR C 2  469  ? 10.014  -34.502 84.156  1.00 74.22  ? 469  THR C CA    1 
ATOM   7273  C  C     . THR C 2  469  ? 10.124  -35.820 84.916  1.00 69.04  ? 469  THR C C     1 
ATOM   7274  O  O     . THR C 2  469  ? 9.865   -36.888 84.346  1.00 72.73  ? 469  THR C O     1 
ATOM   7275  C  CB    . THR C 2  469  ? 8.636   -33.839 84.377  1.00 72.78  ? 469  THR C CB    1 
ATOM   7276  O  OG1   . THR C 2  469  ? 8.477   -33.468 85.752  1.00 75.40  ? 469  THR C OG1   1 
ATOM   7277  C  CG2   . THR C 2  469  ? 7.492   -34.754 83.956  1.00 72.31  ? 469  THR C CG2   1 
ATOM   7278  N  N     . PRO C 2  470  ? 10.573  -35.787 86.177  1.00 69.87  ? 470  PRO C N     1 
ATOM   7279  C  CA    . PRO C 2  470  ? 10.797  -37.035 86.920  1.00 70.47  ? 470  PRO C CA    1 
ATOM   7280  C  C     . PRO C 2  470  ? 9.567   -37.575 87.631  1.00 70.85  ? 470  PRO C C     1 
ATOM   7281  O  O     . PRO C 2  470  ? 8.764   -36.833 88.204  1.00 74.32  ? 470  PRO C O     1 
ATOM   7282  C  CB    . PRO C 2  470  ? 11.856  -36.620 87.949  1.00 70.73  ? 470  PRO C CB    1 
ATOM   7283  C  CG    . PRO C 2  470  ? 11.536  -35.208 88.231  1.00 71.69  ? 470  PRO C CG    1 
ATOM   7284  C  CD    . PRO C 2  470  ? 11.109  -34.623 86.908  1.00 74.44  ? 470  PRO C CD    1 
ATOM   7285  N  N     . TYR C 2  471  ? 9.441   -38.901 87.613  1.00 69.84  ? 471  TYR C N     1 
ATOM   7286  C  CA    . TYR C 2  471  ? 8.420   -39.595 88.382  1.00 70.54  ? 471  TYR C CA    1 
ATOM   7287  C  C     . TYR C 2  471  ? 9.047   -40.782 89.091  1.00 73.25  ? 471  TYR C C     1 
ATOM   7288  O  O     . TYR C 2  471  ? 10.086  -41.294 88.687  1.00 78.02  ? 471  TYR C O     1 
ATOM   7289  C  CB    . TYR C 2  471  ? 7.262   -40.073 87.507  1.00 71.51  ? 471  TYR C CB    1 
ATOM   7290  C  CG    . TYR C 2  471  ? 6.500   -38.956 86.832  1.00 80.35  ? 471  TYR C CG    1 
ATOM   7291  C  CD1   . TYR C 2  471  ? 5.617   -38.156 87.552  1.00 73.42  ? 471  TYR C CD1   1 
ATOM   7292  C  CD2   . TYR C 2  471  ? 6.669   -38.697 85.475  1.00 70.84  ? 471  TYR C CD2   1 
ATOM   7293  C  CE1   . TYR C 2  471  ? 4.914   -37.138 86.937  1.00 71.03  ? 471  TYR C CE1   1 
ATOM   7294  C  CE2   . TYR C 2  471  ? 5.974   -37.684 84.854  1.00 73.72  ? 471  TYR C CE2   1 
ATOM   7295  C  CZ    . TYR C 2  471  ? 5.100   -36.906 85.586  1.00 81.04  ? 471  TYR C CZ    1 
ATOM   7296  O  OH    . TYR C 2  471  ? 4.413   -35.894 84.958  1.00 81.30  ? 471  TYR C OH    1 
ATOM   7297  N  N     . ARG C 2  472  ? 8.398   -41.219 90.160  1.00 82.32  ? 472  ARG C N     1 
ATOM   7298  C  CA    . ARG C 2  472  ? 8.840   -42.355 90.949  1.00 83.04  ? 472  ARG C CA    1 
ATOM   7299  C  C     . ARG C 2  472  ? 8.133   -43.607 90.460  1.00 84.01  ? 472  ARG C C     1 
ATOM   7300  O  O     . ARG C 2  472  ? 6.917   -43.587 90.237  1.00 80.70  ? 472  ARG C O     1 
ATOM   7301  C  CB    . ARG C 2  472  ? 8.553   -42.131 92.433  1.00 75.43  ? 472  ARG C CB    1 
ATOM   7302  C  CG    . ARG C 2  472  ? 9.374   -41.017 93.044  1.00 81.66  ? 472  ARG C CG    1 
ATOM   7303  C  CD    . ARG C 2  472  ? 9.693   -41.325 94.485  1.00 89.80  ? 472  ARG C CD    1 
ATOM   7304  N  NE    . ARG C 2  472  ? 8.690   -40.788 95.399  1.00 99.28  ? 472  ARG C NE    1 
ATOM   7305  C  CZ    . ARG C 2  472  ? 8.608   -41.106 96.688  1.00 106.73 ? 472  ARG C CZ    1 
ATOM   7306  N  NH1   . ARG C 2  472  ? 9.464   -41.974 97.219  1.00 98.37  ? 472  ARG C NH1   1 
ATOM   7307  N  NH2   . ARG C 2  472  ? 7.663   -40.561 97.447  1.00 112.78 ? 472  ARG C NH2   1 
ATOM   7308  N  N     . ARG C 2  473  ? 8.901   -44.683 90.287  1.00 83.52  ? 473  ARG C N     1 
ATOM   7309  C  CA    . ARG C 2  473  ? 8.338   -45.975 89.924  1.00 85.74  ? 473  ARG C CA    1 
ATOM   7310  C  C     . ARG C 2  473  ? 7.508   -46.533 91.077  1.00 88.13  ? 473  ARG C C     1 
ATOM   7311  O  O     . ARG C 2  473  ? 7.951   -46.545 92.231  1.00 84.52  ? 473  ARG C O     1 
ATOM   7312  C  CB    . ARG C 2  473  ? 9.458   -46.947 89.558  1.00 88.76  ? 473  ARG C CB    1 
ATOM   7313  C  CG    . ARG C 2  473  ? 8.988   -48.357 89.237  1.00 92.76  ? 473  ARG C CG    1 
ATOM   7314  C  CD    . ARG C 2  473  ? 8.788   -48.550 87.745  1.00 86.28  ? 473  ARG C CD    1 
ATOM   7315  N  NE    . ARG C 2  473  ? 10.022  -48.307 87.003  1.00 88.84  ? 473  ARG C NE    1 
ATOM   7316  C  CZ    . ARG C 2  473  ? 10.129  -48.389 85.680  1.00 93.69  ? 473  ARG C CZ    1 
ATOM   7317  N  NH1   . ARG C 2  473  ? 9.069   -48.713 84.950  1.00 90.69  ? 473  ARG C NH1   1 
ATOM   7318  N  NH2   . ARG C 2  473  ? 11.294  -48.144 85.087  1.00 88.37  ? 473  ARG C NH2   1 
ATOM   7319  N  N     . VAL C 2  474  ? 6.297   -46.988 90.766  1.00 84.32  ? 474  VAL C N     1 
ATOM   7320  C  CA    . VAL C 2  474  ? 5.410   -47.591 91.754  1.00 90.10  ? 474  VAL C CA    1 
ATOM   7321  C  C     . VAL C 2  474  ? 4.967   -48.952 91.229  1.00 96.45  ? 474  VAL C C     1 
ATOM   7322  O  O     . VAL C 2  474  ? 4.367   -49.040 90.150  1.00 96.80  ? 474  VAL C O     1 
ATOM   7323  C  CB    . VAL C 2  474  ? 4.197   -46.698 92.065  1.00 87.19  ? 474  VAL C CB    1 
ATOM   7324  C  CG1   . VAL C 2  474  ? 3.182   -47.458 92.905  1.00 86.87  ? 474  VAL C CG1   1 
ATOM   7325  C  CG2   . VAL C 2  474  ? 4.650   -45.443 92.790  1.00 85.46  ? 474  VAL C CG2   1 
ATOM   7326  N  N     . VAL C 2  475  ? 5.273   -50.010 91.983  1.00 97.79  ? 475  VAL C N     1 
ATOM   7327  C  CA    . VAL C 2  475  ? 4.951   -51.382 91.596  1.00 97.14  ? 475  VAL C CA    1 
ATOM   7328  C  C     . VAL C 2  475  ? 4.296   -52.079 92.784  1.00 97.58  ? 475  VAL C C     1 
ATOM   7329  O  O     . VAL C 2  475  ? 4.937   -52.278 93.824  1.00 97.71  ? 475  VAL C O     1 
ATOM   7330  C  CB    . VAL C 2  475  ? 6.197   -52.158 91.129  1.00 92.19  ? 475  VAL C CB    1 
ATOM   7331  C  CG1   . VAL C 2  475  ? 5.862   -53.622 90.922  1.00 89.04  ? 475  VAL C CG1   1 
ATOM   7332  C  CG2   . VAL C 2  475  ? 6.748   -51.555 89.845  1.00 82.71  ? 475  VAL C CG2   1 
ATOM   7333  N  N     . GLY C 2  476  ? 3.022   -52.444 92.629  1.00 95.90  ? 476  GLY C N     1 
ATOM   7334  C  CA    . GLY C 2  476  ? 2.295   -53.157 93.660  1.00 89.20  ? 476  GLY C CA    1 
ATOM   7335  C  C     . GLY C 2  476  ? 2.137   -52.378 94.948  1.00 98.02  ? 476  GLY C C     1 
ATOM   7336  O  O     . GLY C 2  476  ? 2.421   -52.897 96.032  1.00 104.47 ? 476  GLY C O     1 
ATOM   7337  N  N     . GLY C 2  477  ? 1.686   -51.128 94.845  1.00 98.74  ? 477  GLY C N     1 
ATOM   7338  C  CA    . GLY C 2  477  ? 1.504   -50.280 96.007  1.00 96.87  ? 477  GLY C CA    1 
ATOM   7339  C  C     . GLY C 2  477  ? 2.777   -49.803 96.669  1.00 97.56  ? 477  GLY C C     1 
ATOM   7340  O  O     . GLY C 2  477  ? 2.699   -49.054 97.652  1.00 93.21  ? 477  GLY C O     1 
ATOM   7341  N  N     . VAL C 2  478  ? 3.946   -50.204 96.168  1.00 93.17  ? 478  VAL C N     1 
ATOM   7342  C  CA    . VAL C 2  478  ? 5.232   -49.824 96.737  1.00 93.33  ? 478  VAL C CA    1 
ATOM   7343  C  C     . VAL C 2  478  ? 5.829   -48.716 95.881  1.00 89.70  ? 478  VAL C C     1 
ATOM   7344  O  O     . VAL C 2  478  ? 5.773   -48.770 94.649  1.00 90.96  ? 478  VAL C O     1 
ATOM   7345  C  CB    . VAL C 2  478  ? 6.182   -51.036 96.826  1.00 96.06  ? 478  VAL C CB    1 
ATOM   7346  C  CG1   . VAL C 2  478  ? 7.293   -50.776 97.837  1.00 95.41  ? 478  VAL C CG1   1 
ATOM   7347  C  CG2   . VAL C 2  478  ? 5.413   -52.297 97.182  1.00 96.49  ? 478  VAL C CG2   1 
ATOM   7348  N  N     . VAL C 2  479  ? 6.396   -47.708 96.532  1.00 91.40  ? 479  VAL C N     1 
ATOM   7349  C  CA    . VAL C 2  479  ? 6.973   -46.550 95.860  1.00 90.26  ? 479  VAL C CA    1 
ATOM   7350  C  C     . VAL C 2  479  ? 8.487   -46.681 95.946  1.00 88.56  ? 479  VAL C C     1 
ATOM   7351  O  O     . VAL C 2  479  ? 9.071   -46.535 97.026  1.00 94.06  ? 479  VAL C O     1 
ATOM   7352  C  CB    . VAL C 2  479  ? 6.494   -45.231 96.486  1.00 92.14  ? 479  VAL C CB    1 
ATOM   7353  C  CG1   . VAL C 2  479  ? 6.905   -44.046 95.627  1.00 88.68  ? 479  VAL C CG1   1 
ATOM   7354  C  CG2   . VAL C 2  479  ? 4.985   -45.247 96.687  1.00 96.67  ? 479  VAL C CG2   1 
ATOM   7355  N  N     . THR C 2  480  ? 9.132   -46.947 94.817  1.00 82.59  ? 480  THR C N     1 
ATOM   7356  C  CA    . THR C 2  480  ? 10.577  -47.097 94.828  1.00 93.10  ? 480  THR C CA    1 
ATOM   7357  C  C     . THR C 2  480  ? 11.247  -45.731 94.930  1.00 96.31  ? 480  THR C C     1 
ATOM   7358  O  O     . THR C 2  480  ? 10.598  -44.680 94.925  1.00 89.45  ? 480  THR C O     1 
ATOM   7359  C  CB    . THR C 2  480  ? 11.058  -47.831 93.578  1.00 95.59  ? 480  THR C CB    1 
ATOM   7360  O  OG1   . THR C 2  480  ? 10.952  -46.960 92.445  1.00 99.29  ? 480  THR C OG1   1 
ATOM   7361  C  CG2   . THR C 2  480  ? 10.224  -49.077 93.333  1.00 93.54  ? 480  THR C CG2   1 
ATOM   7362  N  N     . ASP C 2  481  ? 12.572  -45.751 95.040  1.00 94.37  ? 481  ASP C N     1 
ATOM   7363  C  CA    . ASP C 2  481  ? 13.377  -44.550 94.907  1.00 95.38  ? 481  ASP C CA    1 
ATOM   7364  C  C     . ASP C 2  481  ? 13.982  -44.426 93.521  1.00 97.35  ? 481  ASP C C     1 
ATOM   7365  O  O     . ASP C 2  481  ? 14.779  -43.513 93.280  1.00 93.96  ? 481  ASP C O     1 
ATOM   7366  C  CB    . ASP C 2  481  ? 14.476  -44.528 95.969  1.00 101.68 ? 481  ASP C CB    1 
ATOM   7367  C  CG    . ASP C 2  481  ? 13.941  -44.199 97.343  1.00 105.88 ? 481  ASP C CG    1 
ATOM   7368  O  OD1   . ASP C 2  481  ? 12.813  -43.664 97.424  1.00 108.46 ? 481  ASP C OD1   1 
ATOM   7369  O  OD2   . ASP C 2  481  ? 14.646  -44.467 98.341  1.00 115.89 ? 481  ASP C OD2   1 
ATOM   7370  N  N     . GLU C 2  482  ? 13.634  -45.336 92.619  1.00 93.21  ? 482  GLU C N     1 
ATOM   7371  C  CA    . GLU C 2  482  ? 13.996  -45.202 91.215  1.00 96.91  ? 482  GLU C CA    1 
ATOM   7372  C  C     . GLU C 2  482  ? 13.135  -44.120 90.586  1.00 97.22  ? 482  GLU C C     1 
ATOM   7373  O  O     . GLU C 2  482  ? 11.903  -44.210 90.610  1.00 94.65  ? 482  GLU C O     1 
ATOM   7374  C  CB    . GLU C 2  482  ? 13.789  -46.526 90.487  1.00 95.15  ? 482  GLU C CB    1 
ATOM   7375  C  CG    . GLU C 2  482  ? 13.878  -46.414 88.969  1.00 97.81  ? 482  GLU C CG    1 
ATOM   7376  C  CD    . GLU C 2  482  ? 13.256  -47.603 88.259  1.00 101.71 ? 482  GLU C CD    1 
ATOM   7377  O  OE1   . GLU C 2  482  ? 13.344  -47.674 87.009  1.00 100.95 ? 482  GLU C OE1   1 
ATOM   7378  O  OE2   . GLU C 2  482  ? 12.676  -48.464 88.959  1.00 96.06  ? 482  GLU C OE2   1 
ATOM   7379  N  N     . VAL C 2  483  ? 13.766  -43.094 90.029  1.00 87.83  ? 483  VAL C N     1 
ATOM   7380  C  CA    . VAL C 2  483  ? 13.037  -41.981 89.445  1.00 83.05  ? 483  VAL C CA    1 
ATOM   7381  C  C     . VAL C 2  483  ? 13.382  -41.941 87.962  1.00 78.80  ? 483  VAL C C     1 
ATOM   7382  O  O     . VAL C 2  483  ? 14.562  -41.907 87.589  1.00 81.31  ? 483  VAL C O     1 
ATOM   7383  C  CB    . VAL C 2  483  ? 13.337  -40.659 90.176  1.00 78.57  ? 483  VAL C CB    1 
ATOM   7384  C  CG1   . VAL C 2  483  ? 14.549  -40.820 91.098  1.00 86.66  ? 483  VAL C CG1   1 
ATOM   7385  C  CG2   . VAL C 2  483  ? 13.530  -39.510 89.202  1.00 78.41  ? 483  VAL C CG2   1 
ATOM   7386  N  N     . VAL C 2  484  ? 12.348  -42.035 87.128  1.00 74.87  ? 484  VAL C N     1 
ATOM   7387  C  CA    . VAL C 2  484  ? 12.463  -42.079 85.675  1.00 81.29  ? 484  VAL C CA    1 
ATOM   7388  C  C     . VAL C 2  484  ? 12.031  -40.733 85.111  1.00 80.00  ? 484  VAL C C     1 
ATOM   7389  O  O     . VAL C 2  484  ? 10.970  -40.210 85.480  1.00 77.70  ? 484  VAL C O     1 
ATOM   7390  C  CB    . VAL C 2  484  ? 11.602  -43.211 85.085  1.00 82.10  ? 484  VAL C CB    1 
ATOM   7391  C  CG1   . VAL C 2  484  ? 11.682  -43.207 83.566  1.00 72.90  ? 484  VAL C CG1   1 
ATOM   7392  C  CG2   . VAL C 2  484  ? 12.019  -44.553 85.661  1.00 87.80  ? 484  VAL C CG2   1 
ATOM   7393  N  N     . TYR C 2  485  ? 12.852  -40.170 84.226  1.00 66.89  ? 485  TYR C N     1 
ATOM   7394  C  CA    . TYR C 2  485  ? 12.529  -38.927 83.543  1.00 65.60  ? 485  TYR C CA    1 
ATOM   7395  C  C     . TYR C 2  485  ? 11.774  -39.240 82.258  1.00 72.97  ? 485  TYR C C     1 
ATOM   7396  O  O     . TYR C 2  485  ? 12.305  -39.920 81.375  1.00 75.20  ? 485  TYR C O     1 
ATOM   7397  C  CB    . TYR C 2  485  ? 13.802  -38.142 83.246  1.00 67.46  ? 485  TYR C CB    1 
ATOM   7398  C  CG    . TYR C 2  485  ? 14.185  -37.193 84.344  1.00 70.10  ? 485  TYR C CG    1 
ATOM   7399  C  CD1   . TYR C 2  485  ? 14.953  -37.613 85.420  1.00 71.40  ? 485  TYR C CD1   1 
ATOM   7400  C  CD2   . TYR C 2  485  ? 13.774  -35.867 84.307  1.00 75.39  ? 485  TYR C CD2   1 
ATOM   7401  C  CE1   . TYR C 2  485  ? 15.303  -36.730 86.432  1.00 74.38  ? 485  TYR C CE1   1 
ATOM   7402  C  CE2   . TYR C 2  485  ? 14.118  -34.980 85.311  1.00 76.04  ? 485  TYR C CE2   1 
ATOM   7403  C  CZ    . TYR C 2  485  ? 14.877  -35.416 86.372  1.00 74.23  ? 485  TYR C CZ    1 
ATOM   7404  O  OH    . TYR C 2  485  ? 15.214  -34.526 87.364  1.00 75.62  ? 485  TYR C OH    1 
ATOM   7405  N  N     . MET C 2  486  ? 10.543  -38.749 82.150  1.00 68.99  ? 486  MET C N     1 
ATOM   7406  C  CA    . MET C 2  486  ? 9.715   -39.043 80.992  1.00 70.16  ? 486  MET C CA    1 
ATOM   7407  C  C     . MET C 2  486  ? 9.494   -37.808 80.128  1.00 73.80  ? 486  MET C C     1 
ATOM   7408  O  O     . MET C 2  486  ? 9.449   -36.675 80.625  1.00 77.39  ? 486  MET C O     1 
ATOM   7409  C  CB    . MET C 2  486  ? 8.352   -39.590 81.405  1.00 71.40  ? 486  MET C CB    1 
ATOM   7410  C  CG    . MET C 2  486  ? 8.381   -40.744 82.364  1.00 70.04  ? 486  MET C CG    1 
ATOM   7411  S  SD    . MET C 2  486  ? 6.736   -41.476 82.422  1.00 84.46  ? 486  MET C SD    1 
ATOM   7412  C  CE    . MET C 2  486  ? 6.859   -42.356 83.964  1.00 81.07  ? 486  MET C CE    1 
ATOM   7413  N  N     . THR C 2  487  ? 9.354   -38.049 78.824  1.00 68.91  ? 487  THR C N     1 
ATOM   7414  C  CA    . THR C 2  487  ? 8.755   -37.094 77.909  1.00 69.99  ? 487  THR C CA    1 
ATOM   7415  C  C     . THR C 2  487  ? 7.238   -37.147 78.050  1.00 69.43  ? 487  THR C C     1 
ATOM   7416  O  O     . THR C 2  487  ? 6.680   -38.034 78.698  1.00 73.06  ? 487  THR C O     1 
ATOM   7417  C  CB    . THR C 2  487  ? 9.147   -37.386 76.456  1.00 68.77  ? 487  THR C CB    1 
ATOM   7418  O  OG1   . THR C 2  487  ? 8.639   -38.666 76.057  1.00 64.75  ? 487  THR C OG1   1 
ATOM   7419  C  CG2   . THR C 2  487  ? 10.646  -37.362 76.283  1.00 54.04  ? 487  THR C CG2   1 
ATOM   7420  N  N     . ALA C 2  488  ? 6.561   -36.186 77.423  1.00 71.55  ? 488  ALA C N     1 
ATOM   7421  C  CA    . ALA C 2  488  ? 5.103   -36.162 77.493  1.00 71.40  ? 488  ALA C CA    1 
ATOM   7422  C  C     . ALA C 2  488  ? 4.498   -37.390 76.822  1.00 76.56  ? 488  ALA C C     1 
ATOM   7423  O  O     . ALA C 2  488  ? 3.517   -37.962 77.321  1.00 72.53  ? 488  ALA C O     1 
ATOM   7424  C  CB    . ALA C 2  488  ? 4.579   -34.874 76.861  1.00 70.48  ? 488  ALA C CB    1 
ATOM   7425  N  N     . THR C 2  489  ? 5.086   -37.818 75.698  1.00 77.49  ? 489  THR C N     1 
ATOM   7426  C  CA    . THR C 2  489  ? 4.620   -39.018 75.011  1.00 70.68  ? 489  THR C CA    1 
ATOM   7427  C  C     . THR C 2  489  ? 4.701   -40.238 75.920  1.00 79.08  ? 489  THR C C     1 
ATOM   7428  O  O     . THR C 2  489  ? 3.739   -41.008 76.032  1.00 81.12  ? 489  THR C O     1 
ATOM   7429  C  CB    . THR C 2  489  ? 5.440   -39.241 73.746  1.00 75.65  ? 489  THR C CB    1 
ATOM   7430  O  OG1   . THR C 2  489  ? 5.483   -38.026 72.991  1.00 79.82  ? 489  THR C OG1   1 
ATOM   7431  C  CG2   . THR C 2  489  ? 4.815   -40.338 72.901  1.00 86.20  ? 489  THR C CG2   1 
ATOM   7432  N  N     . GLU C 2  490  ? 5.847   -40.425 76.585  1.00 75.00  ? 490  GLU C N     1 
ATOM   7433  C  CA    . GLU C 2  490  ? 5.995   -41.535 77.524  1.00 74.62  ? 490  GLU C CA    1 
ATOM   7434  C  C     . GLU C 2  490  ? 5.033   -41.404 78.700  1.00 77.83  ? 490  GLU C C     1 
ATOM   7435  O  O     . GLU C 2  490  ? 4.423   -42.393 79.125  1.00 81.34  ? 490  GLU C O     1 
ATOM   7436  C  CB    . GLU C 2  490  ? 7.439   -41.607 78.025  1.00 76.40  ? 490  GLU C CB    1 
ATOM   7437  C  CG    . GLU C 2  490  ? 8.271   -42.715 77.399  1.00 88.50  ? 490  GLU C CG    1 
ATOM   7438  C  CD    . GLU C 2  490  ? 7.784   -44.101 77.785  1.00 87.84  ? 490  GLU C CD    1 
ATOM   7439  O  OE1   . GLU C 2  490  ? 7.380   -44.870 76.885  1.00 91.29  ? 490  GLU C OE1   1 
ATOM   7440  O  OE2   . GLU C 2  490  ? 7.802   -44.419 78.995  1.00 79.71  ? 490  GLU C OE2   1 
ATOM   7441  N  N     . GLU C 2  491  ? 4.888   -40.190 79.242  1.00 75.77  ? 491  GLU C N     1 
ATOM   7442  C  CA    . GLU C 2  491  ? 4.023   -39.981 80.399  1.00 75.23  ? 491  GLU C CA    1 
ATOM   7443  C  C     . GLU C 2  491  ? 2.576   -40.350 80.104  1.00 77.96  ? 491  GLU C C     1 
ATOM   7444  O  O     . GLU C 2  491  ? 1.876   -40.860 80.987  1.00 78.53  ? 491  GLU C O     1 
ATOM   7445  C  CB    . GLU C 2  491  ? 4.105   -38.526 80.858  1.00 77.65  ? 491  GLU C CB    1 
ATOM   7446  C  CG    . GLU C 2  491  ? 3.125   -38.159 81.970  1.00 76.00  ? 491  GLU C CG    1 
ATOM   7447  C  CD    . GLU C 2  491  ? 3.014   -36.657 82.176  1.00 83.20  ? 491  GLU C CD    1 
ATOM   7448  O  OE1   . GLU C 2  491  ? 1.873   -36.139 82.208  1.00 86.90  ? 491  GLU C OE1   1 
ATOM   7449  O  OE2   . GLU C 2  491  ? 4.072   -35.995 82.291  1.00 77.20  ? 491  GLU C OE2   1 
ATOM   7450  N  N     . ASP C 2  492  ? 2.105   -40.111 78.876  1.00 78.56  ? 492  ASP C N     1 
ATOM   7451  C  CA    . ASP C 2  492  ? 0.715   -40.440 78.562  1.00 78.12  ? 492  ASP C CA    1 
ATOM   7452  C  C     . ASP C 2  492  ? 0.406   -41.936 78.629  1.00 82.21  ? 492  ASP C C     1 
ATOM   7453  O  O     . ASP C 2  492  ? -0.762  -42.309 78.469  1.00 82.75  ? 492  ASP C O     1 
ATOM   7454  C  CB    . ASP C 2  492  ? 0.332   -39.909 77.176  1.00 73.15  ? 492  ASP C CB    1 
ATOM   7455  C  CG    . ASP C 2  492  ? 0.049   -38.415 77.174  1.00 77.48  ? 492  ASP C CG    1 
ATOM   7456  O  OD1   . ASP C 2  492  ? -0.307  -37.865 78.241  1.00 78.69  ? 492  ASP C OD1   1 
ATOM   7457  O  OD2   . ASP C 2  492  ? 0.196   -37.785 76.105  1.00 74.48  ? 492  ASP C OD2   1 
ATOM   7458  N  N     . ARG C 2  493  ? 1.400   -42.799 78.857  1.00 84.92  ? 493  ARG C N     1 
ATOM   7459  C  CA    . ARG C 2  493  ? 1.145   -44.235 78.905  1.00 83.38  ? 493  ARG C CA    1 
ATOM   7460  C  C     . ARG C 2  493  ? 0.694   -44.715 80.274  1.00 89.07  ? 493  ARG C C     1 
ATOM   7461  O  O     . ARG C 2  493  ? 0.202   -45.844 80.382  1.00 95.28  ? 493  ARG C O     1 
ATOM   7462  C  CB    . ARG C 2  493  ? 2.399   -45.026 78.508  1.00 83.79  ? 493  ARG C CB    1 
ATOM   7463  C  CG    . ARG C 2  493  ? 2.967   -44.693 77.142  1.00 83.76  ? 493  ARG C CG    1 
ATOM   7464  C  CD    . ARG C 2  493  ? 4.182   -45.559 76.803  1.00 86.21  ? 493  ARG C CD    1 
ATOM   7465  N  NE    . ARG C 2  493  ? 3.813   -46.875 76.283  1.00 91.70  ? 493  ARG C NE    1 
ATOM   7466  C  CZ    . ARG C 2  493  ? 3.929   -48.014 76.962  1.00 92.83  ? 493  ARG C CZ    1 
ATOM   7467  N  NH1   . ARG C 2  493  ? 4.415   -48.012 78.198  1.00 88.70  ? 493  ARG C NH1   1 
ATOM   7468  N  NH2   . ARG C 2  493  ? 3.566   -49.159 76.401  1.00 91.30  ? 493  ARG C NH2   1 
ATOM   7469  N  N     . TYR C 2  494  ? 0.839   -43.901 81.310  1.00 86.88  ? 494  TYR C N     1 
ATOM   7470  C  CA    . TYR C 2  494  ? 0.776   -44.398 82.673  1.00 81.97  ? 494  TYR C CA    1 
ATOM   7471  C  C     . TYR C 2  494  ? -0.267  -43.653 83.496  1.00 85.07  ? 494  TYR C C     1 
ATOM   7472  O  O     . TYR C 2  494  ? -0.895  -42.685 83.059  1.00 84.21  ? 494  TYR C O     1 
ATOM   7473  C  CB    . TYR C 2  494  ? 2.150   -44.301 83.342  1.00 80.53  ? 494  TYR C CB    1 
ATOM   7474  C  CG    . TYR C 2  494  ? 3.239   -44.943 82.524  1.00 85.63  ? 494  TYR C CG    1 
ATOM   7475  C  CD1   . TYR C 2  494  ? 3.311   -46.321 82.402  1.00 81.89  ? 494  TYR C CD1   1 
ATOM   7476  C  CD2   . TYR C 2  494  ? 4.186   -44.173 81.859  1.00 85.57  ? 494  TYR C CD2   1 
ATOM   7477  C  CE1   . TYR C 2  494  ? 4.296   -46.918 81.651  1.00 90.22  ? 494  TYR C CE1   1 
ATOM   7478  C  CE2   . TYR C 2  494  ? 5.179   -44.763 81.103  1.00 85.49  ? 494  TYR C CE2   1 
ATOM   7479  C  CZ    . TYR C 2  494  ? 5.228   -46.139 81.001  1.00 88.70  ? 494  TYR C CZ    1 
ATOM   7480  O  OH    . TYR C 2  494  ? 6.209   -46.747 80.249  1.00 86.54  ? 494  TYR C OH    1 
ATOM   7481  N  N     . THR C 2  495  ? -0.434  -44.152 84.712  1.00 84.37  ? 495  THR C N     1 
ATOM   7482  C  CA    . THR C 2  495  ? -1.302  -43.586 85.729  1.00 78.16  ? 495  THR C CA    1 
ATOM   7483  C  C     . THR C 2  495  ? -0.397  -43.101 86.847  1.00 79.66  ? 495  THR C C     1 
ATOM   7484  O  O     . THR C 2  495  ? 0.278   -43.911 87.489  1.00 80.02  ? 495  THR C O     1 
ATOM   7485  C  CB    . THR C 2  495  ? -2.286  -44.637 86.241  1.00 81.13  ? 495  THR C CB    1 
ATOM   7486  O  OG1   . THR C 2  495  ? -3.041  -45.163 85.143  1.00 80.74  ? 495  THR C OG1   1 
ATOM   7487  C  CG2   . THR C 2  495  ? -3.224  -44.047 87.280  1.00 76.51  ? 495  THR C CG2   1 
ATOM   7488  N  N     . ILE C 2  496  ? -0.362  -41.790 87.066  1.00 76.49  ? 496  ILE C N     1 
ATOM   7489  C  CA    . ILE C 2  496  ? 0.649   -41.178 87.925  1.00 77.37  ? 496  ILE C CA    1 
ATOM   7490  C  C     . ILE C 2  496  ? -0.032  -40.528 89.125  1.00 82.37  ? 496  ILE C C     1 
ATOM   7491  O  O     . ILE C 2  496  ? -0.799  -39.570 88.968  1.00 85.16  ? 496  ILE C O     1 
ATOM   7492  C  CB    . ILE C 2  496  ? 1.501   -40.155 87.159  1.00 75.74  ? 496  ILE C CB    1 
ATOM   7493  C  CG1   . ILE C 2  496  ? 2.126   -40.806 85.921  1.00 77.34  ? 496  ILE C CG1   1 
ATOM   7494  C  CG2   . ILE C 2  496  ? 2.562   -39.582 88.072  1.00 76.75  ? 496  ILE C CG2   1 
ATOM   7495  C  CD1   . ILE C 2  496  ? 3.138   -39.935 85.219  1.00 74.56  ? 496  ILE C CD1   1 
ATOM   7496  N  N     . ALA C 2  497  ? 0.270   -41.029 90.319  1.00 78.89  ? 497  ALA C N     1 
ATOM   7497  C  CA    . ALA C 2  497  ? -0.350  -40.554 91.544  1.00 79.62  ? 497  ALA C CA    1 
ATOM   7498  C  C     . ALA C 2  497  ? 0.298   -39.257 92.017  1.00 81.45  ? 497  ALA C C     1 
ATOM   7499  O  O     . ALA C 2  497  ? 1.448   -38.953 91.694  1.00 78.93  ? 497  ALA C O     1 
ATOM   7500  C  CB    . ALA C 2  497  ? -0.243  -41.615 92.638  1.00 84.92  ? 497  ALA C CB    1 
ATOM   7501  N  N     . GLN C 2  498  ? -0.457  -38.500 92.814  1.00 81.67  ? 498  GLN C N     1 
ATOM   7502  C  CA    . GLN C 2  498  ? 0.004   -37.209 93.304  1.00 77.75  ? 498  GLN C CA    1 
ATOM   7503  C  C     . GLN C 2  498  ? 1.055   -37.366 94.396  1.00 79.99  ? 498  GLN C C     1 
ATOM   7504  O  O     . GLN C 2  498  ? 1.028   -38.314 95.184  1.00 85.11  ? 498  GLN C O     1 
ATOM   7505  C  CB    . GLN C 2  498  ? -1.173  -36.388 93.827  1.00 79.06  ? 498  GLN C CB    1 
ATOM   7506  C  CG    . GLN C 2  498  ? -2.054  -35.804 92.730  1.00 80.05  ? 498  GLN C CG    1 
ATOM   7507  C  CD    . GLN C 2  498  ? -1.362  -34.714 91.915  1.00 76.14  ? 498  GLN C CD    1 
ATOM   7508  O  OE1   . GLN C 2  498  ? -1.820  -34.364 90.828  1.00 76.26  ? 498  GLN C OE1   1 
ATOM   7509  N  NE2   . GLN C 2  498  ? -0.262  -34.171 92.438  1.00 73.40  ? 498  GLN C NE2   1 
