data_6KQH
# 
_entry.id   6KQH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.323 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6KQH         
WWPDB D_1300013468 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6KQH 
_pdbx_database_status.recvd_initial_deposition_date   2019-08-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zhang, Y.'     1 ? 
'Li, L.'        2 ? 
'Ebright, R.H.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            117 
_citation.language                  ? 
_citation.page_first                5801 
_citation.page_last                 5809 
_citation.title                     
'RNA extension drives a stepwise displacement of an initiation-factor structural module in initial transcription.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1920747117 
_citation.pdbx_database_id_PubMed   32127479 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, L.'        1 ? 
primary 'Molodtsov, V.' 2 ? 
primary 'Lin, W.'       3 ? 
primary 'Ebright, R.H.' 4 ? 
primary 'Zhang, Y.'     5 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   99.200 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6KQH 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     183.007 
_cell.length_a_esd                 ? 
_cell.length_b                     103.566 
_cell.length_b_esd                 ? 
_cell.length_c                     294.935 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6KQH 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                                                        35056.164  2 
2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                                                         125436.539 1 
2.7.7.6 ? ? ? 
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 1   2.7.7.6 ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                                                        11533.316  1 
2.7.7.6 ? ? ? 
5  polymer     man 'RNA polymerase sigma factor SigA'                                                                 50769.398  1 
?       ? ? ? 
6  polymer     syn 
;DNA (5'-D(*CP*CP*T*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*CP*GP*AP*GP*GP*G)-3')
;
6480.172   1   ?       ? ? ? 
7  polymer     syn 
;DNA (5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*GP*CP*AP*GP*G*)-3')
;
8421.432   1   ?       ? ? ? 
8  polymer     syn 
;RNA (5'-R(*CP*CP*CP*UP*CP*GP*A)-3')
;
2156.347   1   ?       ? ? ? 
9  non-polymer syn 'MAGNESIUM ION'                                                                                    24.305     4 
?       ? ? ? 
10 non-polymer syn 'ZINC ION'                                                                                         65.409     2 
?       ? ? ? 
11 water       nat water                                                                                              18.015     
139 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B ? 
2 'polypeptide(L)'        no no 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C   ? 
3 'polypeptide(L)'        no no 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D   ? 
4 'polypeptide(L)'        no no 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E   ? 
5 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
F   ? 
6 polydeoxyribonucleotide no no 
;(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DG)(DA)(DG)(DG)
(DG)
;
CCTGCATCCGTGAGTCGAGGG G   ? 
7 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGTCACGGATGCAGG H   ? 
8 polyribonucleotide      no no CCCUCGA CCCUCGA I   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLY n 
5 3    SER n 
5 4    SER n 
5 5    HIS n 
5 6    HIS n 
5 7    HIS n 
5 8    HIS n 
5 9    HIS n 
5 10   HIS n 
5 11   SER n 
5 12   SER n 
5 13   GLY n 
5 14   LEU n 
5 15   VAL n 
5 16   PRO n 
5 17   ARG n 
5 18   GLY n 
5 19   SER n 
5 20   HIS n 
5 21   MET n 
5 22   LYS n 
5 23   LYS n 
5 24   SER n 
5 25   LYS n 
5 26   ARG n 
5 27   LYS n 
5 28   ASN n 
5 29   ALA n 
5 30   GLN n 
5 31   ALA n 
5 32   GLN n 
5 33   GLU n 
5 34   ALA n 
5 35   GLN n 
5 36   GLU n 
5 37   THR n 
5 38   GLU n 
5 39   VAL n 
5 40   LEU n 
5 41   VAL n 
5 42   GLN n 
5 43   GLU n 
5 44   GLU n 
5 45   ALA n 
5 46   GLU n 
5 47   GLU n 
5 48   LEU n 
5 49   PRO n 
5 50   GLU n 
5 51   PHE n 
5 52   PRO n 
5 53   GLU n 
5 54   GLY n 
5 55   GLU n 
5 56   PRO n 
5 57   ASP n 
5 58   PRO n 
5 59   ASP n 
5 60   LEU n 
5 61   GLU n 
5 62   ASP n 
5 63   PRO n 
5 64   ASP n 
5 65   LEU n 
5 66   THR n 
5 67   LEU n 
5 68   GLU n 
5 69   ASP n 
5 70   ASP n 
5 71   LEU n 
5 72   LEU n 
5 73   ASP n 
5 74   LEU n 
5 75   PRO n 
5 76   GLU n 
5 77   GLU n 
5 78   GLY n 
5 79   GLU n 
5 80   GLY n 
5 81   LEU n 
5 82   ASP n 
5 83   LEU n 
5 84   GLU n 
5 85   GLU n 
5 86   GLU n 
5 87   GLU n 
5 88   GLU n 
5 89   ASP n 
5 90   LEU n 
5 91   PRO n 
5 92   ILE n 
5 93   PRO n 
5 94   LYS n 
5 95   ILE n 
5 96   SER n 
5 97   THR n 
5 98   SER n 
5 99   ASP n 
5 100  PRO n 
5 101  VAL n 
5 102  ARG n 
5 103  GLN n 
5 104  TYR n 
5 105  LEU n 
5 106  HIS n 
5 107  GLU n 
5 108  ILE n 
5 109  GLY n 
5 110  GLN n 
5 111  VAL n 
5 112  PRO n 
5 113  LEU n 
5 114  LEU n 
5 115  THR n 
5 116  LEU n 
5 117  GLU n 
5 118  GLU n 
5 119  GLU n 
5 120  VAL n 
5 121  GLU n 
5 122  LEU n 
5 123  ALA n 
5 124  ARG n 
5 125  LYS n 
5 126  VAL n 
5 127  GLU n 
5 128  GLU n 
5 129  GLY n 
5 130  MET n 
5 131  GLU n 
5 132  ALA n 
5 133  ILE n 
5 134  LYS n 
5 135  LYS n 
5 136  LEU n 
5 137  SER n 
5 138  GLU n 
5 139  ILE n 
5 140  THR n 
5 141  GLY n 
5 142  LEU n 
5 143  ASP n 
5 144  PRO n 
5 145  ASP n 
5 146  LEU n 
5 147  ILE n 
5 148  ARG n 
5 149  GLU n 
5 150  VAL n 
5 151  VAL n 
5 152  ARG n 
5 153  ALA n 
5 154  LYS n 
5 155  ILE n 
5 156  LEU n 
5 157  GLY n 
5 158  SER n 
5 159  ALA n 
5 160  ARG n 
5 161  VAL n 
5 162  ARG n 
5 163  HIS n 
5 164  ILE n 
5 165  PRO n 
5 166  GLY n 
5 167  LEU n 
5 168  LYS n 
5 169  GLU n 
5 170  THR n 
5 171  LEU n 
5 172  ASP n 
5 173  PRO n 
5 174  LYS n 
5 175  THR n 
5 176  VAL n 
5 177  GLU n 
5 178  GLU n 
5 179  ILE n 
5 180  ASP n 
5 181  GLN n 
5 182  LYS n 
5 183  LEU n 
5 184  LYS n 
5 185  SER n 
5 186  LEU n 
5 187  PRO n 
5 188  LYS n 
5 189  GLU n 
5 190  HIS n 
5 191  LYS n 
5 192  ARG n 
5 193  TYR n 
5 194  LEU n 
5 195  HIS n 
5 196  ILE n 
5 197  ALA n 
5 198  ARG n 
5 199  GLU n 
5 200  GLY n 
5 201  GLU n 
5 202  ALA n 
5 203  ALA n 
5 204  ARG n 
5 205  GLN n 
5 206  HIS n 
5 207  LEU n 
5 208  ILE n 
5 209  GLU n 
5 210  ALA n 
5 211  ASN n 
5 212  LEU n 
5 213  ARG n 
5 214  LEU n 
5 215  VAL n 
5 216  VAL n 
5 217  SER n 
5 218  ILE n 
5 219  ALA n 
5 220  LYS n 
5 221  LYS n 
5 222  TYR n 
5 223  THR n 
5 224  GLY n 
5 225  ARG n 
5 226  GLY n 
5 227  LEU n 
5 228  SER n 
5 229  PHE n 
5 230  LEU n 
5 231  ASP n 
5 232  LEU n 
5 233  ILE n 
5 234  GLN n 
5 235  GLU n 
5 236  GLY n 
5 237  ASN n 
5 238  GLN n 
5 239  GLY n 
5 240  LEU n 
5 241  ILE n 
5 242  ARG n 
5 243  ALA n 
5 244  VAL n 
5 245  GLU n 
5 246  LYS n 
5 247  PHE n 
5 248  GLU n 
5 249  TYR n 
5 250  LYS n 
5 251  ARG n 
5 252  ARG n 
5 253  PHE n 
5 254  LYS n 
5 255  PHE n 
5 256  SER n 
5 257  THR n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  TRP n 
5 262  TRP n 
5 263  ILE n 
5 264  ARG n 
5 265  GLN n 
5 266  ALA n 
5 267  ILE n 
5 268  ASN n 
5 269  ARG n 
5 270  ALA n 
5 271  ILE n 
5 272  ALA n 
5 273  ASP n 
5 274  GLN n 
5 275  ALA n 
5 276  ARG n 
5 277  THR n 
5 278  ILE n 
5 279  ARG n 
5 280  ILE n 
5 281  PRO n 
5 282  VAL n 
5 283  HIS n 
5 284  MET n 
5 285  VAL n 
5 286  GLU n 
5 287  THR n 
5 288  ILE n 
5 289  ASN n 
5 290  LYS n 
5 291  LEU n 
5 292  SER n 
5 293  ARG n 
5 294  THR n 
5 295  ALA n 
5 296  ARG n 
5 297  GLN n 
5 298  LEU n 
5 299  GLN n 
5 300  GLN n 
5 301  GLU n 
5 302  LEU n 
5 303  GLY n 
5 304  ARG n 
5 305  GLU n 
5 306  PRO n 
5 307  THR n 
5 308  TYR n 
5 309  GLU n 
5 310  GLU n 
5 311  ILE n 
5 312  ALA n 
5 313  GLU n 
5 314  ALA n 
5 315  MET n 
5 316  GLY n 
5 317  PRO n 
5 318  GLY n 
5 319  TRP n 
5 320  ASP n 
5 321  ALA n 
5 322  LYS n 
5 323  ARG n 
5 324  VAL n 
5 325  GLU n 
5 326  GLU n 
5 327  THR n 
5 328  LEU n 
5 329  LYS n 
5 330  ILE n 
5 331  ALA n 
5 332  GLN n 
5 333  GLU n 
5 334  PRO n 
5 335  VAL n 
5 336  SER n 
5 337  LEU n 
5 338  GLU n 
5 339  THR n 
5 340  PRO n 
5 341  ILE n 
5 342  GLY n 
5 343  ASP n 
5 344  GLU n 
5 345  LYS n 
5 346  ASP n 
5 347  SER n 
5 348  PHE n 
5 349  TYR n 
5 350  GLY n 
5 351  ASP n 
5 352  PHE n 
5 353  ILE n 
5 354  PRO n 
5 355  ASP n 
5 356  GLU n 
5 357  HIS n 
5 358  LEU n 
5 359  PRO n 
5 360  SER n 
5 361  PRO n 
5 362  VAL n 
5 363  ASP n 
5 364  ALA n 
5 365  ALA n 
5 366  THR n 
5 367  GLN n 
5 368  SER n 
5 369  LEU n 
5 370  LEU n 
5 371  SER n 
5 372  GLU n 
5 373  GLU n 
5 374  LEU n 
5 375  GLU n 
5 376  LYS n 
5 377  ALA n 
5 378  LEU n 
5 379  SER n 
5 380  LYS n 
5 381  LEU n 
5 382  SER n 
5 383  GLU n 
5 384  ARG n 
5 385  GLU n 
5 386  ALA n 
5 387  MET n 
5 388  VAL n 
5 389  LEU n 
5 390  LYS n 
5 391  LEU n 
5 392  ARG n 
5 393  LYS n 
5 394  GLY n 
5 395  LEU n 
5 396  ILE n 
5 397  ASP n 
5 398  GLY n 
5 399  ARG n 
5 400  GLU n 
5 401  HIS n 
5 402  THR n 
5 403  LEU n 
5 404  GLU n 
5 405  GLU n 
5 406  VAL n 
5 407  GLY n 
5 408  ALA n 
5 409  PHE n 
5 410  PHE n 
5 411  GLY n 
5 412  VAL n 
5 413  THR n 
5 414  ARG n 
5 415  GLU n 
5 416  ARG n 
5 417  ILE n 
5 418  ARG n 
5 419  GLN n 
5 420  ILE n 
5 421  GLU n 
5 422  ASN n 
5 423  LYS n 
5 424  ALA n 
5 425  LEU n 
5 426  ARG n 
5 427  LYS n 
5 428  LEU n 
5 429  LYS n 
5 430  TYR n 
5 431  HIS n 
5 432  GLU n 
5 433  SER n 
5 434  ARG n 
5 435  THR n 
5 436  ARG n 
5 437  LYS n 
5 438  LEU n 
5 439  ARG n 
5 440  ASP n 
5 441  PHE n 
5 442  LEU n 
5 443  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DT  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DC  n 
6 10   DG  n 
6 11   DT  n 
6 12   DG  n 
6 13   DA  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DG  n 
6 18   DA  n 
6 19   DG  n 
6 20   DG  n 
6 21   DG  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DC  n 
7 17   DA  n 
7 18   DC  n 
7 19   DG  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
8 1    C   n 
8 2    C   n 
8 3    C   n 
8 4    U   n 
8 5    C   n 
8 6    G   n 
8 7    A   n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   443 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'sigA, TTHA0532' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'HB8 / ATCC 27634 / DSM 579' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     300852 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample 1 315  ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
2 1 sample 1 1119 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
3 1 sample 1 1524 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
4 1 sample 1 99   ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 21 'synthetic construct' ? 32630 ? 
7 1 sample 1 27 'synthetic construct' ? 32630 ? 
8 1 sample 1 7  'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_THET8   Q5SHR6 ? 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 
2 UNP RPOB_THET8   Q8RQE9 ? 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 
3 UNP RPOC_THET8   Q8RQE8 ? 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 
4 UNP RPOZ_THET8   Q8RQE7 ? 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 
5 UNP Q5SKW1_THET8 Q5SKW1 ? 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 
6 PDB 6KQH         6KQH   ? 6 ? 1 
7 PDB 6KQH         6KQH   ? 7 ? 1 
8 PDB 6KQH         6KQH   ? 8 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6KQH A 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
2 1 6KQH B 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
3 2 6KQH C 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4 3 6KQH D 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5 4 6KQH E 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6 5 6KQH F 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
7 6 6KQH G 1  ? 21   ? 6KQH   1 ? 21   ? 1 21   
8 7 6KQH H 1  ? 27   ? 6KQH   1 ? 27   ? 1 27   
9 8 6KQH I 1  ? 7    ? 6KQH   1 ? 7    ? 1 7    
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6 6KQH MET F 1  ? UNP Q5SKW1 ? ? 'initiating methionine' -19 1  
6 6KQH GLY F 2  ? UNP Q5SKW1 ? ? 'expression tag'        -18 2  
6 6KQH SER F 3  ? UNP Q5SKW1 ? ? 'expression tag'        -17 3  
6 6KQH SER F 4  ? UNP Q5SKW1 ? ? 'expression tag'        -16 4  
6 6KQH HIS F 5  ? UNP Q5SKW1 ? ? 'expression tag'        -15 5  
6 6KQH HIS F 6  ? UNP Q5SKW1 ? ? 'expression tag'        -14 6  
6 6KQH HIS F 7  ? UNP Q5SKW1 ? ? 'expression tag'        -13 7  
6 6KQH HIS F 8  ? UNP Q5SKW1 ? ? 'expression tag'        -12 8  
6 6KQH HIS F 9  ? UNP Q5SKW1 ? ? 'expression tag'        -11 9  
6 6KQH HIS F 10 ? UNP Q5SKW1 ? ? 'expression tag'        -10 10 
6 6KQH SER F 11 ? UNP Q5SKW1 ? ? 'expression tag'        -9  11 
6 6KQH SER F 12 ? UNP Q5SKW1 ? ? 'expression tag'        -8  12 
6 6KQH GLY F 13 ? UNP Q5SKW1 ? ? 'expression tag'        -7  13 
6 6KQH LEU F 14 ? UNP Q5SKW1 ? ? 'expression tag'        -6  14 
6 6KQH VAL F 15 ? UNP Q5SKW1 ? ? 'expression tag'        -5  15 
6 6KQH PRO F 16 ? UNP Q5SKW1 ? ? 'expression tag'        -4  16 
6 6KQH ARG F 17 ? UNP Q5SKW1 ? ? 'expression tag'        -3  17 
6 6KQH GLY F 18 ? UNP Q5SKW1 ? ? 'expression tag'        -2  18 
6 6KQH SER F 19 ? UNP Q5SKW1 ? ? 'expression tag'        -1  19 
6 6KQH HIS F 20 ? UNP Q5SKW1 ? ? 'expression tag'        0   20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6KQH 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.09 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         60.24 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.05 M Magnesium chloride, 0.2 M Potassium chloride, 0.1 M Tris-HCl pH8.0, 10% PEG 4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-06-05 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.067 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.067 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            61.300 
_reflns.entry_id                         6KQH 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.180 
_reflns.d_resolution_low                 40.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       85564 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             93.700 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.500 
_reflns.pdbx_Rmerge_I_obs                0.185 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4.300 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.029 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
3.200 3.260  ? ? ? ? ? ? 4099 91.100  ? ? ? ? 0.863 ? ? ? ? ? ? ? ? 3.300 ? 1.021 ? ? ? ? ? 1  1 ? ? 
3.260 3.310  ? ? ? ? ? ? 4044 88.500  ? ? ? ? 0.724 ? ? ? ? ? ? ? ? 3.400 ? 1.028 ? ? ? ? ? 2  1 ? ? 
3.310 3.380  ? ? ? ? ? ? 4060 90.500  ? ? ? ? 0.644 ? ? ? ? ? ? ? ? 3.300 ? 1.030 ? ? ? ? ? 3  1 ? ? 
3.380 3.450  ? ? ? ? ? ? 4089 89.500  ? ? ? ? 0.565 ? ? ? ? ? ? ? ? 3.400 ? 1.048 ? ? ? ? ? 4  1 ? ? 
3.450 3.520  ? ? ? ? ? ? 4050 88.600  ? ? ? ? 0.495 ? ? ? ? ? ? ? ? 3.400 ? 1.009 ? ? ? ? ? 5  1 ? ? 
3.520 3.600  ? ? ? ? ? ? 4055 90.100  ? ? ? ? 0.429 ? ? ? ? ? ? ? ? 3.400 ? 1.028 ? ? ? ? ? 6  1 ? ? 
3.600 3.690  ? ? ? ? ? ? 4057 89.200  ? ? ? ? 0.358 ? ? ? ? ? ? ? ? 3.400 ? 1.031 ? ? ? ? ? 7  1 ? ? 
3.690 3.790  ? ? ? ? ? ? 4091 89.800  ? ? ? ? 0.318 ? ? ? ? ? ? ? ? 3.400 ? 1.066 ? ? ? ? ? 8  1 ? ? 
3.790 3.910  ? ? ? ? ? ? 4072 89.500  ? ? ? ? 0.274 ? ? ? ? ? ? ? ? 3.400 ? 1.027 ? ? ? ? ? 9  1 ? ? 
3.910 4.030  ? ? ? ? ? ? 4119 90.800  ? ? ? ? 0.231 ? ? ? ? ? ? ? ? 3.400 ? 1.045 ? ? ? ? ? 10 1 ? ? 
4.030 4.170  ? ? ? ? ? ? 4164 91.700  ? ? ? ? 0.203 ? ? ? ? ? ? ? ? 3.400 ? 1.049 ? ? ? ? ? 11 1 ? ? 
4.170 4.340  ? ? ? ? ? ? 4239 93.100  ? ? ? ? 0.181 ? ? ? ? ? ? ? ? 3.400 ? 1.069 ? ? ? ? ? 12 1 ? ? 
4.340 4.540  ? ? ? ? ? ? 4349 95.600  ? ? ? ? 0.149 ? ? ? ? ? ? ? ? 3.400 ? 1.106 ? ? ? ? ? 13 1 ? ? 
4.540 4.780  ? ? ? ? ? ? 4458 97.500  ? ? ? ? 0.141 ? ? ? ? ? ? ? ? 3.400 ? 1.038 ? ? ? ? ? 14 1 ? ? 
4.780 5.080  ? ? ? ? ? ? 4506 99.000  ? ? ? ? 0.138 ? ? ? ? ? ? ? ? 3.500 ? 1.053 ? ? ? ? ? 15 1 ? ? 
5.080 5.470  ? ? ? ? ? ? 4581 99.700  ? ? ? ? 0.147 ? ? ? ? ? ? ? ? 3.600 ? 1.038 ? ? ? ? ? 16 1 ? ? 
5.470 6.020  ? ? ? ? ? ? 4573 100.000 ? ? ? ? 0.147 ? ? ? ? ? ? ? ? 3.700 ? 1.004 ? ? ? ? ? 17 1 ? ? 
6.020 6.880  ? ? ? ? ? ? 4587 100.000 ? ? ? ? 0.134 ? ? ? ? ? ? ? ? 3.800 ? 1.008 ? ? ? ? ? 18 1 ? ? 
6.880 8.660  ? ? ? ? ? ? 4648 100.000 ? ? ? ? 0.087 ? ? ? ? ? ? ? ? 3.800 ? 0.933 ? ? ? ? ? 19 1 ? ? 
8.660 40.000 ? ? ? ? ? ? 4723 100.000 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 3.700 ? 0.988 ? ? ? ? ? 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                198.240 
_refine.B_iso_mean                               64.5457 
_refine.B_iso_min                                14.460 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6KQH 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.1800 
_refine.ls_d_res_low                             39.8170 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     85533 
_refine.ls_number_reflns_R_free                  4266 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    93.1500 
_refine.ls_percent_reflns_R_free                 4.9900 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2052 
_refine.ls_R_factor_R_free                       0.2467 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2030 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4G7H 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.6800 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       3.1800 
_refine_hist.d_res_low                        39.8170 
_refine_hist.number_atoms_solvent             139 
_refine_hist.number_atoms_total               28684 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       3532 
_refine_hist.pdbx_B_iso_mean_ligand           53.21 
_refine_hist.pdbx_B_iso_mean_solvent          40.15 
_refine_hist.pdbx_number_atoms_protein        27530 
_refine_hist.pdbx_number_atoms_nucleic_acid   1009 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 29228 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.632  ? 39728 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.046  ? 4486  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 5035  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 25.854 ? 11353 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.1803 3.2164  . . 112 2119 73.0000  . . . 0.3733 0.0000 0.3123 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2164 3.2542  . . 109 2593 90.0000  . . . 0.3222 0.0000 0.2980 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2542 3.2939  . . 154 2554 88.0000  . . . 0.3479 0.0000 0.2869 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2939 3.3356  . . 143 2635 91.0000  . . . 0.3248 0.0000 0.2832 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3356 3.3795  . . 129 2546 89.0000  . . . 0.3252 0.0000 0.2810 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3795 3.4257  . . 140 2592 90.0000  . . . 0.3273 0.0000 0.2638 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4257 3.4746  . . 131 2618 90.0000  . . . 0.3462 0.0000 0.2691 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4746 3.5265  . . 132 2555 89.0000  . . . 0.3596 0.0000 0.2608 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5265 3.5815  . . 147 2609 90.0000  . . . 0.2791 0.0000 0.2520 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5815 3.6402  . . 134 2567 89.0000  . . . 0.3024 0.0000 0.2408 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6402 3.7030  . . 136 2605 91.0000  . . . 0.2502 0.0000 0.2387 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7030 3.7702  . . 131 2613 89.0000  . . . 0.2738 0.0000 0.2272 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7702 3.8427  . . 149 2587 90.0000  . . . 0.3003 0.0000 0.2246 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8427 3.9211  . . 151 2587 90.0000  . . . 0.2621 0.0000 0.2180 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9211 4.0062  . . 127 2656 91.0000  . . . 0.2766 0.0000 0.1999 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0062 4.0994  . . 139 2623 91.0000  . . . 0.2430 0.0000 0.1966 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0994 4.2018  . . 145 2689 93.0000  . . . 0.2527 0.0000 0.1917 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2018 4.3152  . . 143 2701 93.0000  . . . 0.2093 0.0000 0.1825 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3152 4.4421  . . 141 2753 95.0000  . . . 0.2067 0.0000 0.1682 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4421 4.5852  . . 147 2826 97.0000  . . . 0.2122 0.0000 0.1737 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5852 4.7489  . . 151 2864 98.0000  . . . 0.2104 0.0000 0.1706 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7489 4.9387  . . 138 2857 99.0000  . . . 0.2168 0.0000 0.1689 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9387 5.1630  . . 157 2914 100.0000 . . . 0.2234 0.0000 0.1768 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1630 5.4346  . . 155 2904 100.0000 . . . 0.2081 0.0000 0.1813 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.4346 5.7741  . . 154 2918 100.0000 . . . 0.2613 0.0000 0.1909 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.7741 6.2184  . . 156 2928 100.0000 . . . 0.2954 0.0000 0.1999 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.2184 6.8413  . . 163 2897 100.0000 . . . 0.2238 0.0000 0.1919 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.8413 7.8247  . . 142 2969 100.0000 . . . 0.2286 0.0000 0.1840 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.8247 9.8337  . . 153 2957 100.0000 . . . 0.1764 0.0000 0.1487 . . . . . . . . . . 
'X-RAY DIFFRACTION' 9.8337 39.8170 . . 157 3031 99.0000  . . . 0.1788 0.0000 0.1808 . . . . . . . . . . 
# 
_struct.entry_id                     6KQH 
_struct.title                        
;Thermus thermophilus initial transcription complex comprising sigma A and 5'-OH RNA of 7 nt
;
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6KQH 
_struct_keywords.text            'Thermus thermophilus, RNA polymerase, transcription initiation complex, 7nt RNA, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 9  ? 
K N N 9  ? 
L N N 10 ? 
M N N 10 ? 
N N N 9  ? 
O N N 9  ? 
P N N 11 ? 
Q N N 11 ? 
R N N 11 ? 
S N N 11 ? 
T N N 11 ? 
U N N 11 ? 
V N N 11 ? 
W N N 11 ? 
X N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? ILE A 48   ? GLY A 31   ILE A 48   1 ? 18 
HELX_P HELX_P2   AA2 ASP A 74   ? LYS A 83   ? ASP A 74   LYS A 83   1 ? 10 
HELX_P HELX_P3   AA3 ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   AA4 PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   AA5 THR A 206  ? THR A 223  ? THR A 206  THR A 223  1 ? 18 
HELX_P HELX_P6   AA6 TYR A 224  ? SER A 226  ? TYR A 224  SER A 226  5 ? 3  
HELX_P HELX_P7   AA7 GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P8   AA8 VAL B 76   ? GLU B 84   ? VAL B 76   GLU B 84   1 ? 9  
HELX_P HELX_P9   AA9 ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P10  AB1 PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P11  AB2 THR B 206  ? THR B 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P12  AB3 THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P13  AB4 PRO C 35   ? ARG C 39   ? PRO C 35   ARG C 39   5 ? 5  
HELX_P HELX_P14  AB5 GLY C 43   ? PHE C 52   ? GLY C 43   PHE C 52   1 ? 10 
HELX_P HELX_P15  AB6 PRO C 79   ? LYS C 86   ? PRO C 79   LYS C 86   1 ? 8  
HELX_P HELX_P16  AB7 LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P17  AB8 ASP C 203  ? GLY C 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P18  AB9 LEU C 217  ? MET C 222  ? LEU C 217  MET C 222  5 ? 6  
HELX_P HELX_P19  AC1 ASP C 223  ? ALA C 228  ? ASP C 223  ALA C 228  1 ? 6  
HELX_P HELX_P20  AC2 ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P21  AC3 LYS C 249  ? ILE C 261  ? LYS C 249  ILE C 261  1 ? 13 
HELX_P HELX_P22  AC4 GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P23  AC5 VAL C 302  ? GLY C 316  ? VAL C 302  GLY C 316  1 ? 15 
HELX_P HELX_P24  AC6 THR C 335  ? MET C 361  ? THR C 335  MET C 361  1 ? 27 
HELX_P HELX_P25  AC7 THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P26  AC8 SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P27  AC9 ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P28  AD1 GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P29  AD2 HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P30  AD3 THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P31  AD4 SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P32  AD5 SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P33  AD6 ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P34  AD7 PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P35  AD8 ASP C 554  ? GLN C 565  ? ASP C 554  GLN C 565  1 ? 12 
HELX_P HELX_P36  AD9 THR C 566  ? ALA C 568  ? THR C 566  ALA C 568  5 ? 3  
HELX_P HELX_P37  AE1 LEU C 583  ? SER C 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P38  AE2 ASN C 683  ? ALA C 687  ? ASN C 683  ALA C 687  5 ? 5  
HELX_P HELX_P39  AE3 GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P40  AE4 SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  1 ? 6  
HELX_P HELX_P41  AE5 THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P42  AE6 PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P43  AE7 LEU C 874  ? MET C 880  ? LEU C 874  MET C 880  1 ? 7  
HELX_P HELX_P44  AE8 LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P45  AE9 LYS C 910  ? GLY C 933  ? LYS C 910  GLY C 933  1 ? 24 
HELX_P HELX_P46  AF1 ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P47  AF2 THR C 958  ? GLN C 969  ? THR C 958  GLN C 969  1 ? 12 
HELX_P HELX_P48  AF3 MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P49  AF4 GLY C 1033 ? GLY C 1044 ? GLY C 1033 GLY C 1044 1 ? 12 
HELX_P HELX_P50  AF5 ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P51  AF6 ASP C 1059 ? GLY C 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P52  AF7 PRO C 1082 ? ALA C 1094 ? PRO C 1082 ALA C 1094 1 ? 13 
HELX_P HELX_P53  AF8 SER D 14   ? SER D 22   ? SER D 14   SER D 22   1 ? 9  
HELX_P HELX_P54  AF9 ASP D 46   ? GLY D 51   ? ASP D 46   GLY D 51   1 ? 6  
HELX_P HELX_P55  AG1 LYS D 82   ? TYR D 88   ? LYS D 82   TYR D 88   5 ? 7  
HELX_P HELX_P56  AG2 ILE D 102  ? ASP D 107  ? ILE D 102  ASP D 107  1 ? 6  
HELX_P HELX_P57  AG3 SER D 110  ? LEU D 116  ? SER D 110  LEU D 116  1 ? 7  
HELX_P HELX_P58  AG4 SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P59  AG5 THR D 154  ? GLY D 164  ? THR D 154  GLY D 164  1 ? 11 
HELX_P HELX_P60  AG6 ASP D 372  ? GLU D 376  ? ASP D 372  GLU D 376  5 ? 5  
HELX_P HELX_P61  AG7 ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P62  AG8 GLY D 457  ? LEU D 468  ? GLY D 457  LEU D 468  1 ? 12 
HELX_P HELX_P63  AG9 ASP D 469  ? LYS D 482  ? ASP D 469  LYS D 482  1 ? 14 
HELX_P HELX_P64  AH1 SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P65  AH2 ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P66  AH3 PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P67  AH4 SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P68  AH5 PRO D 563  ? ASP D 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P69  AH6 SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P70  AH7 GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P71  AH8 LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P72  AH9 PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P73  AI1 ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P74  AI2 GLN D 680  ? ILE D 683  ? GLN D 680  ILE D 683  5 ? 4  
HELX_P HELX_P75  AI3 ASP D 685  ? ILE D 695  ? ASP D 685  ILE D 695  1 ? 11 
HELX_P HELX_P76  AI4 HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P77  AI5 HIS D 729  ? LEU D 731  ? HIS D 729  LEU D 731  5 ? 3  
HELX_P HELX_P78  AI6 VAL D 732  ? ASN D 737  ? VAL D 732  ASN D 737  1 ? 6  
HELX_P HELX_P79  AI7 SER D 752  ? GLN D 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P80  AI8 LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P81  AI9 SER D 782  ? GLN D 794  ? SER D 782  GLN D 794  1 ? 13 
HELX_P HELX_P82  AJ1 THR D 808  ? ARG D 818  ? THR D 808  ARG D 818  1 ? 11 
HELX_P HELX_P83  AJ2 SER D 835  ? TYR D 841  ? SER D 835  TYR D 841  1 ? 7  
HELX_P HELX_P84  AJ3 ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P85  AJ4 SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P86  AJ5 ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P87  AJ6 GLU D 907  ? SER D 945  ? GLU D 907  SER D 945  1 ? 39 
HELX_P HELX_P88  AJ7 GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P89  AJ8 GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P90  AJ9 THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P91  AK1 ASN D 1018 ? GLY D 1027 ? ASN D 1018 GLY D 1027 1 ? 10 
HELX_P HELX_P92  AK2 ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P93  AK3 THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P94  AK4 LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P95  AK5 SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P96  AK6 GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P97  AK7 ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P98  AK8 PRO D 1232 ? THR D 1234 ? PRO D 1232 THR D 1234 5 ? 3  
HELX_P HELX_P99  AK9 GLN D 1254 ? GLU D 1264 ? GLN D 1254 GLU D 1264 1 ? 11 
HELX_P HELX_P100 AL1 ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P101 AL2 GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P102 AL3 HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P103 AL4 LYS D 1397 ? GLU D 1410 ? LYS D 1397 GLU D 1410 1 ? 14 
HELX_P HELX_P104 AL5 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P105 AL6 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P106 AL7 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P107 AL8 GLY D 1461 ? LEU D 1468 ? GLY D 1461 LEU D 1468 1 ? 8  
HELX_P HELX_P108 AL9 ALA D 1474 ? GLY D 1477 ? ALA D 1474 GLY D 1477 5 ? 4  
HELX_P HELX_P109 AM1 SER D 1478 ? PHE D 1483 ? SER D 1478 PHE D 1483 1 ? 6  
HELX_P HELX_P110 AM2 GLN D 1489 ? ALA D 1502 ? GLN D 1489 ALA D 1502 1 ? 14 
HELX_P HELX_P111 AM3 GLY E 5    ? VAL E 13   ? GLY E 5    VAL E 13   1 ? 9  
HELX_P HELX_P112 AM4 SER E 15   ? HIS E 33   ? SER E 15   HIS E 33   1 ? 19 
HELX_P HELX_P113 AM5 GLU E 41   ? ARG E 45   ? GLU E 41   ARG E 45   5 ? 5  
HELX_P HELX_P114 AM6 ASN E 59   ? THR E 70   ? ASN E 59   THR E 70   1 ? 12 
HELX_P HELX_P115 AM7 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P116 AM8 ASP F 99   ? VAL F 111  ? ASP F 79   VAL F 91   1 ? 13 
HELX_P HELX_P117 AM9 THR F 115  ? GLY F 141  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P118 AN1 ASP F 143  ? GLY F 157  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P119 AN2 ASP F 172  ? SER F 185  ? ASP F 152  SER F 165  1 ? 14 
HELX_P HELX_P120 AN3 PRO F 187  ? LYS F 220  ? PRO F 167  LYS F 200  1 ? 34 
HELX_P HELX_P121 AN4 LYS F 221  ? THR F 223  ? LYS F 201  THR F 203  5 ? 3  
HELX_P HELX_P122 AN5 SER F 228  ? LYS F 246  ? SER F 208  LYS F 226  1 ? 19 
HELX_P HELX_P123 AN6 GLU F 248  ? ARG F 252  ? GLU F 228  ARG F 232  5 ? 5  
HELX_P HELX_P124 AN7 LYS F 254  ? ALA F 275  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P125 AN8 PRO F 281  ? GLY F 303  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P126 AN9 THR F 307  ? GLY F 316  ? THR F 287  GLY F 296  1 ? 10 
HELX_P HELX_P127 AO1 ASP F 320  ? GLN F 332  ? ASP F 300  GLN F 312  1 ? 13 
HELX_P HELX_P128 AO2 TYR F 349  ? ILE F 353  ? TYR F 329  ILE F 333  5 ? 5  
HELX_P HELX_P129 AO3 SER F 360  ? SER F 379  ? SER F 340  SER F 359  1 ? 20 
HELX_P HELX_P130 AO4 SER F 382  ? GLY F 394  ? SER F 362  GLY F 374  1 ? 13 
HELX_P HELX_P131 AO5 THR F 402  ? PHE F 410  ? THR F 382  PHE F 390  1 ? 9  
HELX_P HELX_P132 AO6 THR F 413  ? ARG F 436  ? THR F 393  ARG F 416  1 ? 24 
HELX_P HELX_P133 AO7 ARG F 439  ? ASP F 443  ? ARG F 419  ASP F 423  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B ASP 183  OD1   ? ? ? 1_555 J MG  .  MG ? ? B ASP 183  B MG  2001 1_555 ? ? ? ? ? ? ?              2.708 ? 
metalc2  metalc ? ? B ASP 191  O     ? ? ? 1_555 J MG  .  MG ? ? B ASP 191  B MG  2001 1_555 ? ? ? ? ? ? ?              2.389 ? 
metalc3  metalc ? ? D CYS 58   SG    ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 58   D ZN  2002 1_555 ? ? ? ? ? ? ?              2.508 ? 
metalc4  metalc ? ? D CYS 60   SG    ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 60   D ZN  2002 1_555 ? ? ? ? ? ? ?              2.253 ? 
metalc5  metalc ? ? D CYS 73   SG    ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 73   D ZN  2002 1_555 ? ? ? ? ? ? ?              2.323 ? 
metalc6  metalc ? ? D CYS 76   SG    ? ? ? 1_555 M ZN  .  ZN ? ? D CYS 76   D ZN  2002 1_555 ? ? ? ? ? ? ?              2.322 ? 
metalc7  metalc ? ? D ASP 739  OD1   ? ? ? 1_555 N MG  .  MG ? ? D ASP 739  D MG  2003 1_555 ? ? ? ? ? ? ?              2.001 ? 
metalc8  metalc ? ? D ASP 741  OD1   ? ? ? 1_555 N MG  .  MG ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?              2.030 ? 
metalc9  metalc ? ? D ASP 741  OD2   ? ? ? 1_555 N MG  .  MG ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?              2.914 ? 
metalc10 metalc ? ? D ASP 743  OD1   ? ? ? 1_555 N MG  .  MG ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?              2.166 ? 
metalc11 metalc ? ? D LYS 840  O     ? ? ? 1_555 K MG  .  MG ? ? D LYS 840  B MG  2002 1_555 ? ? ? ? ? ? ?              2.629 ? 
metalc12 metalc ? ? D CYS 1112 SG    ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 1112 D ZN  2001 1_555 ? ? ? ? ? ? ?              2.401 ? 
metalc13 metalc ? ? D CYS 1194 SG    ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 1194 D ZN  2001 1_555 ? ? ? ? ? ? ?              2.408 ? 
metalc14 metalc ? ? D CYS 1201 SG    ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 1201 D ZN  2001 1_555 ? ? ? ? ? ? ?              2.318 ? 
metalc15 metalc ? ? D CYS 1204 SG    ? ? ? 1_555 L ZN  .  ZN ? ? D CYS 1204 D ZN  2001 1_555 ? ? ? ? ? ? ?              2.363 ? 
metalc16 metalc ? ? F ALA 312  O     ? ? ? 1_555 O MG  .  MG ? ? F ALA 292  F MG  2001 1_555 ? ? ? ? ? ? ?              2.412 ? 
metalc17 metalc ? ? F GLY 316  O     ? ? ? 1_555 O MG  .  MG ? ? F GLY 296  F MG  2001 1_555 ? ? ? ? ? ? ?              2.482 ? 
metalc18 metalc ? ? I A   7    "O3'" ? ? ? 1_555 N MG  .  MG ? ? I A   7    D MG  2003 1_555 ? ? ? ? ? ? ?              2.570 ? 
metalc19 metalc ? ? K MG  .    MG    ? ? ? 1_555 Q HOH .  O  ? ? B MG  2002 B HOH 2106 1_555 ? ? ? ? ? ? ?              2.146 ? 
metalc20 metalc ? ? K MG  .    MG    ? ? ? 1_555 S HOH .  O  ? ? B MG  2002 D HOH 2108 1_555 ? ? ? ? ? ? ?              2.455 ? 
metalc21 metalc ? ? K MG  .    MG    ? ? ? 1_555 Q HOH .  O  ? ? B MG  2002 B HOH 2108 1_555 ? ? ? ? ? ? ?              2.041 ? 
metalc22 metalc ? ? N MG  .    MG    ? ? ? 1_555 S HOH .  O  ? ? D MG  2003 D HOH 2124 1_555 ? ? ? ? ? ? ?              2.002 ? 
metalc23 metalc ? ? N MG  .    MG    ? ? ? 1_555 S HOH .  O  ? ? D MG  2003 D HOH 2119 1_555 ? ? ? ? ? ? ?              2.422 ? 
hydrog1  hydrog ? ? G DG  4    N1    ? ? ? 1_555 H DC  24 N3 ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog2  hydrog ? ? G DG  4    N2    ? ? ? 1_555 H DC  24 O2 ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog3  hydrog ? ? G DG  4    O6    ? ? ? 1_555 H DC  24 N4 ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog4  hydrog ? ? G DC  5    N3    ? ? ? 1_555 H DG  23 N1 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog5  hydrog ? ? G DC  5    N4    ? ? ? 1_555 H DG  23 O6 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog6  hydrog ? ? G DC  5    O2    ? ? ? 1_555 H DG  23 N2 ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog7  hydrog ? ? G DA  6    N1    ? ? ? 1_555 H DT  22 N3 ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog8  hydrog ? ? G DA  6    N6    ? ? ? 1_555 H DT  22 O4 ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog9  hydrog ? ? G DT  7    N3    ? ? ? 1_555 H DA  21 N1 ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog10 hydrog ? ? G DT  7    O4    ? ? ? 1_555 H DA  21 N6 ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog11 hydrog ? ? G DC  8    N3    ? ? ? 1_555 H DG  20 N1 ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog12 hydrog ? ? G DC  8    N4    ? ? ? 1_555 H DG  20 O6 ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog13 hydrog ? ? G DC  8    O2    ? ? ? 1_555 H DG  20 N2 ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog14 hydrog ? ? G DC  9    O2    ? ? ? 1_555 H DG  19 N2 ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? 'DC-DG PAIR'   ?     ? 
hydrog15 hydrog ? ? G DG  10   N1    ? ? ? 1_555 H DC  18 N3 ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog16 hydrog ? ? G DG  10   N2    ? ? ? 1_555 H DC  18 O2 ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog17 hydrog ? ? G DG  10   O6    ? ? ? 1_555 H DC  18 N4 ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog18 hydrog ? ? G DT  11   N3    ? ? ? 1_555 H DA  17 N1 ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog19 hydrog ? ? G DT  11   O4    ? ? ? 1_555 H DA  17 N6 ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog20 hydrog ? ? G DG  12   N1    ? ? ? 1_555 H DC  16 N3 ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog21 hydrog ? ? G DG  12   N2    ? ? ? 1_555 H DC  16 O2 ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog22 hydrog ? ? G DG  12   O6    ? ? ? 1_555 H DC  16 N4 ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog23 hydrog ? ? G DA  13   N1    ? ? ? 1_555 H DT  15 N3 ? ? G DA  13   H DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog24 hydrog ? ? G DA  13   N6    ? ? ? 1_555 H DT  15 O4 ? ? G DA  13   H DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog25 hydrog ? ? G DG  14   N2    ? ? ? 1_555 I A   7  N1 ? ? G DG  14   I A   7    1_555 ? ? ? ? ? ? 'DG-A MISPAIR' ?     ? 
hydrog26 hydrog ? ? G DT  15   N3    ? ? ? 1_555 I A   7  N1 ? ? G DT  15   I A   7    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog27 hydrog ? ? G DT  15   O4    ? ? ? 1_555 I A   7  N6 ? ? G DT  15   I A   7    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog28 hydrog ? ? G DC  16   N3    ? ? ? 1_555 I G   6  N1 ? ? G DC  16   I G   6    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog29 hydrog ? ? G DC  16   N4    ? ? ? 1_555 I G   6  O6 ? ? G DC  16   I G   6    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog30 hydrog ? ? G DC  16   O2    ? ? ? 1_555 I G   6  N2 ? ? G DC  16   I G   6    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog31 hydrog ? ? G DG  17   N2    ? ? ? 1_555 I C   5  O2 ? ? G DG  17   I C   5    1_555 ? ? ? ? ? ? 'DG-C PAIR'    ?     ? 
hydrog32 hydrog ? ? G DA  18   N1    ? ? ? 1_555 I U   4  N3 ? ? G DA  18   I U   4    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog33 hydrog ? ? G DA  18   N6    ? ? ? 1_555 I U   4  O4 ? ? G DA  18   I U   4    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog34 hydrog ? ? G DG  19   N2    ? ? ? 1_555 I C   3  O2 ? ? G DG  19   I C   3    1_555 ? ? ? ? ? ? 'DG-C PAIR'    ?     ? 
hydrog35 hydrog ? ? G DG  20   N1    ? ? ? 1_555 I C   2  N3 ? ? G DG  20   I C   2    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog36 hydrog ? ? G DG  20   N2    ? ? ? 1_555 I C   2  O2 ? ? G DG  20   I C   2    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog37 hydrog ? ? G DG  20   O6    ? ? ? 1_555 I C   2  N4 ? ? G DG  20   I C   2    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog38 hydrog ? ? G DG  21   O6    ? ? ? 1_555 I C   1  N4 ? ? G DG  21   I C   1    1_555 ? ? ? ? ? ? 'DG-C PAIR'    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -4.20 
2 GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -6.97 
3 PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 3.37  
4 VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -5.48 
5 ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 0.01  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 6 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 5 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 8 ? 
AD2 ? 2 ? 
AD3 ? 4 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 5 ? 
AD8 ? 4 ? 
AD9 ? 2 ? 
AE1 ? 3 ? 
AE2 ? 3 ? 
AE3 ? 4 ? 
AE4 ? 3 ? 
AE5 ? 4 ? 
AE6 ? 2 ? 
AE7 ? 3 ? 
AE8 ? 3 ? 
AE9 ? 3 ? 
AF1 ? 2 ? 
AF2 ? 3 ? 
AF3 ? 2 ? 
AF4 ? 2 ? 
AF5 ? 4 ? 
AF6 ? 3 ? 
AF7 ? 2 ? 
AF8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? parallel      
AD1 6 7 ? anti-parallel 
AD1 7 8 ? parallel      
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD7 4 5 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? parallel      
AE8 1 2 ? parallel      
AE8 2 3 ? anti-parallel 
AE9 1 2 ? parallel      
AE9 2 3 ? anti-parallel 
AF1 1 2 ? parallel      
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF5 3 4 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
AA1 2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
AA1 3 ARG A 189  ? THR A 201  ? ARG A 189  THR A 201  
AA1 4 VAL A 174  ? LEU A 186  ? VAL A 174  LEU A 186  
AA2 1 THR A 96   ? GLU A 104  ? THR A 96   GLU A 104  
AA2 2 ARG A 137  ? GLY A 147  ? ARG A 137  GLY A 147  
AA2 3 GLY A 50   ? ILE A 58   ? GLY A 50   ILE A 58   
AA2 4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
AA3 1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
AA3 2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
AA4 1 LYS A 107  ? LYS A 110  ? LYS A 107  LYS A 110  
AA4 2 HIS A 128  ? LEU A 132  ? HIS A 128  LEU A 132  
AA5 1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
AA5 2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
AA6 1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
AA6 2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
AA6 3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
AA6 4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
AA7 1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
AA7 2 ARG B 137  ? GLY B 147  ? ARG B 137  GLY B 147  
AA7 3 GLY B 50   ? ILE B 58   ? GLY B 50   ILE B 58   
AA7 4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
AA8 1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
AA8 2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
AA9 1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
AA9 2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
AB1 1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
AB1 2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
AB2 1 GLU C 2    ? ARG C 5    ? GLU C 2    ARG C 5    
AB2 2 GLN C 899  ? ILE C 902  ? GLN C 899  ILE C 902  
AB2 3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
AB3 1 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
AB3 2 GLN C 91   ? ILE C 101  ? GLN C 91   ILE C 101  
AB3 3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
AB4 1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
AB4 2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
AB4 3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
AB5 1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
AB5 2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
AB5 3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
AB5 4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
AB6 1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
AB6 2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
AB6 3 ILE C 172  ? VAL C 176  ? ILE C 172  VAL C 176  
AB6 4 VAL C 182  ? LYS C 185  ? VAL C 182  LYS C 185  
AB6 5 LYS C 190  ? PRO C 192  ? LYS C 190  PRO C 192  
AB7 1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
AB7 2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
AB8 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB8 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB8 3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
AB9 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB9 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB9 3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
AB9 4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
AB9 5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
AB9 6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
AC1 1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
AC1 2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
AC2 1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
AC2 2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
AC2 3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
AC3 1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
AC3 2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
AC3 3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
AC3 4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
AC4 1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
AC4 2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
AC5 1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
AC5 2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
AC6 1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
AC6 2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC6 3 LYS C 838  ? ASN C 841  ? LYS C 838  ASN C 841  
AC6 4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
AC6 5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
AC6 6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
AC6 7 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
AC6 8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC7 1 GLY C 718  ? PRO C 719  ? GLY C 718  PRO C 719  
AC7 2 SER C 702  ? THR C 715  ? SER C 702  THR C 715  
AC7 3 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
AC7 4 GLY C 798  ? ARG C 807  ? GLY C 798  ARG C 807  
AC7 5 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
AC8 1 ARG C 721  ? ILE C 722  ? ARG C 721  ILE C 722  
AC8 2 ARG C 758  ? PHE C 761  ? ARG C 758  PHE C 761  
AC8 3 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AC9 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AC9 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AD1 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AD1 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD1 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AD1 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AD1 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AD1 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AD1 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AD1 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD2 1 ARG C 1031 ? PHE C 1032 ? ARG C 1031 PHE C 1032 
AD2 2 LYS D 621  ? ARG D 622  ? LYS D 621  ARG D 622  
AD3 1 PRO C 1108 ? VAL C 1109 ? PRO C 1108 VAL C 1109 
AD3 2 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD3 3 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD3 4 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AD4 1 GLY D 91   ? ALA D 100  ? GLY D 91   ALA D 100  
AD4 2 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AD5 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AD5 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AD5 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AD6 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AD6 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AD7 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AD7 2 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AD7 3 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AD7 4 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AD7 5 VAL D 317  ? GLU D 327  ? VAL D 317  GLU D 327  
AD8 1 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AD8 2 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AD8 3 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AD8 4 ARG D 360  ? VAL D 361  ? ARG D 360  VAL D 361  
AD9 1 GLU D 190  ? ALA D 192  ? GLU D 190  ALA D 192  
AD9 2 VAL D 195  ? VAL D 196  ? VAL D 195  VAL D 196  
AE1 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE1 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE1 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AE2 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE2 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE2 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AE3 1 PRO D 278  ? LEU D 284  ? PRO D 278  LEU D 284  
AE3 2 ALA D 268  ? ARG D 273  ? ALA D 268  ARG D 273  
AE3 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AE3 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AE4 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AE4 2 LYS D 366  ? ALA D 369  ? LYS D 366  ALA D 369  
AE4 3 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AE5 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AE5 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AE5 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AE5 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AE6 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AE6 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AE7 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AE7 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AE7 3 VAL F 335  ? SER F 336  ? VAL F 315  SER F 316  
AE8 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AE8 2 ILE D 827  ? VAL D 829  ? ILE D 827  VAL D 829  
AE8 3 ARG D 832  ? THR D 834  ? ARG D 832  THR D 834  
AE9 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AE9 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AE9 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AF1 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AF1 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AF2 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AF2 2 GLU D 1185 ? ARG D 1189 ? GLU D 1185 ARG D 1189 
AF2 3 VAL D 1148 ? LEU D 1149 ? VAL D 1148 LEU D 1149 
AF3 1 PHE D 1123 ? PRO D 1125 ? PHE D 1123 PRO D 1125 
AF3 2 LEU D 1132 ? LEU D 1134 ? LEU D 1132 LEU D 1134 
AF4 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AF4 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AF5 1 SER D 1300 ? LYS D 1304 ? SER D 1300 LYS D 1304 
AF5 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AF5 3 GLY D 1279 ? GLU D 1285 ? GLY D 1279 GLU D 1285 
AF5 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AF6 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AF6 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AF6 3 ALA D 1416 ? LEU D 1420 ? ALA D 1416 LEU D 1420 
AF7 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AF7 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
AF8 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AF8 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 14   ? N ARG A 14   O GLU A 22   ? O GLU A 22   
AA1 2 3 N LEU A 28   ? N LEU A 28   O ASP A 193  ? O ASP A 193  
AA1 3 4 O TRP A 200  ? O TRP A 200  N ARG A 176  ? N ARG A 176  
AA2 1 2 N VAL A 97   ? N VAL A 97   O VAL A 144  ? O VAL A 144  
AA2 2 3 O GLY A 147  ? O GLY A 147  N GLY A 50   ? N GLY A 50   
AA2 3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
AA3 1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
AA4 1 2 N VAL A 109  ? N VAL A 109  O ILE A 129  ? O ILE A 129  
AA5 1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
AA6 1 2 N GLN B 16   ? N GLN B 16   O TYR B 20   ? O TYR B 20   
AA6 2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
AA6 3 4 O TRP B 200  ? O TRP B 200  N ARG B 175  ? N ARG B 175  
AA7 1 2 N VAL B 97   ? N VAL B 97   O VAL B 144  ? O VAL B 144  
AA7 2 3 O ARG B 143  ? O ARG B 143  N THR B 54   ? N THR B 54   
AA7 3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
AA8 1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
AA9 1 2 N LYS B 107  ? N LYS B 107  O LEU B 132  ? O LEU B 132  
AB1 1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
AB2 1 2 N GLU C 2    ? N GLU C 2    O ARG C 900  ? O ARG C 900  
AB2 2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
AB3 1 2 N VAL C 65   ? N VAL C 65   O ILE C 101  ? O ILE C 101  
AB3 2 3 N LEU C 94   ? N LEU C 94   O GLY C 116  ? O GLY C 116  
AB4 1 2 N ILE C 129  ? N ILE C 129  O ALA C 132  ? O ALA C 132  
AB4 2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
AB5 1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
AB5 2 3 N ILE C 140  ? N ILE C 140  O SER C 411  ? O SER C 411  
AB5 3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
AB6 1 2 N TYR C 147  ? N TYR C 147  O SER C 161  ? O SER C 161  
AB6 2 3 N ALA C 160  ? N ALA C 160  O LEU C 174  ? O LEU C 174  
AB6 3 4 N GLU C 175  ? N GLU C 175  O SER C 183  ? O SER C 183  
AB6 4 5 N MET C 184  ? N MET C 184  O PHE C 191  ? O PHE C 191  
AB7 1 2 N GLU C 294  ? N GLU C 294  O GLU C 297  ? O GLU C 297  
AB8 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB8 2 3 N ARG C 473  ? N ARG C 473  O THR C 480  ? O THR C 480  
AB9 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB9 2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
AB9 3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
AB9 4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
AB9 5 6 N ALA C 515  ? N ALA C 515  O VAL C 522  ? O VAL C 522  
AC1 1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
AC2 1 2 N LEU C 595  ? N LEU C 595  O ALA C 656  ? O ALA C 656  
AC2 2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
AC3 1 2 O TYR C 623  ? O TYR C 623  N ILE C 611  ? N ILE C 611  
AC3 2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
AC3 3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
AC4 1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
AC5 1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
AC6 1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
AC6 2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
AC6 3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
AC6 4 5 O ALA C 850  ? O ALA C 850  N ILE C 688  ? N ILE C 688  
AC6 5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
AC6 6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
AC6 7 8 N VAL C 674  ? N VAL C 674  O GLY C 990  ? O GLY C 990  
AC7 1 2 O GLY C 718  ? O GLY C 718  N THR C 715  ? N THR C 715  
AC7 2 3 N SER C 702  ? N SER C 702  O ARG C 831  ? O ARG C 831  
AC7 3 4 O ARG C 824  ? O ARG C 824  N VAL C 804  ? N VAL C 804  
AC7 4 5 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
AC8 1 2 N ARG C 721  ? N ARG C 721  O THR C 759  ? O THR C 759  
AC8 2 3 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AC9 1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AD1 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AD1 2 3 N SER D 629  ? N SER D 629  O MET D 745  ? O MET D 745  
AD1 3 4 O HIS D 748  ? O HIS D 748  N LEU D 701  ? N LEU D 701  
AD1 4 5 N LEU D 702  ? N LEU D 702  O GLN D 714  ? O GLN D 714  
AD1 5 6 O VAL D 719  ? O VAL D 719  N CYS D 642  ? N CYS D 642  
AD1 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AD1 7 8 O ILE D 726  ? O ILE D 726  N VAL D 630  ? N VAL D 630  
AD2 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD3 1 2 O VAL C 1109 ? O VAL C 1109 N THR C 1101 ? N THR C 1101 
AD3 2 3 N GLN C 1100 ? N GLN C 1100 O ARG D 9    ? O ARG D 9    
AD3 3 4 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD4 1 2 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AD5 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AD5 2 3 N LEU D 135  ? N LEU D 135  O ASP D 453  ? O ASP D 453  
AD6 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AD7 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AD7 2 3 O GLU D 389  ? O GLU D 389  N ARG D 209  ? N ARG D 209  
AD7 3 4 N LEU D 223  ? N LEU D 223  O LEU D 333  ? O LEU D 333  
AD7 4 5 O TYR D 332  ? O TYR D 332  N GLU D 325  ? N GLU D 325  
AD8 1 2 N VAL D 185  ? N VAL D 185  O GLY D 201  ? O GLY D 201  
AD8 2 3 N ARG D 209  ? N ARG D 209  O GLU D 389  ? O GLU D 389  
AD8 3 4 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AD9 1 2 N ALA D 192  ? N ALA D 192  O VAL D 195  ? O VAL D 195  
AE1 1 2 N LEU D 242  ? N LEU D 242  O LEU D 311  ? O LEU D 311  
AE1 2 3 O ALA D 307  ? O ALA D 307  N TYR D 249  ? N TYR D 249  
AE2 1 2 N LEU D 242  ? N LEU D 242  O LEU D 311  ? O LEU D 311  
AE2 2 3 O ARG D 312  ? O ARG D 312  N VAL D 286  ? N VAL D 286  
AE3 1 2 O VAL D 279  ? O VAL D 279  N LEU D 272  ? N LEU D 272  
AE3 2 3 O ARG D 273  ? O ARG D 273  N VAL D 258  ? N VAL D 258  
AE3 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AE4 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AE4 2 3 N ILE D 367  ? N ILE D 367  O VAL D 377  ? O VAL D 377  
AE5 1 2 N TYR D 401  ? N TYR D 401  O VAL D 444  ? O VAL D 444  
AE5 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AE5 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AE6 1 2 N LEU D 421  ? N LEU D 421  O VAL D 427  ? O VAL D 427  
AE7 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AE7 2 3 N PHE D 535  ? N PHE D 535  O VAL F 335  ? O VAL F 315  
AE8 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AE8 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AE9 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AE9 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AF1 1 2 N VAL D 1106 ? N VAL D 1106 O VAL D 1200 ? O VAL D 1200 
AF2 1 2 N VAL D 1120 ? N VAL D 1120 O VAL D 1186 ? O VAL D 1186 
AF2 2 3 O ARG D 1189 ? O ARG D 1189 N VAL D 1148 ? N VAL D 1148 
AF3 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AF4 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AF5 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AF5 2 3 O GLU D 1295 ? O GLU D 1295 N VAL D 1280 ? N VAL D 1280 
AF5 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AF6 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AF6 2 3 N GLU D 1380 ? N GLU D 1380 O LYS D 1418 ? O LYS D 1418 
AF7 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
AF8 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B MG 2001 ? 3 'binding site for residue MG B 2001' 
AC2 Software B MG 2002 ? 5 'binding site for residue MG B 2002' 
AC3 Software D ZN 2001 ? 4 'binding site for residue ZN D 2001' 
AC4 Software D ZN 2002 ? 4 'binding site for residue ZN D 2002' 
AC5 Software D MG 2003 ? 6 'binding site for residue MG D 2003' 
AC6 Software F MG 2001 ? 3 'binding site for residue MG F 2001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 ASP B 183  ? ASP B 183  . ? 1_555 ? 
2  AC1 3 ASP B 191  ? ASP B 191  . ? 1_555 ? 
3  AC1 3 ASP B 193  ? ASP B 193  . ? 1_555 ? 
4  AC2 5 ASP B 168  ? ASP B 168  . ? 1_555 ? 
5  AC2 5 HOH Q .    ? HOH B 2106 . ? 1_555 ? 
6  AC2 5 HOH Q .    ? HOH B 2108 . ? 1_555 ? 
7  AC2 5 LYS D 840  ? LYS D 840  . ? 1_555 ? 
8  AC2 5 HOH S .    ? HOH D 2108 . ? 1_555 ? 
9  AC3 4 CYS D 1112 ? CYS D 1112 . ? 1_555 ? 
10 AC3 4 CYS D 1194 ? CYS D 1194 . ? 1_555 ? 
11 AC3 4 CYS D 1201 ? CYS D 1201 . ? 1_555 ? 
12 AC3 4 CYS D 1204 ? CYS D 1204 . ? 1_555 ? 
13 AC4 4 CYS D 58   ? CYS D 58   . ? 1_555 ? 
14 AC4 4 CYS D 60   ? CYS D 60   . ? 1_555 ? 
15 AC4 4 CYS D 73   ? CYS D 73   . ? 1_555 ? 
16 AC4 4 CYS D 76   ? CYS D 76   . ? 1_555 ? 
17 AC5 6 ASP D 739  ? ASP D 739  . ? 1_555 ? 
18 AC5 6 ASP D 741  ? ASP D 741  . ? 1_555 ? 
19 AC5 6 ASP D 743  ? ASP D 743  . ? 1_555 ? 
20 AC5 6 HOH S .    ? HOH D 2119 . ? 1_555 ? 
21 AC5 6 HOH S .    ? HOH D 2124 . ? 1_555 ? 
22 AC5 6 A   I 7    ? A   I 7    . ? 1_555 ? 
23 AC6 3 ALA F 312  ? ALA F 292  . ? 1_555 ? 
24 AC6 3 GLY F 316  ? GLY F 296  . ? 1_555 ? 
25 AC6 3 TRP F 319  ? TRP F 299  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6KQH 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.005464 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000885 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009656 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003435 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1  4    ? -16.602 18.411  144.166 1.00 73.21  ? 4    SER A N     1 
ATOM   2     C  CA    . SER A 1  4    ? -16.663 17.290  143.235 1.00 82.52  ? 4    SER A CA    1 
ATOM   3     C  C     . SER A 1  4    ? -15.586 17.405  142.160 1.00 87.22  ? 4    SER A C     1 
ATOM   4     O  O     . SER A 1  4    ? -15.406 16.496  141.349 1.00 87.59  ? 4    SER A O     1 
ATOM   5     C  CB    . SER A 1  4    ? -18.044 17.205  142.585 1.00 89.46  ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A 1  4    ? -18.122 16.091  141.712 1.00 83.21  ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A 1  5    ? -14.880 18.533  142.158 1.00 88.33  ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A 1  5    ? -13.763 18.739  141.248 1.00 82.50  ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A 1  5    ? -12.546 17.970  141.749 1.00 88.27  ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A 1  5    ? -12.154 18.105  142.913 1.00 86.44  ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A 1  5    ? -13.447 20.231  141.133 1.00 82.10  ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A 1  5    ? -12.070 20.553  140.574 1.00 86.67  ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A 1  5    ? -11.955 20.206  139.099 1.00 85.56  ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A 1  5    ? -10.581 20.577  138.556 1.00 86.77  ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A 1  5    ? -10.289 22.028  138.728 1.00 81.49  ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A 1  6    ? -11.950 17.161  140.876 1.00 82.34  ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A 1  6    ? -10.787 16.378  141.270 1.00 70.93  ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A 1  6    ? -9.529  17.240  141.256 1.00 68.38  ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A 1  6    ? -9.440  18.233  140.530 1.00 76.72  ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A 1  6    ? -10.608 15.177  140.348 1.00 63.48  ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A 1  6    ? -10.040 13.952  141.053 1.00 64.42  ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A 1  6    ? -11.045 12.835  140.969 1.00 63.56  ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A 1  6    ? -8.715  13.546  140.451 1.00 67.45  ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A 1  7    ? -8.544  16.850  142.068 1.00 60.78  ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A 1  7    ? -7.359  17.684  142.244 1.00 66.35  ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A 1  7    ? -6.063  16.898  142.066 1.00 60.94  ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A 1  7    ? -6.085  15.761  141.588 1.00 57.73  ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A 1  7    ? -7.398  18.371  143.611 1.00 64.05  ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A 1  7    ? -8.560  19.342  143.746 1.00 66.09  ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A 1  7    ? -8.417  20.235  144.960 1.00 78.61  ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A 1  7    ? -9.527  21.279  145.000 1.00 81.44  ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A 1  7    ? -9.378  22.234  146.137 1.00 77.83  ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A 1  8    ? -4.940  17.510  142.447 1.00 55.92  ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A 1  8    ? -3.616  17.036  142.064 1.00 54.05  ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A 1  8    ? -3.436  15.561  142.430 1.00 58.31  ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A 1  8    ? -3.689  15.176  143.582 1.00 63.78  ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A 1  8    ? -2.528  17.884  142.729 1.00 58.91  ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A 1  9    ? -3.025  14.715  141.487 1.00 59.81  ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A 1  9    ? -2.808  13.297  141.779 1.00 58.91  ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A 1  9    ? -1.374  13.004  142.203 1.00 58.00  ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A 1  9    ? -0.451  13.795  141.985 1.00 51.68  ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A 1  9    ? -3.119  12.632  140.433 1.00 55.41  ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A 1  9    ? -2.637  13.631  139.439 1.00 60.75  ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A 1  9    ? -2.943  14.991  140.043 1.00 61.73  ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A 1  10   ? -1.203  11.825  142.814 1.00 64.72  ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A 1  10   ? 0.120   11.361  143.217 1.00 61.91  ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A 1  10   ? 0.896   10.887  141.993 1.00 60.14  ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A 1  10   ? 0.339   10.279  141.059 1.00 56.49  ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A 1  10   ? 0.017   10.265  144.298 1.00 58.01  ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A 1  10   ? -0.590  8.978   143.757 1.00 64.05  ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A 1  10   ? 1.386   9.986   144.918 1.00 53.05  ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A 1  11   ? 2.198   11.183  142.007 1.00 59.14  ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A 1  11   ? 3.118   10.983  140.893 1.00 56.97  ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A 1  11   ? 4.225   10.043  141.357 1.00 51.79  ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A 1  11   ? 5.036   10.407  142.213 1.00 59.97  ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A 1  11   ? 3.673   12.331  140.427 1.00 55.55  ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A 1  11   ? 4.810   12.230  139.449 1.00 65.09  ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A 1  11   ? 4.745   11.368  138.365 1.00 64.55  ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A 1  11   ? 5.946   13.011  139.609 1.00 68.01  ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A 1  11   ? 5.792   11.282  137.461 1.00 60.71  ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A 1  11   ? 6.996   12.933  138.708 1.00 66.64  ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A 1  11   ? 6.919   12.066  137.634 1.00 60.28  ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A 1  12   ? 4.259   8.842   140.787 1.00 51.46  ? 12   THR A N     1 
ATOM   64    C  CA    . THR A 1  12   ? 5.185   7.785   141.178 1.00 54.67  ? 12   THR A CA    1 
ATOM   65    C  C     . THR A 1  12   ? 6.246   7.589   140.099 1.00 56.95  ? 12   THR A C     1 
ATOM   66    O  O     . THR A 1  12   ? 5.950   7.686   138.904 1.00 54.63  ? 12   THR A O     1 
ATOM   67    C  CB    . THR A 1  12   ? 4.431   6.471   141.411 1.00 52.70  ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A 1  12   ? 3.283   6.722   142.231 1.00 50.99  ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1  12   ? 5.328   5.431   142.082 1.00 39.53  ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A 1  13   ? 7.475   7.292   140.525 1.00 54.11  ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A 1  13   ? 8.630   7.184   139.636 1.00 48.21  ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A 1  13   ? 9.351   5.874   139.922 1.00 47.31  ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A 1  13   ? 9.817   5.653   141.046 1.00 50.00  ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A 1  13   ? 9.596   8.368   139.808 1.00 42.24  ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1  13   ? 10.902  8.097   139.085 1.00 44.17  ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1  13   ? 8.959   9.654   139.310 1.00 45.60  ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A 1  14   ? 9.465   5.018   138.907 1.00 51.85  ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A 1  14   ? 10.247  3.790   138.991 1.00 53.95  ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A 1  14   ? 11.307  3.818   137.899 1.00 53.96  ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A 1  14   ? 11.005  4.161   136.755 1.00 58.60  ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A 1  14   ? 9.353   2.556   138.844 1.00 48.92  ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A 1  14   ? 8.356   2.386   139.977 1.00 53.07  ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A 1  14   ? 7.559   1.096   139.845 1.00 62.02  ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A 1  14   ? 6.470   1.201   138.875 1.00 59.10  ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A 1  14   ? 5.191   1.365   139.200 1.00 62.32  ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A 1  14   ? 4.829   1.442   140.475 1.00 65.59  ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A 1  14   ? 4.270   1.448   138.248 1.00 65.24  ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A 1  15   ? 12.548  3.482   138.245 1.00 55.76  ? 15   THR A N     1 
ATOM   89    C  CA    . THR A 1  15   ? 13.649  3.590   137.293 1.00 57.09  ? 15   THR A CA    1 
ATOM   90    C  C     . THR A 1  15   ? 14.529  2.352   137.362 1.00 58.90  ? 15   THR A C     1 
ATOM   91    O  O     . THR A 1  15   ? 14.921  1.926   138.452 1.00 64.84  ? 15   THR A O     1 
ATOM   92    C  CB    . THR A 1  15   ? 14.509  4.837   137.557 1.00 59.50  ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A 1  15   ? 15.108  4.744   138.856 1.00 66.74  ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A 1  15   ? 13.677  6.115   137.475 1.00 50.79  ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A 1  16   ? 14.848  1.789   136.199 1.00 59.49  ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A 1  16   ? 15.846  0.733   136.068 1.00 57.47  ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A 1  16   ? 17.020  1.321   135.296 1.00 69.31  ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A 1  16   ? 16.902  1.607   134.098 1.00 77.29  ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A 1  16   ? 15.277  -0.490  135.356 1.00 58.97  ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A 1  16   ? 14.154  -1.171  136.109 1.00 82.10  ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A 1  16   ? 13.662  -2.419  135.403 1.00 90.07  ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A 1  16   ? 14.298  -2.907  134.467 1.00 75.44  ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A 1  16   ? 12.523  -2.941  135.847 1.00 88.39  ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A 1  17   ? 18.139  1.515   135.988 1.00 70.09  ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A 1  17   ? 19.327  2.123   135.416 1.00 69.03  ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A 1  17   ? 19.032  3.450   134.757 1.00 62.03  ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A 1  17   ? 18.046  4.109   135.091 1.00 53.06  ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A 1  18   ? 19.887  3.855   133.823 1.00 65.99  ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A 1  18   ? 19.608  5.006   132.981 1.00 65.95  ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A 1  18   ? 18.791  4.630   131.759 1.00 68.36  ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A 1  18   ? 18.411  5.518   130.989 1.00 63.82  ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A 1  18   ? 20.916  5.667   132.535 1.00 66.30  ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A 1  18   ? 21.843  6.052   133.676 1.00 60.85  ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A 1  18   ? 23.116  6.713   133.164 1.00 59.46  ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A 1  18   ? 22.829  7.861   132.312 1.00 57.50  ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A 1  18   ? 22.693  9.106   132.756 1.00 64.35  ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A 1  18   ? 22.820  9.370   134.049 1.00 70.14  ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A 1  18   ? 22.430  10.089  131.904 1.00 62.81  ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A 1  19   ? 18.505  3.338   131.578 1.00 73.14  ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A 1  19   ? 17.889  2.850   130.351 1.00 68.43  ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A 1  19   ? 16.366  2.953   130.387 1.00 62.37  ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A 1  19   ? 15.753  3.371   129.399 1.00 61.10  ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A 1  19   ? 18.310  1.398   130.096 1.00 68.86  ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A 1  19   ? 19.808  1.111   130.259 1.00 74.42  ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A 1  19   ? 20.630  1.433   129.016 1.00 77.43  ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A 1  19   ? 20.394  2.490   128.392 1.00 76.75  ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A 1  19   ? 21.518  0.626   128.662 1.00 73.54  ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A 1  20   ? 15.730  2.576   131.500 1.00 59.93  ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A 1  20   ? 14.287  2.369   131.485 1.00 57.71  ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A 1  20   ? 13.607  3.075   132.650 1.00 62.52  ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A 1  20   ? 14.167  3.189   133.744 1.00 63.96  ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A 1  20   ? 13.964  0.872   131.520 1.00 58.49  ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A 1  20   ? 12.499  0.548   131.647 1.00 55.42  ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A 1  20   ? 11.617  0.817   130.611 1.00 54.31  ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A 1  20   ? 11.999  -0.031  132.802 1.00 56.95  ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A 1  20   ? 10.272  0.517   130.723 1.00 59.02  ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A 1  20   ? 10.656  -0.337  132.925 1.00 63.49  ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A 1  20   ? 9.797   -0.062  131.881 1.00 63.33  ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A 1  20   ? 8.459   -0.366  131.993 1.00 58.23  ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A 1  21   ? 12.377  3.534   132.411 1.00 62.88  ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A 1  21   ? 11.614  4.194   133.456 1.00 59.76  ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A 1  21   ? 10.118  4.036   133.282 1.00 54.69  ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A 1  21   ? 9.615   3.806   132.177 1.00 60.94  ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A 1  22   ? 9.412   4.164   134.405 1.00 51.68  ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A 1  22   ? 7.958   4.163   134.472 1.00 47.29  ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A 1  22   ? 7.518   5.339   135.328 1.00 47.84  ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A 1  22   ? 8.130   5.628   136.363 1.00 56.44  ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A 1  22   ? 7.405   2.863   135.069 1.00 44.47  ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A 1  22   ? 7.829   1.607   134.349 1.00 50.04  ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A 1  22   ? 7.157   0.370   134.908 1.00 60.41  ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A 1  22   ? 6.317   0.517   135.820 1.00 64.83  ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A 1  22   ? 7.464   -0.746  134.438 1.00 63.39  ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A 1  23   ? 6.453   6.006   134.897 1.00 41.64  ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A 1  23   ? 5.969   7.220   135.549 1.00 49.34  ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A 1  23   ? 4.454   7.128   135.673 1.00 54.86  ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A 1  23   ? 3.747   7.137   134.662 1.00 51.54  ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A 1  23   ? 6.394   8.458   134.763 1.00 46.00  ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A 1  23   ? 7.867   8.508   134.489 1.00 50.86  ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A 1  23   ? 8.395   7.901   133.366 1.00 49.46  ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A 1  23   ? 8.729   9.128   135.376 1.00 57.91  ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A 1  23   ? 9.751   7.927   133.121 1.00 52.22  ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A 1  23   ? 10.087  9.161   135.133 1.00 56.46  ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A 1  23   ? 10.597  8.557   134.006 1.00 53.05  ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A 1  24   ? 3.955   7.033   136.905 1.00 53.54  ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A 1  24   ? 2.534   6.828   137.167 1.00 47.90  ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A 1  24   ? 1.925   8.123   137.683 1.00 46.98  ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A 1  24   ? 2.540   8.837   138.481 1.00 51.84  ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A 1  24   ? 2.298   5.680   138.169 1.00 48.98  ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A 1  24   ? 0.814   5.345   138.261 1.00 47.92  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A 1  24   ? 3.098   4.458   137.773 1.00 50.41  ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A 1  25   ? 0.712   8.415   137.224 1.00 44.87  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A 1  25   ? -0.078  9.559   137.663 1.00 51.26  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A 1  25   ? -1.464  9.040   138.010 1.00 53.09  ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A 1  25   ? -2.160  8.500   137.140 1.00 53.33  ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A 1  25   ? -0.156  10.629  136.568 1.00 48.21  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A 1  25   ? 0.100   12.093  136.920 1.00 53.62  ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A 1  25   ? 1.496   12.265  137.487 1.00 47.32  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A 1  25   ? -0.087  12.957  135.681 1.00 49.28  ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A 1  26   ? -1.859  9.169   139.278 1.00 64.21  ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A 1  26   ? -3.185  8.683   139.646 1.00 58.54  ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A 1  26   ? -3.654  9.379   140.911 1.00 51.80  ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A 1  26   ? -2.838  9.687   141.783 1.00 50.78  ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A 1  26   ? -3.198  7.159   139.845 1.00 52.75  ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A 1  26   ? -2.488  6.646   141.082 1.00 49.01  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A 1  26   ? -2.792  5.178   141.339 1.00 56.21  ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A 1  26   ? -3.947  4.760   141.092 1.00 46.10  ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A 1  26   ? -1.879  4.441   141.778 1.00 57.15  ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A 1  27   ? -4.962  9.652   141.038 1.00 57.71  ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A 1  27   ? -5.953  9.398   139.990 1.00 53.67  ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A 1  27   ? -6.159  10.600  139.064 1.00 54.97  ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A 1  27   ? -5.989  11.749  139.483 1.00 49.40  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A 1  27   ? -7.220  9.101   140.789 1.00 52.19  ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A 1  27   ? -7.089  9.986   141.975 1.00 52.74  ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A 1  27   ? -5.601  10.084  142.293 1.00 66.43  ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A 1  28   ? -6.530  10.325  137.815 1.00 61.26  ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A 1  28   ? -6.811  11.350  136.821 1.00 55.50  ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A 1  28   ? -8.265  11.251  136.379 1.00 51.91  ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A 1  28   ? -8.887  10.186  136.461 1.00 51.02  ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A 1  28   ? -5.877  11.219  135.606 1.00 44.62  ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A 1  28   ? -4.441  11.723  135.774 1.00 44.28  ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A 1  28   ? -3.518  11.098  134.742 1.00 54.87  ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A 1  28   ? -4.395  13.238  135.665 1.00 43.14  ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A 1  29   ? -8.807  12.376  135.918 1.00 45.83  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A 1  29   ? -10.186 12.399  135.457 1.00 51.93  ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A 1  29   ? -10.351 11.508  134.230 1.00 56.95  ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A 1  29   ? -9.388  11.177  133.532 1.00 56.12  ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A 1  29   ? -10.627 13.827  135.136 1.00 55.56  ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A 1  29   ? -11.305 14.551  136.293 1.00 69.21  ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A 1  29   ? -12.664 13.962  136.642 1.00 72.16  ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A 1  29   ? -13.203 13.176  135.832 1.00 56.99  ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A 1  29   ? -13.191 14.287  137.730 1.00 79.96  ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A 1  30   ? -11.600 11.117  133.975 1.00 55.05  ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A 1  30   ? -11.898 10.193  132.890 1.00 48.73  ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A 1  30   ? -11.394 10.740  131.559 1.00 51.85  ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A 1  30   ? -11.639 11.900  131.215 1.00 48.69  ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A 1  30   ? -13.403 9.935   132.826 1.00 46.04  ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A 1  30   ? -13.826 8.924   131.776 1.00 58.03  ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A 1  30   ? -15.326 8.708   131.815 1.00 51.54  ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A 1  30   ? -16.050 9.974   131.749 1.00 59.90  ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A 1  30   ? -16.710 10.406  130.679 1.00 62.14  ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A 1  30   ? -16.749 9.664   129.579 1.00 63.45  ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A 1  30   ? -17.339 11.576  130.712 1.00 52.60  ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A 1  31   ? -10.667 9.901   130.821 1.00 50.96  ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A 1  31   ? -10.133 10.269  129.530 1.00 49.59  ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A 1  31   ? -8.842  11.051  129.561 1.00 49.00  ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A 1  31   ? -8.204  11.200  128.511 1.00 50.69  ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A 1  32   ? -8.426  11.557  130.723 1.00 50.24  ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A 1  32   ? -7.191  12.323  130.788 1.00 48.06  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A 1  32   ? -5.959  11.441  130.725 1.00 45.54  ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A 1  32   ? -4.870  11.949  130.435 1.00 41.10  ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A 1  32   ? -7.167  13.181  132.050 1.00 46.15  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A 1  32   ? -7.801  14.522  131.863 1.00 46.28  ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A 1  32   ? -9.171  14.636  131.719 1.00 47.26  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A 1  32   ? -7.025  15.666  131.807 1.00 47.63  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A 1  32   ? -9.758  15.869  131.532 1.00 52.38  ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A 1  32   ? -7.607  16.904  131.621 1.00 47.51  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A 1  32   ? -8.974  17.006  131.483 1.00 47.83  ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A 1  33   ? -6.106  10.139  130.979 1.00 44.29  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A 1  33   ? -5.020  9.224   130.684 1.00 42.87  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A 1  33   ? -4.488  9.429   129.284 1.00 44.99  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A 1  33   ? -3.301  9.686   129.089 1.00 43.61  ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A 1  34   ? -5.378  9.387   128.291 1.00 48.23  ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A 1  34   ? -4.960  9.572   126.905 1.00 45.12  ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A 1  34   ? -4.580  11.025  126.644 1.00 43.19  ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A 1  34   ? -3.529  11.304  126.048 1.00 47.26  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A 1  34   ? -6.072  9.100   125.954 1.00 37.81  ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A 1  34   ? -5.650  9.289   124.510 1.00 46.63  ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A 1  34   ? -6.404  7.646   126.225 1.00 42.33  ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A 1  35   ? -5.415  11.964  127.111 1.00 39.08  ? 35   THR A N     1 
ATOM   250   C  CA    . THR A 1  35   ? -5.184  13.393  126.899 1.00 41.31  ? 35   THR A CA    1 
ATOM   251   C  C     . THR A 1  35   ? -3.781  13.811  127.325 1.00 39.31  ? 35   THR A C     1 
ATOM   252   O  O     . THR A 1  35   ? -3.176  14.699  126.715 1.00 32.46  ? 35   THR A O     1 
ATOM   253   C  CB    . THR A 1  35   ? -6.227  14.211  127.669 1.00 45.34  ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A 1  35   ? -7.506  13.570  127.591 1.00 42.66  ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A 1  35   ? -6.348  15.613  127.095 1.00 40.04  ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A 1  36   ? -3.248  13.190  128.377 1.00 44.93  ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A 1  36   ? -1.893  13.499  128.814 1.00 44.81  ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A 1  36   ? -0.853  12.575  128.194 1.00 41.07  ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A 1  36   ? 0.235   13.033  127.828 1.00 43.54  ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A 1  36   ? -1.794  13.426  130.341 1.00 45.65  ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A 1  36   ? -2.037  14.698  131.156 1.00 44.49  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A 1  36   ? -1.732  14.436  132.621 1.00 48.89  ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A 1  36   ? -1.204  15.862  130.635 1.00 45.26  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A 1  37   ? -1.162  11.284  128.060 1.00 44.91  ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A 1  37   ? -0.140  10.326  127.683 1.00 46.57  ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A 1  37   ? 0.259   10.408  126.224 1.00 45.33  ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A 1  37   ? 1.445   10.333  125.896 1.00 48.31  ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A 1  38   ? -0.717  10.562  125.324 1.00 44.96  ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A 1  38   ? -0.367  10.479  123.906 1.00 47.99  ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A 1  38   ? 0.483   11.656  123.440 1.00 40.02  ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A 1  38   ? 1.505   11.418  122.775 1.00 43.11  ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A 1  38   ? -1.623  10.313  123.052 1.00 52.40  ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A 1  38   ? -1.300  9.775   121.672 1.00 47.12  ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A 1  38   ? -1.025  8.583   121.504 1.00 40.79  ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A 1  38   ? -1.306  10.657  120.679 1.00 45.31  ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A 1  39   ? 0.136   12.922  123.716 1.00 37.41  ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A 1  39   ? 1.019   14.012  123.264 1.00 37.00  ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A 1  39   ? 2.415   13.890  123.828 1.00 39.35  ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A 1  39   ? 3.397   14.208  123.145 1.00 44.44  ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A 1  39   ? 0.319   15.279  123.774 1.00 37.84  ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A 1  39   ? -1.041  14.866  124.098 1.00 39.18  ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A 1  39   ? -1.012  13.439  124.479 1.00 42.77  ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A 1  40   ? 2.526   13.433  125.074 1.00 40.44  ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A 1  40   ? 3.843   13.195  125.645 1.00 44.33  ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A 1  40   ? 4.586   12.126  124.860 1.00 43.20  ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A 1  40   ? 5.778   12.276  124.581 1.00 43.70  ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A 1  40   ? 3.718   12.806  127.118 1.00 42.52  ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A 1  40   ? 3.332   13.949  128.056 1.00 38.96  ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A 1  40   ? 3.354   13.472  129.497 1.00 43.39  ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A 1  40   ? 4.253   15.147  127.859 1.00 35.04  ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A 1  41   ? 3.898   11.050  124.475 1.00 40.78  ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A 1  41   ? 4.554   10.013  123.687 1.00 43.09  ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A 1  41   ? 5.020   10.555  122.342 1.00 44.21  ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A 1  41   ? 6.123   10.235  121.884 1.00 51.30  ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A 1  41   ? 3.617   8.826   123.485 1.00 41.51  ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A 1  41   ? 4.135   7.842   122.462 1.00 38.89  ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A 1  41   ? 3.429   6.509   122.535 1.00 42.34  ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A 1  41   ? 3.978   5.589   121.547 1.00 43.80  ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A 1  41   ? 3.662   5.614   120.258 1.00 43.26  ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A 1  41   ? 2.798   6.515   119.805 1.00 43.61  ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A 1  41   ? 4.212   4.744   119.422 1.00 42.46  ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A 1  42   ? 4.195   11.381  121.697 1.00 38.65  ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A 1  42   ? 4.571   11.955  120.409 1.00 39.10  ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A 1  42   ? 5.813   12.833  120.546 1.00 46.52  ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A 1  42   ? 6.785   12.687  119.787 1.00 50.52  ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A 1  42   ? 3.392   12.744  119.830 1.00 38.41  ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A 1  42   ? 2.139   11.899  119.579 1.00 37.69  ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A 1  42   ? 0.974   12.723  119.025 1.00 37.03  ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A 1  42   ? 1.353   13.490  117.842 1.00 41.06  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A 1  42   ? 1.533   12.964  116.632 1.00 44.96  ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A 1  42   ? 1.369   11.662  116.440 1.00 40.37  ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A 1  42   ? 1.882   13.738  115.612 1.00 46.96  ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A 1  43   ? 5.809   13.734  121.536 1.00 40.54  ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A 1  43   ? 6.949   14.624  121.740 1.00 42.21  ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A 1  43   ? 8.188   13.838  122.161 1.00 43.44  ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A 1  43   ? 9.315   14.201  121.798 1.00 45.96  ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A 1  43   ? 6.585   15.716  122.764 1.00 41.13  ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A 1  43   ? 5.383   16.522  122.275 1.00 38.87  ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A 1  43   ? 7.756   16.653  122.994 1.00 48.80  ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A 1  43   ? 4.927   17.587  123.246 1.00 38.56  ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A 1  44   ? 8.009   12.748  122.909 1.00 40.01  ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A 1  44   ? 9.140   11.913  123.299 1.00 45.34  ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A 1  44   ? 9.761   11.238  122.083 1.00 46.36  ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A 1  44   ? 10.984  11.267  121.897 1.00 49.11  ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A 1  44   ? 8.689   10.868  124.324 1.00 46.40  ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A 1  44   ? 8.437   11.324  125.766 1.00 47.32  ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A 1  44   ? 7.565   10.318  126.508 1.00 35.90  ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A 1  44   ? 9.747   11.549  126.503 1.00 45.23  ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A 1  45   ? 8.929   10.636  121.234 1.00 43.61  ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A 1  45   ? 9.440   9.942   120.062 1.00 37.67  ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A 1  45   ? 10.034  10.895  119.036 1.00 48.55  ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A 1  45   ? 10.868  10.468  118.232 1.00 57.49  ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A 1  45   ? 8.333   9.105   119.419 1.00 33.00  ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A 1  45   ? 7.895   7.880   120.228 1.00 38.64  ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A 1  45   ? 6.723   7.173   119.572 1.00 32.50  ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A 1  45   ? 9.055   6.919   120.423 1.00 38.96  ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A 1  46   ? 9.647   12.173  119.042 1.00 46.67  ? 46   SER A N     1 
ATOM   338   C  CA    . SER A 1  46   ? 10.070  13.071  117.973 1.00 42.45  ? 46   SER A CA    1 
ATOM   339   C  C     . SER A 1  46   ? 11.090  14.114  118.415 1.00 46.27  ? 46   SER A C     1 
ATOM   340   O  O     . SER A 1  46   ? 12.190  14.168  117.857 1.00 53.13  ? 46   SER A O     1 
ATOM   341   C  CB    . SER A 1  46   ? 8.849   13.769  117.369 1.00 45.24  ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A 1  46   ? 8.273   14.663  118.302 1.00 43.75  ? 46   SER A OG    1 
ATOM   343   N  N     . SER A 1  47   ? 10.772  14.943  119.411 1.00 47.29  ? 47   SER A N     1 
ATOM   344   C  CA    . SER A 1  47   ? 11.474  16.206  119.605 1.00 45.92  ? 47   SER A CA    1 
ATOM   345   C  C     . SER A 1  47   ? 12.452  16.195  120.777 1.00 45.22  ? 47   SER A C     1 
ATOM   346   O  O     . SER A 1  47   ? 12.852  17.270  121.241 1.00 42.64  ? 47   SER A O     1 
ATOM   347   C  CB    . SER A 1  47   ? 10.460  17.333  119.781 1.00 45.63  ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A 1  47   ? 9.637   17.437  118.632 1.00 46.22  ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A 1  48   ? 12.859  15.023  121.257 1.00 44.63  ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A 1  48   ? 13.820  14.958  122.358 1.00 48.94  ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A 1  48   ? 15.239  15.026  121.805 1.00 53.97  ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A 1  48   ? 15.641  14.154  121.020 1.00 63.42  ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A 1  48   ? 13.626  13.691  123.200 1.00 50.78  ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A 1  48   ? 12.242  13.703  123.849 1.00 54.73  ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A 1  48   ? 14.717  13.588  124.246 1.00 42.57  ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A 1  48   ? 11.959  14.952  124.653 1.00 51.42  ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A 1  49   ? 16.022  16.035  122.176 1.00 48.17  ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A 1  49   ? 17.387  16.143  121.654 1.00 50.35  ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A 1  49   ? 18.288  15.034  122.178 1.00 53.51  ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A 1  49   ? 17.993  14.365  123.172 1.00 54.04  ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A 1  49   ? 17.851  17.517  122.152 1.00 49.33  ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A 1  49   ? 16.582  18.267  122.436 1.00 48.05  ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A 1  49   ? 15.616  17.235  122.923 1.00 45.44  ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A 1  50   ? 19.406  14.853  121.486 1.00 58.68  ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A 1  50   ? 20.358  13.826  121.851 1.00 53.79  ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A 1  50   ? 21.637  13.948  121.052 1.00 54.77  ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A 1  50   ? 21.957  15.011  120.517 1.00 55.53  ? 50   GLY A O     1 
ATOM   368   N  N     . THR A 1  51   ? 22.370  12.839  120.973 1.00 55.27  ? 51   THR A N     1 
ATOM   369   C  CA    . THR A 1  51   ? 23.645  12.799  120.273 1.00 56.42  ? 51   THR A CA    1 
ATOM   370   C  C     . THR A 1  51   ? 23.630  11.733  119.184 1.00 57.55  ? 51   THR A C     1 
ATOM   371   O  O     . THR A 1  51   ? 22.935  10.715  119.291 1.00 53.80  ? 51   THR A O     1 
ATOM   372   C  CB    . THR A 1  51   ? 24.807  12.523  121.236 1.00 52.30  ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A 1  51   ? 24.600  11.264  121.888 1.00 50.80  ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A 1  51   ? 24.908  13.624  122.282 1.00 54.24  ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A 1  52   ? 24.411  11.983  118.132 1.00 57.38  ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A 1  52   ? 24.554  11.039  117.032 1.00 57.85  ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A 1  52   ? 25.843  11.334  116.276 1.00 52.57  ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A 1  52   ? 26.344  12.461  116.277 1.00 51.68  ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A 1  52   ? 23.355  11.098  116.082 1.00 57.04  ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A 1  53   ? 26.366  10.301  115.620 1.00 54.03  ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A 1  53   ? 27.575  10.428  114.810 1.00 53.45  ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A 1  53   ? 27.210  11.075  113.483 1.00 49.69  ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A 1  53   ? 26.415  10.526  112.714 1.00 50.58  ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A 1  53   ? 28.233  9.061   114.581 1.00 50.95  ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A 1  53   ? 29.444  9.206   113.677 1.00 44.62  ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A 1  53   ? 28.613  8.427   115.903 1.00 56.70  ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A 1  54   ? 27.801  12.235  113.201 1.00 47.06  ? 54   THR A N     1 
ATOM   388   C  CA    . THR A 1  54   ? 27.496  12.947  111.969 1.00 46.63  ? 54   THR A CA    1 
ATOM   389   C  C     . THR A 1  54   ? 28.546  12.767  110.878 1.00 52.03  ? 54   THR A C     1 
ATOM   390   O  O     . THR A 1  54   ? 28.260  13.094  109.720 1.00 55.69  ? 54   THR A O     1 
ATOM   391   C  CB    . THR A 1  54   ? 27.308  14.446  112.239 1.00 45.85  ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A 1  54   ? 28.527  15.008  112.738 1.00 48.40  ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A 1  54   ? 26.197  14.663  113.253 1.00 54.31  ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A 1  55   ? 29.740  12.261  111.196 1.00 53.98  ? 55   SER A N     1 
ATOM   395   C  CA    . SER A 1  55   ? 30.745  12.120  110.140 1.00 48.85  ? 55   SER A CA    1 
ATOM   396   C  C     . SER A 1  55   ? 31.734  11.014  110.482 1.00 48.16  ? 55   SER A C     1 
ATOM   397   O  O     . SER A 1  55   ? 31.951  10.690  111.649 1.00 53.57  ? 55   SER A O     1 
ATOM   398   C  CB    . SER A 1  55   ? 31.498  13.434  109.900 1.00 53.02  ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A 1  55   ? 32.409  13.309  108.822 1.00 54.31  ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A 1  56   ? 32.349  10.453  109.439 1.00 51.24  ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A 1  56   ? 33.352  9.398   109.571 1.00 53.31  ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A 1  56   ? 34.458  9.648   108.556 1.00 54.64  ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A 1  56   ? 34.184  9.792   107.360 1.00 55.21  ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A 1  56   ? 32.756  7.993   109.350 1.00 55.12  ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A 1  56   ? 33.864  6.954   109.250 1.00 49.50  ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A 1  56   ? 31.798  7.637   110.468 1.00 63.56  ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A 1  57   ? 35.703  9.689   109.023 1.00 55.36  ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A 1  57   ? 36.865  9.692   108.148 1.00 59.62  ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A 1  57   ? 37.754  8.512   108.509 1.00 61.72  ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A 1  57   ? 37.976  8.231   109.691 1.00 62.07  ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A 1  57   ? 37.661  10.998  108.252 1.00 58.29  ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A 1  57   ? 39.047  10.893  107.653 1.00 67.45  ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A 1  57   ? 39.225  10.822  106.278 1.00 66.90  ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A 1  57   ? 40.177  10.850  108.463 1.00 68.23  ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A 1  57   ? 40.488  10.718  105.725 1.00 74.77  ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A 1  57   ? 41.444  10.745  107.919 1.00 66.20  ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A 1  57   ? 41.594  10.680  106.550 1.00 75.88  ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A 1  57   ? 42.851  10.576  105.998 1.00 81.49  ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A 1  58   ? 38.246  7.812   107.493 1.00 56.52  ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A 1  58   ? 39.151  6.689   107.687 1.00 60.92  ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A 1  58   ? 40.368  6.905   106.802 1.00 68.04  ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A 1  58   ? 40.241  7.355   105.658 1.00 72.40  ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A 1  58   ? 38.473  5.339   107.376 1.00 58.25  ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A 1  58   ? 37.149  5.221   108.130 1.00 50.25  ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A 1  58   ? 39.388  4.191   107.763 1.00 62.28  ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A 1  58   ? 36.434  3.913   107.902 1.00 60.16  ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A 1  59   ? 41.548  6.601   107.340 1.00 65.63  ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A 1  59   ? 42.779  6.791   106.589 1.00 69.11  ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A 1  59   ? 42.818  5.854   105.387 1.00 74.96  ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A 1  59   ? 42.473  4.673   105.487 1.00 69.56  ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A 1  59   ? 43.993  6.553   107.488 1.00 70.62  ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A 1  59   ? 45.330  6.762   106.790 1.00 85.46  ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A 1  59   ? 46.517  6.636   107.730 1.00 90.01  ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A 1  59   ? 46.298  6.515   108.955 1.00 91.70  ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A 1  59   ? 47.669  6.659   107.243 1.00 88.77  ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A 1  60   ? 43.226  6.405   104.240 1.00 74.66  ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A 1  60   ? 43.350  5.664   102.983 1.00 68.37  ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A 1  60   ? 41.996  5.161   102.482 1.00 69.15  ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A 1  60   ? 41.923  4.191   101.722 1.00 67.72  ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A 1  60   ? 44.345  4.506   103.113 1.00 70.35  ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A 1  60   ? 45.740  4.975   103.499 1.00 72.96  ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A 1  60   ? 46.172  6.038   103.006 1.00 71.28  ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A 1  60   ? 46.403  4.282   104.299 1.00 72.95  ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A 1  61   ? 40.916  5.820   102.894 1.00 71.79  ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A 1  61   ? 39.565  5.510   102.438 1.00 62.62  ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A 1  61   ? 38.990  6.768   101.807 1.00 64.42  ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A 1  61   ? 38.823  7.790   102.487 1.00 65.66  ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A 1  61   ? 38.668  5.012   103.582 1.00 58.45  ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A 1  61   ? 37.239  4.870   103.100 1.00 50.93  ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A 1  61   ? 39.181  3.686   104.115 1.00 66.12  ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A 1  62   ? 38.683  6.690   100.512 1.00 64.77  ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A 1  62   ? 38.229  7.852   99.759  1.00 62.41  ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A 1  62   ? 36.722  8.071   99.831  1.00 56.97  ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A 1  62   ? 36.270  9.218   99.743  1.00 55.18  ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A 1  62   ? 38.655  7.714   98.299  1.00 60.81  ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A 1  62   ? 40.156  7.538   98.081  1.00 57.85  ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A 1  62   ? 40.471  7.220   96.627  1.00 61.37  ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A 1  62   ? 40.901  8.787   98.529  1.00 56.61  ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A 1  63   ? 35.934  7.011   99.997  1.00 51.74  ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A 1  63   ? 34.482  7.132   99.969  1.00 48.51  ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A 1  63   ? 33.869  5.929   100.673 1.00 49.34  ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A 1  63   ? 34.560  4.975   101.038 1.00 43.77  ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A 1  63   ? 33.965  7.244   98.535  1.00 55.03  ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A 1  63   ? 34.378  6.102   97.662  1.00 54.91  ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A 1  63   ? 33.861  4.832   97.801  1.00 52.64  ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A 1  63   ? 35.275  6.035   96.650  1.00 52.91  ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A 1  63   ? 34.415  4.034   96.906  1.00 55.15  ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A 1  63   ? 35.277  4.739   96.195  1.00 57.21  ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A 1  64   ? 32.541  5.974   100.821 1.00 48.70  ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A 1  64   ? 31.816  4.994   101.624 1.00 48.39  ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A 1  64   ? 31.780  3.612   100.984 1.00 47.72  ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A 1  64   ? 31.592  2.618   101.694 1.00 42.20  ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A 1  64   ? 30.390  5.496   101.870 1.00 47.24  ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A 1  64   ? 29.581  4.698   102.882 1.00 49.52  ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A 1  64   ? 28.253  5.358   103.209 1.00 61.42  ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A 1  64   ? 27.968  6.443   102.652 1.00 60.51  ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A 1  64   ? 27.491  4.794   104.025 1.00 64.72  ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A 1  65   ? 31.962  3.521   99.671  1.00 48.25  ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A 1  65   ? 31.861  2.255   98.961  1.00 47.07  ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A 1  65   ? 33.181  1.508   98.907  1.00 49.81  ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A 1  65   ? 33.309  0.560   98.128  1.00 51.64  ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A 1  65   ? 31.328  2.498   97.550  1.00 42.98  ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A 1  65   ? 30.053  3.290   97.524  1.00 43.63  ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A 1  65   ? 28.831  2.664   97.724  1.00 38.87  ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A 1  65   ? 30.075  4.663   97.324  1.00 39.61  ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A 1  65   ? 27.653  3.390   97.710  1.00 38.25  ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A 1  65   ? 28.904  5.395   97.309  1.00 39.63  ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A 1  65   ? 27.689  4.757   97.503  1.00 42.05  ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A 1  66   ? 34.154  1.904   99.725  1.00 52.10  ? 66   SER A N     1 
ATOM   490   C  CA    . SER A 1  66   ? 35.489  1.332   99.699  1.00 54.66  ? 66   SER A CA    1 
ATOM   491   C  C     . SER A 1  66   ? 35.581  0.121   100.627 1.00 46.23  ? 66   SER A C     1 
ATOM   492   O  O     . SER A 1  66   ? 34.629  -0.236  101.323 1.00 43.10  ? 66   SER A O     1 
ATOM   493   C  CB    . SER A 1  66   ? 36.513  2.396   100.082 1.00 56.38  ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A 1  66   ? 36.154  3.661   99.551  1.00 57.38  ? 66   SER A OG    1 
ATOM   495   N  N     . THR A 1  67   ? 36.746  -0.528  100.623 1.00 53.97  ? 67   THR A N     1 
ATOM   496   C  CA    . THR A 1  67   ? 37.073  -1.600  101.555 1.00 48.80  ? 67   THR A CA    1 
ATOM   497   C  C     . THR A 1  67   ? 38.500  -1.387  102.035 1.00 56.18  ? 67   THR A C     1 
ATOM   498   O  O     . THR A 1  67   ? 39.330  -0.822  101.315 1.00 60.94  ? 67   THR A O     1 
ATOM   499   C  CB    . THR A 1  67   ? 36.954  -3.000  100.931 1.00 42.12  ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A 1  67   ? 37.853  -3.111  99.821  1.00 55.73  ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A 1  67   ? 35.537  -3.276  100.458 1.00 44.85  ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A 1  68   ? 38.783  -1.837  103.250 1.00 57.85  ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A 1  68   ? 40.101  -1.681  103.859 1.00 55.11  ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A 1  68   ? 40.760  -3.054  103.926 1.00 51.95  ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A 1  68   ? 40.160  -3.992  104.465 1.00 52.83  ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A 1  68   ? 40.014  -1.052  105.256 1.00 60.26  ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A 1  68   ? 39.242  0.264   105.196 1.00 64.00  ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A 1  68   ? 41.411  -0.811  105.808 1.00 59.89  ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A 1  68   ? 38.944  0.851   106.549 1.00 63.74  ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A 1  69   ? 41.970  -3.218  103.393 1.00 55.96  ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A 1  69   ? 42.637  -4.522  103.469 1.00 51.81  ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A 1  69   ? 42.909  -4.912  104.913 1.00 57.52  ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A 1  69   ? 43.293  -4.081  105.739 1.00 65.28  ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A 1  69   ? 43.938  -4.304  102.688 1.00 49.89  ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A 1  69   ? 43.663  -3.126  101.810 1.00 54.74  ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A 1  69   ? 42.737  -2.249  102.594 1.00 56.98  ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A 1  70   ? 42.693  -6.190  105.213 1.00 56.59  ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A 1  70   ? 42.797  -6.683  106.567 1.00 62.63  ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A 1  70   ? 41.551  -6.514  107.407 1.00 61.18  ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A 1  70   ? 41.551  -6.934  108.571 1.00 63.42  ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A 1  71   ? 40.492  -5.914  106.864 1.00 63.63  ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A 1  71   ? 39.243  -5.698  107.587 1.00 58.40  ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A 1  71   ? 38.133  -6.473  106.889 1.00 54.81  ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A 1  71   ? 37.957  -6.359  105.669 1.00 49.13  ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A 1  71   ? 38.883  -4.204  107.684 1.00 55.02  ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A 1  71   ? 37.752  -4.002  108.687 1.00 54.90  ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A 1  71   ? 40.102  -3.383  108.076 1.00 53.12  ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A 1  72   ? 37.379  -7.247  107.672 1.00 58.88  ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A 1  72   ? 36.287  -8.046  107.125 1.00 58.54  ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A 1  72   ? 35.147  -7.160  106.635 1.00 61.46  ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A 1  72   ? 34.640  -7.336  105.520 1.00 57.53  ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A 1  72   ? 35.794  -9.032  108.187 1.00 50.36  ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A 1  72   ? 34.679  -9.955  107.735 1.00 48.77  ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A 1  72   ? 34.329  -10.957 108.824 1.00 45.82  ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A 1  72   ? 33.246  -11.915 108.356 1.00 50.95  ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A 1  72   ? 33.004  -13.027 109.316 1.00 52.97  ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A 1  73   ? 34.729  -6.204  107.459 1.00 61.37  ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A 1  73   ? 33.623  -5.333  107.098 1.00 54.41  ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A 1  73   ? 34.030  -4.355  106.001 1.00 47.67  ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A 1  73   ? 35.199  -3.985  105.860 1.00 43.55  ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A 1  73   ? 33.129  -4.559  108.323 1.00 57.33  ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A 1  73   ? 32.437  -5.411  109.389 1.00 56.95  ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A 1  73   ? 33.388  -5.946  110.444 1.00 56.63  ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A 1  73   ? 34.617  -5.831  110.260 1.00 65.83  ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A 1  73   ? 32.904  -6.480  111.464 1.00 52.90  ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A 1  74   ? 33.043  -3.950  105.210 1.00 50.20  ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A 1  74   ? 33.193  -2.851  104.274 1.00 43.16  ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A 1  74   ? 32.906  -1.536  104.997 1.00 43.39  ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A 1  74   ? 32.540  -1.515  106.175 1.00 46.28  ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A 1  74   ? 32.267  -3.054  103.078 1.00 39.48  ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A 1  74   ? 30.863  -3.450  103.496 1.00 58.93  ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A 1  74   ? 30.075  -2.549  103.860 1.00 55.14  ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A 1  74   ? 30.552  -4.662  103.477 1.00 68.00  ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A 1  75   ? 33.061  -0.418  104.290 1.00 36.50  ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A 1  75   ? 32.845  0.867   104.945 1.00 42.28  ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A 1  75   ? 31.355  1.129   105.152 1.00 45.41  ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A 1  75   ? 30.962  1.778   106.131 1.00 47.11  ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A 1  75   ? 33.541  1.987   104.148 1.00 40.21  ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A 1  75   ? 33.145  3.364   104.659 1.00 39.27  ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A 1  75   ? 35.048  1.817   104.240 1.00 46.75  ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A 1  76   ? 30.501  0.613   104.264 1.00 43.44  ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A 1  76   ? 29.058  0.745   104.461 1.00 41.13  ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A 1  76   ? 28.637  0.069   105.761 1.00 48.34  ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A 1  76   ? 27.864  0.630   106.551 1.00 46.16  ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A 1  76   ? 28.296  0.178   103.248 1.00 37.65  ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A 1  76   ? 26.817  0.051   103.557 1.00 37.22  ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A 1  76   ? 28.499  1.074   102.040 1.00 42.52  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A 1  77   ? 29.169  -1.128  106.027 1.00 48.68  ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A 1  77   ? 28.831  -1.817  107.269 1.00 43.44  ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A 1  77   ? 29.468  -1.135  108.474 1.00 43.36  ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A 1  77   ? 28.861  -1.077  109.548 1.00 48.48  ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A 1  77   ? 29.255  -3.281  107.201 1.00 37.98  ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A 1  77   ? 28.961  -4.038  108.479 1.00 37.36  ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A 1  77   ? 29.117  -5.531  108.322 1.00 52.73  ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A 1  77   ? 28.742  -6.265  109.264 1.00 47.08  ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A 1  77   ? 29.609  -5.968  107.258 1.00 53.56  ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A 1  78   ? 30.688  -0.615  108.323 1.00 42.03  ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A 1  78   ? 31.327  0.079   109.439 1.00 46.69  ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A 1  78   ? 30.514  1.304   109.841 1.00 48.80  ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A 1  78   ? 30.345  1.592   111.032 1.00 54.78  ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A 1  78   ? 32.781  0.441   109.084 1.00 53.09  ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A 1  78   ? 33.638  -0.829  109.037 1.00 53.01  ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A 1  78   ? 33.354  1.440   110.087 1.00 47.98  ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A 1  78   ? 35.086  -0.587  108.680 1.00 46.45  ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A 1  79   ? 29.978  2.035   108.861 1.00 48.23  ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A 1  79   ? 29.131  3.178   109.189 1.00 49.62  ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A 1  79   ? 27.776  2.721   109.723 1.00 51.23  ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A 1  79   ? 27.191  3.380   110.593 1.00 50.78  ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A 1  79   ? 28.985  4.099   107.967 1.00 45.70  ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A 1  79   ? 30.346  4.684   107.595 1.00 50.80  ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A 1  79   ? 27.994  5.212   108.249 1.00 36.85  ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A 1  79   ? 30.303  5.580   106.392 1.00 51.00  ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A 1  80   ? 27.250  1.597   109.226 1.00 47.84  ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A 1  80   ? 26.064  1.019   109.847 1.00 45.97  ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A 1  80   ? 26.300  0.726   111.320 1.00 45.26  ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A 1  80   ? 25.384  0.863   112.137 1.00 53.52  ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A 1  80   ? 25.649  -0.263  109.129 1.00 42.61  ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1  80   ? 24.910  -0.124  107.802 1.00 39.20  ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1  80   ? 24.256  -1.450  107.461 1.00 38.13  ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1  80   ? 23.884  0.999   107.862 1.00 37.24  ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A 1  81   ? 27.518  0.313   111.670 1.00 44.66  ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A 1  81   ? 27.848  0.057   113.067 1.00 48.07  ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A 1  81   ? 27.977  1.358   113.847 1.00 50.48  ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A 1  81   ? 27.434  1.484   114.951 1.00 56.53  ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A 1  81   ? 29.139  -0.756  113.161 1.00 42.21  ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A 1  81   ? 28.992  -2.144  112.583 1.00 43.16  ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A 1  81   ? 27.885  -2.671  112.486 1.00 47.45  ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A 1  81   ? 30.109  -2.747  112.197 1.00 48.20  ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A 1  82   ? 28.677  2.340   113.279 1.00 42.50  ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A 1  82   ? 28.878  3.614   113.959 1.00 49.90  ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A 1  82   ? 27.580  4.394   114.131 1.00 53.18  ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A 1  82   ? 27.505  5.262   115.007 1.00 54.70  ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A 1  82   ? 29.905  4.455   113.200 1.00 52.14  ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A 1  82   ? 31.304  3.833   113.168 1.00 55.14  ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A 1  82   ? 32.255  4.632   112.293 1.00 55.37  ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A 1  82   ? 31.856  3.698   114.577 1.00 46.20  ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A 1  83   ? 26.561  4.106   113.318 1.00 53.27  ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A 1  83   ? 25.259  4.728   113.529 1.00 51.37  ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A 1  83   ? 24.662  4.323   114.868 1.00 52.39  ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A 1  83   ? 23.915  5.098   115.475 1.00 60.31  ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A 1  83   ? 24.303  4.362   112.395 1.00 47.70  ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A 1  83   ? 24.492  5.180   111.136 1.00 54.03  ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A 1  83   ? 23.542  4.731   110.034 1.00 62.93  ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A 1  83   ? 22.087  4.968   110.409 1.00 56.90  ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A 1  83   ? 21.162  4.532   109.324 1.00 46.79  ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A 1  84   ? 24.986  3.126   115.349 1.00 47.25  ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A 1  84   ? 24.466  2.629   116.612 1.00 64.03  ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A 1  84   ? 25.360  2.978   117.797 1.00 65.60  ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A 1  84   ? 25.137  2.467   118.899 1.00 64.76  ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A 1  84   ? 24.254  1.116   116.527 1.00 67.49  ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A 1  84   ? 23.174  0.724   115.523 1.00 72.84  ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A 1  84   ? 22.963  -0.774  115.429 1.00 91.62  ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A 1  84   ? 21.897  -1.188  114.922 1.00 88.31  ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A 1  84   ? 23.858  -1.535  115.857 1.00 99.05  ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A 1  85   ? 26.354  3.839   117.597 1.00 60.26  ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A 1  85   ? 27.189  4.289   118.701 1.00 52.71  ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A 1  85   ? 26.431  5.298   119.555 1.00 53.69  ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A 1  85   ? 25.888  6.280   119.040 1.00 53.73  ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A 1  85   ? 28.478  4.908   118.167 1.00 57.25  ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A 1  85   ? 29.456  5.404   119.231 1.00 57.18  ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A 1  85   ? 29.982  4.228   120.033 1.00 57.38  ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A 1  85   ? 30.597  6.195   118.611 1.00 51.07  ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A 1  86   ? 26.396  5.053   120.862 1.00 60.06  ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A 1  86   ? 25.722  5.918   121.825 1.00 55.40  ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A 1  86   ? 26.794  6.705   122.571 1.00 58.99  ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A 1  86   ? 27.583  6.129   123.330 1.00 63.11  ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A 1  86   ? 24.852  5.109   122.797 1.00 56.74  ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A 1  86   ? 24.072  6.036   123.715 1.00 62.90  ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A 1  86   ? 23.914  4.180   122.034 1.00 60.66  ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A 1  87   ? 26.822  8.019   122.373 1.00 55.87  ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A 1  87   ? 27.824  8.890   122.981 1.00 60.39  ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A 1  87   ? 27.108  9.864   123.906 1.00 61.26  ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A 1  87   ? 26.204  10.588  123.470 1.00 66.40  ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A 1  87   ? 28.637  9.645   121.918 1.00 61.28  ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A 1  87   ? 29.642  10.573  122.579 1.00 60.88  ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A 1  87   ? 29.335  8.667   120.985 1.00 56.79  ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A 1  88   ? 27.515  9.895   125.175 1.00 58.76  ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A 1  88   ? 26.912  10.753  126.184 1.00 63.08  ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A 1  88   ? 27.834  11.921  126.497 1.00 61.99  ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A 1  88   ? 29.023  11.721  126.773 1.00 63.20  ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A 1  88   ? 26.631  9.979   127.470 1.00 58.91  ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A 1  88   ? 26.118  10.880  128.566 1.00 60.85  ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A 1  88   ? 26.135  10.230  129.929 1.00 65.74  ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A 1  88   ? 25.672  11.177  130.939 1.00 66.18  ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A 1  88   ? 25.548  10.897  132.229 1.00 60.26  ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A 1  88   ? 25.853  9.686   132.677 1.00 60.02  ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A 1  88   ? 25.118  11.829  133.068 1.00 62.03  ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A 1  89   ? 27.279  13.129  126.469 1.00 63.02  ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A 1  89   ? 27.996  14.337  126.851 1.00 67.72  ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A 1  89   ? 27.634  14.686  128.285 1.00 72.41  ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A 1  89   ? 26.454  14.677  128.653 1.00 69.79  ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A 1  89   ? 27.654  15.514  125.934 1.00 60.05  ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A 1  89   ? 28.118  15.345  124.518 1.00 68.32  ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A 1  89   ? 28.930  14.284  124.155 1.00 65.55  ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A 1  89   ? 27.746  16.261  123.547 1.00 73.01  ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A 1  89   ? 29.352  14.134  122.850 1.00 65.72  ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A 1  89   ? 28.167  16.118  122.241 1.00 67.11  ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A 1  89   ? 28.970  15.055  121.891 1.00 66.35  ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A 1  90   ? 28.644  14.978  129.095 1.00 73.63  ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A 1  90   ? 28.376  15.409  130.457 1.00 69.36  ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A 1  90   ? 28.377  16.924  130.596 1.00 65.60  ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A 1  90   ? 27.745  17.456  131.515 1.00 67.32  ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A 1  90   ? 29.385  14.763  131.407 1.00 66.47  ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A 1  90   ? 29.101  13.267  131.573 1.00 60.16  ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A 1  90   ? 30.313  12.420  131.242 1.00 53.40  ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A 1  90   ? 28.598  12.987  132.977 1.00 62.48  ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A 1  91   ? 29.065  17.631  129.705 1.00 71.07  ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A 1  91   ? 29.059  19.087  129.721 1.00 73.44  ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A 1  91   ? 27.907  19.602  128.865 1.00 76.57  ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A 1  91   ? 27.829  19.255  127.678 1.00 75.91  ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A 1  91   ? 30.379  19.636  129.209 1.00 73.35  ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A 1  91   ? 30.574  21.097  129.555 1.00 78.45  ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A 1  91   ? 29.691  21.927  129.334 1.00 83.02  ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A 1  91   ? 31.734  21.419  130.116 1.00 81.68  ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A 1  92   ? 27.001  20.416  129.415 1.00 71.56  ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A 1  92   ? 25.873  20.914  128.610 1.00 69.28  ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A 1  92   ? 26.281  21.908  127.542 1.00 71.37  ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A 1  92   ? 25.534  22.087  126.573 1.00 77.74  ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A 1  92   ? 24.956  21.569  129.652 1.00 72.71  ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A 1  92   ? 25.420  21.037  130.978 1.00 76.19  ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A 1  92   ? 26.887  20.810  130.826 1.00 70.98  ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A 1  93   ? 27.430  22.563  127.687 1.00 70.23  ? 93   SER A N     1 
ATOM   703   C  CA    . SER A 1  93   ? 27.890  23.532  126.702 1.00 77.55  ? 93   SER A CA    1 
ATOM   704   C  C     . SER A 1  93   ? 28.534  22.882  125.483 1.00 86.52  ? 93   SER A C     1 
ATOM   705   O  O     . SER A 1  93   ? 28.764  23.570  124.481 1.00 84.18  ? 93   SER A O     1 
ATOM   706   C  CB    . SER A 1  93   ? 28.881  24.493  127.360 1.00 76.90  ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A 1  93   ? 28.427  24.872  128.649 1.00 73.48  ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A 1  94   ? 28.809  21.581  125.542 1.00 84.40  ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A 1  94   ? 29.572  20.881  124.514 1.00 78.44  ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A 1  94   ? 28.668  20.529  123.336 1.00 82.64  ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A 1  94   ? 27.672  19.816  123.504 1.00 82.37  ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A 1  94   ? 30.191  19.622  125.117 1.00 67.80  ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A 1  94   ? 31.525  19.053  124.642 1.00 63.23  ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A 1  94   ? 31.542  17.571  124.965 1.00 67.16  ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A 1  94   ? 31.788  19.312  123.171 1.00 70.54  ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A 1  95   ? 29.017  21.014  122.142 1.00 78.78  ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A 1  95   ? 28.201  20.751  120.961 1.00 77.58  ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A 1  95   ? 28.698  19.561  120.142 1.00 74.19  ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A 1  95   ? 27.882  18.772  119.651 1.00 68.59  ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A 1  95   ? 28.135  21.996  120.070 1.00 78.20  ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A 1  95   ? 27.338  23.156  120.663 1.00 89.51  ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A 1  95   ? 25.876  22.809  120.917 1.00 97.30  ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1  95   ? 25.302  21.950  120.246 1.00 100.72 ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1  95   ? 25.269  23.479  121.891 1.00 96.09  ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A 1  96   ? 30.012  19.409  119.976 1.00 78.93  ? 96   THR A N     1 
ATOM   726   C  CA    . THR A 1  96   ? 30.531  18.397  119.065 1.00 68.09  ? 96   THR A CA    1 
ATOM   727   C  C     . THR A 1  96   ? 31.847  17.829  119.582 1.00 63.68  ? 96   THR A C     1 
ATOM   728   O  O     . THR A 1  96   ? 32.651  18.534  120.199 1.00 61.27  ? 96   THR A O     1 
ATOM   729   C  CB    . THR A 1  96   ? 30.736  18.965  117.657 1.00 68.30  ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A 1  96   ? 31.654  18.133  116.934 1.00 69.82  ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A 1  96   ? 31.276  20.390  117.724 1.00 62.02  ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A 1  97   ? 32.059  16.542  119.304 1.00 67.40  ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A 1  97   ? 33.256  15.816  119.724 1.00 66.84  ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A 1  97   ? 33.778  15.000  118.546 1.00 69.14  ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A 1  97   ? 32.997  14.475  117.747 1.00 74.52  ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A 1  97   ? 32.966  14.901  120.935 1.00 52.01  ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A 1  97   ? 34.217  14.162  121.361 1.00 59.55  ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A 1  97   ? 32.437  15.715  122.089 1.00 65.75  ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A 1  98   ? 35.101  14.892  118.431 1.00 61.24  ? 98   THR A N     1 
ATOM   740   C  CA    . THR A 1  98   ? 35.730  14.051  117.415 1.00 58.01  ? 98   THR A CA    1 
ATOM   741   C  C     . THR A 1  98   ? 36.477  12.914  118.104 1.00 52.62  ? 98   THR A C     1 
ATOM   742   O  O     . THR A 1  98   ? 37.572  13.114  118.640 1.00 55.87  ? 98   THR A O     1 
ATOM   743   C  CB    . THR A 1  98   ? 36.663  14.867  116.523 1.00 62.92  ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A 1  98   ? 35.886  15.763  115.719 1.00 63.79  ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A 1  98   ? 37.465  13.951  115.606 1.00 60.00  ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A 1  99   ? 35.885  11.722  118.077 1.00 52.81  ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A 1  99   ? 36.499  10.539  118.662 1.00 56.61  ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A 1  99   ? 37.526  9.948   117.708 1.00 61.62  ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A 1  99   ? 37.296  9.866   116.497 1.00 66.70  ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A 1  99   ? 35.439  9.485   118.989 1.00 54.37  ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A 1  99   ? 34.746  9.501   120.355 1.00 60.70  ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A 1  99   ? 33.920  10.753  120.540 1.00 53.33  ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A 1  99   ? 33.877  8.264   120.519 1.00 60.11  ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A 1  100  ? 38.658  9.525   118.260 1.00 62.85  ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A 1  100  ? 39.744  8.941   117.486 1.00 56.22  ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A 1  100  ? 39.888  7.471   117.847 1.00 56.63  ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A 1  100  ? 39.847  7.110   119.028 1.00 64.21  ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A 1  100  ? 41.059  9.682   117.742 1.00 55.76  ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A 1  100  ? 41.018  11.206  117.605 1.00 59.70  ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A 1  100  ? 42.422  11.793  117.689 1.00 67.41  ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A 1  100  ? 40.335  11.620  116.312 1.00 62.91  ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A 1  101  ? 40.048  6.627   116.832 1.00 60.48  ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A 1  101  ? 40.262  5.200   117.032 1.00 58.93  ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A 1  101  ? 41.449  4.775   116.183 1.00 62.48  ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A 1  101  ? 41.495  5.069   114.986 1.00 60.54  ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A 1  101  ? 39.008  4.391   116.666 1.00 55.91  ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A 1  101  ? 38.944  2.902   117.027 1.00 58.65  ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A 1  101  ? 37.498  2.495   117.256 1.00 61.79  ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A 1  101  ? 39.576  2.028   115.948 1.00 54.01  ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A 1  102  ? 42.414  4.105   116.802 1.00 65.13  ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A 1  102  ? 43.600  3.621   116.105 1.00 57.09  ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A 1  102  ? 43.856  2.200   116.583 1.00 62.21  ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A 1  102  ? 44.198  1.987   117.752 1.00 67.85  ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A 1  102  ? 44.802  4.530   116.368 1.00 61.00  ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A 1  102  ? 45.813  4.586   115.237 1.00 67.29  ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A 1  102  ? 46.691  5.830   115.337 1.00 73.04  ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A 1  102  ? 45.865  7.105   115.217 1.00 65.42  ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A 1  102  ? 46.699  8.337   115.311 1.00 64.77  ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A 1  103  ? 43.672  1.228   115.692 1.00 61.59  ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A 1  103  ? 43.791  -0.174  116.060 1.00 67.99  ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A 1  103  ? 44.505  -0.926  114.948 1.00 67.52  ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A 1  103  ? 44.549  -0.486  113.796 1.00 64.75  ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A 1  103  ? 42.419  -0.804  116.337 1.00 64.45  ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A 1  104  ? 45.059  -2.078  115.310 1.00 67.11  ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A 1  104  ? 45.864  -2.862  114.385 1.00 74.13  ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A 1  104  ? 45.964  -4.286  114.917 1.00 70.60  ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A 1  104  ? 45.430  -4.613  115.981 1.00 64.46  ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A 1  104  ? 47.244  -2.228  114.193 1.00 85.70  ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A 1  104  ? 47.954  -1.891  115.492 1.00 87.84  ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A 1  104  ? 49.195  -1.052  115.272 1.00 94.80  ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A 1  104  ? 49.931  -0.809  116.252 1.00 105.28 ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A 1  104  ? 49.433  -0.636  114.118 1.00 102.06 ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A 1  105  ? 46.655  -5.134  114.158 1.00 77.61  ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A 1  105  ? 46.819  -6.525  114.506 1.00 77.82  ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A 1  105  ? 45.500  -7.267  114.490 1.00 75.02  ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A 1  105  ? 44.432  -6.677  114.300 1.00 73.69  ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A 1  106  ? 45.545  -8.586  114.666 1.00 71.28  ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A 1  106  ? 44.296  -9.343  114.818 1.00 61.98  ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A 1  106  ? 43.568  -8.914  116.080 1.00 61.14  ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A 1  106  ? 44.103  -9.011  117.187 1.00 66.41  ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A 1  106  ? 44.768  -10.798 114.906 1.00 65.01  ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A 1  106  ? 46.119  -10.803 114.298 1.00 72.42  ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A 1  106  ? 46.722  -9.467  114.612 1.00 75.71  ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A 1  107  ? 42.344  -8.424  115.904 1.00 67.09  ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A 1  107  ? 41.491  -8.074  117.033 1.00 68.50  ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A 1  107  ? 40.088  -7.821  116.502 1.00 64.18  ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A 1  107  ? 39.865  -7.720  115.293 1.00 61.02  ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A 1  107  ? 42.016  -6.857  117.807 1.00 65.09  ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A 1  107  ? 41.860  -5.527  117.094 1.00 65.82  ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A 1  107  ? 42.295  -4.377  117.996 1.00 66.02  ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A 1  107  ? 41.504  -4.365  119.296 1.00 59.93  ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A 1  107  ? 41.925  -3.261  120.198 1.00 64.02  ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A 1  108  ? 39.138  -7.751  117.424 1.00 62.19  ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A 1  108  ? 37.768  -7.364  117.108 1.00 59.04  ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A 1  108  ? 37.530  -6.007  117.762 1.00 54.26  ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A 1  108  ? 37.287  -5.918  118.969 1.00 63.99  ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A 1  108  ? 36.775  -8.423  117.576 1.00 59.11  ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A 1  108  ? 36.857  -9.722  116.779 1.00 55.54  ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A 1  108  ? 35.614  -10.589 116.912 1.00 76.66  ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A 1  108  ? 34.819  -10.370 117.852 1.00 76.41  ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A 1  108  ? 35.432  -11.492 116.064 1.00 78.75  ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A 1  109  ? 37.613  -4.955  116.956 1.00 52.05  ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A 1  109  ? 37.545  -3.587  117.451 1.00 51.03  ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A 1  109  ? 36.106  -3.263  117.820 1.00 51.69  ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A 1  109  ? 35.215  -3.287  116.960 1.00 54.46  ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A 1  109  ? 38.077  -2.597  116.407 1.00 54.76  ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A 1  109  ? 37.988  -1.173  116.933 1.00 52.33  ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A 1  109  ? 39.502  -2.951  116.020 1.00 55.91  ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A 1  110  ? 35.890  -2.940  119.097 1.00 58.13  ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A 1  110  ? 34.617  -2.518  119.661 1.00 55.57  ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A 1  110  ? 34.654  -1.020  119.954 1.00 53.30  ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A 1  110  ? 35.700  -0.370  119.867 1.00 54.82  ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A 1  110  ? 34.308  -3.305  120.935 1.00 44.66  ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A 1  110  ? 34.626  -4.783  120.857 1.00 46.14  ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A 1  110  ? 33.609  -5.543  120.026 1.00 51.34  ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A 1  110  ? 33.903  -7.035  120.051 1.00 57.49  ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A 1  110  ? 32.873  -7.830  119.329 1.00 62.69  ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A 1  111  ? 33.494  -0.477  120.333 1.00 52.06  ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A 1  111  ? 33.376  0.942   120.655 1.00 58.49  ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A 1  111  ? 34.222  1.353   121.852 1.00 66.40  ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A 1  111  ? 34.449  2.552   122.046 1.00 69.05  ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A 1  111  ? 31.913  1.294   120.921 1.00 63.00  ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A 1  112  ? 34.696  0.391   122.647 1.00 66.52  ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A 1  112  ? 35.525  0.707   123.802 1.00 62.64  ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A 1  112  ? 36.871  1.281   123.383 1.00 70.19  ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A 1  112  ? 37.447  2.100   124.108 1.00 72.75  ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A 1  112  ? 35.726  -0.554  124.641 1.00 59.76  ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A 1  112  ? 36.070  -0.335  126.104 1.00 72.35  ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A 1  112  ? 36.346  -1.677  126.776 1.00 79.27  ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A 1  112  ? 35.981  -2.804  125.915 1.00 82.51  ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A 1  112  ? 34.841  -3.484  126.007 1.00 86.17  ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A 1  112  ? 33.945  -3.156  126.929 1.00 82.96  ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A 1  112  ? 34.598  -4.492  125.177 1.00 75.49  ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A 1  113  ? 37.379  0.873   122.217 1.00 66.90  ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A 1  113  ? 38.725  1.210   121.767 1.00 57.96  ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A 1  113  ? 38.890  2.676   121.384 1.00 59.50  ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A 1  113  ? 40.003  3.072   121.025 1.00 63.64  ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A 1  113  ? 39.108  0.314   120.587 1.00 53.68  ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A 1  113  ? 39.208  -1.153  120.977 1.00 60.17  ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A 1  113  ? 40.169  -1.520  121.686 1.00 66.47  ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A 1  113  ? 38.318  -1.939  120.589 1.00 57.48  ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A 1  114  ? 37.835  3.484   121.438 1.00 60.17  ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A 1  114  ? 37.983  4.906   121.164 1.00 62.48  ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A 1  114  ? 38.808  5.576   122.255 1.00 68.47  ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A 1  114  ? 38.752  5.198   123.429 1.00 64.67  ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A 1  114  ? 36.618  5.584   121.052 1.00 65.93  ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A 1  114  ? 35.959  5.399   119.719 1.00 66.96  ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A 1  114  ? 36.400  6.101   118.608 1.00 65.89  ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A 1  114  ? 34.899  4.522   119.573 1.00 61.81  ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A 1  114  ? 35.792  5.932   117.376 1.00 61.51  ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A 1  114  ? 34.288  4.353   118.349 1.00 57.66  ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A 1  114  ? 34.736  5.056   117.247 1.00 56.34  ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A 1  115  ? 39.578  6.577   121.854 1.00 67.58  ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A 1  115  ? 40.442  7.274   122.796 1.00 61.51  ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A 1  115  ? 39.594  8.110   123.745 1.00 66.01  ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A 1  115  ? 38.663  8.792   123.296 1.00 64.79  ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A 1  115  ? 41.444  8.155   122.057 1.00 58.74  ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A 1  115  ? 42.378  7.413   121.096 1.00 69.90  ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A 1  115  ? 43.473  8.339   120.593 1.00 72.36  ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A 1  115  ? 42.974  6.173   121.752 1.00 71.07  ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A 1  116  ? 39.870  8.075   125.049 1.00 70.44  ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A 1  116  ? 39.033  8.810   126.007 1.00 67.53  ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A 1  116  ? 39.107  10.316  125.800 1.00 67.60  ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A 1  116  ? 40.163  10.874  125.493 1.00 65.40  ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A 1  116  ? 39.613  8.404   127.368 1.00 62.22  ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A 1  116  ? 40.328  7.116   127.114 1.00 63.81  ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A 1  116  ? 40.861  7.216   125.719 1.00 64.11  ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A 1  117  ? 37.961  10.972  125.972 1.00 66.19  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A 1  117  ? 37.848  12.422  125.886 1.00 73.07  ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A 1  117  ? 37.132  12.917  127.135 1.00 83.21  ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A 1  117  ? 36.275  12.228  127.699 1.00 78.95  ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A 1  117  ? 37.108  12.868  124.603 1.00 63.29  ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A 1  117  ? 37.054  14.386  124.506 1.00 64.72  ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A 1  117  ? 37.785  12.286  123.374 1.00 64.93  ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A 1  118  ? 37.503  14.117  127.579 1.00 83.36  ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A 1  118  ? 36.916  14.684  128.785 1.00 84.69  ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A 1  118  ? 35.423  14.934  128.602 1.00 80.24  ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A 1  118  ? 34.977  15.411  127.554 1.00 77.05  ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A 1  118  ? 37.630  15.986  129.155 1.00 88.51  ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A 1  119  ? 34.650  14.597  129.638 1.00 78.94  ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A 1  119  ? 33.205  14.829  129.677 1.00 84.12  ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A 1  119  ? 32.475  14.110  128.544 1.00 82.89  ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A 1  119  ? 31.475  14.611  128.023 1.00 84.17  ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A 1  119  ? 32.877  16.327  129.654 1.00 89.88  ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A 1  119  ? 33.443  17.071  130.852 1.00 91.44  ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A 1  119  ? 33.769  16.412  131.864 1.00 93.20  ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A 1  119  ? 33.553  18.315  130.784 1.00 85.27  ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A 1  120  ? 32.965  12.933  128.150 1.00 74.07  ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A 1  120  ? 32.359  12.143  127.081 1.00 65.23  ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A 1  120  ? 32.436  10.674  127.469 1.00 62.04  ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A 1  120  ? 33.532  10.151  127.702 1.00 63.60  ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A 1  120  ? 33.052  12.367  125.726 1.00 67.32  ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A 1  120  ? 32.581  11.333  124.724 1.00 68.51  ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A 1  120  ? 32.782  13.772  125.210 1.00 66.41  ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A 1  121  ? 31.285  10.001  127.517 1.00 64.81  ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A 1  121  ? 31.213  8.604   127.933 1.00 67.81  ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A 1  121  ? 30.469  7.781   126.890 1.00 70.81  ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A 1  121  ? 29.372  8.156   126.467 1.00 74.07  ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A 1  121  ? 30.517  8.468   129.291 1.00 66.17  ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A 1  121  ? 30.329  7.032   129.751 1.00 67.71  ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A 1  121  ? 29.331  6.912   130.889 1.00 77.94  ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A 1  121  ? 28.827  7.958   131.353 1.00 78.36  ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A 1  121  ? 29.048  5.771   131.315 1.00 75.06  ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A 1  122  ? 31.049  6.654   126.491 1.00 65.75  ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A 1  122  ? 30.420  5.763   125.522 1.00 62.49  ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A 1  122  ? 29.539  4.775   126.278 1.00 63.05  ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A 1  122  ? 30.035  3.975   127.079 1.00 69.24  ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A 1  122  ? 31.467  5.034   124.666 1.00 60.52  ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A 1  122  ? 32.103  5.991   123.656 1.00 56.34  ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A 1  122  ? 30.840  3.853   123.942 1.00 61.78  ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A 1  122  ? 33.246  6.809   124.210 1.00 69.96  ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A 1  123  ? 28.231  4.828   126.018 1.00 58.97  ? 123  MET A N     1 
ATOM   933   C  CA    . MET A 1  123  ? 27.259  4.036   126.762 1.00 55.26  ? 123  MET A CA    1 
ATOM   934   C  C     . MET A 1  123  ? 27.187  2.583   126.311 1.00 54.81  ? 123  MET A C     1 
ATOM   935   O  O     . MET A 1  123  ? 26.596  1.763   127.021 1.00 58.58  ? 123  MET A O     1 
ATOM   936   C  CB    . MET A 1  123  ? 25.870  4.668   126.646 1.00 54.03  ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A 1  123  ? 25.838  6.154   126.962 1.00 64.59  ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A 1  123  ? 26.509  6.557   128.586 1.00 73.85  ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A 1  123  ? 25.485  5.535   129.646 1.00 64.04  ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A 1  124  ? 27.747  2.244   125.153 1.00 61.15  ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A 1  124  ? 27.749  0.873   124.643 1.00 62.31  ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A 1  124  ? 29.170  0.512   124.239 1.00 63.53  ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A 1  124  ? 29.504  0.474   123.047 1.00 64.46  ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A 1  124  ? 26.772  0.708   123.475 1.00 67.19  ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A 1  124  ? 26.840  1.857   122.481 1.00 58.66  ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A 1  124  ? 27.334  2.939   122.794 1.00 56.57  ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A 1  124  ? 26.323  1.627   121.280 1.00 63.65  ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A 1  125  ? 30.041  0.237   125.214 1.00 61.66  ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A 1  125  ? 31.425  -0.127  124.876 1.00 71.38  ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A 1  125  ? 31.565  -1.518  124.277 1.00 64.30  ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A 1  125  ? 32.612  -1.814  123.688 1.00 60.26  ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A 1  125  ? 32.151  -0.020  126.223 1.00 77.95  ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A 1  125  ? 31.085  -0.273  127.237 1.00 68.57  ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A 1  125  ? 29.824  0.314   126.669 1.00 57.05  ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A 1  126  ? 30.558  -2.379  124.410 1.00 63.97  ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A 1  126  ? 30.593  -3.715  123.828 1.00 67.59  ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A 1  126  ? 30.139  -3.739  122.375 1.00 66.98  ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A 1  126  ? 30.206  -4.796  121.735 1.00 60.36  ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A 1  126  ? 29.729  -4.669  124.657 1.00 76.38  ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A 1  126  ? 30.410  -5.106  125.938 1.00 89.67  ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A 1  126  ? 31.237  -4.331  126.469 1.00 88.04  ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A 1  126  ? 30.132  -6.232  126.404 1.00 96.38  ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A 1  127  ? 29.682  -2.605  121.848 1.00 68.15  ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A 1  127  ? 29.238  -2.533  120.463 1.00 57.63  ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A 1  127  ? 30.382  -2.876  119.522 1.00 55.55  ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A 1  127  ? 31.466  -2.292  119.603 1.00 55.21  ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A 1  127  ? 28.704  -1.133  120.161 1.00 51.97  ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A 1  127  ? 28.374  -0.801  118.706 1.00 57.72  ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A 1  127  ? 27.271  -1.707  118.176 1.00 61.99  ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A 1  127  ? 27.986  0.664   118.577 1.00 53.65  ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A 1  128  ? 30.138  -3.828  118.629 1.00 56.11  ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A 1  128  ? 31.145  -4.214  117.655 1.00 56.03  ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A 1  128  ? 31.244  -3.174  116.547 1.00 52.94  ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A 1  128  ? 30.231  -2.671  116.054 1.00 50.83  ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A 1  128  ? 30.816  -5.579  117.055 1.00 58.31  ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A 1  128  ? 31.851  -6.077  116.098 1.00 51.28  ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A 1  128  ? 32.742  -7.076  116.421 1.00 53.19  ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A 1  128  ? 32.146  -5.704  114.830 1.00 52.84  ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A 1  128  ? 33.537  -7.303  115.390 1.00 57.82  ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A 1  128  ? 33.197  -6.483  114.412 1.00 56.01  ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A 1  129  ? 32.477  -2.856  116.155 1.00 51.38  ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A 1  129  ? 32.749  -1.926  115.061 1.00 53.40  ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A 1  129  ? 33.343  -2.647  113.856 1.00 55.54  ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A 1  129  ? 32.787  -2.601  112.757 1.00 55.06  ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A 1  129  ? 33.664  -0.771  115.522 1.00 46.53  ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A 1  129  ? 32.941  0.107   116.533 1.00 48.07  ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A 1  129  ? 34.125  0.053   114.324 1.00 50.36  ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A 1  129  ? 33.759  1.291   116.962 1.00 63.01  ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A 1  130  ? 34.485  -3.307  114.038 1.00 53.05  ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A 1  130  ? 35.159  -3.920  112.902 1.00 48.70  ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A 1  130  ? 35.916  -5.159  113.356 1.00 54.37  ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A 1  130  ? 36.135  -5.376  114.547 1.00 62.58  ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A 1  130  ? 36.111  -2.931  112.215 1.00 57.54  ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A 1  131  ? 36.309  -5.977  112.384 1.00 58.61  ? 131  THR A N     1 
ATOM   995   C  CA    . THR A 1  131  ? 37.120  -7.168  112.620 1.00 56.73  ? 131  THR A CA    1 
ATOM   996   C  C     . THR A 1  131  ? 38.430  -6.997  111.859 1.00 62.18  ? 131  THR A C     1 
ATOM   997   O  O     . THR A 1  131  ? 38.444  -7.045  110.624 1.00 61.14  ? 131  THR A O     1 