ATOM   7510  N  N     . ALA C 2  499  ? 1.982   -36.403 94.444  1.00 79.97  ? 499  ALA C N     1 
ATOM   7511  C  CA    . ALA C 2  499  ? 3.121   -36.482 95.356  1.00 80.60  ? 499  ALA C CA    1 
ATOM   7512  C  C     . ALA C 2  499  ? 2.710   -36.523 96.824  1.00 77.27  ? 499  ALA C C     1 
ATOM   7513  O  O     . ALA C 2  499  ? 3.486   -36.993 97.662  1.00 81.84  ? 499  ALA C O     1 
ATOM   7514  C  CB    . ALA C 2  499  ? 4.061   -35.298 95.116  1.00 72.34  ? 499  ALA C CB    1 
ATOM   7515  N  N     . ASN C 2  500  ? 1.524   -36.039 97.159  1.00 79.43  ? 500  ASN C N     1 
ATOM   7516  C  CA    . ASN C 2  500  ? 1.073   -36.015 98.540  1.00 85.92  ? 500  ASN C CA    1 
ATOM   7517  C  C     . ASN C 2  500  ? 0.273   -37.256 98.924  1.00 93.49  ? 500  ASN C C     1 
ATOM   7518  O  O     . ASN C 2  500  ? -0.381  -37.253 99.972  1.00 93.09  ? 500  ASN C O     1 
ATOM   7519  C  CB    . ASN C 2  500  ? 0.239   -34.760 98.797  1.00 80.72  ? 500  ASN C CB    1 
ATOM   7520  C  CG    . ASN C 2  500  ? -1.141  -34.838 98.168  1.00 84.35  ? 500  ASN C CG    1 
ATOM   7521  O  OD1   . ASN C 2  500  ? -1.347  -35.525 97.165  1.00 86.08  ? 500  ASN C OD1   1 
ATOM   7522  N  ND2   . ASN C 2  500  ? -2.097  -34.131 98.759  1.00 82.89  ? 500  ASN C ND2   1 
ATOM   7523  N  N     . THR C 2  501  ? 0.298   -38.302 98.099  1.00 94.44  ? 501  THR C N     1 
ATOM   7524  C  CA    . THR C 2  501  ? -0.413  -39.531 98.425  1.00 88.87  ? 501  THR C CA    1 
ATOM   7525  C  C     . THR C 2  501  ? 0.133   -40.102 99.734  1.00 94.66  ? 501  THR C C     1 
ATOM   7526  O  O     . THR C 2  501  ? 1.360   -40.190 99.899  1.00 88.35  ? 501  THR C O     1 
ATOM   7527  C  CB    . THR C 2  501  ? -0.274  -40.546 97.284  1.00 88.72  ? 501  THR C CB    1 
ATOM   7528  O  OG1   . THR C 2  501  ? -1.036  -40.109 96.149  1.00 87.04  ? 501  THR C OG1   1 
ATOM   7529  C  CG2   . THR C 2  501  ? -0.770  -41.918 97.704  1.00 90.08  ? 501  THR C CG2   1 
ATOM   7530  N  N     . PRO C 2  502  ? -0.730  -40.471 100.689 1.00 97.81  ? 502  PRO C N     1 
ATOM   7531  C  CA    . PRO C 2  502  ? -0.246  -40.880 102.019 1.00 94.40  ? 502  PRO C CA    1 
ATOM   7532  C  C     . PRO C 2  502  ? 0.587   -42.151 101.955 1.00 100.56 ? 502  PRO C C     1 
ATOM   7533  O  O     . PRO C 2  502  ? 0.194   -43.143 101.336 1.00 98.73  ? 502  PRO C O     1 
ATOM   7534  C  CB    . PRO C 2  502  ? -1.538  -41.099 102.816 1.00 90.71  ? 502  PRO C CB    1 
ATOM   7535  C  CG    . PRO C 2  502  ? -2.589  -40.354 102.072 1.00 92.43  ? 502  PRO C CG    1 
ATOM   7536  C  CD    . PRO C 2  502  ? -2.201  -40.437 100.630 1.00 92.31  ? 502  PRO C CD    1 
ATOM   7537  N  N     . LEU C 2  503  ? 1.740   -42.119 102.623 1.00 103.77 ? 503  LEU C N     1 
ATOM   7538  C  CA    . LEU C 2  503  ? 2.688   -43.224 102.611 1.00 105.15 ? 503  LEU C CA    1 
ATOM   7539  C  C     . LEU C 2  503  ? 3.054   -43.615 104.034 1.00 108.26 ? 503  LEU C C     1 
ATOM   7540  O  O     . LEU C 2  503  ? 3.463   -42.765 104.832 1.00 106.76 ? 503  LEU C O     1 
ATOM   7541  C  CB    . LEU C 2  503  ? 3.960   -42.861 101.835 1.00 93.40  ? 503  LEU C CB    1 
ATOM   7542  C  CG    . LEU C 2  503  ? 3.810   -42.537 100.353 1.00 88.16  ? 503  LEU C CG    1 
ATOM   7543  C  CD1   . LEU C 2  503  ? 5.177   -42.364 99.730  1.00 93.41  ? 503  LEU C CD1   1 
ATOM   7544  C  CD2   . LEU C 2  503  ? 3.029   -43.620 99.643  1.00 92.87  ? 503  LEU C CD2   1 
ATOM   7545  N  N     . GLU C 2  504  ? 2.905   -44.901 104.344 1.00 110.73 ? 504  GLU C N     1 
ATOM   7546  C  CA    . GLU C 2  504  ? 3.498   -45.502 105.535 1.00 113.19 ? 504  GLU C CA    1 
ATOM   7547  C  C     . GLU C 2  504  ? 4.746   -46.255 105.082 1.00 103.02 ? 504  GLU C C     1 
ATOM   7548  O  O     . GLU C 2  504  ? 4.646   -47.305 104.438 1.00 103.41 ? 504  GLU C O     1 
ATOM   7549  C  CB    . GLU C 2  504  ? 2.500   -46.424 106.237 1.00 106.46 ? 504  GLU C CB    1 
ATOM   7550  C  CG    . GLU C 2  504  ? 1.671   -47.279 105.287 1.00 110.41 ? 504  GLU C CG    1 
ATOM   7551  C  CD    . GLU C 2  504  ? 0.812   -48.286 106.019 1.00 117.25 ? 504  GLU C CD    1 
ATOM   7552  O  OE1   . GLU C 2  504  ? 0.628   -48.121 107.245 1.00 112.21 ? 504  GLU C OE1   1 
ATOM   7553  O  OE2   . GLU C 2  504  ? 0.326   -49.240 105.370 1.00 116.54 ? 504  GLU C OE2   1 
ATOM   7554  N  N     . GLY C 2  505  ? 5.917   -45.713 105.398 1.00 99.33  ? 505  GLY C N     1 
ATOM   7555  C  CA    . GLY C 2  505  ? 7.125   -46.223 104.787 1.00 104.73 ? 505  GLY C CA    1 
ATOM   7556  C  C     . GLY C 2  505  ? 7.148   -45.927 103.301 1.00 104.66 ? 505  GLY C C     1 
ATOM   7557  O  O     . GLY C 2  505  ? 7.107   -44.759 102.904 1.00 104.44 ? 505  GLY C O     1 
ATOM   7558  N  N     . ASN C 2  506  ? 7.205   -46.965 102.465 1.00 102.33 ? 506  ASN C N     1 
ATOM   7559  C  CA    . ASN C 2  506  ? 7.144   -46.801 101.019 1.00 98.20  ? 506  ASN C CA    1 
ATOM   7560  C  C     . ASN C 2  506  ? 5.865   -47.358 100.414 1.00 97.95  ? 506  ASN C C     1 
ATOM   7561  O  O     . ASN C 2  506  ? 5.776   -47.468 99.191  1.00 91.87  ? 506  ASN C O     1 
ATOM   7562  C  CB    . ASN C 2  506  ? 8.358   -47.455 100.366 1.00 100.08 ? 506  ASN C CB    1 
ATOM   7563  C  CG    . ASN C 2  506  ? 9.643   -46.725 100.689 1.00 112.17 ? 506  ASN C CG    1 
ATOM   7564  O  OD1   . ASN C 2  506  ? 9.994   -45.740 100.035 1.00 115.44 ? 506  ASN C OD1   1 
ATOM   7565  N  ND2   . ASN C 2  506  ? 10.356  -47.207 101.699 1.00 114.44 ? 506  ASN C ND2   1 
ATOM   7566  N  N     . ARG C 2  507  ? 4.875   -47.708 101.232 1.00 98.98  ? 507  ARG C N     1 
ATOM   7567  C  CA    . ARG C 2  507  ? 3.629   -48.284 100.747 1.00 100.35 ? 507  ARG C CA    1 
ATOM   7568  C  C     . ARG C 2  507  ? 2.522   -47.238 100.756 1.00 98.28  ? 507  ARG C C     1 
ATOM   7569  O  O     . ARG C 2  507  ? 2.469   -46.378 101.640 1.00 100.50 ? 507  ARG C O     1 
ATOM   7570  C  CB    . ARG C 2  507  ? 3.216   -49.490 101.597 1.00 107.59 ? 507  ARG C CB    1 
ATOM   7571  C  CG    . ARG C 2  507  ? 1.976   -50.227 101.087 1.00 109.52 ? 507  ARG C CG    1 
ATOM   7572  C  CD    . ARG C 2  507  ? 1.702   -51.512 101.864 1.00 115.81 ? 507  ARG C CD    1 
ATOM   7573  N  NE    . ARG C 2  507  ? 2.732   -52.528 101.644 1.00 128.17 ? 507  ARG C NE    1 
ATOM   7574  C  CZ    . ARG C 2  507  ? 2.711   -53.427 100.661 1.00 125.29 ? 507  ARG C CZ    1 
ATOM   7575  N  NH1   . ARG C 2  507  ? 1.707   -53.444 99.792  1.00 122.88 ? 507  ARG C NH1   1 
ATOM   7576  N  NH2   . ARG C 2  507  ? 3.696   -54.310 100.546 1.00 116.95 ? 507  ARG C NH2   1 
ATOM   7577  N  N     . ILE C 2  508  ? 1.640   -47.323 99.768  1.00 96.97  ? 508  ILE C N     1 
ATOM   7578  C  CA    . ILE C 2  508  ? 0.521   -46.395 99.640  1.00 93.99  ? 508  ILE C CA    1 
ATOM   7579  C  C     . ILE C 2  508  ? -0.542  -46.748 100.674 1.00 95.84  ? 508  ILE C C     1 
ATOM   7580  O  O     . ILE C 2  508  ? -0.951  -47.909 100.793 1.00 97.10  ? 508  ILE C O     1 
ATOM   7581  C  CB    . ILE C 2  508  ? -0.045  -46.429 98.210  1.00 96.68  ? 508  ILE C CB    1 
ATOM   7582  C  CG1   . ILE C 2  508  ? 0.958   -45.808 97.233  1.00 88.62  ? 508  ILE C CG1   1 
ATOM   7583  C  CG2   . ILE C 2  508  ? -1.393  -45.729 98.141  1.00 100.27 ? 508  ILE C CG2   1 
ATOM   7584  C  CD1   . ILE C 2  508  ? 0.453   -45.720 95.815  1.00 90.00  ? 508  ILE C CD1   1 
ATOM   7585  N  N     . ALA C 2  509  ? -0.996  -45.744 101.421 1.00 98.19  ? 509  ALA C N     1 
ATOM   7586  C  CA    . ALA C 2  509  ? -1.856  -45.951 102.577 1.00 92.77  ? 509  ALA C CA    1 
ATOM   7587  C  C     . ALA C 2  509  ? -3.304  -45.542 102.338 1.00 92.70  ? 509  ALA C C     1 
ATOM   7588  O  O     . ALA C 2  509  ? -4.082  -45.492 103.293 1.00 104.47 ? 509  ALA C O     1 
ATOM   7589  C  CB    . ALA C 2  509  ? -1.293  -45.193 103.779 1.00 95.72  ? 509  ALA C CB    1 
ATOM   7590  N  N     . ALA C 2  510  ? -3.688  -45.247 101.100 1.00 89.04  ? 510  ALA C N     1 
ATOM   7591  C  CA    . ALA C 2  510  ? -5.039  -44.798 100.787 1.00 84.64  ? 510  ALA C CA    1 
ATOM   7592  C  C     . ALA C 2  510  ? -5.678  -45.764 99.802  1.00 90.20  ? 510  ALA C C     1 
ATOM   7593  O  O     . ALA C 2  510  ? -5.079  -46.080 98.771  1.00 94.95  ? 510  ALA C O     1 
ATOM   7594  C  CB    . ALA C 2  510  ? -5.026  -43.385 100.195 1.00 82.46  ? 510  ALA C CB    1 
ATOM   7595  N  N     . GLU C 2  511  ? -6.894  -46.225 100.104 1.00 91.09  ? 511  GLU C N     1 
ATOM   7596  C  CA    . GLU C 2  511  ? -7.581  -47.068 99.129  1.00 97.73  ? 511  GLU C CA    1 
ATOM   7597  C  C     . GLU C 2  511  ? -8.120  -46.267 97.948  1.00 92.37  ? 511  GLU C C     1 
ATOM   7598  O  O     . GLU C 2  511  ? -8.547  -46.861 96.948  1.00 87.01  ? 511  GLU C O     1 
ATOM   7599  C  CB    . GLU C 2  511  ? -8.713  -47.863 99.794  1.00 87.41  ? 511  GLU C CB    1 
ATOM   7600  C  CG    . GLU C 2  511  ? -8.375  -49.351 100.072 1.00 103.81 ? 511  GLU C CG    1 
ATOM   7601  C  CD    . GLU C 2  511  ? -7.727  -50.093 98.876  1.00 115.93 ? 511  GLU C CD    1 
ATOM   7602  O  OE1   . GLU C 2  511  ? -6.742  -50.839 99.096  1.00 113.45 ? 511  GLU C OE1   1 
ATOM   7603  O  OE2   . GLU C 2  511  ? -8.196  -49.943 97.720  1.00 108.55 ? 511  GLU C OE2   1 
ATOM   7604  N  N     . ARG C 2  512  ? -8.105  -44.941 98.035  1.00 89.98  ? 512  ARG C N     1 
ATOM   7605  C  CA    . ARG C 2  512  ? -8.459  -44.077 96.918  1.00 88.05  ? 512  ARG C CA    1 
ATOM   7606  C  C     . ARG C 2  512  ? -7.350  -43.050 96.752  1.00 89.05  ? 512  ARG C C     1 
ATOM   7607  O  O     . ARG C 2  512  ? -7.029  -42.314 97.694  1.00 88.82  ? 512  ARG C O     1 
ATOM   7608  C  CB    . ARG C 2  512  ? -9.825  -43.418 97.129  1.00 89.86  ? 512  ARG C CB    1 
ATOM   7609  C  CG    . ARG C 2  512  ? -10.980 -44.402 96.944  1.00 90.35  ? 512  ARG C CG    1 
ATOM   7610  C  CD    . ARG C 2  512  ? -12.322 -43.831 97.391  1.00 96.92  ? 512  ARG C CD    1 
ATOM   7611  N  NE    . ARG C 2  512  ? -12.951 -42.980 96.382  1.00 100.76 ? 512  ARG C NE    1 
ATOM   7612  C  CZ    . ARG C 2  512  ? -12.936 -41.650 96.405  1.00 98.46  ? 512  ARG C CZ    1 
ATOM   7613  N  NH1   . ARG C 2  512  ? -12.317 -41.007 97.387  1.00 92.51  ? 512  ARG C NH1   1 
ATOM   7614  N  NH2   . ARG C 2  512  ? -13.543 -40.961 95.445  1.00 93.18  ? 512  ARG C NH2   1 
ATOM   7615  N  N     . VAL C 2  513  ? -6.756  -43.034 95.558  1.00 86.52  ? 513  VAL C N     1 
ATOM   7616  C  CA    . VAL C 2  513  ? -5.546  -42.286 95.240  1.00 85.61  ? 513  VAL C CA    1 
ATOM   7617  C  C     . VAL C 2  513  ? -5.850  -41.338 94.086  1.00 86.62  ? 513  VAL C C     1 
ATOM   7618  O  O     . VAL C 2  513  ? -6.434  -41.746 93.072  1.00 82.57  ? 513  VAL C O     1 
ATOM   7619  C  CB    . VAL C 2  513  ? -4.381  -43.221 94.865  1.00 84.61  ? 513  VAL C CB    1 
ATOM   7620  C  CG1   . VAL C 2  513  ? -3.188  -42.404 94.380  1.00 83.95  ? 513  VAL C CG1   1 
ATOM   7621  C  CG2   . VAL C 2  513  ? -4.000  -44.104 96.040  1.00 80.00  ? 513  VAL C CG2   1 
ATOM   7622  N  N     . VAL C 2  514  ? -5.449  -40.080 94.237  1.00 88.15  ? 514  VAL C N     1 
ATOM   7623  C  CA    . VAL C 2  514  ? -5.635  -39.104 93.172  1.00 84.12  ? 514  VAL C CA    1 
ATOM   7624  C  C     . VAL C 2  514  ? -4.479  -39.231 92.190  1.00 79.47  ? 514  VAL C C     1 
ATOM   7625  O  O     . VAL C 2  514  ? -3.305  -39.246 92.586  1.00 75.05  ? 514  VAL C O     1 
ATOM   7626  C  CB    . VAL C 2  514  ? -5.741  -37.683 93.749  1.00 85.63  ? 514  VAL C CB    1 
ATOM   7627  C  CG1   . VAL C 2  514  ? -6.166  -36.699 92.664  1.00 78.12  ? 514  VAL C CG1   1 
ATOM   7628  C  CG2   . VAL C 2  514  ? -6.730  -37.652 94.904  1.00 82.71  ? 514  VAL C CG2   1 
ATOM   7629  N  N     . ALA C 2  515  ? -4.803  -39.330 90.902  1.00 76.37  ? 515  ALA C N     1 
ATOM   7630  C  CA    . ALA C 2  515  ? -3.782  -39.577 89.900  1.00 77.94  ? 515  ALA C CA    1 
ATOM   7631  C  C     . ALA C 2  515  ? -4.165  -38.908 88.584  1.00 76.89  ? 515  ALA C C     1 
ATOM   7632  O  O     . ALA C 2  515  ? -5.256  -38.354 88.431  1.00 73.27  ? 515  ALA C O     1 
ATOM   7633  C  CB    . ALA C 2  515  ? -3.570  -41.079 89.711  1.00 79.64  ? 515  ALA C CB    1 
ATOM   7634  N  N     . ARG C 2  516  ? -3.240  -38.971 87.628  1.00 72.00  ? 516  ARG C N     1 
ATOM   7635  C  CA    . ARG C 2  516  ? -3.433  -38.468 86.277  1.00 73.12  ? 516  ARG C CA    1 
ATOM   7636  C  C     . ARG C 2  516  ? -3.290  -39.603 85.272  1.00 75.33  ? 516  ARG C C     1 
ATOM   7637  O  O     . ARG C 2  516  ? -2.394  -40.446 85.393  1.00 79.98  ? 516  ARG C O     1 
ATOM   7638  C  CB    . ARG C 2  516  ? -2.428  -37.361 85.937  1.00 76.10  ? 516  ARG C CB    1 
ATOM   7639  C  CG    . ARG C 2  516  ? -2.752  -36.006 86.517  1.00 72.94  ? 516  ARG C CG    1 
ATOM   7640  C  CD    . ARG C 2  516  ? -1.625  -35.016 86.266  1.00 73.43  ? 516  ARG C CD    1 
ATOM   7641  N  NE    . ARG C 2  516  ? -0.332  -35.523 86.718  1.00 75.92  ? 516  ARG C NE    1 
ATOM   7642  C  CZ    . ARG C 2  516  ? 0.749   -35.603 85.951  1.00 71.04  ? 516  ARG C CZ    1 
ATOM   7643  N  NH1   . ARG C 2  516  ? 0.703   -35.192 84.692  1.00 72.69  ? 516  ARG C NH1   1 
ATOM   7644  N  NH2   . ARG C 2  516  ? 1.882   -36.081 86.448  1.00 71.57  ? 516  ARG C NH2   1 
ATOM   7645  N  N     . ARG C 2  517  ? -4.191  -39.614 84.293  1.00 70.62  ? 517  ARG C N     1 
ATOM   7646  C  CA    . ARG C 2  517  ? -4.127  -40.491 83.130  1.00 74.17  ? 517  ARG C CA    1 
ATOM   7647  C  C     . ARG C 2  517  ? -4.289  -39.605 81.906  1.00 75.71  ? 517  ARG C C     1 
ATOM   7648  O  O     . ARG C 2  517  ? -5.386  -39.093 81.659  1.00 73.53  ? 517  ARG C O     1 
ATOM   7649  C  CB    . ARG C 2  517  ? -5.221  -41.560 83.162  1.00 83.82  ? 517  ARG C CB    1 
ATOM   7650  C  CG    . ARG C 2  517  ? -4.893  -42.810 83.959  1.00 94.33  ? 517  ARG C CG    1 
ATOM   7651  C  CD    . ARG C 2  517  ? -6.176  -43.555 84.351  1.00 100.54 ? 517  ARG C CD    1 
ATOM   7652  N  NE    . ARG C 2  517  ? -5.922  -44.920 84.814  1.00 98.97  ? 517  ARG C NE    1 
ATOM   7653  C  CZ    . ARG C 2  517  ? -6.857  -45.731 85.299  1.00 101.32 ? 517  ARG C CZ    1 
ATOM   7654  N  NH1   . ARG C 2  517  ? -8.115  -45.313 85.394  1.00 100.50 ? 517  ARG C NH1   1 
ATOM   7655  N  NH2   . ARG C 2  517  ? -6.535  -46.959 85.691  1.00 102.05 ? 517  ARG C NH2   1 
ATOM   7656  N  N     . LYS C 2  518  ? -3.208  -39.440 81.139  1.00 78.96  ? 518  LYS C N     1 
ATOM   7657  C  CA    . LYS C 2  518  ? -3.183  -38.523 80.000  1.00 69.96  ? 518  LYS C CA    1 
ATOM   7658  C  C     . LYS C 2  518  ? -3.717  -37.155 80.407  1.00 73.99  ? 518  LYS C C     1 
ATOM   7659  O  O     . LYS C 2  518  ? -4.602  -36.587 79.762  1.00 70.38  ? 518  LYS C O     1 
ATOM   7660  C  CB    . LYS C 2  518  ? -3.973  -39.078 78.815  1.00 72.16  ? 518  LYS C CB    1 
ATOM   7661  C  CG    . LYS C 2  518  ? -3.184  -40.004 77.909  1.00 81.08  ? 518  LYS C CG    1 
ATOM   7662  C  CD    . LYS C 2  518  ? -3.959  -40.327 76.639  1.00 82.63  ? 518  LYS C CD    1 
ATOM   7663  C  CE    . LYS C 2  518  ? -3.138  -41.189 75.693  1.00 85.80  ? 518  LYS C CE    1 
ATOM   7664  N  NZ    . LYS C 2  518  ? -2.641  -42.426 76.360  1.00 90.45  ? 518  LYS C NZ    1 
ATOM   7665  N  N     . GLY C 2  519  ? -3.189  -36.642 81.520  1.00 72.40  ? 519  GLY C N     1 
ATOM   7666  C  CA    . GLY C 2  519  ? -3.585  -35.352 82.035  1.00 69.57  ? 519  GLY C CA    1 
ATOM   7667  C  C     . GLY C 2  519  ? -4.933  -35.308 82.719  1.00 73.82  ? 519  GLY C C     1 
ATOM   7668  O  O     . GLY C 2  519  ? -5.246  -34.298 83.360  1.00 79.20  ? 519  GLY C O     1 
ATOM   7669  N  N     . GLU C 2  520  ? -5.744  -36.366 82.614  1.00 75.11  ? 520  GLU C N     1 
ATOM   7670  C  CA    . GLU C 2  520  ? -7.080  -36.363 83.205  1.00 79.44  ? 520  GLU C CA    1 
ATOM   7671  C  C     . GLU C 2  520  ? -7.009  -36.803 84.665  1.00 77.94  ? 520  GLU C C     1 
ATOM   7672  O  O     . GLU C 2  520  ? -6.336  -37.793 84.970  1.00 77.39  ? 520  GLU C O     1 
ATOM   7673  C  CB    . GLU C 2  520  ? -8.009  -37.289 82.432  1.00 81.60  ? 520  GLU C CB    1 
ATOM   7674  C  CG    . GLU C 2  520  ? -9.491  -37.053 82.696  1.00 98.39  ? 520  GLU C CG    1 
ATOM   7675  C  CD    . GLU C 2  520  ? -9.968  -35.720 82.144  1.00 109.45 ? 520  GLU C CD    1 
ATOM   7676  O  OE1   . GLU C 2  520  ? -10.928 -35.148 82.713  1.00 101.46 ? 520  GLU C OE1   1 
ATOM   7677  O  OE2   . GLU C 2  520  ? -9.375  -35.249 81.142  1.00 100.64 ? 520  GLU C OE2   1 
ATOM   7678  N  N     . PRO C 2  521  ? -7.655  -36.093 85.590  1.00 77.80  ? 521  PRO C N     1 
ATOM   7679  C  CA    . PRO C 2  521  ? -7.623  -36.510 86.997  1.00 80.54  ? 521  PRO C CA    1 
ATOM   7680  C  C     . PRO C 2  521  ? -8.581  -37.660 87.262  1.00 78.46  ? 521  PRO C C     1 
ATOM   7681  O  O     . PRO C 2  521  ? -9.715  -37.683 86.774  1.00 75.03  ? 521  PRO C O     1 
ATOM   7682  C  CB    . PRO C 2  521  ? -8.046  -35.243 87.750  1.00 74.36  ? 521  PRO C CB    1 
ATOM   7683  C  CG    . PRO C 2  521  ? -7.772  -34.126 86.788  1.00 81.03  ? 521  PRO C CG    1 
ATOM   7684  C  CD    . PRO C 2  521  ? -8.122  -34.710 85.452  1.00 79.19  ? 521  PRO C CD    1 
ATOM   7685  N  N     . VAL C 2  522  ? -8.109  -38.622 88.047  1.00 76.28  ? 522  VAL C N     1 
ATOM   7686  C  CA    . VAL C 2  522  ? -8.817  -39.884 88.217  1.00 78.52  ? 522  VAL C CA    1 
ATOM   7687  C  C     . VAL C 2  522  ? -8.544  -40.427 89.614  1.00 79.91  ? 522  VAL C C     1 
ATOM   7688  O  O     . VAL C 2  522  ? -7.434  -40.296 90.146  1.00 79.59  ? 522  VAL C O     1 
ATOM   7689  C  CB    . VAL C 2  522  ? -8.409  -40.892 87.122  1.00 81.69  ? 522  VAL C CB    1 
ATOM   7690  C  CG1   . VAL C 2  522  ? -6.907  -41.074 87.118  1.00 77.16  ? 522  VAL C CG1   1 
ATOM   7691  C  CG2   . VAL C 2  522  ? -9.128  -42.229 87.314  1.00 91.77  ? 522  VAL C CG2   1 
ATOM   7692  N  N     . ILE C 2  523  ? -9.575  -41.031 90.210  1.00 76.64  ? 523  ILE C N     1 
ATOM   7693  C  CA    . ILE C 2  523  ? -9.485  -41.665 91.522  1.00 81.02  ? 523  ILE C CA    1 
ATOM   7694  C  C     . ILE C 2  523  ? -9.313  -43.160 91.317  1.00 78.67  ? 523  ILE C C     1 
ATOM   7695  O  O     . ILE C 2  523  ? -10.136 -43.807 90.653  1.00 76.13  ? 523  ILE C O     1 
ATOM   7696  C  CB    . ILE C 2  523  ? -10.721 -41.364 92.384  1.00 81.35  ? 523  ILE C CB    1 
ATOM   7697  C  CG1   . ILE C 2  523  ? -10.923 -39.855 92.499  1.00 72.87  ? 523  ILE C CG1   1 
ATOM   7698  C  CG2   . ILE C 2  523  ? -10.564 -41.991 93.765  1.00 80.57  ? 523  ILE C CG2   1 
ATOM   7699  C  CD1   . ILE C 2  523  ? -9.752  -39.119 93.127  1.00 74.56  ? 523  ILE C CD1   1 
ATOM   7700  N  N     . VAL C 2  524  ? -8.264  -43.714 91.920  1.00 78.94  ? 524  VAL C N     1 
ATOM   7701  C  CA    . VAL C 2  524  ? -7.661  -44.943 91.426  1.00 81.56  ? 524  VAL C CA    1 
ATOM   7702  C  C     . VAL C 2  524  ? -7.193  -45.762 92.624  1.00 86.13  ? 524  VAL C C     1 
ATOM   7703  O  O     . VAL C 2  524  ? -6.906  -45.217 93.693  1.00 84.32  ? 524  VAL C O     1 
ATOM   7704  C  CB    . VAL C 2  524  ? -6.512  -44.599 90.435  1.00 82.77  ? 524  VAL C CB    1 
ATOM   7705  C  CG1   . VAL C 2  524  ? -5.151  -45.104 90.942  1.00 75.90  ? 524  VAL C CG1   1 
ATOM   7706  C  CG2   . VAL C 2  524  ? -6.838  -45.105 89.003  1.00 81.96  ? 524  VAL C CG2   1 
ATOM   7707  N  N     . SER C 2  525  ? -7.153  -47.110 92.457  1.00 88.69  ? 525  SER C N     1 
ATOM   7708  C  CA    . SER C 2  525  ? -6.659  -47.943 93.553  1.00 88.29  ? 525  SER C CA    1 
ATOM   7709  C  C     . SER C 2  525  ? -5.133  -48.024 93.523  1.00 87.68  ? 525  SER C C     1 
ATOM   7710  O  O     . SER C 2  525  ? -4.517  -47.849 92.464  1.00 87.04  ? 525  SER C O     1 
ATOM   7711  C  CB    . SER C 2  525  ? -7.243  -49.353 93.477  1.00 91.27  ? 525  SER C CB    1 
ATOM   7712  O  OG    . SER C 2  525  ? -8.593  -49.360 93.905  1.00 106.42 ? 525  SER C OG    1 
ATOM   7713  N  N     . PRO C 2  526  ? -4.497  -48.284 94.675  1.00 86.87  ? 526  PRO C N     1 
ATOM   7714  C  CA    . PRO C 2  526  ? -3.029  -48.455 94.682  1.00 88.53  ? 526  PRO C CA    1 
ATOM   7715  C  C     . PRO C 2  526  ? -2.530  -49.509 93.702  1.00 90.52  ? 526  PRO C C     1 
ATOM   7716  O  O     . PRO C 2  526  ? -1.389  -49.423 93.221  1.00 93.99  ? 526  PRO C O     1 
ATOM   7717  C  CB    . PRO C 2  526  ? -2.728  -48.855 96.134  1.00 86.86  ? 526  PRO C CB    1 
ATOM   7718  C  CG    . PRO C 2  526  ? -3.871  -48.319 96.922  1.00 83.54  ? 526  PRO C CG    1 
ATOM   7719  C  CD    . PRO C 2  526  ? -5.076  -48.398 96.025  1.00 83.59  ? 526  PRO C CD    1 
ATOM   7720  N  N     . GLU C 2  527  ? -3.358  -50.512 93.398  1.00 94.52  ? 527  GLU C N     1 
ATOM   7721  C  CA    . GLU C 2  527  ? -2.999  -51.515 92.403  1.00 90.88  ? 527  GLU C CA    1 
ATOM   7722  C  C     . GLU C 2  527  ? -2.785  -50.895 91.029  1.00 93.01  ? 527  GLU C C     1 
ATOM   7723  O  O     . GLU C 2  527  ? -1.966  -51.389 90.245  1.00 90.54  ? 527  GLU C O     1 
ATOM   7724  C  CB    . GLU C 2  527  ? -4.089  -52.590 92.332  1.00 90.79  ? 527  GLU C CB    1 
ATOM   7725  C  CG    . GLU C 2  527  ? -4.148  -53.540 93.538  1.00 104.72 ? 527  GLU C CG    1 
ATOM   7726  C  CD    . GLU C 2  527  ? -5.028  -53.046 94.693  1.00 102.74 ? 527  GLU C CD    1 
ATOM   7727  O  OE1   . GLU C 2  527  ? -5.590  -51.931 94.612  1.00 100.26 ? 527  GLU C OE1   1 
ATOM   7728  O  OE2   . GLU C 2  527  ? -5.161  -53.789 95.689  1.00 106.43 ? 527  GLU C OE2   1 
ATOM   7729  N  N     . GLU C 2  528  ? -3.498  -49.811 90.724  1.00 90.79  ? 528  GLU C N     1 
ATOM   7730  C  CA    . GLU C 2  528  ? -3.464  -49.197 89.403  1.00 89.57  ? 528  GLU C CA    1 
ATOM   7731  C  C     . GLU C 2  528  ? -2.364  -48.154 89.237  1.00 84.99  ? 528  GLU C C     1 
ATOM   7732  O  O     . GLU C 2  528  ? -2.159  -47.676 88.115  1.00 82.58  ? 528  GLU C O     1 
ATOM   7733  C  CB    . GLU C 2  528  ? -4.815  -48.545 89.096  1.00 90.59  ? 528  GLU C CB    1 
ATOM   7734  C  CG    . GLU C 2  528  ? -6.005  -49.475 89.204  1.00 92.24  ? 528  GLU C CG    1 
ATOM   7735  C  CD    . GLU C 2  528  ? -7.320  -48.747 89.003  1.00 93.39  ? 528  GLU C CD    1 
ATOM   7736  O  OE1   . GLU C 2  528  ? -7.892  -48.260 90.005  1.00 95.02  ? 528  GLU C OE1   1 
ATOM   7737  O  OE2   . GLU C 2  528  ? -7.769  -48.646 87.840  1.00 92.69  ? 528  GLU C OE2   1 
ATOM   7738  N  N     . VAL C 2  529  ? -1.656  -47.799 90.306  1.00 79.03  ? 529  VAL C N     1 
ATOM   7739  C  CA    . VAL C 2  529  ? -0.701  -46.693 90.271  1.00 80.80  ? 529  VAL C CA    1 
ATOM   7740  C  C     . VAL C 2  529  ? 0.617   -47.160 89.657  1.00 84.13  ? 529  VAL C C     1 
ATOM   7741  O  O     . VAL C 2  529  ? 1.300   -48.028 90.208  1.00 87.43  ? 529  VAL C O     1 
ATOM   7742  C  CB    . VAL C 2  529  ? -0.479  -46.115 91.675  1.00 79.36  ? 529  VAL C CB    1 
ATOM   7743  C  CG1   . VAL C 2  529  ? 0.673   -45.127 91.662  1.00 82.52  ? 529  VAL C CG1   1 
ATOM   7744  C  CG2   . VAL C 2  529  ? -1.741  -45.440 92.172  1.00 83.13  ? 529  VAL C CG2   1 
ATOM   7745  N  N     . GLU C 2  530  ? 0.991   -46.560 88.527  1.00 79.69  ? 530  GLU C N     1 
ATOM   7746  C  CA    . GLU C 2  530  ? 2.243   -46.903 87.865  1.00 80.50  ? 530  GLU C CA    1 
ATOM   7747  C  C     . GLU C 2  530  ? 3.407   -46.013 88.300  1.00 79.93  ? 530  GLU C C     1 