ATOM   998   C  CB    . THR A 1  131  ? 36.381  -8.430  112.174 1.00 52.19  ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A 1  131  ? 35.109  -8.497  112.830 1.00 55.97  ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A 1  131  ? 37.190  -9.677  112.512 1.00 51.41  ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A 1  132  ? 39.527  -6.784  112.585 1.00 64.20  ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A 1  132  ? 40.833  -6.586  111.978 1.00 58.85  ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A 1  132  ? 41.649  -7.871  112.034 1.00 59.84  ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A 1  132  ? 41.663  -8.577  113.049 1.00 58.63  ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A 1  132  ? 41.595  -5.454  112.666 1.00 57.16  ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A 1  132  ? 41.482  -4.083  111.997 1.00 59.11  ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A 1  132  ? 40.031  -3.627  111.903 1.00 59.99  ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A 1  132  ? 42.320  -3.060  112.741 1.00 63.85  ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A 1  133  ? 42.332  -8.156  110.934 1.00 65.45  ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A 1  133  ? 43.107  -9.366  110.737 1.00 68.50  ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A 1  133  ? 44.588  -9.054  110.943 1.00 73.56  ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A 1  133  ? 44.980  -7.901  111.144 1.00 75.81  ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A 1  133  ? 42.829  -9.912  109.334 1.00 70.98  ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A 1  133  ? 43.307  -11.318 109.048 1.00 73.05  ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A 1  133  ? 43.465  -11.564 107.559 1.00 70.24  ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A 1  133  ? 43.183  -10.639 106.763 1.00 62.08  ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A 1  133  ? 43.876  -12.680 107.185 1.00 64.87  ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A 1  134  ? 45.420  -10.094 110.898 1.00 73.55  ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A 1  134  ? 46.863  -9.893  110.898 1.00 79.38  ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A 1  134  ? 47.253  -8.977  109.748 1.00 74.91  ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A 1  134  ? 46.896  -9.224  108.593 1.00 70.29  ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A 1  134  ? 47.589  -11.234 110.776 1.00 83.95  ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A 1  134  ? 48.554  -11.550 111.917 1.00 88.50  ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A 1  134  ? 49.591  -10.462 112.147 1.00 93.56  ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A 1  134  ? 49.918  -10.188 113.322 1.00 91.40  ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A 1  134  ? 50.079  -9.878  111.156 1.00 91.70  ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A 1  135  ? 47.978  -7.907  110.067 1.00 77.48  ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A 1  135  ? 48.309  -6.895  109.090 1.00 77.42  ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A 1  135  ? 47.220  -5.877  108.836 1.00 72.11  ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A 1  135  ? 47.484  -4.860  108.181 1.00 72.35  ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A 1  136  ? 46.006  -6.113  109.326 1.00 70.21  ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A 1  136  ? 44.952  -5.127  109.181 1.00 72.88  ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A 1  136  ? 45.162  -3.955  110.124 1.00 77.89  ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A 1  136  ? 45.558  -4.120  111.280 1.00 74.80  ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A 1  137  ? 44.898  -2.754  109.614 1.00 75.43  ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A 1  137  ? 45.041  -1.524  110.379 1.00 77.36  ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A 1  137  ? 43.828  -0.642  110.126 1.00 70.34  ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A 1  137  ? 43.336  -0.567  108.997 1.00 76.98  ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A 1  137  ? 46.335  -0.783  110.007 1.00 82.45  ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A 1  137  ? 47.560  -1.243  110.792 1.00 90.17  ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A 1  137  ? 48.870  -0.827  110.130 1.00 101.54 ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A 1  137  ? 48.814  0.515   109.555 1.00 119.16 ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A 1  137  ? 48.792  0.769   108.249 1.00 112.89 ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A 1  137  ? 48.825  -0.230  107.376 1.00 101.39 ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A 1  137  ? 48.740  2.022   107.814 1.00 100.87 ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A 1  138  ? 43.342  0.017   111.178 1.00 65.28  ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A 1  138  ? 42.168  0.877   111.073 1.00 59.07  ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A 1  138  ? 42.400  2.144   111.884 1.00 63.32  ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A 1  138  ? 42.616  2.076   113.099 1.00 68.83  ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A 1  138  ? 40.909  0.148   111.557 1.00 64.90  ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A 1  138  ? 39.590  0.929   111.560 1.00 67.99  ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A 1  138  ? 39.215  1.372   110.157 1.00 63.08  ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A 1  138  ? 38.474  0.097   112.171 1.00 60.88  ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A 1  139  ? 42.358  3.296   111.211 1.00 62.10  ? 139  ASN A N     1 
ATOM   1055  C  CA    A ASN A 1  139  ? 42.496  4.598   111.854 0.50 59.84  ? 139  ASN A CA    1 
ATOM   1056  C  CA    B ASN A 1  139  ? 42.496  4.599   111.851 0.50 59.95  ? 139  ASN A CA    1 
ATOM   1057  C  C     . ASN A 1  139  ? 41.309  5.461   111.451 1.00 59.45  ? 139  ASN A C     1 
ATOM   1058  O  O     . ASN A 1  139  ? 41.163  5.808   110.275 1.00 63.75  ? 139  ASN A O     1 
ATOM   1059  C  CB    A ASN A 1  139  ? 43.812  5.276   111.465 0.50 60.17  ? 139  ASN A CB    1 
ATOM   1060  C  CB    B ASN A 1  139  ? 43.809  5.279   111.449 0.50 60.18  ? 139  ASN A CB    1 
ATOM   1061  C  CG    A ASN A 1  139  ? 43.988  6.629   112.128 0.50 61.58  ? 139  ASN A CG    1 
ATOM   1062  C  CG    B ASN A 1  139  ? 45.016  4.376   111.624 0.50 61.30  ? 139  ASN A CG    1 
ATOM   1063  O  OD1   A ASN A 1  139  ? 43.409  6.899   113.182 0.50 62.08  ? 139  ASN A OD1   1 
ATOM   1064  O  OD1   B ASN A 1  139  ? 44.995  3.436   112.416 0.50 58.68  ? 139  ASN A OD1   1 
ATOM   1065  N  ND2   A ASN A 1  139  ? 44.789  7.490   111.511 0.50 61.90  ? 139  ASN A ND2   1 
ATOM   1066  N  ND2   B ASN A 1  139  ? 46.076  4.660   110.881 0.50 68.69  ? 139  ASN A ND2   1 
ATOM   1067  N  N     . MET A 1  140  ? 40.469  5.811   112.425 1.00 57.56  ? 140  MET A N     1 
ATOM   1068  C  CA    . MET A 1  140  ? 39.246  6.558   112.175 1.00 55.88  ? 140  MET A CA    1 
ATOM   1069  C  C     . MET A 1  140  ? 39.166  7.809   113.036 1.00 53.89  ? 140  MET A C     1 
ATOM   1070  O  O     . MET A 1  140  ? 39.649  7.841   114.173 1.00 65.40  ? 140  MET A O     1 
ATOM   1071  C  CB    . MET A 1  140  ? 37.998  5.712   112.453 1.00 59.16  ? 140  MET A CB    1 
ATOM   1072  C  CG    . MET A 1  140  ? 37.951  4.395   111.719 1.00 67.49  ? 140  MET A CG    1 
ATOM   1073  S  SD    . MET A 1  140  ? 36.352  3.600   111.926 1.00 73.51  ? 140  MET A SD    1 
ATOM   1074  C  CE    . MET A 1  140  ? 36.238  3.544   113.712 1.00 62.06  ? 140  MET A CE    1 
ATOM   1075  N  N     . GLU A 1  141  ? 38.528  8.834   112.473 1.00 49.64  ? 141  GLU A N     1 
ATOM   1076  C  CA    . GLU A 1  141  ? 38.077  10.016  113.201 1.00 56.30  ? 141  GLU A CA    1 
ATOM   1077  C  C     . GLU A 1  141  ? 36.579  10.149  112.956 1.00 61.31  ? 141  GLU A C     1 
ATOM   1078  O  O     . GLU A 1  141  ? 36.153  10.380  111.819 1.00 66.95  ? 141  GLU A O     1 
ATOM   1079  C  CB    . GLU A 1  141  ? 38.814  11.271  112.739 1.00 55.68  ? 141  GLU A CB    1 
ATOM   1080  C  CG    . GLU A 1  141  ? 40.317  11.128  112.662 1.00 58.68  ? 141  GLU A CG    1 
ATOM   1081  C  CD    . GLU A 1  141  ? 40.987  12.409  112.218 1.00 69.36  ? 141  GLU A CD    1 
ATOM   1082  O  OE1   . GLU A 1  141  ? 40.260  13.373  111.895 1.00 70.39  ? 141  GLU A OE1   1 
ATOM   1083  O  OE2   . GLU A 1  141  ? 42.235  12.453  112.193 1.00 75.06  ? 141  GLU A OE2   1 
ATOM   1084  N  N     . VAL A 1  142  ? 35.777  9.999   114.009 1.00 58.16  ? 142  VAL A N     1 
ATOM   1085  C  CA    . VAL A 1  142  ? 34.322  10.046  113.894 1.00 54.73  ? 142  VAL A CA    1 
ATOM   1086  C  C     . VAL A 1  142  ? 33.810  11.295  114.604 1.00 52.15  ? 142  VAL A C     1 
ATOM   1087  O  O     . VAL A 1  142  ? 34.174  11.563  115.753 1.00 62.90  ? 142  VAL A O     1 
ATOM   1088  C  CB    . VAL A 1  142  ? 33.665  8.762   114.438 1.00 46.93  ? 142  VAL A CB    1 
ATOM   1089  C  CG1   . VAL A 1  142  ? 34.204  7.545   113.695 1.00 52.95  ? 142  VAL A CG1   1 
ATOM   1090  C  CG2   . VAL A 1  142  ? 33.898  8.599   115.922 1.00 53.62  ? 142  VAL A CG2   1 
ATOM   1091  N  N     . ARG A 1  143  ? 32.984  12.069  113.908 1.00 44.63  ? 143  ARG A N     1 
ATOM   1092  C  CA    . ARG A 1  143  ? 32.435  13.312  114.432 1.00 51.52  ? 143  ARG A CA    1 
ATOM   1093  C  C     . ARG A 1  143  ? 31.019  13.077  114.939 1.00 58.28  ? 143  ARG A C     1 
ATOM   1094  O  O     . ARG A 1  143  ? 30.161  12.579  114.192 1.00 58.87  ? 143  ARG A O     1 
ATOM   1095  C  CB    . ARG A 1  143  ? 32.439  14.412  113.369 1.00 48.26  ? 143  ARG A CB    1 
ATOM   1096  C  CG    . ARG A 1  143  ? 31.586  15.612  113.755 1.00 50.94  ? 143  ARG A CG    1 
ATOM   1097  C  CD    . ARG A 1  143  ? 31.862  16.818  112.889 1.00 52.06  ? 143  ARG A CD    1 
ATOM   1098  N  NE    . ARG A 1  143  ? 30.977  17.931  113.220 1.00 54.52  ? 143  ARG A NE    1 
ATOM   1099  C  CZ    . ARG A 1  143  ? 31.125  19.168  112.756 1.00 65.48  ? 143  ARG A CZ    1 
ATOM   1100  N  NH1   . ARG A 1  143  ? 32.131  19.462  111.943 1.00 80.76  ? 143  ARG A NH1   1 
ATOM   1101  N  NH2   . ARG A 1  143  ? 30.269  20.115  113.107 1.00 70.17  ? 143  ARG A NH2   1 
ATOM   1102  N  N     . VAL A 1  144  ? 30.789  13.465  116.199 1.00 61.31  ? 144  VAL A N     1 
ATOM   1103  C  CA    . VAL A 1  144  ? 29.528  13.320  116.916 1.00 54.56  ? 144  VAL A CA    1 
ATOM   1104  C  C     . VAL A 1  144  ? 29.011  14.709  117.262 1.00 56.57  ? 144  VAL A C     1 
ATOM   1105  O  O     . VAL A 1  144  ? 29.764  15.545  117.778 1.00 56.30  ? 144  VAL A O     1 
ATOM   1106  C  CB    . VAL A 1  144  ? 29.710  12.491  118.199 1.00 50.12  ? 144  VAL A CB    1 
ATOM   1107  C  CG1   . VAL A 1  144  ? 28.416  12.434  118.984 1.00 53.26  ? 144  VAL A CG1   1 
ATOM   1108  C  CG2   . VAL A 1  144  ? 30.214  11.099  117.869 1.00 53.72  ? 144  VAL A CG2   1 
ATOM   1109  N  N     . ASP A 1  145  ? 27.726  14.943  117.005 1.00 61.42  ? 145  ASP A N     1 
ATOM   1110  C  CA    . ASP A 1  145  ? 27.094  16.229  117.260 1.00 60.53  ? 145  ASP A CA    1 
ATOM   1111  C  C     . ASP A 1  145  ? 25.831  16.045  118.095 1.00 61.73  ? 145  ASP A C     1 
ATOM   1112  O  O     . ASP A 1  145  ? 25.242  14.962  118.146 1.00 59.30  ? 145  ASP A O     1 
ATOM   1113  C  CB    . ASP A 1  145  ? 26.741  16.945  115.948 1.00 52.72  ? 145  ASP A CB    1 
ATOM   1114  C  CG    . ASP A 1  145  ? 27.913  17.692  115.356 1.00 60.17  ? 145  ASP A CG    1 
ATOM   1115  O  OD1   . ASP A 1  145  ? 28.159  18.839  115.783 1.00 62.02  ? 145  ASP A OD1   1 
ATOM   1116  O  OD2   . ASP A 1  145  ? 28.592  17.131  114.469 1.00 64.86  ? 145  ASP A OD2   1 
ATOM   1117  N  N     . ARG A 1  146  ? 25.422  17.127  118.755 1.00 60.93  ? 146  ARG A N     1 
ATOM   1118  C  CA    . ARG A 1  146  ? 24.094  17.197  119.340 1.00 53.77  ? 146  ARG A CA    1 
ATOM   1119  C  C     . ARG A 1  146  ? 23.071  17.542  118.262 1.00 54.42  ? 146  ARG A C     1 
ATOM   1120  O  O     . ARG A 1  146  ? 23.399  18.130  117.229 1.00 52.94  ? 146  ARG A O     1 
ATOM   1121  C  CB    . ARG A 1  146  ? 24.031  18.253  120.441 1.00 61.83  ? 146  ARG A CB    1 
ATOM   1122  C  CG    . ARG A 1  146  ? 24.902  17.998  121.643 1.00 68.87  ? 146  ARG A CG    1 
ATOM   1123  C  CD    . ARG A 1  146  ? 24.718  19.128  122.641 1.00 71.90  ? 146  ARG A CD    1 
ATOM   1124  N  NE    . ARG A 1  146  ? 25.437  18.892  123.888 1.00 78.94  ? 146  ARG A NE    1 
ATOM   1125  C  CZ    . ARG A 1  146  ? 24.934  18.230  124.925 1.00 80.42  ? 146  ARG A CZ    1 
ATOM   1126  N  NH1   . ARG A 1  146  ? 23.705  17.731  124.865 1.00 72.82  ? 146  ARG A NH1   1 
ATOM   1127  N  NH2   . ARG A 1  146  ? 25.661  18.066  126.022 1.00 77.53  ? 146  ARG A NH2   1 
ATOM   1128  N  N     . GLY A 1  147  ? 21.819  17.184  118.516 1.00 57.17  ? 147  GLY A N     1 
ATOM   1129  C  CA    . GLY A 1  147  ? 20.769  17.479  117.560 1.00 60.17  ? 147  GLY A CA    1 
ATOM   1130  C  C     . GLY A 1  147  ? 19.459  16.848  117.973 1.00 53.09  ? 147  GLY A C     1 
ATOM   1131  O  O     . GLY A 1  147  ? 19.360  16.172  119.001 1.00 50.22  ? 147  GLY A O     1 
ATOM   1132  N  N     . VAL A 1  148  ? 18.446  17.095  117.139 1.00 59.27  ? 148  VAL A N     1 
ATOM   1133  C  CA    . VAL A 1  148  ? 17.080  16.627  117.347 1.00 62.18  ? 148  VAL A CA    1 
ATOM   1134  C  C     . VAL A 1  148  ? 16.635  15.828  116.130 1.00 58.13  ? 148  VAL A C     1 
ATOM   1135  O  O     . VAL A 1  148  ? 16.944  16.192  114.990 1.00 55.99  ? 148  VAL A O     1 
ATOM   1136  C  CB    . VAL A 1  148  ? 16.097  17.795  117.573 1.00 59.27  ? 148  VAL A CB    1 
ATOM   1137  C  CG1   . VAL A 1  148  ? 15.062  17.427  118.627 1.00 56.25  ? 148  VAL A CG1   1 
ATOM   1138  C  CG2   . VAL A 1  148  ? 16.836  19.083  117.906 1.00 60.58  ? 148  VAL A CG2   1 
ATOM   1139  N  N     . GLY A 1  149  ? 15.886  14.757  116.372 1.00 55.12  ? 149  GLY A N     1 
ATOM   1140  C  CA    . GLY A 1  149  ? 15.235  14.079  115.271 1.00 57.74  ? 149  GLY A CA    1 
ATOM   1141  C  C     . GLY A 1  149  ? 16.187  13.291  114.387 1.00 54.28  ? 149  GLY A C     1 
ATOM   1142  O  O     . GLY A 1  149  ? 17.286  12.891  114.784 1.00 60.77  ? 149  GLY A O     1 
ATOM   1143  N  N     . TYR A 1  150  ? 15.726  13.067  113.158 1.00 52.14  ? 150  TYR A N     1 
ATOM   1144  C  CA    . TYR A 1  150  ? 16.418  12.248  112.166 1.00 52.27  ? 150  TYR A CA    1 
ATOM   1145  C  C     . TYR A 1  150  ? 16.835  13.132  110.998 1.00 52.01  ? 150  TYR A C     1 
ATOM   1146  O  O     . TYR A 1  150  ? 15.987  13.601  110.227 1.00 47.84  ? 150  TYR A O     1 
ATOM   1147  C  CB    . TYR A 1  150  ? 15.522  11.103  111.699 1.00 48.81  ? 150  TYR A CB    1 
ATOM   1148  C  CG    . TYR A 1  150  ? 16.001  10.401  110.447 1.00 49.00  ? 150  TYR A CG    1 
ATOM   1149  C  CD1   . TYR A 1  150  ? 17.041  9.483   110.495 1.00 51.33  ? 150  TYR A CD1   1 
ATOM   1150  C  CD2   . TYR A 1  150  ? 15.403  10.649  109.217 1.00 50.29  ? 150  TYR A CD2   1 
ATOM   1151  C  CE1   . TYR A 1  150  ? 17.478  8.836   109.351 1.00 51.89  ? 150  TYR A CE1   1 
ATOM   1152  C  CE2   . TYR A 1  150  ? 15.834  10.007  108.067 1.00 50.87  ? 150  TYR A CE2   1 
ATOM   1153  C  CZ    . TYR A 1  150  ? 16.872  9.101   108.141 1.00 47.57  ? 150  TYR A CZ    1 
ATOM   1154  O  OH    . TYR A 1  150  ? 17.312  8.454   107.009 1.00 51.20  ? 150  TYR A OH    1 
ATOM   1155  N  N     . VAL A 1  151  ? 18.139  13.349  110.866 1.00 52.14  ? 151  VAL A N     1 
ATOM   1156  C  CA    . VAL A 1  151  ? 18.713  14.162  109.802 1.00 48.80  ? 151  VAL A CA    1 
ATOM   1157  C  C     . VAL A 1  151  ? 19.560  13.256  108.910 1.00 55.29  ? 151  VAL A C     1 
ATOM   1158  O  O     . VAL A 1  151  ? 20.615  12.775  109.350 1.00 51.25  ? 151  VAL A O     1 
ATOM   1159  C  CB    . VAL A 1  151  ? 19.553  15.308  110.370 1.00 42.17  ? 151  VAL A CB    1 
ATOM   1160  C  CG1   . VAL A 1  151  ? 20.291  16.021  109.259 1.00 45.95  ? 151  VAL A CG1   1 
ATOM   1161  C  CG2   . VAL A 1  151  ? 18.661  16.287  111.135 1.00 48.16  ? 151  VAL A CG2   1 
ATOM   1162  N  N     . PRO A 1  152  ? 19.141  12.987  107.673 1.00 56.30  ? 152  PRO A N     1 
ATOM   1163  C  CA    . PRO A 1  152  ? 19.924  12.106  106.799 1.00 53.98  ? 152  PRO A CA    1 
ATOM   1164  C  C     . PRO A 1  152  ? 21.203  12.782  106.329 1.00 53.26  ? 152  PRO A C     1 
ATOM   1165  O  O     . PRO A 1  152  ? 21.330  14.008  106.329 1.00 51.73  ? 152  PRO A O     1 
ATOM   1166  C  CB    . PRO A 1  152  ? 18.980  11.831  105.620 1.00 51.03  ? 152  PRO A CB    1 
ATOM   1167  C  CG    . PRO A 1  152  ? 17.629  12.312  106.063 1.00 52.08  ? 152  PRO A CG    1 
ATOM   1168  C  CD    . PRO A 1  152  ? 17.885  13.416  107.039 1.00 50.34  ? 152  PRO A CD    1 
ATOM   1169  N  N     . ALA A 1  153  ? 22.164  11.949  105.923 1.00 52.58  ? 153  ALA A N     1 
ATOM   1170  C  CA    . ALA A 1  153  ? 23.453  12.462  105.474 1.00 50.89  ? 153  ALA A CA    1 
ATOM   1171  C  C     . ALA A 1  153  ? 23.304  13.427  104.305 1.00 53.09  ? 153  ALA A C     1 
ATOM   1172  O  O     . ALA A 1  153  ? 24.078  14.383  104.188 1.00 51.81  ? 153  ALA A O     1 
ATOM   1173  C  CB    . ALA A 1  153  ? 24.369  11.303  105.090 1.00 47.04  ? 153  ALA A CB    1 
ATOM   1174  N  N     . GLU A 1  154  ? 22.309  13.210  103.444 1.00 60.36  ? 154  GLU A N     1 
ATOM   1175  C  CA    . GLU A 1  154  ? 22.154  14.068  102.274 1.00 64.84  ? 154  GLU A CA    1 
ATOM   1176  C  C     . GLU A 1  154  ? 21.788  15.495  102.660 1.00 63.19  ? 154  GLU A C     1 
ATOM   1177  O  O     . GLU A 1  154  ? 22.071  16.429  101.901 1.00 69.97  ? 154  GLU A O     1 
ATOM   1178  C  CB    . GLU A 1  154  ? 21.100  13.495  101.321 1.00 60.76  ? 154  GLU A CB    1 
ATOM   1179  C  CG    . GLU A 1  154  ? 21.285  12.023  100.963 1.00 74.07  ? 154  GLU A CG    1 
ATOM   1180  C  CD    . GLU A 1  154  ? 20.642  11.081  101.976 1.00 79.93  ? 154  GLU A CD    1 
ATOM   1181  O  OE1   . GLU A 1  154  ? 19.475  11.321  102.358 1.00 75.77  ? 154  GLU A OE1   1 
ATOM   1182  O  OE2   . GLU A 1  154  ? 21.307  10.106  102.395 1.00 70.75  ? 154  GLU A OE2   1 
ATOM   1183  N  N     . LYS A 1  155  ? 21.169  15.688  103.828 1.00 51.91  ? 155  LYS A N     1 
ATOM   1184  C  CA    . LYS A 1  155  ? 20.717  17.021  104.216 1.00 55.82  ? 155  LYS A CA    1 
ATOM   1185  C  C     . LYS A 1  155  ? 21.784  17.829  104.944 1.00 57.46  ? 155  LYS A C     1 
ATOM   1186  O  O     . LYS A 1  155  ? 21.948  19.020  104.662 1.00 58.84  ? 155  LYS A O     1 
ATOM   1187  C  CB    . LYS A 1  155  ? 19.467  16.930  105.088 1.00 57.69  ? 155  LYS A CB    1 
ATOM   1188  C  CG    . LYS A 1  155  ? 18.832  18.286  105.360 1.00 61.72  ? 155  LYS A CG    1 
ATOM   1189  C  CD    . LYS A 1  155  ? 18.573  19.033  104.051 1.00 76.11  ? 155  LYS A CD    1 
ATOM   1190  C  CE    . LYS A 1  155  ? 18.127  20.469  104.291 1.00 77.83  ? 155  LYS A CE    1 
ATOM   1191  N  NZ    . LYS A 1  155  ? 17.913  21.212  103.015 1.00 71.95  ? 155  LYS A NZ    1 
ATOM   1192  N  N     . HIS A 1  156  ? 22.518  17.217  105.876 1.00 56.70  ? 156  HIS A N     1 
ATOM   1193  C  CA    . HIS A 1  156  ? 23.483  17.989  106.649 1.00 52.99  ? 156  HIS A CA    1 
ATOM   1194  C  C     . HIS A 1  156  ? 24.854  18.040  105.985 1.00 53.88  ? 156  HIS A C     1 
ATOM   1195  O  O     . HIS A 1  156  ? 25.540  19.063  106.076 1.00 53.16  ? 156  HIS A O     1 
ATOM   1196  C  CB    . HIS A 1  156  ? 23.588  17.441  108.079 1.00 45.96  ? 156  HIS A CB    1 
ATOM   1197  C  CG    . HIS A 1  156  ? 24.202  16.077  108.185 1.00 45.58  ? 156  HIS A CG    1 
ATOM   1198  N  ND1   . HIS A 1  156  ? 25.562  15.862  108.128 1.00 50.39  ? 156  HIS A ND1   1 
ATOM   1199  C  CD2   . HIS A 1  156  ? 23.640  14.861  108.382 1.00 45.77  ? 156  HIS A CD2   1 
ATOM   1200  C  CE1   . HIS A 1  156  ? 25.811  14.572  108.265 1.00 47.17  ? 156  HIS A CE1   1 
ATOM   1201  N  NE2   . HIS A 1  156  ? 24.661  13.942  108.422 1.00 47.20  ? 156  HIS A NE2   1 
ATOM   1202  N  N     . GLY A 1  157  ? 25.263  16.961  105.317 1.00 58.05  ? 157  GLY A N     1 
ATOM   1203  C  CA    . GLY A 1  157  ? 26.507  16.931  104.566 1.00 57.51  ? 157  GLY A CA    1 
ATOM   1204  C  C     . GLY A 1  157  ? 27.733  17.364  105.344 1.00 54.43  ? 157  GLY A C     1 
ATOM   1205  O  O     . GLY A 1  157  ? 28.542  18.149  104.842 1.00 58.26  ? 157  GLY A O     1 
ATOM   1206  N  N     . ILE A 1  158  ? 27.883  16.863  106.567 1.00 55.84  ? 158  ILE A N     1 
ATOM   1207  C  CA    . ILE A 1  158  ? 28.964  17.298  107.446 1.00 60.93  ? 158  ILE A CA    1 
ATOM   1208  C  C     . ILE A 1  158  ? 30.244  16.556  107.082 1.00 60.59  ? 158  ILE A C     1 
ATOM   1209  O  O     . ILE A 1  158  ? 30.300  15.323  107.136 1.00 57.89  ? 158  ILE A O     1 
ATOM   1210  C  CB    . ILE A 1  158  ? 28.603  17.080  108.922 1.00 56.78  ? 158  ILE A CB    1 
ATOM   1211  C  CG1   . ILE A 1  158  ? 27.567  18.109  109.379 1.00 54.11  ? 158  ILE A CG1   1 
ATOM   1212  C  CG2   . ILE A 1  158  ? 29.845  17.164  109.790 1.00 58.06  ? 158  ILE A CG2   1 
ATOM   1213  C  CD1   . ILE A 1  158  ? 27.124  17.918  110.817 1.00 58.07  ? 158  ILE A CD1   1 
ATOM   1214  N  N     . LYS A 1  159  ? 31.276  17.313  106.715 1.00 62.19  ? 159  LYS A N     1 
ATOM   1215  C  CA    . LYS A 1  159  ? 32.584  16.760  106.392 1.00 66.49  ? 159  LYS A CA    1 
ATOM   1216  C  C     . LYS A 1  159  ? 33.639  17.615  107.077 1.00 73.50  ? 159  LYS A C     1 
ATOM   1217  O  O     . LYS A 1  159  ? 33.713  18.824  106.830 1.00 70.47  ? 159  LYS A O     1 
ATOM   1218  C  CB    . LYS A 1  159  ? 32.811  16.719  104.875 1.00 67.09  ? 159  LYS A CB    1 
ATOM   1219  C  CG    . LYS A 1  159  ? 31.697  16.015  104.104 1.00 62.60  ? 159  LYS A CG    1 
ATOM   1220  C  CD    . LYS A 1  159  ? 31.818  16.194  102.596 1.00 55.54  ? 159  LYS A CD    1 
ATOM   1221  C  CE    . LYS A 1  159  ? 32.772  15.182  101.990 1.00 60.38  ? 159  LYS A CE    1 
ATOM   1222  N  NZ    . LYS A 1  159  ? 32.587  15.064  100.516 1.00 52.68  ? 159  LYS A NZ    1 
ATOM   1223  N  N     . ASP A 1  160  ? 34.443  16.993  107.944 1.00 77.07  ? 160  ASP A N     1 
ATOM   1224  C  CA    . ASP A 1  160  ? 35.551  17.704  108.574 1.00 76.20  ? 160  ASP A CA    1 
ATOM   1225  C  C     . ASP A 1  160  ? 36.728  17.878  107.618 1.00 73.70  ? 160  ASP A C     1 
ATOM   1226  O  O     . ASP A 1  160  ? 37.387  18.923  107.631 1.00 78.01  ? 160  ASP A O     1 
ATOM   1227  C  CB    . ASP A 1  160  ? 35.992  16.977  109.845 1.00 79.83  ? 160  ASP A CB    1 
ATOM   1228  C  CG    . ASP A 1  160  ? 35.144  17.343  111.052 1.00 80.96  ? 160  ASP A CG    1 
ATOM   1229  O  OD1   . ASP A 1  160  ? 34.129  18.051  110.873 1.00 79.69  ? 160  ASP A OD1   1 
ATOM   1230  O  OD2   . ASP A 1  160  ? 35.497  16.929  112.178 1.00 76.29  ? 160  ASP A OD2   1 
ATOM   1231  N  N     . ARG A 1  161  ? 37.011  16.875  106.785 1.00 72.30  ? 161  ARG A N     1 
ATOM   1232  C  CA    . ARG A 1  161  ? 38.053  17.002  105.775 1.00 75.05  ? 161  ARG A CA    1 
ATOM   1233  C  C     . ARG A 1  161  ? 37.543  16.539  104.416 1.00 73.57  ? 161  ARG A C     1 
ATOM   1234  O  O     . ARG A 1  161  ? 36.350  16.254  104.260 1.00 69.82  ? 161  ARG A O     1 
ATOM   1235  C  CB    . ARG A 1  161  ? 39.302  16.220  106.187 1.00 77.66  ? 161  ARG A CB    1 
ATOM   1236  C  CG    . ARG A 1  161  ? 39.058  14.771  106.524 1.00 71.40  ? 161  ARG A CG    1 
ATOM   1237  C  CD    . ARG A 1  161  ? 40.319  14.123  107.051 1.00 80.45  ? 161  ARG A CD    1 
ATOM   1238  N  NE    . ARG A 1  161  ? 40.695  14.644  108.362 1.00 86.08  ? 161  ARG A NE    1 
ATOM   1239  C  CZ    . ARG A 1  161  ? 41.852  14.388  108.967 1.00 86.48  ? 161  ARG A CZ    1 
ATOM   1240  N  NH1   . ARG A 1  161  ? 42.761  13.622  108.376 1.00 81.19  ? 161  ARG A NH1   1 
ATOM   1241  N  NH2   . ARG A 1  161  ? 42.104  14.904  110.163 1.00 83.34  ? 161  ARG A NH2   1 
ATOM   1242  N  N     . ILE A 1  162  ? 38.436  16.492  103.423 1.00 72.61  ? 162  ILE A N     1 
ATOM   1243  C  CA    . ILE A 1  162  ? 38.012  16.268  102.042 1.00 68.89  ? 162  ILE A CA    1 
ATOM   1244  C  C     . ILE A 1  162  ? 37.447  14.862  101.872 1.00 67.36  ? 162  ILE A C     1 
ATOM   1245  O  O     . ILE A 1  162  ? 36.397  14.670  101.248 1.00 66.72  ? 162  ILE A O     1 
ATOM   1246  C  CB    . ILE A 1  162  ? 39.178  16.525  101.069 1.00 67.04  ? 162  ILE A CB    1 
ATOM   1247  C  CG1   . ILE A 1  162  ? 39.718  17.950  101.236 1.00 72.10  ? 162  ILE A CG1   1 
ATOM   1248  C  CG2   . ILE A 1  162  ? 38.733  16.292  99.632  1.00 64.22  ? 162  ILE A CG2   1 
ATOM   1249  C  CD1   . ILE A 1  162  ? 38.756  19.026  100.780 1.00 71.41  ? 162  ILE A CD1   1 
ATOM   1250  N  N     . ASN A 1  163  ? 38.138  13.859  102.409 1.00 62.39  ? 163  ASN A N     1 
ATOM   1251  C  CA    . ASN A 1  163  ? 37.728  12.471  102.247 1.00 60.78  ? 163  ASN A CA    1 
ATOM   1252  C  C     . ASN A 1  163  ? 36.771  12.000  103.338 1.00 59.98  ? 163  ASN A C     1 
ATOM   1253  O  O     . ASN A 1  163  ? 36.586  10.789  103.503 1.00 58.93  ? 163  ASN A O     1 
ATOM   1254  C  CB    . ASN A 1  163  ? 38.958  11.559  102.196 1.00 67.84  ? 163  ASN A CB    1 
ATOM   1255  C  CG    . ASN A 1  163  ? 39.626  11.555  100.831 1.00 72.50  ? 163  ASN A CG    1 
ATOM   1256  O  OD1   . ASN A 1  163  ? 38.953  11.518  99.801  1.00 69.85  ? 163  ASN A OD1   1 
ATOM   1257  N  ND2   . ASN A 1  163  ? 40.955  11.596  100.817 1.00 76.90  ? 163  ASN A ND2   1 
ATOM   1258  N  N     . ALA A 1  164  ? 36.166  12.921  104.084 1.00 67.24  ? 164  ALA A N     1 
ATOM   1259  C  CA    . ALA A 1  164  ? 35.226  12.541  105.130 1.00 66.31  ? 164  ALA A CA    1 
ATOM   1260  C  C     . ALA A 1  164  ? 33.910  12.055  104.529 1.00 58.83  ? 164  ALA A C     1 
ATOM   1261  O  O     . ALA A 1  164  ? 33.517  12.447  103.429 1.00 56.41  ? 164  ALA A O     1 
ATOM   1262  C  CB    . ALA A 1  164  ? 34.971  13.719  106.070 1.00 68.14  ? 164  ALA A CB    1 
ATOM   1263  N  N     . ILE A 1  165  ? 33.225  11.195  105.269 1.00 55.84  ? 165  ILE A N     1 
ATOM   1264  C  CA    . ILE A 1  165  ? 31.962  10.599  104.843 1.00 50.74  ? 165  ILE A CA    1 
ATOM   1265  C  C     . ILE A 1  165  ? 30.855  11.128  105.747 1.00 54.34  ? 165  ILE A C     1 
ATOM   1266  O  O     . ILE A 1  165  ? 30.877  10.868  106.958 1.00 53.45  ? 165  ILE A O     1 
ATOM   1267  C  CB    . ILE A 1  165  ? 32.011  9.066   104.898 1.00 43.96  ? 165  ILE A CB    1 
ATOM   1268  C  CG1   . ILE A 1  165  ? 33.183  8.528   104.081 1.00 38.49  ? 165  ILE A CG1   1 
ATOM   1269  C  CG2   . ILE A 1  165  ? 30.695  8.489   104.408 1.00 48.27  ? 165  ILE A CG2   1 
ATOM   1270  C  CD1   . ILE A 1  165  ? 33.365  7.035   104.212 1.00 34.19  ? 165  ILE A CD1   1 
ATOM   1271  N  N     . PRO A 1  166  ? 29.879  11.865  105.220 1.00 50.50  ? 166  PRO A N     1 
ATOM   1272  C  CA    . PRO A 1  166  ? 28.692  12.178  106.021 1.00 51.86  ? 166  PRO A CA    1 
ATOM   1273  C  C     . PRO A 1  166  ? 27.947  10.903  106.385 1.00 50.85  ? 166  PRO A C     1 
ATOM   1274  O  O     . PRO A 1  166  ? 27.987  9.906   105.660 1.00 51.93  ? 166  PRO A O     1 
ATOM   1275  C  CB    . PRO A 1  166  ? 27.864  13.077  105.096 1.00 51.96  ? 166  PRO A CB    1 
ATOM   1276  C  CG    . PRO A 1  166  ? 28.856  13.655  104.144 1.00 42.92  ? 166  PRO A CG    1 
ATOM   1277  C  CD    . PRO A 1  166  ? 29.880  12.577  103.931 1.00 46.68  ? 166  PRO A CD    1 
ATOM   1278  N  N     . VAL A 1  167  ? 27.271  10.941  107.534 1.00 50.72  ? 167  VAL A N     1 
ATOM   1279  C  CA    . VAL A 1  167  ? 26.588  9.779   108.093 1.00 49.32  ? 167  VAL A CA    1 
ATOM   1280  C  C     . VAL A 1  167  ? 25.173  10.176  108.498 1.00 49.13  ? 167  VAL A C     1 
ATOM   1281  O  O     . VAL A 1  167  ? 24.946  11.289  108.987 1.00 48.49  ? 167  VAL A O     1 
ATOM   1282  C  CB    . VAL A 1  167  ? 27.365  9.201   109.297 1.00 43.60  ? 167  VAL A CB    1 
ATOM   1283  C  CG1   . VAL A 1  167  ? 26.614  8.048   109.929 1.00 47.40  ? 167  VAL A CG1   1 
ATOM   1284  C  CG2   . VAL A 1  167  ? 28.746  8.748   108.862 1.00 49.99  ? 167  VAL A CG2   1 
ATOM   1285  N  N     . ASP A 1  168  ? 24.220  9.270   108.275 1.00 47.72  ? 168  ASP A N     1 
ATOM   1286  C  CA    . ASP A 1  168  ? 22.861  9.472   108.759 1.00 48.80  ? 168  ASP A CA    1 
ATOM   1287  C  C     . ASP A 1  168  ? 22.848  9.575   110.279 1.00 48.44  ? 168  ASP A C     1 
ATOM   1288  O  O     . ASP A 1  168  ? 23.364  8.700   110.983 1.00 44.15  ? 168  ASP A O     1 
ATOM   1289  C  CB    . ASP A 1  168  ? 21.954  8.329   108.305 1.00 50.55  ? 168  ASP A CB    1 
ATOM   1290  C  CG    . ASP A 1  168  ? 21.711  8.334   106.811 1.00 54.64  ? 168  ASP A CG    1 
ATOM   1291  O  OD1   . ASP A 1  168  ? 21.896  9.392   106.171 1.00 53.91  ? 168  ASP A OD1   1 
ATOM   1292  O  OD2   . ASP A 1  168  ? 21.326  7.272   106.282 1.00 60.39  ? 168  ASP A OD2   1 
ATOM   1293  N  N     . ALA A 1  169  ? 22.242  10.647  110.781 1.00 47.42  ? 169  ALA A N     1 
ATOM   1294  C  CA    . ALA A 1  169  ? 22.204  10.941  112.208 1.00 48.38  ? 169  ALA A CA    1 
ATOM   1295  C  C     . ALA A 1  169  ? 20.770  10.826  112.707 1.00 50.20  ? 169  ALA A C     1 
ATOM   1296  O  O     . ALA A 1  169  ? 19.911  11.632  112.336 1.00 48.83  ? 169  ALA A O     1 
ATOM   1297  C  CB    . ALA A 1  169  ? 22.766  12.334  112.487 1.00 46.29  ? 169  ALA A CB    1 
ATOM   1298  N  N     . VAL A 1  170  ? 20.511  9.832   113.546 1.00 47.40  ? 170  VAL A N     1 
ATOM   1299  C  CA    . VAL A 1  170  ? 19.285  9.762   114.327 1.00 53.77  ? 170  VAL A CA    1 
ATOM   1300  C  C     . VAL A 1  170  ? 19.667  10.206  115.733 1.00 58.29  ? 170  VAL A C     1 
ATOM   1301  O  O     . VAL A 1  170  ? 20.393  9.512   116.454 1.00 65.13  ? 170  VAL A O     1 
ATOM   1302  C  CB    . VAL A 1  170  ? 18.646  8.362   114.268 1.00 53.27  ? 170  VAL A CB    1 
ATOM   1303  C  CG1   . VAL A 1  170  ? 19.569  7.375   113.569 1.00 51.96  ? 170  VAL A CG1   1 
ATOM   1304  C  CG2   . VAL A 1  170  ? 18.211  7.843   115.634 1.00 53.98  ? 170  VAL A CG2   1 
ATOM   1305  N  N     . PHE A 1  171  ? 19.261  11.425  116.080 1.00 52.89  ? 171  PHE A N     1 
ATOM   1306  C  CA    . PHE A 1  171  ? 19.693  12.016  117.336 1.00 53.72  ? 171  PHE A CA    1 
ATOM   1307  C  C     . PHE A 1  171  ? 18.874  11.504  118.506 1.00 58.27  ? 171  PHE A C     1 
ATOM   1308  O  O     . PHE A 1  171  ? 19.385  11.443  119.630 1.00 53.01  ? 171  PHE A O     1 
ATOM   1309  C  CB    . PHE A 1  171  ? 19.594  13.539  117.260 1.00 49.35  ? 171  PHE A CB    1 
ATOM   1310  C  CG    . PHE A 1  171  ? 20.490  14.161  116.225 1.00 57.31  ? 171  PHE A CG    1 
ATOM   1311  C  CD1   . PHE A 1  171  ? 21.861  14.224  116.419 1.00 56.66  ? 171  PHE A CD1   1 
ATOM   1312  C  CD2   . PHE A 1  171  ? 19.957  14.713  115.072 1.00 55.89  ? 171  PHE A CD2   1 
ATOM   1313  C  CE1   . PHE A 1  171  ? 22.683  14.810  115.470 1.00 50.14  ? 171  PHE A CE1   1 
ATOM   1314  C  CE2   . PHE A 1  171  ? 20.771  15.302  114.124 1.00 44.33  ? 171  PHE A CE2   1 
ATOM   1315  C  CZ    . PHE A 1  171  ? 22.134  15.351  114.323 1.00 44.40  ? 171  PHE A CZ    1 
ATOM   1316  N  N     . SER A 1  172  ? 17.628  11.116  118.249 1.00 62.28  ? 172  SER A N     1 
ATOM   1317  C  CA    . SER A 1  172  ? 16.666  10.798  119.291 1.00 50.87  ? 172  SER A CA    1 
ATOM   1318  C  C     . SER A 1  172  ? 17.244  9.772   120.261 1.00 52.34  ? 172  SER A C     1 
ATOM   1319  O  O     . SER A 1  172  ? 17.597  8.658   119.840 1.00 50.45  ? 172  SER A O     1 
ATOM   1320  C  CB    . SER A 1  172  ? 15.370  10.265  118.687 1.00 55.55  ? 172  SER A CB    1 
ATOM   1321  O  OG    . SER A 1  172  ? 14.418  9.988   119.701 1.00 51.99  ? 172  SER A OG    1 
ATOM   1322  N  N     . PRO A 1  173  ? 17.382  10.111  121.545 1.00 54.00  ? 173  PRO A N     1 
ATOM   1323  C  CA    . PRO A 1  173  ? 17.824  9.121   122.533 1.00 46.21  ? 173  PRO A CA    1 
ATOM   1324  C  C     . PRO A 1  173  ? 16.722  8.175   122.968 1.00 41.72  ? 173  PRO A C     1 
ATOM   1325  O  O     . PRO A 1  173  ? 17.003  7.210   123.689 1.00 39.97  ? 173  PRO A O     1 
ATOM   1326  C  CB    . PRO A 1  173  ? 18.292  9.995   123.699 1.00 41.63  ? 173  PRO A CB    1 
ATOM   1327  C  CG    . PRO A 1  173  ? 17.385  11.188  123.622 1.00 46.85  ? 173  PRO A CG    1 
ATOM   1328  C  CD    . PRO A 1  173  ? 17.132  11.430  122.156 1.00 48.90  ? 173  PRO A CD    1 
ATOM   1329  N  N     . VAL A 1  174  ? 15.489  8.416   122.544 1.00 40.60  ? 174  VAL A N     1 
ATOM   1330  C  CA    . VAL A 1  174  ? 14.339  7.639   122.985 1.00 43.74  ? 174  VAL A CA    1 
ATOM   1331  C  C     . VAL A 1  174  ? 14.183  6.427   122.075 1.00 43.05  ? 174  VAL A C     1 
ATOM   1332  O  O     . VAL A 1  174  ? 13.931  6.569   120.873 1.00 40.88  ? 174  VAL A O     1 
ATOM   1333  C  CB    . VAL A 1  174  ? 13.068  8.499   122.987 1.00 42.52  ? 174  VAL A CB    1 
ATOM   1334  C  CG1   . VAL A 1  174  ? 11.882  7.678   123.426 1.00 41.91  ? 174  VAL A CG1   1 
ATOM   1335  C  CG2   . VAL A 1  174  ? 13.247  9.711   123.888 1.00 43.25  ? 174  VAL A CG2   1 
ATOM   1336  N  N     . ARG A 1  175  ? 14.323  5.231   122.652 1.00 44.26  ? 175  ARG A N     1 
ATOM   1337  C  CA    . ARG A 1  175  ? 14.159  3.996   121.895 1.00 39.03  ? 175  ARG A CA    1 
ATOM   1338  C  C     . ARG A 1  175  ? 12.708  3.529   121.827 1.00 42.80  ? 175  ARG A C     1 
ATOM   1339  O  O     . ARG A 1  175  ? 12.293  2.973   120.804 1.00 47.08  ? 175  ARG A O     1 
ATOM   1340  C  CB    . ARG A 1  175  ? 15.029  2.893   122.493 1.00 40.35  ? 175  ARG A CB    1 
ATOM   1341  C  CG    . ARG A 1  175  ? 16.521  3.147   122.345 1.00 55.27  ? 175  ARG A CG    1 
ATOM   1342  C  CD    . ARG A 1  175  ? 17.328  1.858   122.411 1.00 75.59  ? 175  ARG A CD    1 
ATOM   1343  N  NE    . ARG A 1  175  ? 18.729  2.078   122.054 1.00 91.10  ? 175  ARG A NE    1 
ATOM   1344  C  CZ    . ARG A 1  175  ? 19.201  2.054   120.809 1.00 96.19  ? 175  ARG A CZ    1 
ATOM   1345  N  NH1   . ARG A 1  175  ? 18.386  1.818   119.788 1.00 86.02  ? 175  ARG A NH1   1 
ATOM   1346  N  NH2   . ARG A 1  175  ? 20.492  2.266   120.583 1.00 95.42  ? 175  ARG A NH2   1 
ATOM   1347  N  N     . ARG A 1  176  ? 11.922  3.742   122.885 1.00 46.37  ? 176  ARG A N     1 
ATOM   1348  C  CA    . ARG A 1  176  ? 10.522  3.324   122.842 1.00 45.22  ? 176  ARG A CA    1 
ATOM   1349  C  C     . ARG A 1  176  ? 9.709   4.077   123.889 1.00 47.02  ? 176  ARG A C     1 
ATOM   1350  O  O     . ARG A 1  176  ? 10.210  4.403   124.967 1.00 47.95  ? 176  ARG A O     1 
ATOM   1351  C  CB    . ARG A 1  176  ? 10.387  1.809   123.054 1.00 40.54  ? 176  ARG A CB    1 
ATOM   1352  C  CG    . ARG A 1  176  ? 8.951   1.286   123.018 1.00 39.13  ? 176  ARG A CG    1 
ATOM   1353  C  CD    . ARG A 1  176  ? 8.857   -0.006  122.225 1.00 45.94  ? 176  ARG A CD    1 
ATOM   1354  N  NE    . ARG A 1  176  ? 9.845   -0.984  122.667 1.00 57.79  ? 176  ARG A NE    1 
ATOM   1355  C  CZ    . ARG A 1  176  ? 9.577   -2.000  123.478 1.00 62.55  ? 176  ARG A CZ    1 
ATOM   1356  N  NH1   . ARG A 1  176  ? 8.343   -2.177  123.930 1.00 61.89  ? 176  ARG A NH1   1 
ATOM   1357  N  NH2   . ARG A 1  176  ? 10.540  -2.843  123.834 1.00 65.47  ? 176  ARG A NH2   1 
ATOM   1358  N  N     . VAL A 1  177  ? 8.445   4.346   123.562 1.00 44.77  ? 177  VAL A N     1 
ATOM   1359  C  CA    . VAL A 1  177  ? 7.509   4.957   124.501 1.00 39.60  ? 177  VAL A CA    1 
ATOM   1360  C  C     . VAL A 1  177  ? 6.175   4.233   124.408 1.00 45.43  ? 177  VAL A C     1 
ATOM   1361  O  O     . VAL A 1  177  ? 5.617   4.085   123.316 1.00 45.88  ? 177  VAL A O     1 
ATOM   1362  C  CB    . VAL A 1  177  ? 7.301   6.461   124.243 1.00 34.17  ? 177  VAL A CB    1 
ATOM   1363  C  CG1   . VAL A 1  177  ? 6.229   6.993   125.162 1.00 38.25  ? 177  VAL A CG1   1 
ATOM   1364  C  CG2   . VAL A 1  177  ? 8.576   7.222   124.469 1.00 41.62  ? 177  VAL A CG2   1 
ATOM   1365  N  N     . ALA A 1  178  ? 5.664   3.789   125.554 1.00 52.49  ? 178  ALA A N     1 
ATOM   1366  C  CA    . ALA A 1  178  ? 4.313   3.259   125.663 1.00 51.41  ? 178  ALA A CA    1 
ATOM   1367  C  C     . ALA A 1  178  ? 3.607   3.957   126.815 1.00 47.41  ? 178  ALA A C     1 
ATOM   1368  O  O     . ALA A 1  178  ? 4.245   4.555   127.682 1.00 47.60  ? 178  ALA A O     1 
ATOM   1369  C  CB    . ALA A 1  178  ? 4.309   1.741   125.891 1.00 42.87  ? 178  ALA A CB    1 
ATOM   1370  N  N     . PHE A 1  179  ? 2.278   3.893   126.824 1.00 49.49  ? 179  PHE A N     1 
ATOM   1371  C  CA    . PHE A 1  179  ? 1.568   4.370   128.000 1.00 41.37  ? 179  PHE A CA    1 
ATOM   1372  C  C     . PHE A 1  179  ? 0.320   3.531   128.228 1.00 44.34  ? 179  PHE A C     1 
ATOM   1373  O  O     . PHE A 1  179  ? -0.402  3.179   127.291 1.00 42.76  ? 179  PHE A O     1 
ATOM   1374  C  CB    . PHE A 1  179  ? 1.242   5.873   127.917 1.00 36.03  ? 179  PHE A CB    1 
ATOM   1375  C  CG    . PHE A 1  179  ? 0.130   6.227   126.978 1.00 37.29  ? 179  PHE A CG    1 
ATOM   1376  C  CD1   . PHE A 1  179  ? -1.180  6.266   127.422 1.00 38.78  ? 179  PHE A CD1   1 
ATOM   1377  C  CD2   . PHE A 1  179  ? 0.398   6.578   125.669 1.00 50.17  ? 179  PHE A CD2   1 
ATOM   1378  C  CE1   . PHE A 1  179  ? -2.207  6.611   126.571 1.00 38.54  ? 179  PHE A CE1   1 
ATOM   1379  C  CE2   . PHE A 1  179  ? -0.628  6.925   124.807 1.00 56.06  ? 179  PHE A CE2   1 
ATOM   1380  C  CZ    . PHE A 1  179  ? -1.932  6.943   125.263 1.00 50.61  ? 179  PHE A CZ    1 
ATOM   1381  N  N     . GLN A 1  180  ? 0.107   3.207   129.497 1.00 49.43  ? 180  GLN A N     1 
ATOM   1382  C  CA    . GLN A 1  180  ? -0.962  2.350   129.979 1.00 48.09  ? 180  GLN A CA    1 
ATOM   1383  C  C     . GLN A 1  180  ? -1.987  3.212   130.701 1.00 44.78  ? 180  GLN A C     1 
ATOM   1384  O  O     . GLN A 1  180  ? -1.623  4.024   131.556 1.00 44.41  ? 180  GLN A O     1 
ATOM   1385  C  CB    . GLN A 1  180  ? -0.399  1.293   130.933 1.00 52.23  ? 180  GLN A CB    1 
ATOM   1386  C  CG    . GLN A 1  180  ? -1.307  0.121   131.206 1.00 59.79  ? 180  GLN A CG    1 
ATOM   1387  C  CD    . GLN A 1  180  ? -1.057  -1.014  130.245 1.00 67.80  ? 180  GLN A CD    1 
ATOM   1388  O  OE1   . GLN A 1  180  ? -0.454  -0.823  129.187 1.00 67.75  ? 180  GLN A OE1   1 
ATOM   1389  N  NE2   . GLN A 1  180  ? -1.507  -2.209  130.610 1.00 66.79  ? 180  GLN A NE2   1 
ATOM   1390  N  N     . VAL A 1  181  ? -3.258  3.042   130.358 1.00 40.25  ? 181  VAL A N     1 
ATOM   1391  C  CA    . VAL A 1  181  ? -4.353  3.713   131.049 1.00 43.90  ? 181  VAL A CA    1 
ATOM   1392  C  C     . VAL A 1  181  ? -5.195  2.633   131.708 1.00 47.85  ? 181  VAL A C     1 
ATOM   1393  O  O     . VAL A 1  181  ? -5.829  1.821   131.019 1.00 46.73  ? 181  VAL A O     1 
ATOM   1394  C  CB    . VAL A 1  181  ? -5.194  4.577   130.102 1.00 43.83  ? 181  VAL A CB    1 
ATOM   1395  C  CG1   . VAL A 1  181  ? -6.424  5.101   130.820 1.00 42.70  ? 181  VAL A CG1   1 
ATOM   1396  C  CG2   . VAL A 1  181  ? -4.361  5.731   129.570 1.00 41.60  ? 181  VAL A CG2   1 
ATOM   1397  N  N     . GLU A 1  182  ? -5.202  2.612   133.038 1.00 49.30  ? 182  GLU A N     1 
ATOM   1398  C  CA    . GLU A 1  182  ? -5.924  1.591   133.778 1.00 47.63  ? 182  GLU A CA    1 
ATOM   1399  C  C     . GLU A 1  182  ? -7.031  2.227   134.610 1.00 46.50  ? 182  GLU A C     1 
ATOM   1400  O  O     . GLU A 1  182  ? -7.030  3.433   134.869 1.00 47.15  ? 182  GLU A O     1 
ATOM   1401  C  CB    . GLU A 1  182  ? -4.968  0.782   134.664 1.00 51.89  ? 182  GLU A CB    1 
ATOM   1402  C  CG    . GLU A 1  182  ? -3.938  0.009   133.857 1.00 62.27  ? 182  GLU A CG    1 
ATOM   1403  C  CD    . GLU A 1  182  ? -2.759  -0.446  134.687 1.00 72.00  ? 182  GLU A CD    1 
ATOM   1404  O  OE1   . GLU A 1  182  ? -2.400  -1.639  134.606 1.00 77.01  ? 182  GLU A OE1   1 
ATOM   1405  O  OE2   . GLU A 1  182  ? -2.190  0.393   135.417 1.00 70.60  ? 182  GLU A OE2   1 
ATOM   1406  N  N     . ASP A 1  183  ? -7.990  1.400   135.014 1.00 53.21  ? 183  ASP A N     1 
ATOM   1407  C  CA    . ASP A 1  183  ? -9.152  1.881   135.750 1.00 57.58  ? 183  ASP A CA    1 
ATOM   1408  C  C     . ASP A 1  183  ? -8.816  2.052   137.230 1.00 51.72  ? 183  ASP A C     1 
ATOM   1409  O  O     . ASP A 1  183  ? -8.164  1.192   137.831 1.00 41.33  ? 183  ASP A O     1 
ATOM   1410  C  CB    . ASP A 1  183  ? -10.320 0.911   135.577 1.00 56.89  ? 183  ASP A CB    1 
ATOM   1411  C  CG    . ASP A 1  183  ? -11.663 1.582   135.758 1.00 58.46  ? 183  ASP A CG    1 
ATOM   1412  O  OD1   . ASP A 1  183  ? -11.709 2.831   135.742 1.00 55.10  ? 183  ASP A OD1   1 
ATOM   1413  O  OD2   . ASP A 1  183  ? -12.670 0.860   135.920 1.00 63.58  ? 183  ASP A OD2   1 
ATOM   1414  N  N     . THR A 1  184  ? -9.261  3.165   137.814 1.00 57.83  ? 184  THR A N     1 
ATOM   1415  C  CA    . THR A 1  184  ? -9.054  3.431   139.231 1.00 61.42  ? 184  THR A CA    1 
ATOM   1416  C  C     . THR A 1  184  ? -10.226 4.252   139.762 1.00 59.09  ? 184  THR A C     1 
ATOM   1417  O  O     . THR A 1  184  ? -11.049 4.776   139.003 1.00 57.41  ? 184  THR A O     1 
ATOM   1418  C  CB    . THR A 1  184  ? -7.717  4.148   139.481 1.00 55.65  ? 184  THR A CB    1 
ATOM   1419  O  OG1   . THR A 1  184  ? -7.325  3.977   140.849 1.00 48.46  ? 184  THR A OG1   1 
ATOM   1420  C  CG2   . THR A 1  184  ? -7.834  5.634   139.187 1.00 57.37  ? 184  THR A CG2   1 
ATOM   1421  N  N     . ARG A 1  185  ? -10.291 4.358   141.088 1.00 66.02  ? 185  ARG A N     1 
ATOM   1422  C  CA    . ARG A 1  185  ? -11.381 5.038   141.771 1.00 67.62  ? 185  ARG A CA    1 
ATOM   1423  C  C     . ARG A 1  185  ? -10.833 5.840   142.943 1.00 66.76  ? 185  ARG A C     1 
ATOM   1424  O  O     . ARG A 1  185  ? -9.824  5.473   143.552 1.00 66.97  ? 185  ARG A O     1 
ATOM   1425  C  CB    . ARG A 1  185  ? -12.437 4.039   142.270 1.00 72.76  ? 185  ARG A CB    1 
ATOM   1426  C  CG    . ARG A 1  185  ? -11.877 2.960   143.191 1.00 75.06  ? 185  ARG A CG    1 
ATOM   1427  C  CD    . ARG A 1  185  ? -12.974 2.108   143.830 1.00 94.35  ? 185  ARG A CD    1 
ATOM   1428  N  NE    . ARG A 1  185  ? -13.840 2.882   144.720 1.00 104.64 ? 185  ARG A NE    1 
ATOM   1429  C  CZ    . ARG A 1  185  ? -15.146 3.056   144.536 1.00 100.01 ? 185  ARG A CZ    1 
ATOM   1430  N  NH1   . ARG A 1  185  ? -15.756 2.501   143.497 1.00 96.95  ? 185  ARG A NH1   1 
ATOM   1431  N  NH2   . ARG A 1  185  ? -15.847 3.779   145.399 1.00 89.28  ? 185  ARG A NH2   1 
ATOM   1432  N  N     . LEU A 1  186  ? -11.509 6.946   143.254 1.00 63.77  ? 186  LEU A N     1 
ATOM   1433  C  CA    . LEU A 1  186  ? -11.196 7.765   144.424 1.00 61.76  ? 186  LEU A CA    1 
ATOM   1434  C  C     . LEU A 1  186  ? -12.491 8.045   145.169 1.00 70.26  ? 186  LEU A C     1 
ATOM   1435  O  O     . LEU A 1  186  ? -13.348 8.783   144.671 1.00 72.60  ? 186  LEU A O     1 
ATOM   1436  C  CB    . LEU A 1  186  ? -10.514 9.076   144.035 1.00 65.50  ? 186  LEU A CB    1 
ATOM   1437  C  CG    . LEU A 1  186  ? -10.231 9.996   145.228 1.00 58.77  ? 186  LEU A CG    1 
ATOM   1438  C  CD1   . LEU A 1  186  ? -9.136  9.407   146.103 1.00 59.29  ? 186  LEU A CD1   1 
ATOM   1439  C  CD2   . LEU A 1  186  ? -9.876  11.409  144.787 1.00 54.87  ? 186  LEU A CD2   1 
ATOM   1440  N  N     . GLY A 1  187  ? -12.623 7.481   146.365 1.00 69.49  ? 187  GLY A N     1 
ATOM   1441  C  CA    . GLY A 1  187  ? -13.867 7.627   147.098 1.00 79.73  ? 187  GLY A CA    1 
ATOM   1442  C  C     . GLY A 1  187  ? -14.993 6.956   146.342 1.00 81.88  ? 187  GLY A C     1 
ATOM   1443  O  O     . GLY A 1  187  ? -14.892 5.794   145.934 1.00 70.43  ? 187  GLY A O     1 
ATOM   1444  N  N     . GLN A 1  188  ? -16.078 7.697   146.132 1.00 85.23  ? 188  GLN A N     1 
ATOM   1445  C  CA    . GLN A 1  188  ? -17.240 7.181   145.422 1.00 92.15  ? 188  GLN A CA    1 
ATOM   1446  C  C     . GLN A 1  188  ? -17.193 7.455   143.925 1.00 87.83  ? 188  GLN A C     1 
ATOM   1447  O  O     . GLN A 1  188  ? -18.151 7.121   143.219 1.00 90.99  ? 188  GLN A O     1 
ATOM   1448  C  CB    . GLN A 1  188  ? -18.525 7.770   146.017 1.00 102.75 ? 188  GLN A CB    1 
ATOM   1449  C  CG    . GLN A 1  188  ? -18.770 7.375   147.468 1.00 102.63 ? 188  GLN A CG    1 
ATOM   1450  C  CD    . GLN A 1  188  ? -18.914 5.874   147.651 1.00 109.67 ? 188  GLN A CD    1 
ATOM   1451  O  OE1   . GLN A 1  188  ? -19.513 5.187   146.820 1.00 104.59 ? 188  GLN A OE1   1 
ATOM   1452  N  NE2   . GLN A 1  188  ? -18.358 5.355   148.741 1.00 100.88 ? 188  GLN A NE2   1 
ATOM   1453  N  N     . ARG A 1  189  ? -16.112 8.048   143.424 1.00 81.20  ? 189  ARG A N     1 
ATOM   1454  C  CA    . ARG A 1  189  ? -15.974 8.294   141.995 1.00 78.66  ? 189  ARG A CA    1 
ATOM   1455  C  C     . ARG A 1  189  ? -15.478 7.040   141.286 1.00 76.47  ? 189  ARG A C     1 
ATOM   1456  O  O     . ARG A 1  189  ? -14.617 6.318   141.799 1.00 74.71  ? 189  ARG A O     1 
ATOM   1457  C  CB    . ARG A 1  189  ? -15.001 9.443   141.739 1.00 72.21  ? 189  ARG A CB    1 
ATOM   1458  C  CG    . ARG A 1  189  ? -15.185 10.643  142.641 1.00 69.86  ? 189  ARG A CG    1 
ATOM   1459  C  CD    . ARG A 1  189  ? -13.901 11.444  142.675 1.00 71.85  ? 189  ARG A CD    1 
ATOM   1460  N  NE    . ARG A 1  189  ? -14.003 12.644  143.493 1.00 77.89  ? 189  ARG A NE    1 
ATOM   1461  C  CZ    . ARG A 1  189  ? -14.370 13.833  143.027 1.00 86.27  ? 189  ARG A CZ    1 
ATOM   1462  N  NH1   . ARG A 1  189  ? -14.430 14.876  143.844 1.00 88.52  ? 189  ARG A NH1   1 
ATOM   1463  N  NH2   . ARG A 1  189  ? -14.679 13.978  141.744 1.00 82.22  ? 189  ARG A NH2   1 
ATOM   1464  N  N     . THR A 1  190  ? -16.017 6.786   140.097 1.00 77.50  ? 190  THR A N     1 
ATOM   1465  C  CA    . THR A 1  190  ? -15.648 5.614   139.318 1.00 79.40  ? 190  THR A CA    1 
ATOM   1466  C  C     . THR A 1  190  ? -15.182 6.034   137.930 1.00 73.96  ? 190  THR A C     1 
ATOM   1467  O  O     . THR A 1  190  ? -15.386 7.171   137.496 1.00 68.57  ? 190  THR A O     1 
ATOM   1468  C  CB    . THR A 1  190  ? -16.811 4.621   139.190 1.00 80.51  ? 190  THR A CB    1 
ATOM   1469  O  OG1   . THR A 1  190  ? -17.916 5.259   138.537 1.00 81.65  ? 190  THR A OG1   1 
ATOM   1470  C  CG2   . THR A 1  190  ? -17.244 4.123   140.562 1.00 79.19  ? 190  THR A CG2   1 
ATOM   1471  N  N     . ASP A 1  191  ? -14.542 5.085   137.244 1.00 70.51  ? 191  ASP A N     1 
ATOM   1472  C  CA    . ASP A 1  191  ? -14.033 5.271   135.885 1.00 71.86  ? 191  ASP A CA    1 
ATOM   1473  C  C     . ASP A 1  191  ? -12.930 6.328   135.825 1.00 65.66  ? 191  ASP A C     1 
ATOM   1474  O  O     . ASP A 1  191  ? -12.744 6.989   134.800 1.00 59.01  ? 191  ASP A O     1 
ATOM   1475  C  CB    . ASP A 1  191  ? -15.163 5.613   134.907 1.00 70.91  ? 191  ASP A CB    1 
ATOM   1476  C  CG    . ASP A 1  191  ? -14.849 5.193   133.483 1.00 78.54  ? 191  ASP A CG    1 
ATOM   1477  O  OD1   . ASP A 1  191  ? -13.895 4.407   133.292 1.00 76.62  ? 191  ASP A OD1   1 
ATOM   1478  O  OD2   . ASP A 1  191  ? -15.553 5.651   132.557 1.00 76.91  ? 191  ASP A OD2   1 
ATOM   1479  N  N     . LEU A 1  192  ? -12.181 6.494   136.913 1.00 65.49  ? 192  LEU A N     1 
ATOM   1480  C  CA    . LEU A 1  192  ? -11.029 7.381   136.875 1.00 59.80  ? 192  LEU A CA    1 
ATOM   1481  C  C     . LEU A 1  192  ? -9.851  6.681   136.201 1.00 53.88  ? 192  LEU A C     1 
ATOM   1482  O  O     . LEU A 1  192  ? -9.776  5.451   136.144 1.00 51.18  ? 192  LEU A O     1 
ATOM   1483  C  CB    . LEU A 1  192  ? -10.652 7.836   138.284 1.00 59.32  ? 192  LEU A CB    1 
ATOM   1484  C  CG    . LEU A 1  192  ? -11.701 8.695   138.989 1.00 60.22  ? 192  LEU A CG    1 
ATOM   1485  C  CD1   . LEU A 1  192  ? -11.276 8.989   140.413 1.00 59.91  ? 192  LEU A CD1   1 
ATOM   1486  C  CD2   . LEU A 1  192  ? -11.917 9.984   138.215 1.00 64.32  ? 192  LEU A CD2   1 
ATOM   1487  N  N     . ASP A 1  193  ? -8.921  7.481   135.691 1.00 51.62  ? 193  ASP A N     1 
ATOM   1488  C  CA    . ASP A 1  193  ? -7.806  6.969   134.909 1.00 53.15  ? 193  ASP A CA    1 
ATOM   1489  C  C     . ASP A 1  193  ? -6.514  6.987   135.716 1.00 49.72  ? 193  ASP A C     1 
ATOM   1490  O  O     . ASP A 1  193  ? -6.213  7.962   136.410 1.00 49.71  ? 193  ASP A O     1 
ATOM   1491  C  CB    . ASP A 1  193  ? -7.613  7.775   133.620 1.00 56.43  ? 193  ASP A CB    1 
ATOM   1492  C  CG    . ASP A 1  193  ? -8.759  7.599   132.640 1.00 53.98  ? 193  ASP A CG    1 
ATOM   1493  O  OD1   . ASP A 1  193  ? -9.273  6.469   132.519 1.00 51.01  ? 193  ASP A OD1   1 
ATOM   1494  O  OD2   . ASP A 1  193  ? -9.149  8.597   131.997 1.00 51.35  ? 193  ASP A OD2   1 
ATOM   1495  N  N     . LYS A 1  194  ? -5.748  5.906   135.601 1.00 46.31  ? 194  LYS A N     1 
ATOM   1496  C  CA    . LYS A 1  194  ? -4.414  5.789   136.176 1.00 43.16  ? 194  LYS A CA    1 
ATOM   1497  C  C     . LYS A 1  194  ? -3.436  5.674   135.015 1.00 43.93  ? 194  LYS A C     1 
ATOM   1498  O  O     . LYS A 1  194  ? -3.441  4.666   134.293 1.00 44.96  ? 194  LYS A O     1 
ATOM   1499  C  CB    . LYS A 1  194  ? -4.327  4.577   137.098 1.00 50.20  ? 194  LYS A CB    1 
ATOM   1500  C  CG    . LYS A 1  194  ? -2.922  4.204   137.531 1.00 49.62  ? 194  LYS A CG    1 
ATOM   1501  C  CD    . LYS A 1  194  ? -2.926  2.835   138.196 1.00 46.40  ? 194  LYS A CD    1 
ATOM   1502  C  CE    . LYS A 1  194  ? -1.540  2.430   138.660 1.00 50.79  ? 194  LYS A CE    1 
ATOM   1503  N  NZ    . LYS A 1  194  ? -1.543  1.060   139.246 1.00 55.40  ? 194  LYS A NZ    1 
ATOM   1504  N  N     . LEU A 1  195  ? -2.621  6.712   134.823 1.00 47.23  ? 195  LEU A N     1 
ATOM   1505  C  CA    . LEU A 1  195  ? -1.735  6.811   133.673 1.00 42.47  ? 195  LEU A CA    1 
ATOM   1506  C  C     . LEU A 1  195  ? -0.349  6.298   134.031 1.00 42.43  ? 195  LEU A C     1 
ATOM   1507  O  O     . LEU A 1  195  ? 0.163   6.574   135.117 1.00 48.19  ? 195  LEU A O     1 
ATOM   1508  C  CB    . LEU A 1  195  ? -1.638  8.257   133.179 1.00 36.53  ? 195  LEU A CB    1 
ATOM   1509  C  CG    . LEU A 1  195  ? -0.585  8.516   132.099 1.00 41.87  ? 195  LEU A CG    1 
ATOM   1510  C  CD1   . LEU A 1  195  ? -0.931  7.779   130.815 1.00 40.71  ? 195  LEU A CD1   1 
ATOM   1511  C  CD2   . LEU A 1  195  ? -0.413  10.001  131.836 1.00 41.98  ? 195  LEU A CD2   1 
ATOM   1512  N  N     . THR A 1  196  ? 0.256   5.549   133.114 1.00 44.95  ? 196  THR A N     1 
ATOM   1513  C  CA    . THR A 1  196  ? 1.610   5.046   133.300 1.00 51.06  ? 196  THR A CA    1 
ATOM   1514  C  C     . THR A 1  196  ? 2.381   5.242   132.005 1.00 54.97  ? 196  THR A C     1 
ATOM   1515  O  O     . THR A 1  196  ? 2.027   4.658   130.981 1.00 54.88  ? 196  THR A O     1 
ATOM   1516  C  CB    . THR A 1  196  ? 1.608   3.566   133.692 1.00 51.53  ? 196  THR A CB    1 
ATOM   1517  O  OG1   . THR A 1  196  ? 0.501   3.295   134.563 1.00 50.57  ? 196  THR A OG1   1 
ATOM   1518  C  CG2   . THR A 1  196  ? 2.910   3.214   134.392 1.00 51.26  ? 196  THR A CG2   1 
ATOM   1519  N  N     . LEU A 1  197  ? 3.429   6.053   132.049 1.00 50.05  ? 197  LEU A N     1 
ATOM   1520  C  CA    . LEU A 1  197  ? 4.331   6.243   130.922 1.00 38.66  ? 197  LEU A CA    1 
ATOM   1521  C  C     . LEU A 1  197  ? 5.524   5.312   131.088 1.00 46.30  ? 197  LEU A C     1 
ATOM   1522  O  O     . LEU A 1  197  ? 6.226   5.381   132.101 1.00 55.99  ? 197  LEU A O     1 
ATOM   1523  C  CB    . LEU A 1  197  ? 4.794   7.696   130.839 1.00 37.60  ? 197  LEU A CB    1 
ATOM   1524  C  CG    . LEU A 1  197  ? 3.831   8.690   130.198 1.00 43.52  ? 197  LEU A CG    1 
ATOM   1525  C  CD1   . LEU A 1  197  ? 4.333   10.106  130.397 1.00 37.33  ? 197  LEU A CD1   1 
ATOM   1526  C  CD2   . LEU A 1  197  ? 3.690   8.379   128.720 1.00 48.09  ? 197  LEU A CD2   1 
ATOM   1527  N  N     . ARG A 1  198  ? 5.742   4.436   130.110 1.00 45.28  ? 198  ARG A N     1 
ATOM   1528  C  CA    . ARG A 1  198  ? 6.920   3.579   130.058 1.00 46.23  ? 198  ARG A CA    1 
ATOM   1529  C  C     . ARG A 1  198  ? 7.859   4.125   128.990 1.00 49.05  ? 198  ARG A C     1 
ATOM   1530  O  O     . ARG A 1  198  ? 7.466   4.257   127.824 1.00 58.71  ? 198  ARG A O     1 
ATOM   1531  C  CB    . ARG A 1  198  ? 6.535   2.135   129.746 1.00 43.25  ? 198  ARG A CB    1 
ATOM   1532  C  CG    . ARG A 1  198  ? 5.376   1.616   130.560 1.00 42.61  ? 198  ARG A CG    1 
ATOM   1533  C  CD    . ARG A 1  198  ? 5.564   0.149   130.871 1.00 50.05  ? 198  ARG A CD    1 
ATOM   1534  N  NE    . ARG A 1  198  ? 5.475   -0.691  129.683 1.00 58.35  ? 198  ARG A NE    1 
ATOM   1535  C  CZ    . ARG A 1  198  ? 5.846   -1.966  129.643 1.00 66.75  ? 198  ARG A CZ    1 
ATOM   1536  N  NH1   . ARG A 1  198  ? 5.727   -2.657  128.516 1.00 70.87  ? 198  ARG A NH1   1 
ATOM   1537  N  NH2   . ARG A 1  198  ? 6.343   -2.550  130.726 1.00 60.53  ? 198  ARG A NH2   1 
ATOM   1538  N  N     . ILE A 1  199  ? 9.093   4.438   129.384 1.00 44.19  ? 199  ILE A N     1 
ATOM   1539  C  CA    . ILE A 1  199  ? 10.049  5.117   128.516 1.00 46.99  ? 199  ILE A CA    1 
ATOM   1540  C  C     . ILE A 1  199  ? 11.352  4.327   128.501 1.00 53.45  ? 199  ILE A C     1 
ATOM   1541  O  O     . ILE A 1  199  ? 11.971  4.123   129.554 1.00 60.83  ? 199  ILE A O     1 
ATOM   1542  C  CB    . ILE A 1  199  ? 10.300  6.564   128.969 1.00 42.35  ? 199  ILE A CB    1 
ATOM   1543  C  CG1   . ILE A 1  199  ? 8.989   7.356   128.971 1.00 37.56  ? 199  ILE A CG1   1 
ATOM   1544  C  CG2   . ILE A 1  199  ? 11.343  7.229   128.083 1.00 42.58  ? 199  ILE A CG2   1 
ATOM   1545  C  CD1   . ILE A 1  199  ? 9.155   8.801   129.371 1.00 44.85  ? 199  ILE A CD1   1 
ATOM   1546  N  N     . TRP A 1  200  ? 11.766  3.889   127.311 1.00 43.39  ? 200  TRP A N     1 
ATOM   1547  C  CA    . TRP A 1  200  ? 13.058  3.257   127.079 1.00 42.77  ? 200  TRP A CA    1 
ATOM   1548  C  C     . TRP A 1  200  ? 13.932  4.233   126.307 1.00 47.29  ? 200  TRP A C     1 
ATOM   1549  O  O     . TRP A 1  200  ? 13.547  4.673   125.216 1.00 54.43  ? 200  TRP A O     1 
ATOM   1550  C  CB    . TRP A 1  200  ? 12.919  1.969   126.268 1.00 39.90  ? 200  TRP A CB    1 
ATOM   1551  C  CG    . TRP A 1  200  ? 12.171  0.851   126.899 1.00 45.00  ? 200  TRP A CG    1 
ATOM   1552  C  CD1   . TRP A 1  200  ? 12.704  -0.248  127.501 1.00 46.56  ? 200  TRP A CD1   1 
ATOM   1553  C  CD2   . TRP A 1  200  ? 10.749  0.687   126.950 1.00 51.81  ? 200  TRP A CD2   1 
ATOM   1554  N  NE1   . TRP A 1  200  ? 11.704  -1.079  127.942 1.00 50.37  ? 200  TRP A NE1   1 
ATOM   1555  C  CE2   . TRP A 1  200  ? 10.493  -0.528  127.615 1.00 52.98  ? 200  TRP A CE2   1 
ATOM   1556  C  CE3   . TRP A 1  200  ? 9.667   1.455   126.507 1.00 51.68  ? 200  TRP A CE3   1 
ATOM   1557  C  CZ2   . TRP A 1  200  ? 9.200   -0.994  127.849 1.00 52.48  ? 200  TRP A CZ2   1 
ATOM   1558  C  CZ3   . TRP A 1  200  ? 8.381   0.989   126.739 1.00 51.42  ? 200  TRP A CZ3   1 
ATOM   1559  C  CH2   . TRP A 1  200  ? 8.160   -0.224  127.404 1.00 50.78  ? 200  TRP A CH2   1 
ATOM   1560  N  N     . THR A 1  201  ? 15.111  4.534   126.848 1.00 48.75  ? 201  THR A N     1 
ATOM   1561  C  CA    . THR A 1  201  ? 16.110  5.377   126.198 1.00 50.14  ? 201  THR A CA    1 
ATOM   1562  C  C     . THR A 1  201  ? 17.407  4.596   125.992 1.00 50.86  ? 201  THR A C     1 
ATOM   1563  O  O     . THR A 1  201  ? 17.529  3.428   126.367 1.00 50.85  ? 201  THR A O     1 
ATOM   1564  C  CB    . THR A 1  201  ? 16.380  6.644   127.013 1.00 50.35  ? 201  THR A CB    1 
ATOM   1565  O  OG1   . THR A 1  201  ? 16.918  6.286   128.292 1.00 50.57  ? 201  THR A OG1   1 
ATOM   1566  C  CG2   . THR A 1  201  ? 15.101  7.445   127.199 1.00 48.34  ? 201  THR A CG2   1 
ATOM   1567  N  N     . ASP A 1  202  ? 18.387  5.266   125.389 1.00 56.76  ? 202  ASP A N     1 
ATOM   1568  C  CA    . ASP A 1  202  ? 19.682  4.673   125.081 1.00 59.26  ? 202  ASP A CA    1 
ATOM   1569  C  C     . ASP A 1  202  ? 20.699  4.842   126.201 1.00 62.94  ? 202  ASP A C     1 
ATOM   1570  O  O     . ASP A 1  202  ? 21.823  4.342   126.078 1.00 63.00  ? 202  ASP A O     1 
ATOM   1571  C  CB    . ASP A 1  202  ? 20.245  5.280   123.788 1.00 58.89  ? 202  ASP A CB    1 
ATOM   1572  C  CG    . ASP A 1  202  ? 20.465  6.785   123.890 1.00 51.06  ? 202  ASP A CG    1 
ATOM   1573  O  OD1   . ASP A 1  202  ? 19.875  7.422   124.785 1.00 56.89  ? 202  ASP A OD1   1 
ATOM   1574  O  OD2   . ASP A 1  202  ? 21.223  7.337   123.068 1.00 47.50  ? 202  ASP A OD2   1 
ATOM   1575  N  N     . GLY A 1  203  ? 20.336  5.526   127.286 1.00 59.84  ? 203  GLY A N     1 
ATOM   1576  C  CA    . GLY A 1  203  ? 21.267  5.854   128.336 1.00 52.95  ? 203  GLY A CA    1 
ATOM   1577  C  C     . GLY A 1  203  ? 21.955  7.192   128.173 1.00 54.00  ? 203  GLY A C     1 
ATOM   1578  O  O     . GLY A 1  203  ? 22.435  7.749   129.165 1.00 59.92  ? 203  GLY A O     1 
ATOM   1579  N  N     . SER A 1  204  ? 22.029  7.718   126.946 1.00 51.79  ? 204  SER A N     1 
ATOM   1580  C  CA    . SER A 1  204  ? 22.579  9.053   126.734 1.00 54.64  ? 204  SER A CA    1 
ATOM   1581  C  C     . SER A 1  204  ? 21.857  10.078  127.602 1.00 56.26  ? 204  SER A C     1 
ATOM   1582  O  O     . SER A 1  204  ? 22.487  10.861  128.322 1.00 52.27  ? 204  SER A O     1 
ATOM   1583  C  CB    . SER A 1  204  ? 22.485  9.426   125.253 1.00 54.89  ? 204  SER A CB    1 
ATOM   1584  O  OG    . SER A 1  204  ? 22.969  10.736  125.019 1.00 59.06  ? 204  SER A OG    1 
ATOM   1585  N  N     . VAL A 1  205  ? 20.529  10.085  127.542 1.00 56.52  ? 205  VAL A N     1 
ATOM   1586  C  CA    . VAL A 1  205  ? 19.714  10.792  128.515 1.00 57.17  ? 205  VAL A CA    1 
ATOM   1587  C  C     . VAL A 1  205  ? 18.777  9.771   129.149 1.00 54.58  ? 205  VAL A C     1 
ATOM   1588  O  O     . VAL A 1  205  ? 18.483  8.717   128.578 1.00 48.93  ? 205  VAL A O     1 
ATOM   1589  C  CB    . VAL A 1  205  ? 18.928  11.972  127.902 1.00 49.51  ? 205  VAL A CB    1 
ATOM   1590  C  CG1   . VAL A 1  205  ? 19.800  12.738  126.912 1.00 43.39  ? 205  VAL A CG1   1 
ATOM   1591  C  CG2   . VAL A 1  205  ? 17.644  11.491  127.252 1.00 46.27  ? 205  VAL A CG2   1 
ATOM   1592  N  N     . THR A 1  206  ? 18.333  10.082  130.352 1.00 54.39  ? 206  THR A N     1 
ATOM   1593  C  CA    . THR A 1  206  ? 17.530  9.154   131.127 1.00 53.13  ? 206  THR A CA    1 
ATOM   1594  C  C     . THR A 1  206  ? 16.052  9.330   130.809 1.00 53.18  ? 206  THR A C     1 
ATOM   1595  O  O     . THR A 1  206  ? 15.634  10.377  130.302 1.00 50.21  ? 206  THR A O     1 
ATOM   1596  C  CB    . THR A 1  206  ? 17.773  9.379   132.616 1.00 60.68  ? 206  THR A CB    1 
ATOM   1597  O  OG1   . THR A 1  206  ? 17.086  10.564  133.035 1.00 58.98  ? 206  THR A OG1   1 
ATOM   1598  C  CG2   . THR A 1  206  ? 19.257  9.538   132.881 1.00 58.90  ? 206  THR A CG2   1 
ATOM   1599  N  N     . PRO A 1  207  ? 15.230  8.310   131.088 1.00 54.65  ? 207  PRO A N     1 
ATOM   1600  C  CA    . PRO A 1  207  ? 13.783  8.456   130.850 1.00 54.85  ? 207  PRO A CA    1 
ATOM   1601  C  C     . PRO A 1  207  ? 13.171  9.653   131.556 1.00 56.78  ? 207  PRO A C     1 
ATOM   1602  O  O     . PRO A 1  207  ? 12.332  10.351  130.971 1.00 56.78  ? 207  PRO A O     1 
ATOM   1603  C  CB    . PRO A 1  207  ? 13.210  7.133   131.381 1.00 50.92  ? 207  PRO A CB    1 
ATOM   1604  C  CG    . PRO A 1  207  ? 14.332  6.165   131.284 1.00 50.29  ? 207  PRO A CG    1 
ATOM   1605  C  CD    . PRO A 1  207  ? 15.583  6.951   131.541 1.00 53.35  ? 207  PRO A CD    1 
ATOM   1606  N  N     . LEU A 1  208  ? 13.576  9.910   132.802 1.00 51.48  ? 208  LEU A N     1 
ATOM   1607  C  CA    . LEU A 1  208  ? 13.005  11.018  133.560 1.00 51.07  ? 208  LEU A CA    1 
ATOM   1608  C  C     . LEU A 1  208  ? 13.348  12.358  132.919 1.00 51.24  ? 208  LEU A C     1 
ATOM   1609  O  O     . LEU A 1  208  ? 12.486  13.236  132.802 1.00 56.28  ? 208  LEU A O     1 
ATOM   1610  C  CB    . LEU A 1  208  ? 13.490  10.965  135.010 1.00 61.20  ? 208  LEU A CB    1 
ATOM   1611  C  CG    . LEU A 1  208  ? 13.148  12.150  135.920 1.00 57.42  ? 208  LEU A CG    1 
ATOM   1612  C  CD1   . LEU A 1  208  ? 11.658  12.219  136.224 1.00 45.75  ? 208  LEU A CD1   1 
ATOM   1613  C  CD2   . LEU A 1  208  ? 13.965  12.090  137.202 1.00 56.18  ? 208  LEU A CD2   1 
ATOM   1614  N  N     . GLU A 1  209  ? 14.606  12.538  132.506 1.00 42.77  ? 209  GLU A N     1 
ATOM   1615  C  CA    . GLU A 1  209  ? 14.981  13.773  131.824 1.00 49.71  ? 209  GLU A CA    1 
ATOM   1616  C  C     . GLU A 1  209  ? 14.161  13.961  130.557 1.00 52.76  ? 209  GLU A C     1 
ATOM   1617  O  O     . GLU A 1  209  ? 13.716  15.076  130.247 1.00 45.67  ? 209  GLU A O     1 
ATOM   1618  C  CB    . GLU A 1  209  ? 16.469  13.762  131.481 1.00 56.33  ? 209  GLU A CB    1 
ATOM   1619  C  CG    . GLU A 1  209  ? 17.411  13.610  132.652 1.00 53.36  ? 209  GLU A CG    1 
ATOM   1620  C  CD    . GLU A 1  209  ? 18.816  13.254  132.200 1.00 56.18  ? 209  GLU A CD    1 
ATOM   1621  O  OE1   . GLU A 1  209  ? 19.650  12.881  133.052 1.00 62.01  ? 209  GLU A OE1   1 
ATOM   1622  O  OE2   . GLU A 1  209  ? 19.085  13.342  130.984 1.00 56.91  ? 209  GLU A OE2   1 
ATOM   1623  N  N     . ALA A 1  210  ? 13.971  12.875  129.805 1.00 52.71  ? 210  ALA A N     1 
ATOM   1624  C  CA    . ALA A 1  210  ? 13.188  12.933  128.578 1.00 53.95  ? 210  ALA A CA    1 
ATOM   1625  C  C     . ALA A 1  210  ? 11.764  13.380  128.865 1.00 53.24  ? 210  ALA A C     1 
ATOM   1626  O  O     . ALA A 1  210  ? 11.235  14.274  128.194 1.00 50.26  ? 210  ALA A O     1 
ATOM   1627  C  CB    . ALA A 1  210  ? 13.197  11.567  127.893 1.00 54.80  ? 210  ALA A CB    1 
ATOM   1628  N  N     . LEU A 1  211  ? 11.122  12.752  129.854 1.00 49.27  ? 211  LEU A N     1 
ATOM   1629  C  CA    . LEU A 1  211  ? 9.777   13.160  130.245 1.00 44.92  ? 211  LEU A CA    1 
ATOM   1630  C  C     . LEU A 1  211  ? 9.747   14.628  130.648 1.00 47.36  ? 211  LEU A C     1 
ATOM   1631  O  O     . LEU A 1  211  ? 8.812   15.358  130.298 1.00 47.92  ? 211  LEU A O     1 
ATOM   1632  C  CB    . LEU A 1  211  ? 9.277   12.275  131.387 1.00 47.09  ? 211  LEU A CB    1 
ATOM   1633  C  CG    . LEU A 1  211  ? 8.057   12.737  132.191 1.00 46.28  ? 211  LEU A CG    1 
ATOM   1634  C  CD1   . LEU A 1  211  ? 6.829   12.876  131.307 1.00 41.54  ? 211  LEU A CD1   1 
ATOM   1635  C  CD2   . LEU A 1  211  ? 7.786   11.773  133.332 1.00 39.28  ? 211  LEU A CD2   1 
ATOM   1636  N  N     . ASN A 1  212  ? 10.774  15.081  131.369 1.00 46.85  ? 212  ASN A N     1 
ATOM   1637  C  CA    . ASN A 1  212  ? 10.796  16.459  131.848 1.00 53.02  ? 212  ASN A CA    1 
ATOM   1638  C  C     . ASN A 1  212  ? 10.850  17.444  130.687 1.00 51.63  ? 212  ASN A C     1 
ATOM   1639  O  O     . ASN A 1  212  ? 10.061  18.396  130.627 1.00 45.15  ? 212  ASN A O     1 
ATOM   1640  C  CB    . ASN A 1  212  ? 11.978  16.663  132.796 1.00 53.89  ? 212  ASN A CB    1 
ATOM   1641  C  CG    . ASN A 1  212  ? 11.738  16.046  134.161 1.00 54.27  ? 212  ASN A CG    1 
ATOM   1642  O  OD1   . ASN A 1  212  ? 10.637  16.135  134.705 1.00 58.99  ? 212  ASN A OD1   1 
ATOM   1643  N  ND2   . ASN A 1  212  ? 12.763  15.412  134.719 1.00 47.15  ? 212  ASN A ND2   1 
ATOM   1644  N  N     . GLN A 1  213  ? 11.769  17.226  129.742 1.00 53.51  ? 213  GLN A N     1 
ATOM   1645  C  CA    . GLN A 1  213  ? 11.847  18.161  128.625 1.00 51.22  ? 213  GLN A CA    1 
ATOM   1646  C  C     . GLN A 1  213  ? 10.691  17.989  127.648 1.00 49.65  ? 213  GLN A C     1 
ATOM   1647  O  O     . GLN A 1  213  ? 10.339  18.949  126.961 1.00 50.40  ? 213  GLN A O     1 
ATOM   1648  C  CB    . GLN A 1  213  ? 13.190  18.059  127.897 1.00 51.84  ? 213  GLN A CB    1 
ATOM   1649  C  CG    . GLN A 1  213  ? 13.737  16.671  127.672 1.00 52.49  ? 213  GLN A CG    1 
ATOM   1650  C  CD    . GLN A 1  213  ? 15.217  16.705  127.330 1.00 52.45  ? 213  GLN A CD    1 
ATOM   1651  O  OE1   . GLN A 1  213  ? 15.727  17.718  126.846 1.00 48.52  ? 213  GLN A OE1   1 
ATOM   1652  N  NE2   . GLN A 1  213  ? 15.918  15.604  127.592 1.00 48.43  ? 213  GLN A NE2   1 
ATOM   1653  N  N     . ALA A 1  214  ? 10.050  16.819  127.610 1.00 45.27  ? 214  ALA A N     1 
ATOM   1654  C  CA    . ALA A 1  214  ? 8.832   16.681  126.818 1.00 44.94  ? 214  ALA A CA    1 
ATOM   1655  C  C     . ALA A 1  214  ? 7.706   17.519  127.411 1.00 47.14  ? 214  ALA A C     1 
ATOM   1656  O  O     . ALA A 1  214  ? 6.998   18.236  126.689 1.00 47.46  ? 214  ALA A O     1 
ATOM   1657  C  CB    . ALA A 1  214  ? 8.422   15.211  126.735 1.00 39.47  ? 214  ALA A CB    1 
ATOM   1658  N  N     . VAL A 1  215  ? 7.521   17.427  128.730 1.00 49.04  ? 215  VAL A N     1 
ATOM   1659  C  CA    . VAL A 1  215  ? 6.550   18.274  129.415 1.00 47.45  ? 215  VAL A CA    1 
ATOM   1660  C  C     . VAL A 1  215  ? 6.863   19.744  129.171 1.00 49.38  ? 215  VAL A C     1 
ATOM   1661  O  O     . VAL A 1  215  ? 5.964   20.555  128.918 1.00 45.37  ? 215  VAL A O     1 
ATOM   1662  C  CB    . VAL A 1  215  ? 6.527   17.944  130.918 1.00 37.94  ? 215  VAL A CB    1 
ATOM   1663  C  CG1   . VAL A 1  215  ? 5.675   18.949  131.663 1.00 45.97  ? 215  VAL A CG1   1 
ATOM   1664  C  CG2   . VAL A 1  215  ? 6.011   16.538  131.140 1.00 42.01  ? 215  VAL A CG2   1 
ATOM   1665  N  N     . GLU A 1  216  ? 8.146   20.105  129.236 1.00 50.33  ? 216  GLU A N     1 
ATOM   1666  C  CA    . GLU A 1  216  ? 8.537   21.492  129.011 1.00 50.62  ? 216  GLU A CA    1 
ATOM   1667  C  C     . GLU A 1  216  ? 8.212   21.935  127.589 1.00 50.66  ? 216  GLU A C     1 
ATOM   1668  O  O     . GLU A 1  216  ? 7.762   23.066  127.371 1.00 49.51  ? 216  GLU A O     1 
ATOM   1669  C  CB    . GLU A 1  216  ? 10.027  21.664  129.307 1.00 50.29  ? 216  GLU A CB    1 
ATOM   1670  C  CG    . GLU A 1  216  ? 10.556  23.069  129.086 1.00 54.78  ? 216  GLU A CG    1 
ATOM   1671  C  CD    . GLU A 1  216  ? 9.912   24.091  130.001 1.00 55.95  ? 216  GLU A CD    1 
ATOM   1672  O  OE1   . GLU A 1  216  ? 9.630   23.755  131.172 1.00 58.87  ? 216  GLU A OE1   1 
ATOM   1673  O  OE2   . GLU A 1  216  ? 9.685   25.232  129.546 1.00 59.98  ? 216  GLU A OE2   1 
ATOM   1674  N  N     . ILE A 1  217  ? 8.426   21.053  126.608 1.00 48.46  ? 217  ILE A N     1 
ATOM   1675  C  CA    . ILE A 1  217  ? 8.106   21.384  125.221 1.00 53.53  ? 217  ILE A CA    1 
ATOM   1676  C  C     . ILE A 1  217  ? 6.609   21.611  125.065 1.00 51.39  ? 217  ILE A C     1 
ATOM   1677  O  O     . ILE A 1  217  ? 6.170   22.596  124.459 1.00 52.29  ? 217  ILE A O     1 
ATOM   1678  C  CB    . ILE A 1  217  ? 8.608   20.279  124.274 1.00 49.38  ? 217  ILE A CB    1 
ATOM   1679  C  CG1   . ILE A 1  217  ? 10.132  20.307  124.170 1.00 48.58  ? 217  ILE A CG1   1 
ATOM   1680  C  CG2   . ILE A 1  217  ? 7.979   20.429  122.896 1.00 49.20  ? 217  ILE A CG2   1 
ATOM   1681  C  CD1   . ILE A 1  217  ? 10.704  19.137  123.397 1.00 50.01  ? 217  ILE A CD1   1 
ATOM   1682  N  N     . LEU A 1  218  ? 5.802   20.699  125.609 1.00 44.99  ? 218  LEU A N     1 
ATOM   1683  C  CA    . LEU A 1  218  ? 4.355   20.844  125.487 1.00 42.40  ? 218  LEU A CA    1 
ATOM   1684  C  C     . LEU A 1  218  ? 3.867   22.104  126.193 1.00 48.78  ? 218  LEU A C     1 
ATOM   1685  O  O     . LEU A 1  218  ? 2.949   22.778  125.712 1.00 47.20  ? 218  LEU A O     1 
ATOM   1686  C  CB    . LEU A 1  218  ? 3.659   19.603  126.038 1.00 39.94  ? 218  LEU A CB    1 
ATOM   1687  C  CG    . LEU A 1  218  ? 2.136   19.558  125.924 1.00 40.61  ? 218  LEU A CG    1 
ATOM   1688  C  CD1   . LEU A 1  218  ? 1.691   19.907  124.518 1.00 37.35  ? 218  LEU A CD1   1 
ATOM   1689  C  CD2   . LEU A 1  218  ? 1.631   18.181  126.319 1.00 40.08  ? 218  LEU A CD2   1 
ATOM   1690  N  N     . ARG A 1  219  ? 4.489   22.453  127.322 1.00 51.84  ? 219  ARG A N     1 
ATOM   1691  C  CA    . ARG A 1  219  ? 4.119   23.670  128.039 1.00 49.90  ? 219  ARG A CA    1 
ATOM   1692  C  C     . ARG A 1  219  ? 4.474   24.909  127.227 1.00 50.60  ? 219  ARG A C     1 
ATOM   1693  O  O     . ARG A 1  219  ? 3.650   25.818  127.057 1.00 54.10  ? 219  ARG A O     1 
ATOM   1694  C  CB    . ARG A 1  219  ? 4.811   23.692  129.406 1.00 49.71  ? 219  ARG A CB    1 
ATOM   1695  C  CG    . ARG A 1  219  ? 4.168   24.606  130.457 1.00 60.19  ? 219  ARG A CG    1 
ATOM   1696  C  CD    . ARG A 1  219  ? 4.702   26.031  130.384 1.00 49.77  ? 219  ARG A CD    1 
ATOM   1697  N  NE    . ARG A 1  219  ? 6.161   26.065  130.407 1.00 44.96  ? 219  ARG A NE    1 
ATOM   1698  C  CZ    . ARG A 1  219  ? 6.888   27.131  130.091 1.00 46.31  ? 219  ARG A CZ    1 
ATOM   1699  N  NH1   . ARG A 1  219  ? 6.293   28.257  129.725 1.00 49.66  ? 219  ARG A NH1   1 
ATOM   1700  N  NH2   . ARG A 1  219  ? 8.210   27.071  130.134 1.00 47.79  ? 219  ARG A NH2   1 
ATOM   1701  N  N     . GLU A 1  220  ? 5.706   24.963  126.720 1.00 51.31  ? 220  GLU A N     1 
ATOM   1702  C  CA    . GLU A 1  220  ? 6.106   26.072  125.865 1.00 58.80  ? 220  GLU A CA    1 
ATOM   1703  C  C     . GLU A 1  220  ? 5.199   26.189  124.649 1.00 58.89  ? 220  GLU A C     1 
ATOM   1704  O  O     . GLU A 1  220  ? 4.943   27.299  124.169 1.00 58.73  ? 220  GLU A O     1 
ATOM   1705  C  CB    . GLU A 1  220  ? 7.562   25.891  125.442 1.00 61.94  ? 220  GLU A CB    1 
ATOM   1706  C  CG    . GLU A 1  220  ? 8.100   26.993  124.559 1.00 65.67  ? 220  GLU A CG    1 
ATOM   1707  C  CD    . GLU A 1  220  ? 9.489   26.682  124.064 1.00 78.29  ? 220  GLU A CD    1 
ATOM   1708  O  OE1   . GLU A 1  220  ? 10.023  25.620  124.448 1.00 85.41  ? 220  GLU A OE1   1 
ATOM   1709  O  OE2   . GLU A 1  220  ? 10.045  27.490  123.293 1.00 88.48  ? 220  GLU A OE2   1 
ATOM   1710  N  N     . HIS A 1  221  ? 4.690   25.061  124.147 1.00 57.35  ? 221  HIS A N     1 
ATOM   1711  C  CA    . HIS A 1  221  ? 3.774   25.115  123.012 1.00 59.48  ? 221  HIS A CA    1 
ATOM   1712  C  C     . HIS A 1  221  ? 2.412   25.653  123.425 1.00 53.90  ? 221  HIS A C     1 
ATOM   1713  O  O     . HIS A 1  221  ? 1.785   26.411  122.676 1.00 53.34  ? 221  HIS A O     1 
ATOM   1714  C  CB    . HIS A 1  221  ? 3.643   23.734  122.372 1.00 55.65  ? 221  HIS A CB    1 
ATOM   1715  C  CG    . HIS A 1  221  ? 4.676   23.458  121.324 1.00 54.80  ? 221  HIS A CG    1 
ATOM   1716  N  ND1   . HIS A 1  221  ? 5.932   22.976  121.624 1.00 54.61  ? 221  HIS A ND1   1 
ATOM   1717  C  CD2   . HIS A 1  221  ? 4.642   23.612  119.980 1.00 49.18  ? 221  HIS A CD2   1 
ATOM   1718  C  CE1   . HIS A 1  221  ? 6.624   22.835  120.508 1.00 54.87  ? 221  HIS A CE1   1 
ATOM   1719  N  NE2   . HIS A 1  221  ? 5.865   23.214  119.496 1.00 55.43  ? 221  HIS A NE2   1 
ATOM   1720  N  N     . LEU A 1  222  ? 1.937   25.273  124.612 1.00 57.65  ? 222  LEU A N     1 
ATOM   1721  C  CA    . LEU A 1  222  ? 0.716   25.876  125.134 1.00 56.97  ? 222  LEU A CA    1 
ATOM   1722  C  C     . LEU A 1  222  ? 0.872   27.380  125.286 1.00 56.70  ? 222  LEU A C     1 
ATOM   1723  O  O     . LEU A 1  222  ? -0.109  28.124  125.173 1.00 56.32  ? 222  LEU A O     1 
ATOM   1724  C  CB    . LEU A 1  222  ? 0.346   25.243  126.474 1.00 51.68  ? 222  LEU A CB    1 
ATOM   1725  C  CG    . LEU A 1  222  ? -0.132  23.794  126.420 1.00 49.32  ? 222  LEU A CG    1 
ATOM   1726  C  CD1   . LEU A 1  222  ? -0.358  23.259  127.823 1.00 46.38  ? 222  LEU A CD1   1 
ATOM   1727  C  CD2   . LEU A 1  222  ? -1.400  23.701  125.589 1.00 47.18  ? 222  LEU A CD2   1 
ATOM   1728  N  N     . THR A 1  223  ? 2.100   27.839  125.541 1.00 55.10  ? 223  THR A N     1 
ATOM   1729  C  CA    . THR A 1  223  ? 2.356   29.274  125.639 1.00 55.99  ? 223  THR A CA    1 
ATOM   1730  C  C     . THR A 1  223  ? 2.012   30.001  124.343 1.00 63.11  ? 223  THR A C     1 
ATOM   1731  O  O     . THR A 1  223  ? 1.686   31.193  124.368 1.00 62.06  ? 223  THR A O     1 
ATOM   1732  C  CB    . THR A 1  223  ? 3.822   29.523  126.007 1.00 59.22  ? 223  THR A CB    1 
ATOM   1733  O  OG1   . THR A 1  223  ? 4.152   28.778  127.185 1.00 63.05  ? 223  THR A OG1   1 
ATOM   1734  C  CG2   . THR A 1  223  ? 4.084   31.002  126.262 1.00 70.70  ? 223  THR A CG2   1 
ATOM   1735  N  N     . TYR A 1  224  ? 2.057   29.301  123.207 1.00 61.94  ? 224  TYR A N     1 
ATOM   1736  C  CA    . TYR A 1  224  ? 1.894   29.945  121.909 1.00 61.30  ? 224  TYR A CA    1 
ATOM   1737  C  C     . TYR A 1  224  ? 0.500   30.521  121.688 1.00 66.69  ? 224  TYR A C     1 
ATOM   1738  O  O     . TYR A 1  224  ? 0.313   31.291  120.738 1.00 66.12  ? 224  TYR A O     1 
ATOM   1739  C  CB    . TYR A 1  224  ? 2.228   28.952  120.799 1.00 61.08  ? 224  TYR A CB    1 
ATOM   1740  C  CG    . TYR A 1  224  ? 3.675   28.506  120.802 1.00 65.61  ? 224  TYR A CG    1 
ATOM   1741  C  CD1   . TYR A 1  224  ? 4.667   29.301  121.367 1.00 63.69  ? 224  TYR A CD1   1 
ATOM   1742  C  CD2   . TYR A 1  224  ? 4.051   27.294  120.234 1.00 63.66  ? 224  TYR A CD2   1 
ATOM   1743  C  CE1   . TYR A 1  224  ? 5.991   28.897  121.372 1.00 62.77  ? 224  TYR A CE1   1 
ATOM   1744  C  CE2   . TYR A 1  224  ? 5.372   26.882  120.236 1.00 61.23  ? 224  TYR A CE2   1 
ATOM   1745  C  CZ    . TYR A 1  224  ? 6.338   27.687  120.805 1.00 62.26  ? 224  TYR A CZ    1 
ATOM   1746  O  OH    . TYR A 1  224  ? 7.652   27.279  120.807 1.00 60.58  ? 224  TYR A OH    1 
ATOM   1747  N  N     . PHE A 1  225  ? -0.471  30.177  122.529 1.00 67.63  ? 225  PHE A N     1 
ATOM   1748  C  CA    . PHE A 1  225  ? -1.816  30.730  122.444 1.00 67.05  ? 225  PHE A CA    1 
ATOM   1749  C  C     . PHE A 1  225  ? -1.972  32.028  123.228 1.00 75.06  ? 225  PHE A C     1 
ATOM   1750  O  O     . PHE A 1  225  ? -3.091  32.542  123.333 1.00 77.69  ? 225  PHE A O     1 
ATOM   1751  C  CB    . PHE A 1  225  ? -2.840  29.710  122.954 1.00 59.37  ? 225  PHE A CB    1 
ATOM   1752  C  CG    . PHE A 1  225  ? -2.917  28.454  122.135 1.00 58.22  ? 225  PHE A CG    1 
ATOM   1753  C  CD1   . PHE A 1  225  ? -2.018  27.419  122.336 1.00 59.57  ? 225  PHE A CD1   1 
ATOM   1754  C  CD2   . PHE A 1  225  ? -3.903  28.300  121.176 1.00 55.04  ? 225  PHE A CD2   1 
ATOM   1755  C  CE1   . PHE A 1  225  ? -2.093  26.259  121.584 1.00 55.42  ? 225  PHE A CE1   1 
ATOM   1756  C  CE2   . PHE A 1  225  ? -3.985  27.144  120.424 1.00 49.69  ? 225  PHE A CE2   1 
ATOM   1757  C  CZ    . PHE A 1  225  ? -3.080  26.123  120.627 1.00 48.98  ? 225  PHE A CZ    1 
ATOM   1758  N  N     . SER A 1  226  ? -0.880  32.571  123.773 1.00 75.99  ? 226  SER A N     1 
ATOM   1759  C  CA    . SER A 1  226  ? -0.979  33.667  124.733 1.00 82.59  ? 226  SER A CA    1 
ATOM   1760  C  C     . SER A 1  226  ? -1.288  35.008  124.078 1.00 89.74  ? 226  SER A C     1 
ATOM   1761  O  O     . SER A 1  226  ? -1.848  35.894  124.734 1.00 91.62  ? 226  SER A O     1 
ATOM   1762  C  CB    . SER A 1  226  ? 0.316   33.774  125.538 1.00 82.14  ? 226  SER A CB    1 
ATOM   1763  O  OG    . SER A 1  226  ? 1.443   33.848  124.682 1.00 77.79  ? 226  SER A OG    1 
ATOM   1764  N  N     . ASN A 1  227  ? -0.940  35.189  122.804 1.00 81.50  ? 227  ASN A N     1 
ATOM   1765  C  CA    . ASN A 1  227  ? -1.135  36.468  122.122 1.00 82.70  ? 227  ASN A CA    1 
ATOM   1766  C  C     . ASN A 1  227  ? -2.048  36.268  120.921 1.00 85.77  ? 227  ASN A C     1 
ATOM   1767  O  O     . ASN A 1  227  ? -1.572  35.999  119.806 1.00 88.12  ? 227  ASN A O     1 
ATOM   1768  C  CB    . ASN A 1  227  ? 0.198   37.079  121.697 1.00 90.25  ? 227  ASN A CB    1 
ATOM   1769  C  CG    . ASN A 1  227  ? 0.033   38.454  121.075 1.00 89.43  ? 227  ASN A CG    1 
ATOM   1770  O  OD1   . ASN A 1  227  ? -0.918  39.176  121.378 1.00 84.61  ? 227  ASN A OD1   1 
ATOM   1771  N  ND2   . ASN A 1  227  ? 0.958   38.821  120.195 1.00 92.50  ? 227  ASN A ND2   1 
ATOM   1772  N  N     . PRO A 1  228  ? -3.362  36.394  121.096 1.00 87.79  ? 228  PRO A N     1 
ATOM   1773  C  CA    . PRO A 1  228  ? -4.274  36.305  119.950 1.00 84.80  ? 228  PRO A CA    1 
ATOM   1774  C  C     . PRO A 1  228  ? -4.087  37.469  118.985 1.00 84.03  ? 228  PRO A C     1 
ATOM   1775  O  O     . PRO A 1  228  ? -3.557  38.526  119.331 1.00 85.63  ? 228  PRO A O     1 
ATOM   1776  C  CB    . PRO A 1  228  ? -5.663  36.338  120.599 1.00 81.11  ? 228  PRO A CB    1 
ATOM   1777  C  CG    . PRO A 1  228  ? -5.440  35.883  122.008 1.00 79.52  ? 228  PRO A CG    1 
ATOM   1778  C  CD    . PRO A 1  228  ? -4.087  36.415  122.379 1.00 85.24  ? 228  PRO A CD    1 
ATOM   1779  N  N     . GLN A 1  229  ? -4.537  37.253  117.748 1.00 85.55  ? 229  GLN A N     1 
ATOM   1780  C  CA    . GLN A 1  229  ? -4.450  38.253  116.692 1.00 87.04  ? 229  GLN A CA    1 
ATOM   1781  C  C     . GLN A 1  229  ? -5.755  38.269  115.910 1.00 81.44  ? 229  GLN A C     1 
ATOM   1782  O  O     . GLN A 1  229  ? -6.372  37.222  115.696 1.00 76.33  ? 229  GLN A O     1 
ATOM   1783  C  CB    . GLN A 1  229  ? -3.277  37.968  115.740 1.00 84.52  ? 229  GLN A CB    1 
ATOM   1784  C  CG    . GLN A 1  229  ? -2.675  39.201  115.088 1.00 85.33  ? 229  GLN A CG    1 
ATOM   1785  C  CD    . GLN A 1  229  ? -1.657  39.883  115.979 1.00 92.96  ? 229  GLN A CD    1 
ATOM   1786  O  OE1   . GLN A 1  229  ? -1.223  39.320  116.985 1.00 88.14  ? 229  GLN A OE1   1 
ATOM   1787  N  NE2   . GLN A 1  229  ? -1.270  41.101  115.615 1.00 100.25 ? 229  GLN A NE2   1 
ATOM   1788  N  N     . ALA A 1  230  ? -6.174  39.459  115.486 1.00 82.45  ? 230  ALA A N     1 
ATOM   1789  C  CA    . ALA A 1  230  ? -7.405  39.594  114.721 1.00 87.28  ? 230  ALA A CA    1 
ATOM   1790  C  C     . ALA A 1  230  ? -7.184  39.169  113.273 1.00 92.39  ? 230  ALA A C     1 
ATOM   1791  O  O     . ALA A 1  230  ? -6.142  39.455  112.677 1.00 94.29  ? 230  ALA A O     1 
ATOM   1792  C  CB    . ALA A 1  230  ? -7.917  41.034  114.780 1.00 87.87  ? 230  ALA A CB    1 
ATOM   1793  N  N     . ALA A 1  231  ? -8.173  38.477  112.710 1.00 92.40  ? 231  ALA A N     1 
ATOM   1794  C  CA    . ALA A 1  231  ? -8.082  38.013  111.331 1.00 101.24 ? 231  ALA A CA    1 
ATOM   1795  C  C     . ALA A 1  231  ? -8.272  39.180  110.368 1.00 118.18 ? 231  ALA A C     1 
ATOM   1796  O  O     . ALA A 1  231  ? -9.311  39.850  110.387 1.00 116.46 ? 231  ALA A O     1 
ATOM   1797  C  CB    . ALA A 1  231  ? -9.121  36.926  111.069 1.00 91.10  ? 231  ALA A CB    1 
ATOM   1798  N  N     . ALA A 1  232  ? -7.275  39.417  109.519 1.00 123.61 ? 232  ALA A N     1 
ATOM   1799  C  CA    . ALA A 1  232  ? -7.316  40.493  108.539 1.00 122.56 ? 232  ALA A CA    1 
ATOM   1800  C  C     . ALA A 1  232  ? -7.991  40.081  107.236 1.00 134.59 ? 232  ALA A C     1 
ATOM   1801  O  O     . ALA A 1  232  ? -7.914  40.825  106.253 1.00 139.98 ? 232  ALA A O     1 
ATOM   1802  C  CB    . ALA A 1  232  ? -5.899  40.996  108.252 1.00 117.66 ? 232  ALA A CB    1 
ATOM   1803  N  N     . VAL A 1  233  ? -8.648  38.918  107.208 1.00 136.43 ? 233  VAL A N     1 
ATOM   1804  C  CA    . VAL A 1  233  ? -9.276  38.440  105.977 1.00 143.22 ? 233  VAL A CA    1 
ATOM   1805  C  C     . VAL A 1  233  ? -10.405 39.371  105.552 1.00 138.28 ? 233  VAL A C     1 
ATOM   1806  O  O     . VAL A 1  233  ? -10.552 39.692  104.365 1.00 127.30 ? 233  VAL A O     1 
ATOM   1807  C  CB    . VAL A 1  233  ? -9.773  36.992  106.158 1.00 142.10 ? 233  VAL A CB    1 
ATOM   1808  C  CG1   . VAL A 1  233  ? -10.381 36.467  104.863 1.00 136.19 ? 233  VAL A CG1   1 
ATOM   1809  C  CG2   . VAL A 1  233  ? -8.634  36.094  106.627 1.00 128.60 ? 233  VAL A CG2   1 
ATOM   1810  N  N     . ALA A 1  234  ? -11.216 39.818  106.507 1.00 136.54 ? 234  ALA A N     1 
ATOM   1811  C  CA    . ALA A 1  234  ? -12.349 40.688  106.212 1.00 133.30 ? 234  ALA A CA    1 
ATOM   1812  C  C     . ALA A 1  234  ? -11.889 42.022  105.628 1.00 133.79 ? 234  ALA A C     1 
ATOM   1813  O  O     . ALA A 1  234  ? -11.807 43.025  106.335 1.00 138.28 ? 234  ALA A O     1 
ATOM   1814  C  CB    . ALA A 1  234  ? -13.178 40.917  107.466 1.00 126.46 ? 234  ALA A CB    1 
ATOM   1815  N  N     . LEU B 1  6    ? 13.617  29.136  112.809 1.00 119.20 ? 6    LEU B N     1 
ATOM   1816  C  CA    . LEU B 1  6    ? 12.442  28.723  113.567 1.00 124.72 ? 6    LEU B CA    1 
ATOM   1817  C  C     . LEU B 1  6    ? 11.594  29.924  113.974 1.00 126.62 ? 6    LEU B C     1 
ATOM   1818  O  O     . LEU B 1  6    ? 11.712  30.430  115.089 1.00 125.73 ? 6    LEU B O     1 
ATOM   1819  C  CB    . LEU B 1  6    ? 12.856  27.929  114.807 1.00 116.37 ? 6    LEU B CB    1 
ATOM   1820  C  CG    . LEU B 1  6    ? 11.713  27.317  115.618 1.00 108.91 ? 6    LEU B CG    1 
ATOM   1821  C  CD1   . LEU B 1  6    ? 12.094  25.933  116.122 1.00 102.04 ? 6    LEU B CD1   1 
ATOM   1822  C  CD2   . LEU B 1  6    ? 11.327  28.228  116.773 1.00 99.99  ? 6    LEU B CD2   1 
ATOM   1823  N  N     . LYS B 1  7    ? 10.738  30.372  113.062 1.00 121.74 ? 7    LYS B N     1 
ATOM   1824  C  CA    . LYS B 1  7    ? 9.870   31.513  113.321 1.00 115.72 ? 7    LYS B CA    1 
ATOM   1825  C  C     . LYS B 1  7    ? 8.881   31.204  114.439 1.00 113.87 ? 7    LYS B C     1 
ATOM   1826  O  O     . LYS B 1  7    ? 8.370   30.090  114.538 1.00 112.58 ? 7    LYS B O     1 
ATOM   1827  C  CB    . LYS B 1  7    ? 9.121   31.913  112.048 1.00 109.46 ? 7    LYS B CB    1 
ATOM   1828  C  CG    . LYS B 1  7    ? 7.916   32.809  112.284 1.00 104.12 ? 7    LYS B CG    1 
ATOM   1829  C  CD    . LYS B 1  7    ? 6.786   32.475  111.323 1.00 95.22  ? 7    LYS B CD    1 
ATOM   1830  C  CE    . LYS B 1  7    ? 5.964   33.708  110.988 1.00 89.98  ? 7    LYS B CE    1 
ATOM   1831  N  NZ    . LYS B 1  7    ? 4.903   33.956  112.002 1.00 89.94  ? 7    LYS B NZ    1 
ATOM   1832  N  N     . ALA B 1  8    ? 8.616   32.200  115.278 1.00 111.15 ? 8    ALA B N     1 
ATOM   1833  C  CA    . ALA B 1  8    ? 7.690   32.035  116.391 1.00 97.70  ? 8    ALA B CA    1 
ATOM   1834  C  C     . ALA B 1  8    ? 6.274   31.769  115.895 1.00 98.70  ? 8    ALA B C     1 
ATOM   1835  O  O     . ALA B 1  8    ? 5.837   32.352  114.899 1.00 101.59 ? 8    ALA B O     1 
ATOM   1836  C  CB    . ALA B 1  8    ? 7.717   33.262  117.288 1.00 91.43  ? 8    ALA B CB    1 
ATOM   1837  N  N     . PRO B 1  9    ? 5.542   30.847  116.633 1.00 90.34  ? 9    PRO B N     1 
ATOM   1838  C  CA    . PRO B 1  9    ? 4.179   30.614  116.125 1.00 81.79  ? 9    PRO B CA    1 
ATOM   1839  C  C     . PRO B 1  9    ? 3.291   31.837  116.306 1.00 76.14  ? 9    PRO B C     1 
ATOM   1840  O  O     . PRO B 1  9    ? 3.446   32.567  117.283 1.00 84.27  ? 9    PRO B O     1 
ATOM   1841  C  CB    . PRO B 1  9    ? 3.664   29.459  116.985 1.00 76.58  ? 9    PRO B CB    1 
ATOM   1842  C  CG    . PRO B 1  9    ? 4.329   29.656  118.291 1.00 75.91  ? 9    PRO B CG    1 
ATOM   1843  C  CD    . PRO B 1  9    ? 5.730   29.977  117.881 1.00 74.74  ? 9    PRO B CD    1 
ATOM   1844  N  N     . VAL B 1  10   ? 2.372   32.056  115.372 1.00 69.16  ? 10   VAL B N     1 
ATOM   1845  C  CA    . VAL B 1  10   ? 1.467   33.194  115.448 1.00 73.69  ? 10   VAL B CA    1 
ATOM   1846  C  C     . VAL B 1  10   ? 0.031   32.727  115.649 1.00 77.17  ? 10   VAL B C     1 
ATOM   1847  O  O     . VAL B 1  10   ? -0.464  31.879  114.909 1.00 68.34  ? 10   VAL B O     1 
ATOM   1848  C  CB    . VAL B 1  10   ? 1.540   34.057  114.177 1.00 68.79  ? 10   VAL B CB    1 
ATOM   1849  C  CG1   . VAL B 1  10   ? 0.924   33.318  113.001 1.00 73.69  ? 10   VAL B CG1   1 
ATOM   1850  C  CG2   . VAL B 1  10   ? 0.841   35.388  114.401 1.00 69.34  ? 10   VAL B CG2   1 
ATOM   1851  N  N     . PHE B 1  11   ? -0.632  33.288  116.654 1.00 81.74  ? 11   PHE B N     1 
ATOM   1852  C  CA    . PHE B 1  11   ? -2.012  32.932  116.964 1.00 72.88  ? 11   PHE B CA    1 
ATOM   1853  C  C     . PHE B 1  11   ? -2.988  33.891  116.296 1.00 69.36  ? 11   PHE B C     1 
ATOM   1854  O  O     . PHE B 1  11   ? -2.898  35.104  116.473 1.00 75.82  ? 11   PHE B O     1 