ATOM   7748  O  O     . GLU C 2  530  ? 4.532   -46.502 88.449  1.00 80.22  ? 530  GLU C O     1 
ATOM   7749  C  CB    . GLU C 2  530  ? 2.052   -46.851 86.345  1.00 78.09  ? 530  GLU C CB    1 
ATOM   7750  C  CG    . GLU C 2  530  ? 1.491   -48.153 85.776  1.00 79.30  ? 530  GLU C CG    1 
ATOM   7751  C  CD    . GLU C 2  530  ? 0.746   -47.977 84.467  1.00 82.41  ? 530  GLU C CD    1 
ATOM   7752  O  OE1   . GLU C 2  530  ? -0.088  -47.056 84.374  1.00 84.22  ? 530  GLU C OE1   1 
ATOM   7753  O  OE2   . GLU C 2  530  ? 0.991   -48.765 83.528  1.00 97.51  ? 530  GLU C OE2   1 
ATOM   7754  N  N     . PHE C 2  531  ? 3.173   -44.719 88.522  1.00 77.75  ? 531  PHE C N     1 
ATOM   7755  C  CA    . PHE C 2  531  ? 4.227   -43.813 88.962  1.00 76.81  ? 531  PHE C CA    1 
ATOM   7756  C  C     . PHE C 2  531  ? 3.657   -42.815 89.968  1.00 78.25  ? 531  PHE C C     1 
ATOM   7757  O  O     . PHE C 2  531  ? 2.463   -42.827 90.282  1.00 79.17  ? 531  PHE C O     1 
ATOM   7758  C  CB    . PHE C 2  531  ? 4.864   -43.090 87.771  1.00 77.39  ? 531  PHE C CB    1 
ATOM   7759  C  CG    . PHE C 2  531  ? 5.635   -43.992 86.855  1.00 77.53  ? 531  PHE C CG    1 
ATOM   7760  C  CD1   . PHE C 2  531  ? 5.009   -44.618 85.787  1.00 78.12  ? 531  PHE C CD1   1 
ATOM   7761  C  CD2   . PHE C 2  531  ? 6.984   -44.210 87.057  1.00 76.65  ? 531  PHE C CD2   1 
ATOM   7762  C  CE1   . PHE C 2  531  ? 5.715   -45.445 84.939  1.00 76.94  ? 531  PHE C CE1   1 
ATOM   7763  C  CE2   . PHE C 2  531  ? 7.698   -45.037 86.211  1.00 76.46  ? 531  PHE C CE2   1 
ATOM   7764  C  CZ    . PHE C 2  531  ? 7.062   -45.655 85.152  1.00 78.28  ? 531  PHE C CZ    1 
ATOM   7765  N  N     . MET C 2  532  ? 4.525   -41.945 90.482  1.00 72.04  ? 532  MET C N     1 
ATOM   7766  C  CA    . MET C 2  532  ? 4.103   -40.925 91.437  1.00 72.37  ? 532  MET C CA    1 
ATOM   7767  C  C     . MET C 2  532  ? 4.974   -39.680 91.301  1.00 71.61  ? 532  MET C C     1 
ATOM   7768  O  O     . MET C 2  532  ? 6.172   -39.786 91.056  1.00 73.20  ? 532  MET C O     1 
ATOM   7769  C  CB    . MET C 2  532  ? 4.163   -41.475 92.866  1.00 78.46  ? 532  MET C CB    1 
ATOM   7770  C  CG    . MET C 2  532  ? 3.803   -40.485 93.954  1.00 76.59  ? 532  MET C CG    1 
ATOM   7771  S  SD    . MET C 2  532  ? 3.532   -41.337 95.512  1.00 83.80  ? 532  MET C SD    1 
ATOM   7772  C  CE    . MET C 2  532  ? 4.092   -40.114 96.696  1.00 88.04  ? 532  MET C CE    1 
ATOM   7773  N  N     . ASP C 2  533  ? 4.372   -38.503 91.466  1.00 72.33  ? 533  ASP C N     1 
ATOM   7774  C  CA    . ASP C 2  533  ? 5.132   -37.260 91.384  1.00 66.98  ? 533  ASP C CA    1 
ATOM   7775  C  C     . ASP C 2  533  ? 6.243   -37.230 92.429  1.00 71.24  ? 533  ASP C C     1 
ATOM   7776  O  O     . ASP C 2  533  ? 6.128   -37.804 93.513  1.00 78.68  ? 533  ASP C O     1 
ATOM   7777  C  CB    . ASP C 2  533  ? 4.224   -36.046 91.579  1.00 70.21  ? 533  ASP C CB    1 
ATOM   7778  C  CG    . ASP C 2  533  ? 3.187   -35.896 90.482  1.00 76.17  ? 533  ASP C CG    1 
ATOM   7779  O  OD1   . ASP C 2  533  ? 2.739   -36.920 89.921  1.00 75.73  ? 533  ASP C OD1   1 
ATOM   7780  O  OD2   . ASP C 2  533  ? 2.820   -34.738 90.184  1.00 77.60  ? 533  ASP C OD2   1 
ATOM   7781  N  N     . VAL C 2  534  ? 7.335   -36.546 92.088  1.00 73.87  ? 534  VAL C N     1 
ATOM   7782  C  CA    . VAL C 2  534  ? 8.460   -36.430 93.009  1.00 72.03  ? 534  VAL C CA    1 
ATOM   7783  C  C     . VAL C 2  534  ? 8.184   -35.384 94.076  1.00 70.92  ? 534  VAL C C     1 
ATOM   7784  O  O     . VAL C 2  534  ? 8.503   -35.584 95.254  1.00 77.86  ? 534  VAL C O     1 
ATOM   7785  C  CB    . VAL C 2  534  ? 9.746   -36.116 92.226  1.00 68.48  ? 534  VAL C CB    1 
ATOM   7786  C  CG1   . VAL C 2  534  ? 10.829  -35.570 93.148  1.00 67.28  ? 534  VAL C CG1   1 
ATOM   7787  C  CG2   . VAL C 2  534  ? 10.225  -37.362 91.516  1.00 76.16  ? 534  VAL C CG2   1 
ATOM   7788  N  N     . SER C 2  535  ? 7.578   -34.266 93.687  1.00 76.86  ? 535  SER C N     1 
ATOM   7789  C  CA    . SER C 2  535  ? 7.344   -33.136 94.576  1.00 76.39  ? 535  SER C CA    1 
ATOM   7790  C  C     . SER C 2  535  ? 6.351   -32.169 93.945  1.00 71.30  ? 535  SER C C     1 
ATOM   7791  O  O     . SER C 2  535  ? 6.207   -32.142 92.715  1.00 67.66  ? 535  SER C O     1 
ATOM   7792  C  CB    . SER C 2  535  ? 8.659   -32.415 94.881  1.00 74.07  ? 535  SER C CB    1 
ATOM   7793  O  OG    . SER C 2  535  ? 8.441   -31.247 95.648  1.00 73.31  ? 535  SER C OG    1 
ATOM   7794  N  N     . PRO C 2  536  ? 5.634   -31.377 94.747  1.00 79.58  ? 536  PRO C N     1 
ATOM   7795  C  CA    . PRO C 2  536  ? 4.879   -30.257 94.166  1.00 71.50  ? 536  PRO C CA    1 
ATOM   7796  C  C     . PRO C 2  536  ? 5.776   -29.260 93.461  1.00 68.83  ? 536  PRO C C     1 
ATOM   7797  O  O     . PRO C 2  536  ? 5.379   -28.704 92.425  1.00 70.52  ? 536  PRO C O     1 
ATOM   7798  C  CB    . PRO C 2  536  ? 4.175   -29.638 95.382  1.00 73.28  ? 536  PRO C CB    1 
ATOM   7799  C  CG    . PRO C 2  536  ? 4.941   -30.131 96.572  1.00 77.55  ? 536  PRO C CG    1 
ATOM   7800  C  CD    . PRO C 2  536  ? 5.406   -31.502 96.196  1.00 83.58  ? 536  PRO C CD    1 
ATOM   7801  N  N     . LYS C 2  537  ? 6.995   -29.052 93.975  1.00 67.45  ? 537  LYS C N     1 
ATOM   7802  C  CA    . LYS C 2  537  ? 7.944   -28.139 93.344  1.00 68.83  ? 537  LYS C CA    1 
ATOM   7803  C  C     . LYS C 2  537  ? 8.080   -28.386 91.845  1.00 70.34  ? 537  LYS C C     1 
ATOM   7804  O  O     . LYS C 2  537  ? 8.279   -27.440 91.074  1.00 71.95  ? 537  LYS C O     1 
ATOM   7805  C  CB    . LYS C 2  537  ? 9.318   -28.264 94.010  1.00 68.38  ? 537  LYS C CB    1 
ATOM   7806  C  CG    . LYS C 2  537  ? 9.321   -28.187 95.532  1.00 68.78  ? 537  LYS C CG    1 
ATOM   7807  C  CD    . LYS C 2  537  ? 10.753  -28.186 96.057  1.00 69.16  ? 537  LYS C CD    1 
ATOM   7808  C  CE    . LYS C 2  537  ? 10.833  -28.355 97.564  1.00 74.79  ? 537  LYS C CE    1 
ATOM   7809  N  NZ    . LYS C 2  537  ? 10.155  -27.275 98.340  1.00 87.84  ? 537  LYS C NZ    1 
ATOM   7810  N  N     . GLN C 2  538  ? 7.952   -29.641 91.407  1.00 68.55  ? 538  GLN C N     1 
ATOM   7811  C  CA    . GLN C 2  538  ? 8.226   -29.969 90.015  1.00 71.24  ? 538  GLN C CA    1 
ATOM   7812  C  C     . GLN C 2  538  ? 7.208   -29.374 89.052  1.00 72.31  ? 538  GLN C C     1 
ATOM   7813  O  O     . GLN C 2  538  ? 7.428   -29.435 87.838  1.00 78.97  ? 538  GLN C O     1 
ATOM   7814  C  CB    . GLN C 2  538  ? 8.310   -31.494 89.835  1.00 66.04  ? 538  GLN C CB    1 
ATOM   7815  C  CG    . GLN C 2  538  ? 7.022   -32.202 89.444  1.00 66.65  ? 538  GLN C CG    1 
ATOM   7816  C  CD    . GLN C 2  538  ? 7.193   -33.718 89.366  1.00 70.97  ? 538  GLN C CD    1 
ATOM   7817  O  OE1   . GLN C 2  538  ? 7.476   -34.374 90.370  1.00 73.29  ? 538  GLN C OE1   1 
ATOM   7818  N  NE2   . GLN C 2  538  ? 7.025   -34.278 88.174  1.00 64.47  ? 538  GLN C NE2   1 
ATOM   7819  N  N     . VAL C 2  539  ? 6.128   -28.774 89.546  1.00 67.38  ? 539  VAL C N     1 
ATOM   7820  C  CA    . VAL C 2  539  ? 5.153   -28.185 88.637  1.00 68.54  ? 539  VAL C CA    1 
ATOM   7821  C  C     . VAL C 2  539  ? 5.442   -26.715 88.328  1.00 66.46  ? 539  VAL C C     1 
ATOM   7822  O  O     . VAL C 2  539  ? 4.945   -26.195 87.317  1.00 62.31  ? 539  VAL C O     1 
ATOM   7823  C  CB    . VAL C 2  539  ? 3.740   -28.399 89.212  1.00 67.30  ? 539  VAL C CB    1 
ATOM   7824  C  CG1   . VAL C 2  539  ? 2.680   -27.660 88.411  1.00 64.97  ? 539  VAL C CG1   1 
ATOM   7825  C  CG2   . VAL C 2  539  ? 3.420   -29.890 89.229  1.00 70.89  ? 539  VAL C CG2   1 
ATOM   7826  N  N     . PHE C 2  540  ? 6.281   -26.048 89.120  1.00 60.05  ? 540  PHE C N     1 
ATOM   7827  C  CA    . PHE C 2  540  ? 6.447   -24.607 89.004  1.00 62.61  ? 540  PHE C CA    1 
ATOM   7828  C  C     . PHE C 2  540  ? 7.892   -24.218 88.723  1.00 60.21  ? 540  PHE C C     1 
ATOM   7829  O  O     . PHE C 2  540  ? 8.834   -24.968 88.992  1.00 64.11  ? 540  PHE C O     1 
ATOM   7830  C  CB    . PHE C 2  540  ? 5.958   -23.895 90.275  1.00 62.02  ? 540  PHE C CB    1 
ATOM   7831  C  CG    . PHE C 2  540  ? 4.526   -24.174 90.592  1.00 63.39  ? 540  PHE C CG    1 
ATOM   7832  C  CD1   . PHE C 2  540  ? 3.524   -23.726 89.751  1.00 60.54  ? 540  PHE C CD1   1 
ATOM   7833  C  CD2   . PHE C 2  540  ? 4.180   -24.923 91.704  1.00 67.22  ? 540  PHE C CD2   1 
ATOM   7834  C  CE1   . PHE C 2  540  ? 2.195   -23.998 90.027  1.00 69.68  ? 540  PHE C CE1   1 
ATOM   7835  C  CE2   . PHE C 2  540  ? 2.851   -25.202 91.989  1.00 65.71  ? 540  PHE C CE2   1 
ATOM   7836  C  CZ    . PHE C 2  540  ? 1.856   -24.738 91.152  1.00 68.20  ? 540  PHE C CZ    1 
ATOM   7837  N  N     . SER C 2  541  ? 8.045   -23.005 88.196  1.00 54.05  ? 541  SER C N     1 
ATOM   7838  C  CA    . SER C 2  541  ? 9.347   -22.438 87.900  1.00 55.09  ? 541  SER C CA    1 
ATOM   7839  C  C     . SER C 2  541  ? 10.120  -22.206 89.189  1.00 60.58  ? 541  SER C C     1 
ATOM   7840  O  O     . SER C 2  541  ? 9.634   -22.449 90.293  1.00 64.20  ? 541  SER C O     1 
ATOM   7841  C  CB    . SER C 2  541  ? 9.193   -21.127 87.142  1.00 63.90  ? 541  SER C CB    1 
ATOM   7842  O  OG    . SER C 2  541  ? 8.412   -20.213 87.894  1.00 67.16  ? 541  SER C OG    1 
ATOM   7843  N  N     . VAL C 2  542  ? 11.347  -21.714 89.049  1.00 63.30  ? 542  VAL C N     1 
ATOM   7844  C  CA    . VAL C 2  542  ? 12.144  -21.429 90.236  1.00 66.59  ? 542  VAL C CA    1 
ATOM   7845  C  C     . VAL C 2  542  ? 11.560  -20.247 91.000  1.00 64.82  ? 542  VAL C C     1 
ATOM   7846  O  O     . VAL C 2  542  ? 11.536  -20.237 92.237  1.00 70.02  ? 542  VAL C O     1 
ATOM   7847  C  CB    . VAL C 2  542  ? 13.612  -21.200 89.840  1.00 68.57  ? 542  VAL C CB    1 
ATOM   7848  C  CG1   . VAL C 2  542  ? 14.416  -20.710 91.022  1.00 57.32  ? 542  VAL C CG1   1 
ATOM   7849  C  CG2   . VAL C 2  542  ? 14.205  -22.490 89.285  1.00 66.80  ? 542  VAL C CG2   1 
ATOM   7850  N  N     . ASN C 2  543  ? 11.046  -19.249 90.283  1.00 67.81  ? 543  ASN C N     1 
ATOM   7851  C  CA    . ASN C 2  543  ? 10.545  -18.049 90.948  1.00 63.19  ? 543  ASN C CA    1 
ATOM   7852  C  C     . ASN C 2  543  ? 9.234   -18.314 91.669  1.00 62.16  ? 543  ASN C C     1 
ATOM   7853  O  O     . ASN C 2  543  ? 9.040   -17.846 92.795  1.00 64.47  ? 543  ASN C O     1 
ATOM   7854  C  CB    . ASN C 2  543  ? 10.377  -16.923 89.935  1.00 64.15  ? 543  ASN C CB    1 
ATOM   7855  C  CG    . ASN C 2  543  ? 11.673  -16.556 89.277  1.00 65.62  ? 543  ASN C CG    1 
ATOM   7856  O  OD1   . ASN C 2  543  ? 12.189  -17.299 88.434  1.00 66.71  ? 543  ASN C OD1   1 
ATOM   7857  N  ND2   . ASN C 2  543  ? 12.224  -15.414 89.666  1.00 57.24  ? 543  ASN C ND2   1 
ATOM   7858  N  N     . THR C 2  544  ? 8.314   -19.044 91.029  1.00 62.07  ? 544  THR C N     1 
ATOM   7859  C  CA    . THR C 2  544  ? 7.052   -19.388 91.679  1.00 60.48  ? 544  THR C CA    1 
ATOM   7860  C  C     . THR C 2  544  ? 7.287   -20.226 92.935  1.00 68.04  ? 544  THR C C     1 
ATOM   7861  O  O     . THR C 2  544  ? 6.614   -20.035 93.957  1.00 64.32  ? 544  THR C O     1 
ATOM   7862  C  CB    . THR C 2  544  ? 6.148   -20.130 90.697  1.00 57.13  ? 544  THR C CB    1 
ATOM   7863  O  OG1   . THR C 2  544  ? 6.080   -19.400 89.474  1.00 62.12  ? 544  THR C OG1   1 
ATOM   7864  C  CG2   . THR C 2  544  ? 4.757   -20.254 91.251  1.00 62.92  ? 544  THR C CG2   1 
ATOM   7865  N  N     . ASN C 2  545  ? 8.259   -21.144 92.883  1.00 70.21  ? 545  ASN C N     1 
ATOM   7866  C  CA    . ASN C 2  545  ? 8.614   -21.979 94.027  1.00 65.54  ? 545  ASN C CA    1 
ATOM   7867  C  C     . ASN C 2  545  ? 9.126   -21.181 95.221  1.00 66.93  ? 545  ASN C C     1 
ATOM   7868  O  O     . ASN C 2  545  ? 9.307   -21.764 96.294  1.00 68.65  ? 545  ASN C O     1 
ATOM   7869  C  CB    . ASN C 2  545  ? 9.675   -23.004 93.617  1.00 67.00  ? 545  ASN C CB    1 
ATOM   7870  C  CG    . ASN C 2  545  ? 9.079   -24.343 93.239  1.00 70.55  ? 545  ASN C CG    1 
ATOM   7871  O  OD1   . ASN C 2  545  ? 8.603   -25.080 94.098  1.00 80.64  ? 545  ASN C OD1   1 
ATOM   7872  N  ND2   . ASN C 2  545  ? 9.115   -24.673 91.953  1.00 63.68  ? 545  ASN C ND2   1 
ATOM   7873  N  N     . LEU C 2  546  ? 9.375   -19.883 95.065  1.00 64.96  ? 546  LEU C N     1 
ATOM   7874  C  CA    . LEU C 2  546  ? 9.844   -19.025 96.144  1.00 62.48  ? 546  LEU C CA    1 
ATOM   7875  C  C     . LEU C 2  546  ? 8.710   -18.343 96.892  1.00 65.97  ? 546  LEU C C     1 
ATOM   7876  O  O     . LEU C 2  546  ? 8.976   -17.578 97.825  1.00 65.34  ? 546  LEU C O     1 
ATOM   7877  C  CB    . LEU C 2  546  ? 10.799  -17.971 95.588  1.00 57.60  ? 546  LEU C CB    1 
ATOM   7878  C  CG    . LEU C 2  546  ? 12.158  -18.507 95.169  1.00 59.95  ? 546  LEU C CG    1 
ATOM   7879  C  CD1   . LEU C 2  546  ? 12.952  -17.421 94.477  1.00 64.26  ? 546  LEU C CD1   1 
ATOM   7880  C  CD2   . LEU C 2  546  ? 12.888  -19.000 96.402  1.00 58.85  ? 546  LEU C CD2   1 
ATOM   7881  N  N     . ILE C 2  547  ? 7.466   -18.604 96.503  1.00 65.83  ? 547  ILE C N     1 
ATOM   7882  C  CA    . ILE C 2  547  ? 6.275   -17.982 97.080  1.00 60.35  ? 547  ILE C CA    1 
ATOM   7883  C  C     . ILE C 2  547  ? 5.671   -18.885 98.145  1.00 64.43  ? 547  ILE C C     1 
ATOM   7884  O  O     . ILE C 2  547  ? 4.966   -19.847 97.808  1.00 62.64  ? 547  ILE C O     1 
ATOM   7885  C  CB    . ILE C 2  547  ? 5.213   -17.698 96.009  1.00 63.19  ? 547  ILE C CB    1 
ATOM   7886  C  CG1   . ILE C 2  547  ? 5.737   -16.757 94.935  1.00 55.15  ? 547  ILE C CG1   1 
ATOM   7887  C  CG2   . ILE C 2  547  ? 3.943   -17.134 96.640  1.00 53.69  ? 547  ILE C CG2   1 
ATOM   7888  C  CD1   . ILE C 2  547  ? 4.699   -16.468 93.874  1.00 51.00  ? 547  ILE C CD1   1 
ATOM   7889  N  N     . PRO C 2  548  ? 5.905   -18.621 99.427  1.00 69.94  ? 548  PRO C N     1 
ATOM   7890  C  CA    . PRO C 2  548  ? 5.246   -19.418 100.465 1.00 60.63  ? 548  PRO C CA    1 
ATOM   7891  C  C     . PRO C 2  548  ? 3.736   -19.288 100.363 1.00 58.39  ? 548  PRO C C     1 
ATOM   7892  O  O     . PRO C 2  548  ? 3.210   -18.280 99.893  1.00 56.76  ? 548  PRO C O     1 
ATOM   7893  C  CB    . PRO C 2  548  ? 5.783   -18.820 101.770 1.00 61.01  ? 548  PRO C CB    1 
ATOM   7894  C  CG    . PRO C 2  548  ? 6.301   -17.461 101.393 1.00 63.15  ? 548  PRO C CG    1 
ATOM   7895  C  CD    . PRO C 2  548  ? 6.762   -17.563 99.988  1.00 63.66  ? 548  PRO C CD    1 
ATOM   7896  N  N     . PHE C 2  549  ? 3.039   -20.340 100.790 1.00 63.77  ? 549  PHE C N     1 
ATOM   7897  C  CA    . PHE C 2  549  ? 1.577   -20.376 100.764 1.00 60.26  ? 549  PHE C CA    1 
ATOM   7898  C  C     . PHE C 2  549  ? 1.021   -20.141 99.365  1.00 62.04  ? 549  PHE C C     1 
ATOM   7899  O  O     . PHE C 2  549  ? -0.043  -19.538 99.205  1.00 63.95  ? 549  PHE C O     1 
ATOM   7900  C  CB    . PHE C 2  549  ? 0.981   -19.360 101.734 1.00 58.70  ? 549  PHE C CB    1 
ATOM   7901  C  CG    . PHE C 2  549  ? 1.496   -19.485 103.126 1.00 58.42  ? 549  PHE C CG    1 
ATOM   7902  C  CD1   . PHE C 2  549  ? 1.116   -20.552 103.922 1.00 61.86  ? 549  PHE C CD1   1 
ATOM   7903  C  CD2   . PHE C 2  549  ? 2.353   -18.529 103.649 1.00 61.06  ? 549  PHE C CD2   1 
ATOM   7904  C  CE1   . PHE C 2  549  ? 1.586   -20.671 105.211 1.00 64.64  ? 549  PHE C CE1   1 
ATOM   7905  C  CE2   . PHE C 2  549  ? 2.824   -18.638 104.941 1.00 61.46  ? 549  PHE C CE2   1 
ATOM   7906  C  CZ    . PHE C 2  549  ? 2.440   -19.709 105.725 1.00 64.02  ? 549  PHE C CZ    1 
ATOM   7907  N  N     . LEU C 2  550  ? 1.738   -20.616 98.347  1.00 64.12  ? 550  LEU C N     1 
ATOM   7908  C  CA    . LEU C 2  550  ? 1.278   -20.449 96.972  1.00 58.88  ? 550  LEU C CA    1 
ATOM   7909  C  C     . LEU C 2  550  ? -0.129  -20.997 96.789  1.00 62.13  ? 550  LEU C C     1 
ATOM   7910  O  O     . LEU C 2  550  ? -0.939  -20.407 96.065  1.00 61.48  ? 550  LEU C O     1 
ATOM   7911  C  CB    . LEU C 2  550  ? 2.250   -21.137 96.018  1.00 64.52  ? 550  LEU C CB    1 
ATOM   7912  C  CG    . LEU C 2  550  ? 1.877   -21.297 94.546  1.00 66.22  ? 550  LEU C CG    1 
ATOM   7913  C  CD1   . LEU C 2  550  ? 1.677   -19.940 93.872  1.00 60.66  ? 550  LEU C CD1   1 
ATOM   7914  C  CD2   . LEU C 2  550  ? 2.963   -22.102 93.840  1.00 64.43  ? 550  LEU C CD2   1 
ATOM   7915  N  N     . GLU C 2  551  ? -0.446  -22.112 97.459  1.00 67.56  ? 551  GLU C N     1 
ATOM   7916  C  CA    . GLU C 2  551  ? -1.754  -22.747 97.319  1.00 66.60  ? 551  GLU C CA    1 
ATOM   7917  C  C     . GLU C 2  551  ? -2.901  -21.856 97.790  1.00 63.42  ? 551  GLU C C     1 
ATOM   7918  O  O     . GLU C 2  551  ? -4.064  -22.177 97.516  1.00 60.03  ? 551  GLU C O     1 
ATOM   7919  C  CB    . GLU C 2  551  ? -1.783  -24.079 98.081  1.00 61.06  ? 551  GLU C CB    1 
ATOM   7920  C  CG    . GLU C 2  551  ? -1.729  -23.953 99.600  1.00 67.53  ? 551  GLU C CG    1 
ATOM   7921  C  CD    . GLU C 2  551  ? -0.315  -23.986 100.162 1.00 68.88  ? 551  GLU C CD    1 
ATOM   7922  O  OE1   . GLU C 2  551  ? -0.162  -24.314 101.358 1.00 76.21  ? 551  GLU C OE1   1 
ATOM   7923  O  OE2   . GLU C 2  551  ? 0.643   -23.691 99.420  1.00 62.98  ? 551  GLU C OE2   1 
ATOM   7924  N  N     . HIS C 2  552  ? -2.606  -20.750 98.474  1.00 61.28  ? 552  HIS C N     1 
ATOM   7925  C  CA    . HIS C 2  552  ? -3.620  -19.810 98.930  1.00 69.33  ? 552  HIS C CA    1 
ATOM   7926  C  C     . HIS C 2  552  ? -3.698  -18.552 98.073  1.00 68.71  ? 552  HIS C C     1 
ATOM   7927  O  O     . HIS C 2  552  ? -4.462  -17.641 98.411  1.00 68.21  ? 552  HIS C O     1 
ATOM   7928  C  CB    . HIS C 2  552  ? -3.359  -19.417 100.392 1.00 68.54  ? 552  HIS C CB    1 
ATOM   7929  C  CG    . HIS C 2  552  ? -3.317  -20.579 101.336 1.00 70.00  ? 552  HIS C CG    1 
ATOM   7930  N  ND1   . HIS C 2  552  ? -4.454  -21.209 101.795 1.00 65.90  ? 552  HIS C ND1   1 
ATOM   7931  C  CD2   . HIS C 2  552  ? -2.273  -21.221 101.912 1.00 67.38  ? 552  HIS C CD2   1 
ATOM   7932  C  CE1   . HIS C 2  552  ? -4.112  -22.188 102.613 1.00 65.22  ? 552  HIS C CE1   1 
ATOM   7933  N  NE2   . HIS C 2  552  ? -2.795  -22.217 102.701 1.00 65.88  ? 552  HIS C NE2   1 
ATOM   7934  N  N     . ASP C 2  553  ? -2.933  -18.475 96.984  1.00 66.17  ? 553  ASP C N     1 
ATOM   7935  C  CA    . ASP C 2  553  ? -2.888  -17.298 96.123  1.00 61.21  ? 553  ASP C CA    1 
ATOM   7936  C  C     . ASP C 2  553  ? -3.481  -17.619 94.763  1.00 61.65  ? 553  ASP C C     1 
ATOM   7937  O  O     . ASP C 2  553  ? -3.061  -18.583 94.118  1.00 63.28  ? 553  ASP C O     1 
ATOM   7938  C  CB    . ASP C 2  553  ? -1.456  -16.791 95.943  1.00 55.54  ? 553  ASP C CB    1 
ATOM   7939  C  CG    . ASP C 2  553  ? -0.910  -16.158 97.196  1.00 61.44  ? 553  ASP C CG    1 
ATOM   7940  O  OD1   . ASP C 2  553  ? -1.731  -15.750 98.042  1.00 67.01  ? 553  ASP C OD1   1 
ATOM   7941  O  OD2   . ASP C 2  553  ? 0.328   -16.095 97.357  1.00 57.11  ? 553  ASP C OD2   1 
ATOM   7942  N  N     . ASP C 2  554  ? -4.446  -16.807 94.332  1.00 59.87  ? 554  ASP C N     1 
ATOM   7943  C  CA    . ASP C 2  554  ? -4.951  -16.905 92.968  1.00 59.39  ? 554  ASP C CA    1 
ATOM   7944  C  C     . ASP C 2  554  ? -3.810  -16.714 91.977  1.00 59.68  ? 554  ASP C C     1 
ATOM   7945  O  O     . ASP C 2  554  ? -2.881  -15.939 92.221  1.00 59.88  ? 554  ASP C O     1 
ATOM   7946  C  CB    . ASP C 2  554  ? -6.046  -15.865 92.739  1.00 59.22  ? 554  ASP C CB    1 
ATOM   7947  C  CG    . ASP C 2  554  ? -6.502  -15.801 91.298  1.00 62.85  ? 554  ASP C CG    1 
ATOM   7948  O  OD1   . ASP C 2  554  ? -7.345  -16.630 90.897  1.00 66.00  ? 554  ASP C OD1   1 
ATOM   7949  O  OD2   . ASP C 2  554  ? -6.019  -14.910 90.567  1.00 61.10  ? 554  ASP C OD2   1 
ATOM   7950  N  N     . ALA C 2  555  ? -3.884  -17.431 90.852  1.00 58.36  ? 555  ALA C N     1 
ATOM   7951  C  CA    . ALA C 2  555  ? -2.736  -17.529 89.953  1.00 59.85  ? 555  ALA C CA    1 
ATOM   7952  C  C     . ALA C 2  555  ? -2.358  -16.186 89.341  1.00 61.13  ? 555  ALA C C     1 
ATOM   7953  O  O     . ALA C 2  555  ? -1.177  -15.945 89.063  1.00 58.47  ? 555  ALA C O     1 
ATOM   7954  C  CB    . ALA C 2  555  ? -3.019  -18.546 88.849  1.00 58.35  ? 555  ALA C CB    1 
ATOM   7955  N  N     . ASN C 2  556  ? -3.335  -15.304 89.121  1.00 61.14  ? 556  ASN C N     1 
ATOM   7956  C  CA    . ASN C 2  556  ? -3.056  -14.064 88.404  1.00 52.76  ? 556  ASN C CA    1 
ATOM   7957  C  C     . ASN C 2  556  ? -2.158  -13.132 89.202  1.00 55.95  ? 556  ASN C C     1 
ATOM   7958  O  O     . ASN C 2  556  ? -1.484  -12.276 88.614  1.00 60.22  ? 556  ASN C O     1 
ATOM   7959  C  CB    . ASN C 2  556  ? -4.361  -13.371 88.033  1.00 48.78  ? 556  ASN C CB    1 
ATOM   7960  C  CG    . ASN C 2  556  ? -5.226  -14.213 87.119  1.00 60.85  ? 556  ASN C CG    1 
ATOM   7961  O  OD1   . ASN C 2  556  ? -5.251  -14.008 85.904  1.00 72.49  ? 556  ASN C OD1   1 
ATOM   7962  N  ND2   . ASN C 2  556  ? -5.931  -15.181 87.697  1.00 66.29  ? 556  ASN C ND2   1 
ATOM   7963  N  N     . ARG C 2  557  ? -2.125  -13.279 90.525  1.00 51.92  ? 557  ARG C N     1 
ATOM   7964  C  CA    . ARG C 2  557  ? -1.221  -12.504 91.365  1.00 56.81  ? 557  ARG C CA    1 
ATOM   7965  C  C     . ARG C 2  557  ? 0.046   -13.258 91.730  1.00 57.34  ? 557  ARG C C     1 
ATOM   7966  O  O     . ARG C 2  557  ? 1.081   -12.628 91.992  1.00 54.52  ? 557  ARG C O     1 
ATOM   7967  C  CB    . ARG C 2  557  ? -1.940  -12.061 92.646  1.00 63.15  ? 557  ARG C CB    1 
ATOM   7968  C  CG    . ARG C 2  557  ? -2.926  -10.921 92.428  1.00 58.74  ? 557  ARG C CG    1 
ATOM   7969  C  CD    . ARG C 2  557  ? -2.199  -9.594  92.341  1.00 55.46  ? 557  ARG C CD    1 
ATOM   7970  N  NE    . ARG C 2  557  ? -3.000  -8.576  91.671  1.00 53.19  ? 557  ARG C NE    1 
ATOM   7971  C  CZ    . ARG C 2  557  ? -2.775  -7.270  91.770  1.00 52.12  ? 557  ARG C CZ    1 
ATOM   7972  N  NH1   . ARG C 2  557  ? -1.771  -6.812  92.519  1.00 43.33  ? 557  ARG C NH1   1 
ATOM   7973  N  NH2   . ARG C 2  557  ? -3.562  -6.424  91.123  1.00 54.38  ? 557  ARG C NH2   1 
ATOM   7974  N  N     . ALA C 2  558  ? -0.020  -14.591 91.767  1.00 58.86  ? 558  ALA C N     1 
ATOM   7975  C  CA    . ALA C 2  558  ? 1.203   -15.376 91.861  1.00 58.08  ? 558  ALA C CA    1 
ATOM   7976  C  C     . ALA C 2  558  ? 2.108   -15.083 90.677  1.00 58.81  ? 558  ALA C C     1 
ATOM   7977  O  O     . ALA C 2  558  ? 3.329   -14.982 90.829  1.00 59.72  ? 558  ALA C O     1 
ATOM   7978  C  CB    . ALA C 2  558  ? 0.873   -16.868 91.932  1.00 57.05  ? 558  ALA C CB    1 
ATOM   7979  N  N     . LEU C 2  559  ? 1.520   -14.948 89.485  1.00 58.97  ? 559  LEU C N     1 
ATOM   7980  C  CA    . LEU C 2  559  ? 2.263   -14.483 88.321  1.00 59.44  ? 559  LEU C CA    1 
ATOM   7981  C  C     . LEU C 2  559  ? 3.053   -13.221 88.646  1.00 63.63  ? 559  LEU C C     1 
ATOM   7982  O  O     . LEU C 2  559  ? 4.249   -13.120 88.340  1.00 62.06  ? 559  LEU C O     1 
ATOM   7983  C  CB    . LEU C 2  559  ? 1.291   -14.228 87.168  1.00 53.68  ? 559  LEU C CB    1 
ATOM   7984  C  CG    . LEU C 2  559  ? 1.833   -13.779 85.810  1.00 55.97  ? 559  LEU C CG    1 
ATOM   7985  C  CD1   . LEU C 2  559  ? 0.896   -14.270 84.716  1.00 50.49  ? 559  LEU C CD1   1 