ATOM   1855  C  CB    . PHE B 1  11   ? -2.232  32.932  118.477 1.00 77.72  ? 11   PHE B CB    1 
ATOM   1856  C  CG    . PHE B 1  11   ? -3.454  32.177  118.913 1.00 77.59  ? 11   PHE B CG    1 
ATOM   1857  C  CD1   . PHE B 1  11   ? -3.718  30.914  118.415 1.00 72.11  ? 11   PHE B CD1   1 
ATOM   1858  C  CD2   . PHE B 1  11   ? -4.336  32.730  119.823 1.00 77.15  ? 11   PHE B CD2   1 
ATOM   1859  C  CE1   . PHE B 1  11   ? -4.840  30.216  118.816 1.00 67.84  ? 11   PHE B CE1   1 
ATOM   1860  C  CE2   . PHE B 1  11   ? -5.461  32.039  120.228 1.00 71.34  ? 11   PHE B CE2   1 
ATOM   1861  C  CZ    . PHE B 1  11   ? -5.714  30.780  119.723 1.00 65.61  ? 11   PHE B CZ    1 
ATOM   1862  N  N     . THR B 1  12   ? -3.920  33.340  115.528 1.00 66.49  ? 12   THR B N     1 
ATOM   1863  C  CA    . THR B 1  12   ? -4.911  34.151  114.829 1.00 68.24  ? 12   THR B CA    1 
ATOM   1864  C  C     . THR B 1  12   ? -6.321  33.714  115.209 1.00 72.45  ? 12   THR B C     1 
ATOM   1865  O  O     . THR B 1  12   ? -6.597  32.517  115.324 1.00 69.21  ? 12   THR B O     1 
ATOM   1866  C  CB    . THR B 1  12   ? -4.727  34.042  113.313 1.00 69.96  ? 12   THR B CB    1 
ATOM   1867  O  OG1   . THR B 1  12   ? -3.359  34.313  112.980 1.00 71.56  ? 12   THR B OG1   1 
ATOM   1868  C  CG2   . THR B 1  12   ? -5.631  35.029  112.589 1.00 79.85  ? 12   THR B CG2   1 
ATOM   1869  N  N     . VAL B 1  13   ? -7.214  34.688  115.394 1.00 74.30  ? 13   VAL B N     1 
ATOM   1870  C  CA    . VAL B 1  13   ? -8.566  34.446  115.889 1.00 71.35  ? 13   VAL B CA    1 
ATOM   1871  C  C     . VAL B 1  13   ? -9.572  35.082  114.938 1.00 73.96  ? 13   VAL B C     1 
ATOM   1872  O  O     . VAL B 1  13   ? -9.318  36.155  114.378 1.00 80.63  ? 13   VAL B O     1 
ATOM   1873  C  CB    . VAL B 1  13   ? -8.751  35.004  117.318 1.00 68.57  ? 13   VAL B CB    1 
ATOM   1874  C  CG1   . VAL B 1  13   ? -10.067 34.531  117.919 1.00 62.40  ? 13   VAL B CG1   1 
ATOM   1875  C  CG2   . VAL B 1  13   ? -7.587  34.601  118.202 1.00 71.83  ? 13   VAL B CG2   1 
ATOM   1876  N  N     . ARG B 1  14   ? -10.719 34.425  114.767 1.00 67.17  ? 14   ARG B N     1 
ATOM   1877  C  CA    . ARG B 1  14   ? -11.830 34.967  113.989 1.00 64.60  ? 14   ARG B CA    1 
ATOM   1878  C  C     . ARG B 1  14   ? -13.118 34.546  114.680 1.00 72.53  ? 14   ARG B C     1 
ATOM   1879  O  O     . ARG B 1  14   ? -13.442 33.355  114.706 1.00 76.59  ? 14   ARG B O     1 
ATOM   1880  C  CB    . ARG B 1  14   ? -11.790 34.458  112.551 1.00 76.40  ? 14   ARG B CB    1 
ATOM   1881  C  CG    . ARG B 1  14   ? -12.602 35.266  111.554 1.00 91.63  ? 14   ARG B CG    1 
ATOM   1882  C  CD    . ARG B 1  14   ? -12.404 34.705  110.151 1.00 100.07 ? 14   ARG B CD    1 
ATOM   1883  N  NE    . ARG B 1  14   ? -11.157 33.948  110.055 1.00 103.45 ? 14   ARG B NE    1 
ATOM   1884  C  CZ    . ARG B 1  14   ? -10.701 33.387  108.941 1.00 97.43  ? 14   ARG B CZ    1 
ATOM   1885  N  NH1   . ARG B 1  14   ? -9.558  32.714  108.958 1.00 81.50  ? 14   ARG B NH1   1 
ATOM   1886  N  NH2   . ARG B 1  14   ? -11.387 33.501  107.812 1.00 102.37 ? 14   ARG B NH2   1 
ATOM   1887  N  N     . THR B 1  15   ? -13.866 35.507  115.219 1.00 79.74  ? 15   THR B N     1 
ATOM   1888  C  CA    . THR B 1  15   ? -15.016 35.207  116.066 1.00 83.59  ? 15   THR B CA    1 
ATOM   1889  C  C     . THR B 1  15   ? -16.309 35.717  115.445 1.00 78.86  ? 15   THR B C     1 
ATOM   1890  O  O     . THR B 1  15   ? -16.351 36.816  114.881 1.00 80.72  ? 15   THR B O     1 
ATOM   1891  C  CB    . THR B 1  15   ? -14.863 35.824  117.465 1.00 80.16  ? 15   THR B CB    1 
ATOM   1892  O  OG1   . THR B 1  15   ? -14.852 37.253  117.365 1.00 84.57  ? 15   THR B OG1   1 
ATOM   1893  C  CG2   . THR B 1  15   ? -13.580 35.361  118.122 1.00 72.90  ? 15   THR B CG2   1 
ATOM   1894  N  N     . GLN B 1  16   ? -17.362 34.908  115.563 1.00 74.50  ? 16   GLN B N     1 
ATOM   1895  C  CA    . GLN B 1  16   ? -18.731 35.316  115.277 1.00 84.46  ? 16   GLN B CA    1 
ATOM   1896  C  C     . GLN B 1  16   ? -19.495 35.276  116.594 1.00 92.48  ? 16   GLN B C     1 
ATOM   1897  O  O     . GLN B 1  16   ? -19.763 34.189  117.132 1.00 91.93  ? 16   GLN B O     1 
ATOM   1898  C  CB    . GLN B 1  16   ? -19.381 34.406  114.237 1.00 84.37  ? 16   GLN B CB    1 
ATOM   1899  C  CG    . GLN B 1  16   ? -18.749 34.483  112.864 1.00 97.11  ? 16   GLN B CG    1 
ATOM   1900  C  CD    . GLN B 1  16   ? -19.498 33.657  111.840 1.00 95.69  ? 16   GLN B CD    1 
ATOM   1901  O  OE1   . GLN B 1  16   ? -20.654 33.288  112.053 1.00 89.60  ? 16   GLN B OE1   1 
ATOM   1902  N  NE2   . GLN B 1  16   ? -18.841 33.356  110.723 1.00 86.87  ? 16   GLN B NE2   1 
ATOM   1903  N  N     . GLY B 1  17   ? -19.825 36.457  117.112 1.00 87.03  ? 17   GLY B N     1 
ATOM   1904  C  CA    . GLY B 1  17   ? -20.510 36.667  118.367 1.00 79.19  ? 17   GLY B CA    1 
ATOM   1905  C  C     . GLY B 1  17   ? -19.869 35.888  119.493 1.00 76.17  ? 17   GLY B C     1 
ATOM   1906  O  O     . GLY B 1  17   ? -18.666 35.609  119.496 1.00 73.99  ? 17   GLY B O     1 
ATOM   1907  N  N     . ARG B 1  18   ? -20.692 35.534  120.474 1.00 73.24  ? 18   ARG B N     1 
ATOM   1908  C  CA    . ARG B 1  18   ? -20.288 34.641  121.549 1.00 68.65  ? 18   ARG B CA    1 
ATOM   1909  C  C     . ARG B 1  18   ? -20.520 33.182  121.196 1.00 65.21  ? 18   ARG B C     1 
ATOM   1910  O  O     . ARG B 1  18   ? -20.275 32.306  122.032 1.00 64.82  ? 18   ARG B O     1 
ATOM   1911  C  CB    . ARG B 1  18   ? -21.048 34.984  122.830 1.00 66.65  ? 18   ARG B CB    1 
ATOM   1912  C  CG    . ARG B 1  18   ? -20.937 36.440  123.238 1.00 60.39  ? 18   ARG B CG    1 
ATOM   1913  C  CD    . ARG B 1  18   ? -21.817 36.746  124.435 1.00 59.89  ? 18   ARG B CD    1 
ATOM   1914  N  NE    . ARG B 1  18   ? -21.597 35.803  125.526 1.00 60.45  ? 18   ARG B NE    1 
ATOM   1915  C  CZ    . ARG B 1  18   ? -20.578 35.871  126.377 1.00 64.81  ? 18   ARG B CZ    1 
ATOM   1916  N  NH1   . ARG B 1  18   ? -20.459 34.969  127.341 1.00 59.44  ? 18   ARG B NH1   1 
ATOM   1917  N  NH2   . ARG B 1  18   ? -19.675 36.837  126.262 1.00 61.39  ? 18   ARG B NH2   1 
ATOM   1918  N  N     . GLU B 1  19   ? -20.992 32.909  119.982 1.00 70.74  ? 19   GLU B N     1 
ATOM   1919  C  CA    . GLU B 1  19   ? -21.388 31.566  119.587 1.00 74.22  ? 19   GLU B CA    1 
ATOM   1920  C  C     . GLU B 1  19   ? -20.256 30.763  118.954 1.00 68.79  ? 19   GLU B C     1 
ATOM   1921  O  O     . GLU B 1  19   ? -20.119 29.570  119.244 1.00 61.61  ? 19   GLU B O     1 
ATOM   1922  C  CB    . GLU B 1  19   ? -22.566 31.635  118.613 1.00 78.68  ? 19   GLU B CB    1 
ATOM   1923  C  CG    . GLU B 1  19   ? -23.847 32.168  119.211 1.00 63.85  ? 19   GLU B CG    1 
ATOM   1924  C  CD    . GLU B 1  19   ? -24.620 31.101  119.947 1.00 62.73  ? 19   GLU B CD    1 
ATOM   1925  O  OE1   . GLU B 1  19   ? -25.544 31.457  120.705 1.00 80.18  ? 19   GLU B OE1   1 
ATOM   1926  O  OE2   . GLU B 1  19   ? -24.306 29.907  119.767 1.00 61.60  ? 19   GLU B OE2   1 
ATOM   1927  N  N     . TYR B 1  20   ? -19.438 31.366  118.090 1.00 68.09  ? 20   TYR B N     1 
ATOM   1928  C  CA    . TYR B 1  20   ? -18.573 30.531  117.269 1.00 65.73  ? 20   TYR B CA    1 
ATOM   1929  C  C     . TYR B 1  20   ? -17.207 31.173  117.067 1.00 68.76  ? 20   TYR B C     1 
ATOM   1930  O  O     . TYR B 1  20   ? -17.089 32.399  116.978 1.00 73.38  ? 20   TYR B O     1 
ATOM   1931  C  CB    . TYR B 1  20   ? -19.231 30.264  115.914 1.00 71.90  ? 20   TYR B CB    1 
ATOM   1932  C  CG    . TYR B 1  20   ? -18.323 29.611  114.913 1.00 65.71  ? 20   TYR B CG    1 
ATOM   1933  C  CD1   . TYR B 1  20   ? -17.912 28.299  115.081 1.00 68.54  ? 20   TYR B CD1   1 
ATOM   1934  C  CD2   . TYR B 1  20   ? -17.866 30.307  113.804 1.00 67.93  ? 20   TYR B CD2   1 
ATOM   1935  C  CE1   . TYR B 1  20   ? -17.070 27.689  114.165 1.00 67.37  ? 20   TYR B CE1   1 
ATOM   1936  C  CE2   . TYR B 1  20   ? -17.026 29.706  112.879 1.00 71.18  ? 20   TYR B CE2   1 
ATOM   1937  C  CZ    . TYR B 1  20   ? -16.631 28.395  113.066 1.00 68.12  ? 20   TYR B CZ    1 
ATOM   1938  O  OH    . TYR B 1  20   ? -15.798 27.789  112.154 1.00 65.56  ? 20   TYR B OH    1 
ATOM   1939  N  N     . GLY B 1  21   ? -16.177 30.324  116.962 1.00 63.06  ? 21   GLY B N     1 
ATOM   1940  C  CA    . GLY B 1  21   ? -14.839 30.823  116.681 1.00 63.47  ? 21   GLY B CA    1 
ATOM   1941  C  C     . GLY B 1  21   ? -13.878 29.911  115.937 1.00 67.41  ? 21   GLY B C     1 
ATOM   1942  O  O     . GLY B 1  21   ? -13.866 28.692  116.141 1.00 66.44  ? 21   GLY B O     1 
ATOM   1943  N  N     . GLU B 1  22   ? -13.066 30.508  115.060 1.00 69.14  ? 22   GLU B N     1 
ATOM   1944  C  CA    . GLU B 1  22   ? -11.977 29.832  114.365 1.00 58.87  ? 22   GLU B CA    1 
ATOM   1945  C  C     . GLU B 1  22   ? -10.635 30.339  114.880 1.00 54.74  ? 22   GLU B C     1 
ATOM   1946  O  O     . GLU B 1  22   ? -10.442 31.545  115.075 1.00 60.07  ? 22   GLU B O     1 
ATOM   1947  C  CB    . GLU B 1  22   ? -12.052 30.062  112.853 1.00 68.49  ? 22   GLU B CB    1 
ATOM   1948  C  CG    . GLU B 1  22   ? -13.375 29.682  112.214 1.00 71.17  ? 22   GLU B CG    1 
ATOM   1949  C  CD    . GLU B 1  22   ? -13.291 29.627  110.696 1.00 79.15  ? 22   GLU B CD    1 
ATOM   1950  O  OE1   . GLU B 1  22   ? -12.160 29.621  110.158 1.00 81.91  ? 22   GLU B OE1   1 
ATOM   1951  O  OE2   . GLU B 1  22   ? -14.356 29.584  110.042 1.00 70.42  ? 22   GLU B OE2   1 
ATOM   1952  N  N     . PHE B 1  23   ? -9.700  29.411  115.063 1.00 50.52  ? 23   PHE B N     1 
ATOM   1953  C  CA    . PHE B 1  23   ? -8.411  29.684  115.682 1.00 58.87  ? 23   PHE B CA    1 
ATOM   1954  C  C     . PHE B 1  23   ? -7.318  29.025  114.853 1.00 58.78  ? 23   PHE B C     1 
ATOM   1955  O  O     . PHE B 1  23   ? -7.393  27.828  114.570 1.00 53.77  ? 23   PHE B O     1 
ATOM   1956  C  CB    . PHE B 1  23   ? -8.378  29.153  117.121 1.00 58.09  ? 23   PHE B CB    1 
ATOM   1957  C  CG    . PHE B 1  23   ? -9.463  29.707  118.001 1.00 59.88  ? 23   PHE B CG    1 
ATOM   1958  C  CD1   . PHE B 1  23   ? -10.742 29.176  117.969 1.00 58.75  ? 23   PHE B CD1   1 
ATOM   1959  C  CD2   . PHE B 1  23   ? -9.202  30.760  118.860 1.00 63.37  ? 23   PHE B CD2   1 
ATOM   1960  C  CE1   . PHE B 1  23   ? -11.741 29.687  118.776 1.00 60.32  ? 23   PHE B CE1   1 
ATOM   1961  C  CE2   . PHE B 1  23   ? -10.193 31.272  119.670 1.00 64.24  ? 23   PHE B CE2   1 
ATOM   1962  C  CZ    . PHE B 1  23   ? -11.465 30.735  119.629 1.00 65.02  ? 23   PHE B CZ    1 
ATOM   1963  N  N     . VAL B 1  24   ? -6.301  29.792  114.473 1.00 64.02  ? 24   VAL B N     1 
ATOM   1964  C  CA    . VAL B 1  24   ? -5.242  29.310  113.593 1.00 61.92  ? 24   VAL B CA    1 
ATOM   1965  C  C     . VAL B 1  24   ? -3.900  29.477  114.294 1.00 57.44  ? 24   VAL B C     1 
ATOM   1966  O  O     . VAL B 1  24   ? -3.597  30.553  114.822 1.00 66.87  ? 24   VAL B O     1 
ATOM   1967  C  CB    . VAL B 1  24   ? -5.253  30.044  112.238 1.00 63.53  ? 24   VAL B CB    1 
ATOM   1968  C  CG1   . VAL B 1  24   ? -4.121  29.549  111.352 1.00 60.01  ? 24   VAL B CG1   1 
ATOM   1969  C  CG2   . VAL B 1  24   ? -6.597  29.853  111.539 1.00 54.42  ? 24   VAL B CG2   1 
ATOM   1970  N  N     . LEU B 1  25   ? -3.102  28.411  114.296 1.00 47.21  ? 25   LEU B N     1 
ATOM   1971  C  CA    . LEU B 1  25   ? -1.758  28.412  114.869 1.00 52.34  ? 25   LEU B CA    1 
ATOM   1972  C  C     . LEU B 1  25   ? -0.809  27.843  113.824 1.00 58.51  ? 25   LEU B C     1 
ATOM   1973  O  O     . LEU B 1  25   ? -0.874  26.651  113.506 1.00 57.18  ? 25   LEU B O     1 
ATOM   1974  C  CB    . LEU B 1  25   ? -1.703  27.593  116.161 1.00 49.24  ? 25   LEU B CB    1 
ATOM   1975  C  CG    . LEU B 1  25   ? -0.475  27.768  117.059 1.00 51.50  ? 25   LEU B CG    1 
ATOM   1976  C  CD1   . LEU B 1  25   ? -0.459  29.159  117.669 1.00 62.09  ? 25   LEU B CD1   1 
ATOM   1977  C  CD2   . LEU B 1  25   ? -0.445  26.712  118.148 1.00 47.42  ? 25   LEU B CD2   1 
ATOM   1978  N  N     . GLU B 1  26   ? 0.058   28.693  113.278 1.00 69.30  ? 26   GLU B N     1 
ATOM   1979  C  CA    . GLU B 1  26   ? 1.036   28.274  112.285 1.00 66.53  ? 26   GLU B CA    1 
ATOM   1980  C  C     . GLU B 1  26   ? 2.209   29.236  112.331 1.00 67.40  ? 26   GLU B C     1 
ATOM   1981  O  O     . GLU B 1  26   ? 2.031   30.409  112.682 1.00 79.97  ? 26   GLU B O     1 
ATOM   1982  C  CB    . GLU B 1  26   ? 0.440   28.244  110.870 1.00 58.11  ? 26   GLU B CB    1 
ATOM   1983  C  CG    . GLU B 1  26   ? 0.037   29.609  110.339 1.00 58.16  ? 26   GLU B CG    1 
ATOM   1984  C  CD    . GLU B 1  26   ? -0.620  29.536  108.976 1.00 64.46  ? 26   GLU B CD    1 
ATOM   1985  O  OE1   . GLU B 1  26   ? -0.142  28.759  108.123 1.00 62.85  ? 26   GLU B OE1   1 
ATOM   1986  O  OE2   . GLU B 1  26   ? -1.622  30.250  108.759 1.00 71.00  ? 26   GLU B OE2   1 
ATOM   1987  N  N     . PRO B 1  27   ? 3.421   28.775  111.997 1.00 60.62  ? 27   PRO B N     1 
ATOM   1988  C  CA    . PRO B 1  27   ? 3.781   27.382  111.718 1.00 61.95  ? 27   PRO B CA    1 
ATOM   1989  C  C     . PRO B 1  27   ? 4.150   26.588  112.964 1.00 61.27  ? 27   PRO B C     1 
ATOM   1990  O  O     . PRO B 1  27   ? 4.610   27.155  113.954 1.00 64.81  ? 27   PRO B O     1 
ATOM   1991  C  CB    . PRO B 1  27   ? 4.995   27.520  110.802 1.00 70.29  ? 27   PRO B CB    1 
ATOM   1992  C  CG    . PRO B 1  27   ? 5.630   28.771  111.251 1.00 76.35  ? 27   PRO B CG    1 
ATOM   1993  C  CD    . PRO B 1  27   ? 4.491   29.697  111.587 1.00 73.73  ? 27   PRO B CD    1 
ATOM   1994  N  N     . LEU B 1  28   ? 3.953   25.275  112.895 1.00 56.90  ? 28   LEU B N     1 
ATOM   1995  C  CA    . LEU B 1  28   ? 4.313   24.358  113.963 1.00 57.80  ? 28   LEU B CA    1 
ATOM   1996  C  C     . LEU B 1  28   ? 5.235   23.281  113.414 1.00 56.30  ? 28   LEU B C     1 
ATOM   1997  O  O     . LEU B 1  28   ? 5.172   22.933  112.231 1.00 51.33  ? 28   LEU B O     1 
ATOM   1998  C  CB    . LEU B 1  28   ? 3.073   23.705  114.590 1.00 58.78  ? 28   LEU B CB    1 
ATOM   1999  C  CG    . LEU B 1  28   ? 2.130   24.599  115.396 1.00 52.51  ? 28   LEU B CG    1 
ATOM   2000  C  CD1   . LEU B 1  28   ? 0.879   23.833  115.809 1.00 48.19  ? 28   LEU B CD1   1 
ATOM   2001  C  CD2   . LEU B 1  28   ? 2.845   25.159  116.613 1.00 59.85  ? 28   LEU B CD2   1 
ATOM   2002  N  N     . GLU B 1  29   ? 6.092   22.757  114.287 1.00 62.80  ? 29   GLU B N     1 
ATOM   2003  C  CA    . GLU B 1  29   ? 6.974   21.663  113.912 1.00 62.35  ? 29   GLU B CA    1 
ATOM   2004  C  C     . GLU B 1  29   ? 6.148   20.452  113.477 1.00 61.98  ? 29   GLU B C     1 
ATOM   2005  O  O     . GLU B 1  29   ? 4.971   20.313  113.822 1.00 63.00  ? 29   GLU B O     1 
ATOM   2006  C  CB    . GLU B 1  29   ? 7.896   21.301  115.078 1.00 61.58  ? 29   GLU B CB    1 
ATOM   2007  C  CG    . GLU B 1  29   ? 9.144   20.519  114.694 1.00 69.02  ? 29   GLU B CG    1 
ATOM   2008  C  CD    . GLU B 1  29   ? 10.006  21.241  113.673 1.00 81.12  ? 29   GLU B CD    1 
ATOM   2009  O  OE1   . GLU B 1  29   ? 9.974   20.854  112.484 1.00 78.84  ? 29   GLU B OE1   1 
ATOM   2010  O  OE2   . GLU B 1  29   ? 10.712  22.197  114.059 1.00 83.06  ? 29   GLU B OE2   1 
ATOM   2011  N  N     . ARG B 1  30   ? 6.781   19.574  112.701 1.00 61.36  ? 30   ARG B N     1 
ATOM   2012  C  CA    . ARG B 1  30   ? 6.075   18.452  112.091 1.00 60.72  ? 30   ARG B CA    1 
ATOM   2013  C  C     . ARG B 1  30   ? 5.443   17.551  113.150 1.00 56.70  ? 30   ARG B C     1 
ATOM   2014  O  O     . ARG B 1  30   ? 6.132   17.025  114.031 1.00 55.83  ? 30   ARG B O     1 
ATOM   2015  C  CB    . ARG B 1  30   ? 7.036   17.649  111.216 1.00 62.33  ? 30   ARG B CB    1 
ATOM   2016  C  CG    . ARG B 1  30   ? 6.381   16.476  110.509 1.00 58.97  ? 30   ARG B CG    1 
ATOM   2017  C  CD    . ARG B 1  30   ? 7.416   15.581  109.847 1.00 60.14  ? 30   ARG B CD    1 
ATOM   2018  N  NE    . ARG B 1  30   ? 8.216   14.839  110.820 1.00 54.83  ? 30   ARG B NE    1 
ATOM   2019  C  CZ    . ARG B 1  30   ? 9.209   14.014  110.499 1.00 59.89  ? 30   ARG B CZ    1 
ATOM   2020  N  NH1   . ARG B 1  30   ? 9.536   13.821  109.228 1.00 58.59  ? 30   ARG B NH1   1 
ATOM   2021  N  NH2   . ARG B 1  30   ? 9.881   13.381  111.450 1.00 63.76  ? 30   ARG B NH2   1 
ATOM   2022  N  N     . GLY B 1  31   ? 4.124   17.368  113.048 1.00 53.08  ? 31   GLY B N     1 
ATOM   2023  C  CA    . GLY B 1  31   ? 3.361   16.510  113.921 1.00 58.02  ? 31   GLY B CA    1 
ATOM   2024  C  C     . GLY B 1  31   ? 2.639   17.237  115.036 1.00 51.36  ? 31   GLY B C     1 
ATOM   2025  O  O     . GLY B 1  31   ? 1.604   16.753  115.514 1.00 43.51  ? 31   GLY B O     1 
ATOM   2026  N  N     . PHE B 1  32   ? 3.160   18.391  115.458 1.00 56.83  ? 32   PHE B N     1 
ATOM   2027  C  CA    . PHE B 1  32   ? 2.609   19.090  116.612 1.00 51.95  ? 32   PHE B CA    1 
ATOM   2028  C  C     . PHE B 1  32   ? 1.210   19.628  116.365 1.00 49.73  ? 32   PHE B C     1 
ATOM   2029  O  O     . PHE B 1  32   ? 0.531   19.996  117.334 1.00 56.73  ? 32   PHE B O     1 
ATOM   2030  C  CB    . PHE B 1  32   ? 3.542   20.222  117.034 1.00 50.41  ? 32   PHE B CB    1 
ATOM   2031  C  CG    . PHE B 1  32   ? 4.689   19.767  117.882 1.00 53.09  ? 32   PHE B CG    1 
ATOM   2032  C  CD1   . PHE B 1  32   ? 5.821   19.214  117.305 1.00 49.18  ? 32   PHE B CD1   1 
ATOM   2033  C  CD2   . PHE B 1  32   ? 4.630   19.879  119.259 1.00 54.84  ? 32   PHE B CD2   1 
ATOM   2034  C  CE1   . PHE B 1  32   ? 6.874   18.790  118.087 1.00 46.45  ? 32   PHE B CE1   1 
ATOM   2035  C  CE2   . PHE B 1  32   ? 5.682   19.459  120.047 1.00 53.33  ? 32   PHE B CE2   1 
ATOM   2036  C  CZ    . PHE B 1  32   ? 6.806   18.912  119.460 1.00 49.39  ? 32   PHE B CZ    1 
ATOM   2037  N  N     . GLY B 1  33   ? 0.761   19.658  115.112 1.00 42.60  ? 33   GLY B N     1 
ATOM   2038  C  CA    . GLY B 1  33   ? -0.612  20.004  114.823 1.00 39.88  ? 33   GLY B CA    1 
ATOM   2039  C  C     . GLY B 1  33   ? -1.572  19.152  115.618 1.00 41.14  ? 33   GLY B C     1 
ATOM   2040  O  O     . GLY B 1  33   ? -2.356  19.673  116.415 1.00 39.22  ? 33   GLY B O     1 
ATOM   2041  N  N     . VAL B 1  34   ? -1.490  17.832  115.447 1.00 40.17  ? 34   VAL B N     1 
ATOM   2042  C  CA    . VAL B 1  34   ? -2.383  16.965  116.201 1.00 39.42  ? 34   VAL B CA    1 
ATOM   2043  C  C     . VAL B 1  34   ? -1.952  16.884  117.664 1.00 42.29  ? 34   VAL B C     1 
ATOM   2044  O  O     . VAL B 1  34   ? -2.808  16.767  118.552 1.00 48.15  ? 34   VAL B O     1 
ATOM   2045  C  CB    . VAL B 1  34   ? -2.474  15.571  115.546 1.00 35.15  ? 34   VAL B CB    1 
ATOM   2046  C  CG1   . VAL B 1  34   ? -2.732  15.712  114.068 1.00 47.00  ? 34   VAL B CG1   1 
ATOM   2047  C  CG2   . VAL B 1  34   ? -1.230  14.757  115.810 1.00 36.03  ? 34   VAL B CG2   1 
ATOM   2048  N  N     . THR B 1  35   ? -0.644  16.995  117.942 1.00 38.45  ? 35   THR B N     1 
ATOM   2049  C  CA    . THR B 1  35   ? -0.151  16.956  119.319 1.00 46.15  ? 35   THR B CA    1 
ATOM   2050  C  C     . THR B 1  35   ? -0.822  18.020  120.187 1.00 44.81  ? 35   THR B C     1 
ATOM   2051  O  O     . THR B 1  35   ? -1.102  17.785  121.371 1.00 36.99  ? 35   THR B O     1 
ATOM   2052  C  CB    . THR B 1  35   ? 1.370   17.133  119.333 1.00 47.62  ? 35   THR B CB    1 
ATOM   2053  O  OG1   . THR B 1  35   ? 1.995   16.020  118.683 1.00 39.74  ? 35   THR B OG1   1 
ATOM   2054  C  CG2   . THR B 1  35   ? 1.890   17.236  120.755 1.00 43.81  ? 35   THR B CG2   1 
ATOM   2055  N  N     . LEU B 1  36   ? -1.098  19.193  119.616 1.00 46.67  ? 36   LEU B N     1 
ATOM   2056  C  CA    . LEU B 1  36   ? -1.873  20.199  120.333 1.00 40.77  ? 36   LEU B CA    1 
ATOM   2057  C  C     . LEU B 1  36   ? -3.376  20.035  120.130 1.00 38.00  ? 36   LEU B C     1 
ATOM   2058  O  O     . LEU B 1  36   ? -4.149  20.253  121.067 1.00 42.04  ? 36   LEU B O     1 
ATOM   2059  C  CB    . LEU B 1  36   ? -1.446  21.601  119.904 1.00 41.45  ? 36   LEU B CB    1 
ATOM   2060  C  CG    . LEU B 1  36   ? 0.029   21.957  120.061 1.00 40.49  ? 36   LEU B CG    1 
ATOM   2061  C  CD1   . LEU B 1  36   ? 0.269   23.392  119.630 1.00 48.50  ? 36   LEU B CD1   1 
ATOM   2062  C  CD2   . LEU B 1  36   ? 0.477   21.749  121.493 1.00 47.89  ? 36   LEU B CD2   1 
ATOM   2063  N  N     . GLY B 1  37   ? -3.814  19.632  118.935 1.00 40.41  ? 37   GLY B N     1 
ATOM   2064  C  CA    . GLY B 1  37   ? -5.232  19.700  118.622 1.00 46.22  ? 37   GLY B CA    1 
ATOM   2065  C  C     . GLY B 1  37   ? -6.067  18.628  119.296 1.00 39.80  ? 37   GLY B C     1 
ATOM   2066  O  O     . GLY B 1  37   ? -7.191  18.894  119.729 1.00 38.78  ? 37   GLY B O     1 
ATOM   2067  N  N     . ASN B 1  38   ? -5.557  17.397  119.358 1.00 38.98  ? 38   ASN B N     1 
ATOM   2068  C  CA    . ASN B 1  38   ? -6.334  16.316  119.963 1.00 43.93  ? 38   ASN B CA    1 
ATOM   2069  C  C     . ASN B 1  38   ? -6.582  16.525  121.449 1.00 44.33  ? 38   ASN B C     1 
ATOM   2070  O  O     . ASN B 1  38   ? -7.747  16.420  121.881 1.00 46.69  ? 38   ASN B O     1 
ATOM   2071  C  CB    . ASN B 1  38   ? -5.645  14.975  119.699 1.00 46.61  ? 38   ASN B CB    1 
ATOM   2072  C  CG    . ASN B 1  38   ? -6.236  14.248  118.519 1.00 55.99  ? 38   ASN B CG    1 
ATOM   2073  O  OD1   . ASN B 1  38   ? -7.442  14.315  118.277 1.00 56.51  ? 38   ASN B OD1   1 
ATOM   2074  N  ND2   . ASN B 1  38   ? -5.390  13.555  117.767 1.00 60.04  ? 38   ASN B ND2   1 
ATOM   2075  N  N     . PRO B 1  39   ? -5.573  16.814  122.278 1.00 42.02  ? 39   PRO B N     1 
ATOM   2076  C  CA    . PRO B 1  39   ? -5.859  17.019  123.705 1.00 42.34  ? 39   PRO B CA    1 
ATOM   2077  C  C     . PRO B 1  39   ? -6.816  18.164  123.958 1.00 43.28  ? 39   PRO B C     1 
ATOM   2078  O  O     . PRO B 1  39   ? -7.718  18.034  124.792 1.00 47.37  ? 39   PRO B O     1 
ATOM   2079  C  CB    . PRO B 1  39   ? -4.479  17.308  124.307 1.00 42.34  ? 39   PRO B CB    1 
ATOM   2080  C  CG    . PRO B 1  39   ? -3.510  16.914  123.286 1.00 40.26  ? 39   PRO B CG    1 
ATOM   2081  C  CD    . PRO B 1  39   ? -4.155  17.059  121.973 1.00 42.25  ? 39   PRO B CD    1 
ATOM   2082  N  N     . LEU B 1  40   ? -6.627  19.294  123.276 1.00 35.31  ? 40   LEU B N     1 
ATOM   2083  C  CA    . LEU B 1  40   ? -7.529  20.419  123.476 1.00 37.77  ? 40   LEU B CA    1 
ATOM   2084  C  C     . LEU B 1  40   ? -8.950  20.053  123.075 1.00 39.28  ? 40   LEU B C     1 
ATOM   2085  O  O     . LEU B 1  40   ? -9.912  20.499  123.707 1.00 42.89  ? 40   LEU B O     1 
ATOM   2086  C  CB    . LEU B 1  40   ? -7.038  21.633  122.695 1.00 36.25  ? 40   LEU B CB    1 
ATOM   2087  C  CG    . LEU B 1  40   ? -5.647  22.131  123.090 1.00 39.35  ? 40   LEU B CG    1 
ATOM   2088  C  CD1   . LEU B 1  40   ? -5.292  23.406  122.340 1.00 47.85  ? 40   LEU B CD1   1 
ATOM   2089  C  CD2   . LEU B 1  40   ? -5.553  22.340  124.592 1.00 46.28  ? 40   LEU B CD2   1 
ATOM   2090  N  N     . ARG B 1  41   ? -9.105  19.230  122.037 1.00 40.76  ? 41   ARG B N     1 
ATOM   2091  C  CA    . ARG B 1  41   ? -10.441 18.774  121.674 1.00 43.47  ? 41   ARG B CA    1 
ATOM   2092  C  C     . ARG B 1  41   ? -11.045 17.926  122.786 1.00 45.06  ? 41   ARG B C     1 
ATOM   2093  O  O     . ARG B 1  41   ? -12.223 18.087  123.127 1.00 47.19  ? 41   ARG B O     1 
ATOM   2094  C  CB    . ARG B 1  41   ? -10.406 17.990  120.363 1.00 41.04  ? 41   ARG B CB    1 
ATOM   2095  C  CG    . ARG B 1  41   ? -11.768 17.461  119.962 1.00 42.93  ? 41   ARG B CG    1 
ATOM   2096  C  CD    . ARG B 1  41   ? -11.702 16.496  118.802 1.00 44.94  ? 41   ARG B CD    1 
ATOM   2097  N  NE    . ARG B 1  41   ? -13.026 15.962  118.496 1.00 51.96  ? 41   ARG B NE    1 
ATOM   2098  C  CZ    . ARG B 1  41   ? -13.520 14.847  119.024 1.00 57.69  ? 41   ARG B CZ    1 
ATOM   2099  N  NH1   . ARG B 1  41   ? -12.795 14.138  119.881 1.00 53.29  ? 41   ARG B NH1   1 
ATOM   2100  N  NH2   . ARG B 1  41   ? -14.738 14.437  118.693 1.00 51.52  ? 41   ARG B NH2   1 
ATOM   2101  N  N     . ARG B 1  42   ? -10.253 17.022  123.370 1.00 41.20  ? 42   ARG B N     1 
ATOM   2102  C  CA    . ARG B 1  42   ? -10.774 16.202  124.461 1.00 37.23  ? 42   ARG B CA    1 
ATOM   2103  C  C     . ARG B 1  42   ? -11.159 17.061  125.658 1.00 41.02  ? 42   ARG B C     1 
ATOM   2104  O  O     . ARG B 1  42   ? -12.201 16.838  126.286 1.00 43.14  ? 42   ARG B O     1 
ATOM   2105  C  CB    . ARG B 1  42   ? -9.746  15.152  124.872 1.00 35.99  ? 42   ARG B CB    1 
ATOM   2106  C  CG    . ARG B 1  42   ? -9.422  14.156  123.787 1.00 35.01  ? 42   ARG B CG    1 
ATOM   2107  C  CD    . ARG B 1  42   ? -8.184  13.354  124.137 1.00 41.73  ? 42   ARG B CD    1 
ATOM   2108  N  NE    . ARG B 1  42   ? -8.433  12.366  125.180 1.00 35.88  ? 42   ARG B NE    1 
ATOM   2109  C  CZ    . ARG B 1  42   ? -8.953  11.165  124.954 1.00 39.73  ? 42   ARG B CZ    1 
ATOM   2110  N  NH1   . ARG B 1  42   ? -9.287  10.808  123.722 1.00 41.90  ? 42   ARG B NH1   1 
ATOM   2111  N  NH2   . ARG B 1  42   ? -9.144  10.323  125.958 1.00 49.48  ? 42   ARG B NH2   1 
ATOM   2112  N  N     . ILE B 1  43   ? -10.334 18.057  125.978 1.00 43.82  ? 43   ILE B N     1 
ATOM   2113  C  CA    . ILE B 1  43   ? -10.586 18.902  127.141 1.00 44.16  ? 43   ILE B CA    1 
ATOM   2114  C  C     . ILE B 1  43   ? -11.821 19.765  126.921 1.00 39.99  ? 43   ILE B C     1 
ATOM   2115  O  O     . ILE B 1  43   ? -12.673 19.894  127.810 1.00 46.57  ? 43   ILE B O     1 
ATOM   2116  C  CB    . ILE B 1  43   ? -9.339  19.750  127.455 1.00 40.37  ? 43   ILE B CB    1 
ATOM   2117  C  CG1   . ILE B 1  43   ? -8.150  18.849  127.799 1.00 41.38  ? 43   ILE B CG1   1 
ATOM   2118  C  CG2   . ILE B 1  43   ? -9.608  20.704  128.601 1.00 42.04  ? 43   ILE B CG2   1 
ATOM   2119  C  CD1   . ILE B 1  43   ? -6.861  19.605  128.002 1.00 39.57  ? 43   ILE B CD1   1 
ATOM   2120  N  N     . LEU B 1  44   ? -11.951 20.349  125.727 1.00 34.05  ? 44   LEU B N     1 
ATOM   2121  C  CA    . LEU B 1  44   ? -13.063 21.240  125.424 1.00 39.84  ? 44   LEU B CA    1 
ATOM   2122  C  C     . LEU B 1  44   ? -14.409 20.532  125.443 1.00 44.73  ? 44   LEU B C     1 
ATOM   2123  O  O     . LEU B 1  44   ? -15.440 21.187  125.638 1.00 49.60  ? 44   LEU B O     1 
ATOM   2124  C  CB    . LEU B 1  44   ? -12.840 21.890  124.063 1.00 41.36  ? 44   LEU B CB    1 
ATOM   2125  C  CG    . LEU B 1  44   ? -11.797 22.996  124.000 1.00 39.83  ? 44   LEU B CG    1 
ATOM   2126  C  CD1   . LEU B 1  44   ? -11.338 23.210  122.566 1.00 38.97  ? 44   LEU B CD1   1 
ATOM   2127  C  CD2   . LEU B 1  44   ? -12.374 24.275  124.581 1.00 47.09  ? 44   LEU B CD2   1 
ATOM   2128  N  N     . LEU B 1  45   ? -14.428 19.217  125.261 1.00 36.01  ? 45   LEU B N     1 
ATOM   2129  C  CA    . LEU B 1  45   ? -15.676 18.476  125.268 1.00 36.91  ? 45   LEU B CA    1 
ATOM   2130  C  C     . LEU B 1  45   ? -15.984 17.841  126.613 1.00 38.06  ? 45   LEU B C     1 
ATOM   2131  O  O     . LEU B 1  45   ? -17.087 17.315  126.782 1.00 36.47  ? 45   LEU B O     1 
ATOM   2132  C  CB    . LEU B 1  45   ? -15.655 17.397  124.178 1.00 39.28  ? 45   LEU B CB    1 
ATOM   2133  C  CG    . LEU B 1  45   ? -15.583 17.925  122.743 1.00 39.54  ? 45   LEU B CG    1 
ATOM   2134  C  CD1   . LEU B 1  45   ? -15.542 16.795  121.726 1.00 43.17  ? 45   LEU B CD1   1 
ATOM   2135  C  CD2   . LEU B 1  45   ? -16.746 18.863  122.454 1.00 37.62  ? 45   LEU B CD2   1 
ATOM   2136  N  N     . SER B 1  46   ? -15.048 17.860  127.562 1.00 40.39  ? 46   SER B N     1 
ATOM   2137  C  CA    . SER B 1  46   ? -15.286 17.239  128.860 1.00 42.86  ? 46   SER B CA    1 
ATOM   2138  C  C     . SER B 1  46   ? -15.198 18.212  130.024 1.00 46.75  ? 46   SER B C     1 
ATOM   2139  O  O     . SER B 1  46   ? -16.115 18.267  130.849 1.00 47.75  ? 46   SER B O     1 
ATOM   2140  C  CB    . SER B 1  46   ? -14.295 16.088  129.079 1.00 39.22  ? 46   SER B CB    1 
ATOM   2141  O  OG    . SER B 1  46   ? -12.969 16.582  129.128 1.00 42.55  ? 46   SER B OG    1 
ATOM   2142  N  N     . SER B 1  47   ? -14.116 18.979  130.120 1.00 47.36  ? 47   SER B N     1 
ATOM   2143  C  CA    . SER B 1  47   ? -13.753 19.633  131.367 1.00 51.33  ? 47   SER B CA    1 
ATOM   2144  C  C     . SER B 1  47   ? -14.056 21.125  131.396 1.00 54.00  ? 47   SER B C     1 
ATOM   2145  O  O     . SER B 1  47   ? -13.568 21.818  132.296 1.00 59.21  ? 47   SER B O     1 
ATOM   2146  C  CB    . SER B 1  47   ? -12.270 19.403  131.661 1.00 52.78  ? 47   SER B CB    1 
ATOM   2147  O  OG    . SER B 1  47   ? -11.997 18.021  131.823 1.00 59.07  ? 47   SER B OG    1 
ATOM   2148  N  N     . ILE B 1  48   ? -14.837 21.643  130.454 1.00 51.26  ? 48   ILE B N     1 
ATOM   2149  C  CA    . ILE B 1  48   ? -15.191 23.059  130.429 1.00 48.77  ? 48   ILE B CA    1 
ATOM   2150  C  C     . ILE B 1  48   ? -16.452 23.259  131.265 1.00 55.62  ? 48   ILE B C     1 
ATOM   2151  O  O     . ILE B 1  48   ? -17.484 22.635  130.965 1.00 54.08  ? 48   ILE B O     1 
ATOM   2152  C  CB    . ILE B 1  48   ? -15.391 23.577  129.004 1.00 50.71  ? 48   ILE B CB    1 
ATOM   2153  C  CG1   . ILE B 1  48   ? -14.117 23.379  128.175 1.00 50.59  ? 48   ILE B CG1   1 
ATOM   2154  C  CG2   . ILE B 1  48   ? -15.788 25.048  129.042 1.00 42.32  ? 48   ILE B CG2   1 
ATOM   2155  C  CD1   . ILE B 1  48   ? -12.874 23.998  128.788 1.00 44.54  ? 48   ILE B CD1   1 
ATOM   2156  N  N     . PRO B 1  49   ? -16.422 24.117  132.285 1.00 59.89  ? 49   PRO B N     1 
ATOM   2157  C  CA    . PRO B 1  49   ? -17.560 24.236  133.205 1.00 52.43  ? 49   PRO B CA    1 
ATOM   2158  C  C     . PRO B 1  49   ? -18.802 24.806  132.537 1.00 53.43  ? 49   PRO B C     1 
ATOM   2159  O  O     . PRO B 1  49   ? -18.728 25.688  131.678 1.00 51.78  ? 49   PRO B O     1 
ATOM   2160  C  CB    . PRO B 1  49   ? -17.039 25.190  134.288 1.00 52.88  ? 49   PRO B CB    1 
ATOM   2161  C  CG    . PRO B 1  49   ? -15.558 25.152  134.168 1.00 49.32  ? 49   PRO B CG    1 
ATOM   2162  C  CD    . PRO B 1  49   ? -15.275 24.930  132.718 1.00 52.25  ? 49   PRO B CD    1 
ATOM   2163  N  N     . GLY B 1  50   ? -19.956 24.302  132.965 1.00 53.16  ? 50   GLY B N     1 
ATOM   2164  C  CA    . GLY B 1  50   ? -21.222 24.747  132.430 1.00 50.60  ? 50   GLY B CA    1 
ATOM   2165  C  C     . GLY B 1  50   ? -22.362 24.421  133.370 1.00 55.07  ? 50   GLY B C     1 
ATOM   2166  O  O     . GLY B 1  50   ? -22.154 24.069  134.533 1.00 57.21  ? 50   GLY B O     1 
ATOM   2167  N  N     . THR B 1  51   ? -23.582 24.557  132.849 1.00 56.05  ? 51   THR B N     1 
ATOM   2168  C  CA    . THR B 1  51   ? -24.804 24.310  133.606 1.00 48.34  ? 51   THR B CA    1 
ATOM   2169  C  C     . THR B 1  51   ? -25.789 23.538  132.739 1.00 49.32  ? 51   THR B C     1 
ATOM   2170  O  O     . THR B 1  51   ? -25.764 23.638  131.508 1.00 62.18  ? 51   THR B O     1 
ATOM   2171  C  CB    . THR B 1  51   ? -25.466 25.614  134.074 1.00 49.78  ? 51   THR B CB    1 
ATOM   2172  O  OG1   . THR B 1  51   ? -25.942 26.338  132.935 1.00 50.78  ? 51   THR B OG1   1 
ATOM   2173  C  CG2   . THR B 1  51   ? -24.474 26.480  134.837 1.00 59.27  ? 51   THR B CG2   1 
ATOM   2174  N  N     . ALA B 1  52   ? -26.674 22.784  133.393 1.00 43.95  ? 52   ALA B N     1 
ATOM   2175  C  CA    . ALA B 1  52   ? -27.639 21.961  132.674 1.00 49.83  ? 52   ALA B CA    1 
ATOM   2176  C  C     . ALA B 1  52   ? -28.851 21.682  133.551 1.00 52.63  ? 52   ALA B C     1 
ATOM   2177  O  O     . ALA B 1  52   ? -28.788 21.765  134.780 1.00 57.49  ? 52   ALA B O     1 
ATOM   2178  C  CB    . ALA B 1  52   ? -27.019 20.638  132.222 1.00 51.63  ? 52   ALA B CB    1 
ATOM   2179  N  N     . VAL B 1  53   ? -29.953 21.333  132.895 1.00 49.79  ? 53   VAL B N     1 
ATOM   2180  C  CA    . VAL B 1  53   ? -31.149 20.859  133.584 1.00 49.64  ? 53   VAL B CA    1 
ATOM   2181  C  C     . VAL B 1  53   ? -30.936 19.396  133.945 1.00 55.35  ? 53   VAL B C     1 
ATOM   2182  O  O     . VAL B 1  53   ? -30.725 18.556  133.064 1.00 60.06  ? 53   VAL B O     1 
ATOM   2183  C  CB    . VAL B 1  53   ? -32.401 21.034  132.711 1.00 47.91  ? 53   VAL B CB    1 
ATOM   2184  C  CG1   . VAL B 1  53   ? -33.540 20.169  133.232 1.00 46.69  ? 53   VAL B CG1   1 
ATOM   2185  C  CG2   . VAL B 1  53   ? -32.818 22.494  132.659 1.00 43.67  ? 53   VAL B CG2   1 
ATOM   2186  N  N     . THR B 1  54   ? -30.981 19.088  135.241 1.00 54.03  ? 54   THR B N     1 
ATOM   2187  C  CA    . THR B 1  54   ? -30.735 17.725  135.691 1.00 53.56  ? 54   THR B CA    1 
ATOM   2188  C  C     . THR B 1  54   ? -31.989 16.991  136.151 1.00 57.24  ? 54   THR B C     1 
ATOM   2189  O  O     . THR B 1  54   ? -31.953 15.760  136.261 1.00 56.78  ? 54   THR B O     1 
ATOM   2190  C  CB    . THR B 1  54   ? -29.705 17.713  136.824 1.00 49.44  ? 54   THR B CB    1 
ATOM   2191  O  OG1   . THR B 1  54   ? -30.062 18.690  137.805 1.00 53.20  ? 54   THR B OG1   1 
ATOM   2192  C  CG2   . THR B 1  54   ? -28.323 18.037  136.284 1.00 60.57  ? 54   THR B CG2   1 
ATOM   2193  N  N     . SER B 1  55   ? -33.091 17.697  136.409 1.00 61.36  ? 55   SER B N     1 
ATOM   2194  C  CA    . SER B 1  55   ? -34.308 17.040  136.869 1.00 56.08  ? 55   SER B CA    1 
ATOM   2195  C  C     . SER B 1  55   ? -35.501 17.952  136.613 1.00 49.27  ? 55   SER B C     1 
ATOM   2196  O  O     . SER B 1  55   ? -35.370 19.178  136.603 1.00 46.52  ? 55   SER B O     1 
ATOM   2197  C  CB    . SER B 1  55   ? -34.219 16.678  138.357 1.00 61.65  ? 55   SER B CB    1 
ATOM   2198  O  OG    . SER B 1  55   ? -34.860 15.439  138.622 1.00 63.41  ? 55   SER B OG    1 
ATOM   2199  N  N     . VAL B 1  56   ? -36.668 17.335  136.424 1.00 51.35  ? 56   VAL B N     1 
ATOM   2200  C  CA    . VAL B 1  56   ? -37.901 18.036  136.073 1.00 59.37  ? 56   VAL B CA    1 
ATOM   2201  C  C     . VAL B 1  56   ? -39.063 17.404  136.829 1.00 63.71  ? 56   VAL B C     1 
ATOM   2202  O  O     . VAL B 1  56   ? -39.211 16.177  136.827 1.00 64.69  ? 56   VAL B O     1 
ATOM   2203  C  CB    . VAL B 1  56   ? -38.172 17.982  134.556 1.00 62.33  ? 56   VAL B CB    1 
ATOM   2204  C  CG1   . VAL B 1  56   ? -39.609 18.362  134.247 1.00 54.40  ? 56   VAL B CG1   1 
ATOM   2205  C  CG2   . VAL B 1  56   ? -37.214 18.895  133.816 1.00 71.14  ? 56   VAL B CG2   1 
ATOM   2206  N  N     . TYR B 1  57   ? -39.894 18.236  137.464 1.00 63.29  ? 57   TYR B N     1 
ATOM   2207  C  CA    . TYR B 1  57   ? -41.153 17.793  138.061 1.00 65.53  ? 57   TYR B CA    1 
ATOM   2208  C  C     . TYR B 1  57   ? -42.301 18.616  137.490 1.00 56.17  ? 57   TYR B C     1 
ATOM   2209  O  O     . TYR B 1  57   ? -42.286 19.848  137.581 1.00 48.37  ? 57   TYR B O     1 
ATOM   2210  C  CB    . TYR B 1  57   ? -41.136 17.911  139.588 1.00 74.80  ? 57   TYR B CB    1 
ATOM   2211  C  CG    . TYR B 1  57   ? -42.515 17.739  140.202 1.00 77.18  ? 57   TYR B CG    1 
ATOM   2212  C  CD1   . TYR B 1  57   ? -43.115 16.485  140.276 1.00 78.32  ? 57   TYR B CD1   1 
ATOM   2213  C  CD2   . TYR B 1  57   ? -43.224 18.832  140.691 1.00 72.41  ? 57   TYR B CD2   1 
ATOM   2214  C  CE1   . TYR B 1  57   ? -44.380 16.324  140.826 1.00 76.94  ? 57   TYR B CE1   1 
ATOM   2215  C  CE2   . TYR B 1  57   ? -44.489 18.681  141.240 1.00 73.99  ? 57   TYR B CE2   1 
ATOM   2216  C  CZ    . TYR B 1  57   ? -45.062 17.426  141.307 1.00 75.43  ? 57   TYR B CZ    1 
ATOM   2217  O  OH    . TYR B 1  57   ? -46.321 17.278  141.852 1.00 68.86  ? 57   TYR B OH    1 
ATOM   2218  N  N     . ILE B 1  58   ? -43.297 17.936  136.919 1.00 57.27  ? 58   ILE B N     1 
ATOM   2219  C  CA    . ILE B 1  58   ? -44.490 18.568  136.364 1.00 65.33  ? 58   ILE B CA    1 
ATOM   2220  C  C     . ILE B 1  58   ? -45.708 18.010  137.087 1.00 75.55  ? 58   ILE B C     1 
ATOM   2221  O  O     . ILE B 1  58   ? -45.834 16.789  137.246 1.00 69.24  ? 58   ILE B O     1 
ATOM   2222  C  CB    . ILE B 1  58   ? -44.615 18.333  134.847 1.00 63.26  ? 58   ILE B CB    1 
ATOM   2223  C  CG1   . ILE B 1  58   ? -43.308 18.664  134.134 1.00 66.30  ? 58   ILE B CG1   1 
ATOM   2224  C  CG2   . ILE B 1  58   ? -45.730 19.187  134.266 1.00 66.84  ? 58   ILE B CG2   1 
ATOM   2225  C  CD1   . ILE B 1  58   ? -43.316 18.273  132.677 1.00 65.60  ? 58   ILE B CD1   1 
ATOM   2226  N  N     . GLU B 1  59   ? -46.608 18.903  137.503 1.00 72.26  ? 59   GLU B N     1 
ATOM   2227  C  CA    . GLU B 1  59   ? -47.770 18.501  138.286 1.00 73.33  ? 59   GLU B CA    1 
ATOM   2228  C  C     . GLU B 1  59   ? -48.648 17.526  137.512 1.00 74.96  ? 59   GLU B C     1 
ATOM   2229  O  O     . GLU B 1  59   ? -48.873 17.685  136.310 1.00 73.79  ? 59   GLU B O     1 
ATOM   2230  C  CB    . GLU B 1  59   ? -48.587 19.729  138.692 1.00 83.00  ? 59   GLU B CB    1 
ATOM   2231  C  CG    . GLU B 1  59   ? -48.315 20.214  140.111 1.00 97.84  ? 59   GLU B CG    1 
ATOM   2232  C  CD    . GLU B 1  59   ? -49.341 21.227  140.598 1.00 94.06  ? 59   GLU B CD    1 
ATOM   2233  O  OE1   . GLU B 1  59   ? -48.983 22.082  141.435 1.00 91.86  ? 59   GLU B OE1   1 
ATOM   2234  O  OE2   . GLU B 1  59   ? -50.505 21.167  140.146 1.00 79.56  ? 59   GLU B OE2   1 
ATOM   2235  N  N     . ASP B 1  60   ? -49.139 16.505  138.219 1.00 88.11  ? 60   ASP B N     1 
ATOM   2236  C  CA    . ASP B 1  60   ? -50.042 15.499  137.655 1.00 90.44  ? 60   ASP B CA    1 
ATOM   2237  C  C     . ASP B 1  60   ? -49.410 14.771  136.466 1.00 87.49  ? 60   ASP B C     1 
ATOM   2238  O  O     . ASP B 1  60   ? -50.089 14.422  135.499 1.00 93.06  ? 60   ASP B O     1 
ATOM   2239  C  CB    . ASP B 1  60   ? -51.387 16.118  137.261 1.00 93.40  ? 60   ASP B CB    1 
ATOM   2240  C  CG    . ASP B 1  60   ? -52.133 16.708  138.449 1.00 93.95  ? 60   ASP B CG    1 
ATOM   2241  O  OD1   . ASP B 1  60   ? -51.871 16.278  139.593 1.00 93.28  ? 60   ASP B OD1   1 
ATOM   2242  O  OD2   . ASP B 1  60   ? -52.984 17.598  138.236 1.00 83.58  ? 60   ASP B OD2   1 
ATOM   2243  N  N     . VAL B 1  61   ? -48.100 14.532  136.538 1.00 83.87  ? 61   VAL B N     1 
ATOM   2244  C  CA    . VAL B 1  61   ? -47.365 13.810  135.503 1.00 76.50  ? 61   VAL B CA    1 
ATOM   2245  C  C     . VAL B 1  61   ? -46.549 12.714  136.178 1.00 76.82  ? 61   VAL B C     1 
ATOM   2246  O  O     . VAL B 1  61   ? -45.650 13.009  136.974 1.00 84.23  ? 61   VAL B O     1 
ATOM   2247  C  CB    . VAL B 1  61   ? -46.451 14.741  134.692 1.00 76.33  ? 61   VAL B CB    1 
ATOM   2248  C  CG1   . VAL B 1  61   ? -45.698 13.950  133.636 1.00 90.81  ? 61   VAL B CG1   1 
ATOM   2249  C  CG2   . VAL B 1  61   ? -47.265 15.853  134.048 1.00 69.19  ? 61   VAL B CG2   1 
ATOM   2250  N  N     . LEU B 1  62   ? -46.853 11.456  135.855 1.00 75.83  ? 62   LEU B N     1 
ATOM   2251  C  CA    . LEU B 1  62   ? -46.225 10.340  136.560 1.00 85.66  ? 62   LEU B CA    1 
ATOM   2252  C  C     . LEU B 1  62   ? -44.815 10.053  136.048 1.00 82.33  ? 62   LEU B C     1 
ATOM   2253  O  O     . LEU B 1  62   ? -43.841 10.150  136.803 1.00 84.92  ? 62   LEU B O     1 
ATOM   2254  C  CB    . LEU B 1  62   ? -47.101 9.088   136.456 1.00 92.72  ? 62   LEU B CB    1 
ATOM   2255  C  CG    . LEU B 1  62   ? -48.263 9.003   137.451 1.00 88.88  ? 62   LEU B CG    1 
ATOM   2256  C  CD1   . LEU B 1  62   ? -48.979 7.661   137.356 1.00 72.83  ? 62   LEU B CD1   1 
ATOM   2257  C  CD2   . LEU B 1  62   ? -47.768 9.249   138.868 1.00 82.31  ? 62   LEU B CD2   1 
ATOM   2258  N  N     . HIS B 1  63   ? -44.683 9.689   134.771 1.00 90.10  ? 63   HIS B N     1 
ATOM   2259  C  CA    . HIS B 1  63   ? -43.392 9.301   134.216 1.00 81.45  ? 63   HIS B CA    1 
ATOM   2260  C  C     . HIS B 1  63   ? -43.121 10.059  132.921 1.00 75.10  ? 63   HIS B C     1 
ATOM   2261  O  O     . HIS B 1  63   ? -43.944 10.844  132.440 1.00 71.22  ? 63   HIS B O     1 
ATOM   2262  C  CB    . HIS B 1  63   ? -43.308 7.784   133.993 1.00 82.71  ? 63   HIS B CB    1 
ATOM   2263  C  CG    . HIS B 1  63   ? -44.417 7.224   133.156 1.00 89.94  ? 63   HIS B CG    1 
ATOM   2264  N  ND1   . HIS B 1  63   ? -44.368 7.190   131.779 1.00 86.05  ? 63   HIS B ND1   1 
ATOM   2265  C  CD2   . HIS B 1  63   ? -45.598 6.661   133.504 1.00 101.24 ? 63   HIS B CD2   1 
ATOM   2266  C  CE1   . HIS B 1  63   ? -45.473 6.635   131.314 1.00 88.02  ? 63   HIS B CE1   1 
ATOM   2267  N  NE2   . HIS B 1  63   ? -46.237 6.306   132.341 1.00 97.45  ? 63   HIS B NE2   1 
ATOM   2268  N  N     . GLU B 1  64   ? -41.941 9.790   132.354 1.00 81.34  ? 64   GLU B N     1 
ATOM   2269  C  CA    . GLU B 1  64   ? -41.409 10.578  131.245 1.00 79.39  ? 64   GLU B CA    1 
ATOM   2270  C  C     . GLU B 1  64   ? -42.229 10.414  129.970 1.00 73.29  ? 64   GLU B C     1 
ATOM   2271  O  O     . GLU B 1  64   ? -42.344 11.361  129.183 1.00 62.56  ? 64   GLU B O     1 
ATOM   2272  C  CB    . GLU B 1  64   ? -39.949 10.178  131.006 1.00 78.37  ? 64   GLU B CB    1 
ATOM   2273  C  CG    . GLU B 1  64   ? -39.181 11.017  129.998 1.00 80.84  ? 64   GLU B CG    1 
ATOM   2274  C  CD    . GLU B 1  64   ? -37.697 10.671  129.978 1.00 77.96  ? 64   GLU B CD    1 
ATOM   2275  O  OE1   . GLU B 1  64   ? -36.882 11.535  129.588 1.00 75.74  ? 64   GLU B OE1   1 
ATOM   2276  O  OE2   . GLU B 1  64   ? -37.345 9.535   130.363 1.00 70.24  ? 64   GLU B OE2   1 
ATOM   2277  N  N     . PHE B 1  65   ? -42.803 9.237   129.745 1.00 79.22  ? 65   PHE B N     1 
ATOM   2278  C  CA    . PHE B 1  65   ? -43.548 8.960   128.526 1.00 79.69  ? 65   PHE B CA    1 
ATOM   2279  C  C     . PHE B 1  65   ? -45.044 9.190   128.681 1.00 82.82  ? 65   PHE B C     1 
ATOM   2280  O  O     . PHE B 1  65   ? -45.820 8.751   127.826 1.00 79.13  ? 65   PHE B O     1 
ATOM   2281  C  CB    . PHE B 1  65   ? -43.271 7.531   128.062 1.00 82.37  ? 65   PHE B CB    1 
ATOM   2282  C  CG    . PHE B 1  65   ? -41.814 7.236   127.892 1.00 74.67  ? 65   PHE B CG    1 
ATOM   2283  C  CD1   . PHE B 1  65   ? -41.063 7.937   126.965 1.00 65.81  ? 65   PHE B CD1   1 
ATOM   2284  C  CD2   . PHE B 1  65   ? -41.191 6.273   128.663 1.00 87.38  ? 65   PHE B CD2   1 
ATOM   2285  C  CE1   . PHE B 1  65   ? -39.719 7.679   126.807 1.00 68.65  ? 65   PHE B CE1   1 
ATOM   2286  C  CE2   . PHE B 1  65   ? -39.846 6.009   128.509 1.00 89.23  ? 65   PHE B CE2   1 
ATOM   2287  C  CZ    . PHE B 1  65   ? -39.109 6.713   127.578 1.00 75.08  ? 65   PHE B CZ    1 
ATOM   2288  N  N     . SER B 1  66   ? -45.468 9.864   129.746 1.00 89.26  ? 66   SER B N     1 
ATOM   2289  C  CA    . SER B 1  66   ? -46.866 10.239  129.880 1.00 89.07  ? 66   SER B CA    1 
ATOM   2290  C  C     . SER B 1  66   ? -47.195 11.356  128.891 1.00 84.89  ? 66   SER B C     1 
ATOM   2291  O  O     . SER B 1  66   ? -46.358 11.792  128.094 1.00 79.44  ? 66   SER B O     1 
ATOM   2292  C  CB    . SER B 1  66   ? -47.171 10.665  131.316 1.00 89.45  ? 66   SER B CB    1 
ATOM   2293  O  OG    . SER B 1  66   ? -47.018 9.584   132.222 1.00 90.85  ? 66   SER B OG    1 
ATOM   2294  N  N     . THR B 1  67   ? -48.439 11.818  128.937 1.00 86.69  ? 67   THR B N     1 
ATOM   2295  C  CA    . THR B 1  67   ? -48.875 12.945  128.130 1.00 87.55  ? 67   THR B CA    1 
ATOM   2296  C  C     . THR B 1  67   ? -49.533 13.976  129.033 1.00 81.91  ? 67   THR B C     1 
ATOM   2297  O  O     . THR B 1  67   ? -50.042 13.655  130.108 1.00 84.15  ? 67   THR B O     1 
ATOM   2298  C  CB    . THR B 1  67   ? -49.842 12.514  127.019 1.00 88.95  ? 67   THR B CB    1 
ATOM   2299  O  OG1   . THR B 1  67   ? -50.349 13.677  126.354 1.00 92.18  ? 67   THR B OG1   1 
ATOM   2300  C  CG2   . THR B 1  67   ? -50.998 11.711  127.598 1.00 82.60  ? 67   THR B CG2   1 
ATOM   2301  N  N     . ILE B 1  68   ? -49.517 15.222  128.583 1.00 78.45  ? 68   ILE B N     1 
ATOM   2302  C  CA    . ILE B 1  68   ? -50.015 16.350  129.363 1.00 82.86  ? 68   ILE B CA    1 
ATOM   2303  C  C     . ILE B 1  68   ? -51.338 16.804  128.755 1.00 87.14  ? 68   ILE B C     1 
ATOM   2304  O  O     . ILE B 1  68   ? -51.358 17.285  127.613 1.00 88.35  ? 68   ILE B O     1 
ATOM   2305  C  CB    . ILE B 1  68   ? -49.003 17.504  129.404 1.00 82.36  ? 68   ILE B CB    1 
ATOM   2306  C  CG1   . ILE B 1  68   ? -47.641 16.998  129.875 1.00 82.96  ? 68   ILE B CG1   1 
ATOM   2307  C  CG2   . ILE B 1  68   ? -49.503 18.607  130.323 1.00 80.71  ? 68   ILE B CG2   1 
ATOM   2308  C  CD1   . ILE B 1  68   ? -46.608 18.089  130.018 1.00 79.69  ? 68   ILE B CD1   1 
ATOM   2309  N  N     . PRO B 1  69   ? -52.456 16.671  129.467 1.00 86.55  ? 69   PRO B N     1 
ATOM   2310  C  CA    . PRO B 1  69   ? -53.724 17.206  128.957 1.00 78.07  ? 69   PRO B CA    1 
ATOM   2311  C  C     . PRO B 1  69   ? -53.694 18.726  128.905 1.00 79.88  ? 69   PRO B C     1 
ATOM   2312  O  O     . PRO B 1  69   ? -53.178 19.389  129.808 1.00 77.37  ? 69   PRO B O     1 
ATOM   2313  C  CB    . PRO B 1  69   ? -54.758 16.695  129.968 1.00 68.31  ? 69   PRO B CB    1 
ATOM   2314  C  CG    . PRO B 1  69   ? -54.085 15.544  130.666 1.00 74.49  ? 69   PRO B CG    1 
ATOM   2315  C  CD    . PRO B 1  69   ? -52.636 15.903  130.709 1.00 84.38  ? 69   PRO B CD    1 
ATOM   2316  N  N     . GLY B 1  70   ? -54.251 19.275  127.827 1.00 78.04  ? 70   GLY B N     1 
ATOM   2317  C  CA    . GLY B 1  70   ? -54.276 20.708  127.627 1.00 76.54  ? 70   GLY B CA    1 
ATOM   2318  C  C     . GLY B 1  70   ? -52.993 21.298  127.096 1.00 83.03  ? 70   GLY B C     1 
ATOM   2319  O  O     . GLY B 1  70   ? -52.918 22.521  126.920 1.00 83.60  ? 70   GLY B O     1 
ATOM   2320  N  N     . VAL B 1  71   ? -51.981 20.475  126.840 1.00 88.13  ? 71   VAL B N     1 
ATOM   2321  C  CA    . VAL B 1  71   ? -50.700 20.921  126.310 1.00 87.77  ? 71   VAL B CA    1 
ATOM   2322  C  C     . VAL B 1  71   ? -50.410 20.135  125.040 1.00 81.48  ? 71   VAL B C     1 
ATOM   2323  O  O     . VAL B 1  71   ? -50.633 18.920  124.986 1.00 80.53  ? 71   VAL B O     1 
ATOM   2324  C  CB    . VAL B 1  71   ? -49.568 20.746  127.344 1.00 85.28  ? 71   VAL B CB    1 
ATOM   2325  C  CG1   . VAL B 1  71   ? -48.211 20.995  126.708 1.00 80.07  ? 71   VAL B CG1   1 
ATOM   2326  C  CG2   . VAL B 1  71   ? -49.783 21.688  128.524 1.00 84.21  ? 71   VAL B CG2   1 
ATOM   2327  N  N     . LYS B 1  72   ? -49.926 20.837  124.012 1.00 76.83  ? 72   LYS B N     1 
ATOM   2328  C  CA    . LYS B 1  72   ? -49.664 20.194  122.729 1.00 77.74  ? 72   LYS B CA    1 
ATOM   2329  C  C     . LYS B 1  72   ? -48.510 19.202  122.830 1.00 74.79  ? 72   LYS B C     1 
ATOM   2330  O  O     . LYS B 1  72   ? -48.648 18.033  122.450 1.00 71.02  ? 72   LYS B O     1 
ATOM   2331  C  CB    . LYS B 1  72   ? -49.375 21.253  121.665 1.00 74.86  ? 72   LYS B CB    1 
ATOM   2332  C  CG    . LYS B 1  72   ? -49.144 20.689  120.275 1.00 79.96  ? 72   LYS B CG    1 
ATOM   2333  C  CD    . LYS B 1  72   ? -48.681 21.772  119.314 1.00 80.51  ? 72   LYS B CD    1 
ATOM   2334  C  CE    . LYS B 1  72   ? -47.314 22.312  119.706 1.00 79.23  ? 72   LYS B CE    1 
ATOM   2335  N  NZ    . LYS B 1  72   ? -46.875 23.422  118.816 1.00 79.51  ? 72   LYS B NZ    1 
ATOM   2336  N  N     . GLU B 1  73   ? -47.366 19.651  123.339 1.00 65.01  ? 73   GLU B N     1 
ATOM   2337  C  CA    . GLU B 1  73   ? -46.199 18.791  123.461 1.00 60.74  ? 73   GLU B CA    1 
ATOM   2338  C  C     . GLU B 1  73   ? -46.441 17.693  124.492 1.00 69.49  ? 73   GLU B C     1 
ATOM   2339  O  O     . GLU B 1  73   ? -47.302 17.804  125.369 1.00 80.59  ? 73   GLU B O     1 
ATOM   2340  C  CB    . GLU B 1  73   ? -44.969 19.609  123.858 1.00 58.44  ? 73   GLU B CB    1 
ATOM   2341  C  CG    . GLU B 1  73   ? -44.565 20.687  122.861 1.00 68.40  ? 73   GLU B CG    1 
ATOM   2342  C  CD    . GLU B 1  73   ? -45.401 21.948  122.971 1.00 70.27  ? 73   GLU B CD    1 
ATOM   2343  O  OE1   . GLU B 1  73   ? -46.440 21.920  123.665 1.00 70.38  ? 73   GLU B OE1   1 
ATOM   2344  O  OE2   . GLU B 1  73   ? -45.016 22.971  122.364 1.00 69.17  ? 73   GLU B OE2   1 
ATOM   2345  N  N     . ASP B 1  74   ? -45.663 16.618  124.380 1.00 72.07  ? 74   ASP B N     1 
ATOM   2346  C  CA    . ASP B 1  74   ? -45.700 15.548  125.364 1.00 75.13  ? 74   ASP B CA    1 
ATOM   2347  C  C     . ASP B 1  74   ? -44.625 15.787  126.423 1.00 73.23  ? 74   ASP B C     1 
ATOM   2348  O  O     . ASP B 1  74   ? -43.906 16.788  126.396 1.00 64.36  ? 74   ASP B O     1 
ATOM   2349  C  CB    . ASP B 1  74   ? -45.539 14.186  124.688 1.00 75.75  ? 74   ASP B CB    1 
ATOM   2350  C  CG    . ASP B 1  74   ? -44.381 14.146  123.706 1.00 75.40  ? 74   ASP B CG    1 
ATOM   2351  O  OD1   . ASP B 1  74   ? -43.536 15.066  123.733 1.00 74.07  ? 74   ASP B OD1   1 
ATOM   2352  O  OD2   . ASP B 1  74   ? -44.324 13.192  122.899 1.00 70.47  ? 74   ASP B OD2   1 
ATOM   2353  N  N     . VAL B 1  75   ? -44.513 14.858  127.378 1.00 78.84  ? 75   VAL B N     1 
ATOM   2354  C  CA    . VAL B 1  75   ? -43.520 14.989  128.441 1.00 78.72  ? 75   VAL B CA    1 
ATOM   2355  C  C     . VAL B 1  75   ? -42.103 14.739  127.939 1.00 75.28  ? 75   VAL B C     1 
ATOM   2356  O  O     . VAL B 1  75   ? -41.137 14.986  128.669 1.00 74.26  ? 75   VAL B O     1 
ATOM   2357  C  CB    . VAL B 1  75   ? -43.894 14.056  129.613 1.00 78.30  ? 75   VAL B CB    1 
ATOM   2358  C  CG1   . VAL B 1  75   ? -43.109 14.407  130.869 1.00 78.39  ? 75   VAL B CG1   1 
ATOM   2359  C  CG2   . VAL B 1  75   ? -45.383 14.149  129.902 1.00 78.69  ? 75   VAL B CG2   1 
ATOM   2360  N  N     . VAL B 1  76   ? -41.952 14.320  126.681 1.00 69.59  ? 76   VAL B N     1 
ATOM   2361  C  CA    . VAL B 1  76   ? -40.631 14.182  126.076 1.00 58.82  ? 76   VAL B CA    1 
ATOM   2362  C  C     . VAL B 1  76   ? -40.164 15.507  125.474 1.00 60.49  ? 76   VAL B C     1 
ATOM   2363  O  O     . VAL B 1  76   ? -38.993 15.892  125.607 1.00 57.73  ? 76   VAL B O     1 
ATOM   2364  C  CB    . VAL B 1  76   ? -40.669 13.062  125.022 1.00 54.00  ? 76   VAL B CB    1 
ATOM   2365  C  CG1   . VAL B 1  76   ? -39.350 12.978  124.272 1.00 54.32  ? 76   VAL B CG1   1 
ATOM   2366  C  CG2   . VAL B 1  76   ? -41.016 11.733  125.677 1.00 58.67  ? 76   VAL B CG2   1 
ATOM   2367  N  N     . GLU B 1  77   ? -41.076 16.231  124.820 1.00 62.82  ? 77   GLU B N     1 
ATOM   2368  C  CA    . GLU B 1  77   ? -40.687 17.393  124.026 1.00 57.60  ? 77   GLU B CA    1 
ATOM   2369  C  C     . GLU B 1  77   ? -40.244 18.560  124.906 1.00 59.15  ? 77   GLU B C     1 
ATOM   2370  O  O     . GLU B 1  77   ? -39.265 19.246  124.586 1.00 54.69  ? 77   GLU B O     1 
ATOM   2371  C  CB    . GLU B 1  77   ? -41.846 17.806  123.119 1.00 61.84  ? 77   GLU B CB    1 
ATOM   2372  C  CG    . GLU B 1  77   ? -41.486 18.820  122.043 1.00 63.41  ? 77   GLU B CG    1 
ATOM   2373  C  CD    . GLU B 1  77   ? -40.647 18.229  120.921 1.00 62.42  ? 77   GLU B CD    1 
ATOM   2374  O  OE1   . GLU B 1  77   ? -40.074 19.016  120.140 1.00 60.39  ? 77   GLU B OE1   1 
ATOM   2375  O  OE2   . GLU B 1  77   ? -40.562 16.986  120.814 1.00 62.01  ? 77   GLU B OE2   1 
ATOM   2376  N  N     . ILE B 1  78   ? -40.954 18.815  126.009 1.00 62.77  ? 78   ILE B N     1 
ATOM   2377  C  CA    . ILE B 1  78   ? -40.551 19.896  126.908 1.00 62.72  ? 78   ILE B CA    1 
ATOM   2378  C  C     . ILE B 1  78   ? -39.212 19.573  127.558 1.00 60.47  ? 78   ILE B C     1 
ATOM   2379  O  O     . ILE B 1  78   ? -38.389 20.465  127.781 1.00 56.21  ? 78   ILE B O     1 
ATOM   2380  C  CB    . ILE B 1  78   ? -41.642 20.161  127.963 1.00 62.25  ? 78   ILE B CB    1 
ATOM   2381  C  CG1   . ILE B 1  78   ? -42.993 20.396  127.286 1.00 65.39  ? 78   ILE B CG1   1 
ATOM   2382  C  CG2   . ILE B 1  78   ? -41.273 21.351  128.827 1.00 65.79  ? 78   ILE B CG2   1 
ATOM   2383  C  CD1   . ILE B 1  78   ? -44.141 20.509  128.257 1.00 64.06  ? 78   ILE B CD1   1 
ATOM   2384  N  N     . ILE B 1  79   ? -38.969 18.297  127.874 1.00 61.22  ? 79   ILE B N     1 
ATOM   2385  C  CA    . ILE B 1  79   ? -37.659 17.906  128.393 1.00 56.78  ? 79   ILE B CA    1 
ATOM   2386  C  C     . ILE B 1  79   ? -36.571 18.194  127.365 1.00 55.69  ? 79   ILE B C     1 
ATOM   2387  O  O     . ILE B 1  79   ? -35.492 18.699  127.703 1.00 52.97  ? 79   ILE B O     1 
ATOM   2388  C  CB    . ILE B 1  79   ? -37.666 16.424  128.812 1.00 56.99  ? 79   ILE B CB    1 
ATOM   2389  C  CG1   . ILE B 1  79   ? -38.523 16.223  130.062 1.00 55.68  ? 79   ILE B CG1   1 
ATOM   2390  C  CG2   . ILE B 1  79   ? -36.246 15.927  129.050 1.00 56.30  ? 79   ILE B CG2   1 
ATOM   2391  C  CD1   . ILE B 1  79   ? -38.504 14.806  130.587 1.00 52.92  ? 79   ILE B CD1   1 
ATOM   2392  N  N     . LEU B 1  80   ? -36.836 17.877  126.092 1.00 55.35  ? 80   LEU B N     1 
ATOM   2393  C  CA    . LEU B 1  80   ? -35.881 18.216  125.039 1.00 42.56  ? 80   LEU B CA    1 
ATOM   2394  C  C     . LEU B 1  80   ? -35.631 19.719  124.983 1.00 45.94  ? 80   LEU B C     1 
ATOM   2395  O  O     . LEU B 1  80   ? -34.485 20.161  124.849 1.00 43.75  ? 80   LEU B O     1 
ATOM   2396  C  CB    . LEU B 1  80   ? -36.378 17.706  123.687 1.00 40.36  ? 80   LEU B CB    1 
ATOM   2397  C  CG    . LEU B 1  80   ? -36.470 16.189  123.534 1.00 45.63  ? 80   LEU B CG    1 
ATOM   2398  C  CD1   . LEU B 1  80   ? -36.823 15.826  122.103 1.00 44.73  ? 80   LEU B CD1   1 
ATOM   2399  C  CD2   . LEU B 1  80   ? -35.169 15.526  123.964 1.00 44.41  ? 80   LEU B CD2   1 
ATOM   2400  N  N     . ASN B 1  81   ? -36.695 20.519  125.091 1.00 49.13  ? 81   ASN B N     1 
ATOM   2401  C  CA    . ASN B 1  81   ? -36.535 21.971  125.066 1.00 46.15  ? 81   ASN B CA    1 
ATOM   2402  C  C     . ASN B 1  81   ? -35.771 22.473  126.283 1.00 46.78  ? 81   ASN B C     1 
ATOM   2403  O  O     . ASN B 1  81   ? -35.083 23.495  126.206 1.00 49.34  ? 81   ASN B O     1 
ATOM   2404  C  CB    . ASN B 1  81   ? -37.896 22.659  124.991 1.00 45.36  ? 81   ASN B CB    1 
ATOM   2405  C  CG    . ASN B 1  81   ? -38.640 22.338  123.717 1.00 57.89  ? 81   ASN B CG    1 
ATOM   2406  O  OD1   . ASN B 1  81   ? -39.742 21.796  123.756 1.00 62.02  ? 81   ASN B OD1   1 
ATOM   2407  N  ND2   . ASN B 1  81   ? -38.046 22.679  122.575 1.00 57.77  ? 81   ASN B ND2   1 
ATOM   2408  N  N     . LEU B 1  82   ? -35.894 21.782  127.414 1.00 47.03  ? 82   LEU B N     1 
ATOM   2409  C  CA    . LEU B 1  82   ? -35.144 22.163  128.602 1.00 50.88  ? 82   LEU B CA    1 
ATOM   2410  C  C     . LEU B 1  82   ? -33.686 21.749  128.490 1.00 50.16  ? 82   LEU B C     1 
ATOM   2411  O  O     . LEU B 1  82   ? -32.823 22.360  129.132 1.00 53.09  ? 82   LEU B O     1 
ATOM   2412  C  CB    . LEU B 1  82   ? -35.785 21.552  129.852 1.00 52.55  ? 82   LEU B CB    1 
ATOM   2413  C  CG    . LEU B 1  82   ? -37.206 22.053  130.142 1.00 51.41  ? 82   LEU B CG    1 
ATOM   2414  C  CD1   . LEU B 1  82   ? -37.935 21.143  131.114 1.00 55.86  ? 82   LEU B CD1   1 
ATOM   2415  C  CD2   . LEU B 1  82   ? -37.187 23.483  130.651 1.00 46.94  ? 82   LEU B CD2   1 
ATOM   2416  N  N     . LYS B 1  83   ? -33.396 20.719  127.689 1.00 45.99  ? 83   LYS B N     1 
ATOM   2417  C  CA    . LYS B 1  83   ? -32.007 20.395  127.384 1.00 40.74  ? 83   LYS B CA    1 
ATOM   2418  C  C     . LYS B 1  83   ? -31.326 21.545  126.649 1.00 45.14  ? 83   LYS B C     1 
ATOM   2419  O  O     . LYS B 1  83   ? -30.151 21.842  126.896 1.00 53.66  ? 83   LYS B O     1 
ATOM   2420  C  CB    . LYS B 1  83   ? -31.934 19.112  126.554 1.00 37.21  ? 83   LYS B CB    1 
ATOM   2421  C  CG    . LYS B 1  83   ? -32.158 17.838  127.336 1.00 34.61  ? 83   LYS B CG    1 
ATOM   2422  C  CD    . LYS B 1  83   ? -32.020 16.640  126.419 1.00 35.31  ? 83   LYS B CD    1 
ATOM   2423  C  CE    . LYS B 1  83   ? -32.197 15.323  127.148 1.00 46.60  ? 83   LYS B CE    1 
ATOM   2424  N  NZ    . LYS B 1  83   ? -32.151 14.164  126.204 1.00 42.81  ? 83   LYS B NZ    1 
ATOM   2425  N  N     . GLU B 1  84   ? -32.051 22.210  125.753 1.00 42.84  ? 84   GLU B N     1 
ATOM   2426  C  CA    . GLU B 1  84   ? -31.519 23.323  124.976 1.00 47.14  ? 84   GLU B CA    1 
ATOM   2427  C  C     . GLU B 1  84   ? -31.535 24.645  125.736 1.00 49.55  ? 84   GLU B C     1 
ATOM   2428  O  O     . GLU B 1  84   ? -31.228 25.686  125.145 1.00 56.82  ? 84   GLU B O     1 
ATOM   2429  C  CB    . GLU B 1  84   ? -32.305 23.477  123.670 1.00 53.31  ? 84   GLU B CB    1 
ATOM   2430  C  CG    . GLU B 1  84   ? -32.168 22.308  122.708 1.00 54.23  ? 84   GLU B CG    1 
ATOM   2431  C  CD    . GLU B 1  84   ? -32.844 22.579  121.375 1.00 58.10  ? 84   GLU B CD    1 
ATOM   2432  O  OE1   . GLU B 1  84   ? -33.184 23.752  121.120 1.00 56.22  ? 84   GLU B OE1   1 
ATOM   2433  O  OE2   . GLU B 1  84   ? -33.042 21.626  120.587 1.00 56.02  ? 84   GLU B OE2   1 
ATOM   2434  N  N     . LEU B 1  85   ? -31.884 24.628  127.020 1.00 49.38  ? 85   LEU B N     1 
ATOM   2435  C  CA    . LEU B 1  85   ? -31.891 25.841  127.829 1.00 54.54  ? 85   LEU B CA    1 
ATOM   2436  C  C     . LEU B 1  85   ? -30.468 26.213  128.234 1.00 50.16  ? 85   LEU B C     1 
ATOM   2437  O  O     . LEU B 1  85   ? -29.709 25.368  128.717 1.00 52.80  ? 85   LEU B O     1 
ATOM   2438  C  CB    . LEU B 1  85   ? -32.768 25.638  129.067 1.00 53.01  ? 85   LEU B CB    1 
ATOM   2439  C  CG    . LEU B 1  85   ? -32.954 26.811  130.031 1.00 49.29  ? 85   LEU B CG    1 
ATOM   2440  C  CD1   . LEU B 1  85   ? -33.557 28.008  129.318 1.00 52.98  ? 85   LEU B CD1   1 
ATOM   2441  C  CD2   . LEU B 1  85   ? -33.825 26.388  131.201 1.00 46.53  ? 85   LEU B CD2   1 
ATOM   2442  N  N     . VAL B 1  86   ? -30.106 27.477  128.038 1.00 44.07  ? 86   VAL B N     1 
ATOM   2443  C  CA    . VAL B 1  86   ? -28.762 27.962  128.334 1.00 52.56  ? 86   VAL B CA    1 
ATOM   2444  C  C     . VAL B 1  86   ? -28.848 28.867  129.554 1.00 60.16  ? 86   VAL B C     1 
ATOM   2445  O  O     . VAL B 1  86   ? -29.318 30.008  129.460 1.00 62.36  ? 86   VAL B O     1 
ATOM   2446  C  CB    . VAL B 1  86   ? -28.144 28.702  127.141 1.00 60.62  ? 86   VAL B CB    1 
ATOM   2447  C  CG1   . VAL B 1  86   ? -26.757 29.217  127.501 1.00 64.83  ? 86   VAL B CG1   1 
ATOM   2448  C  CG2   . VAL B 1  86   ? -28.074 27.792  125.928 1.00 57.39  ? 86   VAL B CG2   1 
ATOM   2449  N  N     . VAL B 1  87   ? -28.373 28.369  130.695 1.00 63.94  ? 87   VAL B N     1 
ATOM   2450  C  CA    . VAL B 1  87   ? -28.400 29.091  131.961 1.00 62.35  ? 87   VAL B CA    1 
ATOM   2451  C  C     . VAL B 1  87   ? -26.964 29.344  132.406 1.00 66.04  ? 87   VAL B C     1 
ATOM   2452  O  O     . VAL B 1  87   ? -26.103 28.466  132.282 1.00 67.61  ? 87   VAL B O     1 
ATOM   2453  C  CB    . VAL B 1  87   ? -29.190 28.314  133.037 1.00 58.65  ? 87   VAL B CB    1 
ATOM   2454  C  CG1   . VAL B 1  87   ? -29.053 28.976  134.399 1.00 68.43  ? 87   VAL B CG1   1 
ATOM   2455  C  CG2   . VAL B 1  87   ? -30.655 28.218  132.644 1.00 47.17  ? 87   VAL B CG2   1 
ATOM   2456  N  N     . ARG B 1  88   ? -26.708 30.548  132.918 1.00 70.27  ? 88   ARG B N     1 
ATOM   2457  C  CA    . ARG B 1  88   ? -25.371 30.975  133.309 1.00 69.03  ? 88   ARG B CA    1 
ATOM   2458  C  C     . ARG B 1  88   ? -25.394 31.475  134.747 1.00 81.69  ? 88   ARG B C     1 
ATOM   2459  O  O     . ARG B 1  88   ? -26.210 32.337  135.098 1.00 83.95  ? 88   ARG B O     1 
ATOM   2460  C  CB    . ARG B 1  88   ? -24.868 32.067  132.365 1.00 67.86  ? 88   ARG B CB    1 
ATOM   2461  C  CG    . ARG B 1  88   ? -23.482 32.574  132.642 1.00 72.28  ? 88   ARG B CG    1 
ATOM   2462  C  CD    . ARG B 1  88   ? -23.151 33.655  131.637 1.00 74.36  ? 88   ARG B CD    1 
ATOM   2463  N  NE    . ARG B 1  88   ? -21.835 34.238  131.860 1.00 80.15  ? 88   ARG B NE    1 
ATOM   2464  C  CZ    . ARG B 1  88   ? -21.390 35.317  131.229 1.00 76.28  ? 88   ARG B CZ    1 
ATOM   2465  N  NH1   . ARG B 1  88   ? -22.164 35.928  130.340 1.00 68.55  ? 88   ARG B NH1   1 
ATOM   2466  N  NH2   . ARG B 1  88   ? -20.177 35.789  131.489 1.00 81.66  ? 88   ARG B NH2   1 
ATOM   2467  N  N     . PHE B 1  89   ? -24.503 30.932  135.576 1.00 84.58  ? 89   PHE B N     1 
ATOM   2468  C  CA    . PHE B 1  89   ? -24.422 31.297  136.986 1.00 77.27  ? 89   PHE B CA    1 
ATOM   2469  C  C     . PHE B 1  89   ? -23.451 32.459  137.144 1.00 82.36  ? 89   PHE B C     1 
ATOM   2470  O  O     . PHE B 1  89   ? -22.267 32.336  136.814 1.00 78.88  ? 89   PHE B O     1 
ATOM   2471  C  CB    . PHE B 1  89   ? -23.980 30.111  137.841 1.00 70.23  ? 89   PHE B CB    1 
ATOM   2472  C  CG    . PHE B 1  89   ? -24.990 29.003  137.915 1.00 69.23  ? 89   PHE B CG    1 
ATOM   2473  C  CD1   . PHE B 1  89   ? -26.287 29.193  137.465 1.00 68.95  ? 89   PHE B CD1   1 
ATOM   2474  C  CD2   . PHE B 1  89   ? -24.642 27.770  138.442 1.00 69.09  ? 89   PHE B CD2   1 
ATOM   2475  C  CE1   . PHE B 1  89   ? -27.214 28.170  137.534 1.00 69.13  ? 89   PHE B CE1   1 
ATOM   2476  C  CE2   . PHE B 1  89   ? -25.566 26.743  138.516 1.00 63.66  ? 89   PHE B CE2   1 
ATOM   2477  C  CZ    . PHE B 1  89   ? -26.852 26.943  138.062 1.00 61.64  ? 89   PHE B CZ    1 
ATOM   2478  N  N     . LEU B 1  90   ? -23.953 33.582  137.650 1.00 81.17  ? 90   LEU B N     1 
ATOM   2479  C  CA    . LEU B 1  90   ? -23.121 34.772  137.762 1.00 86.89  ? 90   LEU B CA    1 
ATOM   2480  C  C     . LEU B 1  90   ? -22.304 34.772  139.048 1.00 87.54  ? 90   LEU B C     1 
ATOM   2481  O  O     . LEU B 1  90   ? -21.151 35.219  139.053 1.00 89.43  ? 90   LEU B O     1 
ATOM   2482  C  CB    . LEU B 1  90   ? -24.002 36.012  137.663 1.00 85.61  ? 90   LEU B CB    1 
ATOM   2483  C  CG    . LEU B 1  90   ? -24.778 35.986  136.348 1.00 85.48  ? 90   LEU B CG    1 
ATOM   2484  C  CD1   . LEU B 1  90   ? -26.209 36.421  136.557 1.00 82.63  ? 90   LEU B CD1   1 
ATOM   2485  C  CD2   . LEU B 1  90   ? -24.082 36.845  135.309 1.00 78.63  ? 90   LEU B CD2   1 
ATOM   2486  N  N     . ASN B 1  91   ? -22.875 34.286  140.141 1.00 84.87  ? 91   ASN B N     1 
ATOM   2487  C  CA    . ASN B 1  91   ? -22.113 34.139  141.371 1.00 89.92  ? 91   ASN B CA    1 
ATOM   2488  C  C     . ASN B 1  91   ? -21.349 32.821  141.334 1.00 90.54  ? 91   ASN B C     1 
ATOM   2489  O  O     . ASN B 1  91   ? -21.976 31.756  141.288 1.00 84.71  ? 91   ASN B O     1 
ATOM   2490  C  CB    . ASN B 1  91   ? -23.022 34.210  142.599 1.00 94.53  ? 91   ASN B CB    1 
ATOM   2491  C  CG    . ASN B 1  91   ? -22.244 34.352  143.893 1.00 90.48  ? 91   ASN B CG    1 
ATOM   2492  O  OD1   . ASN B 1  91   ? -21.165 34.943  143.920 1.00 93.02  ? 91   ASN B OD1   1 
ATOM   2493  N  N     . PRO B 1  92   ? -20.012 32.844  141.351 1.00 92.94  ? 92   PRO B N     1 
ATOM   2494  C  CA    . PRO B 1  92   ? -19.251 31.585  141.284 1.00 89.99  ? 92   PRO B CA    1 
ATOM   2495  C  C     . PRO B 1  92   ? -19.501 30.668  142.461 1.00 87.02  ? 92   PRO B C     1 
ATOM   2496  O  O     . PRO B 1  92   ? -19.192 29.473  142.380 1.00 85.92  ? 92   PRO B O     1 
ATOM   2497  C  CB    . PRO B 1  92   ? -17.794 32.061  141.247 1.00 94.20  ? 92   PRO B CB    1 
ATOM   2498  C  CG    . PRO B 1  92   ? -17.823 33.385  141.940 1.00 87.31  ? 92   PRO B CG    1 
ATOM   2499  C  CD    . PRO B 1  92   ? -19.133 34.010  141.543 1.00 90.92  ? 92   PRO B CD    1 
ATOM   2500  N  N     . SER B 1  93   ? -20.056 31.190  143.553 1.00 88.79  ? 93   SER B N     1 
ATOM   2501  C  CA    . SER B 1  93   ? -20.404 30.367  144.700 1.00 96.38  ? 93   SER B CA    1 
ATOM   2502  C  C     . SER B 1  93   ? -21.550 29.411  144.397 1.00 91.24  ? 93   SER B C     1 
ATOM   2503  O  O     . SER B 1  93   ? -21.693 28.392  145.083 1.00 87.00  ? 93   SER B O     1 
ATOM   2504  C  CB    . SER B 1  93   ? -20.772 31.275  145.871 1.00 99.32  ? 93   SER B CB    1 
ATOM   2505  O  OG    . SER B 1  93   ? -19.795 32.287  146.061 1.00 98.95  ? 93   SER B OG    1 
ATOM   2506  N  N     . LEU B 1  94   ? -22.341 29.705  143.369 1.00 83.40  ? 94   LEU B N     1 
ATOM   2507  C  CA    . LEU B 1  94   ? -23.597 29.015  143.109 1.00 79.14  ? 94   LEU B CA    1 
ATOM   2508  C  C     . LEU B 1  94   ? -23.337 27.630  142.523 1.00 71.57  ? 94   LEU B C     1 
ATOM   2509  O  O     . LEU B 1  94   ? -22.727 27.505  141.457 1.00 80.40  ? 94   LEU B O     1 
ATOM   2510  C  CB    . LEU B 1  94   ? -24.440 29.856  142.153 1.00 81.64  ? 94   LEU B CB    1 
ATOM   2511  C  CG    . LEU B 1  94   ? -25.965 29.818  142.206 1.00 84.84  ? 94   LEU B CG    1 
ATOM   2512  C  CD1   . LEU B 1  94   ? -26.524 30.325  140.894 1.00 85.55  ? 94   LEU B CD1   1 
ATOM   2513  C  CD2   . LEU B 1  94   ? -26.504 28.444  142.566 1.00 72.76  ? 94   LEU B CD2   1 
ATOM   2514  N  N     . GLN B 1  95   ? -23.821 26.592  143.204 1.00 63.41  ? 95   GLN B N     1 
ATOM   2515  C  CA    . GLN B 1  95   ? -23.710 25.232  142.690 1.00 66.82  ? 95   GLN B CA    1 
ATOM   2516  C  C     . GLN B 1  95   ? -24.983 24.753  141.996 1.00 64.88  ? 95   GLN B C     1 
ATOM   2517  O  O     . GLN B 1  95   ? -24.901 24.039  140.989 1.00 63.65  ? 95   GLN B O     1 
ATOM   2518  C  CB    . GLN B 1  95   ? -23.346 24.270  143.822 1.00 76.56  ? 95   GLN B CB    1 
ATOM   2519  C  CG    . GLN B 1  95   ? -21.892 24.339  144.270 1.00 70.41  ? 95   GLN B CG    1 
ATOM   2520  C  CD    . GLN B 1  95   ? -20.979 23.498  143.396 1.00 88.28  ? 95   GLN B CD    1 
ATOM   2521  O  OE1   . GLN B 1  95   ? -20.811 23.772  142.207 1.00 95.36  ? 95   GLN B OE1   1 
ATOM   2522  N  NE2   . GLN B 1  95   ? -20.396 22.454  143.979 1.00 81.76  ? 95   GLN B NE2   1 
ATOM   2523  N  N     . THR B 1  96   ? -26.160 25.118  142.506 1.00 63.78  ? 96   THR B N     1 
ATOM   2524  C  CA    . THR B 1  96   ? -27.405 24.593  141.960 1.00 59.86  ? 96   THR B CA    1 
ATOM   2525  C  C     . THR B 1  96   ? -28.557 25.552  142.238 1.00 56.07  ? 96   THR B C     1 
ATOM   2526  O  O     . THR B 1  96   ? -28.593 26.220  143.275 1.00 61.18  ? 96   THR B O     1 
ATOM   2527  C  CB    . THR B 1  96   ? -27.728 23.209  142.539 1.00 57.33  ? 96   THR B CB    1 
ATOM   2528  O  OG1   . THR B 1  96   ? -29.094 22.876  142.265 1.00 51.70  ? 96   THR B OG1   1 
ATOM   2529  C  CG2   . THR B 1  96   ? -27.497 23.187  144.039 1.00 67.10  ? 96   THR B CG2   1 
ATOM   2530  N  N     . VAL B 1  97   ? -29.503 25.607  141.292 1.00 59.19  ? 97   VAL B N     1 
ATOM   2531  C  CA    . VAL B 1  97   ? -30.712 26.418  141.394 1.00 54.88  ? 97   VAL B CA    1 
ATOM   2532  C  C     . VAL B 1  97   ? -31.915 25.541  141.071 1.00 61.43  ? 97   VAL B C     1 
ATOM   2533  O  O     . VAL B 1  97   ? -31.804 24.516  140.395 1.00 63.66  ? 97   VAL B O     1 
ATOM   2534  C  CB    . VAL B 1  97   ? -30.700 27.639  140.447 1.00 54.92  ? 97   VAL B CB    1 
ATOM   2535  C  CG1   . VAL B 1  97   ? -31.655 28.703  140.945 1.00 60.22  ? 97   VAL B CG1   1 
ATOM   2536  C  CG2   . VAL B 1  97   ? -29.309 28.197  140.310 1.00 61.52  ? 97   VAL B CG2   1 
ATOM   2537  N  N     . THR B 1  98   ? -33.078 25.958  141.574 1.00 65.06  ? 98   THR B N     1 
ATOM   2538  C  CA    . THR B 1  98   ? -34.362 25.367  141.212 1.00 63.94  ? 98   THR B CA    1 
ATOM   2539  C  C     . THR B 1  98   ? -35.221 26.470  140.607 1.00 61.59  ? 98   THR B C     1 
ATOM   2540  O  O     . THR B 1  98   ? -35.576 27.432  141.295 1.00 57.31  ? 98   THR B O     1 
ATOM   2541  C  CB    . THR B 1  98   ? -35.045 24.730  142.423 1.00 61.20  ? 98   THR B CB    1 
ATOM   2542  O  OG1   . THR B 1  98   ? -34.298 23.582  142.850 1.00 67.53  ? 98   THR B OG1   1 
ATOM   2543  C  CG2   . THR B 1  98   ? -36.463 24.296  142.073 1.00 58.31  ? 98   THR B CG2   1 
ATOM   2544  N  N     . LEU B 1  99   ? -35.532 26.341  139.318 1.00 71.35  ? 99   LEU B N     1 
ATOM   2545  C  CA    . LEU B 1  99   ? -36.326 27.326  138.593 1.00 68.41  ? 99   LEU B CA    1 
ATOM   2546  C  C     . LEU B 1  99   ? -37.762 26.829  138.487 1.00 71.04  ? 99   LEU B C     1 
ATOM   2547  O  O     . LEU B 1  99   ? -38.007 25.722  137.995 1.00 62.27  ? 99   LEU B O     1 
ATOM   2548  C  CB    . LEU B 1  99   ? -35.750 27.583  137.201 1.00 62.57  ? 99   LEU B CB    1 
ATOM   2549  C  CG    . LEU B 1  99   ? -34.691 28.679  137.071 1.00 69.86  ? 99   LEU B CG    1 
ATOM   2550  C  CD1   . LEU B 1  99   ? -33.455 28.346  137.888 1.00 61.80  ? 99   LEU B CD1   1 
ATOM   2551  C  CD2   . LEU B 1  99   ? -34.336 28.891  135.605 1.00 65.31  ? 99   LEU B CD2   1 
ATOM   2552  N  N     . LEU B 1  100  ? -38.703 27.646  138.946 1.00 81.09  ? 100  LEU B N     1 
ATOM   2553  C  CA    . LEU B 1  100  ? -40.114 27.301  138.904 1.00 82.21  ? 100  LEU B CA    1 
ATOM   2554  C  C     . LEU B 1  100  ? -40.797 28.033  137.756 1.00 78.05  ? 100  LEU B C     1 
ATOM   2555  O  O     . LEU B 1  100  ? -40.394 29.133  137.365 1.00 69.95  ? 100  LEU B O     1 
ATOM   2556  C  CB    . LEU B 1  100  ? -40.808 27.634  140.230 1.00 82.14  ? 100  LEU B CB    1 
ATOM   2557  C  CG    . LEU B 1  100  ? -40.438 26.787  141.457 1.00 80.36  ? 100  LEU B CG    1 
ATOM   2558  C  CD1   . LEU B 1  100  ? -39.238 27.374  142.191 1.00 70.84  ? 100  LEU B CD1   1 
ATOM   2559  C  CD2   . LEU B 1  100  ? -41.629 26.621  142.397 1.00 83.57  ? 100  LEU B CD2   1 
ATOM   2560  N  N     . LEU B 1  101  ? -41.832 27.398  137.211 1.00 74.33  ? 101  LEU B N     1 
ATOM   2561  C  CA    . LEU B 1  101  ? -42.627 27.987  136.143 1.00 79.50  ? 101  LEU B CA    1 
ATOM   2562  C  C     . LEU B 1  101  ? -44.070 27.539  136.302 1.00 83.34  ? 101  LEU B C     1 
ATOM   2563  O  O     . LEU B 1  101  ? -44.364 26.339  136.261 1.00 80.66  ? 101  LEU B O     1 
ATOM   2564  C  CB    . LEU B 1  101  ? -42.089 27.591  134.767 1.00 83.71  ? 101  LEU B CB    1 
ATOM   2565  C  CG    . LEU B 1  101  ? -42.798 28.253  133.585 1.00 85.69  ? 101  LEU B CG    1 
ATOM   2566  C  CD1   . LEU B 1  101  ? -41.770 28.770  132.594 1.00 82.80  ? 101  LEU B CD1   1 
ATOM   2567  C  CD2   . LEU B 1  101  ? -43.770 27.289  132.912 1.00 77.27  ? 101  LEU B CD2   1 
ATOM   2568  N  N     . LYS B 1  102  ? -44.964 28.509  136.471 1.00 78.23  ? 102  LYS B N     1 
ATOM   2569  C  CA    . LYS B 1  102  ? -46.393 28.262  136.597 1.00 75.83  ? 102  LYS B CA    1 
ATOM   2570  C  C     . LYS B 1  102  ? -47.094 29.148  135.584 1.00 74.04  ? 102  LYS B C     1 
ATOM   2571  O  O     . LYS B 1  102  ? -46.950 30.374  135.628 1.00 72.15  ? 102  LYS B O     1 
ATOM   2572  C  CB    . LYS B 1  102  ? -46.887 28.558  138.018 1.00 84.29  ? 102  LYS B CB    1 
ATOM   2573  C  CG    . LYS B 1  102  ? -46.147 27.783  139.102 1.00 89.98  ? 102  LYS B CG    1 
ATOM   2574  C  CD    . LYS B 1  102  ? -46.435 28.326  140.496 1.00 90.87  ? 102  LYS B CD    1 
ATOM   2575  C  CE    . LYS B 1  102  ? -45.622 27.585  141.554 1.00 86.68  ? 102  LYS B CE    1 
ATOM   2576  N  NZ    . LYS B 1  102  ? -45.779 28.176  142.912 1.00 76.93  ? 102  LYS B NZ    1 
ATOM   2577  N  N     . ALA B 1  103  ? -47.823 28.530  134.659 1.00 78.65  ? 103  ALA B N     1 
ATOM   2578  C  CA    . ALA B 1  103  ? -48.554 29.284  133.650 1.00 80.45  ? 103  ALA B CA    1 
ATOM   2579  C  C     . ALA B 1  103  ? -49.684 28.424  133.106 1.00 83.29  ? 103  ALA B C     1 
ATOM   2580  O  O     . ALA B 1  103  ? -49.594 27.194  133.086 1.00 78.85  ? 103  ALA B O     1 
ATOM   2581  C  CB    . ALA B 1  103  ? -47.634 29.744  132.513 1.00 76.66  ? 103  ALA B CB    1 
ATOM   2582  N  N     . GLU B 1  104  ? -50.743 29.083  132.653 1.00 89.18  ? 104  GLU B N     1 
ATOM   2583  C  CA    . GLU B 1  104  ? -51.913 28.380  132.149 1.00 96.33  ? 104  GLU B CA    1 
ATOM   2584  C  C     . GLU B 1  104  ? -52.546 29.224  131.051 1.00 95.08  ? 104  GLU B C     1 
ATOM   2585  O  O     . GLU B 1  104  ? -51.956 30.196  130.568 1.00 84.97  ? 104  GLU B O     1 
ATOM   2586  C  CB    . GLU B 1  104  ? -52.904 28.087  133.283 1.00 110.40 ? 104  GLU B CB    1 
ATOM   2587  C  CG    . GLU B 1  104  ? -53.483 29.334  133.934 1.00 102.43 ? 104  GLU B CG    1 
ATOM   2588  C  CD    . GLU B 1  104  ? -54.619 29.022  134.885 1.00 104.44 ? 104  GLU B CD    1 
ATOM   2589  O  OE1   . GLU B 1  104  ? -55.286 29.974  135.339 1.00 106.98 ? 104  GLU B OE1   1 
ATOM   2590  O  OE2   . GLU B 1  104  ? -54.847 27.828  135.175 1.00 108.06 ? 104  GLU B OE2   1 
ATOM   2591  N  N     . GLY B 1  105  ? -53.757 28.842  130.653 1.00 103.88 ? 105  GLY B N     1 
ATOM   2592  C  CA    . GLY B 1  105  ? -54.504 29.571  129.660 1.00 102.40 ? 105  GLY B CA    1 
ATOM   2593  C  C     . GLY B 1  105  ? -53.983 29.350  128.256 1.00 97.84  ? 105  GLY B C     1 
ATOM   2594  O  O     . GLY B 1  105  ? -53.068 28.557  128.019 1.00 101.48 ? 105  GLY B O     1 
ATOM   2595  N  N     . PRO B 1  106  ? -54.573 30.053  127.294 1.00 100.10 ? 106  PRO B N     1 
ATOM   2596  C  CA    . PRO B 1  106  ? -54.094 29.982  125.904 1.00 100.76 ? 106  PRO B CA    1 
ATOM   2597  C  C     . PRO B 1  106  ? -52.806 30.766  125.709 1.00 96.79  ? 106  PRO B C     1 
ATOM   2598  O  O     . PRO B 1  106  ? -52.843 31.948  125.356 1.00 84.79  ? 106  PRO B O     1 
ATOM   2599  C  CB    . PRO B 1  106  ? -55.252 30.594  125.106 1.00 102.05 ? 106  PRO B CB    1 
ATOM   2600  C  CG    . PRO B 1  106  ? -55.930 31.509  126.074 1.00 112.93 ? 106  PRO B CG    1 
ATOM   2601  C  CD    . PRO B 1  106  ? -55.790 30.872  127.426 1.00 106.78 ? 106  PRO B CD    1 
ATOM   2602  N  N     . LYS B 1  107  ? -51.661 30.133  125.959 1.00 97.37  ? 107  LYS B N     1 
ATOM   2603  C  CA    . LYS B 1  107  ? -50.409 30.876  126.036 1.00 91.56  ? 107  LYS B CA    1 
ATOM   2604  C  C     . LYS B 1  107  ? -49.257 30.011  125.543 1.00 87.36  ? 107  LYS B C     1 
ATOM   2605  O  O     . LYS B 1  107  ? -49.304 28.780  125.608 1.00 88.08  ? 107  LYS B O     1 
ATOM   2606  C  CB    . LYS B 1  107  ? -50.147 31.355  127.472 1.00 96.27  ? 107  LYS B CB    1 
ATOM   2607  C  CG    . LYS B 1  107  ? -48.969 32.307  127.638 1.00 87.89  ? 107  LYS B CG    1 
ATOM   2608  C  CD    . LYS B 1  107  ? -48.752 32.648  129.106 1.00 95.83  ? 107  LYS B CD    1 
ATOM   2609  C  CE    . LYS B 1  107  ? -47.540 33.546  129.311 1.00 92.58  ? 107  LYS B CE    1 
ATOM   2610  N  NZ    . LYS B 1  107  ? -47.356 33.872  130.756 1.00 108.55 ? 107  LYS B NZ    1 
ATOM   2611  N  N     . GLU B 1  108  ? -48.201 30.674  125.070 1.00 81.15  ? 108  GLU B N     1 
ATOM   2612  C  CA    . GLU B 1  108  ? -46.987 30.006  124.612 1.00 80.42  ? 108  GLU B CA    1 
ATOM   2613  C  C     . GLU B 1  108  ? -45.856 30.303  125.591 1.00 84.36  ? 108  GLU B C     1 
ATOM   2614  O  O     . GLU B 1  108  ? -45.337 31.424  125.633 1.00 83.57  ? 108  GLU B O     1 
ATOM   2615  C  CB    . GLU B 1  108  ? -46.625 30.442  123.195 1.00 80.55  ? 108  GLU B CB    1 
ATOM   2616  C  CG    . GLU B 1  108  ? -47.587 29.914  122.150 1.00 86.34  ? 108  GLU B CG    1 
ATOM   2617  C  CD    . GLU B 1  108  ? -47.006 29.944  120.754 1.00 89.74  ? 108  GLU B CD    1 
ATOM   2618  O  OE1   . GLU B 1  108  ? -45.854 30.398  120.595 1.00 91.70  ? 108  GLU B OE1   1 
ATOM   2619  O  OE2   . GLU B 1  108  ? -47.703 29.508  119.814 1.00 99.36  ? 108  GLU B OE2   1 
ATOM   2620  N  N     . VAL B 1  109  ? -45.471 29.288  126.362 1.00 80.83  ? 109  VAL B N     1 
ATOM   2621  C  CA    . VAL B 1  109  ? -44.442 29.409  127.389 1.00 73.48  ? 109  VAL B CA    1 
ATOM   2622  C  C     . VAL B 1  109  ? -43.061 29.365  126.745 1.00 74.34  ? 109  VAL B C     1 
ATOM   2623  O  O     . VAL B 1  109  ? -42.706 28.381  126.081 1.00 70.02  ? 109  VAL B O     1 
ATOM   2624  C  CB    . VAL B 1  109  ? -44.583 28.294  128.433 1.00 71.32  ? 109  VAL B CB    1 
ATOM   2625  C  CG1   . VAL B 1  109  ? -43.467 28.390  129.457 1.00 69.82  ? 109  VAL B CG1   1 
ATOM   2626  C  CG2   . VAL B 1  109  ? -45.951 28.352  129.101 1.00 81.96  ? 109  VAL B CG2   1 
ATOM   2627  N  N     . LYS B 1  110  ? -42.271 30.411  126.997 1.00 72.25  ? 110  LYS B N     1 
ATOM   2628  C  CA    . LYS B 1  110  ? -40.879 30.567  126.598 1.00 69.84  ? 110  LYS B CA    1 
ATOM   2629  C  C     . LYS B 1  110  ? -39.980 30.474  127.829 1.00 68.03  ? 110  LYS B C     1 
ATOM   2630  O  O     . LYS B 1  110  ? -40.447 30.304  128.958 1.00 76.20  ? 110  LYS B O     1 
ATOM   2631  C  CB    . LYS B 1  110  ? -40.676 31.906  125.886 1.00 76.75  ? 110  LYS B CB    1 
ATOM   2632  C  CG    . LYS B 1  110  ? -41.493 32.075  124.617 1.00 77.24  ? 110  LYS B CG    1 
ATOM   2633  C  CD    . LYS B 1  110  ? -40.965 31.175  123.511 1.00 80.52  ? 110  LYS B CD    1 
ATOM   2634  C  CE    . LYS B 1  110  ? -41.805 31.268  122.245 1.00 80.23  ? 110  LYS B CE    1 
ATOM   2635  N  NZ    . LYS B 1  110  ? -43.196 30.784  122.459 1.00 85.87  ? 110  LYS B NZ    1 
ATOM   2636  N  N     . ALA B 1  111  ? -38.669 30.604  127.607 1.00 65.22  ? 111  ALA B N     1 
ATOM   2637  C  CA    . ALA B 1  111  ? -37.718 30.581  128.713 1.00 72.12  ? 111  ALA B CA    1 
ATOM   2638  C  C     . ALA B 1  111  ? -37.734 31.865  129.525 1.00 80.94  ? 111  ALA B C     1 
ATOM   2639  O  O     . ALA B 1  111  ? -37.064 31.935  130.560 1.00 82.60  ? 111  ALA B O     1 
ATOM   2640  C  CB    . ALA B 1  111  ? -36.303 30.327  128.196 1.00 67.72  ? 111  ALA B CB    1 
ATOM   2641  N  N     . ARG B 1  112  ? -38.471 32.878  129.076 1.00 81.51  ? 112  ARG B N     1 
ATOM   2642  C  CA    . ARG B 1  112  ? -38.573 34.120  129.826 1.00 85.82  ? 112  ARG B CA    1 
ATOM   2643  C  C     . ARG B 1  112  ? -39.488 33.970  131.032 1.00 84.92  ? 112  ARG B C     1 
ATOM   2644  O  O     . ARG B 1  112  ? -39.298 34.654  132.045 1.00 84.54  ? 112  ARG B O     1 
ATOM   2645  C  CB    . ARG B 1  112  ? -39.083 35.224  128.905 1.00 85.52  ? 112  ARG B CB    1 
ATOM   2646  C  CG    . ARG B 1  112  ? -38.794 36.634  129.352 1.00 93.92  ? 112  ARG B CG    1 
ATOM   2647  C  CD    . ARG B 1  112  ? -39.483 37.609  128.411 1.00 100.67 ? 112  ARG B CD    1 
ATOM   2648  N  NE    . ARG B 1  112  ? -39.887 36.971  127.156 1.00 95.52  ? 112  ARG B NE    1 
ATOM   2649  C  CZ    . ARG B 1  112  ? -39.134 36.922  126.060 1.00 93.75  ? 112  ARG B CZ    1 
ATOM   2650  N  NH1   . ARG B 1  112  ? -37.926 37.469  126.059 1.00 97.01  ? 112  ARG B NH1   1 
ATOM   2651  N  NH2   . ARG B 1  112  ? -39.586 36.321  124.966 1.00 87.13  ? 112  ARG B NH2   1 
ATOM   2652  N  N     . ASP B 1  113  ? -40.480 33.082  130.944 1.00 81.87  ? 113  ASP B N     1 
ATOM   2653  C  CA    . ASP B 1  113  ? -41.498 32.971  131.979 1.00 85.55  ? 113  ASP B CA    1 
ATOM   2654  C  C     . ASP B 1  113  ? -40.979 32.338  133.265 1.00 84.26  ? 113  ASP B C     1 
ATOM   2655  O  O     . ASP B 1  113  ? -41.701 32.344  134.268 1.00 91.32  ? 113  ASP B O     1 
ATOM   2656  C  CB    . ASP B 1  113  ? -42.694 32.179  131.445 1.00 86.48  ? 113  ASP B CB    1 
ATOM   2657  C  CG    . ASP B 1  113  ? -43.177 32.687  130.090 1.00 88.60  ? 113  ASP B CG    1 
ATOM   2658  O  OD1   . ASP B 1  113  ? -42.588 33.659  129.567 1.00 82.45  ? 113  ASP B OD1   1 
ATOM   2659  O  OD2   . ASP B 1  113  ? -44.134 32.101  129.538 1.00 87.91  ? 113  ASP B OD2   1 
ATOM   2660  N  N     . PHE B 1  114  ? -39.762 31.800  133.267 1.00 82.66  ? 114  PHE B N     1 
ATOM   2661  C  CA    . PHE B 1  114  ? -39.188 31.272  134.497 1.00 87.26  ? 114  PHE B CA    1 
ATOM   2662  C  C     . PHE B 1  114  ? -38.968 32.402  135.493 1.00 87.03  ? 114  PHE B C     1 
ATOM   2663  O  O     . PHE B 1  114  ? -38.418 33.452  135.144 1.00 80.27  ? 114  PHE B O     1 
ATOM   2664  C  CB    . PHE B 1  114  ? -37.873 30.550  134.208 1.00 79.25  ? 114  PHE B CB    1 
ATOM   2665  C  CG    . PHE B 1  114  ? -38.054 29.157  133.678 1.00 73.74  ? 114  PHE B CG    1 
ATOM   2666  C  CD1   . PHE B 1  114  ? -38.444 28.130  134.519 1.00 79.66  ? 114  PHE B CD1   1 
ATOM   2667  C  CD2   . PHE B 1  114  ? -37.838 28.874  132.342 1.00 70.65  ? 114  PHE B CD2   1 
ATOM   2668  C  CE1   . PHE B 1  114  ? -38.616 26.847  134.036 1.00 71.82  ? 114  PHE B CE1   1 
ATOM   2669  C  CE2   . PHE B 1  114  ? -38.009 27.593  131.856 1.00 66.67  ? 114  PHE B CE2   1 
ATOM   2670  C  CZ    . PHE B 1  114  ? -38.399 26.580  132.705 1.00 61.83  ? 114  PHE B CZ    1 
ATOM   2671  N  N     . LEU B 1  115  ? -39.411 32.191  136.728 1.00 83.95  ? 115  LEU B N     1 
ATOM   2672  C  CA    . LEU B 1  115  ? -39.285 33.208  137.762 1.00 79.46  ? 115  LEU B CA    1 
ATOM   2673  C  C     . LEU B 1  115  ? -37.814 33.505  138.023 1.00 76.24  ? 115  LEU B C     1 
ATOM   2674  O  O     . LEU B 1  115  ? -37.042 32.574  138.305 1.00 81.06  ? 115  LEU B O     1 
ATOM   2675  C  CB    . LEU B 1  115  ? -39.977 32.758  139.045 1.00 81.10  ? 115  LEU B CB    1 
ATOM   2676  C  CG    . LEU B 1  115  ? -41.504 32.850  139.019 1.00 73.93  ? 115  LEU B CG    1 
ATOM   2677  C  CD1   . LEU B 1  115  ? -42.093 32.354  140.327 1.00 76.88  ? 115  LEU B CD1   1 
ATOM   2678  C  CD2   . LEU B 1  115  ? -41.947 34.277  138.732 1.00 53.27  ? 115  LEU B CD2   1 
ATOM   2679  N  N     . PRO B 1  116  ? -37.385 34.766  137.936 1.00 73.61  ? 116  PRO B N     1 
ATOM   2680  C  CA    . PRO B 1  116  ? -35.952 35.074  138.043 1.00 79.68  ? 116  PRO B CA    1 
ATOM   2681  C  C     . PRO B 1  116  ? -35.380 34.708  139.406 1.00 75.01  ? 116  PRO B C     1 
ATOM   2682  O  O     . PRO B 1  116  ? -36.057 34.784  140.434 1.00 76.89  ? 116  PRO B O     1 
ATOM   2683  C  CB    . PRO B 1  116  ? -35.896 36.589  137.805 1.00 65.26  ? 116  PRO B CB    1 
ATOM   2684  C  CG    . PRO B 1  116  ? -37.164 36.915  137.088 1.00 62.56  ? 116  PRO B CG    1 