ATOM   7986  C  CD2   . LEU C 2  559  ? 1.994   -12.263 85.726  1.00 55.16  ? 559  LEU C CD2   1 
ATOM   7987  N  N     . MET C 2  560  ? 2.393   -12.249 89.280  1.00 60.23  ? 560  MET C N     1 
ATOM   7988  C  CA    . MET C 2  560  ? 3.033   -10.966 89.535  1.00 54.76  ? 560  MET C CA    1 
ATOM   7989  C  C     . MET C 2  560  ? 4.126   -11.096 90.581  1.00 59.25  ? 560  MET C C     1 
ATOM   7990  O  O     . MET C 2  560  ? 5.194   -10.497 90.439  1.00 63.50  ? 560  MET C O     1 
ATOM   7991  C  CB    . MET C 2  560  ? 1.994   -9.935  89.968  1.00 54.65  ? 560  MET C CB    1 
ATOM   7992  C  CG    . MET C 2  560  ? 0.839   -9.822  89.002  1.00 57.87  ? 560  MET C CG    1 
ATOM   7993  S  SD    . MET C 2  560  ? -0.231  -8.422  89.341  1.00 58.01  ? 560  MET C SD    1 
ATOM   7994  C  CE    . MET C 2  560  ? -1.486  -8.663  88.077  1.00 50.51  ? 560  MET C CE    1 
ATOM   7995  N  N     . GLY C 2  561  ? 3.884   -11.874 91.634  1.00 56.52  ? 561  GLY C N     1 
ATOM   7996  C  CA    . GLY C 2  561  ? 4.913   -12.046 92.647  1.00 57.16  ? 561  GLY C CA    1 
ATOM   7997  C  C     . GLY C 2  561  ? 6.123   -12.779 92.103  1.00 54.84  ? 561  GLY C C     1 
ATOM   7998  O  O     . GLY C 2  561  ? 7.277   -12.386 92.344  1.00 61.19  ? 561  GLY C O     1 
ATOM   7999  N  N     . SER C 2  562  ? 5.873   -13.848 91.351  1.00 54.86  ? 562  SER C N     1 
ATOM   8000  C  CA    . SER C 2  562  ? 6.921   -14.550 90.630  1.00 61.96  ? 562  SER C CA    1 
ATOM   8001  C  C     . SER C 2  562  ? 7.756   -13.575 89.804  1.00 59.90  ? 562  SER C C     1 
ATOM   8002  O  O     . SER C 2  562  ? 8.967   -13.446 90.006  1.00 59.92  ? 562  SER C O     1 
ATOM   8003  C  CB    . SER C 2  562  ? 6.277   -15.620 89.745  1.00 62.52  ? 562  SER C CB    1 
ATOM   8004  O  OG    . SER C 2  562  ? 7.152   -16.704 89.511  1.00 74.99  ? 562  SER C OG    1 
ATOM   8005  N  N     . ASN C 2  563  ? 7.108   -12.841 88.894  1.00 57.19  ? 563  ASN C N     1 
ATOM   8006  C  CA    . ASN C 2  563  ? 7.848   -11.934 88.022  1.00 56.87  ? 563  ASN C CA    1 
ATOM   8007  C  C     . ASN C 2  563  ? 8.594   -10.872 88.819  1.00 59.15  ? 563  ASN C C     1 
ATOM   8008  O  O     . ASN C 2  563  ? 9.738   -10.533 88.497  1.00 57.00  ? 563  ASN C O     1 
ATOM   8009  C  CB    . ASN C 2  563  ? 6.904   -11.279 87.017  1.00 53.23  ? 563  ASN C CB    1 
ATOM   8010  C  CG    . ASN C 2  563  ? 6.552   -12.198 85.874  1.00 60.65  ? 563  ASN C CG    1 
ATOM   8011  O  OD1   . ASN C 2  563  ? 7.334   -13.079 85.506  1.00 68.79  ? 563  ASN C OD1   1 
ATOM   8012  N  ND2   . ASN C 2  563  ? 5.372   -12.001 85.299  1.00 58.79  ? 563  ASN C ND2   1 
ATOM   8013  N  N     . MET C 2  564  ? 7.976   -10.345 89.872  1.00 58.45  ? 564  MET C N     1 
ATOM   8014  C  CA    . MET C 2  564  ? 8.575   -9.211  90.554  1.00 62.05  ? 564  MET C CA    1 
ATOM   8015  C  C     . MET C 2  564  ? 9.759   -9.603  91.410  1.00 61.39  ? 564  MET C C     1 
ATOM   8016  O  O     . MET C 2  564  ? 10.590  -8.742  91.715  1.00 60.12  ? 564  MET C O     1 
ATOM   8017  C  CB    . MET C 2  564  ? 7.531   -8.481  91.392  1.00 49.26  ? 564  MET C CB    1 
ATOM   8018  C  CG    . MET C 2  564  ? 6.572   -7.731  90.514  1.00 56.49  ? 564  MET C CG    1 
ATOM   8019  S  SD    . MET C 2  564  ? 5.437   -6.671  91.387  1.00 63.65  ? 564  MET C SD    1 
ATOM   8020  C  CE    . MET C 2  564  ? 4.546   -7.876  92.373  1.00 61.78  ? 564  MET C CE    1 
ATOM   8021  N  N     . GLN C 2  565  ? 9.873   -10.873 91.796  1.00 61.95  ? 565  GLN C N     1 
ATOM   8022  C  CA    . GLN C 2  565  ? 11.100  -11.250 92.487  1.00 59.31  ? 565  GLN C CA    1 
ATOM   8023  C  C     . GLN C 2  565  ? 12.329  -10.947 91.639  1.00 58.52  ? 565  GLN C C     1 
ATOM   8024  O  O     . GLN C 2  565  ? 13.366  -10.554 92.180  1.00 64.44  ? 565  GLN C O     1 
ATOM   8025  C  CB    . GLN C 2  565  ? 11.065  -12.717 92.892  1.00 58.24  ? 565  GLN C CB    1 
ATOM   8026  C  CG    . GLN C 2  565  ? 10.249  -12.951 94.132  1.00 58.52  ? 565  GLN C CG    1 
ATOM   8027  C  CD    . GLN C 2  565  ? 10.096  -14.405 94.432  1.00 58.45  ? 565  GLN C CD    1 
ATOM   8028  O  OE1   . GLN C 2  565  ? 10.606  -14.898 95.438  1.00 62.18  ? 565  GLN C OE1   1 
ATOM   8029  N  NE2   . GLN C 2  565  ? 9.394   -15.115 93.557  1.00 55.98  ? 565  GLN C NE2   1 
ATOM   8030  N  N     . THR C 2  566  ? 12.227  -11.069 90.313  1.00 59.87  ? 566  THR C N     1 
ATOM   8031  C  CA    . THR C 2  566  ? 13.386  -10.757 89.478  1.00 65.22  ? 566  THR C CA    1 
ATOM   8032  C  C     . THR C 2  566  ? 13.682  -9.267  89.400  1.00 61.36  ? 566  THR C C     1 
ATOM   8033  O  O     . THR C 2  566  ? 14.757  -8.901  88.921  1.00 64.58  ? 566  THR C O     1 
ATOM   8034  C  CB    . THR C 2  566  ? 13.207  -11.279 88.053  1.00 58.98  ? 566  THR C CB    1 
ATOM   8035  O  OG1   . THR C 2  566  ? 12.513  -10.297 87.276  1.00 56.81  ? 566  THR C OG1   1 
ATOM   8036  C  CG2   . THR C 2  566  ? 12.420  -12.571 88.054  1.00 60.43  ? 566  THR C CG2   1 
ATOM   8037  N  N     . GLN C 2  567  ? 12.763  -8.407  89.836  1.00 63.50  ? 567  GLN C N     1 
ATOM   8038  C  CA    . GLN C 2  567  ? 12.954  -6.966  89.784  1.00 57.26  ? 567  GLN C CA    1 
ATOM   8039  C  C     . GLN C 2  567  ? 13.444  -6.401  91.108  1.00 58.57  ? 567  GLN C C     1 
ATOM   8040  O  O     . GLN C 2  567  ? 13.587  -5.180  91.239  1.00 56.41  ? 567  GLN C O     1 
ATOM   8041  C  CB    . GLN C 2  567  ? 11.654  -6.281  89.354  1.00 54.73  ? 567  GLN C CB    1 
ATOM   8042  C  CG    . GLN C 2  567  ? 11.070  -6.836  88.053  1.00 56.31  ? 567  GLN C CG    1 
ATOM   8043  C  CD    . GLN C 2  567  ? 9.866   -6.055  87.549  1.00 67.09  ? 567  GLN C CD    1 
ATOM   8044  O  OE1   . GLN C 2  567  ? 9.340   -5.180  88.239  1.00 75.27  ? 567  GLN C OE1   1 
ATOM   8045  N  NE2   . GLN C 2  567  ? 9.420   -6.374  86.339  1.00 69.63  ? 567  GLN C NE2   1 
ATOM   8046  N  N     . ALA C 2  568  ? 13.722  -7.263  92.082  1.00 59.14  ? 568  ALA C N     1 
ATOM   8047  C  CA    . ALA C 2  568  ? 14.112  -6.812  93.410  1.00 56.34  ? 568  ALA C CA    1 
ATOM   8048  C  C     . ALA C 2  568  ? 15.551  -6.312  93.415  1.00 60.23  ? 568  ALA C C     1 
ATOM   8049  O  O     . ALA C 2  568  ? 16.446  -6.919  92.815  1.00 60.72  ? 568  ALA C O     1 
ATOM   8050  C  CB    . ALA C 2  568  ? 13.948  -7.946  94.426  1.00 59.88  ? 568  ALA C CB    1 
ATOM   8051  N  N     . VAL C 2  569  ? 15.772  -5.204  94.111  1.00 58.78  ? 569  VAL C N     1 
ATOM   8052  C  CA    . VAL C 2  569  ? 17.079  -4.557  94.163  1.00 57.61  ? 569  VAL C CA    1 
ATOM   8053  C  C     . VAL C 2  569  ? 17.871  -5.099  95.345  1.00 61.81  ? 569  VAL C C     1 
ATOM   8054  O  O     . VAL C 2  569  ? 17.324  -5.210  96.453  1.00 70.88  ? 569  VAL C O     1 
ATOM   8055  C  CB    . VAL C 2  569  ? 16.927  -3.035  94.258  1.00 51.03  ? 569  VAL C CB    1 
ATOM   8056  C  CG1   . VAL C 2  569  ? 18.275  -2.390  94.392  1.00 55.81  ? 569  VAL C CG1   1 
ATOM   8057  C  CG2   . VAL C 2  569  ? 16.189  -2.517  93.043  1.00 53.92  ? 569  VAL C CG2   1 
ATOM   8058  N  N     . PRO C 2  570  ? 19.139  -5.463  95.162  1.00 58.46  ? 570  PRO C N     1 
ATOM   8059  C  CA    . PRO C 2  570  ? 19.955  -5.888  96.307  1.00 58.14  ? 570  PRO C CA    1 
ATOM   8060  C  C     . PRO C 2  570  ? 20.146  -4.749  97.302  1.00 64.24  ? 570  PRO C C     1 
ATOM   8061  O  O     . PRO C 2  570  ? 20.610  -3.660  96.950  1.00 59.35  ? 570  PRO C O     1 
ATOM   8062  C  CB    . PRO C 2  570  ? 21.280  -6.311  95.661  1.00 61.56  ? 570  PRO C CB    1 
ATOM   8063  C  CG    . PRO C 2  570  ? 20.925  -6.623  94.240  1.00 70.10  ? 570  PRO C CG    1 
ATOM   8064  C  CD    . PRO C 2  570  ? 19.849  -5.639  93.885  1.00 67.64  ? 570  PRO C CD    1 
ATOM   8065  N  N     . LEU C 2  571  ? 19.777  -5.010  98.555  1.00 64.21  ? 571  LEU C N     1 
ATOM   8066  C  CA    . LEU C 2  571  ? 19.831  -4.017  99.614  1.00 58.43  ? 571  LEU C CA    1 
ATOM   8067  C  C     . LEU C 2  571  ? 21.081  -4.224  100.456 1.00 59.78  ? 571  LEU C C     1 
ATOM   8068  O  O     . LEU C 2  571  ? 21.594  -5.339  100.563 1.00 62.82  ? 571  LEU C O     1 
ATOM   8069  C  CB    . LEU C 2  571  ? 18.587  -4.107  100.492 1.00 67.21  ? 571  LEU C CB    1 
ATOM   8070  C  CG    . LEU C 2  571  ? 17.274  -4.041  99.716  1.00 64.70  ? 571  LEU C CG    1 
ATOM   8071  C  CD1   . LEU C 2  571  ? 16.115  -4.435  100.610 1.00 56.71  ? 571  LEU C CD1   1 
ATOM   8072  C  CD2   . LEU C 2  571  ? 17.076  -2.642  99.148  1.00 62.91  ? 571  LEU C CD2   1 
ATOM   8073  N  N     . ILE C 2  572  ? 21.575  -3.132  101.049 1.00 56.84  ? 572  ILE C N     1 
ATOM   8074  C  CA    . ILE C 2  572  ? 22.793  -3.225  101.849 1.00 57.86  ? 572  ILE C CA    1 
ATOM   8075  C  C     . ILE C 2  572  ? 22.549  -4.031  103.119 1.00 59.44  ? 572  ILE C C     1 
ATOM   8076  O  O     . ILE C 2  572  ? 23.469  -4.674  103.640 1.00 64.26  ? 572  ILE C O     1 
ATOM   8077  C  CB    . ILE C 2  572  ? 23.345  -1.825  102.176 1.00 64.80  ? 572  ILE C CB    1 
ATOM   8078  C  CG1   . ILE C 2  572  ? 22.329  -1.008  102.975 1.00 64.93  ? 572  ILE C CG1   1 
ATOM   8079  C  CG2   . ILE C 2  572  ? 23.765  -1.091  100.908 1.00 56.58  ? 572  ILE C CG2   1 
ATOM   8080  C  CD1   . ILE C 2  572  ? 22.873  0.324   103.471 1.00 63.72  ? 572  ILE C CD1   1 
ATOM   8081  N  N     . ARG C 2  573  ? 21.322  -4.019  103.641 1.00 63.96  ? 573  ARG C N     1 
ATOM   8082  C  CA    . ARG C 2  573  ? 20.975  -4.777  104.835 1.00 62.94  ? 573  ARG C CA    1 
ATOM   8083  C  C     . ARG C 2  573  ? 20.009  -5.913  104.512 1.00 64.38  ? 573  ARG C C     1 
ATOM   8084  O  O     . ARG C 2  573  ? 19.172  -6.278  105.345 1.00 58.52  ? 573  ARG C O     1 
ATOM   8085  C  CB    . ARG C 2  573  ? 20.385  -3.852  105.898 1.00 64.49  ? 573  ARG C CB    1 
ATOM   8086  C  CG    . ARG C 2  573  ? 21.140  -2.552  106.065 1.00 68.33  ? 573  ARG C CG    1 
ATOM   8087  C  CD    . ARG C 2  573  ? 21.004  -2.009  107.476 1.00 75.91  ? 573  ARG C CD    1 
ATOM   8088  N  NE    . ARG C 2  573  ? 21.408  -2.995  108.474 1.00 80.69  ? 573  ARG C NE    1 
ATOM   8089  C  CZ    . ARG C 2  573  ? 21.164  -2.880  109.773 1.00 77.60  ? 573  ARG C CZ    1 
ATOM   8090  N  NH1   . ARG C 2  573  ? 20.515  -1.817  110.227 1.00 72.80  ? 573  ARG C NH1   1 
ATOM   8091  N  NH2   . ARG C 2  573  ? 21.563  -3.827  110.613 1.00 81.88  ? 573  ARG C NH2   1 
ATOM   8092  N  N     . ALA C 2  574  ? 20.128  -6.476  103.306 1.00 62.75  ? 574  ALA C N     1 
ATOM   8093  C  CA    . ALA C 2  574  ? 19.171  -7.460  102.809 1.00 64.80  ? 574  ALA C CA    1 
ATOM   8094  C  C     . ALA C 2  574  ? 19.020  -8.634  103.774 1.00 62.55  ? 574  ALA C C     1 
ATOM   8095  O  O     . ALA C 2  574  ? 19.939  -8.986  104.518 1.00 64.76  ? 574  ALA C O     1 
ATOM   8096  C  CB    . ALA C 2  574  ? 19.597  -7.958  101.427 1.00 57.00  ? 574  ALA C CB    1 
ATOM   8097  N  N     . GLN C 2  575  ? 17.834  -9.233  103.769 1.00 59.69  ? 575  GLN C N     1 
ATOM   8098  C  CA    . GLN C 2  575  ? 17.526  -10.345 104.653 1.00 63.36  ? 575  GLN C CA    1 
ATOM   8099  C  C     . GLN C 2  575  ? 16.792  -11.436 103.896 1.00 63.75  ? 575  GLN C C     1 
ATOM   8100  O  O     . GLN C 2  575  ? 16.058  -11.170 102.941 1.00 61.46  ? 575  GLN C O     1 
ATOM   8101  C  CB    . GLN C 2  575  ? 16.652  -9.913  105.824 1.00 59.46  ? 575  GLN C CB    1 
ATOM   8102  C  CG    . GLN C 2  575  ? 17.213  -8.784  106.633 1.00 62.86  ? 575  GLN C CG    1 
ATOM   8103  C  CD    . GLN C 2  575  ? 16.201  -8.231  107.589 1.00 57.10  ? 575  GLN C CD    1 
ATOM   8104  O  OE1   . GLN C 2  575  ? 15.207  -7.638  107.178 1.00 58.70  ? 575  GLN C OE1   1 
ATOM   8105  N  NE2   . GLN C 2  575  ? 16.435  -8.433  108.878 1.00 65.13  ? 575  GLN C NE2   1 
ATOM   8106  N  N     . ALA C 2  576  ? 16.981  -12.667 104.352 1.00 66.64  ? 576  ALA C N     1 
ATOM   8107  C  CA    . ALA C 2  576  ? 16.148  -13.761 103.912 1.00 63.30  ? 576  ALA C CA    1 
ATOM   8108  C  C     . ALA C 2  576  ? 14.755  -13.606 104.509 1.00 67.26  ? 576  ALA C C     1 
ATOM   8109  O  O     . ALA C 2  576  ? 14.586  -12.969 105.552 1.00 70.32  ? 576  ALA C O     1 
ATOM   8110  C  CB    . ALA C 2  576  ? 16.766  -15.091 104.326 1.00 64.73  ? 576  ALA C CB    1 
ATOM   8111  N  N     . PRO C 2  577  ? 13.739  -14.178 103.865 1.00 66.17  ? 577  PRO C N     1 
ATOM   8112  C  CA    . PRO C 2  577  ? 12.367  -14.053 104.386 1.00 67.06  ? 577  PRO C CA    1 
ATOM   8113  C  C     . PRO C 2  577  ? 12.181  -14.861 105.667 1.00 61.81  ? 577  PRO C C     1 
ATOM   8114  O  O     . PRO C 2  577  ? 12.752  -15.941 105.814 1.00 66.87  ? 577  PRO C O     1 
ATOM   8115  C  CB    . PRO C 2  577  ? 11.502  -14.616 103.247 1.00 61.91  ? 577  PRO C CB    1 
ATOM   8116  C  CG    . PRO C 2  577  ? 12.407  -14.765 102.080 1.00 65.86  ? 577  PRO C CG    1 
ATOM   8117  C  CD    . PRO C 2  577  ? 13.786  -14.930 102.604 1.00 57.68  ? 577  PRO C CD    1 
ATOM   8118  N  N     . VAL C 2  578  ? 11.376  -14.341 106.604 1.00 68.62  ? 578  VAL C N     1 
ATOM   8119  C  CA    . VAL C 2  578  ? 11.158  -15.116 107.829 1.00 70.75  ? 578  VAL C CA    1 
ATOM   8120  C  C     . VAL C 2  578  ? 10.331  -16.361 107.527 1.00 63.60  ? 578  VAL C C     1 
ATOM   8121  O  O     . VAL C 2  578  ? 10.474  -17.389 108.199 1.00 67.26  ? 578  VAL C O     1 
ATOM   8122  C  CB    . VAL C 2  578  ? 10.539  -14.249 108.957 1.00 69.96  ? 578  VAL C CB    1 
ATOM   8123  C  CG1   . VAL C 2  578  ? 10.418  -12.795 108.540 1.00 65.31  ? 578  VAL C CG1   1 
ATOM   8124  C  CG2   . VAL C 2  578  ? 9.196   -14.817 109.431 1.00 69.38  ? 578  VAL C CG2   1 
ATOM   8125  N  N     . VAL C 2  579  ? 9.494   -16.309 106.498 1.00 60.76  ? 579  VAL C N     1 
ATOM   8126  C  CA    . VAL C 2  579  ? 8.847   -17.495 105.948 1.00 62.07  ? 579  VAL C CA    1 
ATOM   8127  C  C     . VAL C 2  579  ? 9.514   -17.832 104.618 1.00 68.42  ? 579  VAL C C     1 
ATOM   8128  O  O     . VAL C 2  579  ? 9.506   -17.022 103.684 1.00 69.78  ? 579  VAL C O     1 
ATOM   8129  C  CB    . VAL C 2  579  ? 7.337   -17.294 105.770 1.00 60.02  ? 579  VAL C CB    1 
ATOM   8130  C  CG1   . VAL C 2  579  ? 6.691   -18.595 105.325 1.00 60.74  ? 579  VAL C CG1   1 
ATOM   8131  C  CG2   . VAL C 2  579  ? 6.722   -16.800 107.067 1.00 67.79  ? 579  VAL C CG2   1 
ATOM   8132  N  N     . MET C 2  580  ? 10.089  -19.026 104.526 1.00 66.12  ? 580  MET C N     1 
ATOM   8133  C  CA    . MET C 2  580  ? 10.745  -19.464 103.306 1.00 63.97  ? 580  MET C CA    1 
ATOM   8134  C  C     . MET C 2  580  ? 10.079  -20.727 102.782 1.00 67.32  ? 580  MET C C     1 
ATOM   8135  O  O     . MET C 2  580  ? 9.301   -21.383 103.481 1.00 70.64  ? 580  MET C O     1 
ATOM   8136  C  CB    . MET C 2  580  ? 12.238  -19.708 103.538 1.00 64.87  ? 580  MET C CB    1 
ATOM   8137  C  CG    . MET C 2  580  ? 13.009  -18.442 103.854 1.00 66.86  ? 580  MET C CG    1 
ATOM   8138  S  SD    . MET C 2  580  ? 14.703  -18.750 104.388 1.00 77.64  ? 580  MET C SD    1 
ATOM   8139  C  CE    . MET C 2  580  ? 14.425  -19.843 105.772 1.00 61.36  ? 580  MET C CE    1 
ATOM   8140  N  N     . THR C 2  581  ? 10.384  -21.056 101.528 1.00 64.63  ? 581  THR C N     1 
ATOM   8141  C  CA    . THR C 2  581  ? 9.880   -22.266 100.895 1.00 65.57  ? 581  THR C CA    1 
ATOM   8142  C  C     . THR C 2  581  ? 10.878  -23.411 100.924 1.00 66.18  ? 581  THR C C     1 
ATOM   8143  O  O     . THR C 2  581  ? 10.526  -24.530 100.533 1.00 67.27  ? 581  THR C O     1 
ATOM   8144  C  CB    . THR C 2  581  ? 9.503   -21.988 99.440  1.00 71.92  ? 581  THR C CB    1 
ATOM   8145  O  OG1   . THR C 2  581  ? 10.638  -21.437 98.756  1.00 68.89  ? 581  THR C OG1   1 
ATOM   8146  C  CG2   . THR C 2  581  ? 8.330   -21.023 99.362  1.00 64.73  ? 581  THR C CG2   1 
ATOM   8147  N  N     . GLY C 2  582  ? 12.107  -23.160 101.368 1.00 64.25  ? 582  GLY C N     1 
ATOM   8148  C  CA    . GLY C 2  582  ? 13.153  -24.155 101.376 1.00 73.14  ? 582  GLY C CA    1 
ATOM   8149  C  C     . GLY C 2  582  ? 14.087  -24.107 100.184 1.00 69.30  ? 582  GLY C C     1 
ATOM   8150  O  O     . GLY C 2  582  ? 15.216  -24.598 100.279 1.00 67.26  ? 582  GLY C O     1 
ATOM   8151  N  N     . LEU C 2  583  ? 13.649  -23.528 99.070  1.00 68.86  ? 583  LEU C N     1 
ATOM   8152  C  CA    . LEU C 2  583  ? 14.474  -23.375 97.882  1.00 65.75  ? 583  LEU C CA    1 
ATOM   8153  C  C     . LEU C 2  583  ? 15.471  -22.231 97.983  1.00 66.80  ? 583  LEU C C     1 
ATOM   8154  O  O     . LEU C 2  583  ? 16.247  -22.032 97.044  1.00 65.83  ? 583  LEU C O     1 
ATOM   8155  C  CB    . LEU C 2  583  ? 13.582  -23.136 96.668  1.00 69.60  ? 583  LEU C CB    1 
ATOM   8156  C  CG    . LEU C 2  583  ? 13.670  -24.084 95.480  1.00 69.43  ? 583  LEU C CG    1 
ATOM   8157  C  CD1   . LEU C 2  583  ? 12.919  -25.370 95.769  1.00 74.15  ? 583  LEU C CD1   1 
ATOM   8158  C  CD2   . LEU C 2  583  ? 13.106  -23.401 94.262  1.00 63.30  ? 583  LEU C CD2   1 
ATOM   8159  N  N     . GLU C 2  584  ? 15.474  -21.477 99.087  1.00 70.92  ? 584  GLU C N     1 
ATOM   8160  C  CA    . GLU C 2  584  ? 16.196  -20.207 99.115  1.00 70.34  ? 584  GLU C CA    1 
ATOM   8161  C  C     . GLU C 2  584  ? 17.708  -20.378 99.016  1.00 70.83  ? 584  GLU C C     1 
ATOM   8162  O  O     . GLU C 2  584  ? 18.398  -19.450 98.579  1.00 72.76  ? 584  GLU C O     1 
ATOM   8163  C  CB    . GLU C 2  584  ? 15.836  -19.428 100.379 1.00 61.12  ? 584  GLU C CB    1 
ATOM   8164  C  CG    . GLU C 2  584  ? 14.528  -18.655 100.285 1.00 63.87  ? 584  GLU C CG    1 
ATOM   8165  C  CD    . GLU C 2  584  ? 13.290  -19.541 100.377 1.00 75.83  ? 584  GLU C CD    1 
ATOM   8166  O  OE1   . GLU C 2  584  ? 12.162  -19.007 100.244 1.00 71.12  ? 584  GLU C OE1   1 
ATOM   8167  O  OE2   . GLU C 2  584  ? 13.436  -20.766 100.594 1.00 75.03  ? 584  GLU C OE2   1 
ATOM   8168  N  N     . GLU C 2  585  ? 18.247  -21.531 99.422  1.00 74.14  ? 585  GLU C N     1 
ATOM   8169  C  CA    . GLU C 2  585  ? 19.696  -21.728 99.414  1.00 74.42  ? 585  GLU C CA    1 
ATOM   8170  C  C     . GLU C 2  585  ? 20.214  -22.268 98.084  1.00 74.79  ? 585  GLU C C     1 
ATOM   8171  O  O     . GLU C 2  585  ? 21.290  -21.853 97.621  1.00 71.38  ? 585  GLU C O     1 
ATOM   8172  C  CB    . GLU C 2  585  ? 20.105  -22.660 100.556 1.00 73.22  ? 585  GLU C CB    1 
ATOM   8173  C  CG    . GLU C 2  585  ? 20.091  -21.979 101.921 1.00 83.43  ? 585  GLU C CG    1 
ATOM   8174  C  CD    . GLU C 2  585  ? 20.355  -22.935 103.083 1.00 94.38  ? 585  GLU C CD    1 
ATOM   8175  O  OE1   . GLU C 2  585  ? 19.389  -23.558 103.589 1.00 87.03  ? 585  GLU C OE1   1 
ATOM   8176  O  OE2   . GLU C 2  585  ? 21.530  -23.056 103.497 1.00 92.48  ? 585  GLU C OE2   1 
ATOM   8177  N  N     . ARG C 2  586  ? 19.473  -23.195 97.466  1.00 68.62  ? 586  ARG C N     1 
ATOM   8178  C  CA    . ARG C 2  586  ? 19.873  -23.711 96.161  1.00 74.15  ? 586  ARG C CA    1 
ATOM   8179  C  C     . ARG C 2  586  ? 19.940  -22.600 95.120  1.00 75.09  ? 586  ARG C C     1 
ATOM   8180  O  O     . ARG C 2  586  ? 20.774  -22.654 94.208  1.00 72.68  ? 586  ARG C O     1 
ATOM   8181  C  CB    . ARG C 2  586  ? 18.908  -24.812 95.699  1.00 69.91  ? 586  ARG C CB    1 
ATOM   8182  C  CG    . ARG C 2  586  ? 19.277  -26.230 96.127  1.00 62.07  ? 586  ARG C CG    1 
ATOM   8183  C  CD    . ARG C 2  586  ? 20.648  -26.654 95.612  1.00 60.02  ? 586  ARG C CD    1 
ATOM   8184  N  NE    . ARG C 2  586  ? 20.760  -26.582 94.153  1.00 70.21  ? 586  ARG C NE    1 
ATOM   8185  C  CZ    . ARG C 2  586  ? 20.431  -27.564 93.314  1.00 69.57  ? 586  ARG C CZ    1 
ATOM   8186  N  NH1   . ARG C 2  586  ? 19.954  -28.714 93.775  1.00 62.74  ? 586  ARG C NH1   1 
ATOM   8187  N  NH2   . ARG C 2  586  ? 20.576  -27.396 92.005  1.00 67.70  ? 586  ARG C NH2   1 
ATOM   8188  N  N     . VAL C 2  587  ? 19.077  -21.588 95.239  1.00 74.73  ? 587  VAL C N     1 
ATOM   8189  C  CA    . VAL C 2  587  ? 19.096  -20.476 94.295  1.00 71.34  ? 587  VAL C CA    1 
ATOM   8190  C  C     . VAL C 2  587  ? 20.385  -19.678 94.437  1.00 67.14  ? 587  VAL C C     1 
ATOM   8191  O  O     . VAL C 2  587  ? 20.988  -19.267 93.441  1.00 66.62  ? 587  VAL C O     1 
ATOM   8192  C  CB    . VAL C 2  587  ? 17.854  -19.591 94.493  1.00 67.02  ? 587  VAL C CB    1 
ATOM   8193  C  CG1   . VAL C 2  587  ? 17.968  -18.321 93.667  1.00 61.65  ? 587  VAL C CG1   1 
ATOM   8194  C  CG2   . VAL C 2  587  ? 16.602  -20.362 94.126  1.00 58.93  ? 587  VAL C CG2   1 
ATOM   8195  N  N     . VAL C 2  588  ? 20.826  -19.437 95.671  1.00 66.96  ? 588  VAL C N     1 
ATOM   8196  C  CA    . VAL C 2  588  ? 22.094  -18.744 95.860  1.00 73.05  ? 588  VAL C CA    1 
ATOM   8197  C  C     . VAL C 2  588  ? 23.236  -19.591 95.325  1.00 79.58  ? 588  VAL C C     1 
ATOM   8198  O  O     . VAL C 2  588  ? 24.154  -19.085 94.664  1.00 77.57  ? 588  VAL C O     1 
ATOM   8199  C  CB    . VAL C 2  588  ? 22.300  -18.394 97.344  1.00 71.87  ? 588  VAL C CB    1 
ATOM   8200  C  CG1   . VAL C 2  588  ? 23.596  -17.631 97.531  1.00 76.75  ? 588  VAL C CG1   1 
ATOM   8201  C  CG2   . VAL C 2  588  ? 21.144  -17.578 97.848  1.00 75.77  ? 588  VAL C CG2   1 
ATOM   8202  N  N     . ARG C 2  589  ? 23.192  -20.896 95.590  1.00 75.62  ? 589  ARG C N     1 
ATOM   8203  C  CA    . ARG C 2  589  ? 24.303  -21.753 95.201  1.00 72.67  ? 589  ARG C CA    1 
ATOM   8204  C  C     . ARG C 2  589  ? 24.415  -21.859 93.685  1.00 75.44  ? 589  ARG C C     1 
ATOM   8205  O  O     . ARG C 2  589  ? 25.509  -21.723 93.125  1.00 80.69  ? 589  ARG C O     1 
ATOM   8206  C  CB    . ARG C 2  589  ? 24.150  -23.135 95.836  1.00 69.76  ? 589  ARG C CB    1 
ATOM   8207  C  CG    . ARG C 2  589  ? 25.221  -24.118 95.410  1.00 72.19  ? 589  ARG C CG    1 
ATOM   8208  C  CD    . ARG C 2  589  ? 25.214  -25.369 96.258  1.00 74.50  ? 589  ARG C CD    1 
ATOM   8209  N  NE    . ARG C 2  589  ? 25.464  -25.066 97.664  1.00 85.96  ? 589  ARG C NE    1 
ATOM   8210  C  CZ    . ARG C 2  589  ? 26.672  -24.886 98.190  1.00 88.82  ? 589  ARG C CZ    1 
ATOM   8211  N  NH1   . ARG C 2  589  ? 27.754  -24.976 97.425  1.00 91.33  ? 589  ARG C NH1   1 
ATOM   8212  N  NH2   . ARG C 2  589  ? 26.797  -24.609 99.482  1.00 89.41  ? 589  ARG C NH2   1 
ATOM   8213  N  N     . ASP C 2  590  ? 23.295  -22.089 92.999  1.00 71.48  ? 590  ASP C N     1 
ATOM   8214  C  CA    . ASP C 2  590  ? 23.338  -22.335 91.563  1.00 70.83  ? 590  ASP C CA    1 
ATOM   8215  C  C     . ASP C 2  590  ? 23.507  -21.063 90.740  1.00 73.36  ? 590  ASP C C     1 
ATOM   8216  O  O     . ASP C 2  590  ? 23.976  -21.142 89.600  1.00 83.72  ? 590  ASP C O     1 
ATOM   8217  C  CB    . ASP C 2  590  ? 22.084  -23.088 91.120  1.00 70.49  ? 590  ASP C CB    1 
ATOM   8218  C  CG    . ASP C 2  590  ? 22.126  -24.558 91.507  1.00 76.23  ? 590  ASP C CG    1 
ATOM   8219  O  OD1   . ASP C 2  590  ? 22.785  -24.892 92.519  1.00 71.79  ? 590  ASP C OD1   1 
ATOM   8220  O  OD2   . ASP C 2  590  ? 21.518  -25.381 90.786  1.00 74.10  ? 590  ASP C OD2   1 
ATOM   8221  N  N     . SER C 2  591  ? 23.158  -19.899 91.285  1.00 72.65  ? 591  SER C N     1 
ATOM   8222  C  CA    . SER C 2  591  ? 23.416  -18.629 90.618  1.00 75.92  ? 591  SER C CA    1 
ATOM   8223  C  C     . SER C 2  591  ? 24.855  -18.162 90.768  1.00 75.39  ? 591  SER C C     1 
ATOM   8224  O  O     . SER C 2  591  ? 25.180  -17.066 90.299  1.00 77.56  ? 591  SER C O     1 
ATOM   8225  C  CB    . SER C 2  591  ? 22.499  -17.538 91.168  1.00 84.50  ? 591  SER C CB    1 
ATOM   8226  O  OG    . SER C 2  591  ? 23.014  -17.034 92.392  1.00 89.65  ? 591  SER C OG    1 
ATOM   8227  N  N     . LEU C 2  592  ? 25.701  -18.949 91.432  1.00 76.68  ? 592  LEU C N     1 
ATOM   8228  C  CA    . LEU C 2  592  ? 27.094  -18.595 91.695  1.00 79.06  ? 592  LEU C CA    1 
ATOM   8229  C  C     . LEU C 2  592  ? 27.218  -17.226 92.355  1.00 81.18  ? 592  LEU C C     1 
ATOM   8230  O  O     . LEU C 2  592  ? 28.226  -16.535 92.192  1.00 86.43  ? 592  LEU C O     1 
ATOM   8231  C  CB    . LEU C 2  592  ? 27.932  -18.663 90.417  1.00 71.48  ? 592  LEU C CB    1 
ATOM   8232  C  CG    . LEU C 2  592  ? 27.896  -20.046 89.772  1.00 75.92  ? 592  LEU C CG    1 
ATOM   8233  C  CD1   . LEU C 2  592  ? 28.816  -20.111 88.575  1.00 84.55  ? 592  LEU C CD1   1 
ATOM   8234  C  CD2   . LEU C 2  592  ? 28.270  -21.109 90.779  1.00 80.12  ? 592  LEU C CD2   1 
ATOM   8235  N  N     . ALA C 2  593  ? 26.189  -16.818 93.096  1.00 84.44  ? 593  ALA C N     1 
ATOM   8236  C  CA    . ALA C 2  593  ? 26.263  -15.591 93.878  1.00 94.48  ? 593  ALA C CA    1 
ATOM   8237  C  C     . ALA C 2  593  ? 27.355  -15.702 94.931  1.00 98.73  ? 593  ALA C C     1 
ATOM   8238  O  O     . ALA C 2  593  ? 28.384  -15.017 94.855  1.00 82.18  ? 593  ALA C O     1 
ATOM   8239  C  CB    . ALA C 2  593  ? 24.919  -15.300 94.555  1.00 81.23  ? 593  ALA C CB    1 
ATOM   8240  N  N     . ALA C 2  594  ? 27.146  -16.606 95.887  1.00 95.10  ? 594  ALA C N     1 
ATOM   8241  C  CA    . ALA C 2  594  ? 28.007  -16.739 97.048  1.00 89.80  ? 594  ALA C CA    1 
ATOM   8242  C  C     . ALA C 2  594  ? 29.228  -17.602 96.738  1.00 85.20  ? 594  ALA C C     1 
ATOM   8243  O  O     . ALA C 2  594  ? 29.260  -18.373 95.777  1.00 87.05  ? 594  ALA C O     1 
ATOM   8244  C  CB    . ALA C 2  594  ? 27.225  -17.333 98.219  1.00 86.07  ? 594  ALA C CB    1 
ATOM   8245  N  N     . LEU C 2  595  ? 30.238  -17.462 97.587  1.00 87.08  ? 595  LEU C N     1 
ATOM   8246  C  CA    . LEU C 2  595  ? 31.485  -18.205 97.488  1.00 86.23  ? 595  LEU C CA    1 
ATOM   8247  C  C     . LEU C 2  595  ? 31.498  -19.325 98.525  1.00 92.63  ? 595  LEU C C     1 
ATOM   8248  O  O     . LEU C 2  595  ? 31.105  -19.122 99.679  1.00 89.84  ? 595  LEU C O     1 
ATOM   8249  C  CB    . LEU C 2  595  ? 32.666  -17.258 97.698  1.00 83.78  ? 595  LEU C CB    1 
ATOM   8250  C  CG    . LEU C 2  595  ? 33.985  -17.565 97.002  1.00 93.73  ? 595  LEU C CG    1 
ATOM   8251  C  CD1   . LEU C 2  595  ? 34.717  -16.269 96.710  1.00 87.86  ? 595  LEU C CD1   1 
ATOM   8252  C  CD2   . LEU C 2  595  ? 34.829  -18.471 97.876  1.00 92.04  ? 595  LEU C CD2   1 
ATOM   8253  N  N     . TYR C 2  596  ? 31.947  -20.511 98.114  1.00 93.93  ? 596  TYR C N     1 
ATOM   8254  C  CA    . TYR C 2  596  ? 31.855  -21.699 98.956  1.00 95.38  ? 596  TYR C CA    1 
ATOM   8255  C  C     . TYR C 2  596  ? 33.221  -22.357 99.122  1.00 98.54  ? 596  TYR C C     1 
ATOM   8256  O  O     . TYR C 2  596  ? 34.174  -22.068 98.392  1.00 98.17  ? 596  TYR C O     1 
ATOM   8257  C  CB    . TYR C 2  596  ? 30.850  -22.706 98.382  1.00 90.58  ? 596  TYR C CB    1 
ATOM   8258  C  CG    . TYR C 2  596  ? 29.447  -22.161 98.282  1.00 92.63  ? 596  TYR C CG    1 
ATOM   8259  C  CD1   . TYR C 2  596  ? 28.716  -21.859 99.426  1.00 93.80  ? 596  TYR C CD1   1 
ATOM   8260  C  CD2   . TYR C 2  596  ? 28.855  -21.934 97.046  1.00 92.24  ? 596  TYR C CD2   1 
ATOM   8261  C  CE1   . TYR C 2  596  ? 27.429  -21.354 99.342  1.00 89.32  ? 596  TYR C CE1   1 
ATOM   8262  C  CE2   . TYR C 2  596  ? 27.569  -21.431 96.950  1.00 90.54  ? 596  TYR C CE2   1 
ATOM   8263  C  CZ    . TYR C 2  596  ? 26.861  -21.143 98.101  1.00 87.29  ? 596  TYR C CZ    1 
ATOM   8264  O  OH    . TYR C 2  596  ? 25.583  -20.642 98.009  1.00 85.94  ? 596  TYR C OH    1 
ATOM   8265  N  N     . ALA C 2  597  ? 33.300  -23.262 100.101 1.00 98.36  ? 597  ALA C N     1 
ATOM   8266  C  CA    . ALA C 2  597  ? 34.532  -23.986 100.388 1.00 98.81  ? 597  ALA C CA    1 
ATOM   8267  C  C     . ALA C 2  597  ? 34.675  -25.190 99.464  1.00 104.28 ? 597  ALA C C     1 
ATOM   8268  O  O     . ALA C 2  597  ? 33.758  -26.009 99.350  1.00 101.94 ? 597  ALA C O     1 
ATOM   8269  C  CB    . ALA C 2  597  ? 34.558  -24.433 101.848 1.00 92.92  ? 597  ALA C CB    1 
ATOM   8270  N  N     . GLU C 2  598  ? 35.844  -25.302 98.821  1.00 110.43 ? 598  GLU C N     1 
ATOM   8271  C  CA    . GLU C 2  598  ? 36.081  -26.338 97.819  1.00 107.59 ? 598  GLU C CA    1 
ATOM   8272  C  C     . GLU C 2  598  ? 36.305  -27.707 98.449  1.00 114.63 ? 598  GLU C C     1 
ATOM   8273  O  O     . GLU C 2  598  ? 35.863  -28.725 97.904  1.00 111.79 ? 598  GLU C O     1 
ATOM   8274  C  CB    . GLU C 2  598  ? 37.280  -25.954 96.960  1.00 109.10 ? 598  GLU C CB    1 
ATOM   8275  C  CG    . GLU C 2  598  ? 37.779  -27.059 96.057  1.00 116.79 ? 598  GLU C CG    1 
ATOM   8276  C  CD    . GLU C 2  598  ? 39.051  -26.669 95.340  1.00 120.04 ? 598  GLU C CD    1 
ATOM   8277  O  OE1   . GLU C 2  598  ? 39.446  -25.487 95.445  1.00 117.34 ? 598  GLU C OE1   1 
ATOM   8278  O  OE2   . GLU C 2  598  ? 39.655  -27.540 94.679  1.00 125.01 ? 598  GLU C OE2   1 
ATOM   8279  N  N     . GLU C 2  599  ? 37.001  -27.750 99.583  1.00 119.10 ? 599  GLU C N     1 
ATOM   8280  C  CA    . GLU C 2  599  ? 37.214  -28.974 100.343 1.00 117.69 ? 599  GLU C CA    1 
ATOM   8281  C  C     . GLU C 2  599  ? 37.254  -28.595 101.819 1.00 114.27 ? 599  GLU C C     1 
ATOM   8282  O  O     . GLU C 2  599  ? 37.177  -27.415 102.172 1.00 111.39 ? 599  GLU C O     1 
ATOM   8283  C  CB    . GLU C 2  599  ? 38.501  -29.681 99.901  1.00 116.66 ? 599  GLU C CB    1 
ATOM   8284  C  CG    . GLU C 2  599  ? 38.443  -31.198 100.004 1.00 124.59 ? 599  GLU C CG    1 
ATOM   8285  C  CD    . GLU C 2  599  ? 37.546  -31.820 98.948  1.00 123.45 ? 599  GLU C CD    1 
ATOM   8286  O  OE1   . GLU C 2  599  ? 37.531  -31.308 97.807  1.00 119.83 ? 599  GLU C OE1   1 
ATOM   8287  O  OE2   . GLU C 2  599  ? 36.852  -32.813 99.260  1.00 121.40 ? 599  GLU C OE2   1 
ATOM   8288  N  N     . ASP C 2  600  ? 37.369  -29.601 102.687 1.00 115.07 ? 600  ASP C N     1 
ATOM   8289  C  CA    . ASP C 2  600  ? 37.550  -29.317 104.106 1.00 109.32 ? 600  ASP C CA    1 
ATOM   8290  C  C     . ASP C 2  600  ? 38.837  -28.523 104.302 1.00 111.73 ? 600  ASP C C     1 
ATOM   8291  O  O     . ASP C 2  600  ? 39.773  -28.614 103.503 1.00 114.42 ? 600  ASP C O     1 
ATOM   8292  C  CB    . ASP C 2  600  ? 37.601  -30.610 104.928 1.00 113.03 ? 600  ASP C CB    1 
ATOM   8293  C  CG    . ASP C 2  600  ? 36.399  -31.517 104.692 1.00 113.61 ? 600  ASP C CG    1 
ATOM   8294  O  OD1   . ASP C 2  600  ? 35.371  -31.345 105.381 1.00 108.07 ? 600  ASP C OD1   1 
ATOM   8295  O  OD2   . ASP C 2  600  ? 36.487  -32.411 103.822 1.00 118.30 ? 600  ASP C OD2   1 
ATOM   8296  N  N     . GLY C 2  601  ? 38.883  -27.724 105.361 1.00 106.72 ? 601  GLY C N     1 
ATOM   8297  C  CA    . GLY C 2  601  ? 40.076  -26.943 105.608 1.00 109.30 ? 601  GLY C CA    1 
ATOM   8298  C  C     . GLY C 2  601  ? 39.893  -25.964 106.750 1.00 107.80 ? 601  GLY C C     1 
ATOM   8299  O  O     . GLY C 2  601  ? 38.910  -26.010 107.492 1.00 108.71 ? 601  GLY C O     1 
ATOM   8300  N  N     . GLU C 2  602  ? 40.886  -25.087 106.878 1.00 109.04 ? 602  GLU C N     1 
ATOM   8301  C  CA    . GLU C 2  602  ? 40.917  -24.031 107.879 1.00 110.08 ? 602  GLU C CA    1 
ATOM   8302  C  C     . GLU C 2  602  ? 41.181  -22.709 107.175 1.00 108.68 ? 602  GLU C C     1 
ATOM   8303  O  O     . GLU C 2  602  ? 42.009  -22.638 106.262 1.00 106.26 ? 602  GLU C O     1 
ATOM   8304  C  CB    . GLU C 2  602  ? 41.999  -24.300 108.944 1.00 112.38 ? 602  GLU C CB    1 
ATOM   8305  C  CG    . GLU C 2  602  ? 42.189  -23.185 109.972 1.00 112.13 ? 602  GLU C CG    1 
ATOM   8306  C  CD    . GLU C 2  602  ? 43.274  -23.501 110.994 1.00 119.67 ? 602  GLU C CD    1 
ATOM   8307  O  OE1   . GLU C 2  602  ? 43.875  -24.594 110.910 1.00 127.60 ? 602  GLU C OE1   1 
ATOM   8308  O  OE2   . GLU C 2  602  ? 43.527  -22.658 111.881 1.00 117.94 ? 602  GLU C OE2   1 
ATOM   8309  N  N     . VAL C 2  603  ? 40.473  -21.666 107.595 1.00 106.36 ? 603  VAL C N     1 
ATOM   8310  C  CA    . VAL C 2  603  ? 40.581  -20.368 106.941 1.00 101.62 ? 603  VAL C CA    1 
ATOM   8311  C  C     . VAL C 2  603  ? 41.832  -19.662 107.447 1.00 102.46 ? 603  VAL C C     1 
ATOM   8312  O  O     . VAL C 2  603  ? 41.977  -19.411 108.649 1.00 97.90  ? 603  VAL C O     1 
ATOM   8313  C  CB    . VAL C 2  603  ? 39.328  -19.519 107.185 1.00 102.94 ? 603  VAL C CB    1 
ATOM   8314  C  CG1   . VAL C 2  603  ? 39.353  -18.296 106.291 1.00 98.08  ? 603  VAL C CG1   1 
ATOM   8315  C  CG2   . VAL C 2  603  ? 38.078  -20.345 106.930 1.00 102.67 ? 603  VAL C CG2   1 
ATOM   8316  N  N     . ALA C 2  604  ? 42.739  -19.339 106.524 1.00 98.70  ? 604  ALA C N     1 
ATOM   8317  C  CA    . ALA C 2  604  ? 43.998  -18.701 106.893 1.00 99.61  ? 604  ALA C CA    1 
ATOM   8318  C  C     . ALA C 2  604  ? 43.825  -17.198 107.084 1.00 94.75  ? 604  ALA C C     1 
ATOM   8319  O  O     . ALA C 2  604  ? 44.075  -16.662 108.168 1.00 91.42  ? 604  ALA C O     1 
ATOM   8320  C  CB    . ALA C 2  604  ? 45.059  -18.989 105.828 1.00 97.60  ? 604  ALA C CB    1 
ATOM   8321  N  N     . LYS C 2  605  ? 43.399  -16.504 106.038 1.00 94.05  ? 605  LYS C N     1 
ATOM   8322  C  CA    . LYS C 2  605  ? 43.288  -15.055 106.065 1.00 90.65  ? 605  LYS C CA    1 
ATOM   8323  C  C     . LYS C 2  605  ? 41.874  -14.637 105.687 1.00 95.73  ? 605  LYS C C     1 
ATOM   8324  O  O     . LYS C 2  605  ? 41.235  -15.270 104.845 1.00 98.23  ? 605  LYS C O     1 
ATOM   8325  C  CB    . LYS C 2  605  ? 44.296  -14.405 105.106 1.00 97.03  ? 605  LYS C CB    1 
ATOM   8326  C  CG    . LYS C 2  605  ? 45.759  -14.621 105.471 1.00 97.33  ? 605  LYS C CG    1 
ATOM   8327  C  CD    . LYS C 2  605  ? 46.665  -13.929 104.453 1.00 102.82 ? 605  LYS C CD    1 
ATOM   8328  C  CE    . LYS C 2  605  ? 48.132  -14.032 104.830 1.00 103.92 ? 605  LYS C CE    1 
ATOM   8329  N  NZ    . LYS C 2  605  ? 49.004  -13.393 103.804 1.00 94.88  ? 605  LYS C NZ    1 
ATOM   8330  N  N     . VAL C 2  606  ? 41.390  -13.560 106.308 1.00 96.62  ? 606  VAL C N     1 
ATOM   8331  C  CA    . VAL C 2  606  ? 40.072  -13.008 105.999 1.00 89.95  ? 606  VAL C CA    1 
ATOM   8332  C  C     . VAL C 2  606  ? 40.177  -11.492 105.908 1.00 92.96  ? 606  VAL C C     1 
ATOM   8333  O  O     . VAL C 2  606  ? 40.654  -10.832 106.837 1.00 94.65  ? 606  VAL C O     1 
ATOM   8334  C  CB    . VAL C 2  606  ? 39.007  -13.410 107.034 1.00 88.40  ? 606  VAL C CB    1 
ATOM   8335  C  CG1   . VAL C 2  606  ? 37.707  -12.670 106.755 1.00 88.59  ? 606  VAL C CG1   1 
ATOM   8336  C  CG2   . VAL C 2  606  ? 38.782  -14.903 106.989 1.00 86.38  ? 606  VAL C CG2   1 
ATOM   8337  N  N     . ASP C 2  607  ? 39.699  -10.944 104.796 1.00 93.74  ? 607  ASP C N     1 
ATOM   8338  C  CA    . ASP C 2  607  ? 39.919  -9.560  104.418 1.00 93.55  ? 607  ASP C CA    1 
ATOM   8339  C  C     . ASP C 2  607  ? 38.645  -9.040  103.772 1.00 88.18  ? 607  ASP C C     1 
ATOM   8340  O  O     . ASP C 2  607  ? 37.793  -9.815  103.331 1.00 86.50  ? 607  ASP C O     1 
ATOM   8341  C  CB    . ASP C 2  607  ? 41.103  -9.448  103.438 1.00 92.27  ? 607  ASP C CB    1 
ATOM   8342  C  CG    . ASP C 2  607  ? 41.695  -8.063  103.381 1.00 97.40  ? 607  ASP C CG    1 
ATOM   8343  O  OD1   . ASP C 2  607  ? 41.622  -7.354  104.406 1.00 99.77  ? 607  ASP C OD1   1 
ATOM   8344  O  OD2   . ASP C 2  607  ? 42.231  -7.686  102.311 1.00 98.28  ? 607  ASP C OD2   1 
ATOM   8345  N  N     . GLY C 2  608  ? 38.518  -7.716  103.709 1.00 88.36  ? 608  GLY C N     1 
ATOM   8346  C  CA    . GLY C 2  608  ? 37.468  -7.141  102.885 1.00 86.64  ? 608  GLY C CA    1 
ATOM   8347  C  C     . GLY C 2  608  ? 37.610  -7.531  101.426 1.00 90.07  ? 608  GLY C C     1 
ATOM   8348  O  O     . GLY C 2  608  ? 36.614  -7.710  100.718 1.00 85.33  ? 608  GLY C O     1 
ATOM   8349  N  N     . ASN C 2  609  ? 38.852  -7.696  100.965 1.00 90.02  ? 609  ASN C N     1 
ATOM   8350  C  CA    . ASN C 2  609  ? 39.139  -7.978  99.565  1.00 84.08  ? 609  ASN C CA    1 
ATOM   8351  C  C     . ASN C 2  609  ? 39.376  -9.451  99.266  1.00 82.63  ? 609  ASN C C     1 
ATOM   8352  O  O     . ASN C 2  609  ? 39.145  -9.876  98.131  1.00 82.35  ? 609  ASN C O     1 
ATOM   8353  C  CB    . ASN C 2  609  ? 40.361  -7.175  99.105  1.00 76.14  ? 609  ASN C CB    1 
ATOM   8354  C  CG    . ASN C 2  609  ? 40.140  -5.673  99.193  1.00 81.83  ? 609  ASN C CG    1 
ATOM   8355  O  OD1   . ASN C 2  609  ? 39.330  -5.114  98.458  1.00 82.21  ? 609  ASN C OD1   1 
ATOM   8356  N  ND2   . ASN C 2  609  ? 40.872  -5.011  100.087 1.00 84.79  ? 609  ASN C ND2   1 
ATOM   8357  N  N     . ARG C 2  610  ? 39.820  -10.249 100.235 1.00 80.57  ? 610  ARG C N     1 
ATOM   8358  C  CA    . ARG C 2  610  ? 40.281  -11.593 99.909  1.00 87.06  ? 610  ARG C CA    1 
ATOM   8359  C  C     . ARG C 2  610  ? 40.079  -12.541 101.083 1.00 87.07  ? 610  ARG C C     1 
ATOM   8360  O  O     . ARG C 2  610  ? 40.169  -12.136 102.242 1.00 89.90  ? 610  ARG C O     1 
ATOM   8361  C  CB    . ARG C 2  610  ? 41.761  -11.561 99.498  1.00 89.50  ? 610  ARG C CB    1 
ATOM   8362  C  CG    . ARG C 2  610  ? 42.642  -12.638 100.133 1.00 91.30  ? 610  ARG C CG    1 
ATOM   8363  C  CD    . ARG C 2  610  ? 43.817  -12.032 100.894 1.00 87.94  ? 610  ARG C CD    1 
ATOM   8364  N  NE    . ARG C 2  610  ? 43.470  -11.699 102.271 1.00 96.98  ? 610  ARG C NE    1 
ATOM   8365  C  CZ    . ARG C 2  610  ? 44.282  -11.070 103.115 1.00 100.34 ? 610  ARG C CZ    1 
ATOM   8366  N  NH1   . ARG C 2  610  ? 43.880  -10.811 104.351 1.00 97.13  ? 610  ARG C NH1   1 
ATOM   8367  N  NH2   . ARG C 2  610  ? 45.494  -10.694 102.725 1.00 100.41 ? 610  ARG C NH2   1 
ATOM   8368  N  N     . ILE C 2  611  ? 39.811  -13.811 100.773 1.00 79.66  ? 611  ILE C N     1 
ATOM   8369  C  CA    . ILE C 2  611  ? 39.834  -14.888 101.759 1.00 87.39  ? 611  ILE C CA    1 
ATOM   8370  C  C     . ILE C 2  611  ? 40.854  -15.929 101.315 1.00 94.51  ? 611  ILE C C     1 
ATOM   8371  O  O     . ILE C 2  611  ? 40.760  -16.463 100.205 1.00 90.98  ? 611  ILE C O     1 
ATOM   8372  C  CB    . ILE C 2  611  ? 38.452  -15.544 101.947 1.00 87.73  ? 611  ILE C CB    1 
ATOM   8373  C  CG1   . ILE C 2  611  ? 37.375  -14.517 102.273 1.00 84.43  ? 611  ILE C CG1   1 
ATOM   8374  C  CG2   . ILE C 2  611  ? 38.496  -16.571 103.068 1.00 83.01  ? 611  ILE C CG2   1 
ATOM   8375  C  CD1   . ILE C 2  611  ? 36.023  -15.151 102.480 1.00 73.97  ? 611  ILE C CD1   1 
ATOM   8376  N  N     . VAL C 2  612  ? 41.806  -16.245 102.192 1.00 97.45  ? 612  VAL C N     1 
ATOM   8377  C  CA    . VAL C 2  612  ? 42.809  -17.276 101.945 1.00 94.16  ? 612  VAL C CA    1 
ATOM   8378  C  C     . VAL C 2  612  ? 42.478  -18.490 102.804 1.00 96.86  ? 612  VAL C C     1 
ATOM   8379  O  O     . VAL C 2  612  ? 42.350  -18.370 104.029 1.00 94.43  ? 612  VAL C O     1 
ATOM   8380  C  CB    . VAL C 2  612  ? 44.230  -16.769 102.246 1.00 91.40  ? 612  VAL C CB    1 
ATOM   8381  C  CG1   . VAL C 2  612  ? 45.246  -17.851 101.936 1.00 89.31  ? 612  VAL C CG1   1 
ATOM   8382  C  CG2   . VAL C 2  612  ? 44.524  -15.509 101.455 1.00 93.57  ? 612  VAL C CG2   1 
ATOM   8383  N  N     . VAL C 2  613  ? 42.377  -19.656 102.165 1.00 101.27 ? 613  VAL C N     1 
ATOM   8384  C  CA    . VAL C 2  613  ? 41.977  -20.905 102.802 1.00 100.40 ? 613  VAL C CA    1 
ATOM   8385  C  C     . VAL C 2  613  ? 43.071  -21.946 102.592 1.00 110.15 ? 613  VAL C C     1 
ATOM   8386  O  O     . VAL C 2  613  ? 43.638  -22.058 101.498 1.00 108.74 ? 613  VAL C O     1 
ATOM   8387  C  CB    . VAL C 2  613  ? 40.631  -21.409 102.236 1.00 101.76 ? 613  VAL C CB    1 
ATOM   8388  C  CG1   . VAL C 2  613  ? 40.330  -22.826 102.709 1.00 104.39 ? 613  VAL C CG1   1 
ATOM   8389  C  CG2   . VAL C 2  613  ? 39.506  -20.466 102.628 1.00 101.79 ? 613  VAL C CG2   1 
ATOM   8390  N  N     . ARG C 2  614  ? 43.364  -22.709 103.644 1.00 109.03 ? 614  ARG C N     1 
ATOM   8391  C  CA    . ARG C 2  614  ? 44.245  -23.868 103.559 1.00 112.05 ? 614  ARG C CA    1 
ATOM   8392  C  C     . ARG C 2  614  ? 43.390  -25.127 103.641 1.00 111.76 ? 614  ARG C C     1 
ATOM   8393  O  O     . ARG C 2  614  ? 42.649  -25.313 104.612 1.00 113.58 ? 614  ARG C O     1 
ATOM   8394  C  CB    . ARG C 2  614  ? 45.293  -23.848 104.672 1.00 117.53 ? 614  ARG C CB    1 
ATOM   8395  C  CG    . ARG C 2  614  ? 46.234  -25.046 104.656 1.00 120.54 ? 614  ARG C CG    1 
ATOM   8396  C  CD    . ARG C 2  614  ? 47.316  -24.932 105.721 1.00 117.96 ? 614  ARG C CD    1 
ATOM   8397  N  NE    . ARG C 2  614  ? 48.186  -23.780 105.498 1.00 118.71 ? 614  ARG C NE    1 
ATOM   8398  C  CZ    . ARG C 2  614  ? 49.182  -23.758 104.618 1.00 120.21 ? 614  ARG C CZ    1 
ATOM   8399  N  NH1   . ARG C 2  614  ? 49.929  -22.669 104.476 1.00 113.04 ? 614  ARG C NH1   1 
ATOM   8400  N  NH2   . ARG C 2  614  ? 49.430  -24.825 103.871 1.00 118.40 ? 614  ARG C NH2   1 
ATOM   8401  N  N     . TYR C 2  615  ? 43.492  -25.984 102.627 1.00 117.18 ? 615  TYR C N     1 
ATOM   8402  C  CA    . TYR C 2  615  ? 42.659  -27.176 102.532 1.00 121.92 ? 615  TYR C CA    1 
ATOM   8403  C  C     . TYR C 2  615  ? 43.364  -28.376 103.175 1.00 128.39 ? 615  TYR C C     1 
ATOM   8404  O  O     . TYR C 2  615  ? 44.429  -28.247 103.787 1.00 127.73 ? 615  TYR C O     1 
ATOM   8405  C  CB    . TYR C 2  615  ? 42.283  -27.436 101.069 1.00 120.48 ? 615  TYR C CB    1 
ATOM   8406  C  CG    . TYR C 2  615  ? 41.228  -26.484 100.536 1.00 118.39 ? 615  TYR C CG    1 
ATOM   8407  C  CD1   . TYR C 2  615  ? 39.982  -26.391 101.146 1.00 120.88 ? 615  TYR C CD1   1 
ATOM   8408  C  CD2   . TYR C 2  615  ? 41.480  -25.666 99.439  1.00 112.77 ? 615  TYR C CD2   1 
ATOM   8409  C  CE1   . TYR C 2  615  ? 39.013  -25.519 100.677 1.00 113.85 ? 615  TYR C CE1   1 
ATOM   8410  C  CE2   . TYR C 2  615  ? 40.511  -24.789 98.961  1.00 109.20 ? 615  TYR C CE2   1 
ATOM   8411  C  CZ    . TYR C 2  615  ? 39.280  -24.723 99.588  1.00 110.00 ? 615  TYR C CZ    1 
ATOM   8412  O  OH    . TYR C 2  615  ? 38.308  -23.861 99.133  1.00 98.36  ? 615  TYR C OH    1 
ATOM   8413  N  N     . GLU C 2  616  ? 42.758  -29.564 103.051 1.00 130.76 ? 616  GLU C N     1 
ATOM   8414  C  CA    . GLU C 2  616  ? 43.333  -30.780 103.623 1.00 128.15 ? 616  GLU C CA    1 
ATOM   8415  C  C     . GLU C 2  616  ? 44.629  -31.194 102.939 1.00 126.96 ? 616  GLU C C     1 
ATOM   8416  O  O     . GLU C 2  616  ? 45.388  -31.984 103.509 1.00 129.05 ? 616  GLU C O     1 
ATOM   8417  C  CB    . GLU C 2  616  ? 42.335  -31.940 103.544 1.00 125.63 ? 616  GLU C CB    1 
ATOM   8418  C  CG    . GLU C 2  616  ? 41.094  -31.799 104.419 1.00 132.62 ? 616  GLU C CG    1 
ATOM   8419  C  CD    . GLU C 2  616  ? 41.370  -32.019 105.902 1.00 139.86 ? 616  GLU C CD    1 
ATOM   8420  O  OE1   . GLU C 2  616  ? 42.063  -31.180 106.519 1.00 139.85 ? 616  GLU C OE1   1 
ATOM   8421  O  OE2   . GLU C 2  616  ? 40.889  -33.035 106.453 1.00 141.13 ? 616  GLU C OE2   1 
ATOM   8422  N  N     . ASP C 2  617  ? 44.891  -30.695 101.732 1.00 126.94 ? 617  ASP C N     1 
ATOM   8423  C  CA    . ASP C 2  617  ? 46.124  -31.007 101.019 1.00 126.07 ? 617  ASP C CA    1 
ATOM   8424  C  C     . ASP C 2  617  ? 47.307  -30.173 101.486 1.00 122.95 ? 617  ASP C C     1 
ATOM   8425  O  O     . ASP C 2  617  ? 48.438  -30.453 101.078 1.00 122.09 ? 617  ASP C O     1 
ATOM   8426  C  CB    . ASP C 2  617  ? 45.926  -30.791 99.517  1.00 118.61 ? 617  ASP C CB    1 
ATOM   8427  C  CG    . ASP C 2  617  ? 44.615  -31.358 99.017  1.00 123.64 ? 617  ASP C CG    1 
ATOM   8428  O  OD1   . ASP C 2  617  ? 44.368  -32.559 99.244  1.00 126.70 ? 617  ASP C OD1   1 
ATOM   8429  O  OD2   . ASP C 2  617  ? 43.827  -30.602 98.410  1.00 123.43 ? 617  ASP C OD2   1 
ATOM   8430  N  N     . GLY C 2  618  ? 47.075  -29.164 102.326 1.00 124.19 ? 618  GLY C N     1 
ATOM   8431  C  CA    . GLY C 2  618  ? 48.080  -28.175 102.635 1.00 121.57 ? 618  GLY C CA    1 
ATOM   8432  C  C     . GLY C 2  618  ? 48.182  -27.045 101.633 1.00 118.33 ? 618  GLY C C     1 
ATOM   8433  O  O     . GLY C 2  618  ? 48.891  -26.065 101.900 1.00 118.13 ? 618  GLY C O     1 
ATOM   8434  N  N     . ARG C 2  619  ? 47.494  -27.138 100.497 1.00 109.68 ? 619  ARG C N     1 
ATOM   8435  C  CA    . ARG C 2  619  ? 47.579  -26.097 99.483  1.00 113.01 ? 619  ARG C CA    1 
ATOM   8436  C  C     . ARG C 2  619  ? 46.867  -24.835 99.946  1.00 114.75 ? 619  ARG C C     1 
ATOM   8437  O  O     . ARG C 2  619  ? 45.845  -24.891 100.636 1.00 115.57 ? 619  ARG C O     1 
ATOM   8438  C  CB    . ARG C 2  619  ? 46.980  -26.590 98.171  1.00 114.53 ? 619  ARG C CB    1 
ATOM   8439  C  CG    . ARG C 2  619  ? 45.574  -27.116 98.311  1.00 113.51 ? 619  ARG C CG    1 
ATOM   8440  C  CD    . ARG C 2  619  ? 45.217  -28.000 97.142  1.00 116.71 ? 619  ARG C CD    1 
ATOM   8441  N  NE    . ARG C 2  619  ? 43.813  -28.390 97.173  1.00 120.13 ? 619  ARG C NE    1 
ATOM   8442  C  CZ    . ARG C 2  619  ? 42.871  -27.823 96.428  1.00 119.73 ? 619  ARG C CZ    1 
ATOM   8443  N  NH1   . ARG C 2  619  ? 41.614  -28.238 96.515  1.00 120.02 ? 619  ARG C NH1   1 
ATOM   8444  N  NH2   . ARG C 2  619  ? 43.190  -26.845 95.590  1.00 115.25 ? 619  ARG C NH2   1 
ATOM   8445  N  N     . LEU C 2  620  ? 47.414  -23.689 99.558  1.00 111.90 ? 620  LEU C N     1 
ATOM   8446  C  CA    . LEU C 2  620  ? 46.915  -22.388 99.983  1.00 109.62 ? 620  LEU C CA    1 
ATOM   8447  C  C     . LEU C 2  620  ? 46.190  -21.743 98.809  1.00 105.54 ? 620  LEU C C     1 
ATOM   8448  O  O     . LEU C 2  620  ? 46.830  -21.269 97.865  1.00 105.82 ? 620  LEU C O     1 
ATOM   8449  C  CB    . LEU C 2  620  ? 48.061  -21.510 100.480 1.00 104.84 ? 620  LEU C CB    1 
ATOM   8450  C  CG    . LEU C 2  620  ? 47.746  -20.585 101.651 1.00 99.15  ? 620  LEU C CG    1 
ATOM   8451  C  CD1   . LEU C 2  620  ? 47.303  -21.409 102.840 1.00 110.50 ? 620  LEU C CD1   1 
ATOM   8452  C  CD2   . LEU C 2  620  ? 48.945  -19.726 102.008 1.00 90.34  ? 620  LEU C CD2   1 
ATOM   8453  N  N     . VAL C 2  621  ? 44.859  -21.714 98.871  1.00 105.85 ? 621  VAL C N     1 
ATOM   8454  C  CA    . VAL C 2  621  ? 44.028  -21.164 97.805  1.00 98.15  ? 621  VAL C CA    1 
ATOM   8455  C  C     . VAL C 2  621  ? 43.532  -19.791 98.233  1.00 94.71  ? 621  VAL C C     1 
ATOM   8456  O  O     . VAL C 2  621  ? 43.111  -19.598 99.379  1.00 95.88  ? 621  VAL C O     1 
ATOM   8457  C  CB    . VAL C 2  621  ? 42.846  -22.092 97.467  1.00 91.02  ? 621  VAL C CB    1 
ATOM   8458  C  CG1   . VAL C 2  621  ? 42.035  -21.513 96.320  1.00 90.04  ? 621  VAL C CG1   1 
ATOM   8459  C  CG2   . VAL C 2  621  ? 43.347  -23.486 97.128  1.00 99.76  ? 621  VAL C CG2   1 
ATOM   8460  N  N     . GLU C 2  622  ? 43.582  -18.835 97.310  1.00 84.54  ? 622  GLU C N     1 
ATOM   8461  C  CA    . GLU C 2  622  ? 43.203  -17.457 97.589  1.00 83.58  ? 622  GLU C CA    1 