ATOM   2685  C  CD    . PRO B 1  116  ? -38.188 35.956  137.617 1.00 64.81  ? 116  PRO B CD    1 
ATOM   2686  N  N     . VAL B 1  117  ? -34.111 34.299  139.400 1.00 63.43  ? 117  VAL B N     1 
ATOM   2687  C  CA    . VAL B 1  117  ? -33.390 33.928  140.610 1.00 73.51  ? 117  VAL B CA    1 
ATOM   2688  C  C     . VAL B 1  117  ? -32.118 34.761  140.690 1.00 79.01  ? 117  VAL B C     1 
ATOM   2689  O  O     . VAL B 1  117  ? -31.533 35.140  139.670 1.00 70.94  ? 117  VAL B O     1 
ATOM   2690  C  CB    . VAL B 1  117  ? -33.072 32.416  140.647 1.00 73.93  ? 117  VAL B CB    1 
ATOM   2691  C  CG1   . VAL B 1  117  ? -32.392 32.036  141.959 1.00 67.79  ? 117  VAL B CG1   1 
ATOM   2692  C  CG2   . VAL B 1  117  ? -34.350 31.606  140.450 1.00 69.81  ? 117  VAL B CG2   1 
ATOM   2693  N  N     . ALA B 1  118  ? -31.706 35.068  141.921 1.00 88.53  ? 118  ALA B N     1 
ATOM   2694  C  CA    . ALA B 1  118  ? -30.544 35.916  142.146 1.00 85.33  ? 118  ALA B CA    1 
ATOM   2695  C  C     . ALA B 1  118  ? -29.292 35.296  141.539 1.00 88.28  ? 118  ALA B C     1 
ATOM   2696  O  O     . ALA B 1  118  ? -28.949 34.147  141.833 1.00 88.99  ? 118  ALA B O     1 
ATOM   2697  C  CB    . ALA B 1  118  ? -30.349 36.148  143.644 1.00 90.58  ? 118  ALA B CB    1 
ATOM   2698  N  N     . ASP B 1  119  ? -28.617 36.070  140.682 1.00 92.80  ? 119  ASP B N     1 
ATOM   2699  C  CA    . ASP B 1  119  ? -27.359 35.665  140.047 1.00 95.24  ? 119  ASP B CA    1 
ATOM   2700  C  C     . ASP B 1  119  ? -27.550 34.449  139.139 1.00 89.33  ? 119  ASP B C     1 
ATOM   2701  O  O     . ASP B 1  119  ? -26.709 33.548  139.093 1.00 88.00  ? 119  ASP B O     1 
ATOM   2702  C  CB    . ASP B 1  119  ? -26.268 35.401  141.091 1.00 99.55  ? 119  ASP B CB    1 
ATOM   2703  C  CG    . ASP B 1  119  ? -25.884 36.649  141.866 1.00 94.87  ? 119  ASP B CG    1 
ATOM   2704  O  OD1   . ASP B 1  119  ? -25.994 37.758  141.302 1.00 86.75  ? 119  ASP B OD1   1 
ATOM   2705  O  OD2   . ASP B 1  119  ? -25.470 36.518  143.038 1.00 94.42  ? 119  ASP B OD2   1 
ATOM   2706  N  N     . VAL B 1  120  ? -28.660 34.427  138.402 1.00 84.81  ? 120  VAL B N     1 
ATOM   2707  C  CA    . VAL B 1  120  ? -28.954 33.377  137.429 1.00 77.18  ? 120  VAL B CA    1 
ATOM   2708  C  C     . VAL B 1  120  ? -29.442 34.060  136.159 1.00 74.26  ? 120  VAL B C     1 
ATOM   2709  O  O     . VAL B 1  120  ? -30.519 34.670  136.154 1.00 72.77  ? 120  VAL B O     1 
ATOM   2710  C  CB    . VAL B 1  120  ? -30.004 32.379  137.941 1.00 70.44  ? 120  VAL B CB    1 
ATOM   2711  C  CG1   . VAL B 1  120  ? -30.451 31.459  136.820 1.00 61.83  ? 120  VAL B CG1   1 
ATOM   2712  C  CG2   . VAL B 1  120  ? -29.452 31.568  139.101 1.00 75.71  ? 120  VAL B CG2   1 
ATOM   2713  N  N     . GLU B 1  121  ? -28.666 33.951  135.083 1.00 78.70  ? 121  GLU B N     1 
ATOM   2714  C  CA    . GLU B 1  121  ? -28.987 34.589  133.815 1.00 74.97  ? 121  GLU B CA    1 
ATOM   2715  C  C     . GLU B 1  121  ? -29.469 33.542  132.820 1.00 73.87  ? 121  GLU B C     1 
ATOM   2716  O  O     . GLU B 1  121  ? -28.943 32.424  132.778 1.00 74.58  ? 121  GLU B O     1 
ATOM   2717  C  CB    . GLU B 1  121  ? -27.768 35.324  133.253 1.00 76.41  ? 121  GLU B CB    1 
ATOM   2718  C  CG    . GLU B 1  121  ? -28.008 36.057  131.945 1.00 76.17  ? 121  GLU B CG    1 
ATOM   2719  C  CD    . GLU B 1  121  ? -26.733 36.646  131.378 1.00 89.10  ? 121  GLU B CD    1 
ATOM   2720  O  OE1   . GLU B 1  121  ? -26.788 37.278  130.302 1.00 92.66  ? 121  GLU B OE1   1 
ATOM   2721  O  OE2   . GLU B 1  121  ? -25.671 36.473  132.012 1.00 92.32  ? 121  GLU B OE2   1 
ATOM   2722  N  N     . ILE B 1  122  ? -30.475 33.904  132.029 1.00 66.70  ? 122  ILE B N     1 
ATOM   2723  C  CA    . ILE B 1  122  ? -30.999 33.049  130.972 1.00 64.92  ? 122  ILE B CA    1 
ATOM   2724  C  C     . ILE B 1  122  ? -30.606 33.680  129.643 1.00 68.63  ? 122  ILE B C     1 
ATOM   2725  O  O     . ILE B 1  122  ? -31.124 34.739  129.268 1.00 66.81  ? 122  ILE B O     1 
ATOM   2726  C  CB    . ILE B 1  122  ? -32.517 32.862  131.086 1.00 62.81  ? 122  ILE B CB    1 
ATOM   2727  C  CG1   . ILE B 1  122  ? -32.846 32.036  132.331 1.00 59.70  ? 122  ILE B CG1   1 
ATOM   2728  C  CG2   . ILE B 1  122  ? -33.069 32.184  129.843 1.00 71.64  ? 122  ILE B CG2   1 
ATOM   2729  C  CD1   . ILE B 1  122  ? -34.314 31.725  132.488 1.00 73.63  ? 122  ILE B CD1   1 
ATOM   2730  N  N     . MET B 1  123  ? -29.683 33.027  128.931 1.00 70.38  ? 123  MET B N     1 
ATOM   2731  C  CA    . MET B 1  123  ? -29.149 33.598  127.700 1.00 65.22  ? 123  MET B CA    1 
ATOM   2732  C  C     . MET B 1  123  ? -30.189 33.629  126.588 1.00 69.96  ? 123  MET B C     1 
ATOM   2733  O  O     . MET B 1  123  ? -30.193 34.559  125.773 1.00 73.28  ? 123  MET B O     1 
ATOM   2734  C  CB    . MET B 1  123  ? -27.922 32.809  127.238 1.00 65.81  ? 123  MET B CB    1 
ATOM   2735  C  CG    . MET B 1  123  ? -26.771 32.759  128.232 1.00 71.80  ? 123  MET B CG    1 
ATOM   2736  S  SD    . MET B 1  123  ? -25.927 34.329  128.498 1.00 84.89  ? 123  MET B SD    1 
ATOM   2737  C  CE    . MET B 1  123  ? -25.187 34.576  126.884 1.00 79.56  ? 123  MET B CE    1 
ATOM   2738  N  N     . ASN B 1  124  ? -31.078 32.633  126.538 1.00 71.57  ? 124  ASN B N     1 
ATOM   2739  C  CA    . ASN B 1  124  ? -32.009 32.440  125.428 1.00 73.88  ? 124  ASN B CA    1 
ATOM   2740  C  C     . ASN B 1  124  ? -33.444 32.499  125.943 1.00 75.47  ? 124  ASN B C     1 
ATOM   2741  O  O     . ASN B 1  124  ? -34.113 31.462  126.063 1.00 80.16  ? 124  ASN B O     1 
ATOM   2742  C  CB    . ASN B 1  124  ? -31.738 31.115  124.717 1.00 67.78  ? 124  ASN B CB    1 
ATOM   2743  C  CG    . ASN B 1  124  ? -31.566 29.955  125.686 1.00 64.99  ? 124  ASN B CG    1 
ATOM   2744  O  OD1   . ASN B 1  124  ? -31.094 30.133  126.811 1.00 66.89  ? 124  ASN B OD1   1 
ATOM   2745  N  ND2   . ASN B 1  124  ? -31.950 28.760  125.252 1.00 57.56  ? 124  ASN B ND2   1 
ATOM   2746  N  N     . PRO B 1  125  ? -33.960 33.698  126.233 1.00 77.65  ? 125  PRO B N     1 
ATOM   2747  C  CA    . PRO B 1  125  ? -35.329 33.795  126.766 1.00 85.10  ? 125  PRO B CA    1 
ATOM   2748  C  C     . PRO B 1  125  ? -36.407 33.469  125.743 1.00 81.90  ? 125  PRO B C     1 
ATOM   2749  O  O     . PRO B 1  125  ? -37.528 33.121  126.139 1.00 78.37  ? 125  PRO B O     1 
ATOM   2750  C  CB    . PRO B 1  125  ? -35.418 35.254  127.231 1.00 90.12  ? 125  PRO B CB    1 
ATOM   2751  C  CG    . PRO B 1  125  ? -34.463 35.980  126.337 1.00 75.64  ? 125  PRO B CG    1 
ATOM   2752  C  CD    . PRO B 1  125  ? -33.332 35.022  126.070 1.00 76.60  ? 125  PRO B CD    1 
ATOM   2753  N  N     . ASP B 1  126  ? -36.106 33.561  124.450 1.00 79.33  ? 126  ASP B N     1 
ATOM   2754  C  CA    . ASP B 1  126  ? -37.070 33.276  123.395 1.00 79.81  ? 126  ASP B CA    1 
ATOM   2755  C  C     . ASP B 1  126  ? -37.158 31.794  123.059 1.00 76.37  ? 126  ASP B C     1 
ATOM   2756  O  O     . ASP B 1  126  ? -37.913 31.424  122.153 1.00 72.50  ? 126  ASP B O     1 
ATOM   2757  C  CB    . ASP B 1  126  ? -36.716 34.072  122.135 1.00 82.24  ? 126  ASP B CB    1 
ATOM   2758  C  CG    . ASP B 1  126  ? -36.916 35.563  122.315 1.00 88.90  ? 126  ASP B CG    1 
ATOM   2759  O  OD1   . ASP B 1  126  ? -36.608 36.073  123.413 1.00 95.59  ? 126  ASP B OD1   1 
ATOM   2760  O  OD2   . ASP B 1  126  ? -37.399 36.223  121.369 1.00 85.77  ? 126  ASP B OD2   1 
ATOM   2761  N  N     . LEU B 1  127  ? -36.408 30.944  123.761 1.00 72.87  ? 127  LEU B N     1 
ATOM   2762  C  CA    . LEU B 1  127  ? -36.476 29.507  123.528 1.00 67.56  ? 127  LEU B CA    1 
ATOM   2763  C  C     . LEU B 1  127  ? -37.856 28.976  123.887 1.00 61.52  ? 127  LEU B C     1 
ATOM   2764  O  O     . LEU B 1  127  ? -38.351 29.194  124.996 1.00 65.18  ? 127  LEU B O     1 
ATOM   2765  C  CB    . LEU B 1  127  ? -35.407 28.786  124.350 1.00 67.23  ? 127  LEU B CB    1 
ATOM   2766  C  CG    . LEU B 1  127  ? -35.486 27.257  124.355 1.00 60.10  ? 127  LEU B CG    1 
ATOM   2767  C  CD1   . LEU B 1  127  ? -35.165 26.694  122.978 1.00 65.18  ? 127  LEU B CD1   1 
ATOM   2768  C  CD2   . LEU B 1  127  ? -34.569 26.658  125.410 1.00 53.49  ? 127  LEU B CD2   1 
ATOM   2769  N  N     . HIS B 1  128  ? -38.469 28.265  122.949 1.00 57.34  ? 128  HIS B N     1 
ATOM   2770  C  CA    . HIS B 1  128  ? -39.818 27.761  123.149 1.00 63.67  ? 128  HIS B CA    1 
ATOM   2771  C  C     . HIS B 1  128  ? -39.808 26.572  124.103 1.00 64.78  ? 128  HIS B C     1 
ATOM   2772  O  O     . HIS B 1  128  ? -39.074 25.601  123.888 1.00 60.59  ? 128  HIS B O     1 
ATOM   2773  C  CB    . HIS B 1  128  ? -40.437 27.358  121.813 1.00 63.51  ? 128  HIS B CB    1 
ATOM   2774  C  CG    . HIS B 1  128  ? -41.808 26.773  121.941 1.00 63.93  ? 128  HIS B CG    1 
ATOM   2775  N  ND1   . HIS B 1  128  ? -42.922 27.543  122.193 1.00 67.01  ? 128  HIS B ND1   1 
ATOM   2776  C  CD2   . HIS B 1  128  ? -42.243 25.493  121.868 1.00 64.94  ? 128  HIS B CD2   1 
ATOM   2777  C  CE1   . HIS B 1  128  ? -43.985 26.763  122.264 1.00 71.28  ? 128  HIS B CE1   1 
ATOM   2778  N  NE2   . HIS B 1  128  ? -43.602 25.515  122.070 1.00 62.56  ? 128  HIS B NE2   1 
ATOM   2779  N  N     . ILE B 1  129  ? -40.625 26.651  125.157 1.00 66.01  ? 129  ILE B N     1 
ATOM   2780  C  CA    . ILE B 1  129  ? -40.807 25.527  126.073 1.00 61.42  ? 129  ILE B CA    1 
ATOM   2781  C  C     . ILE B 1  129  ? -42.062 24.757  125.680 1.00 65.30  ? 129  ILE B C     1 
ATOM   2782  O  O     . ILE B 1  129  ? -41.994 23.555  125.396 1.00 67.24  ? 129  ILE B O     1 
ATOM   2783  C  CB    . ILE B 1  129  ? -40.874 25.973  127.547 1.00 57.67  ? 129  ILE B CB    1 
ATOM   2784  C  CG1   . ILE B 1  129  ? -39.472 26.125  128.136 1.00 54.23  ? 129  ILE B CG1   1 
ATOM   2785  C  CG2   . ILE B 1  129  ? -41.639 24.958  128.383 1.00 66.96  ? 129  ILE B CG2   1 
ATOM   2786  C  CD1   . ILE B 1  129  ? -38.714 27.316  127.635 1.00 63.90  ? 129  ILE B CD1   1 
ATOM   2787  N  N     . ALA B 1  130  ? -43.215 25.426  125.645 1.00 62.99  ? 130  ALA B N     1 
ATOM   2788  C  CA    . ALA B 1  130  ? -44.438 24.669  125.391 1.00 66.71  ? 130  ALA B CA    1 
ATOM   2789  C  C     . ALA B 1  130  ? -45.555 25.596  124.929 1.00 75.33  ? 130  ALA B C     1 
ATOM   2790  O  O     . ALA B 1  130  ? -45.435 26.820  124.983 1.00 76.51  ? 130  ALA B O     1 
ATOM   2791  C  CB    . ALA B 1  130  ? -44.874 23.879  126.634 1.00 64.85  ? 130  ALA B CB    1 
ATOM   2792  N  N     . THR B 1  131  ? -46.632 24.985  124.437 1.00 75.70  ? 131  THR B N     1 
ATOM   2793  C  CA    . THR B 1  131  ? -47.869 25.684  124.112 1.00 75.83  ? 131  THR B CA    1 
ATOM   2794  C  C     . THR B 1  131  ? -49.006 25.106  124.944 1.00 84.66  ? 131  THR B C     1 
ATOM   2795  O  O     . THR B 1  131  ? -49.094 23.888  125.142 1.00 80.11  ? 131  THR B O     1 
ATOM   2796  C  CB    . THR B 1  131  ? -48.217 25.580  122.617 1.00 77.48  ? 131  THR B CB    1 
ATOM   2797  O  OG1   . THR B 1  131  ? -48.249 24.204  122.220 1.00 87.08  ? 131  THR B OG1   1 
ATOM   2798  C  CG2   . THR B 1  131  ? -47.203 26.332  121.763 1.00 70.07  ? 131  THR B CG2   1 
ATOM   2799  N  N     . LEU B 1  132  ? -49.888 25.982  125.416 1.00 84.67  ? 132  LEU B N     1 
ATOM   2800  C  CA    . LEU B 1  132  ? -50.996 25.599  126.275 1.00 81.22  ? 132  LEU B CA    1 
ATOM   2801  C  C     . LEU B 1  132  ? -52.298 26.130  125.699 1.00 83.31  ? 132  LEU B C     1 
ATOM   2802  O  O     . LEU B 1  132  ? -52.394 27.311  125.341 1.00 83.71  ? 132  LEU B O     1 
ATOM   2803  C  CB    . LEU B 1  132  ? -50.809 26.129  127.699 1.00 88.03  ? 132  LEU B CB    1 
ATOM   2804  C  CG    . LEU B 1  132  ? -49.866 25.374  128.634 1.00 83.96  ? 132  LEU B CG    1 
ATOM   2805  C  CD1   . LEU B 1  132  ? -48.425 25.774  128.391 1.00 73.41  ? 132  LEU B CD1   1 
ATOM   2806  C  CD2   . LEU B 1  132  ? -50.270 25.622  130.081 1.00 95.69  ? 132  LEU B CD2   1 
ATOM   2807  N  N     . GLU B 1  133  ? -53.301 25.258  125.648 1.00 81.51  ? 133  GLU B N     1 
ATOM   2808  C  CA    . GLU B 1  133  ? -54.622 25.568  125.124 1.00 86.40  ? 133  GLU B CA    1 
ATOM   2809  C  C     . GLU B 1  133  ? -55.521 26.069  126.257 1.00 91.98  ? 133  GLU B C     1 
ATOM   2810  O  O     . GLU B 1  133  ? -55.070 26.321  127.378 1.00 94.52  ? 133  GLU B O     1 
ATOM   2811  C  CB    . GLU B 1  133  ? -55.214 24.335  124.439 1.00 86.03  ? 133  GLU B CB    1 
ATOM   2812  C  CG    . GLU B 1  133  ? -54.251 23.622  123.503 1.00 88.97  ? 133  GLU B CG    1 
ATOM   2813  C  CD    . GLU B 1  133  ? -54.371 22.109  123.585 1.00 85.69  ? 133  GLU B CD    1 
ATOM   2814  O  OE1   . GLU B 1  133  ? -54.986 21.618  124.553 1.00 85.23  ? 133  GLU B OE1   1 
ATOM   2815  O  OE2   . GLU B 1  133  ? -53.851 21.411  122.687 1.00 82.79  ? 133  GLU B OE2   1 
ATOM   2816  N  N     . GLU B 1  134  ? -56.812 26.220  125.971 1.00 92.42  ? 134  GLU B N     1 
ATOM   2817  C  CA    . GLU B 1  134  ? -57.770 26.599  127.001 1.00 90.78  ? 134  GLU B CA    1 
ATOM   2818  C  C     . GLU B 1  134  ? -57.956 25.455  127.990 1.00 93.54  ? 134  GLU B C     1 
ATOM   2819  O  O     . GLU B 1  134  ? -58.272 24.327  127.599 1.00 95.44  ? 134  GLU B O     1 
ATOM   2820  C  CB    . GLU B 1  134  ? -59.108 26.968  126.366 1.00 102.00 ? 134  GLU B CB    1 
ATOM   2821  C  CG    . GLU B 1  134  ? -59.054 28.140  125.394 1.00 104.35 ? 134  GLU B CG    1 
ATOM   2822  C  CD    . GLU B 1  134  ? -59.092 29.488  126.092 1.00 111.48 ? 134  GLU B CD    1 
ATOM   2823  O  OE1   . GLU B 1  134  ? -58.991 30.520  125.395 1.00 101.18 ? 134  GLU B OE1   1 
ATOM   2824  O  OE2   . GLU B 1  134  ? -59.229 29.519  127.335 1.00 114.30 ? 134  GLU B OE2   1 
ATOM   2825  N  N     . GLY B 1  135  ? -57.761 25.748  129.276 1.00 98.46  ? 135  GLY B N     1 
ATOM   2826  C  CA    . GLY B 1  135  ? -57.871 24.757  130.322 1.00 98.38  ? 135  GLY B CA    1 
ATOM   2827  C  C     . GLY B 1  135  ? -56.586 24.020  130.638 1.00 100.39 ? 135  GLY B C     1 
ATOM   2828  O  O     . GLY B 1  135  ? -56.501 23.374  131.688 1.00 112.33 ? 135  GLY B O     1 
ATOM   2829  N  N     . GLY B 1  136  ? -55.589 24.096  129.761 1.00 96.92  ? 136  GLY B N     1 
ATOM   2830  C  CA    . GLY B 1  136  ? -54.317 23.444  130.027 1.00 94.75  ? 136  GLY B CA    1 
ATOM   2831  C  C     . GLY B 1  136  ? -53.513 24.225  131.048 1.00 98.94  ? 136  GLY B C     1 
ATOM   2832  O  O     . GLY B 1  136  ? -53.395 25.454  130.961 1.00 88.49  ? 136  GLY B O     1 
ATOM   2833  N  N     . ARG B 1  137  ? -52.956 23.513  132.022 1.00 102.65 ? 137  ARG B N     1 
ATOM   2834  C  CA    . ARG B 1  137  ? -52.177 24.107  133.097 1.00 98.04  ? 137  ARG B CA    1 
ATOM   2835  C  C     . ARG B 1  137  ? -50.776 23.512  133.081 1.00 87.52  ? 137  ARG B C     1 
ATOM   2836  O  O     . ARG B 1  137  ? -50.601 22.327  132.777 1.00 81.79  ? 137  ARG B O     1 
ATOM   2837  C  CB    . ARG B 1  137  ? -52.850 23.867  134.457 1.00 99.46  ? 137  ARG B CB    1 
ATOM   2838  C  CG    . ARG B 1  137  ? -54.276 24.398  134.541 1.00 107.26 ? 137  ARG B CG    1 
ATOM   2839  C  CD    . ARG B 1  137  ? -55.014 23.843  135.749 1.00 123.50 ? 137  ARG B CD    1 
ATOM   2840  N  NE    . ARG B 1  137  ? -54.376 24.215  137.009 1.00 131.95 ? 137  ARG B NE    1 
ATOM   2841  C  CZ    . ARG B 1  137  ? -54.727 25.265  137.744 1.00 127.91 ? 137  ARG B CZ    1 
ATOM   2842  N  NH1   . ARG B 1  137  ? -55.718 26.054  137.349 1.00 126.93 ? 137  ARG B NH1   1 
ATOM   2843  N  NH2   . ARG B 1  137  ? -54.089 25.526  138.877 1.00 117.98 ? 137  ARG B NH2   1 
ATOM   2844  N  N     . LEU B 1  138  ? -49.777 24.334  133.406 1.00 81.88  ? 138  LEU B N     1 
ATOM   2845  C  CA    . LEU B 1  138  ? -48.381 23.911  133.412 1.00 79.61  ? 138  LEU B CA    1 
ATOM   2846  C  C     . LEU B 1  138  ? -47.724 24.416  134.690 1.00 79.11  ? 138  LEU B C     1 
ATOM   2847  O  O     . LEU B 1  138  ? -47.528 25.625  134.863 1.00 79.00  ? 138  LEU B O     1 
ATOM   2848  C  CB    . LEU B 1  138  ? -47.643 24.428  132.178 1.00 76.10  ? 138  LEU B CB    1 
ATOM   2849  C  CG    . LEU B 1  138  ? -46.208 23.932  132.003 1.00 64.16  ? 138  LEU B CG    1 
ATOM   2850  C  CD1   . LEU B 1  138  ? -46.185 22.423  131.824 1.00 67.03  ? 138  LEU B CD1   1 
ATOM   2851  C  CD2   . LEU B 1  138  ? -45.555 24.627  130.827 1.00 72.24  ? 138  LEU B CD2   1 
ATOM   2852  N  N     . ASN B 1  139  ? -47.384 23.487  135.577 1.00 71.46  ? 139  ASN B N     1 
ATOM   2853  C  CA    . ASN B 1  139  ? -46.683 23.775  136.822 1.00 71.43  ? 139  ASN B CA    1 
ATOM   2854  C  C     . ASN B 1  139  ? -45.461 22.869  136.845 1.00 79.21  ? 139  ASN B C     1 
ATOM   2855  O  O     . ASN B 1  139  ? -45.601 21.649  136.980 1.00 76.87  ? 139  ASN B O     1 
ATOM   2856  C  CB    . ASN B 1  139  ? -47.593 23.521  138.025 1.00 81.74  ? 139  ASN B CB    1 
ATOM   2857  C  CG    . ASN B 1  139  ? -47.007 24.024  139.334 1.00 90.82  ? 139  ASN B CG    1 
ATOM   2858  O  OD1   . ASN B 1  139  ? -45.792 24.025  139.535 1.00 96.99  ? 139  ASN B OD1   1 
ATOM   2859  N  ND2   . ASN B 1  139  ? -47.881 24.446  140.241 1.00 89.98  ? 139  ASN B ND2   1 
ATOM   2860  N  N     . MET B 1  140  ? -44.265 23.449  136.696 1.00 76.57  ? 140  MET B N     1 
ATOM   2861  C  CA    . MET B 1  140  ? -43.059 22.635  136.621 1.00 70.54  ? 140  MET B CA    1 
ATOM   2862  C  C     . MET B 1  140  ? -41.890 23.289  137.344 1.00 64.97  ? 140  MET B C     1 
ATOM   2863  O  O     . MET B 1  140  ? -41.715 24.511  137.311 1.00 60.89  ? 140  MET B O     1 
ATOM   2864  C  CB    . MET B 1  140  ? -42.666 22.340  135.163 1.00 76.09  ? 140  MET B CB    1 
ATOM   2865  C  CG    . MET B 1  140  ? -42.356 23.558  134.309 1.00 82.84  ? 140  MET B CG    1 
ATOM   2866  S  SD    . MET B 1  140  ? -41.441 23.091  132.823 1.00 78.85  ? 140  MET B SD    1 
ATOM   2867  C  CE    . MET B 1  140  ? -42.426 21.710  132.258 1.00 59.04  ? 140  MET B CE    1 
ATOM   2868  N  N     . GLU B 1  141  ? -41.086 22.446  137.986 1.00 66.83  ? 141  GLU B N     1 
ATOM   2869  C  CA    . GLU B 1  141  ? -39.851 22.843  138.648 1.00 69.36  ? 141  GLU B CA    1 
ATOM   2870  C  C     . GLU B 1  141  ? -38.693 22.125  137.969 1.00 66.44  ? 141  GLU B C     1 
ATOM   2871  O  O     . GLU B 1  141  ? -38.761 20.911  137.741 1.00 68.80  ? 141  GLU B O     1 
ATOM   2872  C  CB    . GLU B 1  141  ? -39.889 22.502  140.142 1.00 77.74  ? 141  GLU B CB    1 
ATOM   2873  C  CG    . GLU B 1  141  ? -41.093 23.066  140.890 1.00 81.37  ? 141  GLU B CG    1 
ATOM   2874  C  CD    . GLU B 1  141  ? -41.316 22.393  142.234 1.00 86.72  ? 141  GLU B CD    1 
ATOM   2875  O  OE1   . GLU B 1  141  ? -40.638 21.381  142.515 1.00 85.74  ? 141  GLU B OE1   1 
ATOM   2876  O  OE2   . GLU B 1  141  ? -42.171 22.875  143.008 1.00 91.02  ? 141  GLU B OE2   1 
ATOM   2877  N  N     . VAL B 1  142  ? -37.638 22.872  137.641 1.00 65.45  ? 142  VAL B N     1 
ATOM   2878  C  CA    . VAL B 1  142  ? -36.494 22.343  136.906 1.00 66.62  ? 142  VAL B CA    1 
ATOM   2879  C  C     . VAL B 1  142  ? -35.224 22.622  137.702 1.00 61.78  ? 142  VAL B C     1 
ATOM   2880  O  O     . VAL B 1  142  ? -34.970 23.762  138.106 1.00 59.77  ? 142  VAL B O     1 
ATOM   2881  C  CB    . VAL B 1  142  ? -36.399 22.932  135.483 1.00 60.17  ? 142  VAL B CB    1 
ATOM   2882  C  CG1   . VAL B 1  142  ? -37.549 22.418  134.624 1.00 58.08  ? 142  VAL B CG1   1 
ATOM   2883  C  CG2   . VAL B 1  142  ? -36.416 24.447  135.515 1.00 59.46  ? 142  VAL B CG2   1 
ATOM   2884  N  N     . ARG B 1  143  ? -34.436 21.576  137.930 1.00 60.16  ? 143  ARG B N     1 
ATOM   2885  C  CA    . ARG B 1  143  ? -33.207 21.669  138.708 1.00 56.89  ? 143  ARG B CA    1 
ATOM   2886  C  C     . ARG B 1  143  ? -32.032 21.912  137.767 1.00 59.63  ? 143  ARG B C     1 
ATOM   2887  O  O     . ARG B 1  143  ? -31.797 21.124  136.844 1.00 59.84  ? 143  ARG B O     1 
ATOM   2888  C  CB    . ARG B 1  143  ? -33.009 20.391  139.522 1.00 57.80  ? 143  ARG B CB    1 
ATOM   2889  C  CG    . ARG B 1  143  ? -31.607 20.186  140.047 1.00 58.47  ? 143  ARG B CG    1 
ATOM   2890  C  CD    . ARG B 1  143  ? -31.505 20.471  141.528 1.00 61.97  ? 143  ARG B CD    1 
ATOM   2891  N  NE    . ARG B 1  143  ? -30.201 20.085  142.062 1.00 58.92  ? 143  ARG B NE    1 
ATOM   2892  C  CZ    . ARG B 1  143  ? -29.923 18.886  142.562 1.00 55.30  ? 143  ARG B CZ    1 
ATOM   2893  N  NH1   . ARG B 1  143  ? -30.858 17.945  142.600 1.00 55.32  ? 143  ARG B NH1   1 
ATOM   2894  N  NH2   . ARG B 1  143  ? -28.709 18.628  143.028 1.00 52.48  ? 143  ARG B NH2   1 
ATOM   2895  N  N     . VAL B 1  144  ? -31.302 23.001  137.995 1.00 57.54  ? 144  VAL B N     1 
ATOM   2896  C  CA    . VAL B 1  144  ? -30.193 23.409  137.141 1.00 55.76  ? 144  VAL B CA    1 
ATOM   2897  C  C     . VAL B 1  144  ? -28.921 23.354  137.976 1.00 55.72  ? 144  VAL B C     1 
ATOM   2898  O  O     . VAL B 1  144  ? -28.760 24.133  138.924 1.00 53.18  ? 144  VAL B O     1 
ATOM   2899  C  CB    . VAL B 1  144  ? -30.407 24.811  136.556 1.00 52.46  ? 144  VAL B CB    1 
ATOM   2900  C  CG1   . VAL B 1  144  ? -29.164 25.278  135.827 1.00 53.33  ? 144  VAL B CG1   1 
ATOM   2901  C  CG2   . VAL B 1  144  ? -31.600 24.812  135.616 1.00 48.11  ? 144  VAL B CG2   1 
ATOM   2902  N  N     . ASP B 1  145  ? -28.012 22.453  137.617 1.00 57.88  ? 145  ASP B N     1 
ATOM   2903  C  CA    . ASP B 1  145  ? -26.767 22.256  138.343 1.00 58.01  ? 145  ASP B CA    1 
ATOM   2904  C  C     . ASP B 1  145  ? -25.570 22.697  137.510 1.00 56.27  ? 145  ASP B C     1 
ATOM   2905  O  O     . ASP B 1  145  ? -25.633 22.792  136.281 1.00 57.33  ? 145  ASP B O     1 
ATOM   2906  C  CB    . ASP B 1  145  ? -26.593 20.788  138.749 1.00 55.58  ? 145  ASP B CB    1 
ATOM   2907  C  CG    . ASP B 1  145  ? -27.293 20.457  140.049 1.00 60.90  ? 145  ASP B CG    1 
ATOM   2908  O  OD1   . ASP B 1  145  ? -28.487 20.098  140.001 1.00 63.99  ? 145  ASP B OD1   1 
ATOM   2909  O  OD2   . ASP B 1  145  ? -26.649 20.557  141.117 1.00 61.94  ? 145  ASP B OD2   1 
ATOM   2910  N  N     . ARG B 1  146  ? -24.470 22.967  138.208 1.00 60.89  ? 146  ARG B N     1 
ATOM   2911  C  CA    . ARG B 1  146  ? -23.188 23.237  137.577 1.00 58.32  ? 146  ARG B CA    1 
ATOM   2912  C  C     . ARG B 1  146  ? -22.387 21.946  137.462 1.00 53.89  ? 146  ARG B C     1 
ATOM   2913  O  O     . ARG B 1  146  ? -22.351 21.136  138.393 1.00 56.23  ? 146  ARG B O     1 
ATOM   2914  C  CB    . ARG B 1  146  ? -22.407 24.279  138.379 1.00 59.48  ? 146  ARG B CB    1 
ATOM   2915  C  CG    . ARG B 1  146  ? -20.965 24.452  137.948 1.00 61.18  ? 146  ARG B CG    1 
ATOM   2916  C  CD    . ARG B 1  146  ? -20.599 25.921  137.865 1.00 73.91  ? 146  ARG B CD    1 
ATOM   2917  N  NE    . ARG B 1  146  ? -20.718 26.596  139.153 1.00 72.39  ? 146  ARG B NE    1 
ATOM   2918  C  CZ    . ARG B 1  146  ? -20.554 27.903  139.327 1.00 76.87  ? 146  ARG B CZ    1 
ATOM   2919  N  NH1   . ARG B 1  146  ? -20.268 28.683  138.293 1.00 76.69  ? 146  ARG B NH1   1 
ATOM   2920  N  NH2   . ARG B 1  146  ? -20.680 28.434  140.535 1.00 83.70  ? 146  ARG B NH2   1 
ATOM   2921  N  N     . GLY B 1  147  ? -21.751 21.757  136.315 1.00 54.54  ? 147  GLY B N     1 
ATOM   2922  C  CA    . GLY B 1  147  ? -20.967 20.559  136.103 1.00 52.34  ? 147  GLY B CA    1 
ATOM   2923  C  C     . GLY B 1  147  ? -20.206 20.632  134.799 1.00 52.44  ? 147  GLY B C     1 
ATOM   2924  O  O     . GLY B 1  147  ? -20.135 21.679  134.152 1.00 46.91  ? 147  GLY B O     1 
ATOM   2925  N  N     . VAL B 1  148  ? -19.629 19.494  134.421 1.00 49.22  ? 148  VAL B N     1 
ATOM   2926  C  CA    . VAL B 1  148  ? -18.841 19.389  133.201 1.00 51.26  ? 148  VAL B CA    1 
ATOM   2927  C  C     . VAL B 1  148  ? -19.209 18.096  132.487 1.00 50.26  ? 148  VAL B C     1 
ATOM   2928  O  O     . VAL B 1  148  ? -19.569 17.096  133.115 1.00 49.63  ? 148  VAL B O     1 
ATOM   2929  C  CB    . VAL B 1  148  ? -17.319 19.444  133.482 1.00 44.08  ? 148  VAL B CB    1 
ATOM   2930  C  CG1   . VAL B 1  148  ? -16.902 20.831  133.928 1.00 44.23  ? 148  VAL B CG1   1 
ATOM   2931  C  CG2   . VAL B 1  148  ? -16.927 18.414  134.526 1.00 38.78  ? 148  VAL B CG2   1 
ATOM   2932  N  N     . GLY B 1  149  ? -19.125 18.127  131.159 1.00 44.72  ? 149  GLY B N     1 
ATOM   2933  C  CA    . GLY B 1  149  ? -19.306 16.929  130.365 1.00 43.60  ? 149  GLY B CA    1 
ATOM   2934  C  C     . GLY B 1  149  ? -20.743 16.618  130.005 1.00 44.37  ? 149  GLY B C     1 
ATOM   2935  O  O     . GLY B 1  149  ? -21.570 17.522  129.854 1.00 47.85  ? 149  GLY B O     1 
ATOM   2936  N  N     . TYR B 1  150  ? -21.050 15.332  129.863 1.00 43.21  ? 150  TYR B N     1 
ATOM   2937  C  CA    . TYR B 1  150  ? -22.386 14.881  129.495 1.00 42.43  ? 150  TYR B CA    1 
ATOM   2938  C  C     . TYR B 1  150  ? -22.747 13.693  130.371 1.00 44.77  ? 150  TYR B C     1 
ATOM   2939  O  O     . TYR B 1  150  ? -22.064 12.664  130.340 1.00 43.74  ? 150  TYR B O     1 
ATOM   2940  C  CB    . TYR B 1  150  ? -22.452 14.504  128.013 1.00 38.45  ? 150  TYR B CB    1 
ATOM   2941  C  CG    . TYR B 1  150  ? -23.829 14.107  127.541 1.00 37.23  ? 150  TYR B CG    1 
ATOM   2942  C  CD1   . TYR B 1  150  ? -24.728 15.062  127.097 1.00 37.58  ? 150  TYR B CD1   1 
ATOM   2943  C  CD2   . TYR B 1  150  ? -24.227 12.778  127.536 1.00 36.78  ? 150  TYR B CD2   1 
ATOM   2944  C  CE1   . TYR B 1  150  ? -25.984 14.708  126.665 1.00 35.66  ? 150  TYR B CE1   1 
ATOM   2945  C  CE2   . TYR B 1  150  ? -25.483 12.412  127.105 1.00 35.64  ? 150  TYR B CE2   1 
ATOM   2946  C  CZ    . TYR B 1  150  ? -26.358 13.384  126.669 1.00 38.26  ? 150  TYR B CZ    1 
ATOM   2947  O  OH    . TYR B 1  150  ? -27.616 13.037  126.234 1.00 44.19  ? 150  TYR B OH    1 
ATOM   2948  N  N     . VAL B 1  151  ? -23.810 13.835  131.152 1.00 47.25  ? 151  VAL B N     1 
ATOM   2949  C  CA    . VAL B 1  151  ? -24.234 12.814  132.099 1.00 47.94  ? 151  VAL B CA    1 
ATOM   2950  C  C     . VAL B 1  151  ? -25.620 12.333  131.690 1.00 49.18  ? 151  VAL B C     1 
ATOM   2951  O  O     . VAL B 1  151  ? -26.576 13.115  131.714 1.00 46.35  ? 151  VAL B O     1 
ATOM   2952  C  CB    . VAL B 1  151  ? -24.248 13.338  133.545 1.00 43.67  ? 151  VAL B CB    1 
ATOM   2953  C  CG1   . VAL B 1  151  ? -24.519 12.201  134.515 1.00 45.01  ? 151  VAL B CG1   1 
ATOM   2954  C  CG2   . VAL B 1  151  ? -22.933 14.033  133.870 1.00 36.38  ? 151  VAL B CG2   1 
ATOM   2955  N  N     . PRO B 1  152  ? -25.779 11.069  131.296 1.00 48.06  ? 152  PRO B N     1 
ATOM   2956  C  CA    . PRO B 1  152  ? -27.121 10.541  131.033 1.00 46.38  ? 152  PRO B CA    1 
ATOM   2957  C  C     . PRO B 1  152  ? -28.003 10.670  132.265 1.00 48.45  ? 152  PRO B C     1 
ATOM   2958  O  O     . PRO B 1  152  ? -27.526 10.807  133.393 1.00 46.83  ? 152  PRO B O     1 
ATOM   2959  C  CB    . PRO B 1  152  ? -26.865 9.069   130.680 1.00 45.18  ? 152  PRO B CB    1 
ATOM   2960  C  CG    . PRO B 1  152  ? -25.445 9.022   130.234 1.00 43.18  ? 152  PRO B CG    1 
ATOM   2961  C  CD    . PRO B 1  152  ? -24.724 10.078  131.022 1.00 42.61  ? 152  PRO B CD    1 
ATOM   2962  N  N     . ALA B 1  153  ? -29.318 10.632  132.030 1.00 53.82  ? 153  ALA B N     1 
ATOM   2963  C  CA    . ALA B 1  153  ? -30.270 10.792  133.126 1.00 50.38  ? 153  ALA B CA    1 
ATOM   2964  C  C     . ALA B 1  153  ? -30.103 9.696   134.174 1.00 52.71  ? 153  ALA B C     1 
ATOM   2965  O  O     . ALA B 1  153  ? -30.089 9.977   135.379 1.00 60.15  ? 153  ALA B O     1 
ATOM   2966  C  CB    . ALA B 1  153  ? -31.700 10.806  132.581 1.00 48.93  ? 153  ALA B CB    1 
ATOM   2967  N  N     . GLU B 1  154  ? -29.952 8.446   133.736 1.00 47.15  ? 154  GLU B N     1 
ATOM   2968  C  CA    . GLU B 1  154  ? -29.895 7.302   134.637 1.00 46.51  ? 154  GLU B CA    1 
ATOM   2969  C  C     . GLU B 1  154  ? -28.537 7.115   135.301 1.00 44.46  ? 154  GLU B C     1 
ATOM   2970  O  O     . GLU B 1  154  ? -28.337 6.097   135.970 1.00 49.19  ? 154  GLU B O     1 
ATOM   2971  C  CB    . GLU B 1  154  ? -30.283 6.019   133.895 1.00 44.31  ? 154  GLU B CB    1 
ATOM   2972  C  CG    . GLU B 1  154  ? -29.860 5.967   132.436 1.00 57.29  ? 154  GLU B CG    1 
ATOM   2973  C  CD    . GLU B 1  154  ? -30.913 6.548   131.506 1.00 62.34  ? 154  GLU B CD    1 
ATOM   2974  O  OE1   . GLU B 1  154  ? -30.547 7.334   130.602 1.00 57.91  ? 154  GLU B OE1   1 
ATOM   2975  O  OE2   . GLU B 1  154  ? -32.108 6.220   131.688 1.00 59.44  ? 154  GLU B OE2   1 
ATOM   2976  N  N     . LYS B 1  155  ? -27.603 8.051   135.141 1.00 45.33  ? 155  LYS B N     1 
ATOM   2977  C  CA    . LYS B 1  155  ? -26.316 7.964   135.824 1.00 52.57  ? 155  LYS B CA    1 
ATOM   2978  C  C     . LYS B 1  155  ? -26.286 8.819   137.087 1.00 49.61  ? 155  LYS B C     1 
ATOM   2979  O  O     . LYS B 1  155  ? -26.010 8.307   138.175 1.00 54.35  ? 155  LYS B O     1 
ATOM   2980  C  CB    . LYS B 1  155  ? -25.179 8.354   134.872 1.00 52.58  ? 155  LYS B CB    1 
ATOM   2981  C  CG    . LYS B 1  155  ? -24.888 7.293   133.814 1.00 60.61  ? 155  LYS B CG    1 
ATOM   2982  C  CD    . LYS B 1  155  ? -24.693 5.922   134.455 1.00 61.32  ? 155  LYS B CD    1 
ATOM   2983  C  CE    . LYS B 1  155  ? -24.798 4.799   133.434 1.00 69.52  ? 155  LYS B CE    1 
ATOM   2984  N  NZ    . LYS B 1  155  ? -23.798 4.947   132.338 1.00 81.58  ? 155  LYS B NZ    1 
ATOM   2985  N  N     . HIS B 1  156  ? -26.561 10.120  136.966 1.00 47.71  ? 156  HIS B N     1 
ATOM   2986  C  CA    . HIS B 1  156  ? -26.739 10.928  138.168 1.00 54.53  ? 156  HIS B CA    1 
ATOM   2987  C  C     . HIS B 1  156  ? -28.003 10.511  138.915 1.00 68.01  ? 156  HIS B C     1 
ATOM   2988  O  O     . HIS B 1  156  ? -28.008 10.447  140.153 1.00 65.28  ? 156  HIS B O     1 
ATOM   2989  C  CB    . HIS B 1  156  ? -26.783 12.414  137.813 1.00 57.33  ? 156  HIS B CB    1 
ATOM   2990  C  CG    . HIS B 1  156  ? -27.966 12.800  136.979 1.00 60.11  ? 156  HIS B CG    1 
ATOM   2991  N  ND1   . HIS B 1  156  ? -29.176 13.169  137.527 1.00 63.06  ? 156  HIS B ND1   1 
ATOM   2992  C  CD2   . HIS B 1  156  ? -28.127 12.864  135.637 1.00 57.57  ? 156  HIS B CD2   1 
ATOM   2993  C  CE1   . HIS B 1  156  ? -30.030 13.446  136.558 1.00 53.74  ? 156  HIS B CE1   1 
ATOM   2994  N  NE2   . HIS B 1  156  ? -29.418 13.269  135.402 1.00 54.32  ? 156  HIS B NE2   1 
ATOM   2995  N  N     . GLY B 1  157  ? -29.079 10.217  138.173 1.00 69.34  ? 157  GLY B N     1 
ATOM   2996  C  CA    . GLY B 1  157  ? -30.322 9.678   138.703 1.00 65.79  ? 157  GLY B CA    1 
ATOM   2997  C  C     . GLY B 1  157  ? -30.854 10.370  139.940 1.00 68.31  ? 157  GLY B C     1 
ATOM   2998  O  O     . GLY B 1  157  ? -31.068 9.726   140.972 1.00 74.38  ? 157  GLY B O     1 
ATOM   2999  N  N     . ILE B 1  158  ? -31.077 11.678  139.852 1.00 64.26  ? 158  ILE B N     1 
ATOM   3000  C  CA    . ILE B 1  158  ? -31.419 12.490  141.012 1.00 64.75  ? 158  ILE B CA    1 
ATOM   3001  C  C     . ILE B 1  158  ? -32.905 12.821  140.986 1.00 72.56  ? 158  ILE B C     1 
ATOM   3002  O  O     . ILE B 1  158  ? -33.490 13.064  139.921 1.00 66.30  ? 158  ILE B O     1 
ATOM   3003  C  CB    . ILE B 1  158  ? -30.554 13.765  141.069 1.00 52.92  ? 158  ILE B CB    1 
ATOM   3004  C  CG1   . ILE B 1  158  ? -30.965 14.766  139.994 1.00 49.42  ? 158  ILE B CG1   1 
ATOM   3005  C  CG2   . ILE B 1  158  ? -29.084 13.412  140.898 1.00 52.37  ? 158  ILE B CG2   1 
ATOM   3006  C  CD1   . ILE B 1  158  ? -30.177 16.049  140.045 1.00 58.74  ? 158  ILE B CD1   1 
ATOM   3007  N  N     . LYS B 1  159  ? -33.524 12.803  142.164 1.00 74.88  ? 159  LYS B N     1 
ATOM   3008  C  CA    . LYS B 1  159  ? -34.935 13.122  142.320 1.00 62.71  ? 159  LYS B CA    1 
ATOM   3009  C  C     . LYS B 1  159  ? -35.112 13.955  143.578 1.00 71.68  ? 159  LYS B C     1 
ATOM   3010  O  O     . LYS B 1  159  ? -34.626 13.575  144.649 1.00 73.25  ? 159  LYS B O     1 
ATOM   3011  C  CB    . LYS B 1  159  ? -35.794 11.855  142.415 1.00 57.42  ? 159  LYS B CB    1 
ATOM   3012  C  CG    . LYS B 1  159  ? -35.915 11.049  141.140 1.00 50.37  ? 159  LYS B CG    1 
ATOM   3013  C  CD    . LYS B 1  159  ? -36.953 9.953   141.321 1.00 49.56  ? 159  LYS B CD    1 
ATOM   3014  C  CE    . LYS B 1  159  ? -37.195 9.186   140.036 1.00 68.18  ? 159  LYS B CE    1 
ATOM   3015  N  NZ    . LYS B 1  159  ? -35.967 8.486   139.569 1.00 75.39  ? 159  LYS B NZ    1 
ATOM   3016  N  N     . ASP B 1  160  ? -35.801 15.090  143.449 1.00 80.14  ? 160  ASP B N     1 
ATOM   3017  C  CA    . ASP B 1  160  ? -36.171 15.863  144.629 1.00 77.07  ? 160  ASP B CA    1 
ATOM   3018  C  C     . ASP B 1  160  ? -37.436 15.323  145.284 1.00 63.77  ? 160  ASP B C     1 
ATOM   3019  O  O     . ASP B 1  160  ? -37.557 15.367  146.513 1.00 71.86  ? 160  ASP B O     1 
ATOM   3020  C  CB    . ASP B 1  160  ? -36.355 17.338  144.265 1.00 77.15  ? 160  ASP B CB    1 
ATOM   3021  C  CG    . ASP B 1  160  ? -35.038 18.046  144.025 1.00 84.25  ? 160  ASP B CG    1 
ATOM   3022  O  OD1   . ASP B 1  160  ? -34.002 17.568  144.539 1.00 79.61  ? 160  ASP B OD1   1 
ATOM   3023  O  OD2   . ASP B 1  160  ? -35.040 19.084  143.327 1.00 85.28  ? 160  ASP B OD2   1 
ATOM   3024  N  N     . ARG B 1  161  ? -38.377 14.816  144.492 1.00 56.08  ? 161  ARG B N     1 
ATOM   3025  C  CA    . ARG B 1  161  ? -39.575 14.176  145.016 1.00 64.85  ? 161  ARG B CA    1 
ATOM   3026  C  C     . ARG B 1  161  ? -39.820 12.905  144.213 1.00 61.77  ? 161  ARG B C     1 
ATOM   3027  O  O     . ARG B 1  161  ? -38.997 12.499  143.389 1.00 70.51  ? 161  ARG B O     1 
ATOM   3028  C  CB    . ARG B 1  161  ? -40.776 15.130  144.983 1.00 66.88  ? 161  ARG B CB    1 
ATOM   3029  C  CG    . ARG B 1  161  ? -41.310 15.446  143.604 1.00 66.31  ? 161  ARG B CG    1 
ATOM   3030  C  CD    . ARG B 1  161  ? -42.310 16.588  143.688 1.00 69.28  ? 161  ARG B CD    1 
ATOM   3031  N  NE    . ARG B 1  161  ? -41.652 17.868  143.941 1.00 69.14  ? 161  ARG B NE    1 
ATOM   3032  C  CZ    . ARG B 1  161  ? -42.291 18.999  144.218 1.00 69.73  ? 161  ARG B CZ    1 
ATOM   3033  N  NH1   . ARG B 1  161  ? -43.615 19.014  144.291 1.00 74.82  ? 161  ARG B NH1   1 
ATOM   3034  N  NH2   . ARG B 1  161  ? -41.608 20.116  144.431 1.00 67.71  ? 161  ARG B NH2   1 
ATOM   3035  N  N     . ILE B 1  162  ? -40.968 12.269  144.454 1.00 63.83  ? 162  ILE B N     1 
ATOM   3036  C  CA    . ILE B 1  162  ? -41.203 10.942  143.895 1.00 67.01  ? 162  ILE B CA    1 
ATOM   3037  C  C     . ILE B 1  162  ? -41.498 11.012  142.401 1.00 71.57  ? 162  ILE B C     1 
ATOM   3038  O  O     . ILE B 1  162  ? -41.099 10.118  141.644 1.00 76.53  ? 162  ILE B O     1 
ATOM   3039  C  CB    . ILE B 1  162  ? -42.329 10.234  144.671 1.00 70.12  ? 162  ILE B CB    1 
ATOM   3040  C  CG1   . ILE B 1  162  ? -42.652 8.874   144.044 1.00 71.86  ? 162  ILE B CG1   1 
ATOM   3041  C  CG2   . ILE B 1  162  ? -43.567 11.113  144.754 1.00 77.15  ? 162  ILE B CG2   1 
ATOM   3042  C  CD1   . ILE B 1  162  ? -41.496 7.899   144.068 1.00 70.45  ? 162  ILE B CD1   1 
ATOM   3043  N  N     . ASN B 1  163  ? -42.169 12.065  141.938 1.00 72.20  ? 163  ASN B N     1 
ATOM   3044  C  CA    . ASN B 1  163  ? -42.549 12.172  140.536 1.00 80.03  ? 163  ASN B CA    1 
ATOM   3045  C  C     . ASN B 1  163  ? -41.599 13.036  139.717 1.00 79.38  ? 163  ASN B C     1 
ATOM   3046  O  O     . ASN B 1  163  ? -41.898 13.323  138.555 1.00 70.92  ? 163  ASN B O     1 
ATOM   3047  C  CB    . ASN B 1  163  ? -43.973 12.711  140.412 1.00 85.36  ? 163  ASN B CB    1 
ATOM   3048  C  CG    . ASN B 1  163  ? -45.016 11.648  140.672 1.00 94.20  ? 163  ASN B CG    1 
ATOM   3049  O  OD1   . ASN B 1  163  ? -44.802 10.468  140.380 1.00 85.81  ? 163  ASN B OD1   1 
ATOM   3050  N  ND2   . ASN B 1  163  ? -46.151 12.055  141.227 1.00 104.79 ? 163  ASN B ND2   1 
ATOM   3051  N  N     . ALA B 1  164  ? -40.472 13.455  140.288 1.00 76.76  ? 164  ALA B N     1 
ATOM   3052  C  CA    . ALA B 1  164  ? -39.477 14.190  139.518 1.00 65.96  ? 164  ALA B CA    1 
ATOM   3053  C  C     . ALA B 1  164  ? -38.811 13.266  138.505 1.00 67.65  ? 164  ALA B C     1 
ATOM   3054  O  O     . ALA B 1  164  ? -38.560 12.091  138.784 1.00 66.78  ? 164  ALA B O     1 
ATOM   3055  C  CB    . ALA B 1  164  ? -38.429 14.807  140.446 1.00 61.79  ? 164  ALA B CB    1 
ATOM   3056  N  N     . ILE B 1  165  ? -38.533 13.798  137.324 1.00 70.48  ? 165  ILE B N     1 
ATOM   3057  C  CA    . ILE B 1  165  ? -37.963 13.037  136.214 1.00 62.37  ? 165  ILE B CA    1 
ATOM   3058  C  C     . ILE B 1  165  ? -36.494 13.415  136.069 1.00 60.46  ? 165  ILE B C     1 
ATOM   3059  O  O     . ILE B 1  165  ? -36.182 14.607  135.954 1.00 51.88  ? 165  ILE B O     1 
ATOM   3060  C  CB    . ILE B 1  165  ? -38.713 13.297  134.895 1.00 56.38  ? 165  ILE B CB    1 
ATOM   3061  C  CG1   . ILE B 1  165  ? -40.220 13.141  135.090 1.00 59.62  ? 165  ILE B CG1   1 
ATOM   3062  C  CG2   . ILE B 1  165  ? -38.228 12.340  133.818 1.00 61.17  ? 165  ILE B CG2   1 
ATOM   3063  C  CD1   . ILE B 1  165  ? -41.011 13.234  133.806 1.00 50.24  ? 165  ILE B CD1   1 
ATOM   3064  N  N     . PRO B 1  166  ? -35.575 12.449  136.077 1.00 63.65  ? 166  PRO B N     1 
ATOM   3065  C  CA    . PRO B 1  166  ? -34.170 12.766  135.800 1.00 56.85  ? 166  PRO B CA    1 
ATOM   3066  C  C     . PRO B 1  166  ? -33.964 13.060  134.323 1.00 57.34  ? 166  PRO B C     1 
ATOM   3067  O  O     . PRO B 1  166  ? -34.556 12.416  133.453 1.00 61.29  ? 166  PRO B O     1 
ATOM   3068  C  CB    . PRO B 1  166  ? -33.432 11.493  136.228 1.00 57.87  ? 166  PRO B CB    1 
ATOM   3069  C  CG    . PRO B 1  166  ? -34.437 10.404  136.012 1.00 64.88  ? 166  PRO B CG    1 
ATOM   3070  C  CD    . PRO B 1  166  ? -35.782 11.012  136.335 1.00 65.05  ? 166  PRO B CD    1 
ATOM   3071  N  N     . VAL B 1  167  ? -33.119 14.048  134.044 1.00 53.28  ? 167  VAL B N     1 
ATOM   3072  C  CA    . VAL B 1  167  ? -32.886 14.525  132.687 1.00 55.18  ? 167  VAL B CA    1 
ATOM   3073  C  C     . VAL B 1  167  ? -31.432 14.274  132.315 1.00 56.66  ? 167  VAL B C     1 
ATOM   3074  O  O     . VAL B 1  167  ? -30.538 14.391  133.161 1.00 58.34  ? 167  VAL B O     1 
ATOM   3075  C  CB    . VAL B 1  167  ? -33.231 16.023  132.552 1.00 50.79  ? 167  VAL B CB    1 
ATOM   3076  C  CG1   . VAL B 1  167  ? -33.215 16.445  131.096 1.00 49.81  ? 167  VAL B CG1   1 
ATOM   3077  C  CG2   . VAL B 1  167  ? -34.582 16.311  133.180 1.00 57.07  ? 167  VAL B CG2   1 
ATOM   3078  N  N     . ASP B 1  168  ? -31.198 13.918  131.051 1.00 57.88  ? 168  ASP B N     1 
ATOM   3079  C  CA    . ASP B 1  168  ? -29.839 13.869  130.527 1.00 45.92  ? 168  ASP B CA    1 
ATOM   3080  C  C     . ASP B 1  168  ? -29.211 15.254  130.637 1.00 41.70  ? 168  ASP B C     1 
ATOM   3081  O  O     . ASP B 1  168  ? -29.741 16.232  130.100 1.00 38.40  ? 168  ASP B O     1 
ATOM   3082  C  CB    . ASP B 1  168  ? -29.846 13.389  129.076 1.00 40.53  ? 168  ASP B CB    1 
ATOM   3083  C  CG    . ASP B 1  168  ? -30.579 12.068  128.895 1.00 47.30  ? 168  ASP B CG    1 
ATOM   3084  O  OD1   . ASP B 1  168  ? -30.280 11.106  129.632 1.00 49.26  ? 168  ASP B OD1   1 
ATOM   3085  O  OD2   . ASP B 1  168  ? -31.465 11.996  128.016 1.00 48.05  ? 168  ASP B OD2   1 
ATOM   3086  N  N     . ALA B 1  169  ? -28.088 15.341  131.345 1.00 39.34  ? 169  ALA B N     1 
ATOM   3087  C  CA    . ALA B 1  169  ? -27.499 16.619  131.730 1.00 41.96  ? 169  ALA B CA    1 
ATOM   3088  C  C     . ALA B 1  169  ? -26.392 16.999  130.750 1.00 44.66  ? 169  ALA B C     1 
ATOM   3089  O  O     . ALA B 1  169  ? -25.352 16.336  130.691 1.00 43.62  ? 169  ALA B O     1 
ATOM   3090  C  CB    . ALA B 1  169  ? -26.964 16.542  133.156 1.00 42.28  ? 169  ALA B CB    1 
ATOM   3091  N  N     . VAL B 1  170  ? -26.615 18.072  129.996 1.00 43.94  ? 170  VAL B N     1 
ATOM   3092  C  CA    . VAL B 1  170  ? -25.648 18.569  129.015 1.00 38.29  ? 170  VAL B CA    1 
ATOM   3093  C  C     . VAL B 1  170  ? -24.945 19.756  129.659 1.00 41.69  ? 170  VAL B C     1 
ATOM   3094  O  O     . VAL B 1  170  ? -25.327 20.913  129.467 1.00 45.24  ? 170  VAL B O     1 
ATOM   3095  C  CB    . VAL B 1  170  ? -26.320 18.957  127.697 1.00 40.70  ? 170  VAL B CB    1 
ATOM   3096  C  CG1   . VAL B 1  170  ? -25.274 19.302  126.645 1.00 55.84  ? 170  VAL B CG1   1 
ATOM   3097  C  CG2   . VAL B 1  170  ? -27.250 17.847  127.209 1.00 39.03  ? 170  VAL B CG2   1 
ATOM   3098  N  N     . PHE B 1  171  ? -23.874 19.474  130.396 1.00 40.28  ? 171  PHE B N     1 
ATOM   3099  C  CA    . PHE B 1  171  ? -23.180 20.550  131.091 1.00 42.93  ? 171  PHE B CA    1 
ATOM   3100  C  C     . PHE B 1  171  ? -22.286 21.337  130.150 1.00 47.88  ? 171  PHE B C     1 
ATOM   3101  O  O     . PHE B 1  171  ? -22.173 22.561  130.281 1.00 49.82  ? 171  PHE B O     1 
ATOM   3102  C  CB    . PHE B 1  171  ? -22.356 19.989  132.248 1.00 46.60  ? 171  PHE B CB    1 
ATOM   3103  C  CG    . PHE B 1  171  ? -23.183 19.365  133.328 1.00 52.47  ? 171  PHE B CG    1 
ATOM   3104  C  CD1   . PHE B 1  171  ? -24.038 20.140  134.095 1.00 47.32  ? 171  PHE B CD1   1 
ATOM   3105  C  CD2   . PHE B 1  171  ? -23.106 18.006  133.581 1.00 48.67  ? 171  PHE B CD2   1 
ATOM   3106  C  CE1   . PHE B 1  171  ? -24.803 19.573  135.089 1.00 45.29  ? 171  PHE B CE1   1 
ATOM   3107  C  CE2   . PHE B 1  171  ? -23.868 17.433  134.575 1.00 43.60  ? 171  PHE B CE2   1 
ATOM   3108  C  CZ    . PHE B 1  171  ? -24.719 18.218  135.331 1.00 45.11  ? 171  PHE B CZ    1 
ATOM   3109  N  N     . SER B 1  172  ? -21.657 20.650  129.200 1.00 55.78  ? 172  SER B N     1 
ATOM   3110  C  CA    . SER B 1  172  ? -20.642 21.248  128.346 1.00 54.55  ? 172  SER B CA    1 
ATOM   3111  C  C     . SER B 1  172  ? -21.202 22.455  127.606 1.00 50.98  ? 172  SER B C     1 
ATOM   3112  O  O     . SER B 1  172  ? -22.115 22.298  126.779 1.00 45.19  ? 172  SER B O     1 
ATOM   3113  C  CB    . SER B 1  172  ? -20.112 20.226  127.343 1.00 50.28  ? 172  SER B CB    1 
ATOM   3114  O  OG    . SER B 1  172  ? -18.936 20.701  126.704 1.00 48.20  ? 172  SER B OG    1 
ATOM   3115  N  N     . PRO B 1  173  ? -20.700 23.665  127.868 1.00 45.12  ? 173  PRO B N     1 
ATOM   3116  C  CA    . PRO B 1  173  ? -21.086 24.809  127.037 1.00 49.29  ? 173  PRO B CA    1 
ATOM   3117  C  C     . PRO B 1  173  ? -20.566 24.698  125.621 1.00 53.37  ? 173  PRO B C     1 
ATOM   3118  O  O     . PRO B 1  173  ? -21.025 25.444  124.751 1.00 53.41  ? 173  PRO B O     1 
ATOM   3119  C  CB    . PRO B 1  173  ? -20.457 25.998  127.767 1.00 50.03  ? 173  PRO B CB    1 
ATOM   3120  C  CG    . PRO B 1  173  ? -19.245 25.411  128.412 1.00 49.28  ? 173  PRO B CG    1 
ATOM   3121  C  CD    . PRO B 1  173  ? -19.623 24.007  128.814 1.00 42.00  ? 173  PRO B CD    1 
ATOM   3122  N  N     . VAL B 1  174  ? -19.631 23.789  125.366 1.00 50.22  ? 174  VAL B N     1 
ATOM   3123  C  CA    . VAL B 1  174  ? -19.082 23.582  124.033 1.00 49.84  ? 174  VAL B CA    1 
ATOM   3124  C  C     . VAL B 1  174  ? -20.014 22.654  123.267 1.00 49.48  ? 174  VAL B C     1 
ATOM   3125  O  O     . VAL B 1  174  ? -20.278 21.526  123.699 1.00 46.13  ? 174  VAL B O     1 
ATOM   3126  C  CB    . VAL B 1  174  ? -17.663 23.001  124.105 1.00 51.00  ? 174  VAL B CB    1 
ATOM   3127  C  CG1   . VAL B 1  174  ? -17.173 22.653  122.718 1.00 48.25  ? 174  VAL B CG1   1 
ATOM   3128  C  CG2   . VAL B 1  174  ? -16.721 23.985  124.776 1.00 44.41  ? 174  VAL B CG2   1 
ATOM   3129  N  N     . ARG B 1  175  ? -20.523 23.129  122.132 1.00 51.08  ? 175  ARG B N     1 
ATOM   3130  C  CA    . ARG B 1  175  ? -21.390 22.303  121.301 1.00 52.31  ? 175  ARG B CA    1 
ATOM   3131  C  C     . ARG B 1  175  ? -20.612 21.466  120.293 1.00 52.54  ? 175  ARG B C     1 
ATOM   3132  O  O     . ARG B 1  175  ? -21.062 20.371  119.932 1.00 46.77  ? 175  ARG B O     1 
ATOM   3133  C  CB    . ARG B 1  175  ? -22.413 23.175  120.573 1.00 50.17  ? 175  ARG B CB    1 
ATOM   3134  C  CG    . ARG B 1  175  ? -23.296 23.988  121.507 1.00 50.69  ? 175  ARG B CG    1 
ATOM   3135  C  CD    . ARG B 1  175  ? -24.710 24.109  120.963 1.00 58.04  ? 175  ARG B CD    1 
ATOM   3136  N  NE    . ARG B 1  175  ? -25.604 24.745  121.925 1.00 70.41  ? 175  ARG B NE    1 
ATOM   3137  C  CZ    . ARG B 1  175  ? -26.176 24.111  122.945 1.00 75.20  ? 175  ARG B CZ    1 
ATOM   3138  N  NH1   . ARG B 1  175  ? -25.946 22.818  123.142 1.00 71.41  ? 175  ARG B NH1   1 
ATOM   3139  N  NH2   . ARG B 1  175  ? -26.979 24.770  123.772 1.00 62.19  ? 175  ARG B NH2   1 
ATOM   3140  N  N     . ARG B 1  176  ? -19.460 21.949  119.827 1.00 51.06  ? 176  ARG B N     1 
ATOM   3141  C  CA    . ARG B 1  176  ? -18.648 21.130  118.929 1.00 50.13  ? 176  ARG B CA    1 
ATOM   3142  C  C     . ARG B 1  176  ? -17.221 21.662  118.866 1.00 47.02  ? 176  ARG B C     1 
ATOM   3143  O  O     . ARG B 1  176  ? -16.986 22.872  118.938 1.00 45.52  ? 176  ARG B O     1 
ATOM   3144  C  CB    . ARG B 1  176  ? -19.244 21.063  117.512 1.00 54.42  ? 176  ARG B CB    1 
ATOM   3145  C  CG    . ARG B 1  176  ? -18.393 20.259  116.518 1.00 57.32  ? 176  ARG B CG    1 
ATOM   3146  C  CD    . ARG B 1  176  ? -19.130 19.872  115.238 1.00 62.62  ? 176  ARG B CD    1 
ATOM   3147  N  NE    . ARG B 1  176  ? -19.772 21.006  114.577 1.00 67.80  ? 176  ARG B NE    1 
ATOM   3148  C  CZ    . ARG B 1  176  ? -19.937 21.110  113.260 1.00 62.28  ? 176  ARG B CZ    1 
ATOM   3149  N  NH1   . ARG B 1  176  ? -19.488 20.157  112.452 1.00 53.16  ? 176  ARG B NH1   1 
ATOM   3150  N  NH2   . ARG B 1  176  ? -20.537 22.177  112.749 1.00 54.85  ? 176  ARG B NH2   1 
ATOM   3151  N  N     . VAL B 1  177  ? -16.273 20.734  118.728 1.00 39.82  ? 177  VAL B N     1 
ATOM   3152  C  CA    . VAL B 1  177  ? -14.866 21.043  118.496 1.00 41.66  ? 177  VAL B CA    1 
ATOM   3153  C  C     . VAL B 1  177  ? -14.407 20.246  117.287 1.00 48.31  ? 177  VAL B C     1 
ATOM   3154  O  O     . VAL B 1  177  ? -14.530 19.015  117.270 1.00 53.32  ? 177  VAL B O     1 
ATOM   3155  C  CB    . VAL B 1  177  ? -13.985 20.710  119.710 1.00 48.72  ? 177  VAL B CB    1 
ATOM   3156  C  CG1   . VAL B 1  177  ? -12.526 20.989  119.391 1.00 51.42  ? 177  VAL B CG1   1 
ATOM   3157  C  CG2   . VAL B 1  177  ? -14.415 21.508  120.908 1.00 51.82  ? 177  VAL B CG2   1 
ATOM   3158  N  N     . ALA B 1  178  ? -13.872 20.938  116.284 1.00 52.46  ? 178  ALA B N     1 
ATOM   3159  C  CA    . ALA B 1  178  ? -13.372 20.269  115.089 1.00 49.26  ? 178  ALA B CA    1 
ATOM   3160  C  C     . ALA B 1  178  ? -12.099 20.958  114.624 1.00 49.79  ? 178  ALA B C     1 
ATOM   3161  O  O     . ALA B 1  178  ? -12.096 22.169  114.398 1.00 50.58  ? 178  ALA B O     1 
ATOM   3162  C  CB    . ALA B 1  178  ? -14.424 20.273  113.973 1.00 51.27  ? 178  ALA B CB    1 
ATOM   3163  N  N     . PHE B 1  179  ? -11.018 20.197  114.480 1.00 50.23  ? 179  PHE B N     1 
ATOM   3164  C  CA    . PHE B 1  179  ? -9.749  20.771  114.065 1.00 48.87  ? 179  PHE B CA    1 
ATOM   3165  C  C     . PHE B 1  179  ? -9.219  20.050  112.835 1.00 55.47  ? 179  PHE B C     1 
ATOM   3166  O  O     . PHE B 1  179  ? -9.597  18.915  112.534 1.00 56.80  ? 179  PHE B O     1 
ATOM   3167  C  CB    . PHE B 1  179  ? -8.708  20.739  115.197 1.00 52.65  ? 179  PHE B CB    1 
ATOM   3168  C  CG    . PHE B 1  179  ? -8.127  19.382  115.462 1.00 53.22  ? 179  PHE B CG    1 
ATOM   3169  C  CD1   . PHE B 1  179  ? -8.800  18.467  116.255 1.00 49.32  ? 179  PHE B CD1   1 
ATOM   3170  C  CD2   . PHE B 1  179  ? -6.896  19.028  114.932 1.00 50.19  ? 179  PHE B CD2   1 
ATOM   3171  C  CE1   . PHE B 1  179  ? -8.262  17.217  116.508 1.00 50.22  ? 179  PHE B CE1   1 
ATOM   3172  C  CE2   . PHE B 1  179  ? -6.350  17.780  115.179 1.00 49.45  ? 179  PHE B CE2   1 
ATOM   3173  C  CZ    . PHE B 1  179  ? -7.035  16.873  115.969 1.00 55.24  ? 179  PHE B CZ    1 
ATOM   3174  N  N     . GLN B 1  180  ? -8.326  20.742  112.132 1.00 62.81  ? 180  GLN B N     1 
ATOM   3175  C  CA    . GLN B 1  180  ? -7.746  20.273  110.885 1.00 62.53  ? 180  GLN B CA    1 
ATOM   3176  C  C     . GLN B 1  180  ? -6.300  20.739  110.806 1.00 53.72  ? 180  GLN B C     1 
ATOM   3177  O  O     . GLN B 1  180  ? -5.990  21.893  111.123 1.00 53.45  ? 180  GLN B O     1 
ATOM   3178  C  CB    . GLN B 1  180  ? -8.541  20.792  109.681 1.00 68.41  ? 180  GLN B CB    1 
ATOM   3179  C  CG    . GLN B 1  180  ? -8.349  20.002  108.404 1.00 71.55  ? 180  GLN B CG    1 
ATOM   3180  C  CD    . GLN B 1  180  ? -9.186  20.551  107.263 1.00 87.52  ? 180  GLN B CD    1 
ATOM   3181  O  OE1   . GLN B 1  180  ? -9.315  21.766  107.101 1.00 93.02  ? 180  GLN B OE1   1 
ATOM   3182  N  NE2   . GLN B 1  180  ? -9.770  19.656  106.472 1.00 83.64  ? 180  GLN B NE2   1 
ATOM   3183  N  N     . VAL B 1  181  ? -5.417  19.837  110.389 1.00 56.54  ? 181  VAL B N     1 
ATOM   3184  C  CA    . VAL B 1  181  ? -3.995  20.128  110.244 1.00 59.93  ? 181  VAL B CA    1 
ATOM   3185  C  C     . VAL B 1  181  ? -3.658  20.122  108.758 1.00 65.18  ? 181  VAL B C     1 
ATOM   3186  O  O     . VAL B 1  181  ? -3.888  19.125  108.062 1.00 55.26  ? 181  VAL B O     1 
ATOM   3187  C  CB    . VAL B 1  181  ? -3.124  19.119  111.006 1.00 51.28  ? 181  VAL B CB    1 
ATOM   3188  C  CG1   . VAL B 1  181  ? -1.662  19.529  110.934 1.00 48.27  ? 181  VAL B CG1   1 
ATOM   3189  C  CG2   . VAL B 1  181  ? -3.585  19.006  112.450 1.00 55.82  ? 181  VAL B CG2   1 
ATOM   3190  N  N     . GLU B 1  182  ? -3.114  21.234  108.276 1.00 63.92  ? 182  GLU B N     1 
ATOM   3191  C  CA    . GLU B 1  182  ? -2.720  21.371  106.884 1.00 57.33  ? 182  GLU B CA    1 
ATOM   3192  C  C     . GLU B 1  182  ? -1.213  21.566  106.797 1.00 65.62  ? 182  GLU B C     1 
ATOM   3193  O  O     . GLU B 1  182  ? -0.588  22.132  107.698 1.00 61.60  ? 182  GLU B O     1 
ATOM   3194  C  CB    . GLU B 1  182  ? -3.446  22.547  106.217 1.00 58.59  ? 182  GLU B CB    1 
ATOM   3195  C  CG    . GLU B 1  182  ? -4.963  22.412  106.205 1.00 62.99  ? 182  GLU B CG    1 
ATOM   3196  C  CD    . GLU B 1  182  ? -5.660  23.696  105.796 1.00 70.24  ? 182  GLU B CD    1 
ATOM   3197  O  OE1   . GLU B 1  182  ? -6.837  23.882  106.171 1.00 76.10  ? 182  GLU B OE1   1 
ATOM   3198  O  OE2   . GLU B 1  182  ? -5.029  24.523  105.106 1.00 65.84  ? 182  GLU B OE2   1 
ATOM   3199  N  N     . ASP B 1  183  ? -0.626  21.075  105.710 1.00 79.95  ? 183  ASP B N     1 
ATOM   3200  C  CA    . ASP B 1  183  ? 0.802   21.266  105.504 1.00 71.78  ? 183  ASP B CA    1 
ATOM   3201  C  C     . ASP B 1  183  ? 1.081   22.707  105.095 1.00 66.96  ? 183  ASP B C     1 
ATOM   3202  O  O     . ASP B 1  183  ? 0.352   23.293  104.290 1.00 65.27  ? 183  ASP B O     1 
ATOM   3203  C  CB    . ASP B 1  183  ? 1.330   20.298  104.445 1.00 72.56  ? 183  ASP B CB    1 
ATOM   3204  C  CG    . ASP B 1  183  ? 1.642   18.926  105.014 1.00 78.31  ? 183  ASP B CG    1 
ATOM   3205  O  OD1   . ASP B 1  183  ? 2.780   18.725  105.490 1.00 83.25  ? 183  ASP B OD1   1 
ATOM   3206  O  OD2   . ASP B 1  183  ? 0.749   18.053  104.996 1.00 81.77  ? 183  ASP B OD2   1 
ATOM   3207  N  N     . THR B 1  184  ? 2.133   23.284  105.669 1.00 65.50  ? 184  THR B N     1 
ATOM   3208  C  CA    . THR B 1  184  ? 2.552   24.630  105.319 1.00 70.37  ? 184  THR B CA    1 
ATOM   3209  C  C     . THR B 1  184  ? 4.070   24.713  105.408 1.00 77.87  ? 184  THR B C     1 
ATOM   3210  O  O     . THR B 1  184  ? 4.735   23.859  106.012 1.00 75.70  ? 184  THR B O     1 
ATOM   3211  C  CB    . THR B 1  184  ? 1.891   25.687  106.214 1.00 63.93  ? 184  THR B CB    1 
ATOM   3212  O  OG1   . THR B 1  184  ? 2.002   26.973  105.593 1.00 62.68  ? 184  THR B OG1   1 
ATOM   3213  C  CG2   . THR B 1  184  ? 2.553   25.728  107.584 1.00 63.48  ? 184  THR B CG2   1 
ATOM   3214  N  N     . ARG B 1  185  ? 4.612   25.759  104.785 1.00 85.29  ? 185  ARG B N     1 
ATOM   3215  C  CA    . ARG B 1  185  ? 6.049   25.938  104.635 1.00 92.62  ? 185  ARG B CA    1 
ATOM   3216  C  C     . ARG B 1  185  ? 6.446   27.349  105.045 1.00 95.46  ? 185  ARG B C     1 
ATOM   3217  O  O     . ARG B 1  185  ? 5.838   28.330  104.601 1.00 89.61  ? 185  ARG B O     1 
ATOM   3218  C  CB    . ARG B 1  185  ? 6.490   25.657  103.188 1.00 95.47  ? 185  ARG B CB    1 
ATOM   3219  C  CG    . ARG B 1  185  ? 5.781   26.500  102.139 1.00 98.69  ? 185  ARG B CG    1 
ATOM   3220  C  CD    . ARG B 1  185  ? 6.346   26.276  100.744 1.00 100.77 ? 185  ARG B CD    1 
ATOM   3221  N  NE    . ARG B 1  185  ? 5.967   27.361  99.841  1.00 93.01  ? 185  ARG B NE    1 
ATOM   3222  C  CZ    . ARG B 1  185  ? 6.720   28.431  99.606  1.00 90.93  ? 185  ARG B CZ    1 
ATOM   3223  N  NH1   . ARG B 1  185  ? 7.901   28.558  100.199 1.00 95.95  ? 185  ARG B NH1   1 
ATOM   3224  N  NH2   . ARG B 1  185  ? 6.292   29.374  98.777  1.00 72.21  ? 185  ARG B NH2   1 
ATOM   3225  N  N     . LEU B 1  186  ? 7.457   27.442  105.907 1.00 99.16  ? 186  LEU B N     1 
ATOM   3226  C  CA    . LEU B 1  186  ? 8.113   28.701  106.244 1.00 106.19 ? 186  LEU B CA    1 
ATOM   3227  C  C     . LEU B 1  186  ? 9.495   28.675  105.604 1.00 119.45 ? 186  LEU B C     1 
ATOM   3228  O  O     . LEU B 1  186  ? 10.377  27.930  106.046 1.00 117.84 ? 186  LEU B O     1 
ATOM   3229  C  CB    . LEU B 1  186  ? 8.214   28.892  107.757 1.00 100.16 ? 186  LEU B CB    1 
ATOM   3230  C  CG    . LEU B 1  186  ? 9.050   30.099  108.198 1.00 100.62 ? 186  LEU B CG    1 
ATOM   3231  C  CD1   . LEU B 1  186  ? 8.222   31.378  108.184 1.00 104.48 ? 186  LEU B CD1   1 
ATOM   3232  C  CD2   . LEU B 1  186  ? 9.699   29.878  109.559 1.00 96.78  ? 186  LEU B CD2   1 
ATOM   3233  N  N     . GLY B 1  187  ? 9.682   29.479  104.564 1.00 120.85 ? 187  GLY B N     1 
ATOM   3234  C  CA    . GLY B 1  187  ? 10.911  29.422  103.797 1.00 114.72 ? 187  GLY B CA    1 
ATOM   3235  C  C     . GLY B 1  187  ? 11.074  28.101  103.076 1.00 117.87 ? 187  GLY B C     1 
ATOM   3236  O  O     . GLY B 1  187  ? 10.243  27.739  102.232 1.00 104.92 ? 187  GLY B O     1 
ATOM   3237  N  N     . GLN B 1  188  ? 12.138  27.368  103.404 1.00 120.46 ? 188  GLN B N     1 
ATOM   3238  C  CA    . GLN B 1  188  ? 12.384  26.061  102.815 1.00 118.75 ? 188  GLN B CA    1 
ATOM   3239  C  C     . GLN B 1  188  ? 12.124  24.918  103.786 1.00 120.25 ? 188  GLN B C     1 
ATOM   3240  O  O     . GLN B 1  188  ? 12.403  23.766  103.448 1.00 123.11 ? 188  GLN B O     1 
ATOM   3241  C  CB    . GLN B 1  188  ? 13.809  25.986  102.265 1.00 110.76 ? 188  GLN B CB    1 
ATOM   3242  C  CG    . GLN B 1  188  ? 13.904  25.151  100.993 1.00 105.08 ? 188  GLN B CG    1 
ATOM   3243  C  CD    . GLN B 1  188  ? 12.828  25.516  99.979  1.00 98.33  ? 188  GLN B CD    1 
ATOM   3244  O  OE1   . GLN B 1  188  ? 12.594  26.691  99.699  1.00 98.00  ? 188  GLN B OE1   1 
ATOM   3245  N  NE2   . GLN B 1  188  ? 12.159  24.505  99.436  1.00 86.94  ? 188  GLN B NE2   1 
ATOM   3246  N  N     . ARG B 1  189  ? 11.609  25.202  104.984 1.00 118.72 ? 189  ARG B N     1 
ATOM   3247  C  CA    . ARG B 1  189  ? 11.045  24.163  105.841 1.00 109.21 ? 189  ARG B CA    1 
ATOM   3248  C  C     . ARG B 1  189  ? 9.692   23.777  105.257 1.00 106.02 ? 189  ARG B C     1 
ATOM   3249  O  O     . ARG B 1  189  ? 8.751   24.575  105.285 1.00 102.01 ? 189  ARG B O     1 
ATOM   3250  C  CB    . ARG B 1  189  ? 10.900  24.662  107.275 1.00 111.37 ? 189  ARG B CB    1 
ATOM   3251  C  CG    . ARG B 1  189  ? 12.194  25.107  107.939 1.00 114.46 ? 189  ARG B CG    1 
ATOM   3252  C  CD    . ARG B 1  189  ? 12.943  23.937  108.559 1.00 120.24 ? 189  ARG B CD    1 
ATOM   3253  N  NE    . ARG B 1  189  ? 13.631  24.328  109.788 1.00 123.43 ? 189  ARG B NE    1 
ATOM   3254  C  CZ    . ARG B 1  189  ? 13.113  24.204  111.007 1.00 123.34 ? 189  ARG B CZ    1 
ATOM   3255  N  NH1   . ARG B 1  189  ? 13.806  24.587  112.072 1.00 114.76 ? 189  ARG B NH1   1 
ATOM   3256  N  NH2   . ARG B 1  189  ? 11.899  23.691  111.163 1.00 122.60 ? 189  ARG B NH2   1 
ATOM   3257  N  N     . THR B 1  190  ? 9.585   22.561  104.723 1.00 105.46 ? 190  THR B N     1 
ATOM   3258  C  CA    . THR B 1  190  ? 8.444   22.187  103.896 1.00 102.92 ? 190  THR B CA    1 
ATOM   3259  C  C     . THR B 1  190  ? 7.423   21.305  104.605 1.00 103.48 ? 190  THR B C     1 
ATOM   3260  O  O     . THR B 1  190  ? 6.306   21.153  104.097 1.00 96.30  ? 190  THR B O     1 
ATOM   3261  C  CB    . THR B 1  190  ? 8.933   21.470  102.634 1.00 101.04 ? 190  THR B CB    1 
ATOM   3262  O  OG1   . THR B 1  190  ? 9.634   20.274  103.004 1.00 102.43 ? 190  THR B OG1   1 
ATOM   3263  C  CG2   . THR B 1  190  ? 9.871   22.377  101.862 1.00 102.62 ? 190  THR B CG2   1 
ATOM   3264  N  N     . ASP B 1  191  ? 7.767   20.727  105.753 1.00 100.99 ? 191  ASP B N     1 
ATOM   3265  C  CA    . ASP B 1  191  ? 6.905   19.775  106.438 1.00 90.31  ? 191  ASP B CA    1 
ATOM   3266  C  C     . ASP B 1  191  ? 6.088   20.405  107.562 1.00 82.47  ? 191  ASP B C     1 
ATOM   3267  O  O     . ASP B 1  191  ? 5.480   19.673  108.350 1.00 80.98  ? 191  ASP B O     1 
ATOM   3268  C  CB    . ASP B 1  191  ? 7.748   18.618  106.985 1.00 94.97  ? 191  ASP B CB    1 
ATOM   3269  C  CG    . ASP B 1  191  ? 9.081   19.086  107.568 1.00 99.55  ? 191  ASP B CG    1 
ATOM   3270  O  OD1   . ASP B 1  191  ? 9.545   20.191  107.209 1.00 90.08  ? 191  ASP B OD1   1 
ATOM   3271  O  OD2   . ASP B 1  191  ? 9.674   18.340  108.379 1.00 106.57 ? 191  ASP B OD2   1 
ATOM   3272  N  N     . LEU B 1  192  ? 6.037   21.733  107.645 1.00 79.43  ? 192  LEU B N     1 
ATOM   3273  C  CA    . LEU B 1  192  ? 5.526   22.355  108.857 1.00 71.73  ? 192  LEU B CA    1 
ATOM   3274  C  C     . LEU B 1  192  ? 4.006   22.212  108.946 1.00 70.41  ? 192  LEU B C     1 
ATOM   3275  O  O     . LEU B 1  192  ? 3.313   21.998  107.948 1.00 66.67  ? 192  LEU B O     1 
ATOM   3276  C  CB    . LEU B 1  192  ? 5.948   23.825  108.919 1.00 66.82  ? 192  LEU B CB    1 
ATOM   3277  C  CG    . LEU B 1  192  ? 7.468   24.046  108.923 1.00 66.94  ? 192  LEU B CG    1 
ATOM   3278  C  CD1   . LEU B 1  192  ? 7.819   25.505  109.182 1.00 75.82  ? 192  LEU B CD1   1 
ATOM   3279  C  CD2   . LEU B 1  192  ? 8.163   23.135  109.929 1.00 60.66  ? 192  LEU B CD2   1 
ATOM   3280  N  N     . ASP B 1  193  ? 3.494   22.317  110.170 1.00 65.31  ? 193  ASP B N     1 
ATOM   3281  C  CA    . ASP B 1  193  ? 2.079   22.114  110.450 1.00 53.98  ? 193  ASP B CA    1 
ATOM   3282  C  C     . ASP B 1  193  ? 1.369   23.449  110.617 1.00 51.48  ? 193  ASP B C     1 
ATOM   3283  O  O     . ASP B 1  193  ? 1.931   24.402  111.165 1.00 51.27  ? 193  ASP B O     1 
ATOM   3284  C  CB    . ASP B 1  193  ? 1.881   21.269  111.711 1.00 51.47  ? 193  ASP B CB    1 
ATOM   3285  C  CG    . ASP B 1  193  ? 2.071   19.778  111.459 1.00 62.35  ? 193  ASP B CG    1 
ATOM   3286  O  OD1   . ASP B 1  193  ? 2.726   19.415  110.460 1.00 74.12  ? 193  ASP B OD1   1 
ATOM   3287  O  OD2   . ASP B 1  193  ? 1.553   18.967  112.257 1.00 51.86  ? 193  ASP B OD2   1 
ATOM   3288  N  N     . LYS B 1  194  ? 0.127   23.510  110.136 1.00 59.50  ? 194  LYS B N     1 
ATOM   3289  C  CA    . LYS B 1  194  ? -0.783  24.623  110.377 1.00 58.31  ? 194  LYS B CA    1 
ATOM   3290  C  C     . LYS B 1  194  ? -2.049  24.056  111.004 1.00 56.87  ? 194  LYS B C     1 
ATOM   3291  O  O     . LYS B 1  194  ? -2.744  23.244  110.381 1.00 55.91  ? 194  LYS B O     1 
ATOM   3292  C  CB    . LYS B 1  194  ? -1.110  25.367  109.080 1.00 52.67  ? 194  LYS B CB    1 
ATOM   3293  C  CG    . LYS B 1  194  ? -2.203  26.412  109.243 1.00 52.98  ? 194  LYS B CG    1 
ATOM   3294  C  CD    . LYS B 1  194  ? -2.801  26.830  107.910 1.00 55.86  ? 194  LYS B CD    1 
ATOM   3295  C  CE    . LYS B 1  194  ? -3.922  27.838  108.113 1.00 53.11  ? 194  LYS B CE    1 
ATOM   3296  N  NZ    . LYS B 1  194  ? -4.666  28.130  106.859 1.00 56.05  ? 194  LYS B NZ    1 
ATOM   3297  N  N     . LEU B 1  195  ? -2.344  24.477  112.231 1.00 53.67  ? 195  LEU B N     1 
ATOM   3298  C  CA    . LEU B 1  195  ? -3.450  23.941  113.011 1.00 54.90  ? 195  LEU B CA    1 
ATOM   3299  C  C     . LEU B 1  195  ? -4.625  24.911  112.978 1.00 52.70  ? 195  LEU B C     1 
ATOM   3300  O  O     . LEU B 1  195  ? -4.464  26.094  113.291 1.00 51.26  ? 195  LEU B O     1 
ATOM   3301  C  CB    . LEU B 1  195  ? -2.995  23.695  114.450 1.00 49.06  ? 195  LEU B CB    1 
ATOM   3302  C  CG    . LEU B 1  195  ? -4.035  23.337  115.505 1.00 45.63  ? 195  LEU B CG    1 
ATOM   3303  C  CD1   . LEU B 1  195  ? -4.671  22.006  115.167 1.00 53.41  ? 195  LEU B CD1   1 
ATOM   3304  C  CD2   . LEU B 1  195  ? -3.378  23.298  116.873 1.00 44.94  ? 195  LEU B CD2   1 
ATOM   3305  N  N     . THR B 1  196  ? -5.802  24.420  112.594 1.00 49.58  ? 196  THR B N     1 
ATOM   3306  C  CA    . THR B 1  196  ? -7.014  25.229  112.588 1.00 52.76  ? 196  THR B CA    1 
ATOM   3307  C  C     . THR B 1  196  ? -8.067  24.546  113.447 1.00 54.05  ? 196  THR B C     1 
ATOM   3308  O  O     . THR B 1  196  ? -8.372  23.369  113.243 1.00 59.62  ? 196  THR B O     1 
ATOM   3309  C  CB    . THR B 1  196  ? -7.532  25.452  111.163 1.00 54.98  ? 196  THR B CB    1 
ATOM   3310  O  OG1   . THR B 1  196  ? -6.698  26.414  110.501 1.00 54.82  ? 196  THR B OG1   1 
ATOM   3311  C  CG2   . THR B 1  196  ? -8.970  25.959  111.179 1.00 50.30  ? 196  THR B CG2   1 
ATOM   3312  N  N     . LEU B 1  197  ? -8.620  25.289  114.400 1.00 49.69  ? 197  LEU B N     1 
ATOM   3313  C  CA    . LEU B 1  197  ? -9.525  24.768  115.413 1.00 49.19  ? 197  LEU B CA    1 
ATOM   3314  C  C     . LEU B 1  197  ? -10.822 25.563  115.381 1.00 48.29  ? 197  LEU B C     1 
ATOM   3315  O  O     . LEU B 1  197  ? -10.797 26.796  115.422 1.00 51.12  ? 197  LEU B O     1 
ATOM   3316  C  CB    . LEU B 1  197  ? -8.870  24.851  116.794 1.00 48.63  ? 197  LEU B CB    1 
ATOM   3317  C  CG    . LEU B 1  197  ? -9.612  24.284  117.998 1.00 57.29  ? 197  LEU B CG    1 
ATOM   3318  C  CD1   . LEU B 1  197  ? -9.807  22.796  117.835 1.00 53.73  ? 197  LEU B CD1   1 
ATOM   3319  C  CD2   . LEU B 1  197  ? -8.839  24.584  119.268 1.00 63.43  ? 197  LEU B CD2   1 
ATOM   3320  N  N     . ARG B 1  198  ? -11.951 24.864  115.322 1.00 46.39  ? 198  ARG B N     1 
ATOM   3321  C  CA    . ARG B 1  198  ? -13.263 25.484  115.221 1.00 53.97  ? 198  ARG B CA    1 
ATOM   3322  C  C     . ARG B 1  198  ? -14.088 25.064  116.427 1.00 53.69  ? 198  ARG B C     1 
ATOM   3323  O  O     . ARG B 1  198  ? -14.231 23.863  116.698 1.00 53.57  ? 198  ARG B O     1 
ATOM   3324  C  CB    . ARG B 1  198  ? -13.954 25.076  113.918 1.00 57.98  ? 198  ARG B CB    1 
ATOM   3325  C  CG    . ARG B 1  198  ? -13.114 25.337  112.672 1.00 56.80  ? 198  ARG B CG    1 
ATOM   3326  C  CD    . ARG B 1  198  ? -13.511 24.415  111.530 1.00 58.72  ? 198  ARG B CD    1 
ATOM   3327  N  NE    . ARG B 1  198  ? -14.907 24.591  111.142 1.00 67.98  ? 198  ARG B NE    1 
ATOM   3328  C  CZ    . ARG B 1  198  ? -15.560 23.785  110.309 1.00 67.89  ? 198  ARG B CZ    1 
ATOM   3329  N  NH1   . ARG B 1  198  ? -16.830 24.024  110.012 1.00 57.46  ? 198  ARG B NH1   1 
ATOM   3330  N  NH2   . ARG B 1  198  ? -14.944 22.737  109.778 1.00 68.28  ? 198  ARG B NH2   1 
ATOM   3331  N  N     . ILE B 1  199  ? -14.620 26.049  117.151 1.00 53.48  ? 199  ILE B N     1 
ATOM   3332  C  CA    . ILE B 1  199  ? -15.301 25.805  118.415 1.00 47.53  ? 199  ILE B CA    1 
ATOM   3333  C  C     . ILE B 1  199  ? -16.675 26.460  118.388 1.00 52.11  ? 199  ILE B C     1 
ATOM   3334  O  O     . ILE B 1  199  ? -16.793 27.671  118.156 1.00 58.48  ? 199  ILE B O     1 
ATOM   3335  C  CB    . ILE B 1  199  ? -14.478 26.315  119.611 1.00 47.57  ? 199  ILE B CB    1 
ATOM   3336  C  CG1   . ILE B 1  199  ? -13.082 25.692  119.593 1.00 45.85  ? 199  ILE B CG1   1 
ATOM   3337  C  CG2   . ILE B 1  199  ? -15.172 25.965  120.913 1.00 54.41  ? 199  ILE B CG2   1 
ATOM   3338  C  CD1   . ILE B 1  199  ? -12.176 26.181  120.697 1.00 50.90  ? 199  ILE B CD1   1 
ATOM   3339  N  N     . TRP B 1  200  ? -17.706 25.650  118.630 1.00 49.39  ? 200  TRP B N     1 
ATOM   3340  C  CA    . TRP B 1  200  ? -19.085 26.093  118.793 1.00 57.85  ? 200  TRP B CA    1 
ATOM   3341  C  C     . TRP B 1  200  ? -19.495 25.921  120.248 1.00 57.51  ? 200  TRP B C     1 
ATOM   3342  O  O     . TRP B 1  200  ? -19.419 24.805  120.782 1.00 54.18  ? 200  TRP B O     1 
ATOM   3343  C  CB    . TRP B 1  200  ? -20.053 25.274  117.937 1.00 59.41  ? 200  TRP B CB    1 
ATOM   3344  C  CG    . TRP B 1  200  ? -19.915 25.388  116.465 1.00 61.89  ? 200  TRP B CG    1 
ATOM   3345  C  CD1   . TRP B 1  200  ? -20.730 26.081  115.623 1.00 67.26  ? 200  TRP B CD1   1 
ATOM   3346  C  CD2   . TRP B 1  200  ? -18.934 24.750  115.643 1.00 60.45  ? 200  TRP B CD2   1 
ATOM   3347  N  NE1   . TRP B 1  200  ? -20.308 25.931  114.325 1.00 62.87  ? 200  TRP B NE1   1 
ATOM   3348  C  CE2   . TRP B 1  200  ? -19.206 25.117  114.311 1.00 59.16  ? 200  TRP B CE2   1 
ATOM   3349  C  CE3   . TRP B 1  200  ? -17.845 23.914  115.904 1.00 59.40  ? 200  TRP B CE3   1 
ATOM   3350  C  CZ2   . TRP B 1  200  ? -18.429 24.680  113.244 1.00 62.72  ? 200  TRP B CZ2   1 
ATOM   3351  C  CZ3   . TRP B 1  200  ? -17.074 23.480  114.843 1.00 57.60  ? 200  TRP B CZ3   1 
ATOM   3352  C  CH2   . TRP B 1  200  ? -17.369 23.863  113.530 1.00 63.70  ? 200  TRP B CH2   1 
ATOM   3353  N  N     . THR B 1  201  ? -19.978 27.004  120.857 1.00 59.99  ? 201  THR B N     1 
ATOM   3354  C  CA    . THR B 1  201  ? -20.505 27.032  122.218 1.00 57.74  ? 201  THR B CA    1 
ATOM   3355  C  C     . THR B 1  201  ? -21.973 27.459  122.195 1.00 61.54  ? 201  THR B C     1 
ATOM   3356  O  O     . THR B 1  201  ? -22.561 27.687  121.135 1.00 66.44  ? 201  THR B O     1 
ATOM   3357  C  CB    . THR B 1  201  ? -19.703 27.982  123.112 1.00 55.30  ? 201  THR B CB    1 
ATOM   3358  O  OG1   . THR B 1  201  ? -20.145 29.329  122.895 1.00 59.68  ? 201  THR B OG1   1 
ATOM   3359  C  CG2   . THR B 1  201  ? -18.215 27.884  122.810 1.00 53.57  ? 201  THR B CG2   1 
ATOM   3360  N  N     . ASP B 1  202  ? -22.566 27.574  123.386 1.00 58.26  ? 202  ASP B N     1 
ATOM   3361  C  CA    . ASP B 1  202  ? -23.957 27.989  123.528 1.00 61.74  ? 202  ASP B CA    1 
ATOM   3362  C  C     . ASP B 1  202  ? -24.109 29.464  123.877 1.00 60.23  ? 202  ASP B C     1 
ATOM   3363  O  O     . ASP B 1  202  ? -25.241 29.953  123.962 1.00 61.60  ? 202  ASP B O     1 
ATOM   3364  C  CB    . ASP B 1  202  ? -24.667 27.124  124.583 1.00 62.83  ? 202  ASP B CB    1 
ATOM   3365  C  CG    . ASP B 1  202  ? -23.934 27.089  125.917 1.00 61.69  ? 202  ASP B CG    1 
ATOM   3366  O  OD1   . ASP B 1  202  ? -23.094 27.976  126.177 1.00 66.72  ? 202  ASP B OD1   1 
ATOM   3367  O  OD2   . ASP B 1  202  ? -24.200 26.159  126.709 1.00 56.42  ? 202  ASP B OD2   1 
ATOM   3368  N  N     . GLY B 1  203  ? -23.007 30.185  124.074 1.00 55.79  ? 203  GLY B N     1 
ATOM   3369  C  CA    . GLY B 1  203  ? -23.042 31.588  124.413 1.00 63.35  ? 203  GLY B CA    1 
ATOM   3370  C  C     . GLY B 1  203  ? -22.756 31.893  125.870 1.00 68.63  ? 203  GLY B C     1 
ATOM   3371  O  O     . GLY B 1  203  ? -22.346 33.018  126.183 1.00 63.63  ? 203  GLY B O     1 
ATOM   3372  N  N     . SER B 1  204  ? -22.969 30.926  126.766 1.00 64.29  ? 204  SER B N     1 
ATOM   3373  C  CA    . SER B 1  204  ? -22.619 31.125  128.168 1.00 58.90  ? 204  SER B CA    1 
ATOM   3374  C  C     . SER B 1  204  ? -21.114 31.294  128.337 1.00 60.16  ? 204  SER B C     1 
ATOM   3375  O  O     . SER B 1  204  ? -20.659 32.094  129.163 1.00 61.13  ? 204  SER B O     1 
ATOM   3376  C  CB    . SER B 1  204  ? -23.127 29.951  129.004 1.00 61.40  ? 204  SER B CB    1 
ATOM   3377  O  OG    . SER B 1  204  ? -22.523 28.738  128.591 1.00 60.58  ? 204  SER B OG    1 
ATOM   3378  N  N     . VAL B 1  205  ? -20.329 30.541  127.571 1.00 60.77  ? 205  VAL B N     1 
ATOM   3379  C  CA    . VAL B 1  205  ? -18.882 30.699  127.500 1.00 55.59  ? 205  VAL B CA    1 
ATOM   3380  C  C     . VAL B 1  205  ? -18.516 30.970  126.048 1.00 59.95  ? 205  VAL B C     1 
ATOM   3381  O  O     . VAL B 1  205  ? -19.076 30.351  125.137 1.00 58.80  ? 205  VAL B O     1 
ATOM   3382  C  CB    . VAL B 1  205  ? -18.141 29.452  128.025 1.00 43.93  ? 205  VAL B CB    1 
ATOM   3383  C  CG1   . VAL B 1  205  ? -16.684 29.776  128.290 1.00 47.36  ? 205  VAL B CG1   1 
ATOM   3384  C  CG2   . VAL B 1  205  ? -18.810 28.924  129.276 1.00 51.72  ? 205  VAL B CG2   1 
ATOM   3385  N  N     . THR B 1  206  ? -17.588 31.906  125.828 1.00 62.60  ? 206  THR B N     1 
ATOM   3386  C  CA    . THR B 1  206  ? -17.220 32.177  124.447 1.00 63.65  ? 206  THR B CA    1 
ATOM   3387  C  C     . THR B 1  206  ? -16.180 31.165  123.969 1.00 58.46  ? 206  THR B C     1 
ATOM   3388  O  O     . THR B 1  206  ? -15.464 30.570  124.781 1.00 55.97  ? 206  THR B O     1 
ATOM   3389  C  CB    . THR B 1  206  ? -16.671 33.594  124.294 1.00 60.65  ? 206  THR B CB    1 
ATOM   3390  O  OG1   . THR B 1  206  ? -15.299 33.629  124.701 1.00 59.39  ? 206  THR B OG1   1 
ATOM   3391  C  CG2   . THR B 1  206  ? -17.475 34.572  125.138 1.00 63.78  ? 206  THR B CG2   1 
ATOM   3392  N  N     . PRO B 1  207  ? -16.096 30.932  122.656 1.00 58.15  ? 207  PRO B N     1 
ATOM   3393  C  CA    . PRO B 1  207  ? -15.092 29.980  122.151 1.00 61.84  ? 207  PRO B CA    1 
ATOM   3394  C  C     . PRO B 1  207  ? -13.671 30.311  122.576 1.00 61.26  ? 207  PRO B C     1 
ATOM   3395  O  O     . PRO B 1  207  ? -12.907 29.401  122.925 1.00 57.40  ? 207  PRO B O     1 
ATOM   3396  C  CB    . PRO B 1  207  ? -15.275 30.069  120.630 1.00 66.56  ? 207  PRO B CB    1 
ATOM   3397  C  CG    . PRO B 1  207  ? -16.705 30.455  120.455 1.00 60.35  ? 207  PRO B CG    1 
ATOM   3398  C  CD    . PRO B 1  207  ? -17.005 31.391  121.590 1.00 61.47  ? 207  PRO B CD    1 
ATOM   3399  N  N     . LEU B 1  208  ? -13.295 31.593  122.567 1.00 58.08  ? 208  LEU B N     1 
ATOM   3400  C  CA    . LEU B 1  208  ? -11.957 31.966  123.016 1.00 58.52  ? 208  LEU B CA    1 
ATOM   3401  C  C     . LEU B 1  208  ? -11.784 31.704  124.510 1.00 56.36  ? 208  LEU B C     1 
ATOM   3402  O  O     . LEU B 1  208  ? -10.736 31.203  124.940 1.00 54.71  ? 208  LEU B O     1 
ATOM   3403  C  CB    . LEU B 1  208  ? -11.683 33.431  122.677 1.00 54.72  ? 208  LEU B CB    1 
ATOM   3404  C  CG    . LEU B 1  208  ? -10.348 34.016  123.140 1.00 55.66  ? 208  LEU B CG    1 
ATOM   3405  C  CD1   . LEU B 1  208  ? -9.188  33.146  122.690 1.00 62.74  ? 208  LEU B CD1   1 
ATOM   3406  C  CD2   . LEU B 1  208  ? -10.187 35.432  122.615 1.00 55.70  ? 208  LEU B CD2   1 
ATOM   3407  N  N     . GLU B 1  209  ? -12.799 32.036  125.313 1.00 56.62  ? 209  GLU B N     1 
ATOM   3408  C  CA    . GLU B 1  209  ? -12.767 31.703  126.735 1.00 53.18  ? 209  GLU B CA    1 
ATOM   3409  C  C     . GLU B 1  209  ? -12.616 30.202  126.935 1.00 53.25  ? 209  GLU B C     1 
ATOM   3410  O  O     . GLU B 1  209  ? -11.811 29.750  127.758 1.00 55.67  ? 209  GLU B O     1 
ATOM   3411  C  CB    . GLU B 1  209  ? -14.036 32.206  127.428 1.00 52.22  ? 209  GLU B CB    1 
ATOM   3412  C  CG    . GLU B 1  209  ? -14.099 33.712  127.637 1.00 60.53  ? 209  GLU B CG    1 
ATOM   3413  C  CD    . GLU B 1  209  ? -15.494 34.186  127.998 1.00 59.83  ? 209  GLU B CD    1 
ATOM   3414  O  OE1   . GLU B 1  209  ? -15.663 35.390  128.288 1.00 56.25  ? 209  GLU B OE1   1 
ATOM   3415  O  OE2   . GLU B 1  209  ? -16.423 33.350  127.986 1.00 58.61  ? 209  GLU B OE2   1 
ATOM   3416  N  N     . ALA B 1  210  ? -13.398 29.414  126.192 1.00 54.11  ? 210  ALA B N     1 
ATOM   3417  C  CA    . ALA B 1  210  ? -13.320 27.962  126.309 1.00 53.26  ? 210  ALA B CA    1 
ATOM   3418  C  C     . ALA B 1  210  ? -11.921 27.456  125.979 1.00 53.58  ? 210  ALA B C     1 
ATOM   3419  O  O     . ALA B 1  210  ? -11.368 26.613  126.698 1.00 53.00  ? 210  ALA B O     1 
ATOM   3420  C  CB    . ALA B 1  210  ? -14.360 27.309  125.399 1.00 49.22  ? 210  ALA B CB    1 
ATOM   3421  N  N     . LEU B 1  211  ? -11.327 27.972  124.902 1.00 49.20  ? 211  LEU B N     1 
ATOM   3422  C  CA    . LEU B 1  211  ? -9.991  27.533  124.518 1.00 53.07  ? 211  LEU B CA    1 
ATOM   3423  C  C     . LEU B 1  211  ? -8.963  27.897  125.581 1.00 52.81  ? 211  LEU B C     1 
ATOM   3424  O  O     . LEU B 1  211  ? -8.103  27.076  125.927 1.00 51.55  ? 211  LEU B O     1 
ATOM   3425  C  CB    . LEU B 1  211  ? -9.607  28.142  123.172 1.00 53.93  ? 211  LEU B CB    1 
ATOM   3426  C  CG    . LEU B 1  211  ? -8.228  27.763  122.637 1.00 44.32  ? 211  LEU B CG    1 
ATOM   3427  C  CD1   . LEU B 1  211  ? -8.125  26.260  122.447 1.00 38.26  ? 211  LEU B CD1   1 
ATOM   3428  C  CD2   . LEU B 1  211  ? -7.951  28.490  121.338 1.00 49.24  ? 211  LEU B CD2   1 
ATOM   3429  N  N     . ASN B 1  212  ? -9.024  29.127  126.098 1.00 52.40  ? 212  ASN B N     1 
ATOM   3430  C  CA    . ASN B 1  212  ? -8.075  29.531  127.130 1.00 51.01  ? 212  ASN B CA    1 
ATOM   3431  C  C     . ASN B 1  212  ? -8.208  28.651  128.363 1.00 47.08  ? 212  ASN B C     1 
ATOM   3432  O  O     . ASN B 1  212  ? -7.202  28.204  128.933 1.00 44.27  ? 212  ASN B O     1 
ATOM   3433  C  CB    . ASN B 1  212  ? -8.282  31.001  127.490 1.00 45.44  ? 212  ASN B CB    1 
ATOM   3434  C  CG    . ASN B 1  212  ? -8.028  31.928  126.318 1.00 58.83  ? 212  ASN B CG    1 
ATOM   3435  O  OD1   . ASN B 1  212  ? -7.060  31.759  125.570 1.00 59.02  ? 212  ASN B OD1   1 
ATOM   3436  N  ND2   . ASN B 1  212  ? -8.902  32.911  126.146 1.00 61.32  ? 212  ASN B ND2   1 
ATOM   3437  N  N     . GLN B 1  213  ? -9.447  28.376  128.778 1.00 47.71  ? 213  GLN B N     1 
ATOM   3438  C  CA    . GLN B 1  213  ? -9.663  27.478  129.906 1.00 48.84  ? 213  GLN B CA    1 
ATOM   3439  C  C     . GLN B 1  213  ? -9.060  26.107  129.635 1.00 48.78  ? 213  GLN B C     1 
ATOM   3440  O  O     . GLN B 1  213  ? -8.435  25.510  130.520 1.00 49.84  ? 213  GLN B O     1 
ATOM   3441  C  CB    . GLN B 1  213  ? -11.158 27.359  130.210 1.00 53.27  ? 213  GLN B CB    1 
ATOM   3442  C  CG    . GLN B 1  213  ? -11.818 28.653  130.682 1.00 56.01  ? 213  GLN B CG    1 
ATOM   3443  C  CD    . GLN B 1  213  ? -13.290 28.475  131.023 1.00 54.68  ? 213  GLN B CD    1 
ATOM   3444  O  OE1   . GLN B 1  213  ? -13.748 27.363  131.294 1.00 52.89  ? 213  GLN B OE1   1 
ATOM   3445  N  NE2   . GLN B 1  213  ? -14.039 29.573  131.009 1.00 49.25  ? 213  GLN B NE2   1 
ATOM   3446  N  N     . ALA B 1  214  ? -9.224  25.597  128.410 1.00 48.82  ? 214  ALA B N     1 
ATOM   3447  C  CA    . ALA B 1  214  ? -8.729  24.259  128.096 1.00 47.64  ? 214  ALA B CA    1 
ATOM   3448  C  C     . ALA B 1  214  ? -7.204  24.203  128.130 1.00 49.14  ? 214  ALA B C     1 
ATOM   3449  O  O     . ALA B 1  214  ? -6.622  23.258  128.683 1.00 47.69  ? 214  ALA B O     1 
ATOM   3450  C  CB    . ALA B 1  214  ? -9.257  23.813  126.734 1.00 46.70  ? 214  ALA B CB    1 
ATOM   3451  N  N     . VAL B 1  215  ? -6.537  25.204  127.546 1.00 47.47  ? 215  VAL B N     1 
ATOM   3452  C  CA    . VAL B 1  215  ? -5.075  25.192  127.565 1.00 46.50  ? 215  VAL B CA    1 
ATOM   3453  C  C     . VAL B 1  215  ? -4.563  25.378  128.989 1.00 50.34  ? 215  VAL B C     1 
ATOM   3454  O  O     . VAL B 1  215  ? -3.520  24.818  129.360 1.00 45.11  ? 215  VAL B O     1 
ATOM   3455  C  CB    . VAL B 1  215  ? -4.488  26.245  126.601 1.00 47.97  ? 215  VAL B CB    1 
ATOM   3456  C  CG1   . VAL B 1  215  ? -5.154  26.146  125.238 1.00 50.14  ? 215  VAL B CG1   1 
ATOM   3457  C  CG2   . VAL B 1  215  ? -4.595  27.657  127.163 1.00 49.33  ? 215  VAL B CG2   1 
ATOM   3458  N  N     . GLU B 1  216  ? -5.299  26.126  129.822 1.00 53.18  ? 216  GLU B N     1 
ATOM   3459  C  CA    . GLU B 1  216  ? -4.913  26.257  131.222 1.00 49.59  ? 216  GLU B CA    1 
ATOM   3460  C  C     . GLU B 1  216  ? -5.049  24.929  131.957 1.00 46.30  ? 216  GLU B C     1 
ATOM   3461  O  O     . GLU B 1  216  ? -4.175  24.559  132.751 1.00 47.48  ? 216  GLU B O     1 
ATOM   3462  C  CB    . GLU B 1  216  ? -5.753  27.342  131.893 1.00 52.93  ? 216  GLU B CB    1 
ATOM   3463  C  CG    . GLU B 1  216  ? -5.601  27.421  133.403 1.00 60.43  ? 216  GLU B CG    1 
ATOM   3464  C  CD    . GLU B 1  216  ? -4.182  27.731  133.845 1.00 56.74  ? 216  GLU B CD    1 
ATOM   3465  O  OE1   . GLU B 1  216  ? -3.819  27.333  134.971 1.00 57.95  ? 216  GLU B OE1   1 
ATOM   3466  O  OE2   . GLU B 1  216  ? -3.432  28.370  133.075 1.00 55.82  ? 216  GLU B OE2   1 
ATOM   3467  N  N     . ILE B 1  217  ? -6.142  24.203  131.709 1.00 38.40  ? 217  ILE B N     1 
ATOM   3468  C  CA    . ILE B 1  217  ? -6.304  22.867  132.279 1.00 38.14  ? 217  ILE B CA    1 
ATOM   3469  C  C     . ILE B 1  217  ? -5.125  21.983  131.897 1.00 46.64  ? 217  ILE B C     1 
ATOM   3470  O  O     . ILE B 1  217  ? -4.559  21.263  132.734 1.00 50.49  ? 217  ILE B O     1 
ATOM   3471  C  CB    . ILE B 1  217  ? -7.635  22.251  131.817 1.00 32.60  ? 217  ILE B CB    1 
ATOM   3472  C  CG1   . ILE B 1  217  ? -8.810  23.053  132.368 1.00 32.76  ? 217  ILE B CG1   1 
ATOM   3473  C  CG2   . ILE B 1  217  ? -7.726  20.795  132.244 1.00 35.78  ? 217  ILE B CG2   1 
ATOM   3474  C  CD1   . ILE B 1  217  ? -10.149 22.556  131.894 1.00 36.02  ? 217  ILE B CD1   1 
ATOM   3475  N  N     . LEU B 1  218  ? -4.738  22.026  130.620 1.00 50.06  ? 218  LEU B N     1 
ATOM   3476  C  CA    . LEU B 1  218  ? -3.634  21.190  130.162 1.00 46.32  ? 218  LEU B CA    1 
ATOM   3477  C  C     . LEU B 1  218  ? -2.333  21.566  130.862 1.00 46.23  ? 218  LEU B C     1 
ATOM   3478  O  O     . LEU B 1  218  ? -1.574  20.687  131.285 1.00 45.82  ? 218  LEU B O     1 
ATOM   3479  C  CB    . LEU B 1  218  ? -3.491  21.293  128.642 1.00 50.31  ? 218  LEU B CB    1 
ATOM   3480  C  CG    . LEU B 1  218  ? -2.503  20.347  127.946 1.00 48.38  ? 218  LEU B CG    1 
ATOM   3481  C  CD1   . LEU B 1  218  ? -2.615  18.922  128.476 1.00 45.03  ? 218  LEU B CD1   1 
ATOM   3482  C  CD2   . LEU B 1  218  ? -2.733  20.374  126.445 1.00 37.68  ? 218  LEU B CD2   1 
ATOM   3483  N  N     . ARG B 1  219  ? -2.062  22.868  131.000 1.00 45.42  ? 219  ARG B N     1 
ATOM   3484  C  CA    . ARG B 1  219  ? -0.848  23.299  131.694 1.00 49.78  ? 219  ARG B CA    1 
ATOM   3485  C  C     . ARG B 1  219  ? -0.849  22.833  133.147 1.00 50.42  ? 219  ARG B C     1 
ATOM   3486  O  O     . ARG B 1  219  ? 0.182   22.383  133.678 1.00 47.89  ? 219  ARG B O     1 
ATOM   3487  C  CB    . ARG B 1  219  ? -0.718  24.820  131.611 1.00 45.02  ? 219  ARG B CB    1 
ATOM   3488  C  CG    . ARG B 1  219  ? 0.628   25.363  132.076 1.00 53.38  ? 219  ARG B CG    1 
ATOM   3489  C  CD    . ARG B 1  219  ? 0.493   26.804  132.544 1.00 53.91  ? 219  ARG B CD    1 
ATOM   3490  N  NE    . ARG B 1  219  ? -0.626  26.953  133.473 1.00 59.92  ? 219  ARG B NE    1 
ATOM   3491  C  CZ    . ARG B 1  219  ? -0.580  26.621  134.760 1.00 58.80  ? 219  ARG B CZ    1 
ATOM   3492  N  NH1   . ARG B 1  219  ? 0.533   26.120  135.279 1.00 62.38  ? 219  ARG B NH1   1 
ATOM   3493  N  NH2   . ARG B 1  219  ? -1.647  26.784  135.530 1.00 51.07  ? 219  ARG B NH2   1 
ATOM   3494  N  N     . GLU B 1  220  ? -2.006  22.930  133.806 1.00 55.06  ? 220  GLU B N     1 
ATOM   3495  C  CA    . GLU B 1  220  ? -2.118  22.466  135.183 1.00 57.18  ? 220  GLU B CA    1 
ATOM   3496  C  C     . GLU B 1  220  ? -1.803  20.979  135.285 1.00 55.94  ? 220  GLU B C     1 
ATOM   3497  O  O     . GLU B 1  220  ? -1.107  20.546  136.212 1.00 55.29  ? 220  GLU B O     1 
ATOM   3498  C  CB    . GLU B 1  220  ? -3.518  22.770  135.717 1.00 54.37  ? 220  GLU B CB    1 
ATOM   3499  C  CG    . GLU B 1  220  ? -3.724  22.413  137.177 1.00 67.10  ? 220  GLU B CG    1 
ATOM   3500  C  CD    . GLU B 1  220  ? -5.083  22.842  137.688 1.00 82.09  ? 220  GLU B CD    1 
ATOM   3501  O  OE1   . GLU B 1  220  ? -5.796  23.555  136.948 1.00 72.18  ? 220  GLU B OE1   1 
ATOM   3502  O  OE2   . GLU B 1  220  ? -5.438  22.465  138.827 1.00 85.43  ? 220  GLU B OE2   1 
ATOM   3503  N  N     . HIS B 1  221  ? -2.288  20.182  134.328 1.00 56.55  ? 221  HIS B N     1 
ATOM   3504  C  CA    . HIS B 1  221  ? -1.956  18.759  134.344 1.00 54.47  ? 221  HIS B CA    1 
ATOM   3505  C  C     . HIS B 1  221  ? -0.483  18.514  134.039 1.00 54.37  ? 221  HIS B C     1 
ATOM   3506  O  O     . HIS B 1  221  ? 0.093   17.539  134.533 1.00 53.70  ? 221  HIS B O     1 
ATOM   3507  C  CB    . HIS B 1  221  ? -2.835  17.993  133.358 1.00 52.35  ? 221  HIS B CB    1 
ATOM   3508  C  CG    . HIS B 1  221  ? -4.208  17.705  133.878 1.00 47.43  ? 221  HIS B CG    1 
ATOM   3509  N  ND1   . HIS B 1  221  ? -5.188  18.669  133.963 1.00 45.74  ? 221  HIS B ND1   1 
ATOM   3510  C  CD2   . HIS B 1  221  ? -4.761  16.562  134.347 1.00 49.19  ? 221  HIS B CD2   1 
ATOM   3511  C  CE1   . HIS B 1  221  ? -6.288  18.132  134.459 1.00 55.63  ? 221  HIS B CE1   1 
ATOM   3512  N  NE2   . HIS B 1  221  ? -6.056  16.854  134.700 1.00 53.43  ? 221  HIS B NE2   1 
ATOM   3513  N  N     . LEU B 1  222  ? 0.134   19.373  133.224 1.00 55.11  ? 222  LEU B N     1 
ATOM   3514  C  CA    . LEU B 1  222  ? 1.573   19.271  132.998 1.00 54.74  ? 222  LEU B CA    1 
ATOM   3515  C  C     . LEU B 1  222  ? 2.344   19.475  134.290 1.00 53.69  ? 222  LEU B C     1 
ATOM   3516  O  O     . LEU B 1  222  ? 3.408   18.875  134.484 1.00 48.58  ? 222  LEU B O     1 
ATOM   3517  C  CB    . LEU B 1  222  ? 2.026   20.296  131.957 1.00 51.09  ? 222  LEU B CB    1 
ATOM   3518  C  CG    . LEU B 1  222  ? 1.688   19.957  130.508 1.00 45.54  ? 222  LEU B CG    1 
ATOM   3519  C  CD1   . LEU B 1  222  ? 2.090   21.091  129.584 1.00 39.94  ? 222  LEU B CD1   1 
ATOM   3520  C  CD2   . LEU B 1  222  ? 2.376   18.662  130.116 1.00 44.05  ? 222  LEU B CD2   1 
ATOM   3521  N  N     . THR B 1  223  ? 1.831   20.325  135.177 1.00 54.60  ? 223  THR B N     1 
ATOM   3522  C  CA    . THR B 1  223  ? 2.509   20.522  136.457 1.00 49.49  ? 223  THR B CA    1 
ATOM   3523  C  C     . THR B 1  223  ? 2.413   19.314  137.385 1.00 53.96  ? 223  THR B C     1 
ATOM   3524  O  O     . THR B 1  223  ? 3.061   19.322  138.435 1.00 57.51  ? 223  THR B O     1 
ATOM   3525  C  CB    . THR B 1  223  ? 1.953   21.739  137.192 1.00 40.99  ? 223  THR B CB    1 
ATOM   3526  O  OG1   . THR B 1  223  ? 0.596   21.481  137.568 1.00 55.43  ? 223  THR B OG1   1 
ATOM   3527  C  CG2   . THR B 1  223  ? 2.008   22.971  136.306 1.00 45.53  ? 223  THR B CG2   1 
ATOM   3528  N  N     . TYR B 1  224  ? 1.639   18.285  137.039 1.00 50.99  ? 224  TYR B N     1 
ATOM   3529  C  CA    . TYR B 1  224  ? 1.452   17.148  137.933 1.00 46.47  ? 224  TYR B CA    1 
ATOM   3530  C  C     . TYR B 1  224  ? 2.640   16.190  137.943 1.00 51.52  ? 224  TYR B C     1 
ATOM   3531  O  O     . TYR B 1  224  ? 2.606   15.198  138.674 1.00 54.55  ? 224  TYR B O     1 
ATOM   3532  C  CB    . TYR B 1  224  ? 0.166   16.397  137.567 1.00 53.16  ? 224  TYR B CB    1 
ATOM   3533  C  CG    . TYR B 1  224  ? -1.093  17.169  137.933 1.00 60.60  ? 224  TYR B CG    1 
ATOM   3534  C  CD1   . TYR B 1  224  ? -1.048  18.206  138.859 1.00 54.33  ? 224  TYR B CD1   1 
ATOM   3535  C  CD2   . TYR B 1  224  ? -2.318  16.871  137.347 1.00 61.58  ? 224  TYR B CD2   1 
ATOM   3536  C  CE1   . TYR B 1  224  ? -2.182  18.916  139.194 1.00 59.09  ? 224  TYR B CE1   1 
ATOM   3537  C  CE2   . TYR B 1  224  ? -3.457  17.575  137.680 1.00 55.30  ? 224  TYR B CE2   1 
ATOM   3538  C  CZ    . TYR B 1  224  ? -3.383  18.598  138.602 1.00 62.61  ? 224  TYR B CZ    1 
ATOM   3539  O  OH    . TYR B 1  224  ? -4.513  19.310  138.941 1.00 77.20  ? 224  TYR B OH    1 
ATOM   3540  N  N     . PHE B 1  225  ? 3.669   16.435  137.134 1.00 59.93  ? 225  PHE B N     1 
ATOM   3541  C  CA    . PHE B 1  225  ? 4.949   15.731  137.263 1.00 62.11  ? 225  PHE B CA    1 
ATOM   3542  C  C     . PHE B 1  225  ? 5.945   16.635  137.984 1.00 65.73  ? 225  PHE B C     1 
ATOM   3543  O  O     . PHE B 1  225  ? 6.870   17.180  137.389 1.00 68.61  ? 225  PHE B O     1 
ATOM   3544  C  CB    . PHE B 1  225  ? 5.493   15.332  135.890 1.00 59.06  ? 225  PHE B CB    1 
ATOM   3545  C  CG    . PHE B 1  225  ? 4.462   14.763  134.944 1.00 52.58  ? 225  PHE B CG    1 
ATOM   3546  C  CD1   . PHE B 1  225  ? 3.691   15.599  134.152 1.00 49.48  ? 225  PHE B CD1   1 
ATOM   3547  C  CD2   . PHE B 1  225  ? 4.305   13.391  134.807 1.00 47.25  ? 225  PHE B CD2   1 
ATOM   3548  C  CE1   . PHE B 1  225  ? 2.753   15.083  133.280 1.00 45.07  ? 225  PHE B CE1   1 
ATOM   3549  C  CE2   . PHE B 1  225  ? 3.368   12.872  133.933 1.00 43.22  ? 225  PHE B CE2   1 
ATOM   3550  C  CZ    . PHE B 1  225  ? 2.592   13.720  133.169 1.00 36.57  ? 225  PHE B CZ    1 
ATOM   3551  N  N     . SER B 1  226  ? 5.727   16.816  139.287 1.00 70.35  ? 226  SER B N     1 
ATOM   3552  C  CA    . SER B 1  226  ? 6.628   17.642  140.085 1.00 73.23  ? 226  SER B CA    1 
ATOM   3553  C  C     . SER B 1  226  ? 7.272   16.885  141.239 1.00 73.17  ? 226  SER B C     1 
ATOM   3554  O  O     . SER B 1  226  ? 8.504   16.846  141.330 1.00 72.37  ? 226  SER B O     1 
ATOM   3555  C  CB    . SER B 1  226  ? 5.875   18.862  140.621 1.00 71.78  ? 226  SER B CB    1 
ATOM   3556  O  OG    . SER B 1  226  ? 5.457   19.704  139.562 1.00 69.25  ? 226  SER B OG    1 
ATOM   3557  N  N     . ASN B 1  227  ? 6.488   16.280  142.124 1.00 65.37  ? 227  ASN B N     1 
ATOM   3558  C  CA    . ASN B 1  227  ? 7.021   15.767  143.390 1.00 68.56  ? 227  ASN B CA    1 
ATOM   3559  C  C     . ASN B 1  227  ? 6.661   14.301  143.571 1.00 69.83  ? 227  ASN B C     1 
ATOM   3560  O  O     . ASN B 1  227  ? 5.487   13.986  143.841 1.00 70.46  ? 227  ASN B O     1 
ATOM   3561  C  CB    . ASN B 1  227  ? 6.499   16.603  144.563 1.00 71.50  ? 227  ASN B CB    1 
ATOM   3562  C  CG    . ASN B 1  227  ? 7.074   16.181  145.902 1.00 72.63  ? 227  ASN B CG    1 
ATOM   3563  O  OD1   . ASN B 1  227  ? 6.452   15.418  146.643 1.00 71.75  ? 227  ASN B OD1   1 
ATOM   3564  N  ND2   . ASN B 1  227  ? 8.266   16.676  146.220 1.00 70.43  ? 227  ASN B ND2   1 
ATOM   3565  N  N     . PRO B 1  228  ? 7.613   13.370  143.428 1.00 70.39  ? 228  PRO B N     1 
ATOM   3566  C  CA    . PRO B 1  228  ? 7.376   11.943  143.680 1.00 62.54  ? 228  PRO B CA    1 
ATOM   3567  C  C     . PRO B 1  228  ? 7.115   11.647  145.155 1.00 54.68  ? 228  PRO B C     1 
ATOM   3568  O  O     . PRO B 1  228  ? 6.358   10.728  145.467 1.00 52.21  ? 228  PRO B O     1 
ATOM   3569  C  CB    . PRO B 1  228  ? 8.676   11.281  143.211 1.00 58.80  ? 228  PRO B CB    1 
ATOM   3570  C  CG    . PRO B 1  228  ? 9.290   12.270  142.262 1.00 57.17  ? 228  PRO B CG    1 
ATOM   3571  C  CD    . PRO B 1  228  ? 8.930   13.613  142.817 1.00 61.67  ? 228  PRO B CD    1 
ATOM   3572  N  N     . MET C 2  1    ? 18.487  -17.770 113.861 1.00 105.65 ? 1    MET C N     1 
ATOM   3573  C  CA    . MET C 2  1    ? 17.249  -18.103 114.556 1.00 96.99  ? 1    MET C CA    1 
ATOM   3574  C  C     . MET C 2  1    ? 16.713  -19.459 114.103 1.00 90.14  ? 1    MET C C     1 
ATOM   3575  O  O     . MET C 2  1    ? 17.012  -19.919 112.999 1.00 86.75  ? 1    MET C O     1 
ATOM   3576  C  CB    . MET C 2  1    ? 16.202  -17.010 114.334 1.00 86.88  ? 1    MET C CB    1 
ATOM   3577  C  CG    . MET C 2  1    ? 15.992  -16.626 112.879 1.00 80.14  ? 1    MET C CG    1 
ATOM   3578  S  SD    . MET C 2  1    ? 14.969  -15.145 112.714 1.00 116.31 ? 1    MET C SD    1 
ATOM   3579  C  CE    . MET C 2  1    ? 16.036  -13.898 113.434 1.00 102.79 ? 1    MET C CE    1 
ATOM   3580  N  N     . GLU C 2  2    ? 15.921  -20.093 114.967 1.00 82.09  ? 2    GLU C N     1 
ATOM   3581  C  CA    . GLU C 2  2    ? 15.435  -21.438 114.694 1.00 84.33  ? 2    GLU C CA    1 
ATOM   3582  C  C     . GLU C 2  2    ? 14.471  -21.441 113.513 1.00 76.69  ? 2    GLU C C     1 
ATOM   3583  O  O     . GLU C 2  2    ? 13.589  -20.582 113.400 1.00 69.05  ? 2    GLU C O     1 
ATOM   3584  C  CB    . GLU C 2  2    ? 14.754  -22.021 115.934 1.00 86.02  ? 2    GLU C CB    1 
ATOM   3585  C  CG    . GLU C 2  2    ? 14.194  -23.426 115.732 1.00 87.00  ? 2    GLU C CG    1 
ATOM   3586  C  CD    . GLU C 2  2    ? 13.560  -23.993 116.987 1.00 92.40  ? 2    GLU C CD    1 
ATOM   3587  O  OE1   . GLU C 2  2    ? 14.219  -24.795 117.681 1.00 103.75 ? 2    GLU C OE1   1 
ATOM   3588  O  OE2   . GLU C 2  2    ? 12.403  -23.628 117.284 1.00 94.52  ? 2    GLU C OE2   1 
ATOM   3589  N  N     . ILE C 2  3    ? 14.644  -22.423 112.634 1.00 70.10  ? 3    ILE C N     1 
ATOM   3590  C  CA    . ILE C 2  3    ? 13.835  -22.574 111.432 1.00 61.09  ? 3    ILE C CA    1 
ATOM   3591  C  C     . ILE C 2  3    ? 13.002  -23.836 111.598 1.00 56.84  ? 3    ILE C C     1 
ATOM   3592  O  O     . ILE C 2  3    ? 13.541  -24.949 111.625 1.00 62.16  ? 3    ILE C O     1 
ATOM   3593  C  CB    . ILE C 2  3    ? 14.704  -22.646 110.169 1.00 64.15  ? 3    ILE C CB    1 
ATOM   3594  C  CG1   . ILE C 2  3    ? 15.555  -21.380 110.030 1.00 69.03  ? 3    ILE C CG1   1 
ATOM   3595  C  CG2   . ILE C 2  3    ? 13.843  -22.858 108.933 1.00 49.24  ? 3    ILE C CG2   1 
ATOM   3596  C  CD1   . ILE C 2  3    ? 16.456  -21.381 108.809 1.00 69.89  ? 3    ILE C CD1   1 
ATOM   3597  N  N     . LYS C 2  4    ? 11.689  -23.670 111.715 1.00 49.90  ? 4    LYS C N     1 
ATOM   3598  C  CA    . LYS C 2  4    ? 10.770  -24.799 111.775 1.00 51.75  ? 4    LYS C CA    1 
ATOM   3599  C  C     . LYS C 2  4    ? 10.203  -25.047 110.385 1.00 55.16  ? 4    LYS C C     1 
ATOM   3600  O  O     . LYS C 2  4    ? 9.661   -24.131 109.760 1.00 55.51  ? 4    LYS C O     1 
ATOM   3601  C  CB    . LYS C 2  4    ? 9.639   -24.546 112.772 1.00 56.96  ? 4    LYS C CB    1 
ATOM   3602  C  CG    . LYS C 2  4    ? 8.759   -25.766 113.021 1.00 64.25  ? 4    LYS C CG    1 
ATOM   3603  C  CD    . LYS C 2  4    ? 7.563   -25.433 113.908 1.00 72.32  ? 4    LYS C CD    1 
ATOM   3604  C  CE    . LYS C 2  4    ? 6.820   -26.694 114.352 1.00 73.99  ? 4    LYS C CE    1 
ATOM   3605  N  NZ    . LYS C 2  4    ? 6.356   -27.537 113.208 1.00 61.08  ? 4    LYS C NZ    1 
ATOM   3606  N  N     . ARG C 2  5    ? 10.347  -26.272 109.889 1.00 49.24  ? 5    ARG C N     1 
ATOM   3607  C  CA    . ARG C 2  5    ? 9.835   -26.621 108.575 1.00 48.36  ? 5    ARG C CA    1 
ATOM   3608  C  C     . ARG C 2  5    ? 8.642   -27.557 108.714 1.00 50.41  ? 5    ARG C C     1 
ATOM   3609  O  O     . ARG C 2  5    ? 8.570   -28.366 109.643 1.00 59.59  ? 5    ARG C O     1 
ATOM   3610  C  CB    . ARG C 2  5    ? 10.920  -27.264 107.700 1.00 58.62  ? 5    ARG C CB    1 
ATOM   3611  C  CG    . ARG C 2  5    ? 11.322  -28.674 108.093 1.00 67.46  ? 5    ARG C CG    1 
ATOM   3612  C  CD    . ARG C 2  5    ? 12.330  -29.266 107.108 1.00 75.93  ? 5    ARG C CD    1 
ATOM   3613  N  NE    . ARG C 2  5    ? 11.862  -29.219 105.723 1.00 74.76  ? 5    ARG C NE    1 
ATOM   3614  C  CZ    . ARG C 2  5    ? 12.497  -28.594 104.734 1.00 77.11  ? 5    ARG C CZ    1 
ATOM   3615  N  NH1   . ARG C 2  5    ? 13.643  -27.965 104.966 1.00 68.63  ? 5    ARG C NH1   1 
ATOM   3616  N  NH2   . ARG C 2  5    ? 11.992  -28.607 103.506 1.00 74.63  ? 5    ARG C NH2   1 
ATOM   3617  N  N     . PHE C 2  6    ? 7.697   -27.424 107.791 1.00 49.26  ? 6    PHE C N     1 
ATOM   3618  C  CA    . PHE C 2  6    ? 6.488   -28.232 107.751 1.00 53.95  ? 6    PHE C CA    1 
ATOM   3619  C  C     . PHE C 2  6    ? 6.544   -29.180 106.555 1.00 64.00  ? 6    PHE C C     1 
ATOM   3620  O  O     . PHE C 2  6    ? 7.516   -29.208 105.793 1.00 60.57  ? 6    PHE C O     1 
ATOM   3621  C  CB    . PHE C 2  6    ? 5.245   -27.336 107.693 1.00 52.57  ? 6    PHE C CB    1 
ATOM   3622  C  CG    . PHE C 2  6    ? 5.148   -26.348 108.826 1.00 51.73  ? 6    PHE C CG    1 
ATOM   3623  C  CD1   . PHE C 2  6    ? 4.490   -26.678 109.999 1.00 56.29  ? 6    PHE C CD1   1 
ATOM   3624  C  CD2   . PHE C 2  6    ? 5.707   -25.084 108.714 1.00 50.97  ? 6    PHE C CD2   1 
ATOM   3625  C  CE1   . PHE C 2  6    ? 4.397   -25.770 111.042 1.00 56.11  ? 6    PHE C CE1   1 
ATOM   3626  C  CE2   . PHE C 2  6    ? 5.617   -24.171 109.754 1.00 52.41  ? 6    PHE C CE2   1 
ATOM   3627  C  CZ    . PHE C 2  6    ? 4.961   -24.515 110.918 1.00 52.32  ? 6    PHE C CZ    1 
ATOM   3628  N  N     . GLY C 2  7    ? 5.483   -29.967 106.394 1.00 67.22  ? 7    GLY C N     1 
ATOM   3629  C  CA    . GLY C 2  7    ? 5.366   -30.839 105.242 1.00 68.98  ? 7    GLY C CA    1 
ATOM   3630  C  C     . GLY C 2  7    ? 5.688   -32.292 105.512 1.00 75.61  ? 7    GLY C C     1 
ATOM   3631  O  O     . GLY C 2  7    ? 6.682   -32.605 106.173 1.00 84.33  ? 7    GLY C O     1 
ATOM   3632  N  N     . ARG C 2  8    ? 4.858   -33.191 104.987 1.00 80.10  ? 8    ARG C N     1 
ATOM   3633  C  CA    . ARG C 2  8    ? 5.026   -34.621 105.191 1.00 85.62  ? 8    ARG C CA    1 
ATOM   3634  C  C     . ARG C 2  8    ? 5.533   -35.345 103.953 1.00 85.34  ? 8    ARG C C     1 
ATOM   3635  O  O     . ARG C 2  8    ? 5.714   -36.567 104.003 1.00 84.48  ? 8    ARG C O     1 
ATOM   3636  C  CB    . ARG C 2  8    ? 3.702   -35.250 105.645 1.00 93.84  ? 8    ARG C CB    1 
ATOM   3637  C  CG    . ARG C 2  8    ? 3.187   -34.715 106.971 1.00 97.18  ? 8    ARG C CG    1 
ATOM   3638  C  CD    . ARG C 2  8    ? 2.036   -35.553 107.504 1.00 113.89 ? 8    ARG C CD    1 
ATOM   3639  N  NE    . ARG C 2  8    ? 1.576   -35.075 108.805 1.00 134.39 ? 8    ARG C NE    1 
ATOM   3640  C  CZ    . ARG C 2  8    ? 0.631   -35.667 109.529 1.00 135.96 ? 8    ARG C CZ    1 
ATOM   3641  N  NH1   . ARG C 2  8    ? 0.041   -36.767 109.081 1.00 132.76 ? 8    ARG C NH1   1 
ATOM   3642  N  NH2   . ARG C 2  8    ? 0.277   -35.160 110.703 1.00 133.48 ? 8    ARG C NH2   1 
ATOM   3643  N  N     . ILE C 2  9    ? 5.773   -34.635 102.851 1.00 88.70  ? 9    ILE C N     1 
ATOM   3644  C  CA    . ILE C 2  9    ? 6.203   -35.244 101.595 1.00 87.32  ? 9    ILE C CA    1 
ATOM   3645  C  C     . ILE C 2  9    ? 7.721   -35.166 101.506 1.00 74.33  ? 9    ILE C C     1 
ATOM   3646  O  O     . ILE C 2  9    ? 8.292   -34.071 101.439 1.00 68.07  ? 9    ILE C O     1 
ATOM   3647  C  CB    . ILE C 2  9    ? 5.549   -34.560 100.384 1.00 83.28  ? 9    ILE C CB    1 
ATOM   3648  C  CG1   . ILE C 2  9    ? 4.024   -34.654 100.476 1.00 79.61  ? 9    ILE C CG1   1 
ATOM   3649  C  CG2   . ILE C 2  9    ? 6.054   -35.176 99.083  1.00 74.43  ? 9    ILE C CG2   1 
ATOM   3650  C  CD1   . ILE C 2  9    ? 3.300   -33.980 99.331  1.00 66.61  ? 9    ILE C CD1   1 
ATOM   3651  N  N     . ARG C 2  10   ? 8.371   -36.326 101.493 1.00 75.47  ? 10   ARG C N     1 
ATOM   3652  C  CA    . ARG C 2  10   ? 9.821   -36.408 101.372 1.00 85.79  ? 10   ARG C CA    1 
ATOM   3653  C  C     . ARG C 2  10   ? 10.195  -36.512 99.896  1.00 85.20  ? 10   ARG C C     1 
ATOM   3654  O  O     . ARG C 2  10   ? 9.820   -37.479 99.223  1.00 89.10  ? 10   ARG C O     1 
ATOM   3655  C  CB    . ARG C 2  10   ? 10.355  -37.607 102.156 1.00 89.55  ? 10   ARG C CB    1 
ATOM   3656  C  CG    . ARG C 2  10   ? 11.834  -37.905 101.937 1.00 87.74  ? 10   ARG C CG    1 
ATOM   3657  C  CD    . ARG C 2  10   ? 12.200  -39.273 102.498 1.00 92.38  ? 10   ARG C CD    1 
ATOM   3658  N  NE    . ARG C 2  10   ? 11.399  -40.341 101.900 1.00 95.93  ? 10   ARG C NE    1 
ATOM   3659  C  CZ    . ARG C 2  10   ? 11.802  -41.104 100.888 1.00 89.84  ? 10   ARG C CZ    1 
ATOM   3660  N  NH1   . ARG C 2  10   ? 11.003  -42.050 100.407 1.00 81.48  ? 10   ARG C NH1   1 
ATOM   3661  N  NH2   . ARG C 2  10   ? 13.005  -40.925 100.359 1.00 78.88  ? 10   ARG C NH2   1 
ATOM   3662  N  N     . GLU C 2  11   ? 10.927  -35.518 99.395  1.00 80.91  ? 11   GLU C N     1 
ATOM   3663  C  CA    . GLU C 2  11   ? 11.326  -35.520 97.994  1.00 67.38  ? 11   GLU C CA    1 
ATOM   3664  C  C     . GLU C 2  11   ? 12.433  -36.540 97.763  1.00 60.55  ? 11   GLU C C     1 
ATOM   3665  O  O     . GLU C 2  11   ? 13.459  -36.529 98.449  1.00 58.24  ? 11   GLU C O     1 
ATOM   3666  C  CB    . GLU C 2  11   ? 11.788  -34.128 97.562  1.00 64.28  ? 11   GLU C CB    1 
ATOM   3667  C  CG    . GLU C 2  11   ? 10.663  -33.214 97.089  1.00 62.18  ? 11   GLU C CG    1 
ATOM   3668  C  CD    . GLU C 2  11   ? 10.196  -32.247 98.161  1.00 67.02  ? 11   GLU C CD    1 
ATOM   3669  O  OE1   . GLU C 2  11   ? 10.950  -32.032 99.133  1.00 73.60  ? 11   GLU C OE1   1 
ATOM   3670  O  OE2   . GLU C 2  11   ? 9.078   -31.702 98.030  1.00 62.82  ? 11   GLU C OE2   1 
ATOM   3671  N  N     . VAL C 2  12   ? 12.217  -37.425 96.790  1.00 59.22  ? 12   VAL C N     1 
ATOM   3672  C  CA    . VAL C 2  12   ? 13.190  -38.477 96.507  1.00 66.73  ? 12   VAL C CA    1 
ATOM   3673  C  C     . VAL C 2  12   ? 14.453  -37.890 95.889  1.00 63.63  ? 12   VAL C C     1 
ATOM   3674  O  O     . VAL C 2  12   ? 15.574  -38.220 96.294  1.00 66.11  ? 12   VAL C O     1 
ATOM   3675  C  CB    . VAL C 2  12   ? 12.562  -39.551 95.603  1.00 60.85  ? 12   VAL C CB    1 
ATOM   3676  C  CG1   . VAL C 2  12   ? 13.641  -40.402 94.957  1.00 57.34  ? 12   VAL C CG1   1 
ATOM   3677  C  CG2   . VAL C 2  12   ? 11.623  -40.417 96.416  1.00 73.34  ? 12   VAL C CG2   1 
ATOM   3678  N  N     . ILE C 2  13   ? 14.292  -37.011 94.906  1.00 57.51  ? 13   ILE C N     1 
ATOM   3679  C  CA    . ILE C 2  13   ? 15.430  -36.430 94.200  1.00 50.04  ? 13   ILE C CA    1 
ATOM   3680  C  C     . ILE C 2  13   ? 15.447  -34.921 94.412  1.00 49.08  ? 13   ILE C C     1 
ATOM   3681  O  O     . ILE C 2  13   ? 14.383  -34.302 94.560  1.00 49.18  ? 13   ILE C O     1 
ATOM   3682  C  CB    . ILE C 2  13   ? 15.388  -36.778 92.704  1.00 44.62  ? 13   ILE C CB    1 
ATOM   3683  C  CG1   . ILE C 2  13   ? 14.069  -36.316 92.083  1.00 43.97  ? 13   ILE C CG1   1 
ATOM   3684  C  CG2   . ILE C 2  13   ? 15.578  -38.269 92.506  1.00 51.26  ? 13   ILE C CG2   1 
ATOM   3685  C  CD1   . ILE C 2  13   ? 13.932  -36.659 90.616  1.00 48.52  ? 13   ILE C CD1   1 
ATOM   3686  N  N     . PRO C 2  14   ? 16.616  -34.295 94.446  1.00 45.33  ? 14   PRO C N     1 
ATOM   3687  C  CA    . PRO C 2  14   ? 16.694  -32.835 94.530  1.00 47.38  ? 14   PRO C CA    1 
ATOM   3688  C  C     . PRO C 2  14   ? 16.518  -32.213 93.148  1.00 46.81  ? 14   PRO C C     1 
ATOM   3689  O  O     . PRO C 2  14   ? 16.379  -32.900 92.138  1.00 47.55  ? 14   PRO C O     1 
ATOM   3690  C  CB    . PRO C 2  14   ? 18.103  -32.600 95.075  1.00 44.81  ? 14   PRO C CB    1 
ATOM   3691  C  CG    . PRO C 2  14   ? 18.888  -33.730 94.507  1.00 37.46  ? 14   PRO C CG    1 
ATOM   3692  C  CD    . PRO C 2  14   ? 17.949  -34.917 94.486  1.00 44.83  ? 14   PRO C CD    1 
ATOM   3693  N  N     . LEU C 2  15   ? 16.542  -30.891 93.117  1.00 45.58  ? 15   LEU C N     1 
ATOM   3694  C  CA    . LEU C 2  15   ? 16.413  -30.182 91.851  1.00 44.05  ? 15   LEU C CA    1 
ATOM   3695  C  C     . LEU C 2  15   ? 17.673  -30.380 91.018  1.00 42.80  ? 15   LEU C C     1 
ATOM   3696  O  O     . LEU C 2  15   ? 18.785  -30.286 91.552  1.00 43.63  ? 15   LEU C O     1 
ATOM   3697  C  CB    . LEU C 2  15   ? 16.165  -28.698 92.094  1.00 47.44  ? 15   LEU C CB    1 
ATOM   3698  C  CG    . LEU C 2  15   ? 14.808  -28.359 92.706  1.00 41.51  ? 15   LEU C CG    1 
ATOM   3699  C  CD1   . LEU C 2  15   ? 14.752  -26.892 93.081  1.00 33.28  ? 15   LEU C CD1   1 
ATOM   3700  C  CD2   . LEU C 2  15   ? 13.699  -28.716 91.732  1.00 35.55  ? 15   LEU C CD2   1 
ATOM   3701  N  N     . PRO C 2  16   ? 17.548  -30.660 89.723  1.00 40.51  ? 16   PRO C N     1 
ATOM   3702  C  CA    . PRO C 2  16   ? 18.733  -30.796 88.864  1.00 41.43  ? 16   PRO C CA    1 
ATOM   3703  C  C     . PRO C 2  16   ? 19.440  -29.463 88.708  1.00 44.09  ? 16   PRO C C     1 
ATOM   3704  O  O     . PRO C 2  16   ? 18.884  -28.418 89.081  1.00 44.96  ? 16   PRO C O     1 
ATOM   3705  C  CB    . PRO C 2  16   ? 18.144  -31.281 87.531  1.00 40.06  ? 16   PRO C CB    1 
ATOM   3706  C  CG    . PRO C 2  16   ? 16.731  -30.795 87.552  1.00 43.81  ? 16   PRO C CG    1 
ATOM   3707  C  CD    . PRO C 2  16   ? 16.294  -30.878 88.983  1.00 39.96  ? 16   PRO C CD    1 
ATOM   3708  N  N     . PRO C 2  17   ? 20.668  -29.450 88.185  1.00 41.13  ? 17   PRO C N     1 
ATOM   3709  C  CA    . PRO C 2  17   ? 21.361  -28.168 87.979  1.00 43.61  ? 17   PRO C CA    1 
ATOM   3710  C  C     . PRO C 2  17   ? 20.535  -27.249 87.096  1.00 42.98  ? 17   PRO C C     1 
ATOM   3711  O  O     . PRO C 2  17   ? 20.282  -27.540 85.927  1.00 40.17  ? 17   PRO C O     1 
ATOM   3712  C  CB    . PRO C 2  17   ? 22.674  -28.580 87.308  1.00 42.78  ? 17   PRO C CB    1 
ATOM   3713  C  CG    . PRO C 2  17   ? 22.900  -29.976 87.765  1.00 38.23  ? 17   PRO C CG    1 
ATOM   3714  C  CD    . PRO C 2  17   ? 21.530  -30.596 87.848  1.00 39.76  ? 17   PRO C CD    1 
ATOM   3715  N  N     . LEU C 2  18   ? 20.113  -26.124 87.671  1.00 45.01  ? 18   LEU C N     1 
ATOM   3716  C  CA    . LEU C 2  18   ? 19.083  -25.305 87.046  1.00 43.61  ? 18   LEU C CA    1 
ATOM   3717  C  C     . LEU C 2  18   ? 19.576  -24.586 85.796  1.00 41.57  ? 18   LEU C C     1 
ATOM   3718  O  O     . LEU C 2  18   ? 18.752  -24.134 84.995  1.00 40.57  ? 18   LEU C O     1 
ATOM   3719  C  CB    . LEU C 2  18   ? 18.538  -24.300 88.066  1.00 46.08  ? 18   LEU C CB    1 
ATOM   3720  C  CG    . LEU C 2  18   ? 18.079  -24.914 89.399  1.00 38.69  ? 18   LEU C CG    1 
ATOM   3721  C  CD1   . LEU C 2  18   ? 17.781  -23.834 90.432  1.00 29.60  ? 18   LEU C CD1   1 
ATOM   3722  C  CD2   . LEU C 2  18   ? 16.869  -25.823 89.207  1.00 33.02  ? 18   LEU C CD2   1 
ATOM   3723  N  N     . THR C 2  19   ? 20.890  -24.477 85.605  1.00 42.01  ? 19   THR C N     1 
ATOM   3724  C  CA    . THR C 2  19   ? 21.459  -23.868 84.412  1.00 39.87  ? 19   THR C CA    1 
ATOM   3725  C  C     . THR C 2  19   ? 21.884  -24.897 83.374  1.00 38.40  ? 19   THR C C     1 
ATOM   3726  O  O     . THR C 2  19   ? 22.518  -24.527 82.379  1.00 34.09  ? 19   THR C O     1 
ATOM   3727  C  CB    . THR C 2  19   ? 22.656  -22.993 84.781  1.00 39.55  ? 19   THR C CB    1 
ATOM   3728  O  OG1   . THR C 2  19   ? 23.637  -23.790 85.454  1.00 40.77  ? 19   THR C OG1   1 
ATOM   3729  C  CG2   . THR C 2  19   ? 22.224  -21.852 85.692  1.00 39.23  ? 19   THR C CG2   1 
ATOM   3730  N  N     . GLU C 2  20   ? 21.553  -26.176 83.581  1.00 38.18  ? 20   GLU C N     1 
ATOM   3731  C  CA    . GLU C 2  20   ? 22.050  -27.222 82.692  1.00 37.08  ? 20   GLU C CA    1 
ATOM   3732  C  C     . GLU C 2  20   ? 21.511  -27.060 81.280  1.00 39.20  ? 20   GLU C C     1 
ATOM   3733  O  O     . GLU C 2  20   ? 22.202  -27.406 80.314  1.00 41.29  ? 20   GLU C O     1 
ATOM   3734  C  CB    . GLU C 2  20   ? 21.694  -28.608 83.236  1.00 40.65  ? 20   GLU C CB    1 
ATOM   3735  C  CG    . GLU C 2  20   ? 20.224  -28.993 83.112  1.00 46.78  ? 20   GLU C CG    1 
ATOM   3736  C  CD    . GLU C 2  20   ? 19.945  -30.398 83.618  1.00 48.27  ? 20   GLU C CD    1 
ATOM   3737  O  OE1   . GLU C 2  20   ? 20.853  -31.253 83.540  1.00 38.07  ? 20   GLU C OE1   1 
ATOM   3738  O  OE2   . GLU C 2  20   ? 18.819  -30.644 84.101  1.00 48.09  ? 20   GLU C OE2   1 
ATOM   3739  N  N     . ILE C 2  21   ? 20.299  -26.512 81.140  1.00 39.96  ? 21   ILE C N     1 
ATOM   3740  C  CA    . ILE C 2  21   ? 19.707  -26.327 79.819  1.00 30.99  ? 21   ILE C CA    1 
ATOM   3741  C  C     . ILE C 2  21   ? 20.605  -25.468 78.943  1.00 33.87  ? 21   ILE C C     1 
ATOM   3742  O  O     . ILE C 2  21   ? 20.611  -25.612 77.716  1.00 40.99  ? 21   ILE C O     1 
ATOM   3743  C  CB    . ILE C 2  21   ? 18.295  -25.725 79.952  1.00 30.64  ? 21   ILE C CB    1 
ATOM   3744  C  CG1   . ILE C 2  21   ? 17.566  -25.774 78.610  1.00 29.62  ? 21   ILE C CG1   1 
ATOM   3745  C  CG2   . ILE C 2  21   ? 18.365  -24.297 80.466  1.00 30.96  ? 21   ILE C CG2   1 
ATOM   3746  C  CD1   . ILE C 2  21   ? 16.241  -25.064 78.616  1.00 28.76  ? 21   ILE C CD1   1 
ATOM   3747  N  N     . GLN C 2  22   ? 21.395  -24.585 79.552  1.00 34.95  ? 22   GLN C N     1 
ATOM   3748  C  CA    . GLN C 2  22   ? 22.359  -23.764 78.828  1.00 36.96  ? 22   GLN C CA    1 
ATOM   3749  C  C     . GLN C 2  22   ? 23.729  -24.434 78.755  1.00 39.98  ? 22   GLN C C     1 
ATOM   3750  O  O     . GLN C 2  22   ? 24.290  -24.609 77.663  1.00 41.77  ? 22   GLN C O     1 
ATOM   3751  C  CB    . GLN C 2  22   ? 22.489  -22.397 79.505  1.00 29.30  ? 22   GLN C CB    1 
ATOM   3752  C  CG    . GLN C 2  22   ? 21.197  -21.610 79.603  1.00 24.84  ? 22   GLN C CG    1 
ATOM   3753  C  CD    . GLN C 2  22   ? 20.980  -20.690 78.420  1.00 34.11  ? 22   GLN C CD    1 
ATOM   3754  O  OE1   . GLN C 2  22   ? 21.932  -20.250 77.772  1.00 39.25  ? 22   GLN C OE1   1 
ATOM   3755  N  NE2   . GLN C 2  22   ? 19.720  -20.393 78.132  1.00 37.92  ? 22   GLN C NE2   1 
ATOM   3756  N  N     . VAL C 2  23   ? 24.267  -24.813 79.918  1.00 33.01  ? 23   VAL C N     1 
ATOM   3757  C  CA    . VAL C 2  23   ? 25.650  -25.273 79.999  1.00 35.54  ? 23   VAL C CA    1 
ATOM   3758  C  C     . VAL C 2  23   ? 25.835  -26.556 79.207  1.00 40.36  ? 23   VAL C C     1 
ATOM   3759  O  O     . VAL C 2  23   ? 26.727  -26.653 78.356  1.00 41.27  ? 23   VAL C O     1 
ATOM   3760  C  CB    . VAL C 2  23   ? 26.074  -25.452 81.467  1.00 34.15  ? 23   VAL C CB    1 
ATOM   3761  C  CG1   . VAL C 2  23   ? 27.307  -26.335 81.563  1.00 43.66  ? 23   VAL C CG1   1 
ATOM   3762  C  CG2   . VAL C 2  23   ? 26.348  -24.099 82.098  1.00 40.51  ? 23   VAL C CG2   1 
ATOM   3763  N  N     . GLU C 2  24   ? 25.004  -27.566 79.477  1.00 40.61  ? 24   GLU C N     1 
ATOM   3764  C  CA    . GLU C 2  24   ? 25.193  -28.847 78.809  1.00 38.14  ? 24   GLU C CA    1 
ATOM   3765  C  C     . GLU C 2  24   ? 24.889  -28.749 77.323  1.00 40.70  ? 24   GLU C C     1 
ATOM   3766  O  O     . GLU C 2  24   ? 25.540  -29.420 76.520  1.00 52.36  ? 24   GLU C O     1 
ATOM   3767  C  CB    . GLU C 2  24   ? 24.332  -29.922 79.470  1.00 38.85  ? 24   GLU C CB    1 
ATOM   3768  C  CG    . GLU C 2  24   ? 24.829  -30.343 80.848  1.00 50.24  ? 24   GLU C CG    1 
ATOM   3769  C  CD    . GLU C 2  24   ? 26.304  -30.722 80.852  1.00 62.53  ? 24   GLU C CD    1 
ATOM   3770  O  OE1   . GLU C 2  24   ? 27.027  -30.300 81.783  1.00 54.82  ? 24   GLU C OE1   1 
ATOM   3771  O  OE2   . GLU C 2  24   ? 26.740  -31.438 79.924  1.00 63.08  ? 24   GLU C OE2   1 
ATOM   3772  N  N     . SER C 2  25   ? 23.936  -27.899 76.935  1.00 39.05  ? 25   SER C N     1 
ATOM   3773  C  CA    . SER C 2  25   ? 23.650  -27.708 75.517  1.00 36.06  ? 25   SER C CA    1 
ATOM   3774  C  C     . SER C 2  25   ? 24.859  -27.136 74.789  1.00 37.34  ? 25   SER C C     1 
ATOM   3775  O  O     . SER C 2  25   ? 25.278  -27.656 73.746  1.00 38.45  ? 25   SER C O     1 
ATOM   3776  C  CB    . SER C 2  25   ? 22.437  -26.794 75.345  1.00 37.39  ? 25   SER C CB    1 
ATOM   3777  O  OG    . SER C 2  25   ? 22.254  -26.443 73.985  1.00 38.25  ? 25   SER C OG    1 
ATOM   3778  N  N     . TYR C 2  26   ? 25.451  -26.071 75.335  1.00 39.19  ? 26   TYR C N     1 
ATOM   3779  C  CA    . TYR C 2  26   ? 26.595  -25.478 74.651  1.00 36.85  ? 26   TYR C CA    1 
ATOM   3780  C  C     . TYR C 2  26   ? 27.822  -26.381 74.721  1.00 40.82  ? 26   TYR C C     1 
ATOM   3781  O  O     . TYR C 2  26   ? 28.617  -26.418 73.774  1.00 45.98  ? 26   TYR C O     1 
ATOM   3782  C  CB    . TYR C 2  26   ? 26.901  -24.098 75.228  1.00 37.00  ? 26   TYR C CB    1 
ATOM   3783  C  CG    . TYR C 2  26   ? 27.509  -23.153 74.217  1.00 39.08  ? 26   TYR C CG    1 
ATOM   3784  C  CD1   . TYR C 2  26   ? 26.792  -22.748 73.097  1.00 33.42  ? 26   TYR C CD1   1 
ATOM   3785  C  CD2   . TYR C 2  26   ? 28.799  -22.666 74.380  1.00 40.92  ? 26   TYR C CD2   1 
ATOM   3786  C  CE1   . TYR C 2  26   ? 27.345  -21.888 72.169  1.00 30.85  ? 26   TYR C CE1   1 
ATOM   3787  C  CE2   . TYR C 2  26   ? 29.357  -21.804 73.457  1.00 38.43  ? 26   TYR C CE2   1 
ATOM   3788  C  CZ    . TYR C 2  26   ? 28.626  -21.421 72.356  1.00 30.85  ? 26   TYR C CZ    1 
ATOM   3789  O  OH    . TYR C 2  26   ? 29.183  -20.564 71.443  1.00 33.35  ? 26   TYR C OH    1 
ATOM   3790  N  N     . ARG C 2  27   ? 27.985  -27.126 75.818  1.00 42.85  ? 27   ARG C N     1 
ATOM   3791  C  CA    . ARG C 2  27   ? 29.096  -28.067 75.922  1.00 40.06  ? 27   ARG C CA    1 
ATOM   3792  C  C     . ARG C 2  27   ? 28.966  -29.171 74.886  1.00 39.21  ? 27   ARG C C     1 
ATOM   3793  O  O     . ARG C 2  27   ? 29.958  -29.568 74.264  1.00 49.40  ? 27   ARG C O     1 
ATOM   3794  C  CB    . ARG C 2  27   ? 29.143  -28.655 77.331  1.00 48.85  ? 27   ARG C CB    1 
ATOM   3795  C  CG    . ARG C 2  27   ? 30.483  -29.232 77.737  1.00 53.95  ? 27   ARG C CG    1 
ATOM   3796  C  CD    . ARG C 2  27   ? 30.337  -30.171 78.926  1.00 57.00  ? 27   ARG C CD    1 
ATOM   3797  N  NE    . ARG C 2  27   ? 30.353  -31.572 78.509  1.00 81.66  ? 27   ARG C NE    1 
ATOM   3798  C  CZ    . ARG C 2  27   ? 29.284  -32.252 78.100  1.00 79.36  ? 27   ARG C CZ    1 
ATOM   3799  N  NH1   . ARG C 2  27   ? 29.407  -33.523 77.738  1.00 84.66  ? 27   ARG C NH1   1 
ATOM   3800  N  NH2   . ARG C 2  27   ? 28.093  -31.668 78.051  1.00 65.90  ? 27   ARG C NH2   1 
ATOM   3801  N  N     . ARG C 2  28   ? 27.746  -29.671 74.686  1.00 40.72  ? 28   ARG C N     1 
ATOM   3802  C  CA    . ARG C 2  28   ? 27.484  -30.621 73.613  1.00 45.91  ? 28   ARG C CA    1 
ATOM   3803  C  C     . ARG C 2  28   ? 27.792  -30.007 72.255  1.00 44.78  ? 28   ARG C C     1 
ATOM   3804  O  O     . ARG C 2  28   ? 28.323  -30.682 71.365  1.00 48.61  ? 28   ARG C O     1 
ATOM   3805  C  CB    . ARG C 2  28   ? 26.023  -31.070 73.679  1.00 51.94  ? 28   ARG C CB    1 
ATOM   3806  C  CG    . ARG C 2  28   ? 25.694  -32.353 72.940  1.00 61.61  ? 28   ARG C CG    1 
ATOM   3807  C  CD    . ARG C 2  28   ? 25.829  -33.560 73.857  1.00 70.95  ? 28   ARG C CD    1 
ATOM   3808  N  NE    . ARG C 2  28   ? 25.158  -34.736 73.309  1.00 88.10  ? 28   ARG C NE    1 
ATOM   3809  C  CZ    . ARG C 2  28   ? 25.711  -35.574 72.437  1.00 84.17  ? 28   ARG C CZ    1 
ATOM   3810  N  NH1   . ARG C 2  28   ? 26.949  -35.363 72.010  1.00 74.56  ? 28   ARG C NH1   1 
ATOM   3811  N  NH2   . ARG C 2  28   ? 25.026  -36.620 71.990  1.00 79.21  ? 28   ARG C NH2   1 
ATOM   3812  N  N     . ALA C 2  29   ? 27.475  -28.721 72.083  1.00 45.13  ? 29   ALA C N     1 
ATOM   3813  C  CA    . ALA C 2  29   ? 27.673  -28.073 70.788  1.00 44.07  ? 29   ALA C CA    1 
ATOM   3814  C  C     . ALA C 2  29   ? 29.152  -27.922 70.446  1.00 39.65  ? 29   ALA C C     1 
ATOM   3815  O  O     . ALA C 2  29   ? 29.558  -28.179 69.306  1.00 41.41  ? 29   ALA C O     1 
ATOM   3816  C  CB    . ALA C 2  29   ? 26.982  -26.711 70.772  1.00 39.59  ? 29   ALA C CB    1 
ATOM   3817  N  N     . LEU C 2  30   ? 29.972  -27.497 71.411  1.00 37.51  ? 30   LEU C N     1 
ATOM   3818  C  CA    . LEU C 2  30   ? 31.373  -27.216 71.105  1.00 42.32  ? 30   LEU C CA    1 
ATOM   3819  C  C     . LEU C 2  30   ? 32.234  -28.472 71.148  1.00 42.94  ? 30   LEU C C     1 
ATOM   3820  O  O     . LEU C 2  30   ? 33.118  -28.643 70.301  1.00 37.18  ? 30   LEU C O     1 
ATOM   3821  C  CB    . LEU C 2  30   ? 31.934  -26.174 72.070  1.00 37.18  ? 30   LEU C CB    1 
ATOM   3822  C  CG    . LEU C 2  30   ? 31.361  -24.760 71.979  1.00 36.35  ? 30   LEU C CG    1 
ATOM   3823  C  CD1   . LEU C 2  30   ? 32.168  -23.805 72.844  1.00 40.87  ? 30   LEU C CD1   1 
ATOM   3824  C  CD2   . LEU C 2  30   ? 31.320  -24.284 70.537  1.00 41.71  ? 30   LEU C CD2   1 
ATOM   3825  N  N     . GLN C 2  31   ? 32.001  -29.348 72.127  1.00 39.96  ? 31   GLN C N     1 
ATOM   3826  C  CA    . GLN C 2  31   ? 32.828  -30.537 72.327  1.00 36.20  ? 31   GLN C CA    1 
ATOM   3827  C  C     . GLN C 2  31   ? 34.300  -30.158 72.461  1.00 31.46  ? 31   GLN C C     1 
ATOM   3828  O  O     . GLN C 2  31   ? 35.185  -30.801 71.894  1.00 32.90  ? 31   GLN C O     1 
ATOM   3829  C  CB    . GLN C 2  31   ? 32.629  -31.548 71.196  1.00 37.05  ? 31   GLN C CB    1 
ATOM   3830  C  CG    . GLN C 2  31   ? 31.304  -32.287 71.232  1.00 42.58  ? 31   GLN C CG    1 
ATOM   3831  C  CD    . GLN C 2  31   ? 31.123  -33.201 70.038  1.00 41.17  ? 31   GLN C CD    1 
ATOM   3832  O  OE1   . GLN C 2  31   ? 31.294  -34.418 70.134  1.00 37.26  ? 31   GLN C OE1   1 
ATOM   3833  N  NE2   . GLN C 2  31   ? 30.779  -32.615 68.899  1.00 42.61  ? 31   GLN C NE2   1 
ATOM   3834  N  N     . ALA C 2  32   ? 34.563  -29.090 73.216  1.00 34.00  ? 32   ALA C N     1 
ATOM   3835  C  CA    . ALA C 2  32   ? 35.929  -28.597 73.352  1.00 34.15  ? 32   ALA C CA    1 
ATOM   3836  C  C     . ALA C 2  32   ? 36.780  -29.513 74.221  1.00 38.94  ? 32   ALA C C     1 
ATOM   3837  O  O     . ALA C 2  32   ? 38.006  -29.540 74.067  1.00 39.15  ? 32   ALA C O     1 
ATOM   3838  C  CB    . ALA C 2  32   ? 35.922  -27.181 73.925  1.00 33.15  ? 32   ALA C CB    1 
ATOM   3839  N  N     . ASP C 2  33   ? 36.158  -30.253 75.143  1.00 45.07  ? 33   ASP C N     1 
ATOM   3840  C  CA    . ASP C 2  33   ? 36.893  -31.188 75.985  1.00 48.07  ? 33   ASP C CA    1 
ATOM   3841  C  C     . ASP C 2  33   ? 37.134  -32.526 75.302  1.00 43.23  ? 33   ASP C C     1 
ATOM   3842  O  O     . ASP C 2  33   ? 38.021  -33.275 75.727  1.00 50.43  ? 33   ASP C O     1 
ATOM   3843  C  CB    . ASP C 2  33   ? 36.150  -31.415 77.304  1.00 52.87  ? 33   ASP C CB    1 
ATOM   3844  C  CG    . ASP C 2  33   ? 36.386  -30.304 78.307  1.00 73.33  ? 33   ASP C CG    1 
ATOM   3845  O  OD1   . ASP C 2  33   ? 36.828  -29.208 77.894  1.00 72.83  ? 33   ASP C OD1   1 
ATOM   3846  O  OD2   . ASP C 2  33   ? 36.141  -30.529 79.512  1.00 90.20  ? 33   ASP C OD2   1 
ATOM   3847  N  N     . VAL C 2  34   ? 36.384  -32.837 74.256  1.00 34.40  ? 34   VAL C N     1 
ATOM   3848  C  CA    . VAL C 2  34   ? 36.493  -34.142 73.604  1.00 35.45  ? 34   VAL C CA    1 
ATOM   3849  C  C     . VAL C 2  34   ? 37.689  -34.124 72.656  1.00 39.01  ? 34   VAL C C     1 
ATOM   3850  O  O     . VAL C 2  34   ? 37.792  -33.212 71.819  1.00 39.65  ? 34   VAL C O     1 
ATOM   3851  C  CB    . VAL C 2  34   ? 35.208  -34.470 72.856  1.00 33.93  ? 34   VAL C CB    1 
ATOM   3852  C  CG1   . VAL C 2  34   ? 35.272  -35.874 72.281  1.00 32.35  ? 34   VAL C CG1   1 
ATOM   3853  C  CG2   . VAL C 2  34   ? 34.014  -34.314 73.779  1.00 34.29  ? 34   VAL C CG2   1 
ATOM   3854  N  N     . PRO C 2  35   ? 38.607  -35.081 72.763  1.00 41.68  ? 35   PRO C N     1 
ATOM   3855  C  CA    . PRO C 2  35   ? 39.646  -35.235 71.740  1.00 42.21  ? 35   PRO C CA    1 
ATOM   3856  C  C     . PRO C 2  35   ? 39.021  -35.438 70.372  1.00 42.07  ? 35   PRO C C     1 
ATOM   3857  O  O     . PRO C 2  35   ? 38.043  -36.187 70.237  1.00 48.32  ? 35   PRO C O     1 
ATOM   3858  C  CB    . PRO C 2  35   ? 40.420  -36.482 72.199  1.00 41.95  ? 35   PRO C CB    1 
ATOM   3859  C  CG    . PRO C 2  35   ? 39.567  -37.120 73.256  1.00 45.34  ? 35   PRO C CG    1 
ATOM   3860  C  CD    . PRO C 2  35   ? 38.794  -36.013 73.884  1.00 42.87  ? 35   PRO C CD    1 
ATOM   3861  N  N     . PRO C 2  36   ? 39.560  -34.786 69.338  1.00 39.46  ? 36   PRO C N     1 
ATOM   3862  C  CA    . PRO C 2  36   ? 38.850  -34.715 68.046  1.00 40.39  ? 36   PRO C CA    1 
ATOM   3863  C  C     . PRO C 2  36   ? 38.415  -36.053 67.463  1.00 47.78  ? 36   PRO C C     1 
ATOM   3864  O  O     . PRO C 2  36   ? 37.346  -36.122 66.843  1.00 51.11  ? 36   PRO C O     1 
ATOM   3865  C  CB    . PRO C 2  36   ? 39.869  -34.012 67.142  1.00 39.39  ? 36   PRO C CB    1 
ATOM   3866  C  CG    . PRO C 2  36   ? 40.672  -33.178 68.074  1.00 48.04  ? 36   PRO C CG    1 
ATOM   3867  C  CD    . PRO C 2  36   ? 40.781  -33.965 69.349  1.00 43.27  ? 36   PRO C CD    1 
ATOM   3868  N  N     . GLU C 2  37   ? 39.203  -37.117 67.636  1.00 48.00  ? 37   GLU C N     1 
ATOM   3869  C  CA    . GLU C 2  37   ? 38.827  -38.406 67.063  1.00 51.77  ? 37   GLU C CA    1 
ATOM   3870  C  C     . GLU C 2  37   ? 37.600  -39.011 67.738  1.00 52.48  ? 37   GLU C C     1 
ATOM   3871  O  O     . GLU C 2  37   ? 36.932  -39.857 67.134  1.00 53.19  ? 37   GLU C O     1 
ATOM   3872  C  CB    . GLU C 2  37   ? 40.000  -39.384 67.144  1.00 52.24  ? 37   GLU C CB    1 
ATOM   3873  C  CG    . GLU C 2  37   ? 40.448  -39.718 68.561  1.00 51.20  ? 37   GLU C CG    1 
ATOM   3874  C  CD    . GLU C 2  37   ? 41.462  -38.736 69.101  1.00 59.51  ? 37   GLU C CD    1 
ATOM   3875  O  OE1   . GLU C 2  37   ? 41.744  -37.733 68.411  1.00 58.80  ? 37   GLU C OE1   1 
ATOM   3876  O  OE2   . GLU C 2  37   ? 41.982  -38.970 70.213  1.00 60.29  ? 37   GLU C OE2   1 
ATOM   3877  N  N     . LYS C 2  38   ? 37.287  -38.593 68.964  1.00 47.19  ? 38   LYS C N     1 
ATOM   3878  C  CA    . LYS C 2  38   ? 36.150  -39.111 69.713  1.00 44.76  ? 38   LYS C CA    1 
ATOM   3879  C  C     . LYS C 2  38   ? 34.902  -38.244 69.585  1.00 44.46  ? 38   LYS C C     1 
ATOM   3880  O  O     . LYS C 2  38   ? 33.882  -38.559 70.204  1.00 43.44  ? 38   LYS C O     1 
ATOM   3881  C  CB    . LYS C 2  38   ? 36.520  -39.255 71.195  1.00 43.67  ? 38   LYS C CB    1 
ATOM   3882  C  CG    . LYS C 2  38   ? 37.746  -40.112 71.463  1.00 38.59  ? 38   LYS C CG    1 
ATOM   3883  C  CD    . LYS C 2  38   ? 37.993  -40.260 72.957  1.00 31.25  ? 38   LYS C CD    1 
ATOM   3884  C  CE    . LYS C 2  38   ? 39.128  -41.232 73.237  1.00 37.11  ? 38   LYS C CE    1 
ATOM   3885  N  NZ    . LYS C 2  38   ? 39.469  -41.298 74.684  1.00 35.89  ? 38   LYS C NZ    1 
ATOM   3886  N  N     . ARG C 2  39   ? 34.956  -37.167 68.805  1.00 44.72  ? 39   ARG C N     1 
ATOM   3887  C  CA    . ARG C 2  39   ? 33.828  -36.250 68.722  1.00 44.51  ? 39   ARG C CA    1 
ATOM   3888  C  C     . ARG C 2  39   ? 32.677  -36.891 67.960  1.00 46.63  ? 39   ARG C C     1 
ATOM   3889  O  O     . ARG C 2  39   ? 32.886  -37.632 66.996  1.00 52.78  ? 39   ARG C O     1 
ATOM   3890  C  CB    . ARG C 2  39   ? 34.248  -34.945 68.043  1.00 40.95  ? 39   ARG C CB    1 
ATOM   3891  C  CG    . ARG C 2  39   ? 35.249  -34.117 68.840  1.00 35.72  ? 39   ARG C CG    1 
ATOM   3892  C  CD    . ARG C 2  39   ? 35.259  -32.671 68.371  1.00 35.34  ? 39   ARG C CD    1 
ATOM   3893  N  NE    . ARG C 2  39   ? 35.991  -31.798 69.284  1.00 34.45  ? 39   ARG C NE    1 
ATOM   3894  C  CZ    . ARG C 2  39   ? 37.071  -31.097 68.954  1.00 36.06  ? 39   ARG C CZ    1 
ATOM   3895  N  NH1   . ARG C 2  39   ? 37.551  -31.153 67.719  1.00 39.11  ? 39   ARG C NH1   1 
ATOM   3896  N  NH2   . ARG C 2  39   ? 37.665  -30.331 69.857  1.00 36.43  ? 39   ARG C NH2   1 
ATOM   3897  N  N     . GLU C 2  40   ? 31.453  -36.610 68.404  1.00 45.24  ? 40   GLU C N     1 
ATOM   3898  C  CA    . GLU C 2  40   ? 30.273  -37.112 67.718  1.00 52.13  ? 40   GLU C CA    1 
ATOM   3899  C  C     . GLU C 2  40   ? 29.932  -36.227 66.518  1.00 57.38  ? 40   GLU C C     1 
ATOM   3900  O  O     . GLU C 2  40   ? 30.443  -35.114 66.363  1.00 56.76  ? 40   GLU C O     1 
ATOM   3901  C  CB    . GLU C 2  40   ? 29.084  -37.191 68.673  1.00 49.63  ? 40   GLU C CB    1 
ATOM   3902  C  CG    . GLU C 2  40   ? 29.236  -38.224 69.772  1.00 59.41  ? 40   GLU C CG    1 
ATOM   3903  C  CD    . GLU C 2  40   ? 27.930  -38.497 70.487  1.00 72.43  ? 40   GLU C CD    1 
ATOM   3904  O  OE1   . GLU C 2  40   ? 26.864  -38.325 69.858  1.00 77.36  ? 40   GLU C OE1   1 
ATOM   3905  O  OE2   . GLU C 2  40   ? 27.968  -38.880 71.677  1.00 74.73  ? 40   GLU C OE2   1 
ATOM   3906  N  N     . ASN C 2  41   ? 29.055  -36.742 65.658  1.00 61.13  ? 41   ASN C N     1 
ATOM   3907  C  CA    . ASN C 2  41   ? 28.600  -36.019 64.477  1.00 61.26  ? 41   ASN C CA    1 
ATOM   3908  C  C     . ASN C 2  41   ? 27.550  -34.959 64.798  1.00 61.93  ? 41   ASN C C     1 
ATOM   3909  O  O     . ASN C 2  41   ? 26.896  -34.464 63.879  1.00 61.71  ? 41   ASN C O     1 
ATOM   3910  C  CB    . ASN C 2  41   ? 28.047  -37.002 63.439  1.00 71.74  ? 41   ASN C CB    1 
ATOM   3911  C  CG    . ASN C 2  41   ? 27.927  -36.386 62.050  1.00 74.22  ? 41   ASN C CG    1 
ATOM   3912  O  OD1   . ASN C 2  41   ? 28.584  -35.393 61.741  1.00 67.33  ? 41   ASN C OD1   1 
ATOM   3913  N  ND2   . ASN C 2  41   ? 27.083  -36.976 61.209  1.00 79.12  ? 41   ASN C ND2   1 
ATOM   3914  N  N     . VAL C 2  42   ? 27.353  -34.630 66.069  1.00 58.97  ? 42   VAL C N     1 
ATOM   3915  C  CA    . VAL C 2  42   ? 26.493  -33.524 66.458  1.00 51.76  ? 42   VAL C CA    1 
ATOM   3916  C  C     . VAL C 2  42   ? 27.331  -32.259 66.630  1.00 49.78  ? 42   VAL C C     1 
ATOM   3917  O  O     . VAL C 2  42   ? 28.562  -32.299 66.712  1.00 55.21  ? 42   VAL C O     1 
ATOM   3918  C  CB    . VAL C 2  42   ? 25.718  -33.858 67.746  1.00 60.03  ? 42   VAL C CB    1 
ATOM   3919  C  CG1   . VAL C 2  42   ? 24.806  -35.064 67.531  1.00 62.06  ? 42   VAL C CG1   1 
ATOM   3920  C  CG2   . VAL C 2  42   ? 26.682  -34.110 68.890  1.00 59.18  ? 42   VAL C CG2   1 
ATOM   3921  N  N     . GLY C 2  43   ? 26.659  -31.116 66.671  1.00 40.19  ? 43   GLY C N     1 
ATOM   3922  C  CA    . GLY C 2  43   ? 27.323  -29.876 67.028  1.00 44.49  ? 43   GLY C CA    1 
ATOM   3923  C  C     . GLY C 2  43   ? 27.933  -29.154 65.842  1.00 46.41  ? 43   GLY C C     1 
ATOM   3924  O  O     . GLY C 2  43   ? 27.508  -29.305 64.696  1.00 48.18  ? 43   GLY C O     1 
ATOM   3925  N  N     . ILE C 2  44   ? 28.947  -28.334 66.137  1.00 45.95  ? 44   ILE C N     1 
ATOM   3926  C  CA    . ILE C 2  44   ? 29.654  -27.642 65.062  1.00 40.83  ? 44   ILE C CA    1 
ATOM   3927  C  C     . ILE C 2  44   ? 30.451  -28.638 64.236  1.00 43.57  ? 44   ILE C C     1 
ATOM   3928  O  O     . ILE C 2  44   ? 30.736  -28.395 63.053  1.00 52.86  ? 44   ILE C O     1 
ATOM   3929  C  CB    . ILE C 2  44   ? 30.545  -26.521 65.627  1.00 39.37  ? 44   ILE C CB    1 
ATOM   3930  C  CG1   . ILE C 2  44   ? 31.656  -27.097 66.498  1.00 40.54  ? 44   ILE C CG1   1 
ATOM   3931  C  CG2   . ILE C 2  44   ? 29.715  -25.549 66.439  1.00 41.18  ? 44   ILE C CG2   1 
ATOM   3932  C  CD1   . ILE C 2  44   ? 32.550  -26.039 67.092  1.00 39.39  ? 44   ILE C CD1   1 
ATOM   3933  N  N     . GLN C 2  45   ? 30.819  -29.773 64.836  1.00 41.24  ? 45   GLN C N     1 
ATOM   3934  C  CA    . GLN C 2  45   ? 31.335  -30.891 64.058  1.00 42.99  ? 45   GLN C CA    1 
ATOM   3935  C  C     . GLN C 2  45   ? 30.364  -31.267 62.943  1.00 48.31  ? 45   GLN C C     1 
ATOM   3936  O  O     . GLN C 2  45   ? 30.779  -31.534 61.809  1.00 44.90  ? 45   GLN C O     1 
ATOM   3937  C  CB    . GLN C 2  45   ? 31.601  -32.084 64.980  1.00 41.44  ? 45   GLN C CB    1 
ATOM   3938  C  CG    . GLN C 2  45   ? 32.168  -33.319 64.291  1.00 48.22  ? 45   GLN C CG    1 
ATOM   3939  C  CD    . GLN C 2  45   ? 33.669  -33.246 64.059  1.00 46.79  ? 45   GLN C CD    1 
ATOM   3940  O  OE1   . GLN C 2  45   ? 34.339  -32.324 64.517  1.00 39.79  ? 45   GLN C OE1   1 
ATOM   3941  N  NE2   . GLN C 2  45   ? 34.203  -34.229 63.345  1.00 51.47  ? 45   GLN C NE2   1 
ATOM   3942  N  N     . ALA C 2  46   ? 29.061  -31.260 63.240  1.00 49.83  ? 46   ALA C N     1 
ATOM   3943  C  CA    . ALA C 2  46   ? 28.061  -31.568 62.220  1.00 48.84  ? 46   ALA C CA    1 
ATOM   3944  C  C     . ALA C 2  46   ? 28.069  -30.537 61.101  1.00 51.89  ? 46   ALA C C     1 
ATOM   3945  O  O     . ALA C 2  46   ? 27.930  -30.888 59.925  1.00 64.69  ? 46   ALA C O     1 
ATOM   3946  C  CB    . ALA C 2  46   ? 26.671  -31.648 62.842  1.00 57.94  ? 46   ALA C CB    1 
ATOM   3947  N  N     . ALA C 2  47   ? 28.200  -29.255 61.446  1.00 50.24  ? 47   ALA C N     1 
ATOM   3948  C  CA    . ALA C 2  47   ? 28.249  -28.227 60.413  1.00 49.98  ? 47   ALA C CA    1 
ATOM   3949  C  C     . ALA C 2  47   ? 29.462  -28.419 59.516  1.00 52.43  ? 47   ALA C C     1 
ATOM   3950  O  O     . ALA C 2  47   ? 29.368  -28.275 58.290  1.00 59.88  ? 47   ALA C O     1 
ATOM   3951  C  CB    . ALA C 2  47   ? 28.263  -26.837 61.045  1.00 51.55  ? 47   ALA C CB    1 
ATOM   3952  N  N     . PHE C 2  48   ? 30.611  -28.751 60.108  1.00 51.93  ? 48   PHE C N     1 
ATOM   3953  C  CA    . PHE C 2  48   ? 31.782  -29.057 59.293  1.00 55.05  ? 48   PHE C CA    1 
ATOM   3954  C  C     . PHE C 2  48   ? 31.521  -30.254 58.383  1.00 55.60  ? 48   PHE C C     1 
ATOM   3955  O  O     . PHE C 2  48   ? 31.874  -30.230 57.198  1.00 59.44  ? 48   PHE C O     1 
ATOM   3956  C  CB    . PHE C 2  48   ? 33.000  -29.306 60.186  1.00 47.63  ? 48   PHE C CB    1 
ATOM   3957  C  CG    . PHE C 2  48   ? 33.696  -28.048 60.634  1.00 43.05  ? 48   PHE C CG    1 
ATOM   3958  C  CD1   . PHE C 2  48   ? 34.349  -27.240 59.719  1.00 42.62  ? 48   PHE C CD1   1 
ATOM   3959  C  CD2   . PHE C 2  48   ? 33.702  -27.675 61.968  1.00 41.70  ? 48   PHE C CD2   1 
ATOM   3960  C  CE1   . PHE C 2  48   ? 34.995  -26.084 60.123  1.00 38.52  ? 48   PHE C CE1   1 
ATOM   3961  C  CE2   . PHE C 2  48   ? 34.347  -26.520 62.377  1.00 42.12  ? 48   PHE C CE2   1 
ATOM   3962  C  CZ    . PHE C 2  48   ? 34.992  -25.724 61.452  1.00 40.29  ? 48   PHE C CZ    1 
ATOM   3963  N  N     . ARG C 2  49   ? 30.884  -31.302 58.912  1.00 47.26  ? 49   ARG C N     1 
ATOM   3964  C  CA    . ARG C 2  49   ? 30.636  -32.498 58.112  1.00 47.45  ? 49   ARG C CA    1 
ATOM   3965  C  C     . ARG C 2  49   ? 29.632  -32.236 56.997  1.00 54.31  ? 49   ARG C C     1 
ATOM   3966  O  O     . ARG C 2  49   ? 29.655  -32.922 55.969  1.00 71.50  ? 49   ARG C O     1 
ATOM   3967  C  CB    . ARG C 2  49   ? 30.147  -33.637 59.005  1.00 52.07  ? 49   ARG C CB    1 
ATOM   3968  C  CG    . ARG C 2  49   ? 31.144  -34.048 60.072  1.00 54.93  ? 49   ARG C CG    1 
ATOM   3969  C  CD    . ARG C 2  49   ? 32.339  -34.774 59.489  1.00 61.71  ? 49   ARG C CD    1 
ATOM   3970  N  NE    . ARG C 2  49   ? 32.057  -36.190 59.284  1.00 72.04  ? 49   ARG C NE    1 
ATOM   3971  C  CZ    . ARG C 2  49   ? 31.665  -36.715 58.129  1.00 82.01  ? 49   ARG C CZ    1 
ATOM   3972  N  NH1   . ARG C 2  49   ? 31.513  -35.940 57.062  1.00 77.53  ? 49   ARG C NH1   1 
ATOM   3973  N  NH2   . ARG C 2  49   ? 31.430  -38.017 58.040  1.00 91.97  ? 49   ARG C NH2   1 
ATOM   3974  N  N     . GLU C 2  50   ? 28.741  -31.264 57.185  1.00 56.31  ? 50   GLU C N     1 
ATOM   3975  C  CA    . GLU C 2  50   ? 27.793  -30.914 56.133  1.00 60.44  ? 50   GLU C CA    1 
ATOM   3976  C  C     . GLU C 2  50   ? 28.440  -30.045 55.064  1.00 65.50  ? 50   GLU C C     1 
ATOM   3977  O  O     . GLU C 2  50   ? 28.231  -30.271 53.865  1.00 72.90  ? 50   GLU C O     1 
ATOM   3978  C  CB    . GLU C 2  50   ? 26.585  -30.189 56.724  1.00 64.33  ? 50   GLU C CB    1 
ATOM   3979  C  CG    . GLU C 2  50   ? 25.687  -31.051 57.584  1.00 70.28  ? 50   GLU C CG    1 
ATOM   3980  C  CD    . GLU C 2  50   ? 24.513  -30.270 58.131  1.00 76.80  ? 50   GLU C CD    1 
ATOM   3981  O  OE1   . GLU C 2  50   ? 24.119  -30.511 59.292  1.00 80.98  ? 50   GLU C OE1   1 
ATOM   3982  O  OE2   . GLU C 2  50   ? 23.992  -29.404 57.397  1.00 80.18  ? 50   GLU C OE2   1 
ATOM   3983  N  N     . THR C 2  51   ? 29.223  -29.047 55.479  1.00 61.60  ? 51   THR C N     1 
ATOM   3984  C  CA    . THR C 2  51   ? 29.829  -28.129 54.520  1.00 64.23  ? 51   THR C CA    1 
ATOM   3985  C  C     . THR C 2  51   ? 30.831  -28.850 53.625  1.00 64.67  ? 51   THR C C     1 
ATOM   3986  O  O     . THR C 2  51   ? 30.750  -28.768 52.394  1.00 66.57  ? 51   THR C O     1 
ATOM   3987  C  CB    . THR C 2  51   ? 30.502  -26.970 55.255  1.00 56.27  ? 51   THR C CB    1 
ATOM   3988  O  OG1   . THR C 2  51   ? 29.541  -26.305 56.082  1.00 56.45  ? 51   THR C OG1   1 
ATOM   3989  C  CG2   . THR C 2  51   ? 31.076  -25.977 54.268  1.00 56.72  ? 51   THR C CG2   1 
ATOM   3990  N  N     . PHE C 2  52   ? 31.790  -29.576 54.237  1.00 61.27  ? 52   PHE C N     1 
ATOM   3991  C  CA    . PHE C 2  52   ? 32.873  -30.289 53.577  1.00 63.04  ? 52   PHE C CA    1 
ATOM   3992  C  C     . PHE C 2  52   ? 32.460  -31.721 53.245  1.00 69.46  ? 52   PHE C C     1 
ATOM   3993  O  O     . PHE C 2  52   ? 31.654  -32.324 53.962  1.00 62.22  ? 52   PHE C O     1 
ATOM   3994  C  CB    . PHE C 2  52   ? 34.114  -30.301 54.464  1.00 55.58  ? 52   PHE C CB    1 
ATOM   3995  C  CG    . PHE C 2  52   ? 34.737  -28.944 54.649  1.00 54.65  ? 52   PHE C CG    1 
ATOM   3996  C  CD1   . PHE C 2  52   ? 35.703  -28.484 53.770  1.00 58.68  ? 52   PHE C CD1   1 
ATOM   3997  C  CD2   . PHE C 2  52   ? 34.356  -28.128 55.699  1.00 53.36  ? 52   PHE C CD2   1 
ATOM   3998  C  CE1   . PHE C 2  52   ? 36.276  -27.237 53.935  1.00 53.07  ? 52   PHE C CE1   1 
ATOM   3999  C  CE2   . PHE C 2  52   ? 34.927  -26.879 55.867  1.00 50.78  ? 52   PHE C CE2   1 
ATOM   4000  C  CZ    . PHE C 2  52   ? 35.888  -26.435 54.985  1.00 43.33  ? 52   PHE C CZ    1 
ATOM   4001  N  N     . PRO C 2  53   ? 33.001  -32.307 52.158  1.00 77.33  ? 53   PRO C N     1 
ATOM   4002  C  CA    . PRO C 2  53   ? 34.022  -31.753 51.255  1.00 69.54  ? 53   PRO C CA    1 
ATOM   4003  C  C     . PRO C 2  53   ? 33.495  -30.711 50.264  1.00 65.44  ? 53   PRO C C     1 
ATOM   4004  O  O     . PRO C 2  53   ? 32.293  -30.644 50.008  1.00 66.24  ? 53   PRO C O     1 
ATOM   4005  C  CB    . PRO C 2  53   ? 34.523  -32.991 50.510  1.00 65.05  ? 53   PRO C CB    1 
ATOM   4006  C  CG    . PRO C 2  53   ? 33.333  -33.873 50.452  1.00 65.93  ? 53   PRO C CG    1 
ATOM   4007  C  CD    . PRO C 2  53   ? 32.609  -33.671 51.759  1.00 71.83  ? 53   PRO C CD    1 
ATOM   4008  N  N     . ILE C 2  54   ? 34.403  -29.907 49.720  1.00 63.12  ? 54   ILE C N     1 
ATOM   4009  C  CA    . ILE C 2  54   ? 34.080  -28.874 48.741  1.00 74.06  ? 54   ILE C CA    1 
ATOM   4010  C  C     . ILE C 2  54   ? 34.801  -29.222 47.445  1.00 89.63  ? 54   ILE C C     1 
ATOM   4011  O  O     . ILE C 2  54   ? 36.038  -29.255 47.407  1.00 92.37  ? 54   ILE C O     1 
ATOM   4012  C  CB    . ILE C 2  54   ? 34.478  -27.477 49.241  1.00 68.35  ? 54   ILE C CB    1 
ATOM   4013  C  CG1   . ILE C 2  54   ? 33.771  -27.163 50.559  1.00 61.89  ? 54   ILE C CG1   1 
ATOM   4014  C  CG2   . ILE C 2  54   ? 34.152  -26.420 48.200  1.00 78.69  ? 54   ILE C CG2   1 
ATOM   4015  C  CD1   . ILE C 2  54   ? 34.107  -25.800 51.114  1.00 61.21  ? 54   ILE C CD1   1 
ATOM   4016  N  N     . GLU C 2  55   ? 34.033  -29.475 46.387  1.00 96.33  ? 55   GLU C N     1 
ATOM   4017  C  CA    . GLU C 2  55   ? 34.567  -29.991 45.133  1.00 99.91  ? 55   GLU C CA    1 
ATOM   4018  C  C     . GLU C 2  55   ? 34.391  -28.973 44.008  1.00 104.74 ? 55   GLU C C     1 
ATOM   4019  O  O     . GLU C 2  55   ? 33.801  -27.904 44.187  1.00 110.98 ? 55   GLU C O     1 
ATOM   4020  C  CB    . GLU C 2  55   ? 33.901  -31.321 44.780  1.00 99.54  ? 55   GLU C CB    1 
ATOM   4021  C  CG    . GLU C 2  55   ? 34.084  -32.385 45.846  1.00 98.43  ? 55   GLU C CG    1 
ATOM   4022  C  CD    . GLU C 2  55   ? 33.500  -33.723 45.445  1.00 113.11 ? 55   GLU C CD    1 
ATOM   4023  O  OE1   . GLU C 2  55   ? 33.028  -34.456 46.340  1.00 104.12 ? 55   GLU C OE1   1 
ATOM   4024  O  OE2   . GLU C 2  55   ? 33.509  -34.039 44.236  1.00 115.44 ? 55   GLU C OE2   1 
ATOM   4025  N  N     . GLU C 2  56   ? 34.916  -29.330 42.836  1.00 105.37 ? 56   GLU C N     1 
ATOM   4026  C  CA    . GLU C 2  56   ? 34.864  -28.491 41.636  1.00 106.24 ? 56   GLU C CA    1 
ATOM   4027  C  C     . GLU C 2  56   ? 35.472  -27.111 41.869  1.00 101.47 ? 56   GLU C C     1 
ATOM   4028  O  O     . GLU C 2  56   ? 35.685  -26.348 40.926  1.00 96.40  ? 56   GLU C O     1 
ATOM   4029  C  CB    . GLU C 2  56   ? 33.422  -28.346 41.143  1.00 105.66 ? 56   GLU C CB    1 
ATOM   4030  C  CG    . GLU C 2  56   ? 32.748  -29.665 40.813  1.00 105.57 ? 56   GLU C CG    1 
ATOM   4031  C  CD    . GLU C 2  56   ? 31.317  -29.479 40.359  1.00 112.61 ? 56   GLU C CD    1 
ATOM   4032  O  OE1   . GLU C 2  56   ? 31.026  -29.750 39.174  1.00 113.68 ? 56   GLU C OE1   1 
ATOM   4033  O  OE2   . GLU C 2  56   ? 30.488  -29.047 41.187  1.00 112.73 ? 56   GLU C OE2   1 
ATOM   4034  N  N     . GLY C 2  63   ? 42.748  -25.957 42.987  1.00 100.67 ? 63   GLY C N     1 
ATOM   4035  C  CA    . GLY C 2  63   ? 42.551  -27.377 43.211  1.00 107.37 ? 63   GLY C CA    1 
ATOM   4036  C  C     . GLY C 2  63   ? 41.100  -27.814 43.121  1.00 108.07 ? 63   GLY C C     1 
ATOM   4037  O  O     . GLY C 2  63   ? 40.192  -26.983 43.102  1.00 107.33 ? 63   GLY C O     1 
ATOM   4038  N  N     . LEU C 2  64   ? 40.880  -29.127 43.074  1.00 102.82 ? 64   LEU C N     1 
ATOM   4039  C  CA    . LEU C 2  64   ? 39.536  -29.646 42.861  1.00 104.97 ? 64   LEU C CA    1 
ATOM   4040  C  C     . LEU C 2  64   ? 38.786  -29.925 44.161  1.00 107.98 ? 64   LEU C C     1 
ATOM   4041  O  O     . LEU C 2  64   ? 37.579  -29.668 44.236  1.00 108.22 ? 64   LEU C O     1 
ATOM   4042  C  CB    . LEU C 2  64   ? 39.595  -30.914 42.003  1.00 102.52 ? 64   LEU C CB    1 
ATOM   4043  C  CG    . LEU C 2  64   ? 39.834  -30.674 40.510  1.00 106.06 ? 64   LEU C CG    1 
ATOM   4044  C  CD1   . LEU C 2  64   ? 39.786  -31.980 39.737  1.00 110.39 ? 64   LEU C CD1   1 
ATOM   4045  C  CD2   . LEU C 2  64   ? 38.817  -29.684 39.959  1.00 92.91  ? 64   LEU C CD2   1 
ATOM   4046  N  N     . VAL C 2  65   ? 39.464  -30.435 45.191  1.00 102.29 ? 65   VAL C N     1 
ATOM   4047  C  CA    . VAL C 2  65   ? 38.805  -30.915 46.402  1.00 90.93  ? 65   VAL C CA    1 
ATOM   4048  C  C     . VAL C 2  65   ? 39.483  -30.317 47.629  1.00 86.63  ? 65   VAL C C     1 
ATOM   4049  O  O     . VAL C 2  65   ? 40.713  -30.361 47.750  1.00 85.41  ? 65   VAL C O     1 
ATOM   4050  C  CB    . VAL C 2  65   ? 38.813  -32.455 46.478  1.00 86.04  ? 65   VAL C CB    1 
ATOM   4051  C  CG1   . VAL C 2  65   ? 38.549  -32.928 47.895  1.00 77.45  ? 65   VAL C CG1   1 
ATOM   4052  C  CG2   . VAL C 2  65   ? 37.775  -33.031 45.528  1.00 87.46  ? 65   VAL C CG2   1 
ATOM   4053  N  N     . LEU C 2  66   ? 38.675  -29.766 48.537  1.00 85.32  ? 66   LEU C N     1 
ATOM   4054  C  CA    . LEU C 2  66   ? 39.115  -29.278 49.841  1.00 75.43  ? 66   LEU C CA    1 
ATOM   4055  C  C     . LEU C 2  66   ? 38.269  -29.958 50.909  1.00 65.26  ? 66   LEU C C     1 
ATOM   4056  O  O     . LEU C 2  66   ? 37.047  -29.779 50.942  1.00 65.06  ? 66   LEU C O     1 
ATOM   4057  C  CB    . LEU C 2  66   ? 38.984  -27.756 49.931  1.00 65.70  ? 66   LEU C CB    1 
ATOM   4058  C  CG    . LEU C 2  66   ? 39.396  -27.082 51.239  1.00 53.16  ? 66   LEU C CG    1 
ATOM   4059  C  CD1   . LEU C 2  66   ? 40.876  -27.286 51.498  1.00 60.95  ? 66   LEU C CD1   1 
ATOM   4060  C  CD2   . LEU C 2  66   ? 39.058  -25.601 51.204  1.00 58.27  ? 66   LEU C CD2   1 
ATOM   4061  N  N     . ASP C 2  67   ? 38.912  -30.733 51.777  1.00 56.57  ? 67   ASP C N     1 
ATOM   4062  C  CA    . ASP C 2  67   ? 38.206  -31.600 52.706  1.00 55.74  ? 67   ASP C CA    1 
ATOM   4063  C  C     . ASP C 2  67   ? 38.527  -31.224 54.150  1.00 62.07  ? 67   ASP C C     1 
ATOM   4064  O  O     . ASP C 2  67   ? 39.545  -30.589 54.443  1.00 65.17  ? 67   ASP C O     1 
ATOM   4065  C  CB    . ASP C 2  67   ? 38.552  -33.075 52.444  1.00 64.44  ? 67   ASP C CB    1 
ATOM   4066  C  CG    . ASP C 2  67   ? 37.575  -34.032 53.101  1.00 75.19  ? 67   ASP C CG    1 
ATOM   4067  O  OD1   . ASP C 2  67   ? 36.353  -33.780 53.020  1.00 69.82  ? 67   ASP C OD1   1 
ATOM   4068  O  OD2   . ASP C 2  67   ? 38.027  -35.039 53.688  1.00 77.76  ? 67   ASP C OD2   1 
ATOM   4069  N  N     . PHE C 2  68   ? 37.637  -31.625 55.052  1.00 59.26  ? 68   PHE C N     1 
ATOM   4070  C  CA    . PHE C 2  68   ? 37.733  -31.301 56.470  1.00 56.97  ? 68   PHE C CA    1 
ATOM   4071  C  C     . PHE C 2  68   ? 38.327  -32.477 57.233  1.00 52.59  ? 68   PHE C C     1 
ATOM   4072  O  O     . PHE C 2  68   ? 37.841  -33.606 57.115  1.00 53.73  ? 68   PHE C O     1 
ATOM   4073  C  CB    . PHE C 2  68   ? 36.349  -30.946 57.021  1.00 57.64  ? 68   PHE C CB    1 
ATOM   4074  C  CG    . PHE C 2  68   ? 36.250  -30.974 58.521  1.00 49.25  ? 68   PHE C CG    1 
ATOM   4075  C  CD1   . PHE C 2  68   ? 36.704  -29.910 59.277  1.00 43.84  ? 68   PHE C CD1   1 
ATOM   4076  C  CD2   . PHE C 2  68   ? 35.672  -32.053 59.170  1.00 47.02  ? 68   PHE C CD2   1 
ATOM   4077  C  CE1   . PHE C 2  68   ? 36.605  -29.930 60.647  1.00 42.34  ? 68   PHE C CE1   1 
ATOM   4078  C  CE2   . PHE C 2  68   ? 35.570  -32.078 60.543  1.00 41.85  ? 68   PHE C CE2   1 
ATOM   4079  C  CZ    . PHE C 2  68   ? 36.035  -31.014 61.282  1.00 43.08  ? 68   PHE C CZ    1 
ATOM   4080  N  N     . LEU C 2  69   ? 39.382  -32.215 58.008  1.00 46.89  ? 69   LEU C N     1 
ATOM   4081  C  CA    . LEU C 2  69   ? 39.969  -33.237 58.871  1.00 44.50  ? 69   LEU C CA    1 
ATOM   4082  C  C     . LEU C 2  69   ? 39.425  -33.169 60.294  1.00 42.54  ? 69   LEU C C     1 
ATOM   4083  O  O     . LEU C 2  69   ? 38.817  -34.127 60.779  1.00 47.05  ? 69   LEU C O     1 
ATOM   4084  C  CB    . LEU C 2  69   ? 41.496  -33.106 58.898  1.00 46.66  ? 69   LEU C CB    1 
ATOM   4085  C  CG    . LEU C 2  69   ? 42.299  -33.589 57.695  1.00 46.17  ? 69   LEU C CG    1 
ATOM   4086  C  CD1   . LEU C 2  69   ? 43.781  -33.552 58.028  1.00 47.95  ? 69   LEU C CD1   1 
ATOM   4087  C  CD2   . LEU C 2  69   ? 41.870  -34.988 57.289  1.00 48.49  ? 69   LEU C CD2   1 
ATOM   4088  N  N     . GLU C 2  70   ? 39.629  -32.041 60.967  1.00 42.98  ? 70   GLU C N     1 
ATOM   4089  C  CA    . GLU C 2  70   ? 39.243  -31.869 62.361  1.00 38.61  ? 70   GLU C CA    1 
ATOM   4090  C  C     . GLU C 2  70   ? 39.300  -30.381 62.679  1.00 39.29  ? 70   GLU C C     1 
ATOM   4091  O  O     . GLU C 2  70   ? 39.711  -29.564 61.850  1.00 40.30  ? 70   GLU C O     1 
ATOM   4092  C  CB    . GLU C 2  70   ? 40.149  -32.677 63.297  1.00 42.77  ? 70   GLU C CB    1 
ATOM   4093  C  CG    . GLU C 2  70   ? 41.624  -32.280 63.246  1.00 48.14  ? 70   GLU C CG    1 
ATOM   4094  C  CD    . GLU C 2  70   ? 42.475  -33.019 64.272  1.00 60.59  ? 70   GLU C CD    1 
ATOM   4095  O  OE1   . GLU C 2  70   ? 43.569  -32.519 64.619  1.00 66.48  ? 70   GLU C OE1   1 
ATOM   4096  O  OE2   . GLU C 2  70   ? 42.051  -34.099 64.733  1.00 62.46  ? 70   GLU C OE2   1 
ATOM   4097  N  N     . TYR C 2  71   ? 38.883  -30.030 63.894  1.00 40.60  ? 71   TYR C N     1 
ATOM   4098  C  CA    . TYR C 2  71   ? 38.942  -28.653 64.359  1.00 38.82  ? 71   TYR C CA    1 
ATOM   4099  C  C     . TYR C 2  71   ? 39.466  -28.639 65.787  1.00 38.95  ? 71   TYR C C     1 
ATOM   4100  O  O     . TYR C 2  71   ? 39.545  -29.674 66.456  1.00 42.04  ? 71   TYR C O     1 
ATOM   4101  C  CB    . TYR C 2  71   ? 37.570  -27.963 64.277  1.00 37.06  ? 71   TYR C CB    1 
ATOM   4102  C  CG    . TYR C 2  71   ? 36.576  -28.409 65.331  1.00 42.14  ? 71   TYR C CG    1 
ATOM   4103  C  CD1   . TYR C 2  71   ? 35.749  -29.502 65.116  1.00 41.76  ? 71   TYR C CD1   1 
ATOM   4104  C  CD2   . TYR C 2  71   ? 36.461  -27.730 66.540  1.00 38.80  ? 71   TYR C CD2   1 
ATOM   4105  C  CE1   . TYR C 2  71   ? 34.840  -29.907 66.076  1.00 40.29  ? 71   TYR C CE1   1 
ATOM   4106  C  CE2   . TYR C 2  71   ? 35.557  -28.134 67.504  1.00 37.80  ? 71   TYR C CE2   1 
ATOM   4107  C  CZ    . TYR C 2  71   ? 34.749  -29.224 67.265  1.00 38.21  ? 71   TYR C CZ    1 
ATOM   4108  O  OH    . TYR C 2  71   ? 33.842  -29.635 68.215  1.00 39.26  ? 71   TYR C OH    1 
ATOM   4109  N  N     . ARG C 2  72   ? 39.827  -27.446 66.251  1.00 33.77  ? 72   ARG C N     1 
ATOM   4110  C  CA    . ARG C 2  72   ? 40.244  -27.261 67.631  1.00 37.09  ? 72   ARG C CA    1 
ATOM   4111  C  C     . ARG C 2  72   ? 39.904  -25.848 68.081  1.00 35.23  ? 72   ARG C C     1 
ATOM   4112  O  O     . ARG C 2  72   ? 39.802  -24.919 67.271  1.00 34.76  ? 72   ARG C O     1 
ATOM   4113  C  CB    . ARG C 2  72   ? 41.744  -27.533 67.823  1.00 40.59  ? 72   ARG C CB    1 
ATOM   4114  C  CG    . ARG C 2  72   ? 42.664  -26.436 67.321  1.00 36.58  ? 72   ARG C CG    1 
ATOM   4115  C  CD    . ARG C 2  72   ? 44.109  -26.734 67.685  1.00 32.14  ? 72   ARG C CD    1 
ATOM   4116  N  NE    . ARG C 2  72   ? 45.015  -25.677 67.247  1.00 38.97  ? 72   ARG C NE    1 
ATOM   4117  C  CZ    . ARG C 2  72   ? 45.363  -24.635 67.996  1.00 45.53  ? 72   ARG C CZ    1 
ATOM   4118  N  NH1   . ARG C 2  72   ? 44.879  -24.508 69.225  1.00 45.72  ? 72   ARG C NH1   1 
ATOM   4119  N  NH2   . ARG C 2  72   ? 46.193  -23.718 67.517  1.00 48.57  ? 72   ARG C NH2   1 
ATOM   4120  N  N     . LEU C 2  73   ? 39.716  -25.706 69.390  1.00 33.20  ? 73   LEU C N     1 
ATOM   4121  C  CA    . LEU C 2  73   ? 39.475  -24.422 70.029  1.00 32.98  ? 73   LEU C CA    1 
ATOM   4122  C  C     . LEU C 2  73   ? 40.621  -24.127 70.985  1.00 30.96  ? 73   LEU C C     1 
ATOM   4123  O  O     . LEU C 2  73   ? 40.973  -24.971 71.816  1.00 36.09  ? 73   LEU C O     1 
ATOM   4124  C  CB    . LEU C 2  73   ? 38.136  -24.421 70.771  1.00 33.76  ? 73   LEU C CB    1 
ATOM   4125  C  CG    . LEU C 2  73   ? 36.905  -24.544 69.868  1.00 36.75  ? 73   LEU C CG    1 
ATOM   4126  C  CD1   . LEU C 2  73   ? 35.627  -24.674 70.677  1.00 27.60  ? 73   LEU C CD1   1 
ATOM   4127  C  CD2   . LEU C 2  73   ? 36.820  -23.350 68.933  1.00 44.84  ? 73   LEU C CD2   1 
ATOM   4128  N  N     . GLY C 2  74   ? 41.212  -22.941 70.853  1.00 31.67  ? 74   GLY C N     1 
ATOM   4129  C  CA    . GLY C 2  74   ? 42.294  -22.528 71.719  1.00 36.51  ? 74   GLY C CA    1 
ATOM   4130  C  C     . GLY C 2  74   ? 41.801  -21.777 72.942  1.00 39.71  ? 74   GLY C C     1 
ATOM   4131  O  O     . GLY C 2  74   ? 40.607  -21.578 73.153  1.00 36.80  ? 74   GLY C O     1 
ATOM   4132  N  N     . GLU C 2  75   ? 42.759  -21.357 73.764  1.00 45.32  ? 75   GLU C N     1 
ATOM   4133  C  CA    . GLU C 2  75   ? 42.438  -20.622 74.976  1.00 41.65  ? 75   GLU C CA    1 
ATOM   4134  C  C     . GLU C 2  75   ? 41.895  -19.235 74.632  1.00 43.57  ? 75   GLU C C     1 
ATOM   4135  O  O     . GLU C 2  75   ? 42.227  -18.671 73.586  1.00 46.30  ? 75   GLU C O     1 
ATOM   4136  C  CB    . GLU C 2  75   ? 43.673  -20.483 75.860  1.00 40.47  ? 75   GLU C CB    1 
ATOM   4137  C  CG    . GLU C 2  75   ? 44.244  -21.801 76.342  1.00 51.31  ? 75   GLU C CG    1 
ATOM   4138  C  CD    . GLU C 2  75   ? 43.255  -22.597 77.170  1.00 69.71  ? 75   GLU C CD    1 
ATOM   4139  O  OE1   . GLU C 2  75   ? 42.979  -23.763 76.807  1.00 71.16  ? 75   GLU C OE1   1 
ATOM   4140  O  OE2   . GLU C 2  75   ? 42.749  -22.054 78.178  1.00 71.25  ? 75   GLU C OE2   1 
ATOM   4141  N  N     . PRO C 2  76   ? 41.051  -18.668 75.490  1.00 47.82  ? 76   PRO C N     1 
ATOM   4142  C  CA    . PRO C 2  76   ? 40.557  -17.308 75.253  1.00 47.65  ? 76   PRO C CA    1 
ATOM   4143  C  C     . PRO C 2  76   ? 41.688  -16.302 75.346  1.00 54.49  ? 76   PRO C C     1 
ATOM   4144  O  O     . PRO C 2  76   ? 42.543  -16.398 76.240  1.00 51.59  ? 76   PRO C O     1 
ATOM   4145  C  CB    . PRO C 2  76   ? 39.533  -17.095 76.379  1.00 46.45  ? 76   PRO C CB    1 
ATOM   4146  C  CG    . PRO C 2  76   ? 39.197  -18.462 76.865  1.00 44.44  ? 76   PRO C CG    1 
ATOM   4147  C  CD    . PRO C 2  76   ? 40.433  -19.279 76.679  1.00 46.13  ? 76   PRO C CD    1 
ATOM   4148  N  N     . PRO C 2  77   ? 41.739  -15.330 74.432  1.00 59.94  ? 77   PRO C N     1 
ATOM   4149  C  CA    . PRO C 2  77   ? 42.780  -14.293 74.533  1.00 61.70  ? 77   PRO C CA    1 
ATOM   4150  C  C     . PRO C 2  77   ? 42.691  -13.458 75.802  1.00 61.77  ? 77   PRO C C     1 
ATOM   4151  O  O     . PRO C 2  77   ? 43.710  -12.909 76.241  1.00 60.73  ? 77   PRO C O     1 
ATOM   4152  C  CB    . PRO C 2  77   ? 42.553  -13.441 73.274  1.00 54.51  ? 77   PRO C CB    1 
ATOM   4153  C  CG    . PRO C 2  77   ? 41.156  -13.753 72.831  1.00 53.76  ? 77   PRO C CG    1 
ATOM   4154  C  CD    . PRO C 2  77   ? 40.918  -15.179 73.219  1.00 49.46  ? 77   PRO C CD    1 
ATOM   4155  N  N     . PHE C 2  78   ? 41.515  -13.348 76.413  1.00 61.56  ? 78   PHE C N     1 
ATOM   4156  C  CA    . PHE C 2  78   ? 41.351  -12.506 77.586  1.00 55.59  ? 78   PHE C CA    1 
ATOM   4157  C  C     . PHE C 2  78   ? 40.357  -13.137 78.547  1.00 54.64  ? 78   PHE C C     1 
ATOM   4158  O  O     . PHE C 2  78   ? 39.413  -13.810 78.116  1.00 53.96  ? 78   PHE C O     1 
ATOM   4159  C  CB    . PHE C 2  78   ? 40.873  -11.098 77.203  1.00 56.14  ? 78   PHE C CB    1 
ATOM   4160  C  CG    . PHE C 2  78   ? 41.787  -10.394 76.250  1.00 58.04  ? 78   PHE C CG    1 
ATOM   4161  C  CD1   . PHE C 2  78   ? 42.959  -9.813  76.700  1.00 57.57  ? 78   PHE C CD1   1 
ATOM   4162  C  CD2   . PHE C 2  78   ? 41.485  -10.327 74.901  1.00 53.30  ? 78   PHE C CD2   1 
ATOM   4163  C  CE1   . PHE C 2  78   ? 43.805  -9.168  75.828  1.00 57.77  ? 78   PHE C CE1   1 
ATOM   4164  C  CE2   . PHE C 2  78   ? 42.326  -9.682  74.024  1.00 53.69  ? 78   PHE C CE2   1 
ATOM   4165  C  CZ    . PHE C 2  78   ? 43.489  -9.101  74.487  1.00 56.65  ? 78   PHE C CZ    1 
ATOM   4166  N  N     . PRO C 2  79   ? 40.548  -12.941 79.850  1.00 53.37  ? 79   PRO C N     1 
ATOM   4167  C  CA    . PRO C 2  79   ? 39.597  -13.470 80.833  1.00 55.99  ? 79   PRO C CA    1 
ATOM   4168  C  C     . PRO C 2  79   ? 38.297  -12.679 80.836  1.00 60.77  ? 79   PRO C C     1 
ATOM   4169  O  O     . PRO C 2  79   ? 38.180  -11.602 80.243  1.00 55.24  ? 79   PRO C O     1 
ATOM   4170  C  CB    . PRO C 2  79   ? 40.344  -13.324 82.160  1.00 62.68  ? 79   PRO C CB    1 
ATOM   4171  C  CG    . PRO C 2  79   ? 41.287  -12.191 81.926  1.00 63.57  ? 79   PRO C CG    1 
ATOM   4172  C  CD    . PRO C 2  79   ? 41.713  -12.308 80.493  1.00 55.40  ? 79   PRO C CD    1 
ATOM   4173  N  N     . GLN C 2  80   ? 37.309  -13.237 81.543  1.00 53.33  ? 80   GLN C N     1 
ATOM   4174  C  CA    . GLN C 2  80   ? 35.945  -12.714 81.478  1.00 51.11  ? 80   GLN C CA    1 
ATOM   4175  C  C     . GLN C 2  80   ? 35.865  -11.285 82.004  1.00 62.73  ? 80   GLN C C     1 
ATOM   4176  O  O     . GLN C 2  80   ? 35.289  -10.402 81.352  1.00 58.53  ? 80   GLN C O     1 
ATOM   4177  C  CB    . GLN C 2  80   ? 35.001  -13.625 82.260  1.00 46.81  ? 80   GLN C CB    1 
ATOM   4178  C  CG    . GLN C 2  80   ? 34.942  -15.049 81.756  1.00 46.72  ? 80   GLN C CG    1 
ATOM   4179  C  CD    . GLN C 2  80   ? 33.990  -15.906 82.563  1.00 59.36  ? 80   GLN C CD    1 
ATOM   4180  O  OE1   . GLN C 2  80   ? 33.330  -15.425 83.488  1.00 63.79  ? 80   GLN C OE1   1 
ATOM   4181  N  NE2   . GLN C 2  80   ? 33.913  -17.188 82.221  1.00 62.69  ? 80   GLN C NE2   1 
ATOM   4182  N  N     . ASP C 2  81   ? 36.416  -11.040 83.197  1.00 70.04  ? 81   ASP C N     1 
ATOM   4183  C  CA    . ASP C 2  81   ? 36.363  -9.696  83.763  1.00 72.42  ? 81   ASP C CA    1 
ATOM   4184  C  C     . ASP C 2  81   ? 37.061  -8.693  82.855  1.00 67.73  ? 81   ASP C C     1 
ATOM   4185  O  O     . ASP C 2  81   ? 36.568  -7.578  82.649  1.00 69.17  ? 81   ASP C O     1 
ATOM   4186  C  CB    . ASP C 2  81   ? 36.978  -9.685  85.164  1.00 89.41  ? 81   ASP C CB    1 
ATOM   4187  C  CG    . ASP C 2  81   ? 36.079  -10.338 86.208  1.00 109.54 ? 81   ASP C CG    1 
ATOM   4188  O  OD1   . ASP C 2  81   ? 34.838  -10.224 86.094  1.00 91.93  ? 81   ASP C OD1   1 
ATOM   4189  O  OD2   . ASP C 2  81   ? 36.617  -10.965 87.146  1.00 132.03 ? 81   ASP C OD2   1 
ATOM   4190  N  N     . GLU C 2  82   ? 38.200  -9.081  82.279  1.00 64.58  ? 82   GLU C N     1 
ATOM   4191  C  CA    . GLU C 2  82   ? 38.907  -8.175  81.385  1.00 59.24  ? 82   GLU C CA    1 
ATOM   4192  C  C     . GLU C 2  82   ? 38.114  -7.917  80.111  1.00 57.86  ? 82   GLU C C     1 
ATOM   4193  O  O     . GLU C 2  82   ? 38.170  -6.810  79.562  1.00 58.22  ? 82   GLU C O     1 
ATOM   4194  C  CB    . GLU C 2  82   ? 40.288  -8.739  81.062  1.00 58.12  ? 82   GLU C CB    1 
ATOM   4195  C  CG    . GLU C 2  82   ? 41.253  -7.711  80.514  1.00 62.71  ? 82   GLU C CG    1 
ATOM   4196  C  CD    . GLU C 2  82   ? 42.611  -8.300  80.220  1.00 68.72  ? 82   GLU C CD    1 
ATOM   4197  O  OE1   . GLU C 2  82   ? 42.972  -9.310  80.864  1.00 64.95  ? 82   GLU C OE1   1 
ATOM   4198  O  OE2   . GLU C 2  82   ? 43.312  -7.759  79.339  1.00 73.30  ? 82   GLU C OE2   1 
ATOM   4199  N  N     . CYS C 2  83   ? 37.368  -8.915  79.631  1.00 58.15  ? 83   CYS C N     1 
ATOM   4200  C  CA    . CYS C 2  83   ? 36.509  -8.695  78.471  1.00 58.85  ? 83   CYS C CA    1 
ATOM   4201  C  C     . CYS C 2  83   ? 35.382  -7.728  78.804  1.00 57.82  ? 83   CYS C C     1 
ATOM   4202  O  O     . CYS C 2  83   ? 35.024  -6.878  77.981  1.00 59.23  ? 83   CYS C O     1 
ATOM   4203  C  CB    . CYS C 2  83   ? 35.941  -10.021 77.966  1.00 55.36  ? 83   CYS C CB    1 
ATOM   4204  S  SG    . CYS C 2  83   ? 37.142  -11.135 77.215  1.00 55.58  ? 83   CYS C SG    1 
ATOM   4205  N  N     . ARG C 2  84   ? 34.810  -7.842  80.006  1.00 55.33  ? 84   ARG C N     1 
ATOM   4206  C  CA    . ARG C 2  84   ? 33.806  -6.871  80.428  1.00 55.62  ? 84   ARG C CA    1 
ATOM   4207  C  C     . ARG C 2  84   ? 34.404  -5.476  80.554  1.00 61.91  ? 84   ARG C C     1 
ATOM   4208  O  O     . ARG C 2  84   ? 33.721  -4.479  80.285  1.00 58.25  ? 84   ARG C O     1 
ATOM   4209  C  CB    . ARG C 2  84   ? 33.178  -7.298  81.757  1.00 59.54  ? 84   ARG C CB    1 
ATOM   4210  C  CG    . ARG C 2  84   ? 32.476  -8.647  81.721  1.00 59.80  ? 84   ARG C CG    1 
ATOM   4211  C  CD    . ARG C 2  84   ? 31.673  -8.902  82.995  1.00 50.02  ? 84   ARG C CD    1 
ATOM   4212  N  NE    . ARG C 2  84   ? 30.895  -10.138 82.911  1.00 47.49  ? 84   ARG C NE    1 
ATOM   4213  C  CZ    . ARG C 2  84   ? 31.215  -11.272 83.528  1.00 51.98  ? 84   ARG C CZ    1 
ATOM   4214  N  NH1   . ARG C 2  84   ? 32.298  -11.336 84.291  1.00 54.61  ? 84   ARG C NH1   1 
ATOM   4215  N  NH2   . ARG C 2  84   ? 30.446  -12.345 83.386  1.00 46.96  ? 84   ARG C NH2   1 
ATOM   4216  N  N     . GLU C 2  85   ? 35.678  -5.390  80.954  1.00 64.17  ? 85   GLU C N     1 
ATOM   4217  C  CA    . GLU C 2  85   ? 36.329  -4.097  81.151  1.00 59.53  ? 85   GLU C CA    1 
ATOM   4218  C  C     . GLU C 2  85   ? 36.567  -3.383  79.828  1.00 63.75  ? 85   GLU C C     1 
ATOM   4219  O  O     . GLU C 2  85   ? 36.157  -2.230  79.649  1.00 71.64  ? 85   GLU C O     1 
ATOM   4220  C  CB    . GLU C 2  85   ? 37.653  -4.289  81.889  1.00 61.02  ? 85   GLU C CB    1 
ATOM   4221  C  CG    . GLU C 2  85   ? 37.563  -4.138  83.394  1.00 80.47  ? 85   GLU C CG    1 
ATOM   4222  C  CD    . GLU C 2  85   ? 37.627  -2.691  83.836  1.00 84.25  ? 85   GLU C CD    1 
ATOM   4223  O  OE1   . GLU C 2  85   ? 37.618  -2.448  85.061  1.00 81.30  ? 85   GLU C OE1   1 
ATOM   4224  O  OE2   . GLU C 2  85   ? 37.692  -1.799  82.960  1.00 78.40  ? 85   GLU C OE2   1 
ATOM   4225  N  N     . LYS C 2  86   ? 37.239  -4.047  78.894  1.00 65.36  ? 86   LYS C N     1 
ATOM   4226  C  CA    . LYS C 2  86   ? 37.627  -3.438  77.632  1.00 62.42  ? 86   LYS C CA    1 
ATOM   4227  C  C     . LYS C 2  86   ? 36.538  -3.530  76.571  1.00 62.10  ? 86   LYS C C     1 
ATOM   4228  O  O     . LYS C 2  86   ? 36.812  -3.248  75.400  1.00 65.15  ? 86   LYS C O     1 
ATOM   4229  C  CB    . LYS C 2  86   ? 38.914  -4.085  77.118  1.00 52.54  ? 86   LYS C CB    1 
ATOM   4230  C  CG    . LYS C 2  86   ? 40.072  -4.052  78.106  1.00 53.61  ? 86   LYS C CG    1 
ATOM   4231  C  CD    . LYS C 2  86   ? 41.290  -4.765  77.534  1.00 72.96  ? 86   LYS C CD    1 
ATOM   4232  C  CE    . LYS C 2  86   ? 42.505  -4.650  78.442  1.00 70.51  ? 86   LYS C CE    1 
ATOM   4233  N  NZ    . LYS C 2  86   ? 43.712  -5.263  77.812  1.00 71.77  ? 86   LYS C NZ    1 
ATOM   4234  N  N     . ASP C 2  87   ? 35.317  -3.912  76.954  1.00 55.55  ? 87   ASP C N     1 
ATOM   4235  C  CA    . ASP C 2  87   ? 34.192  -4.045  76.024  1.00 63.24  ? 87   ASP C CA    1 
ATOM   4236  C  C     . ASP C 2  87   ? 34.541  -4.970  74.856  1.00 59.88  ? 87   ASP C C     1 
ATOM   4237  O  O     . ASP C 2  87   ? 34.275  -4.673  73.688  1.00 57.68  ? 87   ASP C O     1 
ATOM   4238  C  CB    . ASP C 2  87   ? 33.719  -2.674  75.530  1.00 72.48  ? 87   ASP C CB    1 
ATOM   4239  C  CG    . ASP C 2  87   ? 32.773  -1.991  76.514  1.00 83.66  ? 87   ASP C CG    1 
ATOM   4240  O  OD1   . ASP C 2  87   ? 33.072  -1.992  77.730  1.00 79.92  ? 87   ASP C OD1   1 
ATOM   4241  O  OD2   . ASP C 2  87   ? 31.734  -1.450  76.071  1.00 76.55  ? 87   ASP C OD2   1 
ATOM   4242  N  N     . LEU C 2  88   ? 35.145  -6.109  75.190  1.00 61.15  ? 88   LEU C N     1 
ATOM   4243  C  CA    . LEU C 2  88   ? 35.469  -7.159  74.239  1.00 52.35  ? 88   LEU C CA    1 
ATOM   4244  C  C     . LEU C 2  88   ? 34.470  -8.303  74.379  1.00 50.04  ? 88   LEU C C     1 
ATOM   4245  O  O     . LEU C 2  88   ? 33.531  -8.254  75.175  1.00 56.24  ? 88   LEU C O     1 
ATOM   4246  C  CB    . LEU C 2  88   ? 36.897  -7.661  74.458  1.00 49.07  ? 88   LEU C CB    1 
ATOM   4247  C  CG    . LEU C 2  88   ? 38.005  -6.626  74.661  1.00 53.72  ? 88   LEU C CG    1 
ATOM   4248  C  CD1   . LEU C 2  88   ? 39.364  -7.312  74.719  1.00 54.13  ? 88   LEU C CD1   1 
ATOM   4249  C  CD2   . LEU C 2  88   ? 37.978  -5.570  73.568  1.00 60.79  ? 88   LEU C CD2   1 
ATOM   4250  N  N     . THR C 2  89   ? 34.682  -9.354  73.596  1.00 46.30  ? 89   THR C N     1 
ATOM   4251  C  CA    . THR C 2  89   ? 33.862  -10.557 73.650  1.00 44.74  ? 89   THR C CA    1 
ATOM   4252  C  C     . THR C 2  89   ? 34.685  -11.703 74.225  1.00 52.36  ? 89   THR C C     1 
ATOM   4253  O  O     . THR C 2  89   ? 35.835  -11.910 73.821  1.00 52.94  ? 89   THR C O     1 
ATOM   4254  C  CB    . THR C 2  89   ? 33.331  -10.920 72.260  1.00 41.23  ? 89   THR C CB    1 
ATOM   4255  O  OG1   . THR C 2  89   ? 32.291  -10.006 71.893  1.00 46.46  ? 89   THR C OG1   1 
ATOM   4256  C  CG2   . THR C 2  89   ? 32.780  -12.339 72.238  1.00 40.79  ? 89   THR C CG2   1 
ATOM   4257  N  N     . TYR C 2  90   ? 34.102  -12.431 75.178  1.00 49.33  ? 90   TYR C N     1 
ATOM   4258  C  CA    . TYR C 2  90   ? 34.744  -13.618 75.735  1.00 46.96  ? 90   TYR C CA    1 
ATOM   4259  C  C     . TYR C 2  90   ? 34.587  -14.764 74.740  1.00 45.14  ? 90   TYR C C     1 
ATOM   4260  O  O     . TYR C 2  90   ? 33.478  -15.272 74.536  1.00 40.42  ? 90   TYR C O     1 
ATOM   4261  C  CB    . TYR C 2  90   ? 34.141  -13.965 77.093  1.00 36.12  ? 90   TYR C CB    1 
ATOM   4262  C  CG    . TYR C 2  90   ? 34.851  -15.087 77.815  1.00 37.06  ? 90   TYR C CG    1 
ATOM   4263  C  CD1   . TYR C 2  90   ? 36.125  -14.908 78.335  1.00 40.32  ? 90   TYR C CD1   1 
ATOM   4264  C  CD2   . TYR C 2  90   ? 34.243  -16.324 77.986  1.00 37.00  ? 90   TYR C CD2   1 
ATOM   4265  C  CE1   . TYR C 2  90   ? 36.778  -15.933 78.996  1.00 43.68  ? 90   TYR C CE1   1 
ATOM   4266  C  CE2   . TYR C 2  90   ? 34.884  -17.352 78.648  1.00 37.45  ? 90   TYR C CE2   1 
ATOM   4267  C  CZ    . TYR C 2  90   ? 36.150  -17.152 79.152  1.00 45.04  ? 90   TYR C CZ    1 
ATOM   4268  O  OH    . TYR C 2  90   ? 36.792  -18.175 79.813  1.00 51.27  ? 90   TYR C OH    1 
ATOM   4269  N  N     . GLN C 2  91   ? 35.697  -15.182 74.133  1.00 39.73  ? 91   GLN C N     1 
ATOM   4270  C  CA    . GLN C 2  91   ? 35.646  -16.061 72.975  1.00 39.47  ? 91   GLN C CA    1 
ATOM   4271  C  C     . GLN C 2  91   ? 36.944  -16.854 72.883  1.00 39.75  ? 91   GLN C C     1 
ATOM   4272  O  O     . GLN C 2  91   ? 37.939  -16.539 73.539  1.00 45.44  ? 91   GLN C O     1 
ATOM   4273  C  CB    . GLN C 2  91   ? 35.405  -15.253 71.698  1.00 41.13  ? 91   GLN C CB    1 
ATOM   4274  C  CG    . GLN C 2  91   ? 36.357  -14.084 71.553  1.00 42.10  ? 91   GLN C CG    1 
ATOM   4275  C  CD    . GLN C 2  91   ? 36.055  -13.229 70.343  1.00 47.51  ? 91   GLN C CD    1 
ATOM   4276  O  OE1   . GLN C 2  91   ? 35.057  -13.438 69.651  1.00 46.93  ? 91   GLN C OE1   1 
ATOM   4277  N  NE2   . GLN C 2  91   ? 36.923  -12.259 70.077  1.00 44.32  ? 91   GLN C NE2   1 
ATOM   4278  N  N     . ALA C 2  92   ? 36.916  -17.891 72.043  1.00 36.97  ? 92   ALA C N     1 
ATOM   4279  C  CA    . ALA C 2  92   ? 38.038  -18.786 71.808  1.00 38.75  ? 92   ALA C CA    1 
ATOM   4280  C  C     . ALA C 2  92   ? 38.314  -18.900 70.316  1.00 38.96  ? 92   ALA C C     1 
ATOM   4281  O  O     . ALA C 2  92   ? 37.376  -18.961 69.514  1.00 36.95  ? 92   ALA C O     1 
ATOM   4282  C  CB    . ALA C 2  92   ? 37.767  -20.182 72.384  1.00 35.26  ? 92   ALA C CB    1 
ATOM   4283  N  N     . PRO C 2  93   ? 39.584  -18.943 69.914  1.00 37.63  ? 93   PRO C N     1 
ATOM   4284  C  CA    . PRO C 2  93   ? 39.898  -19.043 68.484  1.00 35.51  ? 93   PRO C CA    1 
ATOM   4285  C  C     . PRO C 2  93   ? 39.607  -20.435 67.944  1.00 36.10  ? 93   PRO C C     1 
ATOM   4286  O  O     . PRO C 2  93   ? 39.894  -21.445 68.590  1.00 41.57  ? 93   PRO C O     1 
ATOM   4287  C  CB    . PRO C 2  93   ? 41.396  -18.725 68.432  1.00 39.14  ? 93   PRO C CB    1 
ATOM   4288  C  CG    . PRO C 2  93   ? 41.906  -19.155 69.767  1.00 37.92  ? 93   PRO C CG    1 
ATOM   4289  C  CD    . PRO C 2  93   ? 40.798  -18.866 70.745  1.00 39.95  ? 93   PRO C CD    1 
ATOM   4290  N  N     . LEU C 2  94   ? 39.036  -20.480 66.743  1.00 33.86  ? 94   LEU C N     1 
ATOM   4291  C  CA    . LEU C 2  94   ? 38.669  -21.727 66.081  1.00 36.02  ? 94   LEU C CA    1 
ATOM   4292  C  C     . LEU C 2  94   ? 39.635  -21.994 64.934  1.00 43.41  ? 94   LEU C C     1 
ATOM   4293  O  O     . LEU C 2  94   ? 39.676  -21.230 63.961  1.00 44.33  ? 94   LEU C O     1 
ATOM   4294  C  CB    . LEU C 2  94   ? 37.232  -21.669 65.561  1.00 37.81  ? 94   LEU C CB    1 
ATOM   4295  C  CG    . LEU C 2  94   ? 36.763  -22.832 64.681  1.00 34.43  ? 94   LEU C CG    1 
ATOM   4296  C  CD1   . LEU C 2  94   ? 36.706  -24.129 65.466  1.00 29.59  ? 94   LEU C CD1   1 
ATOM   4297  C  CD2   . LEU C 2  94   ? 35.416  -22.527 64.056  1.00 29.51  ? 94   LEU C CD2   1 
ATOM   4298  N  N     . TYR C 2  95   ? 40.403  -23.075 65.042  1.00 40.29  ? 95   TYR C N     1 
ATOM   4299  C  CA    . TYR C 2  95   ? 41.281  -23.517 63.970  1.00 34.19  ? 95   TYR C CA    1 
ATOM   4300  C  C     . TYR C 2  95   ? 40.708  -24.787 63.356  1.00 37.40  ? 95   TYR C C     1 
ATOM   4301  O  O     . TYR C 2  95   ? 40.148  -25.626 64.064  1.00 40.73  ? 95   TYR C O     1 
ATOM   4302  C  CB    . TYR C 2  95   ? 42.697  -23.771 64.490  1.00 33.24  ? 95   TYR C CB    1 
ATOM   4303  C  CG    . TYR C 2  95   ? 43.299  -22.600 65.231  1.00 35.75  ? 95   TYR C CG    1 
ATOM   4304  C  CD1   . TYR C 2  95   ? 44.020  -21.626 64.559  1.00 43.15  ? 95   TYR C CD1   1 
ATOM   4305  C  CD2   . TYR C 2  95   ? 43.151  -22.470 66.605  1.00 38.64  ? 95   TYR C CD2   1 
ATOM   4306  C  CE1   . TYR C 2  95   ? 44.578  -20.556 65.230  1.00 42.16  ? 95   TYR C CE1   1 
ATOM   4307  C  CE2   . TYR C 2  95   ? 43.704  -21.400 67.286  1.00 42.07  ? 95   TYR C CE2   1 
ATOM   4308  C  CZ    . TYR C 2  95   ? 44.417  -20.446 66.593  1.00 43.34  ? 95   TYR C CZ    1 
ATOM   4309  O  OH    . TYR C 2  95   ? 44.971  -19.377 67.261  1.00 44.96  ? 95   TYR C OH    1 
ATOM   4310  N  N     . ALA C 2  96   ? 40.833  -24.923 62.039  1.00 40.99  ? 96   ALA C N     1 
ATOM   4311  C  CA    . ALA C 2  96   ? 40.315  -26.093 61.339  1.00 41.31  ? 96   ALA C CA    1 
ATOM   4312  C  C     . ALA C 2  96   ? 41.389  -26.632 60.407  1.00 48.51  ? 96   ALA C C     1 
ATOM   4313  O  O     . ALA C 2  96   ? 41.930  -25.887 59.583  1.00 48.92  ? 96   ALA C O     1 
ATOM   4314  C  CB    . ALA C 2  96   ? 39.042  -25.758 60.553  1.00 38.42  ? 96   ALA C CB    1 
ATOM   4315  N  N     . ARG C 2  97   ? 41.709  -27.915 60.547  1.00 47.76  ? 97   ARG C N     1 
ATOM   4316  C  CA    . ARG C 2  97   ? 42.697  -28.558 59.691  1.00 49.93  ? 97   ARG C CA    1 
ATOM   4317  C  C     . ARG C 2  97   ? 42.019  -29.059 58.423  1.00 48.46  ? 97   ARG C C     1 
ATOM   4318  O  O     . ARG C 2  97   ? 41.161  -29.946 58.478  1.00 44.16  ? 97   ARG C O     1 
ATOM   4319  C  CB    . ARG C 2  97   ? 43.384  -29.707 60.424  1.00 53.54  ? 97   ARG C CB    1 
ATOM   4320  C  CG    . ARG C 2  97   ? 44.451  -29.259 61.403  1.00 59.44  ? 97   ARG C CG    1 
ATOM   4321  C  CD    . ARG C 2  97   ? 45.167  -30.453 62.002  1.00 70.59  ? 97   ARG C CD    1 
ATOM   4322  N  NE    . ARG C 2  97   ? 45.634  -31.378 60.972  1.00 70.96  ? 97   ARG C NE    1 
ATOM   4323  C  CZ    . ARG C 2  97   ? 46.178  -32.564 61.227  1.00 76.21  ? 97   ARG C CZ    1 
ATOM   4324  N  NH1   . ARG C 2  97   ? 46.572  -33.345 60.229  1.00 72.10  ? 97   ARG C NH1   1 
ATOM   4325  N  NH2   . ARG C 2  97   ? 46.324  -32.972 62.481  1.00 78.56  ? 97   ARG C NH2   1 
ATOM   4326  N  N     . LEU C 2  98   ? 42.404  -28.488 57.287  1.00 50.53  ? 98   LEU C N     1 
ATOM   4327  C  CA    . LEU C 2  98   ? 41.838  -28.828 55.995  1.00 53.80  ? 98   LEU C CA    1 
ATOM   4328  C  C     . LEU C 2  98   ? 42.954  -29.313 55.082  1.00 65.19  ? 98   LEU C C     1 
ATOM   4329  O  O     . LEU C 2  98   ? 44.136  -29.043 55.318  1.00 74.37  ? 98   LEU C O     1 
ATOM   4330  C  CB    . LEU C 2  98   ? 41.125  -27.620 55.374  1.00 51.24  ? 98   LEU C CB    1 
ATOM   4331  C  CG    . LEU C 2  98   ? 40.159  -26.890 56.308  1.00 45.91  ? 98   LEU C CG    1 
ATOM   4332  C  CD1   . LEU C 2  98   ? 39.719  -25.559 55.719  1.00 43.50  ? 98   LEU C CD1   1 
ATOM   4333  C  CD2   . LEU C 2  98   ? 38.963  -27.775 56.605  1.00 44.53  ? 98   LEU C CD2   1 
ATOM   4334  N  N     . GLN C 2  99   ? 42.577  -30.061 54.049  1.00 64.07  ? 99   GLN C N     1 
ATOM   4335  C  CA    . GLN C 2  99   ? 43.536  -30.534 53.062  1.00 67.64  ? 99   GLN C CA    1 
ATOM   4336  C  C     . GLN C 2  99   ? 42.973  -30.318 51.666  1.00 70.97  ? 99   GLN C C     1 
ATOM   4337  O  O     . GLN C 2  99   ? 41.812  -30.645 51.397  1.00 68.30  ? 99   GLN C O     1 
ATOM   4338  C  CB    . GLN C 2  99   ? 43.893  -32.010 53.286  1.00 65.20  ? 99   GLN C CB    1 
ATOM   4339  C  CG    . GLN C 2  99   ? 42.761  -32.989 53.060  1.00 67.14  ? 99   GLN C CG    1 
ATOM   4340  C  CD    . GLN C 2  99   ? 43.211  -34.421 53.207  1.00 71.41  ? 99   GLN C CD    1 
ATOM   4341  O  OE1   . GLN C 2  99   ? 44.266  -34.692 53.783  1.00 67.08  ? 99   GLN C OE1   1 
ATOM   4342  N  NE2   . GLN C 2  99   ? 42.417  -35.351 52.682  1.00 68.91  ? 99   GLN C NE2   1 
ATOM   4343  N  N     . LEU C 2  100  ? 43.796  -29.751 50.792  1.00 80.41  ? 100  LEU C N     1 
ATOM   4344  C  CA    . LEU C 2  100  ? 43.471  -29.545 49.391  1.00 77.10  ? 100  LEU C CA    1 
ATOM   4345  C  C     . LEU C 2  100  ? 44.048  -30.699 48.586  1.00 77.82  ? 100  LEU C C     1 