ATOM   8462  C  C     . GLU C 2  622  ? 42.004  -17.084 96.728  1.00 92.14  ? 622  GLU C C     1 
ATOM   8463  O  O     . GLU C 2  622  ? 42.100  -17.058 95.495  1.00 93.25  ? 622  GLU C O     1 
ATOM   8464  C  CB    . GLU C 2  622  ? 44.374  -16.507 97.341  1.00 80.35  ? 622  GLU C CB    1 
ATOM   8465  C  CG    . GLU C 2  622  ? 44.074  -15.051 97.654  1.00 89.43  ? 622  GLU C CG    1 
ATOM   8466  C  CD    . GLU C 2  622  ? 45.298  -14.166 97.525  1.00 100.38 ? 622  GLU C CD    1 
ATOM   8467  O  OE1   . GLU C 2  622  ? 45.469  -13.247 98.356  1.00 91.13  ? 622  GLU C OE1   1 
ATOM   8468  O  OE2   . GLU C 2  622  ? 46.099  -14.399 96.594  1.00 116.33 ? 622  GLU C OE2   1 
ATOM   8469  N  N     . TYR C 2  623  ? 40.877  -16.802 97.381  1.00 89.71  ? 623  TYR C N     1 
ATOM   8470  C  CA    . TYR C 2  623  ? 39.658  -16.377 96.720  1.00 83.90  ? 623  TYR C CA    1 
ATOM   8471  C  C     . TYR C 2  623  ? 39.549  -14.865 96.814  1.00 84.25  ? 623  TYR C C     1 
ATOM   8472  O  O     . TYR C 2  623  ? 39.313  -14.334 97.915  1.00 84.12  ? 623  TYR C O     1 
ATOM   8473  C  CB    . TYR C 2  623  ? 38.446  -17.038 97.368  1.00 83.37  ? 623  TYR C CB    1 
ATOM   8474  C  CG    . TYR C 2  623  ? 38.477  -18.545 97.323  1.00 79.63  ? 623  TYR C CG    1 
ATOM   8475  C  CD1   . TYR C 2  623  ? 37.928  -19.233 96.252  1.00 81.74  ? 623  TYR C CD1   1 
ATOM   8476  C  CD2   . TYR C 2  623  ? 39.048  -19.281 98.351  1.00 81.76  ? 623  TYR C CD2   1 
ATOM   8477  C  CE1   . TYR C 2  623  ? 37.947  -20.607 96.202  1.00 88.65  ? 623  TYR C CE1   1 
ATOM   8478  C  CE2   . TYR C 2  623  ? 39.070  -20.660 98.314  1.00 87.15  ? 623  TYR C CE2   1 
ATOM   8479  C  CZ    . TYR C 2  623  ? 38.519  -21.320 97.234  1.00 95.13  ? 623  TYR C CZ    1 
ATOM   8480  O  OH    . TYR C 2  623  ? 38.538  -22.697 97.179  1.00 107.00 ? 623  TYR C OH    1 
ATOM   8481  N  N     . PRO C 2  624  ? 39.742  -14.135 95.723  1.00 81.95  ? 624  PRO C N     1 
ATOM   8482  C  CA    . PRO C 2  624  ? 39.476  -12.698 95.734  1.00 81.41  ? 624  PRO C CA    1 
ATOM   8483  C  C     . PRO C 2  624  ? 37.986  -12.428 95.627  1.00 85.09  ? 624  PRO C C     1 
ATOM   8484  O  O     . PRO C 2  624  ? 37.231  -13.182 95.004  1.00 80.46  ? 624  PRO C O     1 
ATOM   8485  C  CB    . PRO C 2  624  ? 40.224  -12.199 94.494  1.00 69.10  ? 624  PRO C CB    1 
ATOM   8486  C  CG    . PRO C 2  624  ? 40.147  -13.356 93.561  1.00 69.91  ? 624  PRO C CG    1 
ATOM   8487  C  CD    . PRO C 2  624  ? 40.249  -14.594 94.421  1.00 71.21  ? 624  PRO C CD    1 
ATOM   8488  N  N     . LEU C 2  625  ? 37.565  -11.331 96.247  1.00 87.11  ? 625  LEU C N     1 
ATOM   8489  C  CA    . LEU C 2  625  ? 36.156  -10.984 96.346  1.00 81.86  ? 625  LEU C CA    1 
ATOM   8490  C  C     . LEU C 2  625  ? 35.842  -9.810  95.430  1.00 79.86  ? 625  LEU C C     1 
ATOM   8491  O  O     . LEU C 2  625  ? 36.533  -8.786  95.454  1.00 77.30  ? 625  LEU C O     1 
ATOM   8492  C  CB    . LEU C 2  625  ? 35.777  -10.662 97.792  1.00 81.06  ? 625  LEU C CB    1 
ATOM   8493  C  CG    . LEU C 2  625  ? 36.031  -11.810 98.775  1.00 83.47  ? 625  LEU C CG    1 
ATOM   8494  C  CD1   . LEU C 2  625  ? 35.654  -11.417 100.200 1.00 76.01  ? 625  LEU C CD1   1 
ATOM   8495  C  CD2   . LEU C 2  625  ? 35.293  -13.071 98.344  1.00 81.18  ? 625  LEU C CD2   1 
ATOM   8496  N  N     . ARG C 2  626  ? 34.815  -9.980  94.608  1.00 82.50  ? 626  ARG C N     1 
ATOM   8497  C  CA    . ARG C 2  626  ? 34.292  -8.895  93.792  1.00 82.95  ? 626  ARG C CA    1 
ATOM   8498  C  C     . ARG C 2  626  ? 33.654  -7.857  94.707  1.00 83.27  ? 626  ARG C C     1 
ATOM   8499  O  O     . ARG C 2  626  ? 32.746  -8.186  95.475  1.00 83.87  ? 626  ARG C O     1 
ATOM   8500  C  CB    . ARG C 2  626  ? 33.278  -9.459  92.803  1.00 86.62  ? 626  ARG C CB    1 
ATOM   8501  C  CG    . ARG C 2  626  ? 32.508  -8.449  91.988  1.00 86.68  ? 626  ARG C CG    1 
ATOM   8502  C  CD    . ARG C 2  626  ? 31.508  -9.141  91.065  1.00 86.80  ? 626  ARG C CD    1 
ATOM   8503  N  NE    . ARG C 2  626  ? 32.160  -9.982  90.060  1.00 97.83  ? 626  ARG C NE    1 
ATOM   8504  C  CZ    . ARG C 2  626  ? 32.319  -11.301 90.161  1.00 96.34  ? 626  ARG C CZ    1 
ATOM   8505  N  NH1   . ARG C 2  626  ? 31.874  -11.951 91.232  1.00 86.16  ? 626  ARG C NH1   1 
ATOM   8506  N  NH2   . ARG C 2  626  ? 32.925  -11.971 89.187  1.00 95.63  ? 626  ARG C NH2   1 
ATOM   8507  N  N     . ARG C 2  627  ? 34.134  -6.613  94.649  1.00 85.47  ? 627  ARG C N     1 
ATOM   8508  C  CA    . ARG C 2  627  ? 33.731  -5.579  95.603  1.00 81.94  ? 627  ARG C CA    1 
ATOM   8509  C  C     . ARG C 2  627  ? 33.247  -4.331  94.873  1.00 79.09  ? 627  ARG C C     1 
ATOM   8510  O  O     . ARG C 2  627  ? 34.038  -3.649  94.213  1.00 87.65  ? 627  ARG C O     1 
ATOM   8511  C  CB    . ARG C 2  627  ? 34.879  -5.237  96.552  1.00 81.10  ? 627  ARG C CB    1 
ATOM   8512  C  CG    . ARG C 2  627  ? 34.945  -6.131  97.780  1.00 79.52  ? 627  ARG C CG    1 
ATOM   8513  C  CD    . ARG C 2  627  ? 33.660  -6.038  98.587  1.00 80.41  ? 627  ARG C CD    1 
ATOM   8514  N  NE    . ARG C 2  627  ? 33.805  -6.657  99.900  1.00 85.76  ? 627  ARG C NE    1 
ATOM   8515  C  CZ    . ARG C 2  627  ? 32.989  -6.433  100.926 1.00 88.06  ? 627  ARG C CZ    1 
ATOM   8516  N  NH1   . ARG C 2  627  ? 31.966  -5.599  100.791 1.00 84.37  ? 627  ARG C NH1   1 
ATOM   8517  N  NH2   . ARG C 2  627  ? 33.200  -7.040  102.089 1.00 91.81  ? 627  ARG C NH2   1 
ATOM   8518  N  N     . PHE C 2  628  ? 31.952  -4.030  95.022  1.00 75.55  ? 628  PHE C N     1 
ATOM   8519  C  CA    . PHE C 2  628  ? 31.311  -2.827  94.481  1.00 76.66  ? 628  PHE C CA    1 
ATOM   8520  C  C     . PHE C 2  628  ? 31.430  -2.753  92.959  1.00 82.47  ? 628  PHE C C     1 
ATOM   8521  O  O     . PHE C 2  628  ? 31.850  -1.741  92.389  1.00 83.74  ? 628  PHE C O     1 
ATOM   8522  C  CB    . PHE C 2  628  ? 31.866  -1.567  95.147  1.00 74.22  ? 628  PHE C CB    1 
ATOM   8523  C  CG    . PHE C 2  628  ? 31.664  -1.543  96.630  1.00 81.76  ? 628  PHE C CG    1 
ATOM   8524  C  CD1   . PHE C 2  628  ? 30.456  -1.139  97.171  1.00 77.37  ? 628  PHE C CD1   1 
ATOM   8525  C  CD2   . PHE C 2  628  ? 32.674  -1.953  97.483  1.00 83.57  ? 628  PHE C CD2   1 
ATOM   8526  C  CE1   . PHE C 2  628  ? 30.270  -1.129  98.534  1.00 75.55  ? 628  PHE C CE1   1 
ATOM   8527  C  CE2   . PHE C 2  628  ? 32.491  -1.945  98.849  1.00 76.41  ? 628  PHE C CE2   1 
ATOM   8528  C  CZ    . PHE C 2  628  ? 31.290  -1.532  99.376  1.00 73.65  ? 628  PHE C CZ    1 
ATOM   8529  N  N     . TYR C 2  629  ? 31.026  -3.838  92.304  1.00 81.32  ? 629  TYR C N     1 
ATOM   8530  C  CA    . TYR C 2  629  ? 31.032  -3.950  90.854  1.00 77.82  ? 629  TYR C CA    1 
ATOM   8531  C  C     . TYR C 2  629  ? 29.662  -3.591  90.294  1.00 78.09  ? 629  TYR C C     1 
ATOM   8532  O  O     . TYR C 2  629  ? 28.632  -3.915  90.892  1.00 70.22  ? 629  TYR C O     1 
ATOM   8533  C  CB    . TYR C 2  629  ? 31.413  -5.370  90.426  1.00 84.67  ? 629  TYR C CB    1 
ATOM   8534  C  CG    . TYR C 2  629  ? 32.903  -5.608  90.277  1.00 97.58  ? 629  TYR C CG    1 
ATOM   8535  C  CD1   . TYR C 2  629  ? 33.780  -5.353  91.328  1.00 89.44  ? 629  TYR C CD1   1 
ATOM   8536  C  CD2   . TYR C 2  629  ? 33.430  -6.106  89.084  1.00 101.14 ? 629  TYR C CD2   1 
ATOM   8537  C  CE1   . TYR C 2  629  ? 35.142  -5.575  91.193  1.00 98.98  ? 629  TYR C CE1   1 
ATOM   8538  C  CE2   . TYR C 2  629  ? 34.791  -6.333  88.941  1.00 98.63  ? 629  TYR C CE2   1 
ATOM   8539  C  CZ    . TYR C 2  629  ? 35.642  -6.065  89.997  1.00 103.90 ? 629  TYR C CZ    1 
ATOM   8540  O  OH    . TYR C 2  629  ? 36.994  -6.287  89.860  1.00 106.57 ? 629  TYR C OH    1 
ATOM   8541  N  N     . ARG C 2  630  ? 29.658  -2.924  89.141  1.00 78.76  ? 630  ARG C N     1 
ATOM   8542  C  CA    . ARG C 2  630  ? 28.424  -2.527  88.479  1.00 69.69  ? 630  ARG C CA    1 
ATOM   8543  C  C     . ARG C 2  630  ? 27.914  -3.653  87.591  1.00 68.57  ? 630  ARG C C     1 
ATOM   8544  O  O     . ARG C 2  630  ? 28.684  -4.285  86.862  1.00 84.47  ? 630  ARG C O     1 
ATOM   8545  C  CB    . ARG C 2  630  ? 28.641  -1.262  87.649  1.00 69.19  ? 630  ARG C CB    1 
ATOM   8546  C  CG    . ARG C 2  630  ? 27.402  -0.791  86.924  1.00 70.58  ? 630  ARG C CG    1 
ATOM   8547  C  CD    . ARG C 2  630  ? 27.676  0.381   85.996  1.00 70.43  ? 630  ARG C CD    1 
ATOM   8548  N  NE    . ARG C 2  630  ? 26.432  0.845   85.385  1.00 74.95  ? 630  ARG C NE    1 
ATOM   8549  C  CZ    . ARG C 2  630  ? 25.876  0.301   84.306  1.00 75.51  ? 630  ARG C CZ    1 
ATOM   8550  N  NH1   . ARG C 2  630  ? 24.739  0.785   83.831  1.00 73.76  ? 630  ARG C NH1   1 
ATOM   8551  N  NH2   . ARG C 2  630  ? 26.458  -0.726  83.698  1.00 77.22  ? 630  ARG C NH2   1 
ATOM   8552  N  N     . SER C 2  631  ? 26.610  -3.902  87.660  1.00 69.87  ? 631  SER C N     1 
ATOM   8553  C  CA    . SER C 2  631  ? 25.960  -4.927  86.860  1.00 71.43  ? 631  SER C CA    1 
ATOM   8554  C  C     . SER C 2  631  ? 25.314  -4.293  85.635  1.00 71.54  ? 631  SER C C     1 
ATOM   8555  O  O     . SER C 2  631  ? 25.302  -3.069  85.472  1.00 72.41  ? 631  SER C O     1 
ATOM   8556  C  CB    . SER C 2  631  ? 24.911  -5.670  87.684  1.00 73.49  ? 631  SER C CB    1 
ATOM   8557  O  OG    . SER C 2  631  ? 23.813  -4.821  87.972  1.00 66.98  ? 631  SER C OG    1 
ATOM   8558  N  N     . ASN C 2  632  ? 24.748  -5.148  84.773  1.00 67.41  ? 632  ASN C N     1 
ATOM   8559  C  CA    . ASN C 2  632  ? 24.081  -4.670  83.561  1.00 69.23  ? 632  ASN C CA    1 
ATOM   8560  C  C     . ASN C 2  632  ? 23.051  -3.590  83.877  1.00 71.49  ? 632  ASN C C     1 
ATOM   8561  O  O     . ASN C 2  632  ? 22.926  -2.603  83.143  1.00 72.59  ? 632  ASN C O     1 
ATOM   8562  C  CB    . ASN C 2  632  ? 23.408  -5.839  82.834  1.00 70.19  ? 632  ASN C CB    1 
ATOM   8563  C  CG    . ASN C 2  632  ? 24.330  -6.544  81.845  1.00 76.68  ? 632  ASN C CG    1 
ATOM   8564  O  OD1   . ASN C 2  632  ? 25.496  -6.171  81.663  1.00 72.68  ? 632  ASN C OD1   1 
ATOM   8565  N  ND2   . ASN C 2  632  ? 23.799  -7.580  81.197  1.00 71.48  ? 632  ASN C ND2   1 
ATOM   8566  N  N     . GLN C 2  633  ? 22.315  -3.755  84.978  1.00 70.77  ? 633  GLN C N     1 
ATOM   8567  C  CA    . GLN C 2  633  ? 21.253  -2.842  85.368  1.00 67.56  ? 633  GLN C CA    1 
ATOM   8568  C  C     . GLN C 2  633  ? 21.712  -1.787  86.365  1.00 70.09  ? 633  GLN C C     1 
ATOM   8569  O  O     . GLN C 2  633  ? 20.876  -1.052  86.897  1.00 70.76  ? 633  GLN C O     1 
ATOM   8570  C  CB    . GLN C 2  633  ? 20.072  -3.620  85.946  1.00 66.93  ? 633  GLN C CB    1 
ATOM   8571  C  CG    . GLN C 2  633  ? 19.253  -4.352  84.907  1.00 67.53  ? 633  GLN C CG    1 
ATOM   8572  C  CD    . GLN C 2  633  ? 20.006  -5.501  84.290  1.00 62.34  ? 633  GLN C CD    1 
ATOM   8573  O  OE1   . GLN C 2  633  ? 20.926  -6.044  84.897  1.00 60.18  ? 633  GLN C OE1   1 
ATOM   8574  N  NE2   . GLN C 2  633  ? 19.627  -5.876  83.072  1.00 61.42  ? 633  GLN C NE2   1 
ATOM   8575  N  N     . GLY C 2  634  ? 23.010  -1.699  86.639  1.00 69.67  ? 634  GLY C N     1 
ATOM   8576  C  CA    . GLY C 2  634  ? 23.507  -0.636  87.488  1.00 67.85  ? 634  GLY C CA    1 
ATOM   8577  C  C     . GLY C 2  634  ? 23.387  -0.892  88.968  1.00 68.91  ? 634  GLY C C     1 
ATOM   8578  O  O     . GLY C 2  634  ? 23.509  0.047   89.762  1.00 69.53  ? 634  GLY C O     1 
ATOM   8579  N  N     . THR C 2  635  ? 23.129  -2.131  89.367  1.00 66.93  ? 635  THR C N     1 
ATOM   8580  C  CA    . THR C 2  635  ? 23.049  -2.494  90.768  1.00 63.05  ? 635  THR C CA    1 
ATOM   8581  C  C     . THR C 2  635  ? 24.397  -3.037  91.218  1.00 62.16  ? 635  THR C C     1 
ATOM   8582  O  O     . THR C 2  635  ? 25.141  -3.625  90.432  1.00 72.84  ? 635  THR C O     1 
ATOM   8583  C  CB    . THR C 2  635  ? 21.941  -3.521  91.009  1.00 62.83  ? 635  THR C CB    1 
ATOM   8584  O  OG1   . THR C 2  635  ? 22.272  -4.772  90.392  1.00 66.71  ? 635  THR C OG1   1 
ATOM   8585  C  CG2   . THR C 2  635  ? 20.642  -3.016  90.428  1.00 62.48  ? 635  THR C CG2   1 
ATOM   8586  N  N     . ALA C 2  636  ? 24.720  -2.807  92.486  1.00 71.43  ? 636  ALA C N     1 
ATOM   8587  C  CA    . ALA C 2  636  ? 26.012  -3.217  93.016  1.00 71.90  ? 636  ALA C CA    1 
ATOM   8588  C  C     . ALA C 2  636  ? 26.086  -4.735  93.146  1.00 74.25  ? 636  ALA C C     1 
ATOM   8589  O  O     . ALA C 2  636  ? 25.205  -5.367  93.736  1.00 75.27  ? 636  ALA C O     1 
ATOM   8590  C  CB    . ALA C 2  636  ? 26.261  -2.552  94.367  1.00 70.79  ? 636  ALA C CB    1 
ATOM   8591  N  N     . LEU C 2  637  ? 27.132  -5.319  92.577  1.00 77.21  ? 637  LEU C N     1 
ATOM   8592  C  CA    . LEU C 2  637  ? 27.434  -6.737  92.730  1.00 74.61  ? 637  LEU C CA    1 
ATOM   8593  C  C     . LEU C 2  637  ? 28.698  -6.837  93.563  1.00 79.59  ? 637  LEU C C     1 
ATOM   8594  O  O     . LEU C 2  637  ? 29.780  -6.478  93.092  1.00 81.47  ? 637  LEU C O     1 
ATOM   8595  C  CB    . LEU C 2  637  ? 27.625  -7.426  91.380  1.00 70.74  ? 637  LEU C CB    1 
ATOM   8596  C  CG    . LEU C 2  637  ? 26.476  -7.427  90.382  1.00 77.05  ? 637  LEU C CG    1 
ATOM   8597  C  CD1   . LEU C 2  637  ? 26.815  -8.328  89.200  1.00 80.65  ? 637  LEU C CD1   1 
ATOM   8598  C  CD2   . LEU C 2  637  ? 25.174  -7.846  91.062  1.00 81.72  ? 637  LEU C CD2   1 
ATOM   8599  N  N     . ASP C 2  638  ? 28.571  -7.313  94.796  1.00 84.36  ? 638  ASP C N     1 
ATOM   8600  C  CA    . ASP C 2  638  ? 29.777  -7.540  95.570  1.00 90.79  ? 638  ASP C CA    1 
ATOM   8601  C  C     . ASP C 2  638  ? 29.552  -8.648  96.583  1.00 87.03  ? 638  ASP C C     1 
ATOM   8602  O  O     . ASP C 2  638  ? 28.420  -9.039  96.879  1.00 86.36  ? 638  ASP C O     1 
ATOM   8603  C  CB    . ASP C 2  638  ? 30.267  -6.263  96.264  1.00 88.43  ? 638  ASP C CB    1 
ATOM   8604  C  CG    . ASP C 2  638  ? 29.387  -5.837  97.397  1.00 83.72  ? 638  ASP C CG    1 
ATOM   8605  O  OD1   . ASP C 2  638  ? 28.176  -6.133  97.352  1.00 93.62  ? 638  ASP C OD1   1 
ATOM   8606  O  OD2   . ASP C 2  638  ? 29.913  -5.192  98.327  1.00 85.81  ? 638  ASP C OD2   1 
ATOM   8607  N  N     . GLN C 2  639  ? 30.668  -9.148  97.101  1.00 84.83  ? 639  GLN C N     1 
ATOM   8608  C  CA    . GLN C 2  639  ? 30.702  -10.267 98.021  1.00 82.99  ? 639  GLN C CA    1 
ATOM   8609  C  C     . GLN C 2  639  ? 31.343  -9.821  99.326  1.00 82.69  ? 639  GLN C C     1 
ATOM   8610  O  O     . GLN C 2  639  ? 32.283  -9.019  99.325  1.00 84.60  ? 639  GLN C O     1 
ATOM   8611  C  CB    . GLN C 2  639  ? 31.483  -11.433 97.411  1.00 83.68  ? 639  GLN C CB    1 
ATOM   8612  C  CG    . GLN C 2  639  ? 31.020  -11.826 96.013  1.00 85.22  ? 639  GLN C CG    1 
ATOM   8613  C  CD    . GLN C 2  639  ? 32.073  -12.607 95.244  1.00 84.35  ? 639  GLN C CD    1 
ATOM   8614  O  OE1   . GLN C 2  639  ? 33.095  -12.053 94.830  1.00 80.08  ? 639  GLN C OE1   1 
ATOM   8615  N  NE2   . GLN C 2  639  ? 31.828  -13.902 95.051  1.00 84.82  ? 639  GLN C NE2   1 
ATOM   8616  N  N     . ARG C 2  640  ? 30.824  -10.337 100.437 1.00 77.91  ? 640  ARG C N     1 
ATOM   8617  C  CA    . ARG C 2  640  ? 31.337  -10.027 101.757 1.00 79.81  ? 640  ARG C CA    1 
ATOM   8618  C  C     . ARG C 2  640  ? 31.785  -11.306 102.449 1.00 82.84  ? 640  ARG C C     1 
ATOM   8619  O  O     . ARG C 2  640  ? 31.092  -12.324 102.368 1.00 85.54  ? 640  ARG C O     1 
ATOM   8620  C  CB    . ARG C 2  640  ? 30.276  -9.329  102.627 1.00 84.54  ? 640  ARG C CB    1 
ATOM   8621  C  CG    . ARG C 2  640  ? 30.041  -7.842  102.333 1.00 83.27  ? 640  ARG C CG    1 
ATOM   8622  C  CD    . ARG C 2  640  ? 29.171  -7.621  101.103 1.00 90.21  ? 640  ARG C CD    1 
ATOM   8623  N  NE    . ARG C 2  640  ? 27.988  -8.475  101.110 1.00 89.99  ? 640  ARG C NE    1 
ATOM   8624  C  CZ    . ARG C 2  640  ? 26.877  -8.205  101.785 1.00 88.11  ? 640  ARG C CZ    1 
ATOM   8625  N  NH1   . ARG C 2  640  ? 25.850  -9.045  101.729 1.00 83.81  ? 640  ARG C NH1   1 
ATOM   8626  N  NH2   . ARG C 2  640  ? 26.795  -7.097  102.513 1.00 91.77  ? 640  ARG C NH2   1 
ATOM   8627  N  N     . PRO C 2  641  ? 32.928  -11.291 103.132 1.00 78.88  ? 641  PRO C N     1 
ATOM   8628  C  CA    . PRO C 2  641  ? 33.385  -12.502 103.832 1.00 75.05  ? 641  PRO C CA    1 
ATOM   8629  C  C     . PRO C 2  641  ? 32.466  -12.844 104.999 1.00 85.45  ? 641  PRO C C     1 
ATOM   8630  O  O     . PRO C 2  641  ? 32.165  -11.996 105.842 1.00 78.15  ? 641  PRO C O     1 
ATOM   8631  C  CB    . PRO C 2  641  ? 34.793  -12.128 104.307 1.00 72.16  ? 641  PRO C CB    1 
ATOM   8632  C  CG    . PRO C 2  641  ? 34.789  -10.632 104.359 1.00 76.31  ? 641  PRO C CG    1 
ATOM   8633  C  CD    . PRO C 2  641  ? 33.874  -10.170 103.267 1.00 73.55  ? 641  PRO C CD    1 
ATOM   8634  N  N     . ARG C 2  642  ? 32.015  -14.100 105.034 1.00 84.22  ? 642  ARG C N     1 
ATOM   8635  C  CA    . ARG C 2  642  ? 31.146  -14.598 106.093 1.00 77.54  ? 642  ARG C CA    1 
ATOM   8636  C  C     . ARG C 2  642  ? 31.861  -15.553 107.041 1.00 86.15  ? 642  ARG C C     1 
ATOM   8637  O  O     . ARG C 2  642  ? 31.214  -16.150 107.911 1.00 87.14  ? 642  ARG C O     1 
ATOM   8638  C  CB    . ARG C 2  642  ? 29.914  -15.282 105.498 1.00 76.82  ? 642  ARG C CB    1 
ATOM   8639  C  CG    . ARG C 2  642  ? 28.932  -14.327 104.857 1.00 79.79  ? 642  ARG C CG    1 
ATOM   8640  C  CD    . ARG C 2  642  ? 28.741  -13.079 105.710 1.00 77.82  ? 642  ARG C CD    1 
ATOM   8641  N  NE    . ARG C 2  642  ? 27.734  -12.183 105.147 1.00 78.87  ? 642  ARG C NE    1 
ATOM   8642  C  CZ    . ARG C 2  642  ? 27.781  -10.857 105.239 1.00 82.02  ? 642  ARG C CZ    1 
ATOM   8643  N  NH1   . ARG C 2  642  ? 28.796  -10.271 105.862 1.00 77.59  ? 642  ARG C NH1   1 
ATOM   8644  N  NH2   . ARG C 2  642  ? 26.822  -10.117 104.694 1.00 78.89  ? 642  ARG C NH2   1 
ATOM   8645  N  N     . VAL C 2  643  ? 33.175  -15.721 106.892 1.00 87.38  ? 643  VAL C N     1 
ATOM   8646  C  CA    . VAL C 2  643  ? 33.949  -16.558 107.801 1.00 83.41  ? 643  VAL C CA    1 
ATOM   8647  C  C     . VAL C 2  643  ? 34.919  -15.679 108.573 1.00 87.17  ? 643  VAL C C     1 
ATOM   8648  O  O     . VAL C 2  643  ? 35.023  -14.474 108.322 1.00 86.84  ? 643  VAL C O     1 
ATOM   8649  C  CB    . VAL C 2  643  ? 34.698  -17.670 107.050 1.00 77.19  ? 643  VAL C CB    1 
ATOM   8650  C  CG1   . VAL C 2  643  ? 33.720  -18.574 106.333 1.00 76.57  ? 643  VAL C CG1   1 
ATOM   8651  C  CG2   . VAL C 2  643  ? 35.683  -17.059 106.073 1.00 90.81  ? 643  VAL C CG2   1 
ATOM   8652  N  N     . VAL C 2  644  ? 35.641  -16.281 109.513 1.00 89.17  ? 644  VAL C N     1 
ATOM   8653  C  CA    . VAL C 2  644  ? 36.569  -15.563 110.368 1.00 92.05  ? 644  VAL C CA    1 
ATOM   8654  C  C     . VAL C 2  644  ? 37.903  -16.296 110.324 1.00 89.83  ? 644  VAL C C     1 
ATOM   8655  O  O     . VAL C 2  644  ? 37.988  -17.452 109.901 1.00 86.29  ? 644  VAL C O     1 
ATOM   8656  C  CB    . VAL C 2  644  ? 36.036  -15.445 111.817 1.00 84.69  ? 644  VAL C CB    1 
ATOM   8657  C  CG1   . VAL C 2  644  ? 36.242  -16.746 112.566 1.00 82.32  ? 644  VAL C CG1   1 
ATOM   8658  C  CG2   . VAL C 2  644  ? 36.671  -14.272 112.544 1.00 83.32  ? 644  VAL C CG2   1 
ATOM   8659  N  N     . VAL C 2  645  ? 38.960  -15.596 110.748 1.00 93.04  ? 645  VAL C N     1 
ATOM   8660  C  CA    . VAL C 2  645  ? 40.294  -16.184 110.727 1.00 94.40  ? 645  VAL C CA    1 
ATOM   8661  C  C     . VAL C 2  645  ? 40.343  -17.367 111.685 1.00 90.37  ? 645  VAL C C     1 
ATOM   8662  O  O     . VAL C 2  645  ? 39.823  -17.309 112.807 1.00 85.00  ? 645  VAL C O     1 
ATOM   8663  C  CB    . VAL C 2  645  ? 41.356  -15.132 111.083 1.00 91.52  ? 645  VAL C CB    1 
ATOM   8664  C  CG1   . VAL C 2  645  ? 42.738  -15.765 111.142 1.00 86.39  ? 645  VAL C CG1   1 
ATOM   8665  C  CG2   . VAL C 2  645  ? 41.335  -14.002 110.070 1.00 91.17  ? 645  VAL C CG2   1 
ATOM   8666  N  N     . GLY C 2  646  ? 40.951  -18.463 111.227 1.00 95.27  ? 646  GLY C N     1 
ATOM   8667  C  CA    . GLY C 2  646  ? 41.053  -19.677 112.008 1.00 94.02  ? 646  GLY C CA    1 
ATOM   8668  C  C     . GLY C 2  646  ? 39.828  -20.566 111.982 1.00 94.24  ? 646  GLY C C     1 
ATOM   8669  O  O     . GLY C 2  646  ? 39.881  -21.683 112.516 1.00 89.74  ? 646  GLY C O     1 
ATOM   8670  N  N     . GLN C 2  647  ? 38.733  -20.118 111.375 1.00 94.89  ? 647  GLN C N     1 
ATOM   8671  C  CA    . GLN C 2  647  ? 37.509  -20.906 111.353 1.00 93.81  ? 647  GLN C CA    1 
ATOM   8672  C  C     . GLN C 2  647  ? 37.708  -22.206 110.583 1.00 95.66  ? 647  GLN C C     1 
ATOM   8673  O  O     . GLN C 2  647  ? 38.273  -22.214 109.485 1.00 101.64 ? 647  GLN C O     1 
ATOM   8674  C  CB    . GLN C 2  647  ? 36.376  -20.082 110.738 1.00 89.73  ? 647  GLN C CB    1 
ATOM   8675  C  CG    . GLN C 2  647  ? 35.129  -20.878 110.400 1.00 89.92  ? 647  GLN C CG    1 
ATOM   8676  C  CD    . GLN C 2  647  ? 33.922  -19.991 110.171 1.00 88.00  ? 647  GLN C CD    1 
ATOM   8677  O  OE1   . GLN C 2  647  ? 33.901  -18.833 110.598 1.00 83.79  ? 647  GLN C OE1   1 
ATOM   8678  N  NE2   . GLN C 2  647  ? 32.908  -20.528 109.496 1.00 77.73  ? 647  GLN C NE2   1 
ATOM   8679  N  N     . ARG C 2  648  ? 37.250  -23.308 111.172 1.00 92.94  ? 648  ARG C N     1 
ATOM   8680  C  CA    . ARG C 2  648  ? 37.285  -24.607 110.512 1.00 101.10 ? 648  ARG C CA    1 
ATOM   8681  C  C     . ARG C 2  648  ? 36.074  -24.746 109.596 1.00 100.82 ? 648  ARG C C     1 
ATOM   8682  O  O     . ARG C 2  648  ? 34.940  -24.497 110.016 1.00 104.87 ? 648  ARG C O     1 
ATOM   8683  C  CB    . ARG C 2  648  ? 37.304  -25.728 111.553 1.00 102.63 ? 648  ARG C CB    1 
ATOM   8684  C  CG    . ARG C 2  648  ? 37.692  -27.099 111.008 1.00 111.40 ? 648  ARG C CG    1 
ATOM   8685  C  CD    . ARG C 2  648  ? 39.154  -27.131 110.573 1.00 115.92 ? 648  ARG C CD    1 
ATOM   8686  N  NE    . ARG C 2  648  ? 39.501  -28.384 109.910 1.00 120.08 ? 648  ARG C NE    1 
ATOM   8687  C  CZ    . ARG C 2  648  ? 40.630  -28.589 109.238 1.00 122.54 ? 648  ARG C CZ    1 
ATOM   8688  N  NH1   . ARG C 2  648  ? 40.858  -29.764 108.665 1.00 123.44 ? 648  ARG C NH1   1 
ATOM   8689  N  NH2   . ARG C 2  648  ? 41.531  -27.619 109.135 1.00 113.97 ? 648  ARG C NH2   1 
ATOM   8690  N  N     . VAL C 2  649  ? 36.309  -25.134 108.343 1.00 99.27  ? 649  VAL C N     1 
ATOM   8691  C  CA    . VAL C 2  649  ? 35.250  -25.227 107.344 1.00 100.95 ? 649  VAL C CA    1 
ATOM   8692  C  C     . VAL C 2  649  ? 35.291  -26.597 106.679 1.00 104.65 ? 649  VAL C C     1 
ATOM   8693  O  O     . VAL C 2  649  ? 36.368  -27.157 106.448 1.00 110.71 ? 649  VAL C O     1 
ATOM   8694  C  CB    . VAL C 2  649  ? 35.356  -24.104 106.287 1.00 99.13  ? 649  VAL C CB    1 
ATOM   8695  C  CG1   . VAL C 2  649  ? 35.155  -22.739 106.934 1.00 99.69  ? 649  VAL C CG1   1 
ATOM   8696  C  CG2   . VAL C 2  649  ? 36.690  -24.159 105.567 1.00 99.37  ? 649  VAL C CG2   1 
ATOM   8697  N  N     . ARG C 2  650  ? 34.111  -27.138 106.381 1.00 103.98 ? 650  ARG C N     1 
ATOM   8698  C  CA    . ARG C 2  650  ? 33.979  -28.364 105.614 1.00 103.56 ? 650  ARG C CA    1 
ATOM   8699  C  C     . ARG C 2  650  ? 33.660  -28.028 104.161 1.00 106.77 ? 650  ARG C C     1 