ATOM   4346  O  O     . LEU C 2  100  ? 45.227  -31.039 48.737  1.00 81.39  ? 100  LEU C O     1 
ATOM   4347  C  CB    . LEU C 2  100  ? 44.045  -28.215 48.904  1.00 71.41  ? 100  LEU C CB    1 
ATOM   4348  C  CG    . LEU C 2  100  ? 43.314  -27.428 47.820  1.00 76.18  ? 100  LEU C CG    1 
ATOM   4349  C  CD1   . LEU C 2  100  ? 44.084  -26.156 47.525  1.00 88.54  ? 100  LEU C CD1   1 
ATOM   4350  C  CD2   . LEU C 2  100  ? 43.142  -28.250 46.561  1.00 89.17  ? 100  LEU C CD2   1 
ATOM   4351  N  N     . ILE C 2  101  ? 43.219  -31.296 47.732  1.00 79.56  ? 101  ILE C N     1 
ATOM   4352  C  CA    . ILE C 2  101  ? 43.603  -32.456 46.938  1.00 89.48  ? 101  ILE C CA    1 
ATOM   4353  C  C     . ILE C 2  101  ? 43.222  -32.207 45.487  1.00 105.44 ? 101  ILE C C     1 
ATOM   4354  O  O     . ILE C 2  101  ? 42.064  -31.889 45.192  1.00 108.16 ? 101  ILE C O     1 
ATOM   4355  C  CB    . ILE C 2  101  ? 42.934  -33.745 47.452  1.00 81.57  ? 101  ILE C CB    1 
ATOM   4356  C  CG1   . ILE C 2  101  ? 43.431  -34.086 48.858  1.00 88.36  ? 101  ILE C CG1   1 
ATOM   4357  C  CG2   . ILE C 2  101  ? 43.190  -34.898 46.494  1.00 89.90  ? 101  ILE C CG2   1 
ATOM   4358  C  CD1   . ILE C 2  101  ? 42.860  -35.371 49.413  1.00 90.13  ? 101  ILE C CD1   1 
ATOM   4359  N  N     . HIS C 2  102  ? 44.194  -32.337 44.584  1.00 106.09 ? 102  HIS C N     1 
ATOM   4360  C  CA    A HIS C 2  102  ? 43.918  -32.301 43.154  0.50 106.04 ? 102  HIS C CA    1 
ATOM   4361  C  CA    B HIS C 2  102  ? 43.938  -32.304 43.149  0.50 106.10 ? 102  HIS C CA    1 
ATOM   4362  C  C     . HIS C 2  102  ? 43.642  -33.725 42.684  1.00 109.54 ? 102  HIS C C     1 
ATOM   4363  O  O     . HIS C 2  102  ? 44.469  -34.623 42.880  1.00 111.16 ? 102  HIS C O     1 
ATOM   4364  C  CB    A HIS C 2  102  ? 45.078  -31.682 42.375  0.50 105.09 ? 102  HIS C CB    1 
ATOM   4365  C  CB    B HIS C 2  102  ? 45.135  -31.734 42.388  0.50 105.02 ? 102  HIS C CB    1 
ATOM   4366  C  CG    A HIS C 2  102  ? 44.697  -31.208 41.005  0.50 106.22 ? 102  HIS C CG    1 
ATOM   4367  C  CG    B HIS C 2  102  ? 45.600  -30.402 42.890  0.50 104.89 ? 102  HIS C CG    1 
ATOM   4368  N  ND1   A HIS C 2  102  ? 44.890  -31.967 39.871  0.50 106.88 ? 102  HIS C ND1   1 
ATOM   4369  N  ND1   B HIS C 2  102  ? 46.296  -30.252 44.070  0.50 102.82 ? 102  HIS C ND1   1 
ATOM   4370  C  CD2   A HIS C 2  102  ? 44.122  -30.054 40.591  0.50 102.48 ? 102  HIS C CD2   1 
ATOM   4371  C  CD2   B HIS C 2  102  ? 45.478  -29.160 42.365  0.50 107.52 ? 102  HIS C CD2   1 
ATOM   4372  C  CE1   A HIS C 2  102  ? 44.456  -31.299 38.817  0.50 104.10 ? 102  HIS C CE1   1 
ATOM   4373  C  CE1   B HIS C 2  102  ? 46.577  -28.975 44.253  0.50 105.14 ? 102  HIS C CE1   1 
ATOM   4374  N  NE2   A HIS C 2  102  ? 43.984  -30.135 39.226  0.50 100.00 ? 102  HIS C NE2   1 
ATOM   4375  N  NE2   B HIS C 2  102  ? 46.092  -28.290 43.233  0.50 109.02 ? 102  HIS C NE2   1 
ATOM   4376  N  N     . LYS C 2  103  ? 42.469  -33.931 42.080  1.00 111.35 ? 103  LYS C N     1 
ATOM   4377  C  CA    . LYS C 2  103  ? 42.082  -35.274 41.654  1.00 117.64 ? 103  LYS C CA    1 
ATOM   4378  C  C     . LYS C 2  103  ? 43.082  -35.848 40.658  1.00 123.79 ? 103  LYS C C     1 
ATOM   4379  O  O     . LYS C 2  103  ? 43.541  -36.988 40.805  1.00 123.80 ? 103  LYS C O     1 
ATOM   4380  C  CB    . LYS C 2  103  ? 40.678  -35.252 41.048  1.00 119.80 ? 103  LYS C CB    1 
ATOM   4381  C  CG    . LYS C 2  103  ? 39.576  -34.903 42.030  1.00 113.50 ? 103  LYS C CG    1 
ATOM   4382  C  CD    . LYS C 2  103  ? 38.213  -34.977 41.363  1.00 118.38 ? 103  LYS C CD    1 
ATOM   4383  C  CE    . LYS C 2  103  ? 37.098  -34.706 42.356  1.00 116.82 ? 103  LYS C CE    1 
ATOM   4384  N  NZ    . LYS C 2  103  ? 35.757  -34.762 41.714  1.00 111.49 ? 103  LYS C NZ    1 
ATOM   4385  N  N     . ASP C 2  104  ? 43.433  -35.068 39.635  1.00 118.41 ? 104  ASP C N     1 
ATOM   4386  C  CA    . ASP C 2  104  ? 44.345  -35.558 38.607  1.00 113.08 ? 104  ASP C CA    1 
ATOM   4387  C  C     . ASP C 2  104  ? 45.766  -35.682 39.143  1.00 110.05 ? 104  ASP C C     1 
ATOM   4388  O  O     . ASP C 2  104  ? 46.387  -36.746 39.044  1.00 114.44 ? 104  ASP C O     1 
ATOM   4389  C  CB    . ASP C 2  104  ? 44.302  -34.627 37.396  1.00 116.07 ? 104  ASP C CB    1 
ATOM   4390  C  CG    . ASP C 2  104  ? 42.894  -34.411 36.882  1.00 128.44 ? 104  ASP C CG    1 
ATOM   4391  O  OD1   . ASP C 2  104  ? 42.088  -35.365 36.938  1.00 127.37 ? 104  ASP C OD1   1 
ATOM   4392  O  OD2   . ASP C 2  104  ? 42.591  -33.287 36.429  1.00 137.23 ? 104  ASP C OD2   1 
ATOM   4393  N  N     . THR C 2  105  ? 46.292  -34.603 39.727  1.00 106.67 ? 105  THR C N     1 
ATOM   4394  C  CA    . THR C 2  105  ? 47.687  -34.590 40.153  1.00 104.36 ? 105  THR C CA    1 
ATOM   4395  C  C     . THR C 2  105  ? 47.947  -35.553 41.305  1.00 105.05 ? 105  THR C C     1 
ATOM   4396  O  O     . THR C 2  105  ? 49.051  -36.098 41.417  1.00 104.01 ? 105  THR C O     1 
ATOM   4397  C  CB    . THR C 2  105  ? 48.095  -33.174 40.557  1.00 99.70  ? 105  THR C CB    1 
ATOM   4398  O  OG1   . THR C 2  105  ? 47.561  -32.233 39.617  1.00 101.00 ? 105  THR C OG1   1 
ATOM   4399  C  CG2   . THR C 2  105  ? 49.607  -33.044 40.585  1.00 95.72  ? 105  THR C CG2   1 
ATOM   4400  N  N     . GLY C 2  106  ? 46.954  -35.779 42.163  1.00 111.16 ? 106  GLY C N     1 
ATOM   4401  C  CA    . GLY C 2  106  ? 47.175  -36.490 43.403  1.00 112.25 ? 106  GLY C CA    1 
ATOM   4402  C  C     . GLY C 2  106  ? 47.843  -35.667 44.481  1.00 111.57 ? 106  GLY C C     1 
ATOM   4403  O  O     . GLY C 2  106  ? 48.019  -36.166 45.601  1.00 102.18 ? 106  GLY C O     1 
ATOM   4404  N  N     . LEU C 2  107  ? 48.212  -34.424 44.178  1.00 113.24 ? 107  LEU C N     1 
ATOM   4405  C  CA    . LEU C 2  107  ? 48.882  -33.557 45.136  1.00 109.72 ? 107  LEU C CA    1 
ATOM   4406  C  C     . LEU C 2  107  ? 47.971  -33.256 46.321  1.00 103.51 ? 107  LEU C C     1 
ATOM   4407  O  O     . LEU C 2  107  ? 46.774  -33.003 46.157  1.00 98.86  ? 107  LEU C O     1 
ATOM   4408  C  CB    . LEU C 2  107  ? 49.306  -32.261 44.444  1.00 104.05 ? 107  LEU C CB    1 
ATOM   4409  C  CG    . LEU C 2  107  ? 50.053  -31.207 45.255  1.00 100.67 ? 107  LEU C CG    1 
ATOM   4410  C  CD1   . LEU C 2  107  ? 51.359  -31.776 45.780  1.00 97.66  ? 107  LEU C CD1   1 
ATOM   4411  C  CD2   . LEU C 2  107  ? 50.297  -29.969 44.404  1.00 96.73  ? 107  LEU C CD2   1 
ATOM   4412  N  N     . ILE C 2  108  ? 48.546  -33.292 47.523  1.00 97.32  ? 108  ILE C N     1 
ATOM   4413  C  CA    . ILE C 2  108  ? 47.809  -33.100 48.769  1.00 90.18  ? 108  ILE C CA    1 
ATOM   4414  C  C     . ILE C 2  108  ? 48.558  -32.072 49.607  1.00 84.10  ? 108  ILE C C     1 
ATOM   4415  O  O     . ILE C 2  108  ? 49.674  -32.337 50.069  1.00 90.46  ? 108  ILE C O     1 
ATOM   4416  C  CB    . ILE C 2  108  ? 47.639  -34.412 49.548  1.00 87.55  ? 108  ILE C CB    1 
ATOM   4417  C  CG1   . ILE C 2  108  ? 46.947  -35.466 48.679  1.00 93.43  ? 108  ILE C CG1   1 
ATOM   4418  C  CG2   . ILE C 2  108  ? 46.859  -34.174 50.831  1.00 75.51  ? 108  ILE C CG2   1 
ATOM   4419  C  CD1   . ILE C 2  108  ? 46.852  -36.824 49.329  1.00 90.23  ? 108  ILE C CD1   1 
ATOM   4420  N  N     . LYS C 2  109  ? 47.947  -30.908 49.815  1.00 80.81  ? 109  LYS C N     1 
ATOM   4421  C  CA    . LYS C 2  109  ? 48.520  -29.853 50.647  1.00 78.86  ? 109  LYS C CA    1 
ATOM   4422  C  C     . LYS C 2  109  ? 47.582  -29.589 51.818  1.00 74.30  ? 109  LYS C C     1 
ATOM   4423  O  O     . LYS C 2  109  ? 46.445  -29.155 51.622  1.00 77.44  ? 109  LYS C O     1 
ATOM   4424  C  CB    . LYS C 2  109  ? 48.766  -28.577 49.836  1.00 74.56  ? 109  LYS C CB    1 
ATOM   4425  C  CG    . LYS C 2  109  ? 49.088  -27.346 50.681  1.00 79.00  ? 109  LYS C CG    1 
ATOM   4426  C  CD    . LYS C 2  109  ? 50.276  -27.575 51.617  1.00 82.06  ? 109  LYS C CD    1 
ATOM   4427  C  CE    . LYS C 2  109  ? 50.441  -26.414 52.593  1.00 70.48  ? 109  LYS C CE    1 
ATOM   4428  N  NZ    . LYS C 2  109  ? 51.334  -26.747 53.742  1.00 56.11  ? 109  LYS C NZ    1 
ATOM   4429  N  N     . GLU C 2  110  ? 48.057  -29.851 53.028  1.00 68.42  ? 110  GLU C N     1 
ATOM   4430  C  CA    . GLU C 2  110  ? 47.233  -29.806 54.225  1.00 64.62  ? 110  GLU C CA    1 
ATOM   4431  C  C     . GLU C 2  110  ? 47.740  -28.735 55.183  1.00 61.32  ? 110  GLU C C     1 
ATOM   4432  O  O     . GLU C 2  110  ? 48.949  -28.606 55.404  1.00 60.18  ? 110  GLU C O     1 
ATOM   4433  C  CB    . GLU C 2  110  ? 47.229  -31.172 54.909  1.00 63.55  ? 110  GLU C CB    1 
ATOM   4434  C  CG    . GLU C 2  110  ? 46.812  -31.159 56.354  1.00 66.61  ? 110  GLU C CG    1 
ATOM   4435  C  CD    . GLU C 2  110  ? 47.120  -32.472 57.034  1.00 70.73  ? 110  GLU C CD    1 
ATOM   4436  O  OE1   . GLU C 2  110  ? 47.350  -32.466 58.260  1.00 78.22  ? 110  GLU C OE1   1 
ATOM   4437  O  OE2   . GLU C 2  110  ? 47.142  -33.509 56.336  1.00 63.71  ? 110  GLU C OE2   1 
ATOM   4438  N  N     . ASP C 2  111  ? 46.810  -27.971 55.757  1.00 57.48  ? 111  ASP C N     1 
ATOM   4439  C  CA    . ASP C 2  111  ? 47.177  -26.891 56.661  1.00 62.08  ? 111  ASP C CA    1 
ATOM   4440  C  C     . ASP C 2  111  ? 46.029  -26.621 57.628  1.00 60.87  ? 111  ASP C C     1 
ATOM   4441  O  O     . ASP C 2  111  ? 44.870  -26.947 57.361  1.00 64.41  ? 111  ASP C O     1 
ATOM   4442  C  CB    . ASP C 2  111  ? 47.556  -25.623 55.876  1.00 62.77  ? 111  ASP C CB    1 
ATOM   4443  C  CG    . ASP C 2  111  ? 48.187  -24.553 56.753  1.00 72.55  ? 111  ASP C CG    1 
ATOM   4444  O  OD1   . ASP C 2  111  ? 48.883  -24.912 57.729  1.00 72.61  ? 111  ASP C OD1   1 
ATOM   4445  O  OD2   . ASP C 2  111  ? 47.974  -23.353 56.472  1.00 68.84  ? 111  ASP C OD2   1 
ATOM   4446  N  N     . GLU C 2  112  ? 46.373  -26.029 58.769  1.00 50.32  ? 112  GLU C N     1 
ATOM   4447  C  CA    . GLU C 2  112  ? 45.400  -25.614 59.771  1.00 44.46  ? 112  GLU C CA    1 
ATOM   4448  C  C     . GLU C 2  112  ? 45.119  -24.128 59.586  1.00 50.55  ? 112  GLU C C     1 
ATOM   4449  O  O     . GLU C 2  112  ? 46.014  -23.298 59.777  1.00 59.24  ? 112  GLU C O     1 
ATOM   4450  C  CB    . GLU C 2  112  ? 45.926  -25.892 61.179  1.00 45.53  ? 112  GLU C CB    1 
ATOM   4451  C  CG    . GLU C 2  112  ? 44.986  -25.485 62.300  1.00 46.46  ? 112  GLU C CG    1 
ATOM   4452  C  CD    . GLU C 2  112  ? 45.589  -25.703 63.678  1.00 47.77  ? 112  GLU C CD    1 
ATOM   4453  O  OE1   . GLU C 2  112  ? 46.270  -24.787 64.189  1.00 46.52  ? 112  GLU C OE1   1 
ATOM   4454  O  OE2   . GLU C 2  112  ? 45.388  -26.795 64.250  1.00 57.46  ? 112  GLU C OE2   1 
ATOM   4455  N  N     . VAL C 2  113  ? 43.886  -23.793 59.216  1.00 49.23  ? 113  VAL C N     1 
ATOM   4456  C  CA    . VAL C 2  113  ? 43.513  -22.418 58.910  1.00 52.84  ? 113  VAL C CA    1 
ATOM   4457  C  C     . VAL C 2  113  ? 42.704  -21.839 60.064  1.00 50.25  ? 113  VAL C C     1 
ATOM   4458  O  O     . VAL C 2  113  ? 41.957  -22.547 60.753  1.00 50.24  ? 113  VAL C O     1 
ATOM   4459  C  CB    . VAL C 2  113  ? 42.729  -22.321 57.584  1.00 52.44  ? 113  VAL C CB    1 
ATOM   4460  C  CG1   . VAL C 2  113  ? 43.523  -22.963 56.465  1.00 49.83  ? 113  VAL C CG1   1 
ATOM   4461  C  CG2   . VAL C 2  113  ? 41.367  -22.977 57.713  1.00 53.52  ? 113  VAL C CG2   1 
ATOM   4462  N  N     . PHE C 2  114  ? 42.858  -20.532 60.269  1.00 52.46  ? 114  PHE C N     1 
ATOM   4463  C  CA    . PHE C 2  114  ? 42.205  -19.818 61.360  1.00 50.84  ? 114  PHE C CA    1 
ATOM   4464  C  C     . PHE C 2  114  ? 40.860  -19.280 60.883  1.00 49.85  ? 114  PHE C C     1 
ATOM   4465  O  O     . PHE C 2  114  ? 40.804  -18.487 59.937  1.00 53.97  ? 114  PHE C O     1 
ATOM   4466  C  CB    . PHE C 2  114  ? 43.102  -18.685 61.855  1.00 51.03  ? 114  PHE C CB    1 
ATOM   4467  C  CG    . PHE C 2  114  ? 42.450  -17.777 62.857  1.00 49.73  ? 114  PHE C CG    1 
ATOM   4468  C  CD1   . PHE C 2  114  ? 42.330  -18.157 64.181  1.00 45.88  ? 114  PHE C CD1   1 
ATOM   4469  C  CD2   . PHE C 2  114  ? 41.976  -16.535 62.478  1.00 52.08  ? 114  PHE C CD2   1 
ATOM   4470  C  CE1   . PHE C 2  114  ? 41.741  -17.321 65.105  1.00 42.17  ? 114  PHE C CE1   1 
ATOM   4471  C  CE2   . PHE C 2  114  ? 41.384  -15.695 63.399  1.00 54.15  ? 114  PHE C CE2   1 
ATOM   4472  C  CZ    . PHE C 2  114  ? 41.268  -16.089 64.714  1.00 45.34  ? 114  PHE C CZ    1 
ATOM   4473  N  N     . LEU C 2  115  ? 39.783  -19.697 61.548  1.00 40.79  ? 115  LEU C N     1 
ATOM   4474  C  CA    . LEU C 2  115  ? 38.431  -19.357 61.129  1.00 41.15  ? 115  LEU C CA    1 
ATOM   4475  C  C     . LEU C 2  115  ? 37.798  -18.253 61.965  1.00 51.81  ? 115  LEU C C     1 
ATOM   4476  O  O     . LEU C 2  115  ? 36.592  -18.019 61.840  1.00 60.15  ? 115  LEU C O     1 
ATOM   4477  C  CB    . LEU C 2  115  ? 37.540  -20.598 61.170  1.00 36.84  ? 115  LEU C CB    1 
ATOM   4478  C  CG    . LEU C 2  115  ? 37.937  -21.734 60.232  1.00 37.84  ? 115  LEU C CG    1 
ATOM   4479  C  CD1   . LEU C 2  115  ? 36.892  -22.836 60.252  1.00 34.38  ? 115  LEU C CD1   1 
ATOM   4480  C  CD2   . LEU C 2  115  ? 38.118  -21.192 58.835  1.00 42.55  ? 115  LEU C CD2   1 
ATOM   4481  N  N     . GLY C 2  116  ? 38.566  -17.572 62.805  1.00 48.53  ? 116  GLY C N     1 
ATOM   4482  C  CA    . GLY C 2  116  ? 38.007  -16.597 63.719  1.00 42.68  ? 116  GLY C CA    1 
ATOM   4483  C  C     . GLY C 2  116  ? 37.764  -17.179 65.098  1.00 47.65  ? 116  GLY C C     1 
ATOM   4484  O  O     . GLY C 2  116  ? 38.326  -18.205 65.487  1.00 49.78  ? 116  GLY C O     1 
ATOM   4485  N  N     . HIS C 2  117  ? 36.896  -16.510 65.847  1.00 45.22  ? 117  HIS C N     1 
ATOM   4486  C  CA    . HIS C 2  117  ? 36.597  -16.918 67.211  1.00 40.77  ? 117  HIS C CA    1 
ATOM   4487  C  C     . HIS C 2  117  ? 35.151  -17.386 67.343  1.00 44.02  ? 117  HIS C C     1 
ATOM   4488  O  O     . HIS C 2  117  ? 34.322  -17.225 66.442  1.00 40.10  ? 117  HIS C O     1 
ATOM   4489  C  CB    . HIS C 2  117  ? 36.871  -15.775 68.191  1.00 40.14  ? 117  HIS C CB    1 
ATOM   4490  C  CG    . HIS C 2  117  ? 38.303  -15.343 68.236  1.00 39.90  ? 117  HIS C CG    1 
ATOM   4491  N  ND1   . HIS C 2  117  ? 39.135  -15.631 69.297  1.00 43.02  ? 117  HIS C ND1   1 
ATOM   4492  C  CD2   . HIS C 2  117  ? 39.047  -14.634 67.356  1.00 42.70  ? 117  HIS C CD2   1 
ATOM   4493  C  CE1   . HIS C 2  117  ? 40.331  -15.120 69.067  1.00 43.66  ? 117  HIS C CE1   1 
ATOM   4494  N  NE2   . HIS C 2  117  ? 40.304  -14.510 67.896  1.00 49.83  ? 117  HIS C NE2   1 
ATOM   4495  N  N     . ILE C 2  118  ? 34.868  -17.983 68.496  1.00 39.50  ? 118  ILE C N     1 
ATOM   4496  C  CA    . ILE C 2  118  ? 33.525  -18.417 68.874  1.00 41.31  ? 118  ILE C CA    1 
ATOM   4497  C  C     . ILE C 2  118  ? 33.299  -17.988 70.317  1.00 36.60  ? 118  ILE C C     1 
ATOM   4498  O  O     . ILE C 2  118  ? 34.186  -18.188 71.157  1.00 36.27  ? 118  ILE C O     1 
ATOM   4499  C  CB    . ILE C 2  118  ? 33.351  -19.936 68.722  1.00 41.60  ? 118  ILE C CB    1 
ATOM   4500  C  CG1   . ILE C 2  118  ? 33.578  -20.372 67.281  1.00 41.50  ? 118  ILE C CG1   1 
ATOM   4501  C  CG2   . ILE C 2  118  ? 31.963  -20.368 69.158  1.00 40.39  ? 118  ILE C CG2   1 
ATOM   4502  C  CD1   . ILE C 2  118  ? 33.357  -21.850 67.080  1.00 54.84  ? 118  ILE C CD1   1 
ATOM   4503  N  N     . PRO C 2  119  ? 32.153  -17.395 70.649  1.00 37.59  ? 119  PRO C N     1 
ATOM   4504  C  CA    . PRO C 2  119  ? 31.904  -17.009 72.043  1.00 42.63  ? 119  PRO C CA    1 
ATOM   4505  C  C     . PRO C 2  119  ? 31.862  -18.221 72.965  1.00 36.80  ? 119  PRO C C     1 
ATOM   4506  O  O     . PRO C 2  119  ? 31.269  -19.253 72.645  1.00 35.52  ? 119  PRO C O     1 
ATOM   4507  C  CB    . PRO C 2  119  ? 30.543  -16.305 71.977  1.00 42.25  ? 119  PRO C CB    1 
ATOM   4508  C  CG    . PRO C 2  119  ? 30.439  -15.824 70.568  1.00 36.63  ? 119  PRO C CG    1 
ATOM   4509  C  CD    . PRO C 2  119  ? 31.121  -16.873 69.738  1.00 34.50  ? 119  PRO C CD    1 
ATOM   4510  N  N     . LEU C 2  120  ? 32.508  -18.087 74.118  1.00 33.05  ? 120  LEU C N     1 
ATOM   4511  C  CA    . LEU C 2  120  ? 32.485  -19.114 75.149  1.00 35.53  ? 120  LEU C CA    1 
ATOM   4512  C  C     . LEU C 2  120  ? 31.423  -18.771 76.183  1.00 42.88  ? 120  LEU C C     1 
ATOM   4513  O  O     . LEU C 2  120  ? 31.312  -17.614 76.606  1.00 46.56  ? 120  LEU C O     1 
ATOM   4514  C  CB    . LEU C 2  120  ? 33.850  -19.251 75.825  1.00 34.26  ? 120  LEU C CB    1 
ATOM   4515  C  CG    . LEU C 2  120  ? 34.978  -19.837 74.978  1.00 36.55  ? 120  LEU C CG    1 
ATOM   4516  C  CD1   . LEU C 2  120  ? 36.209  -20.062 75.837  1.00 29.94  ? 120  LEU C CD1   1 
ATOM   4517  C  CD2   . LEU C 2  120  ? 34.529  -21.129 74.319  1.00 35.68  ? 120  LEU C CD2   1 
ATOM   4518  N  N     . MET C 2  121  ? 30.648  -19.774 76.583  1.00 42.37  ? 121  MET C N     1 
ATOM   4519  C  CA    . MET C 2  121  ? 29.672  -19.594 77.645  1.00 39.00  ? 121  MET C CA    1 
ATOM   4520  C  C     . MET C 2  121  ? 30.362  -19.581 79.004  1.00 43.87  ? 121  MET C C     1 
ATOM   4521  O  O     . MET C 2  121  ? 31.237  -20.406 79.281  1.00 41.86  ? 121  MET C O     1 
ATOM   4522  C  CB    . MET C 2  121  ? 28.626  -20.705 77.598  1.00 33.97  ? 121  MET C CB    1 
ATOM   4523  C  CG    . MET C 2  121  ? 27.640  -20.660 78.746  1.00 37.44  ? 121  MET C CG    1 
ATOM   4524  S  SD    . MET C 2  121  ? 26.454  -22.006 78.697  1.00 37.16  ? 121  MET C SD    1 
ATOM   4525  C  CE    . MET C 2  121  ? 25.435  -21.514 77.308  1.00 32.07  ? 121  MET C CE    1 
ATOM   4526  N  N     . THR C 2  122  ? 29.959  -18.642 79.855  1.00 45.11  ? 122  THR C N     1 
ATOM   4527  C  CA    . THR C 2  122  ? 30.547  -18.527 81.180  1.00 44.63  ? 122  THR C CA    1 
ATOM   4528  C  C     . THR C 2  122  ? 30.086  -19.684 82.066  1.00 42.67  ? 122  THR C C     1 
ATOM   4529  O  O     . THR C 2  122  ? 29.306  -20.551 81.661  1.00 40.79  ? 122  THR C O     1 
ATOM   4530  C  CB    . THR C 2  122  ? 30.187  -17.182 81.804  1.00 44.32  ? 122  THR C CB    1 
ATOM   4531  O  OG1   . THR C 2  122  ? 28.781  -17.142 82.073  1.00 44.36  ? 122  THR C OG1   1 
ATOM   4532  C  CG2   . THR C 2  122  ? 30.547  -16.055 80.853  1.00 38.25  ? 122  THR C CG2   1 
ATOM   4533  N  N     . GLU C 2  123  ? 30.579  -19.695 83.304  1.00 39.81  ? 123  GLU C N     1 
ATOM   4534  C  CA    . GLU C 2  123  ? 30.263  -20.803 84.194  1.00 44.45  ? 123  GLU C CA    1 
ATOM   4535  C  C     . GLU C 2  123  ? 28.798  -20.787 84.621  1.00 50.96  ? 123  GLU C C     1 
ATOM   4536  O  O     . GLU C 2  123  ? 28.230  -21.849 84.904  1.00 51.56  ? 123  GLU C O     1 
ATOM   4537  C  CB    . GLU C 2  123  ? 31.181  -20.775 85.416  1.00 51.72  ? 123  GLU C CB    1 
ATOM   4538  C  CG    . GLU C 2  123  ? 31.137  -22.048 86.256  1.00 64.05  ? 123  GLU C CG    1 
ATOM   4539  C  CD    . GLU C 2  123  ? 31.864  -21.911 87.584  1.00 74.65  ? 123  GLU C CD    1 
ATOM   4540  O  OE1   . GLU C 2  123  ? 31.857  -22.885 88.369  1.00 76.08  ? 123  GLU C OE1   1 
ATOM   4541  O  OE2   . GLU C 2  123  ? 32.438  -20.833 87.845  1.00 71.11  ? 123  GLU C OE2   1 
ATOM   4542  N  N     . ASP C 2  124  ? 28.164  -19.615 84.655  1.00 48.59  ? 124  ASP C N     1 
ATOM   4543  C  CA    . ASP C 2  124  ? 26.770  -19.523 85.075  1.00 48.16  ? 124  ASP C CA    1 
ATOM   4544  C  C     . ASP C 2  124  ? 25.786  -19.648 83.919  1.00 42.96  ? 124  ASP C C     1 
ATOM   4545  O  O     . ASP C 2  124  ? 24.575  -19.572 84.149  1.00 45.02  ? 124  ASP C O     1 
ATOM   4546  C  CB    . ASP C 2  124  ? 26.515  -18.207 85.826  1.00 47.14  ? 124  ASP C CB    1 
ATOM   4547  C  CG    . ASP C 2  124  ? 26.774  -16.980 84.971  1.00 51.31  ? 124  ASP C CG    1 
ATOM   4548  O  OD1   . ASP C 2  124  ? 27.957  -16.681 84.700  1.00 55.16  ? 124  ASP C OD1   1 
ATOM   4549  O  OD2   . ASP C 2  124  ? 25.792  -16.319 84.566  1.00 45.01  ? 124  ASP C OD2   1 
ATOM   4550  N  N     . GLY C 2  125  ? 26.265  -19.838 82.695  1.00 42.15  ? 125  GLY C N     1 
ATOM   4551  C  CA    . GLY C 2  125  ? 25.393  -20.049 81.560  1.00 42.64  ? 125  GLY C CA    1 
ATOM   4552  C  C     . GLY C 2  125  ? 25.108  -18.837 80.702  1.00 40.30  ? 125  GLY C C     1 
ATOM   4553  O  O     . GLY C 2  125  ? 24.158  -18.874 79.912  1.00 40.70  ? 125  GLY C O     1 
ATOM   4554  N  N     . SER C 2  126  ? 25.888  -17.773 80.827  1.00 41.55  ? 126  SER C N     1 
ATOM   4555  C  CA    . SER C 2  126  ? 25.701  -16.562 80.044  1.00 37.66  ? 126  SER C CA    1 
ATOM   4556  C  C     . SER C 2  126  ? 26.862  -16.391 79.069  1.00 42.39  ? 126  SER C C     1 
ATOM   4557  O  O     . SER C 2  126  ? 27.786  -17.207 79.008  1.00 45.94  ? 126  SER C O     1 
ATOM   4558  C  CB    . SER C 2  126  ? 25.568  -15.347 80.964  1.00 38.29  ? 126  SER C CB    1 
ATOM   4559  O  OG    . SER C 2  126  ? 26.728  -15.190 81.763  1.00 39.28  ? 126  SER C OG    1 
ATOM   4560  N  N     . PHE C 2  127  ? 26.804  -15.310 78.295  1.00 39.88  ? 127  PHE C N     1 
ATOM   4561  C  CA    . PHE C 2  127  ? 27.862  -14.947 77.367  1.00 36.95  ? 127  PHE C CA    1 
ATOM   4562  C  C     . PHE C 2  127  ? 28.301  -13.516 77.635  1.00 39.83  ? 127  PHE C C     1 
ATOM   4563  O  O     . PHE C 2  127  ? 27.555  -12.711 78.194  1.00 41.18  ? 127  PHE C O     1 
ATOM   4564  C  CB    . PHE C 2  127  ? 27.413  -15.065 75.906  1.00 37.24  ? 127  PHE C CB    1 
ATOM   4565  C  CG    . PHE C 2  127  ? 27.218  -16.473 75.437  1.00 38.53  ? 127  PHE C CG    1 
ATOM   4566  C  CD1   . PHE C 2  127  ? 28.291  -17.219 74.986  1.00 39.14  ? 127  PHE C CD1   1 
ATOM   4567  C  CD2   . PHE C 2  127  ? 25.959  -17.048 75.434  1.00 42.67  ? 127  PHE C CD2   1 
ATOM   4568  C  CE1   . PHE C 2  127  ? 28.115  -18.518 74.546  1.00 38.52  ? 127  PHE C CE1   1 
ATOM   4569  C  CE2   . PHE C 2  127  ? 25.773  -18.347 74.994  1.00 40.43  ? 127  PHE C CE2   1 
ATOM   4570  C  CZ    . PHE C 2  127  ? 26.854  -19.083 74.550  1.00 37.24  ? 127  PHE C CZ    1 
ATOM   4571  N  N     . ILE C 2  128  ? 29.520  -13.200 77.212  1.00 46.33  ? 128  ILE C N     1 
ATOM   4572  C  CA    . ILE C 2  128  ? 30.024  -11.832 77.218  1.00 42.46  ? 128  ILE C CA    1 
ATOM   4573  C  C     . ILE C 2  128  ? 30.237  -11.429 75.767  1.00 45.35  ? 128  ILE C C     1 
ATOM   4574  O  O     . ILE C 2  128  ? 31.150  -11.934 75.102  1.00 45.40  ? 128  ILE C O     1 
ATOM   4575  C  CB    . ILE C 2  128  ? 31.316  -11.692 78.032  1.00 41.17  ? 128  ILE C CB    1 
ATOM   4576  C  CG1   . ILE C 2  128  ? 31.117  -12.236 79.447  1.00 41.85  ? 128  ILE C CG1   1 
ATOM   4577  C  CG2   . ILE C 2  128  ? 31.744  -10.239 78.088  1.00 42.28  ? 128  ILE C CG2   1 
ATOM   4578  C  CD1   . ILE C 2  128  ? 32.347  -12.138 80.318  1.00 41.07  ? 128  ILE C CD1   1 
ATOM   4579  N  N     . ILE C 2  129  ? 29.390  -10.531 75.274  1.00 45.87  ? 129  ILE C N     1 
ATOM   4580  C  CA    . ILE C 2  129  ? 29.444  -10.036 73.905  1.00 42.53  ? 129  ILE C CA    1 
ATOM   4581  C  C     . ILE C 2  129  ? 29.709  -8.541  73.973  1.00 48.37  ? 129  ILE C C     1 
ATOM   4582  O  O     . ILE C 2  129  ? 28.882  -7.783  74.499  1.00 54.88  ? 129  ILE C O     1 
ATOM   4583  C  CB    . ILE C 2  129  ? 28.148  -10.327 73.142  1.00 38.60  ? 129  ILE C CB    1 
ATOM   4584  C  CG1   . ILE C 2  129  ? 27.859  -11.830 73.145  1.00 40.24  ? 129  ILE C CG1   1 
ATOM   4585  C  CG2   . ILE C 2  129  ? 28.227  -9.769  71.733  1.00 44.44  ? 129  ILE C CG2   1 
ATOM   4586  C  CD1   . ILE C 2  129  ? 29.006  -12.683 72.642  1.00 41.23  ? 129  ILE C CD1   1 
ATOM   4587  N  N     . ASN C 2  130  ? 30.863  -8.118  73.454  1.00 45.80  ? 130  ASN C N     1 
ATOM   4588  C  CA    . ASN C 2  130  ? 31.253  -6.707  73.432  1.00 52.45  ? 130  ASN C CA    1 
ATOM   4589  C  C     . ASN C 2  130  ? 31.179  -6.085  74.826  1.00 53.74  ? 130  ASN C C     1 
ATOM   4590  O  O     . ASN C 2  130  ? 30.752  -4.942  75.001  1.00 55.31  ? 130  ASN C O     1 
ATOM   4591  C  CB    . ASN C 2  130  ? 30.402  -5.922  72.435  1.00 48.46  ? 130  ASN C CB    1 
ATOM   4592  C  CG    . ASN C 2  130  ? 30.616  -6.380  71.011  1.00 56.39  ? 130  ASN C CG    1 
ATOM   4593  O  OD1   . ASN C 2  130  ? 31.753  -6.535  70.561  1.00 61.10  ? 130  ASN C OD1   1 
ATOM   4594  N  ND2   . ASN C 2  130  ? 29.523  -6.616  70.296  1.00 49.94  ? 130  ASN C ND2   1 
ATOM   4595  N  N     . GLY C 2  131  ? 31.592  -6.855  75.832  1.00 47.27  ? 131  GLY C N     1 
ATOM   4596  C  CA    . GLY C 2  131  ? 31.609  -6.390  77.200  1.00 53.82  ? 131  GLY C CA    1 
ATOM   4597  C  C     . GLY C 2  131  ? 30.290  -6.484  77.932  1.00 61.21  ? 131  GLY C C     1 
ATOM   4598  O  O     . GLY C 2  131  ? 30.258  -6.237  79.146  1.00 60.89  ? 131  GLY C O     1 
ATOM   4599  N  N     . ALA C 2  132  ? 29.203  -6.836  77.249  1.00 52.75  ? 132  ALA C N     1 
ATOM   4600  C  CA    . ALA C 2  132  ? 27.886  -6.929  77.860  1.00 49.70  ? 132  ALA C CA    1 
ATOM   4601  C  C     . ALA C 2  132  ? 27.502  -8.388  78.065  1.00 47.91  ? 132  ALA C C     1 
ATOM   4602  O  O     . ALA C 2  132  ? 27.702  -9.220  77.177  1.00 53.02  ? 132  ALA C O     1 
ATOM   4603  C  CB    . ALA C 2  132  ? 26.836  -6.230  76.993  1.00 52.32  ? 132  ALA C CB    1 
ATOM   4604  N  N     . ASP C 2  133  ? 26.948  -8.700  79.232  1.00 41.30  ? 133  ASP C N     1 
ATOM   4605  C  CA    . ASP C 2  133  ? 26.447  -10.045 79.483  1.00 35.61  ? 133  ASP C CA    1 
ATOM   4606  C  C     . ASP C 2  133  ? 25.125  -10.246 78.756  1.00 36.02  ? 133  ASP C C     1 
ATOM   4607  O  O     . ASP C 2  133  ? 24.215  -9.418  78.858  1.00 39.94  ? 133  ASP C O     1 
ATOM   4608  C  CB    . ASP C 2  133  ? 26.274  -10.285 80.980  1.00 43.18  ? 133  ASP C CB    1 
ATOM   4609  C  CG    . ASP C 2  133  ? 27.592  -10.509 81.688  1.00 50.14  ? 133  ASP C CG    1 
ATOM   4610  O  OD1   . ASP C 2  133  ? 28.523  -9.705  81.471  1.00 51.70  ? 133  ASP C OD1   1 
ATOM   4611  O  OD2   . ASP C 2  133  ? 27.690  -11.483 82.466  1.00 48.69  ? 133  ASP C OD2   1 
ATOM   4612  N  N     . ARG C 2  134  ? 25.029  -11.343 78.009  1.00 39.63  ? 134  ARG C N     1 
ATOM   4613  C  CA    . ARG C 2  134  ? 23.848  -11.669 77.223  1.00 41.99  ? 134  ARG C CA    1 
ATOM   4614  C  C     . ARG C 2  134  ? 23.459  -13.124 77.458  1.00 37.71  ? 134  ARG C C     1 
ATOM   4615  O  O     . ARG C 2  134  ? 24.278  -13.950 77.874  1.00 37.90  ? 134  ARG C O     1 
ATOM   4616  C  CB    . ARG C 2  134  ? 24.079  -11.417 75.721  1.00 36.52  ? 134  ARG C CB    1 
ATOM   4617  C  CG    . ARG C 2  134  ? 24.729  -10.076 75.414  1.00 41.68  ? 134  ARG C CG    1 
ATOM   4618  C  CD    . ARG C 2  134  ? 24.653  -9.716  73.938  1.00 47.87  ? 134  ARG C CD    1 
ATOM   4619  N  NE    . ARG C 2  134  ? 23.637  -8.701  73.674  1.00 49.82  ? 134  ARG C NE    1 
ATOM   4620  C  CZ    . ARG C 2  134  ? 22.437  -8.959  73.166  1.00 46.22  ? 134  ARG C CZ    1 
ATOM   4621  N  NH1   . ARG C 2  134  ? 22.102  -10.203 72.859  1.00 47.04  ? 134  ARG C NH1   1 
ATOM   4622  N  NH2   . ARG C 2  134  ? 21.573  -7.975  72.962  1.00 50.43  ? 134  ARG C NH2   1 
ATOM   4623  N  N     . VAL C 2  135  ? 22.191  -13.428 77.185  1.00 30.44  ? 135  VAL C N     1 
ATOM   4624  C  CA    . VAL C 2  135  ? 21.615  -14.748 77.410  1.00 29.83  ? 135  VAL C CA    1 
ATOM   4625  C  C     . VAL C 2  135  ? 20.927  -15.202 76.129  1.00 31.84  ? 135  VAL C C     1 
ATOM   4626  O  O     . VAL C 2  135  ? 20.177  -14.434 75.517  1.00 34.94  ? 135  VAL C O     1 
ATOM   4627  C  CB    . VAL C 2  135  ? 20.623  -14.739 78.591  1.00 28.15  ? 135  VAL C CB    1 
ATOM   4628  C  CG1   . VAL C 2  135  ? 19.857  -16.050 78.674  1.00 28.48  ? 135  VAL C CG1   1 
ATOM   4629  C  CG2   . VAL C 2  135  ? 21.356  -14.481 79.896  1.00 30.42  ? 135  VAL C CG2   1 
ATOM   4630  N  N     . ILE C 2  136  ? 21.184  -16.441 75.721  1.00 30.56  ? 136  ILE C N     1 
ATOM   4631  C  CA    . ILE C 2  136  ? 20.533  -17.037 74.559  1.00 29.89  ? 136  ILE C CA    1 
ATOM   4632  C  C     . ILE C 2  136  ? 19.331  -17.828 75.058  1.00 30.18  ? 136  ILE C C     1 
ATOM   4633  O  O     . ILE C 2  136  ? 19.483  -18.904 75.645  1.00 30.16  ? 136  ILE C O     1 
ATOM   4634  C  CB    . ILE C 2  136  ? 21.492  -17.933 73.766  1.00 31.77  ? 136  ILE C CB    1 
ATOM   4635  C  CG1   . ILE C 2  136  ? 22.687  -17.124 73.269  1.00 32.83  ? 136  ILE C CG1   1 
ATOM   4636  C  CG2   . ILE C 2  136  ? 20.771  -18.588 72.594  1.00 27.19  ? 136  ILE C CG2   1 
ATOM   4637  C  CD1   . ILE C 2  136  ? 22.345  -16.159 72.167  1.00 32.37  ? 136  ILE C CD1   1 
ATOM   4638  N  N     . VAL C 2  137  ? 18.135  -17.310 74.805  1.00 28.59  ? 137  VAL C N     1 
ATOM   4639  C  CA    . VAL C 2  137  ? 16.910  -17.922 75.304  1.00 30.91  ? 137  VAL C CA    1 
ATOM   4640  C  C     . VAL C 2  137  ? 16.507  -19.066 74.384  1.00 31.62  ? 137  VAL C C     1 
ATOM   4641  O  O     . VAL C 2  137  ? 16.528  -18.932 73.155  1.00 33.62  ? 137  VAL C O     1 
ATOM   4642  C  CB    . VAL C 2  137  ? 15.791  -16.876 75.419  1.00 32.02  ? 137  VAL C CB    1 
ATOM   4643  C  CG1   . VAL C 2  137  ? 14.443  -17.548 75.645  1.00 32.09  ? 137  VAL C CG1   1 
ATOM   4644  C  CG2   . VAL C 2  137  ? 16.103  -15.911 76.548  1.00 34.40  ? 137  VAL C CG2   1 
ATOM   4645  N  N     . SER C 2  138  ? 16.152  -20.201 74.981  1.00 36.05  ? 138  SER C N     1 
ATOM   4646  C  CA    . SER C 2  138  ? 15.703  -21.352 74.214  1.00 33.65  ? 138  SER C CA    1 
ATOM   4647  C  C     . SER C 2  138  ? 14.417  -21.030 73.464  1.00 31.41  ? 138  SER C C     1 
ATOM   4648  O  O     . SER C 2  138  ? 13.591  -20.231 73.912  1.00 33.15  ? 138  SER C O     1 
ATOM   4649  C  CB    . SER C 2  138  ? 15.487  -22.547 75.141  1.00 34.60  ? 138  SER C CB    1 
ATOM   4650  O  OG    . SER C 2  138  ? 16.645  -22.786 75.927  1.00 44.19  ? 138  SER C OG    1 
ATOM   4651  N  N     . GLN C 2  139  ? 14.255  -21.661 72.308  1.00 35.09  ? 139  GLN C N     1 
ATOM   4652  C  CA    . GLN C 2  139  ? 13.063  -21.504 71.492  1.00 35.29  ? 139  GLN C CA    1 
ATOM   4653  C  C     . GLN C 2  139  ? 12.218  -22.768 71.574  1.00 34.06  ? 139  GLN C C     1 
ATOM   4654  O  O     . GLN C 2  139  ? 12.738  -23.864 71.781  1.00 34.69  ? 139  GLN C O     1 
ATOM   4655  C  CB    . GLN C 2  139  ? 13.438  -21.208 70.036  1.00 40.40  ? 139  GLN C CB    1 
ATOM   4656  C  CG    . GLN C 2  139  ? 12.269  -20.842 69.138  1.00 41.35  ? 139  GLN C CG    1 
ATOM   4657  C  CD    . GLN C 2  139  ? 12.718  -20.357 67.779  1.00 52.97  ? 139  GLN C CD    1 
ATOM   4658  O  OE1   . GLN C 2  139  ? 13.690  -20.863 67.216  1.00 57.21  ? 139  GLN C OE1   1 
ATOM   4659  N  NE2   . GLN C 2  139  ? 12.019  -19.361 67.246  1.00 62.88  ? 139  GLN C NE2   1 
ATOM   4660  N  N     . ILE C 2  140  ? 10.906  -22.610 71.431  1.00 38.21  ? 140  ILE C N     1 
ATOM   4661  C  CA    . ILE C 2  140  ? 9.984   -23.737 71.339  1.00 38.97  ? 140  ILE C CA    1 
ATOM   4662  C  C     . ILE C 2  140  ? 9.362   -23.722 69.950  1.00 37.76  ? 140  ILE C C     1 
ATOM   4663  O  O     . ILE C 2  140  ? 9.019   -22.655 69.424  1.00 38.73  ? 140  ILE C O     1 
ATOM   4664  C  CB    . ILE C 2  140  ? 8.907   -23.692 72.446  1.00 31.32  ? 140  ILE C CB    1 
ATOM   4665  C  CG1   . ILE C 2  140  ? 8.031   -24.944 72.406  1.00 29.82  ? 140  ILE C CG1   1 
ATOM   4666  C  CG2   . ILE C 2  140  ? 8.053   -22.447 72.335  1.00 28.47  ? 140  ILE C CG2   1 
ATOM   4667  C  CD1   . ILE C 2  140  ? 7.089   -25.049 73.579  1.00 26.42  ? 140  ILE C CD1   1 
ATOM   4668  N  N     . HIS C 2  141  ? 9.249   -24.900 69.337  1.00 34.26  ? 141  HIS C N     1 
ATOM   4669  C  CA    . HIS C 2  141  ? 8.698   -24.965 67.991  1.00 35.96  ? 141  HIS C CA    1 
ATOM   4670  C  C     . HIS C 2  141  ? 8.080   -26.330 67.740  1.00 34.80  ? 141  HIS C C     1 
ATOM   4671  O  O     . HIS C 2  141  ? 8.322   -27.296 68.468  1.00 34.86  ? 141  HIS C O     1 
ATOM   4672  C  CB    . HIS C 2  141  ? 9.759   -24.663 66.929  1.00 31.27  ? 141  HIS C CB    1 
ATOM   4673  C  CG    . HIS C 2  141  ? 10.797  -25.731 66.786  1.00 34.17  ? 141  HIS C CG    1 
ATOM   4674  N  ND1   . HIS C 2  141  ? 11.268  -26.151 65.560  1.00 38.34  ? 141  HIS C ND1   1 
ATOM   4675  C  CD2   . HIS C 2  141  ? 11.461  -26.460 67.713  1.00 34.53  ? 141  HIS C CD2   1 
ATOM   4676  C  CE1   . HIS C 2  141  ? 12.176  -27.094 65.739  1.00 37.44  ? 141  HIS C CE1   1 
ATOM   4677  N  NE2   . HIS C 2  141  ? 12.314  -27.298 67.036  1.00 32.46  ? 141  HIS C NE2   1 
ATOM   4678  N  N     . ARG C 2  142  ? 7.280   -26.398 66.678  1.00 38.56  ? 142  ARG C N     1 
ATOM   4679  C  CA    . ARG C 2  142  ? 6.716   -27.665 66.241  1.00 42.39  ? 142  ARG C CA    1 
ATOM   4680  C  C     . ARG C 2  142  ? 7.831   -28.629 65.860  1.00 47.51  ? 142  ARG C C     1 
ATOM   4681  O  O     . ARG C 2  142  ? 8.666   -28.323 65.001  1.00 39.15  ? 142  ARG C O     1 
ATOM   4682  C  CB    . ARG C 2  142  ? 5.780   -27.446 65.055  1.00 49.19  ? 142  ARG C CB    1 
ATOM   4683  C  CG    . ARG C 2  142  ? 4.603   -26.538 65.341  1.00 52.23  ? 142  ARG C CG    1 
ATOM   4684  C  CD    . ARG C 2  142  ? 3.629   -26.555 64.178  1.00 55.73  ? 142  ARG C CD    1 
ATOM   4685  N  NE    . ARG C 2  142  ? 3.167   -27.911 63.902  1.00 55.34  ? 142  ARG C NE    1 
ATOM   4686  C  CZ    . ARG C 2  142  ? 2.417   -28.246 62.860  1.00 53.73  ? 142  ARG C CZ    1 
ATOM   4687  N  NH1   . ARG C 2  142  ? 2.044   -27.319 61.987  1.00 57.95  ? 142  ARG C NH1   1 
ATOM   4688  N  NH2   . ARG C 2  142  ? 2.044   -29.508 62.689  1.00 46.57  ? 142  ARG C NH2   1 
ATOM   4689  N  N     . SER C 2  143  ? 7.839   -29.793 66.499  1.00 49.65  ? 143  SER C N     1 
ATOM   4690  C  CA    . SER C 2  143  ? 8.857   -30.791 66.217  1.00 44.31  ? 143  SER C CA    1 
ATOM   4691  C  C     . SER C 2  143  ? 8.724   -31.287 64.779  1.00 49.22  ? 143  SER C C     1 
ATOM   4692  O  O     . SER C 2  143  ? 7.607   -31.446 64.277  1.00 47.20  ? 143  SER C O     1 
ATOM   4693  C  CB    . SER C 2  143  ? 8.733   -31.967 67.186  1.00 43.90  ? 143  SER C CB    1 
ATOM   4694  O  OG    . SER C 2  143  ? 9.572   -33.038 66.797  1.00 51.27  ? 143  SER C OG    1 
ATOM   4695  N  N     . PRO C 2  144  ? 9.837   -31.524 64.087  1.00 54.00  ? 144  PRO C N     1 
ATOM   4696  C  CA    . PRO C 2  144  ? 9.757   -32.142 62.760  1.00 51.84  ? 144  PRO C CA    1 
ATOM   4697  C  C     . PRO C 2  144  ? 9.128   -33.527 62.832  1.00 54.64  ? 144  PRO C C     1 
ATOM   4698  O  O     . PRO C 2  144  ? 9.104   -34.176 63.880  1.00 57.69  ? 144  PRO C O     1 
ATOM   4699  C  CB    . PRO C 2  144  ? 11.222  -32.215 62.312  1.00 53.50  ? 144  PRO C CB    1 
ATOM   4700  C  CG    . PRO C 2  144  ? 11.916  -31.169 63.110  1.00 51.10  ? 144  PRO C CG    1 
ATOM   4701  C  CD    . PRO C 2  144  ? 11.212  -31.122 64.432  1.00 47.86  ? 144  PRO C CD    1 
ATOM   4702  N  N     . GLY C 2  145  ? 8.602   -33.970 61.700  1.00 54.31  ? 145  GLY C N     1 
ATOM   4703  C  CA    . GLY C 2  145  ? 7.980   -35.273 61.609  1.00 53.81  ? 145  GLY C CA    1 
ATOM   4704  C  C     . GLY C 2  145  ? 6.807   -35.246 60.648  1.00 50.33  ? 145  GLY C C     1 
ATOM   4705  O  O     . GLY C 2  145  ? 6.630   -34.308 59.873  1.00 50.02  ? 145  GLY C O     1 
ATOM   4706  N  N     . VAL C 2  146  ? 6.004   -36.305 60.723  1.00 53.61  ? 146  VAL C N     1 
ATOM   4707  C  CA    . VAL C 2  146  ? 4.825   -36.473 59.880  1.00 54.47  ? 146  VAL C CA    1 
ATOM   4708  C  C     . VAL C 2  146  ? 3.591   -36.340 60.761  1.00 55.35  ? 146  VAL C C     1 
ATOM   4709  O  O     . VAL C 2  146  ? 3.414   -37.104 61.719  1.00 59.82  ? 146  VAL C O     1 
ATOM   4710  C  CB    . VAL C 2  146  ? 4.839   -37.821 59.146  1.00 56.77  ? 146  VAL C CB    1 
ATOM   4711  C  CG1   . VAL C 2  146  ? 3.694   -37.888 58.149  1.00 62.52  ? 146  VAL C CG1   1 
ATOM   4712  C  CG2   . VAL C 2  146  ? 6.171   -38.031 58.448  1.00 56.35  ? 146  VAL C CG2   1 
ATOM   4713  N  N     . TYR C 2  147  ? 2.742   -35.371 60.437  1.00 53.14  ? 147  TYR C N     1 
ATOM   4714  C  CA    . TYR C 2  147  ? 1.539   -35.076 61.193  1.00 56.33  ? 147  TYR C CA    1 
ATOM   4715  C  C     . TYR C 2  147  ? 0.319   -35.262 60.305  1.00 61.05  ? 147  TYR C C     1 
ATOM   4716  O  O     . TYR C 2  147  ? 0.399   -35.190 59.077  1.00 58.23  ? 147  TYR C O     1 
ATOM   4717  C  CB    . TYR C 2  147  ? 1.563   -33.643 61.745  1.00 55.13  ? 147  TYR C CB    1 
ATOM   4718  C  CG    . TYR C 2  147  ? 2.710   -33.370 62.687  1.00 56.47  ? 147  TYR C CG    1 
ATOM   4719  C  CD1   . TYR C 2  147  ? 3.947   -32.965 62.205  1.00 57.73  ? 147  TYR C CD1   1 
ATOM   4720  C  CD2   . TYR C 2  147  ? 2.557   -33.519 64.058  1.00 54.97  ? 147  TYR C CD2   1 
ATOM   4721  C  CE1   . TYR C 2  147  ? 5.000   -32.717 63.064  1.00 58.94  ? 147  TYR C CE1   1 
ATOM   4722  C  CE2   . TYR C 2  147  ? 3.603   -33.272 64.924  1.00 51.79  ? 147  TYR C CE2   1 
ATOM   4723  C  CZ    . TYR C 2  147  ? 4.821   -32.873 64.424  1.00 56.50  ? 147  TYR C CZ    1 
ATOM   4724  O  OH    . TYR C 2  147  ? 5.864   -32.627 65.287  1.00 58.86  ? 147  TYR C OH    1 
ATOM   4725  N  N     . PHE C 2  148  ? -0.818  -35.502 60.950  1.00 57.61  ? 148  PHE C N     1 
ATOM   4726  C  CA    . PHE C 2  148  ? -2.096  -35.618 60.262  1.00 59.57  ? 148  PHE C CA    1 
ATOM   4727  C  C     . PHE C 2  148  ? -3.117  -34.807 61.041  1.00 59.57  ? 148  PHE C C     1 
ATOM   4728  O  O     . PHE C 2  148  ? -3.285  -35.017 62.247  1.00 58.48  ? 148  PHE C O     1 
ATOM   4729  C  CB    . PHE C 2  148  ? -2.521  -37.084 60.137  1.00 58.13  ? 148  PHE C CB    1 
ATOM   4730  C  CG    . PHE C 2  148  ? -1.548  -37.930 59.364  1.00 54.24  ? 148  PHE C CG    1 
ATOM   4731  C  CD1   . PHE C 2  148  ? -0.454  -38.503 59.995  1.00 51.35  ? 148  PHE C CD1   1 
ATOM   4732  C  CD2   . PHE C 2  148  ? -1.723  -38.146 58.007  1.00 55.86  ? 148  PHE C CD2   1 
ATOM   4733  C  CE1   . PHE C 2  148  ? 0.446   -39.277 59.286  1.00 55.15  ? 148  PHE C CE1   1 
ATOM   4734  C  CE2   . PHE C 2  148  ? -0.826  -38.923 57.291  1.00 56.16  ? 148  PHE C CE2   1 
ATOM   4735  C  CZ    . PHE C 2  148  ? 0.259   -39.488 57.930  1.00 56.05  ? 148  PHE C CZ    1 
ATOM   4736  N  N     . THR C 2  149  ? -3.767  -33.868 60.366  1.00 63.61  ? 149  THR C N     1 
ATOM   4737  C  CA    . THR C 2  149  ? -4.708  -32.958 60.999  1.00 62.04  ? 149  THR C CA    1 
ATOM   4738  C  C     . THR C 2  149  ? -6.031  -32.978 60.253  1.00 66.47  ? 149  THR C C     1 
ATOM   4739  O  O     . THR C 2  149  ? -6.081  -33.352 59.079  1.00 70.54  ? 149  THR C O     1 
ATOM   4740  C  CB    . THR C 2  149  ? -4.151  -31.526 61.036  1.00 65.18  ? 149  THR C CB    1 
ATOM   4741  O  OG1   . THR C 2  149  ? -3.736  -31.129 59.723  1.00 70.37  ? 149  THR C OG1   1 
ATOM   4742  C  CG2   . THR C 2  149  ? -2.969  -31.436 61.992  1.00 57.71  ? 149  THR C CG2   1 
ATOM   4743  N  N     . PRO C 2  150  ? -7.129  -32.605 60.910  1.00 68.51  ? 150  PRO C N     1 
ATOM   4744  C  CA    . PRO C 2  150  ? -8.415  -32.548 60.205  1.00 74.61  ? 150  PRO C CA    1 
ATOM   4745  C  C     . PRO C 2  150  ? -8.486  -31.337 59.285  1.00 81.90  ? 150  PRO C C     1 
ATOM   4746  O  O     . PRO C 2  150  ? -8.084  -30.231 59.654  1.00 77.15  ? 150  PRO C O     1 
ATOM   4747  C  CB    . PRO C 2  150  ? -9.445  -32.444 61.340  1.00 77.51  ? 150  PRO C CB    1 
ATOM   4748  C  CG    . PRO C 2  150  ? -8.690  -32.744 62.610  1.00 77.89  ? 150  PRO C CG    1 
ATOM   4749  C  CD    . PRO C 2  150  ? -7.283  -32.317 62.344  1.00 70.42  ? 150  PRO C CD    1 
ATOM   4750  N  N     . ASP C 2  151  ? -9.000  -31.556 58.079  1.00 88.50  ? 151  ASP C N     1 
ATOM   4751  C  CA    . ASP C 2  151  ? -9.207  -30.459 57.135  1.00 87.37  ? 151  ASP C CA    1 
ATOM   4752  C  C     . ASP C 2  151  ? -10.311 -29.551 57.664  1.00 91.60  ? 151  ASP C C     1 
ATOM   4753  O  O     . ASP C 2  151  ? -11.434 -30.023 57.883  1.00 92.54  ? 151  ASP C O     1 
ATOM   4754  C  CB    . ASP C 2  151  ? -9.571  -31.005 55.751  1.00 87.05  ? 151  ASP C CB    1 
ATOM   4755  C  CG    . ASP C 2  151  ? -9.497  -29.947 54.654  1.00 93.23  ? 151  ASP C CG    1 
ATOM   4756  O  OD1   . ASP C 2  151  ? -9.845  -28.775 54.911  1.00 88.87  ? 151  ASP C OD1   1 
ATOM   4757  O  OD2   . ASP C 2  151  ? -9.094  -30.294 53.521  1.00 92.92  ? 151  ASP C OD2   1 
ATOM   4758  N  N     . PRO C 2  152  ? -10.045 -28.261 57.893  1.00 92.25  ? 152  PRO C N     1 
ATOM   4759  C  CA    . PRO C 2  152  ? -11.101 -27.388 58.433  1.00 91.40  ? 152  PRO C CA    1 
ATOM   4760  C  C     . PRO C 2  152  ? -12.263 -27.190 57.479  1.00 90.28  ? 152  PRO C C     1 
ATOM   4761  O  O     . PRO C 2  152  ? -13.400 -27.014 57.933  1.00 82.43  ? 152  PRO C O     1 
ATOM   4762  C  CB    . PRO C 2  152  ? -10.362 -26.071 58.709  1.00 86.07  ? 152  PRO C CB    1 
ATOM   4763  C  CG    . PRO C 2  152  ? -9.193  -26.096 57.784  1.00 85.58  ? 152  PRO C CG    1 
ATOM   4764  C  CD    . PRO C 2  152  ? -8.778  -27.537 57.687  1.00 87.61  ? 152  PRO C CD    1 
ATOM   4765  N  N     . ALA C 2  153  ? -12.015 -27.215 56.169  1.00 93.20  ? 153  ALA C N     1 
ATOM   4766  C  CA    . ALA C 2  153  ? -13.088 -27.003 55.206  1.00 96.08  ? 153  ALA C CA    1 
ATOM   4767  C  C     . ALA C 2  153  ? -13.879 -28.279 54.945  1.00 95.78  ? 153  ALA C C     1 
ATOM   4768  O  O     . ALA C 2  153  ? -15.108 -28.234 54.822  1.00 92.03  ? 153  ALA C O     1 
ATOM   4769  C  CB    . ALA C 2  153  ? -12.514 -26.457 53.899  1.00 98.51  ? 153  ALA C CB    1 
ATOM   4770  N  N     . ARG C 2  154  ? -13.198 -29.421 54.863  1.00 96.56  ? 154  ARG C N     1 
ATOM   4771  C  CA    . ARG C 2  154  ? -13.834 -30.673 54.466  1.00 95.64  ? 154  ARG C CA    1 
ATOM   4772  C  C     . ARG C 2  154  ? -13.907 -31.640 55.639  1.00 93.02  ? 154  ARG C C     1 
ATOM   4773  O  O     . ARG C 2  154  ? -12.877 -32.217 56.022  1.00 91.53  ? 154  ARG C O     1 
ATOM   4774  C  CB    . ARG C 2  154  ? -13.066 -31.304 53.303  1.00 98.22  ? 154  ARG C CB    1 
ATOM   4775  C  CG    . ARG C 2  154  ? -13.106 -30.481 52.025  1.00 101.85 ? 154  ARG C CG    1 
ATOM   4776  C  CD    . ARG C 2  154  ? -12.037 -30.911 51.027  1.00 102.85 ? 154  ARG C CD    1 
ATOM   4777  N  NE    . ARG C 2  154  ? -12.102 -32.334 50.699  1.00 110.28 ? 154  ARG C NE    1 
ATOM   4778  C  CZ    . ARG C 2  154  ? -12.997 -32.876 49.877  1.00 111.77 ? 154  ARG C CZ    1 
ATOM   4779  N  NH1   . ARG C 2  154  ? -13.923 -32.121 49.303  1.00 113.85 ? 154  ARG C NH1   1 
ATOM   4780  N  NH2   . ARG C 2  154  ? -12.971 -34.180 49.635  1.00 109.03 ? 154  ARG C NH2   1 
ATOM   4781  N  N     . PRO C 2  155  ? -15.081 -31.853 56.235  1.00 93.04  ? 155  PRO C N     1 
ATOM   4782  C  CA    . PRO C 2  155  ? -15.193 -32.857 57.301  1.00 92.08  ? 155  PRO C CA    1 
ATOM   4783  C  C     . PRO C 2  155  ? -15.002 -34.259 56.747  1.00 93.50  ? 155  PRO C C     1 
ATOM   4784  O  O     . PRO C 2  155  ? -15.441 -34.573 55.638  1.00 92.77  ? 155  PRO C O     1 
ATOM   4785  C  CB    . PRO C 2  155  ? -16.617 -32.656 57.838  1.00 81.88  ? 155  PRO C CB    1 
ATOM   4786  C  CG    . PRO C 2  155  ? -17.032 -31.299 57.355  1.00 87.67  ? 155  PRO C CG    1 
ATOM   4787  C  CD    . PRO C 2  155  ? -16.335 -31.107 56.045  1.00 93.17  ? 155  PRO C CD    1 
ATOM   4788  N  N     . GLY C 2  156  ? -14.335 -35.103 57.533  1.00 92.98  ? 156  GLY C N     1 
ATOM   4789  C  CA    . GLY C 2  156  ? -14.006 -36.444 57.107  1.00 89.25  ? 156  GLY C CA    1 
ATOM   4790  C  C     . GLY C 2  156  ? -12.758 -36.561 56.260  1.00 92.42  ? 156  GLY C C     1 
ATOM   4791  O  O     . GLY C 2  156  ? -12.327 -37.686 55.975  1.00 96.50  ? 156  GLY C O     1 
ATOM   4792  N  N     . ARG C 2  157  ? -12.164 -35.444 55.843  1.00 89.60  ? 157  ARG C N     1 
ATOM   4793  C  CA    . ARG C 2  157  ? -10.922 -35.440 55.087  1.00 87.20  ? 157  ARG C CA    1 
ATOM   4794  C  C     . ARG C 2  157  ? -9.807  -34.848 55.938  1.00 85.50  ? 157  ARG C C     1 
ATOM   4795  O  O     . ARG C 2  157  ? -10.049 -34.013 56.814  1.00 83.69  ? 157  ARG C O     1 
ATOM   4796  C  CB    . ARG C 2  157  ? -11.069 -34.651 53.783  1.00 88.96  ? 157  ARG C CB    1 
ATOM   4797  C  CG    . ARG C 2  157  ? -12.123 -35.215 52.848  1.00 97.36  ? 157  ARG C CG    1 
ATOM   4798  C  CD    . ARG C 2  157  ? -11.909 -36.705 52.616  1.00 97.41  ? 157  ARG C CD    1 
ATOM   4799  N  NE    . ARG C 2  157  ? -13.020 -37.314 51.890  1.00 93.19  ? 157  ARG C NE    1 
ATOM   4800  C  CZ    . ARG C 2  157  ? -13.068 -37.445 50.569  1.00 106.01 ? 157  ARG C CZ    1 
ATOM   4801  N  NH1   . ARG C 2  157  ? -12.062 -37.010 49.821  1.00 102.07 ? 157  ARG C NH1   1 
ATOM   4802  N  NH2   . ARG C 2  157  ? -14.121 -38.012 49.995  1.00 111.76 ? 157  ARG C NH2   1 
ATOM   4803  N  N     . TYR C 2  158  ? -8.581  -35.290 55.674  1.00 83.35  ? 158  TYR C N     1 
ATOM   4804  C  CA    . TYR C 2  158  ? -7.446  -34.968 56.525  1.00 80.47  ? 158  TYR C CA    1 
ATOM   4805  C  C     . TYR C 2  158  ? -6.267  -34.497 55.685  1.00 78.33  ? 158  TYR C C     1 
ATOM   4806  O  O     . TYR C 2  158  ? -6.127  -34.861 54.514  1.00 83.33  ? 158  TYR C O     1 
ATOM   4807  C  CB    . TYR C 2  158  ? -7.033  -36.181 57.381  1.00 86.18  ? 158  TYR C CB    1 
ATOM   4808  C  CG    . TYR C 2  158  ? -8.163  -36.767 58.205  1.00 83.17  ? 158  TYR C CG    1 
ATOM   4809  C  CD1   . TYR C 2  158  ? -8.975  -37.770 57.691  1.00 80.20  ? 158  TYR C CD1   1 
ATOM   4810  C  CD2   . TYR C 2  158  ? -8.417  -36.316 59.494  1.00 77.24  ? 158  TYR C CD2   1 
ATOM   4811  C  CE1   . TYR C 2  158  ? -10.009 -38.307 58.435  1.00 78.00  ? 158  TYR C CE1   1 
ATOM   4812  C  CE2   . TYR C 2  158  ? -9.450  -36.849 60.246  1.00 79.58  ? 158  TYR C CE2   1 
ATOM   4813  C  CZ    . TYR C 2  158  ? -10.242 -37.844 59.711  1.00 78.16  ? 158  TYR C CZ    1 
ATOM   4814  O  OH    . TYR C 2  158  ? -11.272 -38.378 60.452  1.00 70.08  ? 158  TYR C OH    1 
ATOM   4815  N  N     . ILE C 2  159  ? -5.420  -33.680 56.307  1.00 74.38  ? 159  ILE C N     1 
ATOM   4816  C  CA    . ILE C 2  159  ? -4.219  -33.131 55.690  1.00 70.22  ? 159  ILE C CA    1 
ATOM   4817  C  C     . ILE C 2  159  ? -3.011  -33.807 56.321  1.00 69.34  ? 159  ILE C C     1 
ATOM   4818  O  O     . ILE C 2  159  ? -2.852  -33.788 57.551  1.00 69.27  ? 159  ILE C O     1 
ATOM   4819  C  CB    . ILE C 2  159  ? -4.139  -31.608 55.871  1.00 71.59  ? 159  ILE C CB    1 
ATOM   4820  C  CG1   . ILE C 2  159  ? -5.442  -30.941 55.423  1.00 79.47  ? 159  ILE C CG1   1 
ATOM   4821  C  CG2   . ILE C 2  159  ? -2.956  -31.039 55.103  1.00 74.61  ? 159  ILE C CG2   1 
ATOM   4822  C  CD1   . ILE C 2  159  ? -5.651  -30.958 53.931  1.00 91.91  ? 159  ILE C CD1   1 
ATOM   4823  N  N     . ALA C 2  160  ? -2.164  -34.405 55.483  1.00 64.27  ? 160  ALA C N     1 
ATOM   4824  C  CA    . ALA C 2  160  ? -0.877  -34.919 55.924  1.00 59.83  ? 160  ALA C CA    1 
ATOM   4825  C  C     . ALA C 2  160  ? 0.182   -33.844 55.730  1.00 64.09  ? 160  ALA C C     1 
ATOM   4826  O  O     . ALA C 2  160  ? 0.191   -33.149 54.714  1.00 63.12  ? 160  ALA C O     1 
ATOM   4827  C  CB    . ALA C 2  160  ? -0.497  -36.174 55.141  1.00 55.90  ? 160  ALA C CB    1 
ATOM   4828  N  N     . SER C 2  161  ? 1.079   -33.715 56.705  1.00 68.40  ? 161  SER C N     1 
ATOM   4829  C  CA    . SER C 2  161  ? 2.090   -32.665 56.687  1.00 60.01  ? 161  SER C CA    1 
ATOM   4830  C  C     . SER C 2  161  ? 3.432   -33.259 57.083  1.00 56.82  ? 161  SER C C     1 
ATOM   4831  O  O     . SER C 2  161  ? 3.570   -33.815 58.175  1.00 60.60  ? 161  SER C O     1 
ATOM   4832  C  CB    . SER C 2  161  ? 1.703   -31.519 57.629  1.00 63.01  ? 161  SER C CB    1 
ATOM   4833  O  OG    . SER C 2  161  ? 0.362   -31.108 57.408  1.00 63.07  ? 161  SER C OG    1 
ATOM   4834  N  N     . ILE C 2  162  ? 4.414   -33.145 56.195  1.00 59.14  ? 162  ILE C N     1 
ATOM   4835  C  CA    . ILE C 2  162  ? 5.782   -33.580 56.452  1.00 57.25  ? 162  ILE C CA    1 
ATOM   4836  C  C     . ILE C 2  162  ? 6.622   -32.334 56.696  1.00 58.54  ? 162  ILE C C     1 
ATOM   4837  O  O     . ILE C 2  162  ? 6.798   -31.507 55.787  1.00 66.10  ? 162  ILE C O     1 
ATOM   4838  C  CB    . ILE C 2  162  ? 6.340   -34.404 55.282  1.00 56.25  ? 162  ILE C CB    1 
ATOM   4839  C  CG1   . ILE C 2  162  ? 5.363   -35.516 54.909  1.00 53.89  ? 162  ILE C CG1   1 
ATOM   4840  C  CG2   . ILE C 2  162  ? 7.701   -34.974 55.643  1.00 60.46  ? 162  ILE C CG2   1 
ATOM   4841  C  CD1   . ILE C 2  162  ? 5.732   -36.255 53.649  1.00 57.60  ? 162  ILE C CD1   1 
ATOM   4842  N  N     . ILE C 2  163  ? 7.138   -32.199 57.916  1.00 49.04  ? 163  ILE C N     1 
ATOM   4843  C  CA    . ILE C 2  163  ? 7.799   -30.987 58.379  1.00 53.75  ? 163  ILE C CA    1 
ATOM   4844  C  C     . ILE C 2  163  ? 9.239   -31.319 58.752  1.00 51.73  ? 163  ILE C C     1 
ATOM   4845  O  O     . ILE C 2  163  ? 9.471   -32.130 59.652  1.00 54.68  ? 163  ILE C O     1 
ATOM   4846  C  CB    . ILE C 2  163  ? 7.063   -30.365 59.577  1.00 52.39  ? 163  ILE C CB    1 
ATOM   4847  C  CG1   . ILE C 2  163  ? 5.641   -29.968 59.182  1.00 52.31  ? 163  ILE C CG1   1 
ATOM   4848  C  CG2   . ILE C 2  163  ? 7.828   -29.167 60.117  1.00 52.93  ? 163  ILE C CG2   1 
ATOM   4849  C  CD1   . ILE C 2  163  ? 4.901   -29.216 60.260  1.00 52.81  ? 163  ILE C CD1   1 
ATOM   4850  N  N     . PRO C 2  164  ? 10.236  -30.737 58.084  1.00 52.33  ? 164  PRO C N     1 
ATOM   4851  C  CA    . PRO C 2  164  ? 11.623  -30.880 58.542  1.00 54.52  ? 164  PRO C CA    1 
ATOM   4852  C  C     . PRO C 2  164  ? 12.020  -29.770 59.501  1.00 56.63  ? 164  PRO C C     1 
ATOM   4853  O  O     . PRO C 2  164  ? 11.193  -28.920 59.845  1.00 64.09  ? 164  PRO C O     1 
ATOM   4854  C  CB    . PRO C 2  164  ? 12.420  -30.808 57.239  1.00 59.00  ? 164  PRO C CB    1 
ATOM   4855  C  CG    . PRO C 2  164  ? 11.617  -29.860 56.409  1.00 66.32  ? 164  PRO C CG    1 
ATOM   4856  C  CD    . PRO C 2  164  ? 10.161  -30.058 56.780  1.00 61.67  ? 164  PRO C CD    1 
ATOM   4857  N  N     . LEU C 2  165  ? 13.286  -29.760 59.926  1.00 54.29  ? 165  LEU C N     1 
ATOM   4858  C  CA    . LEU C 2  165  ? 13.789  -28.711 60.799  1.00 54.19  ? 165  LEU C CA    1 
ATOM   4859  C  C     . LEU C 2  165  ? 13.679  -27.345 60.120  1.00 58.67  ? 165  LEU C C     1 
ATOM   4860  O  O     . LEU C 2  165  ? 13.559  -27.260 58.895  1.00 65.39  ? 165  LEU C O     1 
ATOM   4861  C  CB    . LEU C 2  165  ? 15.240  -29.000 61.177  1.00 57.67  ? 165  LEU C CB    1 
ATOM   4862  C  CG    . LEU C 2  165  ? 15.479  -30.019 62.288  1.00 53.86  ? 165  LEU C CG    1 
ATOM   4863  C  CD1   . LEU C 2  165  ? 16.947  -30.386 62.356  1.00 48.01  ? 165  LEU C CD1   1 
ATOM   4864  C  CD2   . LEU C 2  165  ? 15.012  -29.449 63.614  1.00 49.27  ? 165  LEU C CD2   1 
ATOM   4865  N  N     . PRO C 2  166  ? 13.695  -26.261 60.900  1.00 64.30  ? 166  PRO C N     1 
ATOM   4866  C  CA    . PRO C 2  166  ? 13.569  -24.924 60.302  1.00 65.83  ? 166  PRO C CA    1 
ATOM   4867  C  C     . PRO C 2  166  ? 14.708  -24.636 59.336  1.00 74.53  ? 166  PRO C C     1 
ATOM   4868  O  O     . PRO C 2  166  ? 15.877  -24.892 59.632  1.00 76.71  ? 166  PRO C O     1 
ATOM   4869  C  CB    . PRO C 2  166  ? 13.611  -23.988 61.515  1.00 59.51  ? 166  PRO C CB    1 
ATOM   4870  C  CG    . PRO C 2  166  ? 13.154  -24.825 62.651  1.00 54.72  ? 166  PRO C CG    1 
ATOM   4871  C  CD    . PRO C 2  166  ? 13.679  -26.204 62.372  1.00 55.89  ? 166  PRO C CD    1 
ATOM   4872  N  N     . LYS C 2  167  ? 14.353  -24.094 58.170  1.00 76.18  ? 167  LYS C N     1 
ATOM   4873  C  CA    . LYS C 2  167  ? 15.320  -23.761 57.126  1.00 77.43  ? 167  LYS C CA    1 
ATOM   4874  C  C     . LYS C 2  167  ? 16.151  -24.976 56.727  1.00 73.51  ? 167  LYS C C     1 
ATOM   4875  O  O     . LYS C 2  167  ? 17.306  -24.847 56.312  1.00 70.64  ? 167  LYS C O     1 
ATOM   4876  C  CB    . LYS C 2  167  ? 16.221  -22.596 57.552  1.00 79.79  ? 167  LYS C CB    1 
ATOM   4877  C  CG    . LYS C 2  167  ? 15.513  -21.255 57.595  1.00 74.05  ? 167  LYS C CG    1 
ATOM   4878  C  CD    . LYS C 2  167  ? 16.445  -20.114 57.200  1.00 82.83  ? 167  LYS C CD    1 
ATOM   4879  C  CE    . LYS C 2  167  ? 15.677  -18.827 56.918  1.00 87.38  ? 167  LYS C CE    1 
ATOM   4880  N  NZ    . LYS C 2  167  ? 16.517  -17.807 56.224  1.00 77.10  ? 167  LYS C NZ    1 
ATOM   4881  N  N     . ARG C 2  168  ? 15.566  -26.166 56.878  1.00 72.64  ? 168  ARG C N     1 
ATOM   4882  C  CA    . ARG C 2  168  ? 16.154  -27.413 56.406  1.00 71.80  ? 168  ARG C CA    1 
ATOM   4883  C  C     . ARG C 2  168  ? 15.324  -28.061 55.303  1.00 73.87  ? 168  ARG C C     1 
ATOM   4884  O  O     . ARG C 2  168  ? 15.380  -29.281 55.128  1.00 64.30  ? 168  ARG C O     1 
ATOM   4885  C  CB    . ARG C 2  168  ? 16.340  -28.390 57.566  1.00 70.80  ? 168  ARG C CB    1 
ATOM   4886  C  CG    . ARG C 2  168  ? 17.373  -27.964 58.601  1.00 77.72  ? 168  ARG C CG    1 
ATOM   4887  C  CD    . ARG C 2  168  ? 18.773  -28.421 58.230  1.00 77.36  ? 168  ARG C CD    1 
ATOM   4888  N  NE    . ARG C 2  168  ? 19.334  -27.637 57.136  1.00 82.42  ? 168  ARG C NE    1 
ATOM   4889  C  CZ    . ARG C 2  168  ? 20.449  -27.954 56.487  1.00 91.59  ? 168  ARG C CZ    1 
ATOM   4890  N  NH1   . ARG C 2  168  ? 21.126  -29.047 56.818  1.00 89.91  ? 168  ARG C NH1   1 
ATOM   4891  N  NH2   . ARG C 2  168  ? 20.885  -27.180 55.501  1.00 94.80  ? 168  ARG C NH2   1 
ATOM   4892  N  N     . GLY C 2  169  ? 14.538  -27.277 54.570  1.00 82.51  ? 169  GLY C N     1 
ATOM   4893  C  CA    . GLY C 2  169  ? 13.717  -27.810 53.509  1.00 74.31  ? 169  GLY C CA    1 
ATOM   4894  C  C     . GLY C 2  169  ? 12.249  -27.500 53.708  1.00 78.29  ? 169  GLY C C     1 
ATOM   4895  O  O     . GLY C 2  169  ? 11.810  -27.154 54.808  1.00 88.96  ? 169  GLY C O     1 
ATOM   4896  N  N     . PRO C 2  170  ? 11.455  -27.655 52.653  1.00 76.10  ? 170  PRO C N     1 
ATOM   4897  C  CA    . PRO C 2  170  ? 10.075  -27.161 52.675  1.00 78.15  ? 170  PRO C CA    1 
ATOM   4898  C  C     . PRO C 2  170  ? 9.126   -28.083 53.427  1.00 75.40  ? 170  PRO C C     1 
ATOM   4899  O  O     . PRO C 2  170  ? 9.364   -29.281 53.588  1.00 69.91  ? 170  PRO C O     1 
ATOM   4900  C  CB    . PRO C 2  170  ? 9.707   -27.105 51.189  1.00 67.19  ? 170  PRO C CB    1 
ATOM   4901  C  CG    . PRO C 2  170  ? 10.494  -28.228 50.600  1.00 74.03  ? 170  PRO C CG    1 
ATOM   4902  C  CD    . PRO C 2  170  ? 11.803  -28.257 51.354  1.00 76.68  ? 170  PRO C CD    1 
ATOM   4903  N  N     . TRP C 2  171  ? 8.028   -27.485 53.890  1.00 66.33  ? 171  TRP C N     1 
ATOM   4904  C  CA    . TRP C 2  171  ? 6.906   -28.245 54.424  1.00 66.86  ? 171  TRP C CA    1 
ATOM   4905  C  C     . TRP C 2  171  ? 6.107   -28.827 53.267  1.00 72.83  ? 171  TRP C C     1 
ATOM   4906  O  O     . TRP C 2  171  ? 5.790   -28.114 52.310  1.00 74.46  ? 171  TRP C O     1 
ATOM   4907  C  CB    . TRP C 2  171  ? 5.998   -27.359 55.276  1.00 67.20  ? 171  TRP C CB    1 
ATOM   4908  C  CG    . TRP C 2  171  ? 6.605   -26.858 56.544  1.00 69.94  ? 171  TRP C CG    1 
ATOM   4909  C  CD1   . TRP C 2  171  ? 7.933   -26.742 56.833  1.00 74.21  ? 171  TRP C CD1   1 
ATOM   4910  C  CD2   . TRP C 2  171  ? 5.901   -26.408 57.706  1.00 69.31  ? 171  TRP C CD2   1 
ATOM   4911  N  NE1   . TRP C 2  171  ? 8.100   -26.242 58.102  1.00 66.82  ? 171  TRP C NE1   1 
ATOM   4912  C  CE2   . TRP C 2  171  ? 6.866   -26.030 58.660  1.00 69.33  ? 171  TRP C CE2   1 
ATOM   4913  C  CE3   . TRP C 2  171  ? 4.546   -26.290 58.033  1.00 71.22  ? 171  TRP C CE3   1 
ATOM   4914  C  CZ2   . TRP C 2  171  ? 6.522   -25.542 59.920  1.00 73.72  ? 171  TRP C CZ2   1 
ATOM   4915  C  CZ3   . TRP C 2  171  ? 4.205   -25.805 59.285  1.00 76.17  ? 171  TRP C CZ3   1 
ATOM   4916  C  CH2   . TRP C 2  171  ? 5.190   -25.437 60.213  1.00 70.06  ? 171  TRP C CH2   1 
ATOM   4917  N  N     . ILE C 2  172  ? 5.774   -30.113 53.348  1.00 71.95  ? 172  ILE C N     1 
ATOM   4918  C  CA    . ILE C 2  172  ? 5.054   -30.794 52.276  1.00 63.79  ? 172  ILE C CA    1 
ATOM   4919  C  C     . ILE C 2  172  ? 3.670   -31.186 52.776  1.00 61.88  ? 172  ILE C C     1 
ATOM   4920  O  O     . ILE C 2  172  ? 3.531   -31.711 53.885  1.00 59.30  ? 172  ILE C O     1 
ATOM   4921  C  CB    . ILE C 2  172  ? 5.833   -32.019 51.771  1.00 60.60  ? 172  ILE C CB    1 
ATOM   4922  C  CG1   . ILE C 2  172  ? 7.217   -31.591 51.279  1.00 63.02  ? 172  ILE C CG1   1 
ATOM   4923  C  CG2   . ILE C 2  172  ? 5.065   -32.714 50.661  1.00 67.72  ? 172  ILE C CG2   1 
ATOM   4924  C  CD1   . ILE C 2  172  ? 7.996   -32.693 50.610  1.00 67.53  ? 172  ILE C CD1   1 
ATOM   4925  N  N     . ASP C 2  173  ? 2.647   -30.932 51.960  1.00 68.84  ? 173  ASP C N     1 
ATOM   4926  C  CA    . ASP C 2  173  ? 1.275   -31.304 52.283  1.00 69.06  ? 173  ASP C CA    1 
ATOM   4927  C  C     . ASP C 2  173  ? 0.754   -32.357 51.310  1.00 73.07  ? 173  ASP C C     1 
ATOM   4928  O  O     . ASP C 2  173  ? 1.022   -32.294 50.108  1.00 74.45  ? 173  ASP C O     1 
ATOM   4929  C  CB    . ASP C 2  173  ? 0.346   -30.085 52.264  1.00 66.43  ? 173  ASP C CB    1 
ATOM   4930  C  CG    . ASP C 2  173  ? 0.284   -29.373 53.605  1.00 73.27  ? 173  ASP C CG    1 
ATOM   4931  O  OD1   . ASP C 2  173  ? 1.162   -29.625 54.458  1.00 77.50  ? 173  ASP C OD1   1 
ATOM   4932  O  OD2   . ASP C 2  173  ? -0.651  -28.570 53.810  1.00 72.72  ? 173  ASP C OD2   1 
ATOM   4933  N  N     . LEU C 2  174  ? 0.010   -33.323 51.847  1.00 75.26  ? 174  LEU C N     1 
ATOM   4934  C  CA    . LEU C 2  174  ? -0.695  -34.336 51.069  1.00 67.07  ? 174  LEU C CA    1 
ATOM   4935  C  C     . LEU C 2  174  ? -2.178  -34.236 51.401  1.00 72.19  ? 174  LEU C C     1 
ATOM   4936  O  O     . LEU C 2  174  ? -2.564  -34.306 52.575  1.00 77.24  ? 174  LEU C O     1 
ATOM   4937  C  CB    . LEU C 2  174  ? -0.167  -35.742 51.365  1.00 59.00  ? 174  LEU C CB    1 
ATOM   4938  C  CG    . LEU C 2  174  ? 1.333   -35.965 51.170  1.00 64.39  ? 174  LEU C CG    1 
ATOM   4939  C  CD1   . LEU C 2  174  ? 1.691   -37.429 51.364  1.00 60.04  ? 174  LEU C CD1   1 
ATOM   4940  C  CD2   . LEU C 2  174  ? 1.794   -35.459 49.813  1.00 56.90  ? 174  LEU C CD2   1 
ATOM   4941  N  N     . GLU C 2  175  ? -3.001  -34.071 50.370  1.00 78.97  ? 175  GLU C N     1 
ATOM   4942  C  CA    . GLU C 2  175  ? -4.431  -33.860 50.531  1.00 81.88  ? 175  GLU C CA    1 
ATOM   4943  C  C     . GLU C 2  175  ? -5.173  -34.748 49.543  1.00 89.38  ? 175  GLU C C     1 
ATOM   4944  O  O     . GLU C 2  175  ? -4.618  -35.173 48.530  1.00 96.10  ? 175  GLU C O     1 
ATOM   4945  C  CB    . GLU C 2  175  ? -4.789  -32.377 50.316  1.00 87.07  ? 175  GLU C CB    1 
ATOM   4946  C  CG    . GLU C 2  175  ? -6.239  -32.005 50.565  1.00 85.98  ? 175  GLU C CG    1 
ATOM   4947  C  CD    . GLU C 2  175  ? -6.496  -30.520 50.381  1.00 86.48  ? 175  GLU C CD    1 
ATOM   4948  O  OE1   . GLU C 2  175  ? -5.518  -29.757 50.234  1.00 78.84  ? 175  GLU C OE1   1 
ATOM   4949  O  OE2   . GLU C 2  175  ? -7.678  -30.114 50.384  1.00 96.56  ? 175  GLU C OE2   1 
ATOM   4950  N  N     . VAL C 2  176  ? -6.432  -35.046 49.850  1.00 90.42  ? 176  VAL C N     1 
ATOM   4951  C  CA    . VAL C 2  176  ? -7.310  -35.760 48.929  1.00 95.81  ? 176  VAL C CA    1 
ATOM   4952  C  C     . VAL C 2  176  ? -8.288  -34.745 48.353  1.00 100.25 ? 176  VAL C C     1 
ATOM   4953  O  O     . VAL C 2  176  ? -9.194  -34.271 49.051  1.00 102.06 ? 176  VAL C O     1 
ATOM   4954  C  CB    . VAL C 2  176  ? -8.042  -36.924 49.610  1.00 95.95  ? 176  VAL C CB    1 
ATOM   4955  C  CG1   . VAL C 2  176  ? -9.040  -37.547 48.645  1.00 96.01  ? 176  VAL C CG1   1 
ATOM   4956  C  CG2   . VAL C 2  176  ? -7.045  -37.969 50.076  1.00 90.08  ? 176  VAL C CG2   1 
ATOM   4957  N  N     . GLU C 2  177  ? -8.106  -34.414 47.076  1.00 100.16 ? 177  GLU C N     1 
ATOM   4958  C  CA    . GLU C 2  177  ? -8.883  -33.367 46.440  1.00 104.21 ? 177  GLU C CA    1 
ATOM   4959  C  C     . GLU C 2  177  ? -10.337 -33.803 46.266  1.00 108.63 ? 177  GLU C C     1 
ATOM   4960  O  O     . GLU C 2  177  ? -10.637 -34.998 46.229  1.00 112.65 ? 177  GLU C O     1 
ATOM   4961  C  CB    . GLU C 2  177  ? -8.271  -33.010 45.087  1.00 97.67  ? 177  GLU C CB    1 
ATOM   4962  C  CG    . GLU C 2  177  ? -7.879  -31.545 44.934  1.00 97.80  ? 177  GLU C CG    1 
ATOM   4963  C  CD    . GLU C 2  177  ? -7.099  -31.013 46.124  1.00 96.57  ? 177  GLU C CD    1 
ATOM   4964  O  OE1   . GLU C 2  177  ? -7.624  -30.134 46.842  1.00 97.19  ? 177  GLU C OE1   1 
ATOM   4965  O  OE2   . GLU C 2  177  ? -5.963  -31.480 46.348  1.00 88.24  ? 177  GLU C OE2   1 
ATOM   4966  N  N     . PRO C 2  178  ? -11.262 -32.842 46.173  1.00 104.07 ? 178  PRO C N     1 
ATOM   4967  C  CA    . PRO C 2  178  ? -12.669 -33.198 45.921  1.00 98.20  ? 178  PRO C CA    1 
ATOM   4968  C  C     . PRO C 2  178  ? -12.880 -33.997 44.648  1.00 102.11 ? 178  PRO C C     1 
ATOM   4969  O  O     . PRO C 2  178  ? -13.873 -34.729 44.556  1.00 102.13 ? 178  PRO C O     1 
ATOM   4970  C  CB    . PRO C 2  178  ? -13.367 -31.834 45.844  1.00 91.83  ? 178  PRO C CB    1 
ATOM   4971  C  CG    . PRO C 2  178  ? -12.501 -30.925 46.637  1.00 94.73  ? 178  PRO C CG    1 
ATOM   4972  C  CD    . PRO C 2  178  ? -11.095 -31.402 46.434  1.00 99.31  ? 178  PRO C CD    1 
ATOM   4973  N  N     . ASN C 2  179  ? -11.990 -33.888 43.665  1.00 102.06 ? 179  ASN C N     1 
ATOM   4974  C  CA    . ASN C 2  179  ? -12.113 -34.691 42.456  1.00 104.17 ? 179  ASN C CA    1 
ATOM   4975  C  C     . ASN C 2  179  ? -11.492 -36.075 42.601  1.00 110.49 ? 179  ASN C C     1 
ATOM   4976  O  O     . ASN C 2  179  ? -11.459 -36.825 41.620  1.00 116.76 ? 179  ASN C O     1 
ATOM   4977  C  CB    . ASN C 2  179  ? -11.489 -33.959 41.262  1.00 100.08 ? 179  ASN C CB    1 
ATOM   4978  C  CG    . ASN C 2  179  ? -9.976  -33.995 41.279  1.00 107.34 ? 179  ASN C CG    1 
ATOM   4979  O  OD1   . ASN C 2  179  ? -9.359  -34.901 40.719  1.00 107.80 ? 179  ASN C OD1   1 
ATOM   4980  N  ND2   . ASN C 2  179  ? -9.368  -33.003 41.917  1.00 110.66 ? 179  ASN C ND2   1 
ATOM   4981  N  N     . GLY C 2  180  ? -10.998 -36.431 43.789  1.00 101.23 ? 180  GLY C N     1 
ATOM   4982  C  CA    . GLY C 2  180  ? -10.537 -37.770 44.075  1.00 96.92  ? 180  GLY C CA    1 
ATOM   4983  C  C     . GLY C 2  180  ? -9.036  -37.966 44.013  1.00 106.54 ? 180  GLY C C     1 
ATOM   4984  O  O     . GLY C 2  180  ? -8.528  -38.908 44.632  1.00 110.04 ? 180  GLY C O     1 
ATOM   4985  N  N     . VAL C 2  181  ? -8.312  -37.111 43.292  1.00 109.48 ? 181  VAL C N     1 
ATOM   4986  C  CA    . VAL C 2  181  ? -6.873  -37.290 43.120  1.00 103.62 ? 181  VAL C CA    1 
ATOM   4987  C  C     . VAL C 2  181  ? -6.142  -36.768 44.352  1.00 100.39 ? 181  VAL C C     1 
ATOM   4988  O  O     . VAL C 2  181  ? -6.559  -35.785 44.979  1.00 94.20  ? 181  VAL C O     1 
ATOM   4989  C  CB    . VAL C 2  181  ? -6.387  -36.597 41.832  1.00 93.72  ? 181  VAL C CB    1 
ATOM   4990  C  CG1   . VAL C 2  181  ? -6.450  -35.083 41.967  1.00 92.87  ? 181  VAL C CG1   1 
ATOM   4991  C  CG2   . VAL C 2  181  ? -4.980  -37.055 41.472  1.00 96.63  ? 181  VAL C CG2   1 
ATOM   4992  N  N     . VAL C 2  182  ? -5.053  -37.439 44.712  1.00 100.15 ? 182  VAL C N     1 
ATOM   4993  C  CA    . VAL C 2  182  ? -4.268  -37.079 45.887  1.00 101.69 ? 182  VAL C CA    1 
ATOM   4994  C  C     . VAL C 2  182  ? -3.180  -36.097 45.466  1.00 97.92  ? 182  VAL C C     1 
ATOM   4995  O  O     . VAL C 2  182  ? -2.320  -36.416 44.635  1.00 93.55  ? 182  VAL C O     1 
ATOM   4996  C  CB    . VAL C 2  182  ? -3.674  -38.324 46.566  1.00 97.84  ? 182  VAL C CB    1 
ATOM   4997  C  CG1   . VAL C 2  182  ? -3.116  -39.294 45.533  1.00 105.54 ? 182  VAL C CG1   1 
ATOM   4998  C  CG2   . VAL C 2  182  ? -2.608  -37.927 47.578  1.00 88.70  ? 182  VAL C CG2   1 
ATOM   4999  N  N     . SER C 2  183  ? -3.222  -34.900 46.043  1.00 94.82  ? 183  SER C N     1 
ATOM   5000  C  CA    . SER C 2  183  ? -2.353  -33.800 45.660  1.00 89.90  ? 183  SER C CA    1 
ATOM   5001  C  C     . SER C 2  183  ? -1.250  -33.581 46.687  1.00 84.79  ? 183  SER C C     1 
ATOM   5002  O  O     . SER C 2  183  ? -1.447  -33.751 47.895  1.00 85.25  ? 183  SER C O     1 
ATOM   5003  C  CB    . SER C 2  183  ? -3.154  -32.508 45.491  1.00 84.32  ? 183  SER C CB    1 
ATOM   5004  O  OG    . SER C 2  183  ? -3.748  -32.109 46.714  1.00 72.55  ? 183  SER C OG    1 
ATOM   5005  N  N     . MET C 2  184  ? -0.086  -33.188 46.180  1.00 88.69  ? 184  MET C N     1 
ATOM   5006  C  CA    . MET C 2  184  ? 1.068   -32.805 46.972  1.00 83.58  ? 184  MET C CA    1 
ATOM   5007  C  C     . MET C 2  184  ? 1.351   -31.324 46.756  1.00 88.25  ? 184  MET C C     1 
ATOM   5008  O  O     . MET C 2  184  ? 1.284   -30.821 45.625  1.00 95.27  ? 184  MET C O     1 
ATOM   5009  C  CB    . MET C 2  184  ? 2.287   -33.649 46.592  1.00 74.06  ? 184  MET C CB    1 
ATOM   5010  C  CG    . MET C 2  184  ? 3.595   -33.233 47.236  1.00 68.50  ? 184  MET C CG    1 
ATOM   5011  S  SD    . MET C 2  184  ? 4.846   -34.490 46.923  1.00 71.52  ? 184  MET C SD    1 
ATOM   5012  C  CE    . MET C 2  184  ? 6.352   -33.689 47.460  1.00 66.87  ? 184  MET C CE    1 
ATOM   5013  N  N     . LYS C 2  185  ? 1.645   -30.634 47.857  1.00 82.95  ? 185  LYS C N     1 
ATOM   5014  C  CA    . LYS C 2  185  ? 1.895   -29.198 47.878  1.00 80.79  ? 185  LYS C CA    1 
ATOM   5015  C  C     . LYS C 2  185  ? 3.250   -28.945 48.523  1.00 77.42  ? 185  LYS C C     1 
ATOM   5016  O  O     . LYS C 2  185  ? 3.444   -29.257 49.703  1.00 78.96  ? 185  LYS C O     1 
ATOM   5017  C  CB    . LYS C 2  185  ? 0.792   -28.454 48.642  1.00 75.87  ? 185  LYS C CB    1 
ATOM   5018  C  CG    . LYS C 2  185  ? 1.052   -26.960 48.800  1.00 81.14  ? 185  LYS C CG    1 
ATOM   5019  C  CD    . LYS C 2  185  ? 0.321   -26.383 50.002  1.00 80.64  ? 185  LYS C CD    1 
ATOM   5020  C  CE    . LYS C 2  185  ? -1.187  -26.541 49.873  1.00 80.51  ? 185  LYS C CE    1 
ATOM   5021  N  NZ    . LYS C 2  185  ? -1.750  -25.646 48.830  1.00 80.49  ? 185  LYS C NZ    1 
ATOM   5022  N  N     . VAL C 2  186  ? 4.184   -28.406 47.740  1.00 79.19  ? 186  VAL C N     1 
ATOM   5023  C  CA    . VAL C 2  186  ? 5.469   -27.919 48.235  1.00 82.17  ? 186  VAL C CA    1 
ATOM   5024  C  C     . VAL C 2  186  ? 5.751   -26.583 47.561  1.00 82.07  ? 186  VAL C C     1 
ATOM   5025  O  O     . VAL C 2  186  ? 5.529   -26.430 46.354  1.00 77.37  ? 186  VAL C O     1 
ATOM   5026  C  CB    . VAL C 2  186  ? 6.617   -28.925 47.983  1.00 76.41  ? 186  VAL C CB    1 
ATOM   5027  C  CG1   . VAL C 2  186  ? 6.099   -30.191 47.356  1.00 80.28  ? 186  VAL C CG1   1 
ATOM   5028  C  CG2   . VAL C 2  186  ? 7.712   -28.330 47.124  1.00 68.06  ? 186  VAL C CG2   1 
ATOM   5029  N  N     . ASN C 2  187  ? 6.220   -25.614 48.353  1.00 81.70  ? 187  ASN C N     1 
ATOM   5030  C  CA    . ASN C 2  187  ? 6.499   -24.258 47.882  1.00 80.39  ? 187  ASN C CA    1 
ATOM   5031  C  C     . ASN C 2  187  ? 5.274   -23.651 47.197  1.00 86.91  ? 187  ASN C C     1 
ATOM   5032  O  O     . ASN C 2  187  ? 5.392   -22.919 46.213  1.00 87.76  ? 187  ASN C O     1 
ATOM   5033  C  CB    . ASN C 2  187  ? 7.719   -24.239 46.957  1.00 76.78  ? 187  ASN C CB    1 
ATOM   5034  C  CG    . ASN C 2  187  ? 8.974   -24.789 47.629  1.00 73.88  ? 187  ASN C CG    1 
ATOM   5035  O  OD1   . ASN C 2  187  ? 9.665   -25.647 47.076  1.00 66.69  ? 187  ASN C OD1   1 
ATOM   5036  N  ND2   . ASN C 2  187  ? 9.271   -24.295 48.826  1.00 79.85  ? 187  ASN C ND2   1 
ATOM   5037  N  N     . LYS C 2  188  ? 4.088   -23.967 47.729  1.00 91.52  ? 188  LYS C N     1 
ATOM   5038  C  CA    . LYS C 2  188  ? 2.808   -23.472 47.209  1.00 97.02  ? 188  LYS C CA    1 
ATOM   5039  C  C     . LYS C 2  188  ? 2.586   -23.903 45.758  1.00 98.66  ? 188  LYS C C     1 
ATOM   5040  O  O     . LYS C 2  188  ? 2.285   -23.089 44.882  1.00 98.39  ? 188  LYS C O     1 
ATOM   5041  C  CB    . LYS C 2  188  ? 2.700   -21.950 47.350  1.00 95.59  ? 188  LYS C CB    1 
ATOM   5042  C  CG    . LYS C 2  188  ? 2.372   -21.473 48.752  1.00 93.21  ? 188  LYS C CG    1 
ATOM   5043  C  CD    . LYS C 2  188  ? 2.299   -19.954 48.813  1.00 99.77  ? 188  LYS C CD    1 
ATOM   5044  C  CE    . LYS C 2  188  ? 3.661   -19.328 48.571  1.00 92.58  ? 188  LYS C CE    1 
ATOM   5045  N  NZ    . LYS C 2  188  ? 4.640   -19.747 49.610  1.00 101.98 ? 188  LYS C NZ    1 
ATOM   5046  N  N     . ARG C 2  189  ? 2.721   -25.205 45.509  1.00 95.47  ? 189  ARG C N     1 
ATOM   5047  C  CA    . ARG C 2  189  ? 2.474   -25.779 44.189  1.00 95.52  ? 189  ARG C CA    1 
ATOM   5048  C  C     . ARG C 2  189  ? 1.691   -27.073 44.353  1.00 91.94  ? 189  ARG C C     1 
ATOM   5049  O  O     . ARG C 2  189  ? 2.204   -28.039 44.924  1.00 93.51  ? 189  ARG C O     1 
ATOM   5050  C  CB    . ARG C 2  189  ? 3.784   -26.042 43.435  1.00 98.36  ? 189  ARG C CB    1 
ATOM   5051  C  CG    . ARG C 2  189  ? 4.435   -24.801 42.844  1.00 100.19 ? 189  ARG C CG    1 
ATOM   5052  C  CD    . ARG C 2  189  ? 5.671   -25.159 42.026  1.00 110.94 ? 189  ARG C CD    1 
ATOM   5053  N  NE    . ARG C 2  189  ? 6.331   -23.970 41.493  1.00 124.92 ? 189  ARG C NE    1 
ATOM   5054  C  CZ    . ARG C 2  189  ? 6.213   -23.540 40.240  1.00 121.98 ? 189  ARG C CZ    1 
ATOM   5055  N  NH1   . ARG C 2  189  ? 5.467   -24.208 39.369  1.00 114.15 ? 189  ARG C NH1   1 
ATOM   5056  N  NH2   . ARG C 2  189  ? 6.848   -22.440 39.857  1.00 120.00 ? 189  ARG C NH2   1 
ATOM   5057  N  N     . LYS C 2  190  ? 0.460   -27.093 43.848  1.00 90.94  ? 190  LYS C N     1 
ATOM   5058  C  CA    . LYS C 2  190  ? -0.395  -28.273 43.908  1.00 88.08  ? 190  LYS C CA    1 
ATOM   5059  C  C     . LYS C 2  190  ? -0.164  -29.136 42.673  1.00 88.96  ? 190  LYS C C     1 
ATOM   5060  O  O     . LYS C 2  190  ? -0.372  -28.677 41.545  1.00 87.85  ? 190  LYS C O     1 
ATOM   5061  C  CB    . LYS C 2  190  ? -1.865  -27.867 43.994  1.00 86.82  ? 190  LYS C CB    1 
ATOM   5062  C  CG    . LYS C 2  190  ? -2.322  -27.396 45.358  1.00 84.62  ? 190  LYS C CG    1 
ATOM   5063  C  CD    . LYS C 2  190  ? -2.770  -28.565 46.216  1.00 90.06  ? 190  LYS C CD    1 
ATOM   5064  C  CE    . LYS C 2  190  ? -3.741  -28.106 47.291  1.00 91.37  ? 190  LYS C CE    1 
ATOM   5065  N  NZ    . LYS C 2  190  ? -4.955  -27.484 46.693  1.00 81.85  ? 190  LYS C NZ    1 
ATOM   5066  N  N     . PHE C 2  191  ? 0.247   -30.385 42.879  1.00 86.69  ? 191  PHE C N     1 
ATOM   5067  C  CA    . PHE C 2  191  ? 0.427   -31.281 41.744  1.00 86.37  ? 191  PHE C CA    1 
ATOM   5068  C  C     . PHE C 2  191  ? 0.068   -32.697 42.164  1.00 92.65  ? 191  PHE C C     1 
ATOM   5069  O  O     . PHE C 2  191  ? 0.176   -33.034 43.347  1.00 95.31  ? 191  PHE C O     1 
ATOM   5070  C  CB    . PHE C 2  191  ? 1.865   -31.226 41.204  1.00 86.99  ? 191  PHE C CB    1 
ATOM   5071  C  CG    . PHE C 2  191  ? 2.864   -31.969 42.045  1.00 93.67  ? 191  PHE C CG    1 
ATOM   5072  C  CD1   . PHE C 2  191  ? 3.315   -31.436 43.240  1.00 93.30  ? 191  PHE C CD1   1 
ATOM   5073  C  CD2   . PHE C 2  191  ? 3.362   -33.197 41.632  1.00 96.28  ? 191  PHE C CD2   1 
ATOM   5074  C  CE1   . PHE C 2  191  ? 4.238   -32.114 44.013  1.00 91.29  ? 191  PHE C CE1   1 
ATOM   5075  C  CE2   . PHE C 2  191  ? 4.286   -33.882 42.402  1.00 94.00  ? 191  PHE C CE2   1 
ATOM   5076  C  CZ    . PHE C 2  191  ? 4.725   -33.339 43.594  1.00 95.31  ? 191  PHE C CZ    1 
ATOM   5077  N  N     . PRO C 2  192  ? -0.356  -33.545 41.229  1.00 93.21  ? 192  PRO C N     1 
ATOM   5078  C  CA    . PRO C 2  192  ? -0.724  -34.920 41.599  1.00 94.58  ? 192  PRO C CA    1 
ATOM   5079  C  C     . PRO C 2  192  ? 0.466   -35.698 42.145  1.00 98.14  ? 192  PRO C C     1 
ATOM   5080  O  O     . PRO C 2  192  ? 1.527   -35.772 41.519  1.00 98.22  ? 192  PRO C O     1 
ATOM   5081  C  CB    . PRO C 2  192  ? -1.232  -35.516 40.281  1.00 95.11  ? 192  PRO C CB    1 
ATOM   5082  C  CG    . PRO C 2  192  ? -0.606  -34.676 39.220  1.00 97.74  ? 192  PRO C CG    1 
ATOM   5083  C  CD    . PRO C 2  192  ? -0.544  -33.294 39.791  1.00 98.24  ? 192  PRO C CD    1 
ATOM   5084  N  N     . LEU C 2  193  ? 0.266   -36.298 43.324  1.00 93.79  ? 193  LEU C N     1 
ATOM   5085  C  CA    . LEU C 2  193  ? 1.308   -37.089 43.973  1.00 94.63  ? 193  LEU C CA    1 
ATOM   5086  C  C     . LEU C 2  193  ? 1.721   -38.296 43.138  1.00 95.34  ? 193  LEU C C     1 
ATOM   5087  O  O     . LEU C 2  193  ? 2.851   -38.784 43.279  1.00 86.87  ? 193  LEU C O     1 
ATOM   5088  C  CB    . LEU C 2  193  ? 0.813   -37.540 45.347  1.00 82.59  ? 193  LEU C CB    1 
ATOM   5089  C  CG    . LEU C 2  193  ? 1.717   -38.409 46.220  1.00 72.78  ? 193  LEU C CG    1 
ATOM   5090  C  CD1   . LEU C 2  193  ? 3.023   -37.700 46.530  1.00 76.77  ? 193  LEU C CD1   1 
ATOM   5091  C  CD2   . LEU C 2  193  ? 1.002   -38.787 47.498  1.00 74.52  ? 193  LEU C CD2   1 
ATOM   5092  N  N     . VAL C 2  194  ? 0.838   -38.764 42.253  1.00 99.24  ? 194  VAL C N     1 
ATOM   5093  C  CA    . VAL C 2  194  ? 1.129   -39.939 41.436  1.00 99.94  ? 194  VAL C CA    1 
ATOM   5094  C  C     . VAL C 2  194  ? 2.386   -39.721 40.607  1.00 98.29  ? 194  VAL C C     1 
ATOM   5095  O  O     . VAL C 2  194  ? 3.170   -40.651 40.384  1.00 99.51  ? 194  VAL C O     1 
ATOM   5096  C  CB    . VAL C 2  194  ? -0.080  -40.275 40.546  1.00 101.65 ? 194  VAL C CB    1 
ATOM   5097  C  CG1   . VAL C 2  194  ? 0.043   -41.683 39.986  1.00 105.27 ? 194  VAL C CG1   1 
ATOM   5098  C  CG2   . VAL C 2  194  ? -1.376  -40.087 41.327  1.00 103.03 ? 194  VAL C CG2   1 
ATOM   5099  N  N     . LEU C 2  195  ? 2.597   -38.491 40.132  1.00 95.28  ? 195  LEU C N     1 
ATOM   5100  C  CA    . LEU C 2  195  ? 3.779   -38.200 39.326  1.00 99.01  ? 195  LEU C CA    1 
ATOM   5101  C  C     . LEU C 2  195  ? 5.057   -38.451 40.117  1.00 97.68  ? 195  LEU C C     1 
ATOM   5102  O  O     . LEU C 2  195  ? 5.964   -39.159 39.658  1.00 93.19  ? 195  LEU C O     1 
ATOM   5103  C  CB    . LEU C 2  195  ? 3.722   -36.755 38.831  1.00 99.16  ? 195  LEU C CB    1 
ATOM   5104  C  CG    . LEU C 2  195  ? 4.854   -36.282 37.922  1.00 103.56 ? 195  LEU C CG    1 
ATOM   5105  C  CD1   . LEU C 2  195  ? 4.892   -37.092 36.636  1.00 102.96 ? 195  LEU C CD1   1 
ATOM   5106  C  CD2   . LEU C 2  195  ? 4.693   -34.806 37.622  1.00 105.38 ? 195  LEU C CD2   1 
ATOM   5107  N  N     . LEU C 2  196  ? 5.142   -37.879 41.320  1.00 98.96  ? 196  LEU C N     1 
ATOM   5108  C  CA    . LEU C 2  196  ? 6.310   -38.109 42.161  1.00 97.65  ? 196  LEU C CA    1 
ATOM   5109  C  C     . LEU C 2  196  ? 6.447   -39.583 42.516  1.00 92.03  ? 196  LEU C C     1 
ATOM   5110  O  O     . LEU C 2  196  ? 7.562   -40.116 42.565  1.00 87.58  ? 196  LEU C O     1 
ATOM   5111  C  CB    . LEU C 2  196  ? 6.229   -37.256 43.425  1.00 88.92  ? 196  LEU C CB    1 
ATOM   5112  C  CG    . LEU C 2  196  ? 7.421   -37.449 44.366  1.00 92.61  ? 196  LEU C CG    1 
ATOM   5113  C  CD1   . LEU C 2  196  ? 8.701   -36.943 43.723  1.00 94.01  ? 196  LEU C CD1   1 
ATOM   5114  C  CD2   . LEU C 2  196  ? 7.187   -36.777 45.699  1.00 85.36  ? 196  LEU C CD2   1 
ATOM   5115  N  N     . LEU C 2  197  ? 5.323   -40.261 42.763  1.00 92.72  ? 197  LEU C N     1 
ATOM   5116  C  CA    . LEU C 2  197  ? 5.378   -41.694 43.036  1.00 97.01  ? 197  LEU C CA    1 
ATOM   5117  C  C     . LEU C 2  197  ? 6.005   -42.449 41.871  1.00 102.13 ? 197  LEU C C     1 
ATOM   5118  O  O     . LEU C 2  197  ? 6.762   -43.407 42.073  1.00 100.39 ? 197  LEU C O     1 
ATOM   5119  C  CB    . LEU C 2  197  ? 3.976   -42.223 43.338  1.00 93.50  ? 197  LEU C CB    1 
ATOM   5120  C  CG    . LEU C 2  197  ? 3.374   -41.715 44.649  1.00 90.27  ? 197  LEU C CG    1 
ATOM   5121  C  CD1   . LEU C 2  197  ? 1.916   -42.116 44.762  1.00 92.77  ? 197  LEU C CD1   1 
ATOM   5122  C  CD2   . LEU C 2  197  ? 4.170   -42.239 45.835  1.00 78.27  ? 197  LEU C CD2   1 
ATOM   5123  N  N     . ARG C 2  198  ? 5.711   -42.020 40.641  1.00 101.19 ? 198  ARG C N     1 
ATOM   5124  C  CA    . ARG C 2  198  ? 6.361   -42.615 39.477  1.00 101.05 ? 198  ARG C CA    1 
ATOM   5125  C  C     . ARG C 2  198  ? 7.850   -42.291 39.460  1.00 96.14  ? 198  ARG C C     1 
ATOM   5126  O  O     . ARG C 2  198  ? 8.676   -43.153 39.139  1.00 93.93  ? 198  ARG C O     1 
ATOM   5127  C  CB    . ARG C 2  198  ? 5.689   -42.129 38.192  1.00 100.00 ? 198  ARG C CB    1 
ATOM   5128  C  CG    . ARG C 2  198  ? 6.005   -42.966 36.956  1.00 103.04 ? 198  ARG C CG    1 
ATOM   5129  C  CD    . ARG C 2  198  ? 5.313   -44.322 37.014  1.00 110.06 ? 198  ARG C CD    1 
ATOM   5130  N  NE    . ARG C 2  198  ? 5.535   -45.118 35.808  1.00 114.76 ? 198  ARG C NE    1 
ATOM   5131  C  CZ    . ARG C 2  198  ? 6.425   -46.101 35.712  1.00 121.01 ? 198  ARG C CZ    1 
ATOM   5132  N  NH1   . ARG C 2  198  ? 6.556   -46.772 34.575  1.00 123.47 ? 198  ARG C NH1   1 
ATOM   5133  N  NH2   . ARG C 2  198  ? 7.183   -46.418 36.754  1.00 121.52 ? 198  ARG C NH2   1 
ATOM   5134  N  N     . VAL C 2  199  ? 8.210   -41.053 39.813  1.00 92.62  ? 199  VAL C N     1 
ATOM   5135  C  CA    . VAL C 2  199  ? 9.619   -40.661 39.849  1.00 89.35  ? 199  VAL C CA    1 
ATOM   5136  C  C     . VAL C 2  199  ? 10.393  -41.520 40.844  1.00 90.76  ? 199  VAL C C     1 
ATOM   5137  O  O     . VAL C 2  199  ? 11.562  -41.859 40.620  1.00 84.68  ? 199  VAL C O     1 
ATOM   5138  C  CB    . VAL C 2  199  ? 9.747   -39.161 40.176  1.00 87.43  ? 199  VAL C CB    1 
ATOM   5139  C  CG1   . VAL C 2  199  ? 11.212  -38.749 40.255  1.00 79.46  ? 199  VAL C CG1   1 
ATOM   5140  C  CG2   . VAL C 2  199  ? 9.011   -38.327 39.142  1.00 87.94  ? 199  VAL C CG2   1 
ATOM   5141  N  N     . LEU C 2  200  ? 9.755   -41.891 41.956  1.00 98.41  ? 200  LEU C N     1 
ATOM   5142  C  CA    . LEU C 2  200  ? 10.407  -42.722 42.962  1.00 100.04 ? 200  LEU C CA    1 
ATOM   5143  C  C     . LEU C 2  200  ? 10.646  -44.151 42.490  1.00 99.06  ? 200  LEU C C     1 
ATOM   5144  O  O     . LEU C 2  200  ? 11.320  -44.911 43.195  1.00 97.51  ? 200  LEU C O     1 
ATOM   5145  C  CB    . LEU C 2  200  ? 9.578   -42.738 44.251  1.00 93.37  ? 200  LEU C CB    1 
ATOM   5146  C  CG    . LEU C 2  200  ? 9.939   -41.725 45.342  1.00 87.25  ? 200  LEU C CG    1 
ATOM   5147  C  CD1   . LEU C 2  200  ? 11.392  -41.886 45.750  1.00 92.57  ? 200  LEU C CD1   1 
ATOM   5148  C  CD2   . LEU C 2  200  ? 9.667   -40.297 44.900  1.00 77.57  ? 200  LEU C CD2   1 
ATOM   5149  N  N     . GLY C 2  201  ? 10.113  -44.535 41.334  1.00 96.58  ? 201  GLY C N     1 
ATOM   5150  C  CA    . GLY C 2  201  ? 10.284  -45.873 40.814  1.00 94.84  ? 201  GLY C CA    1 
ATOM   5151  C  C     . GLY C 2  201  ? 9.129   -46.818 41.052  1.00 95.13  ? 201  GLY C C     1 
ATOM   5152  O  O     . GLY C 2  201  ? 9.263   -48.010 40.756  1.00 83.23  ? 201  GLY C O     1 
ATOM   5153  N  N     . TYR C 2  202  ? 8.007   -46.331 41.576  1.00 104.27 ? 202  TYR C N     1 
ATOM   5154  C  CA    . TYR C 2  202  ? 6.858   -47.184 41.841  1.00 105.93 ? 202  TYR C CA    1 
ATOM   5155  C  C     . TYR C 2  202  ? 6.120   -47.522 40.552  1.00 105.84 ? 202  TYR C C     1 
ATOM   5156  O  O     . TYR C 2  202  ? 6.114   -46.751 39.588  1.00 97.26  ? 202  TYR C O     1 
ATOM   5157  C  CB    . TYR C 2  202  ? 5.888   -46.512 42.818  1.00 105.21 ? 202  TYR C CB    1 
ATOM   5158  C  CG    . TYR C 2  202  ? 6.337   -46.528 44.261  1.00 92.31  ? 202  TYR C CG    1 
ATOM   5159  C  CD1   . TYR C 2  202  ? 6.583   -47.727 44.918  1.00 90.55  ? 202  TYR C CD1   1 
ATOM   5160  C  CD2   . TYR C 2  202  ? 6.496   -45.347 44.972  1.00 89.36  ? 202  TYR C CD2   1 
ATOM   5161  C  CE1   . TYR C 2  202  ? 6.990   -47.748 46.237  1.00 88.19  ? 202  TYR C CE1   1 
ATOM   5162  C  CE2   . TYR C 2  202  ? 6.902   -45.358 46.293  1.00 93.07  ? 202  TYR C CE2   1 
ATOM   5163  C  CZ    . TYR C 2  202  ? 7.147   -46.562 46.921  1.00 88.94  ? 202  TYR C CZ    1 
ATOM   5164  O  OH    . TYR C 2  202  ? 7.553   -46.579 48.236  1.00 76.29  ? 202  TYR C OH    1 
ATOM   5165  N  N     . ASP C 2  203  ? 5.485   -48.690 40.551  1.00 114.54 ? 203  ASP C N     1 
ATOM   5166  C  CA    . ASP C 2  203  ? 4.670   -49.150 39.440  1.00 120.08 ? 203  ASP C CA    1 
ATOM   5167  C  C     . ASP C 2  203  ? 3.226   -49.298 39.901  1.00 120.80 ? 203  ASP C C     1 
ATOM   5168  O  O     . ASP C 2  203  ? 2.948   -49.445 41.094  1.00 121.19 ? 203  ASP C O     1 
ATOM   5169  C  CB    . ASP C 2  203  ? 5.179   -50.485 38.884  1.00 125.34 ? 203  ASP C CB    1 
ATOM   5170  C  CG    . ASP C 2  203  ? 4.767   -50.709 37.443  1.00 138.86 ? 203  ASP C CG    1 
ATOM   5171  O  OD1   . ASP C 2  203  ? 3.547   -50.778 37.178  1.00 144.97 ? 203  ASP C OD1   1 
ATOM   5172  O  OD2   . ASP C 2  203  ? 5.663   -50.792 36.574  1.00 139.51 ? 203  ASP C OD2   1 
ATOM   5173  N  N     . GLN C 2  204  ? 2.306   -49.262 38.932  1.00 120.35 ? 204  GLN C N     1 
ATOM   5174  C  CA    . GLN C 2  204  ? 0.886   -49.393 39.250  1.00 118.67 ? 204  GLN C CA    1 
ATOM   5175  C  C     . GLN C 2  204  ? 0.588   -50.700 39.975  1.00 120.43 ? 204  GLN C C     1 