ATOM   8700  O  O     . ARG C 2  650  ? 33.438  -26.870 103.799 1.00 104.58 ? 650  ARG C O     1 
ATOM   8701  C  CB    . ARG C 2  650  ? 32.902  -29.270 106.211 1.00 105.82 ? 650  ARG C CB    1 
ATOM   8702  C  CG    . ARG C 2  650  ? 33.231  -29.809 107.587 1.00 115.58 ? 650  ARG C CG    1 
ATOM   8703  C  CD    . ARG C 2  650  ? 32.190  -30.818 108.035 1.00 124.17 ? 650  ARG C CD    1 
ATOM   8704  N  NE    . ARG C 2  650  ? 32.410  -31.265 109.408 1.00 133.29 ? 650  ARG C NE    1 
ATOM   8705  C  CZ    . ARG C 2  650  ? 31.822  -30.726 110.471 1.00 127.51 ? 650  ARG C CZ    1 
ATOM   8706  N  NH1   . ARG C 2  650  ? 30.975  -29.717 110.321 1.00 128.81 ? 650  ARG C NH1   1 
ATOM   8707  N  NH2   . ARG C 2  650  ? 32.079  -31.197 111.685 1.00 121.80 ? 650  ARG C NH2   1 
ATOM   8708  N  N     . LYS C 2  651  ? 33.632  -29.061 103.322 1.00 112.55 ? 651  LYS C N     1 
ATOM   8709  C  CA    . LYS C 2  651  ? 33.406  -28.875 101.893 1.00 106.37 ? 651  LYS C CA    1 
ATOM   8710  C  C     . LYS C 2  651  ? 31.973  -28.421 101.642 1.00 103.56 ? 651  LYS C C     1 
ATOM   8711  O  O     . LYS C 2  651  ? 31.019  -29.051 102.109 1.00 105.54 ? 651  LYS C O     1 
ATOM   8712  C  CB    . LYS C 2  651  ? 33.702  -30.176 101.146 1.00 103.33 ? 651  LYS C CB    1 
ATOM   8713  C  CG    . LYS C 2  651  ? 33.498  -30.113 99.647  1.00 107.42 ? 651  LYS C CG    1 
ATOM   8714  C  CD    . LYS C 2  651  ? 33.662  -31.490 99.020  1.00 107.68 ? 651  LYS C CD    1 
ATOM   8715  C  CE    . LYS C 2  651  ? 33.421  -31.458 97.517  1.00 110.40 ? 651  LYS C CE    1 
ATOM   8716  N  NZ    . LYS C 2  651  ? 34.465  -30.686 96.783  1.00 111.85 ? 651  LYS C NZ    1 
ATOM   8717  N  N     . GLY C 2  652  ? 31.823  -27.315 100.917 1.00 98.20  ? 652  GLY C N     1 
ATOM   8718  C  CA    . GLY C 2  652  ? 30.517  -26.761 100.631 1.00 96.30  ? 652  GLY C CA    1 
ATOM   8719  C  C     . GLY C 2  652  ? 30.012  -25.747 101.632 1.00 96.26  ? 652  GLY C C     1 
ATOM   8720  O  O     . GLY C 2  652  ? 28.837  -25.365 101.563 1.00 94.58  ? 652  GLY C O     1 
ATOM   8721  N  N     . ASP C 2  653  ? 30.852  -25.306 102.561 1.00 99.47  ? 653  ASP C N     1 
ATOM   8722  C  CA    . ASP C 2  653  ? 30.455  -24.328 103.561 1.00 94.11  ? 653  ASP C CA    1 
ATOM   8723  C  C     . ASP C 2  653  ? 30.625  -22.909 103.026 1.00 89.95  ? 653  ASP C C     1 
ATOM   8724  O  O     . ASP C 2  653  ? 31.505  -22.626 102.207 1.00 92.20  ? 653  ASP C O     1 
ATOM   8725  C  CB    . ASP C 2  653  ? 31.266  -24.515 104.846 1.00 96.29  ? 653  ASP C CB    1 
ATOM   8726  C  CG    . ASP C 2  653  ? 30.641  -25.537 105.793 1.00 101.50 ? 653  ASP C CG    1 
ATOM   8727  O  OD1   . ASP C 2  653  ? 29.892  -26.420 105.317 1.00 100.73 ? 653  ASP C OD1   1 
ATOM   8728  O  OD2   . ASP C 2  653  ? 30.887  -25.443 107.018 1.00 93.55  ? 653  ASP C OD2   1 
ATOM   8729  N  N     . LEU C 2  654  ? 29.766  -22.015 103.507 1.00 88.52  ? 654  LEU C N     1 
ATOM   8730  C  CA    . LEU C 2  654  ? 29.734  -20.647 103.011 1.00 85.44  ? 654  LEU C CA    1 
ATOM   8731  C  C     . LEU C 2  654  ? 31.016  -19.906 103.365 1.00 86.82  ? 654  LEU C C     1 
ATOM   8732  O  O     . LEU C 2  654  ? 31.429  -19.877 104.528 1.00 82.82  ? 654  LEU C O     1 
ATOM   8733  C  CB    . LEU C 2  654  ? 28.530  -19.912 103.594 1.00 84.46  ? 654  LEU C CB    1 
ATOM   8734  C  CG    . LEU C 2  654  ? 28.417  -18.429 103.252 1.00 84.74  ? 654  LEU C CG    1 
ATOM   8735  C  CD1   . LEU C 2  654  ? 27.941  -18.252 101.816 1.00 83.73  ? 654  LEU C CD1   1 
ATOM   8736  C  CD2   . LEU C 2  654  ? 27.487  -17.731 104.229 1.00 84.48  ? 654  LEU C CD2   1 
ATOM   8737  N  N     . LEU C 2  655  ? 31.641  -19.293 102.360 1.00 90.21  ? 655  LEU C N     1 
ATOM   8738  C  CA    . LEU C 2  655  ? 32.809  -18.448 102.582 1.00 89.52  ? 655  LEU C CA    1 
ATOM   8739  C  C     . LEU C 2  655  ? 32.486  -16.961 102.486 1.00 83.37  ? 655  LEU C C     1 
ATOM   8740  O  O     . LEU C 2  655  ? 32.805  -16.199 103.404 1.00 80.15  ? 655  LEU C O     1 
ATOM   8741  C  CB    . LEU C 2  655  ? 33.914  -18.818 101.593 1.00 81.02  ? 655  LEU C CB    1 
ATOM   8742  C  CG    . LEU C 2  655  ? 34.671  -20.084 101.967 1.00 83.18  ? 655  LEU C CG    1 
ATOM   8743  C  CD1   . LEU C 2  655  ? 35.598  -20.509 100.849 1.00 92.22  ? 655  LEU C CD1   1 
ATOM   8744  C  CD2   . LEU C 2  655  ? 35.467  -19.846 103.242 1.00 85.94  ? 655  LEU C CD2   1 
ATOM   8745  N  N     . ALA C 2  656  ? 31.847  -16.530 101.400 1.00 86.67  ? 656  ALA C N     1 
ATOM   8746  C  CA    . ALA C 2  656  ? 31.427  -15.146 101.247 1.00 79.81  ? 656  ALA C CA    1 
ATOM   8747  C  C     . ALA C 2  656  ? 29.993  -15.097 100.745 1.00 80.70  ? 656  ALA C C     1 
ATOM   8748  O  O     . ALA C 2  656  ? 29.534  -15.996 100.034 1.00 79.12  ? 656  ALA C O     1 
ATOM   8749  C  CB    . ALA C 2  656  ? 32.342  -14.376 100.288 1.00 80.44  ? 656  ALA C CB    1 
ATOM   8750  N  N     . ASP C 2  657  ? 29.288  -14.037 101.129 1.00 83.07  ? 657  ASP C N     1 
ATOM   8751  C  CA    . ASP C 2  657  ? 27.908  -13.809 100.718 1.00 81.13  ? 657  ASP C CA    1 
ATOM   8752  C  C     . ASP C 2  657  ? 27.902  -12.904 99.496  1.00 79.71  ? 657  ASP C C     1 
ATOM   8753  O  O     . ASP C 2  657  ? 28.451  -11.798 99.541  1.00 78.16  ? 657  ASP C O     1 
ATOM   8754  C  CB    . ASP C 2  657  ? 27.097  -13.165 101.843 1.00 80.74  ? 657  ASP C CB    1 
ATOM   8755  C  CG    . ASP C 2  657  ? 26.091  -14.110 102.466 1.00 78.86  ? 657  ASP C CG    1 
ATOM   8756  O  OD1   . ASP C 2  657  ? 25.538  -14.973 101.750 1.00 76.58  ? 657  ASP C OD1   1 
ATOM   8757  O  OD2   . ASP C 2  657  ? 25.846  -13.973 103.685 1.00 77.57  ? 657  ASP C OD2   1 
ATOM   8758  N  N     . GLY C 2  658  ? 27.268  -13.359 98.419  1.00 80.62  ? 658  GLY C N     1 
ATOM   8759  C  CA    . GLY C 2  658  ? 27.097  -12.536 97.247  1.00 81.40  ? 658  GLY C CA    1 
ATOM   8760  C  C     . GLY C 2  658  ? 26.088  -11.430 97.491  1.00 81.64  ? 658  GLY C C     1 
ATOM   8761  O  O     . GLY C 2  658  ? 25.643  -11.199 98.621  1.00 79.96  ? 658  GLY C O     1 
ATOM   8762  N  N     . PRO C 2  659  ? 25.716  -10.715 96.433  1.00 86.76  ? 659  PRO C N     1 
ATOM   8763  C  CA    . PRO C 2  659  ? 24.657  -9.711  96.569  1.00 76.84  ? 659  PRO C CA    1 
ATOM   8764  C  C     . PRO C 2  659  ? 23.314  -10.371 96.845  1.00 70.98  ? 659  PRO C C     1 
ATOM   8765  O  O     . PRO C 2  659  ? 23.005  -11.450 96.330  1.00 67.48  ? 659  PRO C O     1 
ATOM   8766  C  CB    . PRO C 2  659  ? 24.659  -9.008  95.206  1.00 80.74  ? 659  PRO C CB    1 
ATOM   8767  C  CG    . PRO C 2  659  ? 25.223  -10.031 94.258  1.00 65.80  ? 659  PRO C CG    1 
ATOM   8768  C  CD    . PRO C 2  659  ? 26.250  -10.782 95.060  1.00 75.00  ? 659  PRO C CD    1 
ATOM   8769  N  N     . ALA C 2  660  ? 22.507  -9.698  97.670  1.00 72.16  ? 660  ALA C N     1 
ATOM   8770  C  CA    . ALA C 2  660  ? 21.166  -10.164 98.025  1.00 60.38  ? 660  ALA C CA    1 
ATOM   8771  C  C     . ALA C 2  660  ? 21.223  -11.580 98.586  1.00 64.39  ? 660  ALA C C     1 
ATOM   8772  O  O     . ALA C 2  660  ? 20.475  -12.478 98.186  1.00 59.77  ? 660  ALA C O     1 
ATOM   8773  C  CB    . ALA C 2  660  ? 20.221  -10.088 96.830  1.00 59.41  ? 660  ALA C CB    1 
ATOM   8774  N  N     . SER C 2  661  ? 22.148  -11.777 99.515  1.00 66.65  ? 661  SER C N     1 
ATOM   8775  C  CA    . SER C 2  661  ? 22.352  -13.075 100.131 1.00 66.78  ? 661  SER C CA    1 
ATOM   8776  C  C     . SER C 2  661  ? 22.662  -12.859 101.598 1.00 70.64  ? 661  SER C C     1 
ATOM   8777  O  O     . SER C 2  661  ? 23.526  -12.046 101.940 1.00 76.34  ? 661  SER C O     1 
ATOM   8778  C  CB    . SER C 2  661  ? 23.491  -13.849 99.455  1.00 73.96  ? 661  SER C CB    1 
ATOM   8779  O  OG    . SER C 2  661  ? 23.573  -15.177 99.955  1.00 72.03  ? 661  SER C OG    1 
ATOM   8780  N  N     . GLU C 2  662  ? 21.943  -13.574 102.457 1.00 66.23  ? 662  GLU C N     1 
ATOM   8781  C  CA    . GLU C 2  662  ? 22.145  -13.512 103.900 1.00 71.72  ? 662  GLU C CA    1 
ATOM   8782  C  C     . GLU C 2  662  ? 22.509  -14.911 104.376 1.00 77.14  ? 662  GLU C C     1 
ATOM   8783  O  O     . GLU C 2  662  ? 21.659  -15.810 104.380 1.00 77.05  ? 662  GLU C O     1 
ATOM   8784  C  CB    . GLU C 2  662  ? 20.897  -12.994 104.613 1.00 75.17  ? 662  GLU C CB    1 
ATOM   8785  C  CG    . GLU C 2  662  ? 21.027  -12.896 106.124 1.00 75.89  ? 662  GLU C CG    1 
ATOM   8786  C  CD    . GLU C 2  662  ? 19.721  -12.527 106.794 1.00 71.91  ? 662  GLU C CD    1 
ATOM   8787  O  OE1   . GLU C 2  662  ? 18.686  -13.141 106.463 1.00 72.56  ? 662  GLU C OE1   1 
ATOM   8788  O  OE2   . GLU C 2  662  ? 19.730  -11.616 107.643 1.00 73.02  ? 662  GLU C OE2   1 
ATOM   8789  N  N     . ASN C 2  663  ? 23.774  -15.091 104.758 1.00 78.85  ? 663  ASN C N     1 
ATOM   8790  C  CA    . ASN C 2  663  ? 24.279  -16.366 105.263 1.00 80.76  ? 663  ASN C CA    1 
ATOM   8791  C  C     . ASN C 2  663  ? 23.952  -17.513 104.306 1.00 81.39  ? 663  ASN C C     1 
ATOM   8792  O  O     . ASN C 2  663  ? 23.528  -18.595 104.719 1.00 82.51  ? 663  ASN C O     1 
ATOM   8793  C  CB    . ASN C 2  663  ? 23.740  -16.641 106.670 1.00 70.31  ? 663  ASN C CB    1 
ATOM   8794  C  CG    . ASN C 2  663  ? 24.086  -15.529 107.653 1.00 75.88  ? 663  ASN C CG    1 
ATOM   8795  O  OD1   . ASN C 2  663  ? 25.140  -14.894 107.546 1.00 76.35  ? 663  ASN C OD1   1 
ATOM   8796  N  ND2   . ASN C 2  663  ? 23.197  -15.285 108.613 1.00 86.54  ? 663  ASN C ND2   1 
ATOM   8797  N  N     . GLY C 2  664  ? 24.146  -17.266 103.006 1.00 74.59  ? 664  GLY C N     1 
ATOM   8798  C  CA    . GLY C 2  664  ? 23.876  -18.255 101.981 1.00 68.60  ? 664  GLY C CA    1 
ATOM   8799  C  C     . GLY C 2  664  ? 22.422  -18.417 101.589 1.00 73.61  ? 664  GLY C C     1 
ATOM   8800  O  O     . GLY C 2  664  ? 22.121  -19.286 100.760 1.00 75.35  ? 664  GLY C O     1 
ATOM   8801  N  N     . PHE C 2  665  ? 21.510  -17.625 102.161 1.00 76.88  ? 665  PHE C N     1 
ATOM   8802  C  CA    . PHE C 2  665  ? 20.094  -17.637 101.810 1.00 67.99  ? 665  PHE C CA    1 
ATOM   8803  C  C     . PHE C 2  665  ? 19.753  -16.448 100.916 1.00 68.06  ? 665  PHE C C     1 
ATOM   8804  O  O     . PHE C 2  665  ? 20.321  -15.363 101.060 1.00 68.01  ? 665  PHE C O     1 
ATOM   8805  C  CB    . PHE C 2  665  ? 19.217  -17.579 103.061 1.00 71.89  ? 665  PHE C CB    1 
ATOM   8806  C  CG    . PHE C 2  665  ? 19.245  -18.822 103.909 1.00 74.04  ? 665  PHE C CG    1 
ATOM   8807  C  CD1   . PHE C 2  665  ? 20.277  -19.047 104.808 1.00 75.70  ? 665  PHE C CD1   1 
ATOM   8808  C  CD2   . PHE C 2  665  ? 18.208  -19.742 103.842 1.00 69.74  ? 665  PHE C CD2   1 
ATOM   8809  C  CE1   . PHE C 2  665  ? 20.285  -20.180 105.608 1.00 77.72  ? 665  PHE C CE1   1 
ATOM   8810  C  CE2   . PHE C 2  665  ? 18.211  -20.877 104.639 1.00 71.88  ? 665  PHE C CE2   1 
ATOM   8811  C  CZ    . PHE C 2  665  ? 19.250  -21.094 105.523 1.00 77.62  ? 665  PHE C CZ    1 
ATOM   8812  N  N     . LEU C 2  666  ? 18.790  -16.655 100.015 1.00 64.27  ? 666  LEU C N     1 
ATOM   8813  C  CA    . LEU C 2  666  ? 18.407  -15.642 99.033  1.00 63.33  ? 666  LEU C CA    1 
ATOM   8814  C  C     . LEU C 2  666  ? 17.732  -14.458 99.723  1.00 64.61  ? 666  LEU C C     1 
ATOM   8815  O  O     . LEU C 2  666  ? 16.663  -14.622 100.316 1.00 65.56  ? 666  LEU C O     1 
ATOM   8816  C  CB    . LEU C 2  666  ? 17.460  -16.271 98.015  1.00 59.02  ? 666  LEU C CB    1 
ATOM   8817  C  CG    . LEU C 2  666  ? 17.365  -15.710 96.596  1.00 68.22  ? 666  LEU C CG    1 
ATOM   8818  C  CD1   . LEU C 2  666  ? 15.897  -15.527 96.200  1.00 50.71  ? 666  LEU C CD1   1 
ATOM   8819  C  CD2   . LEU C 2  666  ? 18.175  -14.417 96.405  1.00 58.90  ? 666  LEU C CD2   1 
ATOM   8820  N  N     . ALA C 2  667  ? 18.316  -13.261 99.618  1.00 62.93  ? 667  ALA C N     1 
ATOM   8821  C  CA    . ALA C 2  667  ? 17.835  -12.109 100.378 1.00 54.01  ? 667  ALA C CA    1 
ATOM   8822  C  C     . ALA C 2  667  ? 17.403  -10.983 99.444  1.00 57.43  ? 667  ALA C C     1 
ATOM   8823  O  O     . ALA C 2  667  ? 18.135  -10.007 99.247  1.00 53.02  ? 667  ALA C O     1 
ATOM   8824  C  CB    . ALA C 2  667  ? 18.901  -11.652 101.290 1.00 62.21  ? 667  ALA C CB    1 
ATOM   8825  N  N     . LEU C 2  668  ? 16.161  -11.057 98.980  1.00 59.92  ? 668  LEU C N     1 
ATOM   8826  C  CA    . LEU C 2  668  ? 15.657  -10.118 97.992  1.00 58.35  ? 668  LEU C CA    1 
ATOM   8827  C  C     . LEU C 2  668  ? 15.083  -8.848  98.600  1.00 63.43  ? 668  LEU C C     1 
ATOM   8828  O  O     . LEU C 2  668  ? 14.723  -7.937  97.848  1.00 71.51  ? 668  LEU C O     1 
ATOM   8829  C  CB    . LEU C 2  668  ? 14.591  -10.793 97.133  1.00 54.86  ? 668  LEU C CB    1 
ATOM   8830  C  CG    . LEU C 2  668  ? 15.112  -11.880 96.201  1.00 58.88  ? 668  LEU C CG    1 
ATOM   8831  C  CD1   . LEU C 2  668  ? 14.025  -12.289 95.209  1.00 57.40  ? 668  LEU C CD1   1 
ATOM   8832  C  CD2   . LEU C 2  668  ? 16.362  -11.396 95.483  1.00 61.28  ? 668  LEU C CD2   1 
ATOM   8833  N  N     . GLY C 2  669  ? 14.978  -8.760  99.921  1.00 58.11  ? 669  GLY C N     1 
ATOM   8834  C  CA    . GLY C 2  669  ? 14.355  -7.607  100.536 1.00 58.14  ? 669  GLY C CA    1 
ATOM   8835  C  C     . GLY C 2  669  ? 14.536  -7.581  102.037 1.00 59.58  ? 669  GLY C C     1 
ATOM   8836  O  O     . GLY C 2  669  ? 15.567  -8.020  102.559 1.00 59.52  ? 669  GLY C O     1 
ATOM   8837  N  N     . GLN C 2  670  ? 13.532  -7.067  102.743 1.00 57.09  ? 670  GLN C N     1 
ATOM   8838  C  CA    . GLN C 2  670  ? 13.586  -6.960  104.192 1.00 65.43  ? 670  GLN C CA    1 
ATOM   8839  C  C     . GLN C 2  670  ? 12.294  -7.462  104.829 1.00 63.39  ? 670  GLN C C     1 
ATOM   8840  O  O     . GLN C 2  670  ? 11.214  -7.410  104.228 1.00 62.51  ? 670  GLN C O     1 
ATOM   8841  C  CB    . GLN C 2  670  ? 13.874  -5.516  104.627 1.00 58.87  ? 670  GLN C CB    1 
ATOM   8842  C  CG    . GLN C 2  670  ? 15.325  -5.302  105.057 1.00 62.59  ? 670  GLN C CG    1 
ATOM   8843  C  CD    . GLN C 2  670  ? 15.955  -4.092  104.403 1.00 70.54  ? 670  GLN C CD    1 
ATOM   8844  O  OE1   . GLN C 2  670  ? 15.327  -3.414  103.586 1.00 72.83  ? 670  GLN C OE1   1 
ATOM   8845  N  NE2   . GLN C 2  670  ? 17.204  -3.813  104.754 1.00 73.06  ? 670  GLN C NE2   1 
ATOM   8846  N  N     . ASN C 2  671  ? 12.431  -7.979  106.050 1.00 56.61  ? 671  ASN C N     1 
ATOM   8847  C  CA    . ASN C 2  671  ? 11.294  -8.369  106.875 1.00 60.90  ? 671  ASN C CA    1 
ATOM   8848  C  C     . ASN C 2  671  ? 10.859  -7.147  107.672 1.00 58.54  ? 671  ASN C C     1 
ATOM   8849  O  O     . ASN C 2  671  ? 11.610  -6.651  108.519 1.00 62.04  ? 671  ASN C O     1 
ATOM   8850  C  CB    . ASN C 2  671  ? 11.668  -9.518  107.804 1.00 58.77  ? 671  ASN C CB    1 
ATOM   8851  C  CG    . ASN C 2  671  ? 12.430  -10.608 107.093 1.00 60.46  ? 671  ASN C CG    1 
ATOM   8852  O  OD1   . ASN C 2  671  ? 11.869  -11.346 106.281 1.00 57.09  ? 671  ASN C OD1   1 
ATOM   8853  N  ND2   . ASN C 2  671  ? 13.715  -10.736 107.412 1.00 63.62  ? 671  ASN C ND2   1 
ATOM   8854  N  N     . VAL C 2  672  ? 9.656   -6.657  107.402 1.00 54.89  ? 672  VAL C N     1 
ATOM   8855  C  CA    . VAL C 2  672  ? 9.150   -5.470  108.079 1.00 63.94  ? 672  VAL C CA    1 
ATOM   8856  C  C     . VAL C 2  672  ? 7.896   -5.815  108.873 1.00 65.01  ? 672  VAL C C     1 
ATOM   8857  O  O     . VAL C 2  672  ? 7.140   -6.733  108.531 1.00 61.46  ? 672  VAL C O     1 
ATOM   8858  C  CB    . VAL C 2  672  ? 8.870   -4.327  107.084 1.00 59.78  ? 672  VAL C CB    1 
ATOM   8859  C  CG1   . VAL C 2  672  ? 10.168  -3.700  106.622 1.00 52.42  ? 672  VAL C CG1   1 
ATOM   8860  C  CG2   . VAL C 2  672  ? 8.089   -4.853  105.916 1.00 52.50  ? 672  VAL C CG2   1 
ATOM   8861  N  N     . LEU C 2  673  ? 7.688   -5.056  109.947 1.00 66.90  ? 673  LEU C N     1 
ATOM   8862  C  CA    . LEU C 2  673  ? 6.513   -5.205  110.795 1.00 57.24  ? 673  LEU C CA    1 
ATOM   8863  C  C     . LEU C 2  673  ? 5.355   -4.417  110.193 1.00 57.70  ? 673  LEU C C     1 
ATOM   8864  O  O     . LEU C 2  673  ? 5.450   -3.198  109.993 1.00 64.93  ? 673  LEU C O     1 
ATOM   8865  C  CB    . LEU C 2  673  ? 6.811   -4.720  112.207 1.00 57.39  ? 673  LEU C CB    1 
ATOM   8866  C  CG    . LEU C 2  673  ? 5.724   -5.073  113.220 1.00 69.32  ? 673  LEU C CG    1 
ATOM   8867  C  CD1   . LEU C 2  673  ? 5.542   -6.587  113.288 1.00 63.75  ? 673  LEU C CD1   1 
ATOM   8868  C  CD2   . LEU C 2  673  ? 6.079   -4.498  114.585 1.00 66.27  ? 673  LEU C CD2   1 
ATOM   8869  N  N     . VAL C 2  674  ? 4.257   -5.105  109.922 1.00 54.43  ? 674  VAL C N     1 
ATOM   8870  C  CA    . VAL C 2  674  ? 3.204   -4.616  109.050 1.00 55.41  ? 674  VAL C CA    1 
ATOM   8871  C  C     . VAL C 2  674  ? 1.902   -4.549  109.836 1.00 64.29  ? 674  VAL C C     1 
ATOM   8872  O  O     . VAL C 2  674  ? 1.651   -5.383  110.719 1.00 60.66  ? 674  VAL C O     1 
ATOM   8873  C  CB    . VAL C 2  674  ? 3.070   -5.527  107.813 1.00 52.96  ? 674  VAL C CB    1 
ATOM   8874  C  CG1   . VAL C 2  674  ? 1.662   -6.058  107.663 1.00 53.12  ? 674  VAL C CG1   1 
ATOM   8875  C  CG2   . VAL C 2  674  ? 3.505   -4.775  106.565 1.00 68.24  ? 674  VAL C CG2   1 
ATOM   8876  N  N     . ALA C 2  675  ? 1.100   -3.526  109.537 1.00 64.74  ? 675  ALA C N     1 
ATOM   8877  C  CA    . ALA C 2  675  ? -0.296  -3.445  109.958 1.00 56.53  ? 675  ALA C CA    1 
ATOM   8878  C  C     . ALA C 2  675  ? -1.175  -3.376  108.716 1.00 60.39  ? 675  ALA C C     1 
ATOM   8879  O  O     . ALA C 2  675  ? -0.870  -2.631  107.773 1.00 58.87  ? 675  ALA C O     1 
ATOM   8880  C  CB    . ALA C 2  675  ? -0.551  -2.232  110.855 1.00 58.25  ? 675  ALA C CB    1 
ATOM   8881  N  N     . ILE C 2  676  ? -2.252  -4.156  108.706 1.00 55.97  ? 676  ILE C N     1 
ATOM   8882  C  CA    . ILE C 2  676  ? -3.182  -4.187  107.583 1.00 55.17  ? 676  ILE C CA    1 
ATOM   8883  C  C     . ILE C 2  676  ? -4.414  -3.395  107.998 1.00 56.26  ? 676  ILE C C     1 
ATOM   8884  O  O     . ILE C 2  676  ? -5.324  -3.928  108.633 1.00 59.27  ? 676  ILE C O     1 
ATOM   8885  C  CB    . ILE C 2  676  ? -3.537  -5.617  107.180 1.00 50.61  ? 676  ILE C CB    1 
ATOM   8886  C  CG1   . ILE C 2  676  ? -2.259  -6.424  106.986 1.00 50.67  ? 676  ILE C CG1   1 
ATOM   8887  C  CG2   . ILE C 2  676  ? -4.398  -5.616  105.918 1.00 50.29  ? 676  ILE C CG2   1 
ATOM   8888  C  CD1   . ILE C 2  676  ? -2.485  -7.766  106.371 1.00 52.08  ? 676  ILE C CD1   1 
ATOM   8889  N  N     . MET C 2  677  ? -4.449  -2.122  107.620 1.00 54.95  ? 677  MET C N     1 
ATOM   8890  C  CA    . MET C 2  677  ? -5.520  -1.207  107.986 1.00 53.57  ? 677  MET C CA    1 
ATOM   8891  C  C     . MET C 2  677  ? -5.466  -0.025  107.038 1.00 57.69  ? 677  MET C C     1 
ATOM   8892  O  O     . MET C 2  677  ? -4.397  0.265   106.486 1.00 54.85  ? 677  MET C O     1 
ATOM   8893  C  CB    . MET C 2  677  ? -5.363  -0.731  109.436 1.00 56.73  ? 677  MET C CB    1 
ATOM   8894  C  CG    . MET C 2  677  ? -3.972  -0.212  109.745 1.00 59.14  ? 677  MET C CG    1 
ATOM   8895  S  SD    . MET C 2  677  ? -3.829  0.666   111.315 1.00 61.94  ? 677  MET C SD    1 
ATOM   8896  C  CE    . MET C 2  677  ? -5.073  1.936   111.093 1.00 57.99  ? 677  MET C CE    1 
ATOM   8897  N  N     . PRO C 2  678  ? -6.579  0.670   106.819 1.00 51.93  ? 678  PRO C N     1 
ATOM   8898  C  CA    . PRO C 2  678  ? -6.521  1.903   106.029 1.00 49.80  ? 678  PRO C CA    1 
ATOM   8899  C  C     . PRO C 2  678  ? -5.762  2.949   106.815 1.00 52.43  ? 678  PRO C C     1 
ATOM   8900  O  O     . PRO C 2  678  ? -5.554  2.810   108.018 1.00 63.37  ? 678  PRO C O     1 
ATOM   8901  C  CB    . PRO C 2  678  ? -7.987  2.298   105.845 1.00 50.58  ? 678  PRO C CB    1 
ATOM   8902  C  CG    . PRO C 2  678  ? -8.793  1.116   106.316 1.00 45.09  ? 678  PRO C CG    1 
ATOM   8903  C  CD    . PRO C 2  678  ? -7.942  0.362   107.275 1.00 45.71  ? 678  PRO C CD    1 
ATOM   8904  N  N     . PHE C 2  679  ? -5.315  3.995   106.133 1.00 54.35  ? 679  PHE C N     1 
ATOM   8905  C  CA    . PHE C 2  679  ? -4.667  5.058   106.904 1.00 53.04  ? 679  PHE C CA    1 
ATOM   8906  C  C     . PHE C 2  679  ? -4.847  6.398   106.181 1.00 59.32  ? 679  PHE C C     1 
ATOM   8907  O  O     . PHE C 2  679  ? -4.002  6.822   105.386 1.00 59.16  ? 679  PHE C O     1 
ATOM   8908  C  CB    . PHE C 2  679  ? -3.203  4.758   107.168 1.00 49.29  ? 679  PHE C CB    1 
ATOM   8909  C  CG    . PHE C 2  679  ? -2.607  5.626   108.224 1.00 58.28  ? 679  PHE C CG    1 
ATOM   8910  C  CD1   . PHE C 2  679  ? -2.687  5.275   109.565 1.00 60.84  ? 679  PHE C CD1   1 
ATOM   8911  C  CD2   . PHE C 2  679  ? -1.976  6.805   107.886 1.00 61.72  ? 679  PHE C CD2   1 
ATOM   8912  C  CE1   . PHE C 2  679  ? -2.125  6.084   110.546 1.00 54.27  ? 679  PHE C CE1   1 
ATOM   8913  C  CE2   . PHE C 2  679  ? -1.417  7.615   108.858 1.00 61.03  ? 679  PHE C CE2   1 
ATOM   8914  C  CZ    . PHE C 2  679  ? -1.491  7.255   110.190 1.00 51.19  ? 679  PHE C CZ    1 
ATOM   8915  N  N     . ASP C 2  680  ? -5.933  7.087   106.532 1.00 62.46  ? 680  ASP C N     1 
ATOM   8916  C  CA    . ASP C 2  680  ? -6.180  8.482   106.145 1.00 63.15  ? 680  ASP C CA    1 
ATOM   8917  C  C     . ASP C 2  680  ? -6.004  8.693   104.645 1.00 58.03  ? 680  ASP C C     1 
ATOM   8918  O  O     . ASP C 2  680  ? -5.621  9.771   104.187 1.00 59.19  ? 680  ASP C O     1 
ATOM   8919  C  CB    . ASP C 2  680  ? -5.297  9.442   106.948 1.00 64.00  ? 680  ASP C CB    1 
ATOM   8920  C  CG    . ASP C 2  680  ? -5.913  9.813   108.290 1.00 67.65  ? 680  ASP C CG    1 
ATOM   8921  O  OD1   . ASP C 2  680  ? -6.764  9.060   108.789 1.00 66.43  ? 680  ASP C OD1   1 
ATOM   8922  O  OD2   . ASP C 2  680  ? -5.548  10.874  108.836 1.00 74.70  ? 680  ASP C OD2   1 
ATOM   8923  N  N     . GLY C 2  681  ? -6.332  7.662   103.864 1.00 59.76  ? 681  GLY C N     1 
ATOM   8924  C  CA    . GLY C 2  681  ? -6.223  7.731   102.423 1.00 57.61  ? 681  GLY C CA    1 
ATOM   8925  C  C     . GLY C 2  681  ? -4.817  7.672   101.867 1.00 58.62  ? 681  GLY C C     1 
ATOM   8926  O  O     . GLY C 2  681  ? -4.655  7.681   100.640 1.00 62.06  ? 681  GLY C O     1 
ATOM   8927  N  N     . TYR C 2  682  ? -3.789  7.618   102.711 1.00 55.34  ? 682  TYR C N     1 
ATOM   8928  C  CA    . TYR C 2  682  ? -2.424  7.557   102.205 1.00 49.30  ? 682  TYR C CA    1 
ATOM   8929  C  C     . TYR C 2  682  ? -2.034  6.184   101.677 1.00 49.86  ? 682  TYR C C     1 
ATOM   8930  O  O     . TYR C 2  682  ? -0.947  6.051   101.120 1.00 58.60  ? 682  TYR C O     1 
ATOM   8931  C  CB    . TYR C 2  682  ? -1.433  7.982   103.287 1.00 46.89  ? 682  TYR C CB    1 
ATOM   8932  C  CG    . TYR C 2  682  ? -1.440  9.461   103.529 1.00 59.85  ? 682  TYR C CG    1 
ATOM   8933  C  CD1   . TYR C 2  682  ? -0.908  10.328  102.589 1.00 62.63  ? 682  TYR C CD1   1 
ATOM   8934  C  CD2   . TYR C 2  682  ? -1.985  10.002  104.689 1.00 65.22  ? 682  TYR C CD2   1 
ATOM   8935  C  CE1   . TYR C 2  682  ? -0.913  11.690  102.787 1.00 63.60  ? 682  TYR C CE1   1 
ATOM   8936  C  CE2   . TYR C 2  682  ? -1.990  11.376  104.901 1.00 62.13  ? 682  TYR C CE2   1 
ATOM   8937  C  CZ    . TYR C 2  682  ? -1.448  12.210  103.939 1.00 66.08  ? 682  TYR C CZ    1 
ATOM   8938  O  OH    . TYR C 2  682  ? -1.431  13.574  104.114 1.00 73.30  ? 682  TYR C OH    1 
ATOM   8939  N  N     . ASN C 2  683  ? -2.855  5.157   101.853 1.00 52.56  ? 683  ASN C N     1 
ATOM   8940  C  CA    . ASN C 2  683  ? -2.669  3.914   101.121 1.00 45.31  ? 683  ASN C CA    1 
ATOM   8941  C  C     . ASN C 2  683  ? -3.885  3.610   100.260 1.00 48.51  ? 683  ASN C C     1 
ATOM   8942  O  O     . ASN C 2  683  ? -4.244  2.448   100.058 1.00 51.91  ? 683  ASN C O     1 
ATOM   8943  C  CB    . ASN C 2  683  ? -2.345  2.753   102.060 1.00 55.67  ? 683  ASN C CB    1 
ATOM   8944  C  CG    . ASN C 2  683  ? -3.367  2.570   103.167 1.00 55.17  ? 683  ASN C CG    1 
ATOM   8945  O  OD1   . ASN C 2  683  ? -4.527  2.976   103.057 1.00 61.25  ? 683  ASN C OD1   1 
ATOM   8946  N  ND2   . ASN C 2  683  ? -2.929  1.947   104.253 1.00 53.85  ? 683  ASN C ND2   1 
ATOM   8947  N  N     . PHE C 2  684  ? -4.522  4.667   99.766  1.00 46.62  ? 684  PHE C N     1 
ATOM   8948  C  CA    . PHE C 2  684  ? -5.593  4.554   98.788  1.00 48.13  ? 684  PHE C CA    1 
ATOM   8949  C  C     . PHE C 2  684  ? -5.090  3.882   97.517  1.00 55.14  ? 684  PHE C C     1 
ATOM   8950  O  O     . PHE C 2  684  ? -4.026  4.236   96.989  1.00 57.61  ? 684  PHE C O     1 
ATOM   8951  C  CB    . PHE C 2  684  ? -6.120  5.952   98.486  1.00 51.21  ? 684  PHE C CB    1 
ATOM   8952  C  CG    . PHE C 2  684  ? -7.258  6.006   97.502  1.00 49.70  ? 684  PHE C CG    1 
ATOM   8953  C  CD1   . PHE C 2  684  ? -8.519  5.585   97.855  1.00 57.42  ? 684  PHE C CD1   1 
ATOM   8954  C  CD2   . PHE C 2  684  ? -7.079  6.571   96.255  1.00 52.40  ? 684  PHE C CD2   1 
ATOM   8955  C  CE1   . PHE C 2  684  ? -9.569  5.670   96.961  1.00 55.45  ? 684  PHE C CE1   1 
ATOM   8956  C  CE2   . PHE C 2  684  ? -8.124  6.665   95.365  1.00 58.87  ? 684  PHE C CE2   1 
ATOM   8957  C  CZ    . PHE C 2  684  ? -9.372  6.213   95.721  1.00 53.37  ? 684  PHE C CZ    1 
ATOM   8958  N  N     . GLU C 2  685  ? -5.847  2.895   97.043  1.00 53.39  ? 685  GLU C N     1 
ATOM   8959  C  CA    . GLU C 2  685  ? -5.615  2.256   95.749  1.00 53.53  ? 685  GLU C CA    1 
ATOM   8960  C  C     . GLU C 2  685  ? -4.164  1.801   95.600  1.00 55.09  ? 685  GLU C C     1 
ATOM   8961  O  O     . GLU C 2  685  ? -3.422  2.247   94.722  1.00 60.11  ? 685  GLU C O     1 
ATOM   8962  C  CB    . GLU C 2  685  ? -6.022  3.195   94.617  1.00 53.49  ? 685  GLU C CB    1 
ATOM   8963  C  CG    . GLU C 2  685  ? -7.520  3.422   94.521  1.00 49.25  ? 685  GLU C CG    1 
ATOM   8964  C  CD    . GLU C 2  685  ? -8.243  2.329   93.745  1.00 58.86  ? 685  GLU C CD    1 
ATOM   8965  O  OE1   . GLU C 2  685  ? -8.020  1.130   94.029  1.00 58.38  ? 685  GLU C OE1   1 
ATOM   8966  O  OE2   . GLU C 2  685  ? -9.040  2.672   92.841  1.00 63.29  ? 685  GLU C OE2   1 
ATOM   8967  N  N     . ASP C 2  686  ? -3.766  0.914   96.507  1.00 57.16  ? 686  ASP C N     1 
ATOM   8968  C  CA    . ASP C 2  686  ? -2.501  0.183   96.512  1.00 53.22  ? 686  ASP C CA    1 
ATOM   8969  C  C     . ASP C 2  686  ? -1.294  1.032   96.889  1.00 50.23  ? 686  ASP C C     1 
ATOM   8970  O  O     . ASP C 2  686  ? -0.189  0.485   96.988  1.00 49.38  ? 686  ASP C O     1 
ATOM   8971  C  CB    . ASP C 2  686  ? -2.229  -0.506  95.171  1.00 54.69  ? 686  ASP C CB    1 
ATOM   8972  C  CG    . ASP C 2  686  ? -3.352  -1.446  94.766  1.00 71.47  ? 686  ASP C CG    1 
ATOM   8973  O  OD1   . ASP C 2  686  ? -3.969  -2.055  95.678  1.00 59.63  ? 686  ASP C OD1   1 
ATOM   8974  O  OD2   . ASP C 2  686  ? -3.628  -1.558  93.545  1.00 71.34  ? 686  ASP C OD2   1 
ATOM   8975  N  N     . ALA C 2  687  ? -1.457  2.326   97.145  1.00 44.88  ? 687  ALA C N     1 
ATOM   8976  C  CA    . ALA C 2  687  ? -0.337  3.066   97.706  1.00 49.51  ? 687  ALA C CA    1 
ATOM   8977  C  C     . ALA C 2  687  ? 0.039   2.478   99.063  1.00 54.56  ? 687  ALA C C     1 
ATOM   8978  O  O     . ALA C 2  687  ? -0.734  1.744   99.689  1.00 60.88  ? 687  ALA C O     1 
ATOM   8979  C  CB    . ALA C 2  687  ? -0.668  4.553   97.843  1.00 50.79  ? 687  ALA C CB    1 
ATOM   8980  N  N     . ILE C 2  688  ? 1.246   2.800   99.521  1.00 50.14  ? 688  ILE C N     1 
ATOM   8981  C  CA    . ILE C 2  688  ? 1.771   2.243   100.759 1.00 50.34  ? 688  ILE C CA    1 
ATOM   8982  C  C     . ILE C 2  688  ? 2.250   3.366   101.669 1.00 57.51  ? 688  ILE C C     1 
ATOM   8983  O  O     . ILE C 2  688  ? 2.760   4.394   101.211 1.00 57.14  ? 688  ILE C O     1 
ATOM   8984  C  CB    . ILE C 2  688  ? 2.911   1.243   100.480 1.00 50.29  ? 688  ILE C CB    1 
ATOM   8985  C  CG1   . ILE C 2  688  ? 2.463   0.222   99.439  1.00 52.19  ? 688  ILE C CG1   1 
ATOM   8986  C  CG2   . ILE C 2  688  ? 3.335   0.528   101.750 1.00 53.53  ? 688  ILE C CG2   1 
ATOM   8987  C  CD1   . ILE C 2  688  ? 3.387   -0.972  99.345  1.00 54.97  ? 688  ILE C CD1   1 
ATOM   8988  N  N     . VAL C 2  689  ? 2.071   3.160   102.974 1.00 52.42  ? 689  VAL C N     1 
ATOM   8989  C  CA    . VAL C 2  689  ? 2.559   4.062   104.012 1.00 59.12  ? 689  VAL C CA    1 
ATOM   8990  C  C     . VAL C 2  689  ? 3.712   3.380   104.735 1.00 59.36  ? 689  VAL C C     1 
ATOM   8991  O  O     . VAL C 2  689  ? 3.630   2.190   105.060 1.00 56.87  ? 689  VAL C O     1 
ATOM   8992  C  CB    . VAL C 2  689  ? 1.436   4.437   105.005 1.00 55.92  ? 689  VAL C CB    1 
ATOM   8993  C  CG1   . VAL C 2  689  ? 1.984   5.260   106.136 1.00 45.95  ? 689  VAL C CG1   1 
ATOM   8994  C  CG2   . VAL C 2  689  ? 0.333   5.194   104.303 1.00 54.03  ? 689  VAL C CG2   1 
ATOM   8995  N  N     . ILE C 2  690  ? 4.787   4.131   104.993 1.00 54.38  ? 690  ILE C N     1 
ATOM   8996  C  CA    . ILE C 2  690  ? 5.948   3.579   105.680 1.00 55.63  ? 690  ILE C CA    1 
ATOM   8997  C  C     . ILE C 2  690  ? 6.389   4.521   106.792 1.00 57.44  ? 690  ILE C C     1 
ATOM   8998  O  O     . ILE C 2  690  ? 6.130   5.728   106.769 1.00 54.02  ? 690  ILE C O     1 
ATOM   8999  C  CB    . ILE C 2  690  ? 7.145   3.316   104.737 1.00 55.57  ? 690  ILE C CB    1 
ATOM   9000  C  CG1   . ILE C 2  690  ? 7.800   4.637   104.334 1.00 54.55  ? 690  ILE C CG1   1 
ATOM   9001  C  CG2   . ILE C 2  690  ? 6.712   2.535   103.508 1.00 56.65  ? 690  ILE C CG2   1 
ATOM   9002  C  CD1   . ILE C 2  690  ? 9.244   4.508   103.978 1.00 53.48  ? 690  ILE C CD1   1 
ATOM   9003  N  N     . SER C 2  691  ? 7.111   3.944   107.747 1.00 53.12  ? 691  SER C N     1 
ATOM   9004  C  CA    . SER C 2  691  ? 7.690   4.676   108.862 1.00 57.32  ? 691  SER C CA    1 
ATOM   9005  C  C     . SER C 2  691  ? 9.072   5.212   108.512 1.00 65.50  ? 691  SER C C     1 
ATOM   9006  O  O     . SER C 2  691  ? 9.906   4.497   107.946 1.00 66.17  ? 691  SER C O     1 
ATOM   9007  C  CB    . SER C 2  691  ? 7.787   3.762   110.084 1.00 65.03  ? 691  SER C CB    1 
ATOM   9008  O  OG    . SER C 2  691  ? 8.586   4.340   111.101 1.00 73.29  ? 691  SER C OG    1 
ATOM   9009  N  N     . GLU C 2  692  ? 9.319   6.474   108.878 1.00 62.19  ? 692  GLU C N     1 
ATOM   9010  C  CA    . GLU C 2  692  ? 10.661  7.040   108.784 1.00 60.87  ? 692  GLU C CA    1 
ATOM   9011  C  C     . GLU C 2  692  ? 11.698  6.175   109.487 1.00 62.79  ? 692  GLU C C     1 
ATOM   9012  O  O     . GLU C 2  692  ? 12.884  6.247   109.156 1.00 64.38  ? 692  GLU C O     1 
ATOM   9013  C  CB    . GLU C 2  692  ? 10.658  8.449   109.380 1.00 64.13  ? 692  GLU C CB    1 
ATOM   9014  C  CG    . GLU C 2  692  ? 11.888  9.290   109.100 1.00 61.65  ? 692  GLU C CG    1 
ATOM   9015  C  CD    . GLU C 2  692  ? 11.720  10.724  109.589 1.00 70.66  ? 692  GLU C CD    1 
ATOM   9016  O  OE1   . GLU C 2  692  ? 11.290  10.908  110.748 1.00 77.45  ? 692  GLU C OE1   1 
ATOM   9017  O  OE2   . GLU C 2  692  ? 12.000  11.669  108.817 1.00 66.47  ? 692  GLU C OE2   1 
ATOM   9018  N  N     . GLU C 2  693  ? 11.268  5.348   110.444 1.00 74.64  ? 693  GLU C N     1 
ATOM   9019  C  CA    . GLU C 2  693  ? 12.183  4.455   111.149 1.00 72.87  ? 693  GLU C CA    1 
ATOM   9020  C  C     . GLU C 2  693  ? 12.915  3.528   110.192 1.00 69.67  ? 693  GLU C C     1 
ATOM   9021  O  O     . GLU C 2  693  ? 14.012  3.054   110.506 1.00 71.45  ? 693  GLU C O     1 
ATOM   9022  C  CB    . GLU C 2  693  ? 11.414  3.633   112.189 1.00 66.01  ? 693  GLU C CB    1 
ATOM   9023  C  CG    . GLU C 2  693  ? 12.257  3.190   113.368 1.00 79.47  ? 693  GLU C CG    1 
ATOM   9024  C  CD    . GLU C 2  693  ? 12.724  4.366   114.223 1.00 84.29  ? 693  GLU C CD    1 
ATOM   9025  O  OE1   . GLU C 2  693  ? 12.069  5.436   114.184 1.00 76.30  ? 693  GLU C OE1   1 
ATOM   9026  O  OE2   . GLU C 2  693  ? 13.749  4.224   114.928 1.00 82.42  ? 693  GLU C OE2   1 
ATOM   9027  N  N     . LEU C 2  694  ? 12.318  3.243   109.032 1.00 60.88  ? 694  LEU C N     1 
ATOM   9028  C  CA    . LEU C 2  694  ? 12.976  2.382   108.059 1.00 69.24  ? 694  LEU C CA    1 
ATOM   9029  C  C     . LEU C 2  694  ? 14.190  3.063   107.434 1.00 67.96  ? 694  LEU C C     1 
ATOM   9030  O  O     . LEU C 2  694  ? 15.168  2.385   107.098 1.00 67.98  ? 694  LEU C O     1 
ATOM   9031  C  CB    . LEU C 2  694  ? 11.984  1.950   106.976 1.00 64.24  ? 694  LEU C CB    1 
ATOM   9032  C  CG    . LEU C 2  694  ? 10.916  0.913   107.333 1.00 55.18  ? 694  LEU C CG    1 
ATOM   9033  C  CD1   . LEU C 2  694  ? 9.987   0.690   106.155 1.00 51.21  ? 694  LEU C CD1   1 
ATOM   9034  C  CD2   . LEU C 2  694  ? 11.537  -0.411  107.770 1.00 58.55  ? 694  LEU C CD2   1 
ATOM   9035  N  N     . LEU C 2  695  ? 14.152  4.391   107.269 1.00 65.10  ? 695  LEU C N     1 
ATOM   9036  C  CA    . LEU C 2  695  ? 15.304  5.089   106.704 1.00 66.81  ? 695  LEU C CA    1 
ATOM   9037  C  C     . LEU C 2  695  ? 16.394  5.269   107.748 1.00 70.30  ? 695  LEU C C     1 
ATOM   9038  O  O     . LEU C 2  695  ? 17.582  5.108   107.444 1.00 71.95  ? 695  LEU C O     1 
ATOM   9039  C  CB    . LEU C 2  695  ? 14.906  6.458   106.145 1.00 58.94  ? 695  LEU C CB    1 
ATOM   9040  C  CG    . LEU C 2  695  ? 13.618  6.688   105.353 1.00 56.57  ? 695  LEU C CG    1 
ATOM   9041  C  CD1   . LEU C 2  695  ? 13.730  7.981   104.554 1.00 48.52  ? 695  LEU C CD1   1 
ATOM   9042  C  CD2   . LEU C 2  695  ? 13.244  5.519   104.454 1.00 55.14  ? 695  LEU C CD2   1 
ATOM   9043  N  N     . LYS C 2  696  ? 15.997  5.610   108.977 1.00 68.50  ? 696  LYS C N     1 
ATOM   9044  C  CA    . LYS C 2  696  ? 16.953  5.827   110.056 1.00 69.24  ? 696  LYS C CA    1 
ATOM   9045  C  C     . LYS C 2  696  ? 17.881  4.634   110.229 1.00 68.58  ? 696  LYS C C     1 
ATOM   9046  O  O     . LYS C 2  696  ? 19.080  4.805   110.474 1.00 79.45  ? 696  LYS C O     1 
ATOM   9047  C  CB    . LYS C 2  696  ? 16.216  6.114   111.368 1.00 75.09  ? 696  LYS C CB    1 
ATOM   9048  C  CG    . LYS C 2  696  ? 15.322  7.346   111.360 1.00 74.36  ? 696  LYS C CG    1 
ATOM   9049  C  CD    . LYS C 2  696  ? 14.488  7.434   112.633 1.00 71.51  ? 696  LYS C CD    1 
ATOM   9050  C  CE    . LYS C 2  696  ? 13.531  8.626   112.596 1.00 75.40  ? 696  LYS C CE    1 
ATOM   9051  N  NZ    . LYS C 2  696  ? 12.508  8.611   113.696 1.00 66.70  ? 696  LYS C NZ    1 
ATOM   9052  N  N     . ARG C 2  697  ? 17.355  3.417   110.108 1.00 63.04  ? 697  ARG C N     1 
ATOM   9053  C  CA    . ARG C 2  697  ? 18.178  2.230   110.296 1.00 70.32  ? 697  ARG C CA    1 
ATOM   9054  C  C     . ARG C 2  697  ? 18.603  1.594   108.978 1.00 72.74  ? 697  ARG C C     1 
ATOM   9055  O  O     . ARG C 2  697  ? 19.078  0.453   108.975 1.00 68.93  ? 697  ARG C O     1 
ATOM   9056  C  CB    . ARG C 2  697  ? 17.468  1.216   111.207 1.00 72.52  ? 697  ARG C CB    1 
ATOM   9057  C  CG    . ARG C 2  697  ? 16.316  0.411   110.626 1.00 75.17  ? 697  ARG C CG    1 
ATOM   9058  C  CD    . ARG C 2  697  ? 15.924  -0.660  111.649 1.00 73.41  ? 697  ARG C CD    1 
ATOM   9059  N  NE    . ARG C 2  697  ? 14.810  -1.509  111.236 1.00 77.27  ? 697  ARG C NE    1 
ATOM   9060  C  CZ    . ARG C 2  697  ? 13.536  -1.264  111.530 1.00 78.66  ? 697  ARG C CZ    1 
ATOM   9061  N  NH1   . ARG C 2  697  ? 13.210  -0.184  112.230 1.00 73.17  ? 697  ARG C NH1   1 
ATOM   9062  N  NH2   . ARG C 2  697  ? 12.588  -2.098  111.121 1.00 75.19  ? 697  ARG C NH2   1 
ATOM   9063  N  N     . ASP C 2  698  ? 18.456  2.322   107.867 1.00 76.55  ? 698  ASP C N     1 
ATOM   9064  C  CA    . ASP C 2  698  ? 19.024  1.966   106.560 1.00 72.24  ? 698  ASP C CA    1 
ATOM   9065  C  C     . ASP C 2  698  ? 18.415  0.687   105.982 1.00 70.08  ? 698  ASP C C     1 
ATOM   9066  O  O     . ASP C 2  698  ? 19.097  -0.096  105.315 1.00 67.97  ? 698  ASP C O     1 
ATOM   9067  C  CB    . ASP C 2  698  ? 20.550  1.862   106.612 1.00 67.25  ? 698  ASP C CB    1 
ATOM   9068  C  CG    . ASP C 2  698  ? 21.230  3.157   106.199 1.00 76.93  ? 698  ASP C CG    1 
ATOM   9069  O  OD1   . ASP C 2  698  ? 20.930  3.660   105.088 1.00 73.14  ? 698  ASP C OD1   1 
ATOM   9070  O  OD2   . ASP C 2  698  ? 22.046  3.682   106.991 1.00 82.47  ? 698  ASP C OD2   1 
ATOM   9071  N  N     . PHE C 2  699  ? 17.124  0.484   106.223 1.00 66.26  ? 699  PHE C N     1 
ATOM   9072  C  CA    . PHE C 2  699  ? 16.371  -0.519  105.489 1.00 64.46  ? 699  PHE C CA    1 
ATOM   9073  C  C     . PHE C 2  699  ? 16.005  0.025   104.113 1.00 64.43  ? 699  PHE C C     1 
ATOM   9074  O  O     . PHE C 2  699  ? 15.759  1.224   103.943 1.00 66.41  ? 699  PHE C O     1 
ATOM   9075  C  CB    . PHE C 2  699  ? 15.109  -0.915  106.261 1.00 67.04  ? 699  PHE C CB    1 
ATOM   9076  C  CG    . PHE C 2  699  ? 15.326  -2.022  107.255 1.00 70.25  ? 699  PHE C CG    1 
ATOM   9077  C  CD1   . PHE C 2  699  ? 16.488  -2.079  108.008 1.00 71.41  ? 699  PHE C CD1   1 
ATOM   9078  C  CD2   . PHE C 2  699  ? 14.361  -2.998  107.448 1.00 68.55  ? 699  PHE C CD2   1 
ATOM   9079  C  CE1   . PHE C 2  699  ? 16.694  -3.095  108.923 1.00 68.19  ? 699  PHE C CE1   1 
ATOM   9080  C  CE2   . PHE C 2  699  ? 14.559  -4.016  108.364 1.00 70.40  ? 699  PHE C CE2   1 
ATOM   9081  C  CZ    . PHE C 2  699  ? 15.731  -4.064  109.101 1.00 68.25  ? 699  PHE C CZ    1 
ATOM   9082  N  N     . TYR C 2  700  ? 15.986  -0.864  103.122 1.00 62.03  ? 700  TYR C N     1 
ATOM   9083  C  CA    . TYR C 2  700  ? 15.616  -0.488  101.756 1.00 66.13  ? 700  TYR C CA    1 
ATOM   9084  C  C     . TYR C 2  700  ? 16.550  0.587   101.203 1.00 66.47  ? 700  TYR C C     1 
ATOM   9085  O  O     . TYR C 2  700  ? 16.119  1.538   100.549 1.00 68.89  ? 700  TYR C O     1 
ATOM   9086  C  CB    . TYR C 2  700  ? 14.153  -0.039  101.687 1.00 58.71  ? 700  TYR C CB    1 
ATOM   9087  C  CG    . TYR C 2  700  ? 13.201  -1.157  102.004 1.00 61.19  ? 700  TYR C CG    1 
ATOM   9088  C  CD1   . TYR C 2  700  ? 13.125  -2.269  101.178 1.00 56.36  ? 700  TYR C CD1   1 
ATOM   9089  C  CD2   . TYR C 2  700  ? 12.401  -1.124  103.144 1.00 58.23  ? 700  TYR C CD2   1 
ATOM   9090  C  CE1   . TYR C 2  700  ? 12.270  -3.303  101.459 1.00 60.02  ? 700  TYR C CE1   1 
ATOM   9091  C  CE2   . TYR C 2  700  ? 11.533  -2.160  103.434 1.00 49.41  ? 700  TYR C CE2   1 
ATOM   9092  C  CZ    . TYR C 2  700  ? 11.479  -3.248  102.587 1.00 56.89  ? 700  TYR C CZ    1 
ATOM   9093  O  OH    . TYR C 2  700  ? 10.636  -4.297  102.844 1.00 53.49  ? 700  TYR C OH    1 
ATOM   9094  N  N     . THR C 2  701  ? 17.838  0.445   101.496 1.00 64.06  ? 701  THR C N     1 
ATOM   9095  C  CA    . THR C 2  701  ? 18.882  1.309   100.964 1.00 67.16  ? 701  THR C CA    1 
ATOM   9096  C  C     . THR C 2  701  ? 19.786  0.477   100.063 1.00 64.32  ? 701  THR C C     1 
ATOM   9097  O  O     . THR C 2  701  ? 20.282  -0.577  100.476 1.00 60.13  ? 701  THR C O     1 
ATOM   9098  C  CB    . THR C 2  701  ? 19.694  1.948   102.093 1.00 66.84  ? 701  THR C CB    1 
ATOM   9099  O  OG1   . THR C 2  701  ? 18.809  2.592   103.015 1.00 63.42  ? 701  THR C OG1   1 
ATOM   9100  C  CG2   . THR C 2  701  ? 20.665  2.974   101.539 1.00 66.59  ? 701  THR C CG2   1 
ATOM   9101  N  N     . SER C 2  702  ? 19.994  0.936   98.834  1.00 60.32  ? 702  SER C N     1 
ATOM   9102  C  CA    . SER C 2  702  ? 20.761  0.152   97.877  1.00 61.84  ? 702  SER C CA    1 
ATOM   9103  C  C     . SER C 2  702  ? 21.845  1.000   97.231  1.00 61.74  ? 702  SER C C     1 
ATOM   9104  O  O     . SER C 2  702  ? 21.697  2.210   97.063  1.00 60.19  ? 702  SER C O     1 
ATOM   9105  C  CB    . SER C 2  702  ? 19.861  -0.451  96.797  1.00 58.20  ? 702  SER C CB    1 
ATOM   9106  O  OG    . SER C 2  702  ? 18.954  0.512   96.297  1.00 60.89  ? 702  SER C OG    1 
ATOM   9107  N  N     . ILE C 2  703  ? 22.944  0.350   96.882  1.00 62.18  ? 703  ILE C N     1 
ATOM   9108  C  CA    . ILE C 2  703  ? 24.031  0.992   96.155  1.00 62.97  ? 703  ILE C CA    1 
ATOM   9109  C  C     . ILE C 2  703  ? 23.751  0.878   94.668  1.00 61.13  ? 703  ILE C C     1 
ATOM   9110  O  O     . ILE C 2  703  ? 23.338  -0.179  94.178  1.00 61.33  ? 703  ILE C O     1 
ATOM   9111  C  CB    . ILE C 2  703  ? 25.383  0.354   96.507  1.00 60.98  ? 703  ILE C CB    1 
ATOM   9112  C  CG1   . ILE C 2  703  ? 25.614  0.394   98.011  1.00 61.85  ? 703  ILE C CG1   1 
ATOM   9113  C  CG2   . ILE C 2  703  ? 26.499  1.076   95.804  1.00 60.92  ? 703  ILE C CG2   1 
ATOM   9114  C  CD1   . ILE C 2  703  ? 26.871  -0.312  98.435  1.00 62.26  ? 703  ILE C CD1   1 
ATOM   9115  N  N     . HIS C 2  704  ? 23.985  1.962   93.941  1.00 63.55  ? 704  HIS C N     1 
ATOM   9116  C  CA    . HIS C 2  704  ? 23.804  1.964   92.498  1.00 71.63  ? 704  HIS C CA    1 
ATOM   9117  C  C     . HIS C 2  704  ? 24.997  2.636   91.833  1.00 70.65  ? 704  HIS C C     1 
ATOM   9118  O  O     . HIS C 2  704  ? 25.436  3.699   92.276  1.00 74.34  ? 704  HIS C O     1 
ATOM   9119  C  CB    . HIS C 2  704  ? 22.492  2.655   92.137  1.00 73.56  ? 704  HIS C CB    1 
ATOM   9120  C  CG    . HIS C 2  704  ? 21.288  1.905   92.610  1.00 65.50  ? 704  HIS C CG    1 
ATOM   9121  N  ND1   . HIS C 2  704  ? 20.588  1.036   91.800  1.00 69.68  ? 704  HIS C ND1   1 
ATOM   9122  C  CD2   . HIS C 2  704  ? 20.689  1.856   93.822  1.00 64.56  ? 704  HIS C CD2   1 
ATOM   9123  C  CE1   . HIS C 2  704  ? 19.593  0.504   92.487  1.00 67.23  ? 704  HIS C CE1   1 
ATOM   9124  N  NE2   . HIS C 2  704  ? 19.631  0.985   93.717  1.00 68.66  ? 704  HIS C NE2   1 
ATOM   9125  N  N     . ILE C 2  705  ? 25.532  2.014   90.786  1.00 68.28  ? 705  ILE C N     1 
ATOM   9126  C  CA    . ILE C 2  705  ? 26.713  2.517   90.093  1.00 70.08  ? 705  ILE C CA    1 
ATOM   9127  C  C     . ILE C 2  705  ? 26.334  2.854   88.660  1.00 71.15  ? 705  ILE C C     1 
ATOM   9128  O  O     . ILE C 2  705  ? 25.773  2.016   87.945  1.00 72.83  ? 705  ILE C O     1 
ATOM   9129  C  CB    . ILE C 2  705  ? 27.870  1.504   90.125  1.00 73.03  ? 705  ILE C CB    1 
ATOM   9130  C  CG1   . ILE C 2  705  ? 28.298  1.241   91.567  1.00 72.97  ? 705  ILE C CG1   1 
ATOM   9131  C  CG2   . ILE C 2  705  ? 29.041  2.011   89.302  1.00 70.90  ? 705  ILE C CG2   1 
ATOM   9132  C  CD1   . ILE C 2  705  ? 29.431  0.255   91.690  1.00 75.57  ? 705  ILE C CD1   1 
ATOM   9133  N  N     . GLU C 2  706  ? 26.641  4.074   88.246  1.00 70.32  ? 706  GLU C N     1 
ATOM   9134  C  CA    . GLU C 2  706  ? 26.412  4.525   86.887  1.00 76.05  ? 706  GLU C CA    1 
ATOM   9135  C  C     . GLU C 2  706  ? 27.747  4.736   86.183  1.00 71.26  ? 706  GLU C C     1 
ATOM   9136  O  O     . GLU C 2  706  ? 28.748  5.093   86.809  1.00 71.59  ? 706  GLU C O     1 
ATOM   9137  C  CB    . GLU C 2  706  ? 25.592  5.818   86.874  1.00 73.77  ? 706  GLU C CB    1 
ATOM   9138  C  CG    . GLU C 2  706  ? 24.982  6.121   85.521  1.00 84.75  ? 706  GLU C CG    1 
ATOM   9139  C  CD    . GLU C 2  706  ? 24.155  4.961   84.991  1.00 92.10  ? 706  GLU C CD    1 
ATOM   9140  O  OE1   . GLU C 2  706  ? 23.070  4.703   85.556  1.00 105.07 ? 706  GLU C OE1   1 
ATOM   9141  O  OE2   . GLU C 2  706  ? 24.596  4.297   84.024  1.00 85.00  ? 706  GLU C OE2   1 
ATOM   9142  N  N     . ARG C 2  707  ? 27.754  4.508   84.874  1.00 76.63  ? 707  ARG C N     1 
ATOM   9143  C  CA    . ARG C 2  707  ? 28.953  4.623   84.054  1.00 76.44  ? 707  ARG C CA    1 
ATOM   9144  C  C     . ARG C 2  707  ? 28.790  5.776   83.070  1.00 73.64  ? 707  ARG C C     1 
ATOM   9145  O  O     . ARG C 2  707  ? 27.767  5.866   82.379  1.00 73.85  ? 707  ARG C O     1 
ATOM   9146  C  CB    . ARG C 2  707  ? 29.223  3.314   83.305  1.00 76.53  ? 707  ARG C CB    1 
ATOM   9147  C  CG    . ARG C 2  707  ? 30.643  3.171   82.811  1.00 86.40  ? 707  ARG C CG    1 
ATOM   9148  C  CD    . ARG C 2  707  ? 30.836  1.912   81.980  1.00 94.63  ? 707  ARG C CD    1 
ATOM   9149  N  NE    . ARG C 2  707  ? 30.515  2.131   80.574  1.00 97.23  ? 707  ARG C NE    1 
ATOM   9150  C  CZ    . ARG C 2  707  ? 30.940  1.355   79.582  1.00 103.41 ? 707  ARG C CZ    1 
ATOM   9151  N  NH1   . ARG C 2  707  ? 31.711  0.307   79.841  1.00 105.41 ? 707  ARG C NH1   1 
ATOM   9152  N  NH2   . ARG C 2  707  ? 30.599  1.632   78.329  1.00 104.62 ? 707  ARG C NH2   1 
ATOM   9153  N  N     . TYR C 2  708  ? 29.792  6.655   83.010  1.00 68.44  ? 708  TYR C N     1 
ATOM   9154  C  CA    . TYR C 2  708  ? 29.816  7.773   82.075  1.00 75.30  ? 708  TYR C CA    1 
ATOM   9155  C  C     . TYR C 2  708  ? 31.074  7.680   81.217  1.00 70.39  ? 708  TYR C C     1 
ATOM   9156  O  O     . TYR C 2  708  ? 32.135  7.294   81.712  1.00 72.59  ? 708  TYR C O     1 
ATOM   9157  C  CB    . TYR C 2  708  ? 29.778  9.112   82.823  1.00 67.82  ? 708  TYR C CB    1 
ATOM   9158  C  CG    . TYR C 2  708  ? 28.590  9.274   83.747  1.00 76.00  ? 708  TYR C CG    1 
ATOM   9159  C  CD1   . TYR C 2  708  ? 28.581  8.694   85.010  1.00 74.22  ? 708  TYR C CD1   1 
ATOM   9160  C  CD2   . TYR C 2  708  ? 27.484  10.023  83.364  1.00 78.65  ? 708  TYR C CD2   1 
ATOM   9161  C  CE1   . TYR C 2  708  ? 27.504  8.844   85.861  1.00 71.41  ? 708  TYR C CE1   1 
ATOM   9162  C  CE2   . TYR C 2  708  ? 26.399  10.181  84.207  1.00 74.11  ? 708  TYR C CE2   1 
ATOM   9163  C  CZ    . TYR C 2  708  ? 26.413  9.590   85.456  1.00 79.93  ? 708  TYR C CZ    1 
ATOM   9164  O  OH    . TYR C 2  708  ? 25.332  9.737   86.304  1.00 79.27  ? 708  TYR C OH    1 
ATOM   9165  N  N     . GLU C 2  709  ? 30.967  8.045   79.938  1.00 62.73  ? 709  GLU C N     1 
ATOM   9166  C  CA    . GLU C 2  709  ? 32.038  7.791   78.978  1.00 70.77  ? 709  GLU C CA    1 
ATOM   9167  C  C     . GLU C 2  709  ? 32.197  8.967   78.023  1.00 68.60  ? 709  GLU C C     1 
ATOM   9168  O  O     . GLU C 2  709  ? 31.205  9.514   77.537  1.00 68.51  ? 709  GLU C O     1 
ATOM   9169  C  CB    . GLU C 2  709  ? 31.741  6.506   78.191  1.00 71.20  ? 709  GLU C CB    1 
ATOM   9170  C  CG    . GLU C 2  709  ? 32.908  5.902   77.434  1.00 84.01  ? 709  GLU C CG    1 
ATOM   9171  C  CD    . GLU C 2  709  ? 32.536  4.580   76.773  1.00 94.30  ? 709  GLU C CD    1 
ATOM   9172  O  OE1   . GLU C 2  709  ? 31.379  4.138   76.939  1.00 103.73 ? 709  GLU C OE1   1 
ATOM   9173  O  OE2   . GLU C 2  709  ? 33.392  3.981   76.091  1.00 93.80  ? 709  GLU C OE2   1 
ATOM   9174  N  N     . ILE C 2  710  ? 33.442  9.361   77.746  1.00 72.77  ? 710  ILE C N     1 
ATOM   9175  C  CA    . ILE C 2  710  ? 33.696  10.422  76.774  1.00 73.88  ? 7