ATOM   5176  O  O     . GLN C 2  204  ? -0.340  -50.759 40.788  1.00 115.64 ? 204  GLN C O     1 
ATOM   5177  C  CB    . GLN C 2  204  ? 0.051   -49.285 37.973  1.00 116.37 ? 204  GLN C CB    1 
ATOM   5178  C  CG    . GLN C 2  204  ? -1.452  -49.342 38.203  1.00 119.13 ? 204  GLN C CG    1 
ATOM   5179  C  CD    . GLN C 2  204  ? -2.246  -49.225 36.917  1.00 118.13 ? 204  GLN C CD    1 
ATOM   5180  O  OE1   . GLN C 2  204  ? -1.685  -48.993 35.847  1.00 117.19 ? 204  GLN C OE1   1 
ATOM   5181  N  NE2   . GLN C 2  204  ? -3.562  -49.386 37.016  1.00 114.14 ? 204  GLN C NE2   1 
ATOM   5182  N  N     . GLU C 2  205  ? 1.373   -51.747 39.712  1.00 123.50 ? 205  GLU C N     1 
ATOM   5183  C  CA    . GLU C 2  205  ? 1.177   -53.024 40.391  1.00 120.91 ? 205  GLU C CA    1 
ATOM   5184  C  C     . GLU C 2  205  ? 1.472   -52.904 41.883  1.00 117.95 ? 205  GLU C C     1 
ATOM   5185  O  O     . GLU C 2  205  ? 0.665   -53.322 42.725  1.00 116.10 ? 205  GLU C O     1 
ATOM   5186  C  CB    . GLU C 2  205  ? 2.065   -54.090 39.749  1.00 126.35 ? 205  GLU C CB    1 
ATOM   5187  C  CG    . GLU C 2  205  ? 1.802   -55.507 40.229  1.00 135.49 ? 205  GLU C CG    1 
ATOM   5188  C  CD    . GLU C 2  205  ? 1.246   -56.396 39.131  1.00 140.92 ? 205  GLU C CD    1 
ATOM   5189  O  OE1   . GLU C 2  205  ? 1.016   -55.888 38.013  1.00 135.00 ? 205  GLU C OE1   1 
ATOM   5190  O  OE2   . GLU C 2  205  ? 1.041   -57.602 39.387  1.00 142.24 ? 205  GLU C OE2   1 
ATOM   5191  N  N     . THR C 2  206  ? 2.633   -52.339 42.226  1.00 115.87 ? 206  THR C N     1 
ATOM   5192  C  CA    . THR C 2  206  ? 3.011   -52.207 43.629  1.00 115.11 ? 206  THR C CA    1 
ATOM   5193  C  C     . THR C 2  206  ? 2.060   -51.275 44.371  1.00 108.32 ? 206  THR C C     1 
ATOM   5194  O  O     . THR C 2  206  ? 1.668   -51.553 45.510  1.00 104.45 ? 206  THR C O     1 
ATOM   5195  C  CB    . THR C 2  206  ? 4.451   -51.706 43.739  1.00 115.21 ? 206  THR C CB    1 
ATOM   5196  O  OG1   . THR C 2  206  ? 5.273   -52.415 42.803  1.00 110.17 ? 206  THR C OG1   1 
ATOM   5197  C  CG2   . THR C 2  206  ? 4.987   -51.933 45.145  1.00 108.19 ? 206  THR C CG2   1 
ATOM   5198  N  N     . LEU C 2  207  ? 1.662   -50.171 43.733  1.00 107.12 ? 207  LEU C N     1 
ATOM   5199  C  CA    . LEU C 2  207  ? 0.727   -49.252 44.373  1.00 109.87 ? 207  LEU C CA    1 
ATOM   5200  C  C     . LEU C 2  207  ? -0.656  -49.873 44.526  1.00 107.46 ? 207  LEU C C     1 
ATOM   5201  O  O     . LEU C 2  207  ? -1.342  -49.615 45.522  1.00 106.04 ? 207  LEU C O     1 
ATOM   5202  C  CB    . LEU C 2  207  ? 0.646   -47.948 43.577  1.00 108.13 ? 207  LEU C CB    1 
ATOM   5203  C  CG    . LEU C 2  207  ? 1.955   -47.161 43.454  1.00 101.48 ? 207  LEU C CG    1 
ATOM   5204  C  CD1   . LEU C 2  207  ? 1.738   -45.876 42.675  1.00 97.80  ? 207  LEU C CD1   1 
ATOM   5205  C  CD2   . LEU C 2  207  ? 2.544   -46.863 44.825  1.00 101.87 ? 207  LEU C CD2   1 
ATOM   5206  N  N     . ALA C 2  208  ? -1.074  -50.706 43.571  1.00 106.07 ? 208  ALA C N     1 
ATOM   5207  C  CA    . ALA C 2  208  ? -2.375  -51.355 43.674  1.00 100.93 ? 208  ALA C CA    1 
ATOM   5208  C  C     . ALA C 2  208  ? -2.385  -52.398 44.784  1.00 100.27 ? 208  ALA C C     1 
ATOM   5209  O  O     . ALA C 2  208  ? -3.373  -52.521 45.516  1.00 101.45 ? 208  ALA C O     1 
ATOM   5210  C  CB    . ALA C 2  208  ? -2.757  -51.989 42.337  1.00 103.56 ? 208  ALA C CB    1 
ATOM   5211  N  N     . ARG C 2  209  ? -1.301  -53.164 44.925  1.00 99.47  ? 209  ARG C N     1 
ATOM   5212  C  CA    . ARG C 2  209  ? -1.269  -54.153 45.999  1.00 102.24 ? 209  ARG C CA    1 
ATOM   5213  C  C     . ARG C 2  209  ? -1.070  -53.499 47.362  1.00 105.10 ? 209  ARG C C     1 
ATOM   5214  O  O     . ARG C 2  209  ? -1.562  -54.018 48.371  1.00 108.82 ? 209  ARG C O     1 
ATOM   5215  C  CB    . ARG C 2  209  ? -0.183  -55.202 45.745  1.00 111.22 ? 209  ARG C CB    1 
ATOM   5216  C  CG    . ARG C 2  209  ? 1.213   -54.646 45.547  1.00 115.07 ? 209  ARG C CG    1 
ATOM   5217  C  CD    . ARG C 2  209  ? 2.256   -55.752 45.478  1.00 114.62 ? 209  ARG C CD    1 
ATOM   5218  N  NE    . ARG C 2  209  ? 2.593   -56.264 46.803  1.00 123.53 ? 209  ARG C NE    1 
ATOM   5219  C  CZ    . ARG C 2  209  ? 3.558   -55.765 47.572  1.00 128.02 ? 209  ARG C CZ    1 
ATOM   5220  N  NH1   . ARG C 2  209  ? 4.285   -54.740 47.147  1.00 123.18 ? 209  ARG C NH1   1 
ATOM   5221  N  NH2   . ARG C 2  209  ? 3.796   -56.291 48.766  1.00 124.16 ? 209  ARG C NH2   1 
ATOM   5222  N  N     . GLU C 2  210  ? -0.365  -52.366 47.418  1.00 104.52 ? 210  GLU C N     1 
ATOM   5223  C  CA    . GLU C 2  210  ? -0.097  -51.734 48.704  1.00 99.18  ? 210  GLU C CA    1 
ATOM   5224  C  C     . GLU C 2  210  ? -1.292  -50.923 49.195  1.00 100.18 ? 210  GLU C C     1 
ATOM   5225  O  O     . GLU C 2  210  ? -1.718  -51.067 50.347  1.00 99.78  ? 210  GLU C O     1 
ATOM   5226  C  CB    . GLU C 2  210  ? 1.147   -50.850 48.598  1.00 91.75  ? 210  GLU C CB    1 
ATOM   5227  C  CG    . GLU C 2  210  ? 2.100   -50.978 49.777  1.00 95.80  ? 210  GLU C CG    1 
ATOM   5228  C  CD    . GLU C 2  210  ? 2.963   -52.227 49.706  1.00 95.05  ? 210  GLU C CD    1 
ATOM   5229  O  OE1   . GLU C 2  210  ? 3.398   -52.590 48.593  1.00 95.28  ? 210  GLU C OE1   1 
ATOM   5230  O  OE2   . GLU C 2  210  ? 3.210   -52.845 50.762  1.00 93.54  ? 210  GLU C OE2   1 
ATOM   5231  N  N     . LEU C 2  211  ? -1.846  -50.066 48.337  1.00 99.16  ? 211  LEU C N     1 
ATOM   5232  C  CA    . LEU C 2  211  ? -2.898  -49.135 48.723  1.00 97.97  ? 211  LEU C CA    1 
ATOM   5233  C  C     . LEU C 2  211  ? -4.290  -49.583 48.299  1.00 101.98 ? 211  LEU C C     1 
ATOM   5234  O  O     . LEU C 2  211  ? -5.254  -48.844 48.519  1.00 103.43 ? 211  LEU C O     1 
ATOM   5235  C  CB    . LEU C 2  211  ? -2.614  -47.751 48.133  1.00 95.67  ? 211  LEU C CB    1 
ATOM   5236  C  CG    . LEU C 2  211  ? -1.795  -46.754 48.958  1.00 91.12  ? 211  LEU C CG    1 
ATOM   5237  C  CD1   . LEU C 2  211  ? -0.529  -47.383 49.522  1.00 87.12  ? 211  LEU C CD1   1 
ATOM   5238  C  CD2   . LEU C 2  211  ? -1.450  -45.548 48.106  1.00 87.72  ? 211  LEU C CD2   1 
ATOM   5239  N  N     . GLY C 2  212  ? -4.420  -50.763 47.691  1.00 107.41 ? 212  GLY C N     1 
ATOM   5240  C  CA    . GLY C 2  212  ? -5.720  -51.213 47.224  1.00 109.13 ? 212  GLY C CA    1 
ATOM   5241  C  C     . GLY C 2  212  ? -6.697  -51.553 48.328  1.00 105.22 ? 212  GLY C C     1 
ATOM   5242  O  O     . GLY C 2  212  ? -7.910  -51.552 48.088  1.00 99.59  ? 212  GLY C O     1 
ATOM   5243  N  N     . ALA C 2  213  ? -6.200  -51.831 49.535  1.00 98.99  ? 213  ALA C N     1 
ATOM   5244  C  CA    . ALA C 2  213  ? -7.066  -52.223 50.640  1.00 93.01  ? 213  ALA C CA    1 
ATOM   5245  C  C     . ALA C 2  213  ? -8.053  -51.132 51.037  1.00 97.92  ? 213  ALA C C     1 
ATOM   5246  O  O     . ALA C 2  213  ? -8.991  -51.414 51.793  1.00 90.13  ? 213  ALA C O     1 
ATOM   5247  C  CB    . ALA C 2  213  ? -6.215  -52.620 51.847  1.00 92.38  ? 213  ALA C CB    1 
ATOM   5248  N  N     . TYR C 2  214  ? -7.871  -49.908 50.553  1.00 107.66 ? 214  TYR C N     1 
ATOM   5249  C  CA    . TYR C 2  214  ? -8.733  -48.785 50.894  1.00 107.99 ? 214  TYR C CA    1 
ATOM   5250  C  C     . TYR C 2  214  ? -9.636  -48.479 49.706  1.00 111.04 ? 214  TYR C C     1 
ATOM   5251  O  O     . TYR C 2  214  ? -9.154  -48.088 48.636  1.00 104.63 ? 214  TYR C O     1 
ATOM   5252  C  CB    . TYR C 2  214  ? -7.898  -47.570 51.291  1.00 96.23  ? 214  TYR C CB    1 
ATOM   5253  C  CG    . TYR C 2  214  ? -6.851  -47.915 52.322  1.00 88.89  ? 214  TYR C CG    1 
ATOM   5254  C  CD1   . TYR C 2  214  ? -7.194  -48.075 53.658  1.00 87.32  ? 214  TYR C CD1   1 
ATOM   5255  C  CD2   . TYR C 2  214  ? -5.523  -48.108 51.959  1.00 86.23  ? 214  TYR C CD2   1 
ATOM   5256  C  CE1   . TYR C 2  214  ? -6.246  -48.402 54.607  1.00 85.66  ? 214  TYR C CE1   1 
ATOM   5257  C  CE2   . TYR C 2  214  ? -4.564  -48.436 52.902  1.00 84.05  ? 214  TYR C CE2   1 
ATOM   5258  C  CZ    . TYR C 2  214  ? -4.932  -48.581 54.226  1.00 84.45  ? 214  TYR C CZ    1 
ATOM   5259  O  OH    . TYR C 2  214  ? -3.990  -48.907 55.176  1.00 78.87  ? 214  TYR C OH    1 
ATOM   5260  N  N     . GLY C 2  215  ? -10.938 -48.661 49.902  1.00 119.48 ? 215  GLY C N     1 
ATOM   5261  C  CA    . GLY C 2  215  ? -11.873 -48.562 48.797  1.00 131.36 ? 215  GLY C CA    1 
ATOM   5262  C  C     . GLY C 2  215  ? -12.114 -47.121 48.382  1.00 128.02 ? 215  GLY C C     1 
ATOM   5263  O  O     . GLY C 2  215  ? -12.223 -46.217 49.214  1.00 121.29 ? 215  GLY C O     1 
ATOM   5264  N  N     . GLU C 2  216  ? -12.179 -46.914 47.066  1.00 129.48 ? 216  GLU C N     1 
ATOM   5265  C  CA    . GLU C 2  216  ? -12.461 -45.643 46.406  1.00 134.70 ? 216  GLU C CA    1 
ATOM   5266  C  C     . GLU C 2  216  ? -11.342 -44.626 46.584  1.00 134.86 ? 216  GLU C C     1 
ATOM   5267  O  O     . GLU C 2  216  ? -11.427 -43.517 46.034  1.00 137.26 ? 216  GLU C O     1 
ATOM   5268  C  CB    . GLU C 2  216  ? -13.785 -45.026 46.881  1.00 135.13 ? 216  GLU C CB    1 
ATOM   5269  C  CG    . GLU C 2  216  ? -14.994 -45.946 46.729  1.00 138.47 ? 216  GLU C CG    1 
ATOM   5270  C  CD    . GLU C 2  216  ? -15.321 -46.282 45.277  1.00 140.56 ? 216  GLU C CD    1 
ATOM   5271  O  OE1   . GLU C 2  216  ? -14.947 -45.497 44.381  1.00 148.24 ? 216  GLU C OE1   1 
ATOM   5272  O  OE2   . GLU C 2  216  ? -15.949 -47.336 45.030  1.00 128.09 ? 216  GLU C OE2   1 
ATOM   5273  N  N     . LEU C 2  217  ? -10.287 -44.964 47.317  1.00 127.64 ? 217  LEU C N     1 
ATOM   5274  C  CA    . LEU C 2  217  ? -9.218  -44.006 47.558  1.00 118.18 ? 217  LEU C CA    1 
ATOM   5275  C  C     . LEU C 2  217  ? -8.069  -44.200 46.575  1.00 119.38 ? 217  LEU C C     1 
ATOM   5276  O  O     . LEU C 2  217  ? -7.662  -43.255 45.891  1.00 119.62 ? 217  LEU C O     1 
ATOM   5277  C  CB    . LEU C 2  217  ? -8.742  -44.122 49.007  1.00 107.39 ? 217  LEU C CB    1 
ATOM   5278  C  CG    . LEU C 2  217  ? -9.750  -43.596 50.027  1.00 106.32 ? 217  LEU C CG    1 
ATOM   5279  C  CD1   . LEU C 2  217  ? -9.758  -44.478 51.244  1.00 98.38  ? 217  LEU C CD1   1 
ATOM   5280  C  CD2   . LEU C 2  217  ? -9.414  -42.169 50.396  1.00 99.13  ? 217  LEU C CD2   1 
ATOM   5281  N  N     . VAL C 2  218  ? -7.544  -45.424 46.493  1.00 119.71 ? 218  VAL C N     1 
ATOM   5282  C  CA    . VAL C 2  218  ? -6.453  -45.716 45.573  1.00 115.46 ? 218  VAL C CA    1 
ATOM   5283  C  C     . VAL C 2  218  ? -6.840  -45.430 44.127  1.00 117.26 ? 218  VAL C C     1 
ATOM   5284  O  O     . VAL C 2  218  ? -5.964  -45.183 43.290  1.00 111.52 ? 218  VAL C O     1 
ATOM   5285  C  CB    . VAL C 2  218  ? -5.997  -47.179 45.761  1.00 111.86 ? 218  VAL C CB    1 
ATOM   5286  C  CG1   . VAL C 2  218  ? -7.095  -48.145 45.336  1.00 114.19 ? 218  VAL C CG1   1 
ATOM   5287  C  CG2   . VAL C 2  218  ? -4.702  -47.444 45.007  1.00 111.56 ? 218  VAL C CG2   1 
ATOM   5288  N  N     . GLN C 2  219  ? -8.141  -45.431 43.813  1.00 123.29 ? 219  GLN C N     1 
ATOM   5289  C  CA    . GLN C 2  219  ? -8.572  -45.150 42.447  1.00 130.90 ? 219  GLN C CA    1 
ATOM   5290  C  C     . GLN C 2  219  ? -8.302  -43.704 42.050  1.00 131.08 ? 219  GLN C C     1 
ATOM   5291  O  O     . GLN C 2  219  ? -8.093  -43.418 40.866  1.00 131.54 ? 219  GLN C O     1 
ATOM   5292  C  CB    . GLN C 2  219  ? -10.055 -45.481 42.279  1.00 128.18 ? 219  GLN C CB    1 
ATOM   5293  C  CG    . GLN C 2  219  ? -10.316 -46.952 42.006  1.00 133.15 ? 219  GLN C CG    1 
ATOM   5294  C  CD    . GLN C 2  219  ? -9.502  -47.474 40.834  1.00 134.45 ? 219  GLN C CD    1 
ATOM   5295  O  OE1   . GLN C 2  219  ? -8.850  -48.514 40.933  1.00 138.94 ? 219  GLN C OE1   1 
ATOM   5296  N  NE2   . GLN C 2  219  ? -9.536  -46.754 39.717  1.00 119.22 ? 219  GLN C NE2   1 
ATOM   5297  N  N     . GLY C 2  220  ? -8.304  -42.782 43.015  1.00 127.13 ? 220  GLY C N     1 
ATOM   5298  C  CA    . GLY C 2  220  ? -7.862  -41.427 42.731  1.00 124.33 ? 220  GLY C CA    1 
ATOM   5299  C  C     . GLY C 2  220  ? -6.375  -41.319 42.471  1.00 118.83 ? 220  GLY C C     1 
ATOM   5300  O  O     . GLY C 2  220  ? -5.920  -40.309 41.923  1.00 113.11 ? 220  GLY C O     1 
ATOM   5301  N  N     . LEU C 2  221  ? -5.611  -42.341 42.850  1.00 117.72 ? 221  LEU C N     1 
ATOM   5302  C  CA    . LEU C 2  221  ? -4.181  -42.404 42.600  1.00 113.34 ? 221  LEU C CA    1 
ATOM   5303  C  C     . LEU C 2  221  ? -3.845  -43.019 41.247  1.00 119.66 ? 221  LEU C C     1 
ATOM   5304  O  O     . LEU C 2  221  ? -2.703  -42.900 40.795  1.00 120.67 ? 221  LEU C O     1 
ATOM   5305  C  CB    . LEU C 2  221  ? -3.504  -43.195 43.730  1.00 111.77 ? 221  LEU C CB    1 
ATOM   5306  C  CG    . LEU C 2  221  ? -2.007  -43.505 43.714  1.00 111.31 ? 221  LEU C CG    1 
ATOM   5307  C  CD1   . LEU C 2  221  ? -1.462  -43.422 45.115  1.00 104.30 ? 221  LEU C CD1   1 
ATOM   5308  C  CD2   . LEU C 2  221  ? -1.753  -44.891 43.139  1.00 114.00 ? 221  LEU C CD2   1 
ATOM   5309  N  N     . MET C 2  222  ? -4.809  -43.646 40.577  1.00 122.76 ? 222  MET C N     1 
ATOM   5310  C  CA    . MET C 2  222  ? -4.552  -44.341 39.320  1.00 119.33 ? 222  MET C CA    1 
ATOM   5311  C  C     . MET C 2  222  ? -4.697  -43.360 38.162  1.00 114.60 ? 222  MET C C     1 
ATOM   5312  O  O     . MET C 2  222  ? -5.792  -42.851 37.899  1.00 109.04 ? 222  MET C O     1 
ATOM   5313  C  CB    . MET C 2  222  ? -5.496  -45.530 39.159  1.00 117.13 ? 222  MET C CB    1 
ATOM   5314  C  CG    . MET C 2  222  ? -5.260  -46.636 40.176  1.00 119.93 ? 222  MET C CG    1 
ATOM   5315  S  SD    . MET C 2  222  ? -3.546  -47.197 40.182  1.00 116.68 ? 222  MET C SD    1 
ATOM   5316  C  CE    . MET C 2  222  ? -3.564  -48.366 41.540  1.00 109.90 ? 222  MET C CE    1 
ATOM   5317  N  N     . ASP C 2  223  ? -3.589  -43.091 37.476  1.00 118.30 ? 223  ASP C N     1 
ATOM   5318  C  CA    . ASP C 2  223  ? -3.582  -42.277 36.266  1.00 121.10 ? 223  ASP C CA    1 
ATOM   5319  C  C     . ASP C 2  223  ? -2.714  -42.976 35.233  1.00 120.21 ? 223  ASP C C     1 
ATOM   5320  O  O     . ASP C 2  223  ? -1.503  -43.120 35.429  1.00 115.21 ? 223  ASP C O     1 
ATOM   5321  C  CB    . ASP C 2  223  ? -3.069  -40.861 36.545  1.00 116.77 ? 223  ASP C CB    1 
ATOM   5322  C  CG    . ASP C 2  223  ? -3.143  -39.965 35.323  1.00 115.17 ? 223  ASP C CG    1 
ATOM   5323  O  OD1   . ASP C 2  223  ? -3.609  -40.433 34.264  1.00 116.32 ? 223  ASP C OD1   1 
ATOM   5324  O  OD2   . ASP C 2  223  ? -2.752  -38.783 35.432  1.00 113.52 ? 223  ASP C OD2   1 
ATOM   5325  N  N     . GLU C 2  224  ? -3.338  -43.413 34.138  1.00 121.66 ? 224  GLU C N     1 
ATOM   5326  C  CA    . GLU C 2  224  ? -2.636  -44.209 33.136  1.00 119.51 ? 224  GLU C CA    1 
ATOM   5327  C  C     . GLU C 2  224  ? -1.558  -43.405 32.421  1.00 119.08 ? 224  GLU C C     1 
ATOM   5328  O  O     . GLU C 2  224  ? -0.511  -43.959 32.066  1.00 117.68 ? 224  GLU C O     1 
ATOM   5329  C  CB    . GLU C 2  224  ? -3.636  -44.780 32.126  1.00 120.39 ? 224  GLU C CB    1 
ATOM   5330  C  CG    . GLU C 2  224  ? -4.551  -43.743 31.472  1.00 126.08 ? 224  GLU C CG    1 
ATOM   5331  C  CD    . GLU C 2  224  ? -5.659  -43.256 32.394  1.00 124.28 ? 224  GLU C CD    1 
ATOM   5332  O  OE1   . GLU C 2  224  ? -6.641  -44.000 32.599  1.00 117.62 ? 224  GLU C OE1   1 
ATOM   5333  O  OE2   . GLU C 2  224  ? -5.536  -42.132 32.929  1.00 118.68 ? 224  GLU C OE2   1 
ATOM   5334  N  N     . SER C 2  225  ? -1.783  -42.107 32.204  1.00 117.23 ? 225  SER C N     1 
ATOM   5335  C  CA    . SER C 2  225  ? -0.786  -41.296 31.516  1.00 118.09 ? 225  SER C CA    1 
ATOM   5336  C  C     . SER C 2  225  ? 0.512   -41.195 32.307  1.00 113.78 ? 225  SER C C     1 
ATOM   5337  O  O     . SER C 2  225  ? 1.569   -40.947 31.716  1.00 109.18 ? 225  SER C O     1 
ATOM   5338  C  CB    . SER C 2  225  ? -1.343  -39.898 31.233  1.00 115.29 ? 225  SER C CB    1 
ATOM   5339  O  OG    . SER C 2  225  ? -1.940  -39.338 32.388  1.00 93.27  ? 225  SER C OG    1 
ATOM   5340  N  N     . VAL C 2  226  ? 0.456   -41.385 33.625  1.00 117.60 ? 226  VAL C N     1 
ATOM   5341  C  CA    . VAL C 2  226  ? 1.665   -41.327 34.438  1.00 119.07 ? 226  VAL C CA    1 
ATOM   5342  C  C     . VAL C 2  226  ? 2.450   -42.629 34.336  1.00 122.70 ? 226  VAL C C     1 
ATOM   5343  O  O     . VAL C 2  226  ? 3.679   -42.618 34.209  1.00 125.20 ? 226  VAL C O     1 
ATOM   5344  C  CB    . VAL C 2  226  ? 1.306   -40.998 35.898  1.00 112.22 ? 226  VAL C CB    1 
ATOM   5345  C  CG1   . VAL C 2  226  ? 2.570   -40.836 36.727  1.00 107.80 ? 226  VAL C CG1   1 
ATOM   5346  C  CG2   . VAL C 2  226  ? 0.446   -39.744 35.964  1.00 99.14  ? 226  VAL C CG2   1 
ATOM   5347  N  N     . PHE C 2  227  ? 1.760   -43.770 34.390  1.00 122.30 ? 227  PHE C N     1 
ATOM   5348  C  CA    . PHE C 2  227  ? 2.440   -45.054 34.280  1.00 122.86 ? 227  PHE C CA    1 
ATOM   5349  C  C     . PHE C 2  227  ? 2.881   -45.364 32.857  1.00 121.96 ? 227  PHE C C     1 
ATOM   5350  O  O     . PHE C 2  227  ? 3.597   -46.351 32.650  1.00 119.27 ? 227  PHE C O     1 
ATOM   5351  C  CB    . PHE C 2  227  ? 1.538   -46.176 34.803  1.00 125.77 ? 227  PHE C CB    1 
ATOM   5352  C  CG    . PHE C 2  227  ? 1.152   -46.019 36.249  1.00 129.04 ? 227  PHE C CG    1 
ATOM   5353  C  CD1   . PHE C 2  227  ? 2.075   -46.254 37.256  1.00 124.90 ? 227  PHE C CD1   1 
ATOM   5354  C  CD2   . PHE C 2  227  ? -0.135  -45.642 36.600  1.00 120.77 ? 227  PHE C CD2   1 
ATOM   5355  C  CE1   . PHE C 2  227  ? 1.725   -46.107 38.584  1.00 114.04 ? 227  PHE C CE1   1 
ATOM   5356  C  CE2   . PHE C 2  227  ? -0.492  -45.497 37.926  1.00 114.96 ? 227  PHE C CE2   1 
ATOM   5357  C  CZ    . PHE C 2  227  ? 0.438   -45.732 38.919  1.00 116.04 ? 227  PHE C CZ    1 
ATOM   5358  N  N     . ALA C 2  228  ? 2.483   -44.548 31.882  1.00 119.88 ? 228  ALA C N     1 
ATOM   5359  C  CA    . ALA C 2  228  ? 2.885   -44.734 30.495  1.00 119.71 ? 228  ALA C CA    1 
ATOM   5360  C  C     . ALA C 2  228  ? 4.271   -44.180 30.197  1.00 119.08 ? 228  ALA C C     1 
ATOM   5361  O  O     . ALA C 2  228  ? 4.715   -44.266 29.047  1.00 121.13 ? 228  ALA C O     1 
ATOM   5362  C  CB    . ALA C 2  228  ? 1.861   -44.083 29.561  1.00 112.64 ? 228  ALA C CB    1 
ATOM   5363  N  N     . MET C 2  229  ? 4.961   -43.620 31.189  1.00 118.71 ? 229  MET C N     1 
ATOM   5364  C  CA    . MET C 2  229  ? 6.273   -43.021 30.989  1.00 119.66 ? 229  MET C CA    1 
ATOM   5365  C  C     . MET C 2  229  ? 7.237   -43.495 32.067  1.00 119.84 ? 229  MET C C     1 
ATOM   5366  O  O     . MET C 2  229  ? 6.859   -43.639 33.234  1.00 119.98 ? 229  MET C O     1 
ATOM   5367  C  CB    . MET C 2  229  ? 6.190   -41.490 30.991  1.00 119.55 ? 229  MET C CB    1 
ATOM   5368  C  CG    . MET C 2  229  ? 5.422   -40.897 32.158  1.00 114.70 ? 229  MET C CG    1 
ATOM   5369  S  SD    . MET C 2  229  ? 5.042   -39.155 31.883  1.00 119.69 ? 229  MET C SD    1 
ATOM   5370  C  CE    . MET C 2  229  ? 4.108   -38.762 33.355  1.00 111.75 ? 229  MET C CE    1 
ATOM   5371  N  N     . ARG C 2  230  ? 8.485   -43.728 31.662  1.00 122.64 ? 230  ARG C N     1 
ATOM   5372  C  CA    . ARG C 2  230  ? 9.520   -44.201 32.568  1.00 126.27 ? 230  ARG C CA    1 
ATOM   5373  C  C     . ARG C 2  230  ? 9.856   -43.130 33.607  1.00 125.46 ? 230  ARG C C     1 
ATOM   5374  O  O     . ARG C 2  230  ? 9.476   -41.965 33.455  1.00 125.56 ? 230  ARG C O     1 
ATOM   5375  C  CB    . ARG C 2  230  ? 10.770  -44.589 31.778  1.00 121.40 ? 230  ARG C CB    1 
ATOM   5376  C  CG    . ARG C 2  230  ? 10.615  -44.490 30.276  1.00 115.71 ? 230  ARG C CG    1 
ATOM   5377  C  CD    . ARG C 2  230  ? 11.877  -44.943 29.569  1.00 112.13 ? 230  ARG C CD    1 
ATOM   5378  N  NE    . ARG C 2  230  ? 11.771  -44.772 28.125  1.00 113.45 ? 230  ARG C NE    1 
ATOM   5379  C  CZ    . ARG C 2  230  ? 12.036  -43.636 27.490  1.00 129.10 ? 230  ARG C CZ    1 
ATOM   5380  N  NH1   . ARG C 2  230  ? 11.910  -43.565 26.171  1.00 133.48 ? 230  ARG C NH1   1 
ATOM   5381  N  NH2   . ARG C 2  230  ? 12.425  -42.568 28.175  1.00 124.69 ? 230  ARG C NH2   1 
ATOM   5382  N  N     . PRO C 2  231  ? 10.557  -43.508 34.685  1.00 118.39 ? 231  PRO C N     1 
ATOM   5383  C  CA    . PRO C 2  231  ? 10.926  -42.516 35.711  1.00 116.76 ? 231  PRO C CA    1 
ATOM   5384  C  C     . PRO C 2  231  ? 11.610  -41.262 35.182  1.00 120.02 ? 231  PRO C C     1 
ATOM   5385  O  O     . PRO C 2  231  ? 11.410  -40.184 35.753  1.00 114.52 ? 231  PRO C O     1 
ATOM   5386  C  CB    . PRO C 2  231  ? 11.856  -43.315 36.632  1.00 113.04 ? 231  PRO C CB    1 
ATOM   5387  C  CG    . PRO C 2  231  ? 11.334  -44.706 36.548  1.00 110.01 ? 231  PRO C CG    1 
ATOM   5388  C  CD    . PRO C 2  231  ? 10.827  -44.887 35.138  1.00 112.00 ? 231  PRO C CD    1 
ATOM   5389  N  N     . GLU C 2  232  ? 12.406  -41.357 34.113  1.00 124.85 ? 232  GLU C N     1 
ATOM   5390  C  CA    . GLU C 2  232  ? 13.083  -40.170 33.592  1.00 122.78 ? 232  GLU C CA    1 
ATOM   5391  C  C     . GLU C 2  232  ? 12.085  -39.175 33.005  1.00 119.14 ? 232  GLU C C     1 
ATOM   5392  O  O     . GLU C 2  232  ? 12.173  -37.965 33.257  1.00 119.48 ? 232  GLU C O     1 
ATOM   5393  C  CB    . GLU C 2  232  ? 14.123  -40.571 32.542  1.00 122.55 ? 232  GLU C CB    1 
ATOM   5394  C  CG    . GLU C 2  232  ? 15.452  -41.070 33.109  1.00 119.00 ? 232  GLU C CG    1 
ATOM   5395  C  CD    . GLU C 2  232  ? 15.374  -42.479 33.675  1.00 122.00 ? 232  GLU C CD    1 
ATOM   5396  O  OE1   . GLU C 2  232  ? 14.326  -43.139 33.511  1.00 128.02 ? 232  GLU C OE1   1 
ATOM   5397  O  OE2   . GLU C 2  232  ? 16.367  -42.928 34.285  1.00 112.57 ? 232  GLU C OE2   1 
ATOM   5398  N  N     . GLU C 2  233  ? 11.127  -39.668 32.215  1.00 118.86 ? 233  GLU C N     1 
ATOM   5399  C  CA    . GLU C 2  233  ? 10.134  -38.780 31.617  1.00 124.29 ? 233  GLU C CA    1 
ATOM   5400  C  C     . GLU C 2  233  ? 9.244   -38.151 32.683  1.00 125.46 ? 233  GLU C C     1 
ATOM   5401  O  O     . GLU C 2  233  ? 8.940   -36.954 32.618  1.00 123.28 ? 233  GLU C O     1 
ATOM   5402  C  CB    . GLU C 2  233  ? 9.299   -39.546 30.591  1.00 129.77 ? 233  GLU C CB    1 
ATOM   5403  C  CG    . GLU C 2  233  ? 10.116  -40.179 29.470  1.00 128.52 ? 233  GLU C CG    1 
ATOM   5404  C  CD    . GLU C 2  233  ? 9.246   -40.790 28.388  1.00 121.50 ? 233  GLU C CD    1 
ATOM   5405  O  OE1   . GLU C 2  233  ? 8.023   -40.538 28.395  1.00 119.40 ? 233  GLU C OE1   1 
ATOM   5406  O  OE2   . GLU C 2  233  ? 9.784   -41.521 27.530  1.00 120.65 ? 233  GLU C OE2   1 
ATOM   5407  N  N     . ALA C 2  234  ? 8.834   -38.935 33.684  1.00 124.02 ? 234  ALA C N     1 
ATOM   5408  C  CA    . ALA C 2  234  ? 8.031   -38.385 34.773  1.00 115.23 ? 234  ALA C CA    1 
ATOM   5409  C  C     . ALA C 2  234  ? 8.823   -37.364 35.582  1.00 112.95 ? 234  ALA C C     1 
ATOM   5410  O  O     . ALA C 2  234  ? 8.269   -36.360 36.043  1.00 106.30 ? 234  ALA C O     1 
ATOM   5411  C  CB    . ALA C 2  234  ? 7.529   -39.513 35.674  1.00 110.59 ? 234  ALA C CB    1 
ATOM   5412  N  N     . LEU C 2  235  ? 10.124  -37.604 35.760  1.00 115.74 ? 235  LEU C N     1 
ATOM   5413  C  CA    . LEU C 2  235  ? 10.971  -36.664 36.486  1.00 110.29 ? 235  LEU C CA    1 
ATOM   5414  C  C     . LEU C 2  235  ? 11.078  -35.337 35.747  1.00 107.98 ? 235  LEU C C     1 
ATOM   5415  O  O     . LEU C 2  235  ? 10.961  -34.264 36.352  1.00 104.82 ? 235  LEU C O     1 
ATOM   5416  C  CB    . LEU C 2  235  ? 12.355  -37.276 36.699  1.00 104.78 ? 235  LEU C CB    1 
ATOM   5417  C  CG    . LEU C 2  235  ? 13.444  -36.388 37.299  1.00 103.50 ? 235  LEU C CG    1 
ATOM   5418  C  CD1   . LEU C 2  235  ? 13.001  -35.820 38.634  1.00 112.18 ? 235  LEU C CD1   1 
ATOM   5419  C  CD2   . LEU C 2  235  ? 14.727  -37.181 37.458  1.00 99.24  ? 235  LEU C CD2   1 
ATOM   5420  N  N     . ILE C 2  236  ? 11.310  -35.390 34.433  1.00 117.87 ? 236  ILE C N     1 
ATOM   5421  C  CA    . ILE C 2  236  ? 11.358  -34.159 33.646  1.00 120.73 ? 236  ILE C CA    1 
ATOM   5422  C  C     . ILE C 2  236  ? 9.993   -33.474 33.638  1.00 114.09 ? 236  ILE C C     1 
ATOM   5423  O  O     . ILE C 2  236  ? 9.907   -32.239 33.624  1.00 107.05 ? 236  ILE C O     1 
ATOM   5424  C  CB    . ILE C 2  236  ? 11.869  -34.457 32.221  1.00 121.96 ? 236  ILE C CB    1 
ATOM   5425  C  CG1   . ILE C 2  236  ? 13.291  -35.029 32.278  1.00 109.29 ? 236  ILE C CG1   1 
ATOM   5426  C  CG2   . ILE C 2  236  ? 11.846  -33.201 31.359  1.00 119.28 ? 236  ILE C CG2   1 
ATOM   5427  C  CD1   . ILE C 2  236  ? 13.882  -35.353 30.922  1.00 111.37 ? 236  ILE C CD1   1 
ATOM   5428  N  N     . ARG C 2  237  ? 8.910   -34.256 33.682  1.00 114.13 ? 237  ARG C N     1 
ATOM   5429  C  CA    . ARG C 2  237  ? 7.570   -33.682 33.780  1.00 112.65 ? 237  ARG C CA    1 
ATOM   5430  C  C     . ARG C 2  237  ? 7.391   -32.916 35.087  1.00 115.07 ? 237  ARG C C     1 
ATOM   5431  O  O     . ARG C 2  237  ? 6.850   -31.802 35.107  1.00 113.51 ? 237  ARG C O     1 
ATOM   5432  C  CB    . ARG C 2  237  ? 6.530   -34.795 33.660  1.00 108.70 ? 237  ARG C CB    1 
ATOM   5433  C  CG    . ARG C 2  237  ? 5.113   -34.352 33.943  1.00 106.15 ? 237  ARG C CG    1 
ATOM   5434  C  CD    . ARG C 2  237  ? 4.681   -33.272 32.974  1.00 105.56 ? 237  ARG C CD    1 
ATOM   5435  N  NE    . ARG C 2  237  ? 3.337   -32.788 33.268  1.00 108.26 ? 237  ARG C NE    1 
ATOM   5436  C  CZ    . ARG C 2  237  ? 2.697   -31.882 32.538  1.00 115.17 ? 237  ARG C CZ    1 
ATOM   5437  N  NH1   . ARG C 2  237  ? 1.474   -31.498 32.879  1.00 117.52 ? 237  ARG C NH1   1 
ATOM   5438  N  NH2   . ARG C 2  237  ? 3.279   -31.361 31.466  1.00 107.97 ? 237  ARG C NH2   1 
ATOM   5439  N  N     . LEU C 2  238  ? 7.833   -33.510 36.196  1.00 113.68 ? 238  LEU C N     1 
ATOM   5440  C  CA    . LEU C 2  238  ? 7.759   -32.832 37.486  1.00 114.16 ? 238  LEU C CA    1 
ATOM   5441  C  C     . LEU C 2  238  ? 8.620   -31.575 37.499  1.00 114.45 ? 238  LEU C C     1 
ATOM   5442  O  O     . LEU C 2  238  ? 8.228   -30.551 38.070  1.00 105.94 ? 238  LEU C O     1 
ATOM   5443  C  CB    . LEU C 2  238  ? 8.182   -33.784 38.602  1.00 114.07 ? 238  LEU C CB    1 
ATOM   5444  C  CG    . LEU C 2  238  ? 8.230   -33.183 40.007  1.00 102.39 ? 238  LEU C CG    1 
ATOM   5445  C  CD1   . LEU C 2  238  ? 6.864   -32.643 40.390  1.00 96.28  ? 238  LEU C CD1   1 
ATOM   5446  C  CD2   . LEU C 2  238  ? 8.709   -34.218 41.008  1.00 92.53  ? 238  LEU C CD2   1 
ATOM   5447  N  N     . PHE C 2  239  ? 9.801   -31.635 36.876  1.00 120.06 ? 239  PHE C N     1 
ATOM   5448  C  CA    . PHE C 2  239  ? 10.670  -30.463 36.818  1.00 113.72 ? 239  PHE C CA    1 
ATOM   5449  C  C     . PHE C 2  239  ? 10.058  -29.351 35.973  1.00 118.33 ? 239  PHE C C     1 
ATOM   5450  O  O     . PHE C 2  239  ? 10.282  -28.168 36.253  1.00 113.49 ? 239  PHE C O     1 
ATOM   5451  C  CB    . PHE C 2  239  ? 12.043  -30.860 36.275  1.00 109.91 ? 239  PHE C CB    1 
ATOM   5452  C  CG    . PHE C 2  239  ? 13.052  -29.742 36.276  1.00 112.67 ? 239  PHE C CG    1 
ATOM   5453  C  CD1   . PHE C 2  239  ? 13.712  -29.385 37.439  1.00 112.96 ? 239  PHE C CD1   1 
ATOM   5454  C  CD2   . PHE C 2  239  ? 13.347  -29.057 35.109  1.00 123.45 ? 239  PHE C CD2   1 
ATOM   5455  C  CE1   . PHE C 2  239  ? 14.644  -28.364 37.440  1.00 113.82 ? 239  PHE C CE1   1 
ATOM   5456  C  CE2   . PHE C 2  239  ? 14.278  -28.035 35.104  1.00 123.65 ? 239  PHE C CE2   1 
ATOM   5457  C  CZ    . PHE C 2  239  ? 14.926  -27.688 36.271  1.00 116.01 ? 239  PHE C CZ    1 
ATOM   5458  N  N     . THR C 2  240  ? 9.292   -29.709 34.937  1.00 125.78 ? 240  THR C N     1 
ATOM   5459  C  CA    . THR C 2  240  ? 8.558   -28.700 34.174  1.00 122.94 ? 240  THR C CA    1 
ATOM   5460  C  C     . THR C 2  240  ? 7.387   -28.138 34.970  1.00 118.03 ? 240  THR C C     1 
ATOM   5461  O  O     . THR C 2  240  ? 7.024   -26.969 34.796  1.00 108.79 ? 240  THR C O     1 
ATOM   5462  C  CB    . THR C 2  240  ? 8.050   -29.287 32.856  1.00 125.51 ? 240  THR C CB    1 
ATOM   5463  O  OG1   . THR C 2  240  ? 7.246   -30.444 33.122  1.00 122.98 ? 240  THR C OG1   1 
ATOM   5464  C  CG2   . THR C 2  240  ? 9.211   -29.673 31.954  1.00 120.56 ? 240  THR C CG2   1 
ATOM   5465  N  N     . LEU C 2  241  ? 6.777   -28.956 35.831  1.00 118.05 ? 241  LEU C N     1 
ATOM   5466  C  CA    . LEU C 2  241  ? 5.688   -28.469 36.673  1.00 112.82 ? 241  LEU C CA    1 
ATOM   5467  C  C     . LEU C 2  241  ? 6.198   -27.528 37.758  1.00 114.24 ? 241  LEU C C     1 
ATOM   5468  O  O     . LEU C 2  241  ? 5.528   -26.549 38.103  1.00 106.60 ? 241  LEU C O     1 
ATOM   5469  C  CB    . LEU C 2  241  ? 4.944   -29.644 37.300  1.00 106.04 ? 241  LEU C CB    1 
ATOM   5470  C  CG    . LEU C 2  241  ? 3.855   -30.286 36.448  1.00 108.69 ? 241  LEU C CG    1 
ATOM   5471  C  CD1   . LEU C 2  241  ? 3.270   -31.477 37.177  1.00 112.83 ? 241  LEU C CD1   1 
ATOM   5472  C  CD2   . LEU C 2  241  ? 2.773   -29.269 36.131  1.00 95.65  ? 241  LEU C CD2   1 
ATOM   5473  N  N     . LEU C 2  242  ? 7.374   -27.814 38.314  1.00 118.63 ? 242  LEU C N     1 
ATOM   5474  C  CA    . LEU C 2  242  ? 7.916   -27.047 39.431  1.00 123.34 ? 242  LEU C CA    1 
ATOM   5475  C  C     . LEU C 2  242  ? 8.760   -25.853 38.999  1.00 121.61 ? 242  LEU C C     1 
ATOM   5476  O  O     . LEU C 2  242  ? 9.023   -24.970 39.824  1.00 114.53 ? 242  LEU C O     1 
ATOM   5477  C  CB    . LEU C 2  242  ? 8.763   -27.958 40.332  1.00 120.58 ? 242  LEU C CB    1 
ATOM   5478  C  CG    . LEU C 2  242  ? 8.167   -28.541 41.619  1.00 106.53 ? 242  LEU C CG    1 
ATOM   5479  C  CD1   . LEU C 2  242  ? 6.653   -28.656 41.549  1.00 103.81 ? 242  LEU C CD1   1 
ATOM   5480  C  CD2   . LEU C 2  242  ? 8.802   -29.893 41.902  1.00 91.13  ? 242  LEU C CD2   1 
ATOM   5481  N  N     . ARG C 2  243  ? 9.196   -25.800 37.742  1.00 124.32 ? 243  ARG C N     1 
ATOM   5482  C  CA    . ARG C 2  243  ? 10.104  -24.753 37.267  1.00 123.35 ? 243  ARG C CA    1 
ATOM   5483  C  C     . ARG C 2  243  ? 9.671   -24.297 35.882  1.00 127.44 ? 243  ARG C C     1 
ATOM   5484  O  O     . ARG C 2  243  ? 10.242  -24.713 34.866  1.00 132.84 ? 243  ARG C O     1 
ATOM   5485  C  CB    . ARG C 2  243  ? 11.551  -25.253 37.243  1.00 122.35 ? 243  ARG C CB    1 
ATOM   5486  C  CG    . ARG C 2  243  ? 12.061  -25.800 38.567  1.00 118.50 ? 243  ARG C CG    1 
ATOM   5487  C  CD    . ARG C 2  243  ? 12.467  -24.686 39.515  1.00 114.18 ? 243  ARG C CD    1 
ATOM   5488  N  NE    . ARG C 2  243  ? 13.573  -23.901 38.974  1.00 115.33 ? 243  ARG C NE    1 
ATOM   5489  C  CZ    . ARG C 2  243  ? 14.354  -23.107 39.698  1.00 99.70  ? 243  ARG C CZ    1 
ATOM   5490  N  NH1   . ARG C 2  243  ? 15.334  -22.434 39.114  1.00 91.87  ? 243  ARG C NH1   1 
ATOM   5491  N  NH2   . ARG C 2  243  ? 14.163  -22.991 41.005  1.00 95.24  ? 243  ARG C NH2   1 
ATOM   5492  N  N     . PRO C 2  244  ? 8.651   -23.438 35.800  1.00 120.80 ? 244  PRO C N     1 
ATOM   5493  C  CA    . PRO C 2  244  ? 8.235   -22.917 34.492  1.00 120.79 ? 244  PRO C CA    1 
ATOM   5494  C  C     . PRO C 2  244  ? 9.306   -22.024 33.887  1.00 119.78 ? 244  PRO C C     1 
ATOM   5495  O  O     . PRO C 2  244  ? 9.911   -21.195 34.570  1.00 114.73 ? 244  PRO C O     1 
ATOM   5496  C  CB    . PRO C 2  244  ? 6.962   -22.124 34.812  1.00 107.62 ? 244  PRO C CB    1 
ATOM   5497  C  CG    . PRO C 2  244  ? 6.494   -22.652 36.125  1.00 100.13 ? 244  PRO C CG    1 
ATOM   5498  C  CD    . PRO C 2  244  ? 7.739   -23.015 36.872  1.00 111.07 ? 244  PRO C CD    1 
ATOM   5499  N  N     . GLY C 2  245  ? 9.542   -22.209 32.588  1.00 114.76 ? 245  GLY C N     1 
ATOM   5500  C  CA    . GLY C 2  245  ? 10.526  -21.434 31.863  1.00 126.57 ? 245  GLY C CA    1 
ATOM   5501  C  C     . GLY C 2  245  ? 11.951  -21.930 31.977  1.00 133.54 ? 245  GLY C C     1 
ATOM   5502  O  O     . GLY C 2  245  ? 12.764  -21.648 31.088  1.00 136.64 ? 245  GLY C O     1 
ATOM   5503  N  N     . ASP C 2  246  ? 12.281  -22.661 33.029  1.00 126.39 ? 246  ASP C N     1 
ATOM   5504  C  CA    . ASP C 2  246  ? 13.625  -23.201 33.171  1.00 130.96 ? 246  ASP C CA    1 
ATOM   5505  C  C     . ASP C 2  246  ? 13.795  -24.395 32.237  1.00 134.38 ? 246  ASP C C     1 
ATOM   5506  O  O     . ASP C 2  246  ? 12.910  -25.256 32.178  1.00 131.07 ? 246  ASP C O     1 
ATOM   5507  C  CB    . ASP C 2  246  ? 13.882  -23.610 34.622  1.00 131.05 ? 246  ASP C CB    1 
ATOM   5508  C  CG    . ASP C 2  246  ? 15.359  -23.815 34.927  1.00 129.60 ? 246  ASP C CG    1 
ATOM   5509  O  OD1   . ASP C 2  246  ? 16.003  -24.656 34.262  1.00 136.90 ? 246  ASP C OD1   1 
ATOM   5510  O  OD2   . ASP C 2  246  ? 15.881  -23.131 35.834  1.00 117.62 ? 246  ASP C OD2   1 
ATOM   5511  N  N     . PRO C 2  247  ? 14.892  -24.470 31.483  1.00 140.07 ? 247  PRO C N     1 
ATOM   5512  C  CA    . PRO C 2  247  ? 15.088  -25.592 30.546  1.00 139.82 ? 247  PRO C CA    1 
ATOM   5513  C  C     . PRO C 2  247  ? 15.092  -26.928 31.267  1.00 130.69 ? 247  PRO C C     1 
ATOM   5514  O  O     . PRO C 2  247  ? 15.844  -27.128 32.233  1.00 124.48 ? 247  PRO C O     1 
ATOM   5515  C  CB    . PRO C 2  247  ? 16.457  -25.294 29.910  1.00 137.89 ? 247  PRO C CB    1 
ATOM   5516  C  CG    . PRO C 2  247  ? 17.095  -24.259 30.793  1.00 132.35 ? 247  PRO C CG    1 
ATOM   5517  C  CD    . PRO C 2  247  ? 15.958  -23.461 31.360  1.00 131.24 ? 247  PRO C CD    1 
ATOM   5518  N  N     . PRO C 2  248  ? 14.268  -27.875 30.817  1.00 126.38 ? 248  PRO C N     1 
ATOM   5519  C  CA    . PRO C 2  248  ? 14.120  -29.170 31.508  1.00 124.92 ? 248  PRO C CA    1 
ATOM   5520  C  C     . PRO C 2  248  ? 15.218  -30.166 31.142  1.00 120.78 ? 248  PRO C C     1 
ATOM   5521  O  O     . PRO C 2  248  ? 14.963  -31.236 30.581  1.00 120.44 ? 248  PRO C O     1 
ATOM   5522  C  CB    . PRO C 2  248  ? 12.731  -29.634 31.039  1.00 127.34 ? 248  PRO C CB    1 
ATOM   5523  C  CG    . PRO C 2  248  ? 12.130  -28.479 30.254  1.00 117.23 ? 248  PRO C CG    1 
ATOM   5524  C  CD    . PRO C 2  248  ? 13.285  -27.714 29.737  1.00 118.71 ? 248  PRO C CD    1 
ATOM   5525  N  N     . LYS C 2  249  ? 16.461  -29.820 31.466  1.00 119.85 ? 249  LYS C N     1 
ATOM   5526  C  CA    . LYS C 2  249  ? 17.569  -30.729 31.214  1.00 123.38 ? 249  LYS C CA    1 
ATOM   5527  C  C     . LYS C 2  249  ? 17.564  -31.859 32.238  1.00 120.60 ? 249  LYS C C     1 
ATOM   5528  O  O     . LYS C 2  249  ? 17.060  -31.712 33.354  1.00 122.17 ? 249  LYS C O     1 
ATOM   5529  C  CB    . LYS C 2  249  ? 18.903  -29.983 31.247  1.00 125.30 ? 249  LYS C CB    1 
ATOM   5530  C  CG    . LYS C 2  249  ? 20.033  -30.717 30.530  1.00 119.61 ? 249  LYS C CG    1 
ATOM   5531  C  CD    . LYS C 2  249  ? 21.272  -29.848 30.396  1.00 124.66 ? 249  LYS C CD    1 
ATOM   5532  C  CE    . LYS C 2  249  ? 22.383  -30.574 29.653  1.00 114.99 ? 249  LYS C CE    1 
ATOM   5533  N  NZ    . LYS C 2  249  ? 21.977  -30.945 28.270  1.00 115.56 ? 249  LYS C NZ    1 
ATOM   5534  N  N     . ARG C 2  250  ? 18.129  -33.001 31.839  1.00 120.91 ? 250  ARG C N     1 
ATOM   5535  C  CA    . ARG C 2  250  ? 18.055  -34.203 32.665  1.00 120.23 ? 250  ARG C CA    1 
ATOM   5536  C  C     . ARG C 2  250  ? 18.826  -34.027 33.970  1.00 124.78 ? 250  ARG C C     1 
ATOM   5537  O  O     . ARG C 2  250  ? 18.267  -34.193 35.063  1.00 133.22 ? 250  ARG C O     1 
ATOM   5538  C  CB    . ARG C 2  250  ? 18.575  -35.409 31.877  1.00 117.58 ? 250  ARG C CB    1 
ATOM   5539  C  CG    . ARG C 2  250  ? 18.254  -36.762 32.496  1.00 112.00 ? 250  ARG C CG    1 
ATOM   5540  C  CD    . ARG C 2  250  ? 19.376  -37.249 33.398  1.00 105.35 ? 250  ARG C CD    1 
ATOM   5541  N  NE    . ARG C 2  250  ? 19.142  -38.609 33.873  1.00 105.08 ? 250  ARG C NE    1 
ATOM   5542  C  CZ    . ARG C 2  250  ? 19.986  -39.280 34.650  1.00 106.77 ? 250  ARG C CZ    1 
ATOM   5543  N  NH1   . ARG C 2  250  ? 21.121  -38.715 35.039  1.00 98.28  ? 250  ARG C NH1   1 
ATOM   5544  N  NH2   . ARG C 2  250  ? 19.696  -40.516 35.036  1.00 108.12 ? 250  ARG C NH2   1 
ATOM   5545  N  N     . ASP C 2  251  ? 20.118  -33.697 33.879  1.00 126.30 ? 251  ASP C N     1 
ATOM   5546  C  CA    . ASP C 2  251  ? 20.923  -33.547 35.087  1.00 127.95 ? 251  ASP C CA    1 
ATOM   5547  C  C     . ASP C 2  251  ? 20.442  -32.383 35.948  1.00 122.68 ? 251  ASP C C     1 
ATOM   5548  O  O     . ASP C 2  251  ? 20.529  -32.451 37.178  1.00 114.63 ? 251  ASP C O     1 
ATOM   5549  C  CB    . ASP C 2  251  ? 22.398  -33.374 34.724  1.00 123.41 ? 251  ASP C CB    1 
ATOM   5550  C  CG    . ASP C 2  251  ? 22.607  -32.425 33.563  1.00 130.88 ? 251  ASP C CG    1 
ATOM   5551  O  OD1   . ASP C 2  251  ? 22.198  -32.767 32.433  1.00 131.50 ? 251  ASP C OD1   1 
ATOM   5552  O  OD2   . ASP C 2  251  ? 23.166  -31.331 33.785  1.00 135.61 ? 251  ASP C OD2   1 
ATOM   5553  N  N     . LYS C 2  252  ? 19.902  -31.327 35.330  1.00 124.45 ? 252  LYS C N     1 
ATOM   5554  C  CA    . LYS C 2  252  ? 19.368  -30.212 36.107  1.00 120.79 ? 252  LYS C CA    1 
ATOM   5555  C  C     . LYS C 2  252  ? 18.132  -30.631 36.902  1.00 117.47 ? 252  LYS C C     1 
ATOM   5556  O  O     . LYS C 2  252  ? 17.987  -30.264 38.074  1.00 113.79 ? 252  LYS C O     1 
ATOM   5557  C  CB    . LYS C 2  252  ? 19.047  -29.038 35.181  1.00 124.20 ? 252  LYS C CB    1 
ATOM   5558  C  CG    . LYS C 2  252  ? 18.913  -27.702 35.888  1.00 125.82 ? 252  LYS C CG    1 
ATOM   5559  C  CD    . LYS C 2  252  ? 18.738  -26.571 34.889  1.00 118.59 ? 252  LYS C CD    1 
ATOM   5560  C  CE    . LYS C 2  252  ? 18.840  -25.221 35.573  1.00 115.62 ? 252  LYS C CE    1 
ATOM   5561  N  NZ    . LYS C 2  252  ? 18.634  -24.099 34.620  1.00 115.98 ? 252  LYS C NZ    1 
ATOM   5562  N  N     . ALA C 2  253  ? 17.245  -31.420 36.288  1.00 119.16 ? 253  ALA C N     1 
ATOM   5563  C  CA    . ALA C 2  253  ? 16.068  -31.916 36.997  1.00 109.53 ? 253  ALA C CA    1 
ATOM   5564  C  C     . ALA C 2  253  ? 16.456  -32.874 38.116  1.00 106.96 ? 253  ALA C C     1 
ATOM   5565  O  O     . ALA C 2  253  ? 15.899  -32.807 39.222  1.00 106.41 ? 253  ALA C O     1 
ATOM   5566  C  CB    . ALA C 2  253  ? 15.118  -32.602 36.018  1.00 111.81 ? 253  ALA C CB    1 
ATOM   5567  N  N     . VAL C 2  254  ? 17.398  -33.785 37.842  1.00 107.94 ? 254  VAL C N     1 
ATOM   5568  C  CA    . VAL C 2  254  ? 17.875  -34.697 38.881  1.00 106.93 ? 254  VAL C CA    1 
ATOM   5569  C  C     . VAL C 2  254  ? 18.454  -33.909 40.047  1.00 109.73 ? 254  VAL C C     1 
ATOM   5570  O  O     . VAL C 2  254  ? 18.142  -34.177 41.212  1.00 110.77 ? 254  VAL C O     1 
ATOM   5571  C  CB    . VAL C 2  254  ? 18.907  -35.687 38.311  1.00 106.72 ? 254  VAL C CB    1 
ATOM   5572  C  CG1   . VAL C 2  254  ? 19.516  -36.529 39.429  1.00 93.45  ? 254  VAL C CG1   1 
ATOM   5573  C  CG2   . VAL C 2  254  ? 18.271  -36.579 37.264  1.00 108.41 ? 254  VAL C CG2   1 
ATOM   5574  N  N     . ALA C 2  255  ? 19.299  -32.917 39.748  1.00 111.19 ? 255  ALA C N     1 
ATOM   5575  C  CA    . ALA C 2  255  ? 19.896  -32.103 40.801  1.00 107.64 ? 255  ALA C CA    1 
ATOM   5576  C  C     . ALA C 2  255  ? 18.826  -31.382 41.614  1.00 109.81 ? 255  ALA C C     1 
ATOM   5577  O  O     . ALA C 2  255  ? 18.875  -31.374 42.848  1.00 105.94 ? 255  ALA C O     1 
ATOM   5578  C  CB    . ALA C 2  255  ? 20.883  -31.102 40.195  1.00 98.57  ? 255  ALA C CB    1 
ATOM   5579  N  N     . TYR C 2  256  ? 17.838  -30.785 40.939  1.00 107.96 ? 256  TYR C N     1 
ATOM   5580  C  CA    . TYR C 2  256  ? 16.806  -30.041 41.654  1.00 100.20 ? 256  TYR C CA    1 
ATOM   5581  C  C     . TYR C 2  256  ? 16.011  -30.950 42.582  1.00 96.42  ? 256  TYR C C     1 
ATOM   5582  O  O     . TYR C 2  256  ? 15.859  -30.658 43.774  1.00 99.60  ? 256  TYR C O     1 
ATOM   5583  C  CB    . TYR C 2  256  ? 15.867  -29.340 40.672  1.00 100.89 ? 256  TYR C CB    1 
ATOM   5584  C  CG    . TYR C 2  256  ? 14.769  -28.564 41.368  1.00 96.08  ? 256  TYR C CG    1 
ATOM   5585  C  CD1   . TYR C 2  256  ? 15.001  -27.284 41.853  1.00 95.24  ? 256  TYR C CD1   1 
ATOM   5586  C  CD2   . TYR C 2  256  ? 13.507  -29.117 41.554  1.00 95.48  ? 256  TYR C CD2   1 
ATOM   5587  C  CE1   . TYR C 2  256  ? 14.005  -26.571 42.496  1.00 108.05 ? 256  TYR C CE1   1 
ATOM   5588  C  CE2   . TYR C 2  256  ? 12.504  -28.413 42.197  1.00 96.76  ? 256  TYR C CE2   1 
ATOM   5589  C  CZ    . TYR C 2  256  ? 12.758  -27.139 42.666  1.00 102.45 ? 256  TYR C CZ    1 
ATOM   5590  O  OH    . TYR C 2  256  ? 11.765  -26.430 43.308  1.00 78.13  ? 256  TYR C OH    1 
ATOM   5591  N  N     . VAL C 2  257  ? 15.481  -32.055 42.052  1.00 94.11  ? 257  VAL C N     1 
ATOM   5592  C  CA    . VAL C 2  257  ? 14.629  -32.908 42.874  1.00 92.06  ? 257  VAL C CA    1 
ATOM   5593  C  C     . VAL C 2  257  ? 15.442  -33.582 43.977  1.00 91.05  ? 257  VAL C C     1 
ATOM   5594  O  O     . VAL C 2  257  ? 14.970  -33.718 45.113  1.00 86.48  ? 257  VAL C O     1 
ATOM   5595  C  CB    . VAL C 2  257  ? 13.877  -33.926 41.997  1.00 91.72  ? 257  VAL C CB    1 
ATOM   5596  C  CG1   . VAL C 2  257  ? 13.677  -35.234 42.738  1.00 89.51  ? 257  VAL C CG1   1 
ATOM   5597  C  CG2   . VAL C 2  257  ? 12.528  -33.353 41.591  1.00 74.68  ? 257  VAL C CG2   1 
ATOM   5598  N  N     . TYR C 2  258  ? 16.680  -33.990 43.677  1.00 88.82  ? 258  TYR C N     1 
ATOM   5599  C  CA    . TYR C 2  258  ? 17.546  -34.553 44.707  1.00 87.31  ? 258  TYR C CA    1 
ATOM   5600  C  C     . TYR C 2  258  ? 17.809  -33.544 45.818  1.00 92.34  ? 258  TYR C C     1 
ATOM   5601  O  O     . TYR C 2  258  ? 17.800  -33.899 47.003  1.00 88.72  ? 258  TYR C O     1 
ATOM   5602  C  CB    . TYR C 2  258  ? 18.857  -35.024 44.075  1.00 83.51  ? 258  TYR C CB    1 
ATOM   5603  C  CG    . TYR C 2  258  ? 19.948  -35.394 45.059  1.00 75.28  ? 258  TYR C CG    1 
ATOM   5604  C  CD1   . TYR C 2  258  ? 20.020  -36.669 45.602  1.00 76.23  ? 258  TYR C CD1   1 
ATOM   5605  C  CD2   . TYR C 2  258  ? 20.920  -34.472 45.428  1.00 67.74  ? 258  TYR C CD2   1 
ATOM   5606  C  CE1   . TYR C 2  258  ? 21.020  -37.012 46.495  1.00 69.75  ? 258  TYR C CE1   1 
ATOM   5607  C  CE2   . TYR C 2  258  ? 21.922  -34.806 46.316  1.00 62.36  ? 258  TYR C CE2   1 
ATOM   5608  C  CZ    . TYR C 2  258  ? 21.968  -36.077 46.847  1.00 64.50  ? 258  TYR C CZ    1 
ATOM   5609  O  OH    . TYR C 2  258  ? 22.963  -36.418 47.734  1.00 61.07  ? 258  TYR C OH    1 
ATOM   5610  N  N     . GLY C 2  259  ? 18.042  -32.277 45.458  1.00 94.61  ? 259  GLY C N     1 
ATOM   5611  C  CA    . GLY C 2  259  ? 18.221  -31.250 46.467  1.00 95.65  ? 259  GLY C CA    1 
ATOM   5612  C  C     . GLY C 2  259  ? 16.959  -30.960 47.251  1.00 95.48  ? 259  GLY C C     1 
ATOM   5613  O  O     . GLY C 2  259  ? 17.027  -30.556 48.416  1.00 97.92  ? 259  GLY C O     1 
ATOM   5614  N  N     . LEU C 2  260  ? 15.795  -31.167 46.635  1.00 89.27  ? 260  LEU C N     1 
ATOM   5615  C  CA    . LEU C 2  260  ? 14.539  -30.903 47.322  1.00 88.74  ? 260  LEU C CA    1 
ATOM   5616  C  C     . LEU C 2  260  ? 14.163  -32.017 48.293  1.00 78.31  ? 260  LEU C C     1 
ATOM   5617  O  O     . LEU C 2  260  ? 13.545  -31.744 49.328  1.00 67.66  ? 260  LEU C O     1 
ATOM   5618  C  CB    . LEU C 2  260  ? 13.419  -30.698 46.301  1.00 86.24  ? 260  LEU C CB    1 
ATOM   5619  C  CG    . LEU C 2  260  ? 12.111  -30.103 46.827  1.00 81.88  ? 260  LEU C CG    1 
ATOM   5620  C  CD1   . LEU C 2  260  ? 12.291  -28.635 47.189  1.00 87.79  ? 260  LEU C CD1   1 
ATOM   5621  C  CD2   . LEU C 2  260  ? 10.992  -30.280 45.814  1.00 69.37  ? 260  LEU C CD2   1 
ATOM   5622  N  N     . ILE C 2  261  ? 14.526  -33.266 47.994  1.00 77.97  ? 261  ILE C N     1 
ATOM   5623  C  CA    . ILE C 2  261  ? 14.060  -34.403 48.785  1.00 70.56  ? 261  ILE C CA    1 
ATOM   5624  C  C     . ILE C 2  261  ? 15.212  -35.198 49.391  1.00 76.42  ? 261  ILE C C     1 
ATOM   5625  O  O     . ILE C 2  261  ? 15.233  -35.441 50.604  1.00 80.88  ? 261  ILE C O     1 
ATOM   5626  C  CB    . ILE C 2  261  ? 13.158  -35.325 47.943  1.00 65.76  ? 261  ILE C CB    1 
ATOM   5627  C  CG1   . ILE C 2  261  ? 11.697  -34.885 48.032  1.00 71.29  ? 261  ILE C CG1   1 
ATOM   5628  C  CG2   . ILE C 2  261  ? 13.265  -36.760 48.407  1.00 64.20  ? 261  ILE C CG2   1 
ATOM   5629  C  CD1   . ILE C 2  261  ? 11.368  -33.652 47.236  1.00 73.61  ? 261  ILE C CD1   1 
ATOM   5630  N  N     . ALA C 2  262  ? 16.173  -35.617 48.563  1.00 73.79  ? 262  ALA C N     1 
ATOM   5631  C  CA    . ALA C 2  262  ? 17.142  -36.625 48.976  1.00 75.42  ? 262  ALA C CA    1 
ATOM   5632  C  C     . ALA C 2  262  ? 18.482  -36.061 49.434  1.00 77.33  ? 262  ALA C C     1 
ATOM   5633  O  O     . ALA C 2  262  ? 19.304  -36.826 49.951  1.00 75.08  ? 262  ALA C O     1 
ATOM   5634  C  CB    . ALA C 2  262  ? 17.382  -37.618 47.835  1.00 85.97  ? 262  ALA C CB    1 
ATOM   5635  N  N     . ASP C 2  263  ? 18.727  -34.759 49.263  1.00 76.99  ? 263  ASP C N     1 
ATOM   5636  C  CA    . ASP C 2  263  ? 20.016  -34.166 49.611  1.00 77.94  ? 263  ASP C CA    1 
ATOM   5637  C  C     . ASP C 2  263  ? 20.089  -33.867 51.103  1.00 75.73  ? 263  ASP C C     1 
ATOM   5638  O  O     . ASP C 2  263  ? 19.430  -32.932 51.578  1.00 75.14  ? 263  ASP C O     1 
ATOM   5639  C  CB    . ASP C 2  263  ? 20.249  -32.883 48.809  1.00 82.78  ? 263  ASP C CB    1 
ATOM   5640  C  CG    . ASP C 2  263  ? 21.718  -32.492 48.728  1.00 85.97  ? 263  ASP C CG    1 
ATOM   5641  O  OD1   . ASP C 2  263  ? 22.583  -33.324 49.077  1.00 81.13  ? 263  ASP C OD1   1 
ATOM   5642  O  OD2   . ASP C 2  263  ? 22.008  -31.350 48.307  1.00 85.26  ? 263  ASP C OD2   1 
ATOM   5643  N  N     . PRO C 2  264  ? 20.888  -34.618 51.870  1.00 74.30  ? 264  PRO C N     1 
ATOM   5644  C  CA    . PRO C 2  264  ? 20.982  -34.342 53.312  1.00 79.78  ? 264  PRO C CA    1 
ATOM   5645  C  C     . PRO C 2  264  ? 21.622  -33.003 53.615  1.00 81.87  ? 264  PRO C C     1 
ATOM   5646  O  O     . PRO C 2  264  ? 21.296  -32.388 54.640  1.00 79.62  ? 264  PRO C O     1 
ATOM   5647  C  CB    . PRO C 2  264  ? 21.833  -35.507 53.834  1.00 73.47  ? 264  PRO C CB    1 
ATOM   5648  C  CG    . PRO C 2  264  ? 22.680  -35.879 52.672  1.00 72.83  ? 264  PRO C CG    1 
ATOM   5649  C  CD    . PRO C 2  264  ? 21.817  -35.682 51.454  1.00 72.85  ? 264  PRO C CD    1 
ATOM   5650  N  N     . ARG C 2  265  ? 22.520  -32.530 52.748  1.00 82.26  ? 265  ARG C N     1 
ATOM   5651  C  CA    . ARG C 2  265  ? 23.101  -31.204 52.908  1.00 84.67  ? 265  ARG C CA    1 
ATOM   5652  C  C     . ARG C 2  265  ? 22.052  -30.108 52.795  1.00 82.97  ? 265  ARG C C     1 
ATOM   5653  O  O     . ARG C 2  265  ? 22.304  -28.978 53.226  1.00 83.80  ? 265  ARG C O     1 
ATOM   5654  C  CB    . ARG C 2  265  ? 24.207  -30.992 51.866  1.00 88.54  ? 265  ARG C CB    1 
ATOM   5655  C  CG    . ARG C 2  265  ? 25.275  -32.083 51.858  1.00 93.00  ? 265  ARG C CG    1 
ATOM   5656  C  CD    . ARG C 2  265  ? 26.025  -32.147 50.526  1.00 90.47  ? 265  ARG C CD    1 
ATOM   5657  N  NE    . ARG C 2  265  ? 26.998  -31.068 50.373  1.00 95.82  ? 265  ARG C NE    1 
ATOM   5658  C  CZ    . ARG C 2  265  ? 28.279  -31.160 50.721  1.00 87.53  ? 265  ARG C CZ    1 
ATOM   5659  N  NH1   . ARG C 2  265  ? 28.749  -32.285 51.247  1.00 76.43  ? 265  ARG C NH1   1 
ATOM   5660  N  NH2   . ARG C 2  265  ? 29.091  -30.125 50.543  1.00 74.91  ? 265  ARG C NH2   1 
ATOM   5661  N  N     . ARG C 2  266  ? 20.884  -30.415 52.229  1.00 81.51  ? 266  ARG C N     1 
ATOM   5662  C  CA    . ARG C 2  266  ? 19.807  -29.444 52.078  1.00 87.00  ? 266  ARG C CA    1 
ATOM   5663  C  C     . ARG C 2  266  ? 18.568  -29.809 52.886  1.00 81.76  ? 266  ARG C C     1 
ATOM   5664  O  O     . ARG C 2  266  ? 18.084  -28.987 53.670  1.00 78.67  ? 266  ARG C O     1 
ATOM   5665  C  CB    . ARG C 2  266  ? 19.448  -29.288 50.598  1.00 85.96  ? 266  ARG C CB    1 
ATOM   5666  C  CG    . ARG C 2  266  ? 20.407  -28.418 49.814  1.00 82.63  ? 266  ARG C CG    1 
ATOM   5667  C  CD    . ARG C 2  266  ? 19.721  -27.926 48.558  1.00 96.56  ? 266  ARG C CD    1 
ATOM   5668  N  NE    . ARG C 2  266  ? 18.411  -27.366 48.879  1.00 105.52 ? 266  ARG C NE    1 
ATOM   5669  C  CZ    . ARG C 2  266  ? 17.370  -27.370 48.053  1.00 109.09 ? 266  ARG C CZ    1 
ATOM   5670  N  NH1   . ARG C 2  266  ? 16.216  -26.837 48.434  1.00 108.08 ? 266  ARG C NH1   1 
ATOM   5671  N  NH2   . ARG C 2  266  ? 17.478  -27.909 46.845  1.00 99.46  ? 266  ARG C NH2   1 
ATOM   5672  N  N     . TYR C 2  267  ? 18.026  -31.013 52.707  1.00 82.83  ? 267  TYR C N     1 
ATOM   5673  C  CA    . TYR C 2  267  ? 16.830  -31.444 53.423  1.00 78.03  ? 267  TYR C CA    1 
ATOM   5674  C  C     . TYR C 2  267  ? 17.231  -32.315 54.606  1.00 75.26  ? 267  TYR C C     1 
ATOM   5675  O  O     . TYR C 2  267  ? 17.945  -33.310 54.439  1.00 76.38  ? 267  TYR C O     1 
ATOM   5676  C  CB    . TYR C 2  267  ? 15.869  -32.204 52.511  1.00 78.02  ? 267  TYR C CB    1 
ATOM   5677  C  CG    . TYR C 2  267  ? 14.519  -32.450 53.146  1.00 70.08  ? 267  TYR C CG    1 
ATOM   5678  C  CD1   . TYR C 2  267  ? 14.302  -33.551 53.965  1.00 68.07  ? 267  TYR C CD1   1 
ATOM   5679  C  CD2   . TYR C 2  267  ? 13.465  -31.571 52.935  1.00 75.60  ? 267  TYR C CD2   1 
ATOM   5680  C  CE1   . TYR C 2  267  ? 13.070  -33.773 54.551  1.00 71.60  ? 267  TYR C CE1   1 
ATOM   5681  C  CE2   . TYR C 2  267  ? 12.229  -31.784 53.513  1.00 77.13  ? 267  TYR C CE2   1 
ATOM   5682  C  CZ    . TYR C 2  267  ? 12.034  -32.885 54.320  1.00 73.43  ? 267  TYR C CZ    1 
ATOM   5683  O  OH    . TYR C 2  267  ? 10.798  -33.091 54.894  1.00 62.58  ? 267  TYR C OH    1 
ATOM   5684  N  N     . ASP C 2  268  ? 16.765  -31.945 55.793  1.00 71.47  ? 268  ASP C N     1 
ATOM   5685  C  CA    . ASP C 2  268  ? 17.123  -32.660 57.011  1.00 68.92  ? 268  ASP C CA    1 
ATOM   5686  C  C     . ASP C 2  268  ? 15.935  -32.642 57.960  1.00 69.73  ? 268  ASP C C     1 
ATOM   5687  O  O     . ASP C 2  268  ? 15.594  -31.589 58.508  1.00 69.74  ? 268  ASP C O     1 
ATOM   5688  C  CB    . ASP C 2  268  ? 18.353  -32.034 57.672  1.00 67.84  ? 268  ASP C CB    1 
ATOM   5689  C  CG    . ASP C 2  268  ? 18.914  -32.885 58.795  1.00 65.29  ? 268  ASP C CG    1 
ATOM   5690  O  OD1   . ASP C 2  268  ? 18.701  -34.113 58.784  1.00 65.22  ? 268  ASP C OD1   1 
ATOM   5691  O  OD2   . ASP C 2  268  ? 19.577  -32.320 59.689  1.00 60.44  ? 268  ASP C OD2   1 
ATOM   5692  N  N     . LEU C 2  269  ? 15.299  -33.796 58.144  1.00 70.38  ? 269  LEU C N     1 
ATOM   5693  C  CA    . LEU C 2  269  ? 14.486  -33.994 59.333  1.00 61.88  ? 269  LEU C CA    1 
ATOM   5694  C  C     . LEU C 2  269  ? 15.403  -34.007 60.546  1.00 61.95  ? 269  LEU C C     1 
ATOM   5695  O  O     . LEU C 2  269  ? 16.572  -34.387 60.458  1.00 66.79  ? 269  LEU C O     1 
ATOM   5696  C  CB    . LEU C 2  269  ? 13.715  -35.314 59.268  1.00 58.40  ? 269  LEU C CB    1 
ATOM   5697  C  CG    . LEU C 2  269  ? 12.630  -35.534 58.214  1.00 54.82  ? 269  LEU C CG    1 
ATOM   5698  C  CD1   . LEU C 2  269  ? 12.151  -36.975 58.245  1.00 41.22  ? 269  LEU C CD1   1 
ATOM   5699  C  CD2   . LEU C 2  269  ? 11.467  -34.586 58.427  1.00 54.46  ? 269  LEU C CD2   1 
ATOM   5700  N  N     . GLY C 2  270  ? 14.879  -33.578 61.685  1.00 62.56  ? 270  GLY C N     1 
ATOM   5701  C  CA    . GLY C 2  270  ? 15.635  -33.720 62.911  1.00 69.05  ? 270  GLY C CA    1 
ATOM   5702  C  C     . GLY C 2  270  ? 15.877  -35.178 63.245  1.00 64.80  ? 270  GLY C C     1 
ATOM   5703  O  O     . GLY C 2  270  ? 15.245  -36.086 62.700  1.00 63.45  ? 270  GLY C O     1 
ATOM   5704  N  N     . GLU C 2  271  ? 16.837  -35.413 64.140  1.00 63.23  ? 271  GLU C N     1 
ATOM   5705  C  CA    . GLU C 2  271  ? 16.898  -36.722 64.773  1.00 69.75  ? 271  GLU C CA    1 
ATOM   5706  C  C     . GLU C 2  271  ? 15.578  -37.014 65.467  1.00 69.88  ? 271  GLU C C     1 
ATOM   5707  O  O     . GLU C 2  271  ? 15.052  -38.132 65.389  1.00 65.48  ? 271  GLU C O     1 
ATOM   5708  C  CB    . GLU C 2  271  ? 18.062  -36.786 65.761  1.00 71.21  ? 271  GLU C CB    1 
ATOM   5709  C  CG    . GLU C 2  271  ? 18.603  -38.189 65.978  1.00 78.78  ? 271  GLU C CG    1 
ATOM   5710  C  CD    . GLU C 2  271  ? 19.322  -38.731 64.753  1.00 97.33  ? 271  GLU C CD    1 
ATOM   5711  O  OE1   . GLU C 2  271  ? 19.747  -37.924 63.898  1.00 97.79  ? 271  GLU C OE1   1 
ATOM   5712  O  OE2   . GLU C 2  271  ? 19.465  -39.966 64.643  1.00 99.84  ? 271  GLU C OE2   1 
ATOM   5713  N  N     . ALA C 2  272  ? 15.005  -35.991 66.107  1.00 70.39  ? 272  ALA C N     1 
ATOM   5714  C  CA    . ALA C 2  272  ? 13.647  -36.084 66.629  1.00 69.46  ? 272  ALA C CA    1 
ATOM   5715  C  C     . ALA C 2  272  ? 12.631  -36.238 65.507  1.00 60.37  ? 272  ALA C C     1 
ATOM   5716  O  O     . ALA C 2  272  ? 11.664  -36.992 65.645  1.00 62.36  ? 272  ALA C O     1 
ATOM   5717  C  CB    . ALA C 2  272  ? 13.322  -34.851 67.470  1.00 68.24  ? 272  ALA C CB    1 
ATOM   5718  N  N     . GLY C 2  273  ? 12.817  -35.516 64.402  1.00 60.81  ? 273  GLY C N     1 
ATOM   5719  C  CA    . GLY C 2  273  ? 11.914  -35.675 63.273  1.00 65.63  ? 273  GLY C CA    1 
ATOM   5720  C  C     . GLY C 2  273  ? 11.932  -37.086 62.716  1.00 68.89  ? 273  GLY C C     1 
ATOM   5721  O  O     . GLY C 2  273  ? 10.883  -37.678 62.450  1.00 65.81  ? 273  GLY C O     1 
ATOM   5722  N  N     . ARG C 2  274  ? 13.132  -37.648 62.550  1.00 73.38  ? 274  ARG C N     1 
ATOM   5723  C  CA    . ARG C 2  274  ? 13.252  -39.026 62.091  1.00 70.68  ? 274  ARG C CA    1 
ATOM   5724  C  C     . ARG C 2  274  ? 12.621  -39.994 63.083  1.00 71.29  ? 274  ARG C C     1 
ATOM   5725  O  O     . ARG C 2  274  ? 11.912  -40.927 62.686  1.00 72.45  ? 274  ARG C O     1 
ATOM   5726  C  CB    . ARG C 2  274  ? 14.723  -39.370 61.865  1.00 76.92  ? 274  ARG C CB    1 
ATOM   5727  C  CG    . ARG C 2  274  ? 14.947  -40.727 61.227  1.00 86.90  ? 274  ARG C CG    1 
ATOM   5728  C  CD    . ARG C 2  274  ? 16.428  -41.030 61.075  1.00 88.04  ? 274  ARG C CD    1 
ATOM   5729  N  NE    . ARG C 2  274  ? 17.084  -41.130 62.372  1.00 88.02  ? 274  ARG C NE    1 
ATOM   5730  C  CZ    . ARG C 2  274  ? 17.112  -42.235 63.109  1.00 98.50  ? 274  ARG C CZ    1 
ATOM   5731  N  NH1   . ARG C 2  274  ? 17.729  -42.234 64.283  1.00 110.40 ? 274  ARG C NH1   1 
ATOM   5732  N  NH2   . ARG C 2  274  ? 16.522  -43.341 62.675  1.00 91.82  ? 274  ARG C NH2   1 
ATOM   5733  N  N     . TYR C 2  275  ? 12.864  -39.786 64.381  1.00 72.45  ? 275  TYR C N     1 
ATOM   5734  C  CA    . TYR C 2  275  ? 12.291  -40.666 65.395  1.00 76.93  ? 275  TYR C CA    1 
ATOM   5735  C  C     . TYR C 2  275  ? 10.767  -40.629 65.361  1.00 76.58  ? 275  TYR C C     1 
ATOM   5736  O  O     . TYR C 2  275  ? 10.109  -41.676 65.377  1.00 82.68  ? 275  TYR C O     1 
ATOM   5737  C  CB    . TYR C 2  275  ? 12.811  -40.279 66.781  1.00 77.15  ? 275  TYR C CB    1 
ATOM   5738  C  CG    . TYR C 2  275  ? 12.087  -40.963 67.922  1.00 84.69  ? 275  TYR C CG    1 
ATOM   5739  C  CD1   . TYR C 2  275  ? 12.397  -42.267 68.287  1.00 84.59  ? 275  TYR C CD1   1 
ATOM   5740  C  CD2   . TYR C 2  275  ? 11.091  -40.303 68.635  1.00 91.77  ? 275  TYR C CD2   1 
ATOM   5741  C  CE1   . TYR C 2  275  ? 11.733  -42.897 69.329  1.00 88.06  ? 275  TYR C CE1   1 
ATOM   5742  C  CE2   . TYR C 2  275  ? 10.422  -40.924 69.677  1.00 96.57  ? 275  TYR C CE2   1 
ATOM   5743  C  CZ    . TYR C 2  275  ? 10.747  -42.221 70.019  1.00 93.72  ? 275  TYR C CZ    1 
ATOM   5744  O  OH    . TYR C 2  275  ? 10.085  -42.841 71.055  1.00 83.90  ? 275  TYR C OH    1 
ATOM   5745  N  N     . LYS C 2  276  ? 10.186  -39.426 65.326  1.00 69.08  ? 276  LYS C N     1 
ATOM   5746  C  CA    . LYS C 2  276  ? 8.732   -39.303 65.320  1.00 68.05  ? 276  LYS C CA    1 
ATOM   5747  C  C     . LYS C 2  276  ? 8.131   -39.868 64.041  1.00 70.96  ? 276  LYS C C     1 
ATOM   5748  O  O     . LYS C 2  276  ? 7.062   -40.486 64.077  1.00 73.26  ? 276  LYS C O     1 
ATOM   5749  C  CB    . LYS C 2  276  ? 8.321   -37.844 65.505  1.00 65.17  ? 276  LYS C CB    1 
ATOM   5750  C  CG    . LYS C 2  276  ? 8.082   -37.449 66.951  1.00 69.51  ? 276  LYS C CG    1 
ATOM   5751  C  CD    . LYS C 2  276  ? 7.360   -36.115 67.038  1.00 60.21  ? 276  LYS C CD    1 
ATOM   5752  C  CE    . LYS C 2  276  ? 6.080   -36.131 66.212  1.00 64.91  ? 276  LYS C CE    1 
ATOM   5753  N  NZ    . LYS C 2  276  ? 5.148   -37.216 66.637  1.00 65.41  ? 276  LYS C NZ    1 
ATOM   5754  N  N     . ALA C 2  277  ? 8.800   -39.675 62.901  1.00 77.07  ? 277  ALA C N     1 
ATOM   5755  C  CA    . ALA C 2  277  ? 8.315   -40.268 61.661  1.00 76.36  ? 277  ALA C CA    1 
ATOM   5756  C  C     . ALA C 2  277  ? 8.318   -41.790 61.749  1.00 78.16  ? 277  ALA C C     1 
ATOM   5757  O  O     . ALA C 2  277  ? 7.338   -42.448 61.379  1.00 77.32  ? 277  ALA C O     1 
ATOM   5758  C  CB    . ALA C 2  277  ? 9.164   -39.788 60.483  1.00 64.96  ? 277  ALA C CB    1 
ATOM   5759  N  N     . GLU C 2  278  ? 9.414   -42.366 62.257  1.00 77.28  ? 278  GLU C N     1 
ATOM   5760  C  CA    . GLU C 2  278  ? 9.492   -43.817 62.401  1.00 78.65  ? 278  GLU C CA    1 
ATOM   5761  C  C     . GLU C 2  278  ? 8.410   -44.339 63.336  1.00 77.08  ? 278  GLU C C     1 
ATOM   5762  O  O     . GLU C 2  278  ? 7.771   -45.359 63.053  1.00 74.61  ? 278  GLU C O     1 
ATOM   5763  C  CB    . GLU C 2  278  ? 10.876  -44.224 62.914  1.00 80.79  ? 278  GLU C CB    1 
ATOM   5764  C  CG    . GLU C 2  278  ? 12.015  -44.014 61.922  1.00 86.58  ? 278  GLU C CG    1 
ATOM   5765  C  CD    . GLU C 2  278  ? 13.370  -44.402 62.493  1.00 91.42  ? 278  GLU C CD    1 
ATOM   5766  O  OE1   . GLU C 2  278  ? 13.425  -44.830 63.666  1.00 92.77  ? 278  GLU C OE1   1 
ATOM   5767  O  OE2   . GLU C 2  278  ? 14.382  -44.279 61.769  1.00 87.64  ? 278  GLU C OE2   1 
ATOM   5768  N  N     . GLU C 2  279  ? 8.187   -43.647 64.456  1.00 79.41  ? 279  GLU C N     1 
ATOM   5769  C  CA    . GLU C 2  279  ? 7.222   -44.121 65.443  1.00 76.72  ? 279  GLU C CA    1 
ATOM   5770  C  C     . GLU C 2  279  ? 5.794   -43.995 64.924  1.00 67.94  ? 279  GLU C C     1 
ATOM   5771  O  O     . GLU C 2  279  ? 4.974   -44.898 65.126  1.00 64.85  ? 279  GLU C O     1 
ATOM   5772  C  CB    . GLU C 2  279  ? 7.396   -43.347 66.751  1.00 77.76  ? 279  GLU C CB    1 
ATOM   5773  C  CG    . GLU C 2  279  ? 6.781   -44.014 67.976  1.00 103.65 ? 279  GLU C CG    1 
ATOM   5774  C  CD    . GLU C 2  279  ? 7.620   -45.166 68.511  1.00 110.18 ? 279  GLU C CD    1 
ATOM   5775  O  OE1   . GLU C 2  279  ? 7.173   -45.827 69.474  1.00 108.45 ? 279  GLU C OE1   1 
ATOM   5776  O  OE2   . GLU C 2  279  ? 8.724   -45.408 67.976  1.00 99.72  ? 279  GLU C OE2   1 
ATOM   5777  N  N     . LYS C 2  280  ? 5.481   -42.890 64.244  1.00 68.41  ? 280  LYS C N     1 
ATOM   5778  C  CA    . LYS C 2  280  ? 4.130   -42.680 63.735  1.00 63.92  ? 280  LYS C CA    1 
ATOM   5779  C  C     . LYS C 2  280  ? 3.827   -43.617 62.573  1.00 66.11  ? 280  LYS C C     1 
ATOM   5780  O  O     . LYS C 2  280  ? 2.817   -44.330 62.582  1.00 56.55  ? 280  LYS C O     1 
ATOM   5781  C  CB    . LYS C 2  280  ? 3.960   -41.220 63.310  1.00 55.50  ? 280  LYS C CB    1 
ATOM   5782  C  CG    . LYS C 2  280  ? 2.580   -40.861 62.790  1.00 49.26  ? 280  LYS C CG    1 
ATOM   5783  C  CD    . LYS C 2  280  ? 1.567   -40.773 63.916  1.00 51.74  ? 280  LYS C CD    1 
ATOM   5784  C  CE    . LYS C 2  280  ? 0.265   -40.146 63.445  1.00 53.77  ? 280  LYS C CE    1 
ATOM   5785  N  NZ    . LYS C 2  280  ? -0.774  -40.153 64.517  1.00 60.98  ? 280  LYS C NZ    1 
ATOM   5786  N  N     . LEU C 2  281  ? 4.693   -43.629 61.560  1.00 72.39  ? 281  LEU C N     1 
ATOM   5787  C  CA    . LEU C 2  281  ? 4.458   -44.435 60.372  1.00 73.44  ? 281  LEU C CA    1 
ATOM   5788  C  C     . LEU C 2  281  ? 4.852   -45.895 60.552  1.00 80.68  ? 281  LEU C C     1 
ATOM   5789  O  O     . LEU C 2  281  ? 4.609   -46.696 59.642  1.00 79.16  ? 281  LEU C O     1 
ATOM   5790  C  CB    . LEU C 2  281  ? 5.213   -43.836 59.186  1.00 70.42  ? 281  LEU C CB    1 
ATOM   5791  C  CG    . LEU C 2  281  ? 4.809   -42.400 58.851  1.00 67.86  ? 281  LEU C CG    1 
ATOM   5792  C  CD1   . LEU C 2  281  ? 5.629   -41.868 57.688  1.00 71.04  ? 281  LEU C CD1   1 
ATOM   5793  C  CD2   . LEU C 2  281  ? 3.320   -42.328 58.543  1.00 66.44  ? 281  LEU C CD2   1 
ATOM   5794  N  N     . GLY C 2  282  ? 5.443   -46.255 61.688  1.00 80.11  ? 282  GLY C N     1 
ATOM   5795  C  CA    . GLY C 2  282  ? 5.811   -47.642 61.935  1.00 80.52  ? 282  GLY C CA    1 
ATOM   5796  C  C     . GLY C 2  282  ? 6.816   -48.184 60.944  1.00 79.92  ? 282  GLY C C     1 
ATOM   5797  O  O     . GLY C 2  282  ? 6.703   -49.340 60.517  1.00 81.44  ? 282  GLY C O     1 
ATOM   5798  N  N     . ILE C 2  283  ? 7.795   -47.369 60.562  1.00 82.08  ? 283  ILE C N     1 
ATOM   5799  C  CA    . ILE C 2  283  ? 8.796   -47.731 59.574  1.00 79.79  ? 283  ILE C CA    1 
ATOM   5800  C  C     . ILE C 2  283  ? 10.176  -47.452 60.161  1.00 81.01  ? 283  ILE C C     1 
ATOM   5801  O  O     . ILE C 2  283  ? 10.313  -47.069 61.322  1.00 80.98  ? 283  ILE C O     1 
ATOM   5802  C  CB    . ILE C 2  283  ? 8.599   -46.978 58.243  1.00 67.87  ? 283  ILE C CB    1 
ATOM   5803  C  CG1   . ILE C 2  283  ? 8.792   -45.476 58.454  1.00 69.32  ? 283  ILE C CG1   1 
ATOM   5804  C  CG2   . ILE C 2  283  ? 7.220   -47.272 57.663  1.00 60.78  ? 283  ILE C CG2   1 
ATOM   5805  C  CD1   . ILE C 2  283  ? 8.587   -44.650 57.209  1.00 67.83  ? 283  ILE C CD1   1 
ATOM   5806  N  N     . ARG C 2  284  ? 11.205  -47.664 59.343  1.00 79.16  ? 284  ARG C N     1 
ATOM   5807  C  CA    . ARG C 2  284  ? 12.578  -47.367 59.725  1.00 89.05  ? 284  ARG C CA    1 
ATOM   5808  C  C     . ARG C 2  284  ? 13.217  -46.511 58.644  1.00 89.32  ? 284  ARG C C     1 
ATOM   5809  O  O     . ARG C 2  284  ? 13.141  -46.843 57.456  1.00 81.28  ? 284  ARG C O     1 
ATOM   5810  C  CB    . ARG C 2  284  ? 13.393  -48.649 59.948  1.00 90.60  ? 284  ARG C CB    1 
ATOM   5811  C  CG    . ARG C 2  284  ? 14.840  -48.405 60.374  1.00 99.49  ? 284  ARG C CG    1 
ATOM   5812  C  CD    . ARG C 2  284  ? 14.934  -47.528 61.619  1.00 94.53  ? 284  ARG C CD    1 
ATOM   5813  N  NE    . ARG C 2  284  ? 14.213  -48.102 62.753  1.00 106.57 ? 284  ARG C NE    1 
ATOM   5814  C  CZ    . ARG C 2  284  ? 14.759  -48.905 63.661  1.00 118.01 ? 284  ARG C CZ    1 
ATOM   5815  N  NH1   . ARG C 2  284  ? 14.023  -49.380 64.658  1.00 121.51 ? 284  ARG C NH1   1 
ATOM   5816  N  NH2   . ARG C 2  284  ? 16.041  -49.233 63.574  1.00 110.44 ? 284  ARG C NH2   1 
ATOM   5817  N  N     . LEU C 2  285  ? 13.836  -45.410 59.059  1.00 96.63  ? 285  LEU C N     1 
ATOM   5818  C  CA    . LEU C 2  285  ? 14.503  -44.482 58.156  1.00 95.71  ? 285  LEU C CA    1 
ATOM   5819  C  C     . LEU C 2  285  ? 16.005  -44.733 58.178  1.00 98.27  ? 285  LEU C C     1 
ATOM   5820  O  O     . LEU C 2  285  ? 16.627  -44.720 59.247  1.00 91.37  ? 285  LEU C O     1 
ATOM   5821  C  CB    . LEU C 2  285  ? 14.207  -43.035 58.552  1.00 94.97  ? 285  LEU C CB    1 
ATOM   5822  C  CG    . LEU C 2  285  ? 13.159  -42.268 57.750  1.00 94.31  ? 285  LEU C CG    1 
ATOM   5823  C  CD1   . LEU C 2  285  ? 13.666  -42.005 56.339  1.00 97.94  ? 285  LEU C CD1   1 
ATOM   5824  C  CD2   . LEU C 2  285  ? 11.839  -43.023 57.720  1.00 85.50  ? 285  LEU C CD2   1 
ATOM   5825  N  N     . SER C 2  286  ? 16.584  -44.966 56.998  1.00 101.87 ? 286  SER C N     1 
ATOM   5826  C  CA    . SER C 2  286  ? 18.034  -45.094 56.898  1.00 100.51 ? 286  SER C CA    1 
ATOM   5827  C  C     . SER C 2  286  ? 18.710  -43.757 57.180  1.00 98.81  ? 286  SER C C     1 
ATOM   5828  O  O     . SER C 2  286  ? 19.555  -43.648 58.077  1.00 97.76  ? 286  SER C O     1 
ATOM   5829  C  CB    . SER C 2  286  ? 18.423  -45.626 55.515  1.00 102.17 ? 286  SER C CB    1 
ATOM   5830  O  OG    . SER C 2  286  ? 18.083  -44.701 54.497  1.00 102.69 ? 286  SER C OG    1 
ATOM   5831  N  N     . GLY C 2  287  ? 18.344  -42.724 56.420  1.00 102.83 ? 287  GLY C N     1 
ATOM   5832  C  CA    . GLY C 2  287  ? 18.799  -41.376 56.657  1.00 96.69  ? 287  GLY C CA    1 
ATOM   5833  C  C     . GLY C 2  287  ? 17.703  -40.488 57.216  1.00 85.50  ? 287  GLY C C     1 
ATOM   5834  O  O     . GLY C 2  287  ? 16.639  -40.946 57.637  1.00 81.45  ? 287  GLY C O     1 
ATOM   5835  N  N     . ARG C 2  288  ? 17.983  -39.188 57.212  1.00 79.67  ? 288  ARG C N     1 
ATOM   5836  C  CA    . ARG C 2  288  ? 17.041  -38.193 57.701  1.00 70.51  ? 288  ARG C CA    1 
ATOM   5837  C  C     . ARG C 2  288  ? 16.325  -37.461 56.576  1.00 72.01  ? 288  ARG C C     1 
ATOM   5838  O  O     . ARG C 2  288  ? 15.680  -36.439 56.827  1.00 75.08  ? 288  ARG C O     1 
ATOM   5839  C  CB    . ARG C 2  288  ? 17.755  -37.195 58.611  1.00 63.37  ? 288  ARG C CB    1 
ATOM   5840  C  CG    . ARG C 2  288  ? 18.343  -37.819 59.864  1.00 64.37  ? 288  ARG C CG    1 
ATOM   5841  C  CD    . ARG C 2  288  ? 18.687  -36.758 60.891  1.00 67.09  ? 288  ARG C CD    1 
ATOM   5842  N  NE    . ARG C 2  288  ? 19.886  -36.004 60.541  1.00 58.45  ? 288  ARG C NE    1 
ATOM   5843  C  CZ    . ARG C 2  288  ? 21.026  -36.067 61.221  1.00 65.83  ? 288  ARG C CZ    1 
ATOM   5844  N  NH1   . ARG C 2  288  ? 21.118  -36.844 62.291  1.00 62.30  ? 288  ARG C NH1   1 
ATOM   5845  N  NH2   . ARG C 2  288  ? 22.073  -35.350 60.837  1.00 82.25  ? 288  ARG C NH2   1 
ATOM   5846  N  N     . THR C 2  289  ? 16.430  -37.953 55.346  1.00 77.43  ? 289  THR C N     1 
ATOM   5847  C  CA    . THR C 2  289  ? 15.745  -37.360 54.211  1.00 82.64  ? 289  THR C CA    1 
ATOM   5848  C  C     . THR C 2  289  ? 14.472  -38.144 53.895  1.00 77.93  ? 289  THR C C     1 
ATOM   5849  O  O     . THR C 2  289  ? 14.178  -39.180 54.498  1.00 72.14  ? 289  THR C O     1 
ATOM   5850  C  CB    . THR C 2  289  ? 16.671  -37.308 52.995  1.00 87.04  ? 289  THR C CB    1 
ATOM   5851  O  OG1   . THR C 2  289  ? 17.065  -38.638 52.632  1.00 90.39  ? 289  THR C OG1   1 
ATOM   5852  C  CG2   . THR C 2  289  ? 17.910  -36.481 53.297  1.00 84.70  ? 289  THR C CG2   1 
ATOM   5853  N  N     . LEU C 2  290  ? 13.710  -37.640 52.922  1.00 77.62  ? 290  LEU C N     1 
ATOM   5854  C  CA    . LEU C 2  290  ? 12.482  -38.301 52.495  1.00 73.75  ? 290  LEU C CA    1 
ATOM   5855  C  C     . LEU C 2  290  ? 12.728  -39.409 51.478  1.00 81.32  ? 290  LEU C C     1 
ATOM   5856  O  O     . LEU C 2  290  ? 11.882  -40.300 51.336  1.00 75.97  ? 290  LEU C O     1 
ATOM   5857  C  CB    . LEU C 2  290  ? 11.508  -37.276 51.906  1.00 72.51  ? 290  LEU C CB    1 
ATOM   5858  C  CG    . LEU C 2  290  ? 11.107  -36.094 52.793  1.00 78.29  ? 290  LEU C CG    1 
ATOM   5859  C  CD1   . LEU C 2  290  ? 9.982   -35.297 52.147  1.00 68.04  ? 290  LEU C CD1   1 
ATOM   5860  C  CD2   . LEU C 2  290  ? 10.712  -36.556 54.194  1.00 66.43  ? 290  LEU C CD2   1 
ATOM   5861  N  N     . ALA C 2  291  ? 13.851  -39.369 50.766  1.00 94.91  ? 291  ALA C N     1 
ATOM   5862  C  CA    . ALA C 2  291  ? 14.213  -40.406 49.807  1.00 92.13  ? 291  ALA C CA    1 
ATOM   5863  C  C     . ALA C 2  291  ? 15.725  -40.377 49.627  1.00 95.04  ? 291  ALA C C     1 
ATOM   5864  O  O     . ALA C 2  291  ? 16.431  -39.575 50.246  1.00 91.47  ? 291  ALA C O     1 
ATOM   5865  C  CB    . ALA C 2  291  ? 13.483  -40.218 48.474  1.00 82.90  ? 291  ALA C CB    1 
ATOM   5866  N  N     . ARG C 2  292  ? 16.221  -41.265 48.766  1.00 102.50 ? 292  ARG C N     1 
ATOM   5867  C  CA    . ARG C 2  292  ? 17.650  -41.410 48.533  1.00 101.66 ? 292  ARG C CA    1 
ATOM   5868  C  C     . ARG C 2  292  ? 17.941  -41.431 47.039  1.00 103.92 ? 292  ARG C C     1 
ATOM   5869  O  O     . ARG C 2  292  ? 17.059  -41.682 46.215  1.00 97.20  ? 292  ARG C O     1 
ATOM   5870  C  CB    . ARG C 2  292  ? 18.203  -42.693 49.165  1.00 91.68  ? 292  ARG C CB    1 
ATOM   5871  C  CG    . ARG C 2  292  ? 17.894  -42.859 50.636  1.00 98.21  ? 292  ARG C CG    1 
ATOM   5872  C  CD    . ARG C 2  292  ? 18.259  -44.253 51.093  1.00 101.71 ? 292  ARG C CD    1 
ATOM   5873  N  NE    . ARG C 2  292  ? 17.590  -45.265 50.283  1.00 104.34 ? 292  ARG C NE    1 
ATOM   5874  C  CZ    . ARG C 2  292  ? 17.754  -46.573 50.439  1.00 110.38 ? 292  ARG C CZ    1 
ATOM   5875  N  NH1   . ARG C 2  292  ? 18.571  -47.033 51.378  1.00 108.12 ? 292  ARG C NH1   1 
ATOM   5876  N  NH2   . ARG C 2  292  ? 17.102  -47.422 49.656  1.00 110.50 ? 292  ARG C NH2   1 
ATOM   5877  N  N     . PHE C 2  293  ? 19.204  -41.178 46.704  1.00 106.88 ? 293  PHE C N     1 
ATOM   5878  C  CA    . PHE C 2  293  ? 19.730  -41.384 45.359  1.00 106.18 ? 293  PHE C CA    1 
ATOM   5879  C  C     . PHE C 2  293  ? 20.690  -42.563 45.437  1.00 107.58 ? 293  PHE C C     1 
ATOM   5880  O  O     . PHE C 2  293  ? 21.789  -42.441 45.992  1.00 94.57  ? 293  PHE C O     1 
ATOM   5881  C  CB    . PHE C 2  293  ? 20.424  -40.130 44.832  1.00 101.39 ? 293  PHE C CB    1 
ATOM   5882  C  CG    . PHE C 2  293  ? 20.791  -40.204 43.373  1.00 105.62 ? 293  PHE C CG    1 
ATOM   5883  C  CD1   . PHE C 2  293  ? 19.883  -39.828 42.397  1.00 105.54 ? 293  PHE C CD1   1 
ATOM   5884  C  CD2   . PHE C 2  293  ? 22.046  -40.642 42.980  1.00 101.56 ? 293  PHE C CD2   1 
ATOM   5885  C  CE1   . PHE C 2  293  ? 20.216  -39.890 41.058  1.00 102.86 ? 293  PHE C CE1   1 
ATOM   5886  C  CE2   . PHE C 2  293  ? 22.386  -40.709 41.642  1.00 95.14  ? 293  PHE C CE2   1 
ATOM   5887  C  CZ    . PHE C 2  293  ? 21.469  -40.330 40.680  1.00 104.96 ? 293  PHE C CZ    1 
ATOM   5888  N  N     . GLU C 2  294  ? 20.267  -43.707 44.903  1.00 108.11 ? 294  GLU C N     1 
ATOM   5889  C  CA    . GLU C 2  294  ? 21.022  -44.947 44.986  1.00 111.14 ? 294  GLU C CA    1 
ATOM   5890  C  C     . GLU C 2  294  ? 21.062  -45.588 43.607  1.00 120.16 ? 294  GLU C C     1 
ATOM   5891  O  O     . GLU C 2  294  ? 20.024  -45.707 42.944  1.00 120.56 ? 294  GLU C O     1 
ATOM   5892  C  CB    . GLU C 2  294  ? 20.391  -45.898 46.010  1.00 108.91 ? 294  GLU C CB    1 
ATOM   5893  C  CG    . GLU C 2  294  ? 21.250  -47.088 46.388  1.00 108.61 ? 294  GLU C CG    1 
ATOM   5894  C  CD    . GLU C 2  294  ? 20.618  -47.926 47.481  1.00 105.97 ? 294  GLU C CD    1 
ATOM   5895  O  OE1   . GLU C 2  294  ? 20.741  -49.168 47.430  1.00 103.30 ? 294  GLU C OE1   1 
ATOM   5896  O  OE2   . GLU C 2  294  ? 19.989  -47.342 48.387  1.00 103.24 ? 294  GLU C OE2   1 
ATOM   5897  N  N     . ASP C 2  295  ? 22.265  -45.979 43.177  1.00 116.09 ? 295  ASP C N     1 
ATOM   5898  C  CA    . ASP C 2  295  ? 22.491  -46.618 41.878  1.00 108.02 ? 295  ASP C CA    1 
ATOM   5899  C  C     . ASP C 2  295  ? 21.808  -45.851 40.748  1.00 106.88 ? 295  ASP C C     1 
ATOM   5900  O  O     . ASP C 2  295  ? 21.178  -46.433 39.862  1.00 107.77 ? 295  ASP C O     1 
ATOM   5901  C  CB    . ASP C 2  295  ? 22.042  -48.080 41.895  1.00 108.90 ? 295  ASP C CB    1 
ATOM   5902  C  CG    . ASP C 2  295  ? 22.722  -48.884 42.986  1.00 105.25 ? 295  ASP C CG    1 
ATOM   5903  O  OD1   . ASP C 2  295  ? 23.955  -48.757 43.139  1.00 102.63 ? 295  ASP C OD1   1 
ATOM   5904  O  OD2   . ASP C 2  295  ? 22.019  -49.627 43.704  1.00 106.99 ? 295  ASP C OD2   1 
ATOM   5905  N  N     . GLY C 2  296  ? 21.924  -44.525 40.788  1.00 101.75 ? 296  GLY C N     1 
ATOM   5906  C  CA    . GLY C 2  296  ? 21.401  -43.684 39.736  1.00 110.41 ? 296  GLY C CA    1 
ATOM   5907  C  C     . GLY C 2  296  ? 19.910  -43.423 39.776  1.00 113.30 ? 296  GLY C C     1 
ATOM   5908  O  O     . GLY C 2  296  ? 19.419  -42.641 38.953  1.00 116.39 ? 296  GLY C O     1 
ATOM   5909  N  N     . GLU C 2  297  ? 19.169  -44.038 40.694  1.00 114.32 ? 297  GLU C N     1 
ATOM   5910  C  CA    . GLU C 2  297  ? 17.726  -43.852 40.747  1.00 115.03 ? 297  GLU C CA    1 
ATOM   5911  C  C     . GLU C 2  297  ? 17.297  -43.434 42.147  1.00 115.19 ? 297  GLU C C     1 
ATOM   5912  O  O     . GLU C 2  297  ? 17.995  -43.669 43.136  1.00 109.93 ? 297  GLU C O     1 
ATOM   5913  C  CB    . GLU C 2  297  ? 16.978  -45.126 40.324  1.00 117.18 ? 297  GLU C CB    1 
ATOM   5914  C  CG    . GLU C 2  297  ? 17.296  -46.352 41.163  1.00 120.52 ? 297  GLU C CG    1 
ATOM   5915  C  CD    . GLU C 2  297  ? 16.497  -47.571 40.740  1.00 124.13 ? 297  GLU C CD    1 
ATOM   5916  O  OE1   . GLU C 2  297  ? 16.402  -48.527 41.538  1.00 129.92 ? 297  GLU C OE1   1 
ATOM   5917  O  OE2   . GLU C 2  297  ? 15.960  -47.571 39.611  1.00 115.99 ? 297  GLU C OE2   1 
ATOM   5918  N  N     . PHE C 2  298  ? 16.128  -42.804 42.217  1.00 115.31 ? 298  PHE C N     1 
ATOM   5919  C  CA    . PHE C 2  298  ? 15.574  -42.369 43.491  1.00 102.08 ? 298  PHE C CA    1 
ATOM   5920  C  C     . PHE C 2  298  ? 14.859  -43.523 44.183  1.00 100.30 ? 298  PHE C C     1 
ATOM   5921  O  O     . PHE C 2  298  ? 14.096  -44.267 43.559  1.00 104.77 ? 298  PHE C O     1 
ATOM   5922  C  CB    . PHE C 2  298  ? 14.612  -41.201 43.279  1.00 96.40  ? 298  PHE C CB    1 
ATOM   5923  C  CG    . PHE C 2  298  ? 15.295  -39.908 42.935  1.00 93.54  ? 298  PHE C CG    1 
ATOM   5924  C  CD1   . PHE C 2  298  ? 16.394  -39.473 43.658  1.00 96.41  ? 298  PHE C CD1   1 
ATOM   5925  C  CD2   . PHE C 2  298  ? 14.828  -39.120 41.896  1.00 90.30  ? 298  PHE C CD2   1 
ATOM   5926  C  CE1   . PHE C 2  298  ? 17.019  -38.278 43.347  1.00 95.57  ? 298  PHE C CE1   1 
ATOM   5927  C  CE2   . PHE C 2  298  ? 15.451  -37.929 41.577  1.00 92.57  ? 298  PHE C CE2   1 
ATOM   5928  C  CZ    . PHE C 2  298  ? 16.546  -37.505 42.304  1.00 93.99  ? 298  PHE C CZ    1 
ATOM   5929  N  N     . LYS C 2  299  ? 15.107  -43.663 45.482  1.00 100.54 ? 299  LYS C N     1 
ATOM   5930  C  CA    . LYS C 2  299  ? 14.572  -44.755 46.285  1.00 108.76 ? 299  LYS C CA    1 
ATOM   5931  C  C     . LYS C 2  299  ? 13.756  -44.179 47.435  1.00 103.08 ? 299  LYS C C     1 
ATOM   5932  O  O     . LYS C 2  299  ? 14.229  -43.290 48.152  1.00 102.18 ? 299  LYS C O     1 
ATOM   5933  C  CB    . LYS C 2  299  ? 15.703  -45.645 46.808  1.00 112.92 ? 299  LYS C CB    1 
ATOM   5934  C  CG    . LYS C 2  299  ? 15.388  -47.130 46.779  1.00 118.51 ? 299  LYS C CG    1 
ATOM   5935  C  CD    . LYS C 2  299  ? 16.615  -47.940 46.394  1.00 114.86 ? 299  LYS C CD    1 
ATOM   5936  C  CE    . LYS C 2  299  ? 17.107  -47.560 45.003  1.00 110.72 ? 299  LYS C CE    1 
ATOM   5937  N  NZ    . LYS C 2  299  ? 18.288  -48.362 44.585  1.00 102.95 ? 299  LYS C NZ    1 
ATOM   5938  N  N     . ASP C 2  300  ? 12.541  -44.697 47.614  1.00 99.57  ? 300  ASP C N     1 
ATOM   5939  C  CA    . ASP C 2  300  ? 11.571  -44.101 48.524  1.00 94.17  ? 300  ASP C CA    1 
ATOM   5940  C  C     . ASP C 2  300  ? 11.855  -44.468 49.976  1.00 97.24  ? 300  ASP C C     1 
ATOM   5941  O  O     . ASP C 2  300  ? 12.251  -45.598 50.285  1.00 106.00 ? 300  ASP C O     1 
ATOM   5942  C  CB    . ASP C 2  300  ? 10.156  -44.539 48.143  1.00 92.18  ? 300  ASP C CB    1 
ATOM   5943  C  CG    . ASP C 2  300  ? 9.078   -43.731 48.844  1.00 89.24  ? 300  ASP C CG    1 
ATOM   5944  O  OD1   . ASP C 2  300  ? 9.081   -43.661 50.091  1.00 86.39  ? 300  ASP C OD1   1 
ATOM   5945  O  OD2   . ASP C 2  300  ? 8.221   -43.161 48.140  1.00 92.21  ? 300  ASP C OD2   1 
ATOM   5946  N  N     . GLU C 2  301  ? 11.656  -43.494 50.869  1.00 90.65  ? 301  GLU C N     1 
ATOM   5947  C  CA    . GLU C 2  301  ? 11.728  -43.718 52.309  1.00 84.50  ? 301  GLU C CA    1 
ATOM   5948  C  C     . GLU C 2  301  ? 10.430  -43.388 53.029  1.00 85.34  ? 301  GLU C C     1 
ATOM   5949  O  O     . GLU C 2  301  ? 9.915   -44.224 53.780  1.00 83.05  ? 301  GLU C O     1 
ATOM   5950  C  CB    . GLU C 2  301  ? 12.872  -42.890 52.913  1.00 82.74  ? 301  GLU C CB    1 
ATOM   5951  C  CG    . GLU C 2  301  ? 14.267  -43.349 52.549  1.00 89.12  ? 301  GLU C CG    1 
ATOM   5952  C  CD    . GLU C 2  301  ? 14.861  -44.291 53.577  1.00 97.33  ? 301  GLU C CD    1 
ATOM   5953  O  OE1   . GLU C 2  301  ? 14.119  -44.774 54.459  1.00 97.45  ? 301  GLU C OE1   1 
ATOM   5954  O  OE2   . GLU C 2  301  ? 16.079  -44.547 53.505  1.00 100.60 ? 301  GLU C OE2   1 
ATOM   5955  N  N     . VAL C 2  302  ? 9.885   -42.194 52.820  1.00 84.21  ? 302  VAL C N     1 
ATOM   5956  C  CA    . VAL C 2  302  ? 8.819   -41.663 53.661  1.00 70.51  ? 302  VAL C CA    1 
ATOM   5957  C  C     . VAL C 2  302  ? 7.474   -41.656 52.943  1.00 71.30  ? 302  VAL C C     1 
ATOM   5958  O  O     . VAL C 2  302  ? 6.451   -41.996 53.539  1.00 75.82  ? 302  VAL C O     1 
ATOM   5959  C  CB    . VAL C 2  302  ? 9.186   -40.245 54.159  1.00 62.46  ? 302  VAL C CB    1 
ATOM   5960  C  CG1   . VAL C 2  302  ? 7.973   -39.540 54.720  1.00 53.45  ? 302  VAL C CG1   1 
ATOM   5961  C  CG2   . VAL C 2  302  ? 10.283  -40.317 55.208  1.00 64.65  ? 302  VAL C CG2   1 
ATOM   5962  N  N     . PHE C 2  303  ? 7.459   -41.271 51.662  1.00 71.71  ? 303  PHE C N     1 
ATOM   5963  C  CA    . PHE C 2  303  ? 6.214   -40.864 51.006  1.00 72.97  ? 303  PHE C CA    1 
ATOM   5964  C  C     . PHE C 2  303  ? 5.150   -41.956 51.046  1.00 76.71  ? 303  PHE C C     1 
ATOM   5965  O  O     . PHE C 2  303  ? 3.988   -41.689 51.377  1.00 73.42  ? 303  PHE C O     1 
ATOM   5966  C  CB    . PHE C 2  303  ? 6.494   -40.445 49.565  1.00 70.31  ? 303  PHE C CB    1 
ATOM   5967  C  CG    . PHE C 2  303  ? 7.132   -39.095 49.450  1.00 71.74  ? 303  PHE C CG    1 
ATOM   5968  C  CD1   . PHE C 2  303  ? 8.508   -38.962 49.502  1.00 66.07  ? 303  PHE C CD1   1 
ATOM   5969  C  CD2   . PHE C 2  303  ? 6.357   -37.957 49.290  1.00 69.20  ? 303  PHE C CD2   1 
ATOM   5970  C  CE1   . PHE C 2  303  ? 9.101   -37.724 49.395  1.00 60.96  ? 303  PHE C CE1   1 
ATOM   5971  C  CE2   . PHE C 2  303  ? 6.946   -36.711 49.183  1.00 67.61  ? 303  PHE C CE2   1 
ATOM   5972  C  CZ    . PHE C 2  303  ? 8.322   -36.596 49.233  1.00 62.11  ? 303  PHE C CZ    1 
ATOM   5973  N  N     . LEU C 2  304  ? 5.515   -43.189 50.680  1.00 79.26  ? 304  LEU C N     1 
ATOM   5974  C  CA    . LEU C 2  304  ? 4.502   -44.240 50.599  1.00 80.75  ? 304  LEU C CA    1 
ATOM   5975  C  C     . LEU C 2  304  ? 3.909   -44.575 51.961  1.00 72.70  ? 304  LEU C C     1 
ATOM   5976  O  O     . LEU C 2  304  ? 2.676   -44.703 52.053  1.00 69.77  ? 304  LEU C O     1 
ATOM   5977  C  CB    . LEU C 2  304  ? 5.076   -45.479 49.903  1.00 84.26  ? 304  LEU C CB    1 
ATOM   5978  C  CG    . LEU C 2  304  ? 4.114   -46.669 49.761  1.00 78.94  ? 304  LEU C CG    1 
ATOM   5979  C  CD1   . LEU C 2  304  ? 2.951   -46.341 48.829  1.00 75.06  ? 304  LEU C CD1   1 
ATOM   5980  C  CD2   . LEU C 2  304  ? 4.843   -47.920 49.295  1.00 71.17  ? 304  LEU C CD2   1 
ATOM   5981  N  N     . PRO C 2  305  ? 4.692   -44.759 53.036  1.00 71.30  ? 305  PRO C N     1 
ATOM   5982  C  CA    . PRO C 2  305  ? 4.058   -44.925 54.357  1.00 74.46  ? 305  PRO C CA    1 
ATOM   5983  C  C     . PRO C 2  305  ? 3.181   -43.751 54.755  1.00 71.31  ? 305  PRO C C     1 
ATOM   5984  O  O     . PRO C 2  305  ? 2.136   -43.950 55.387  1.00 73.59  ? 305  PRO C O     1 
ATOM   5985  C  CB    . PRO C 2  305  ? 5.258   -45.091 55.296  1.00 68.37  ? 305  PRO C CB    1 
ATOM   5986  C  CG    . PRO C 2  305  ? 6.303   -45.696 54.442  1.00 65.76  ? 305  PRO C CG    1 
ATOM   5987  C  CD    . PRO C 2  305  ? 6.136   -45.062 53.093  1.00 68.40  ? 305  PRO C CD    1 
ATOM   5988  N  N     . THR C 2  306  ? 3.573   -42.528 54.394  1.00 69.51  ? 306  THR C N     1 
ATOM   5989  C  CA    . THR C 2  306  ? 2.756   -41.362 54.715  1.00 67.40  ? 306  THR C CA    1 
ATOM   5990  C  C     . THR C 2  306  ? 1.407   -41.430 54.011  1.00 68.02  ? 306  THR C C     1 
ATOM   5991  O  O     . THR C 2  306  ? 0.360   -41.194 54.624  1.00 71.22  ? 306  THR C O     1 
ATOM   5992  C  CB    . THR C 2  306  ? 3.498   -40.081 54.333  1.00 67.04  ? 306  THR C CB    1 
ATOM   5993  O  OG1   . THR C 2  306  ? 4.716   -39.995 55.081  1.00 71.40  ? 306  THR C OG1   1 
ATOM   5994  C  CG2   . THR C 2  306  ? 2.643   -38.860 54.630  1.00 63.78  ? 306  THR C CG2   1 
ATOM   5995  N  N     . LEU C 2  307  ? 1.414   -41.759 52.719  1.00 72.49  ? 307  LEU C N     1 
ATOM   5996  C  CA    . LEU C 2  307  ? 0.163   -41.850 51.972  1.00 72.87  ? 307  LEU C CA    1 
ATOM   5997  C  C     . LEU C 2  307  ? -0.687  -43.018 52.458  1.00 66.96  ? 307  LEU C C     1 
ATOM   5998  O  O     . LEU C 2  307  ? -1.921  -42.930 52.488  1.00 67.34  ? 307  LEU C O     1 
ATOM   5999  C  CB    . LEU C 2  307  ? 0.463   -41.977 50.480  1.00 69.73  ? 307  LEU C CB    1 
ATOM   6000  C  CG    . LEU C 2  307  ? -0.726  -42.061 49.529  1.00 71.81  ? 307  LEU C CG    1 
ATOM   6001  C  CD1   . LEU C 2  307  ? -1.646  -40.862 49.698  1.00 66.57  ? 307  LEU C CD1   1 
ATOM   6002  C  CD2   . LEU C 2  307  ? -0.211  -42.149 48.115  1.00 72.33  ? 307  LEU C CD2   1 
ATOM   6003  N  N     . ARG C 2  308  ? -0.040  -44.118 52.848  1.00 64.31  ? 308  ARG C N     1 
ATOM   6004  C  CA    . ARG C 2  308  ? -0.760  -45.249 53.422  1.00 66.42  ? 308  ARG C CA    1 
ATOM   6005  C  C     . ARG C 2  308  ? -1.473  -44.837 54.706  1.00 67.76  ? 308  ARG C C     1 
ATOM   6006  O  O     . ARG C 2  308  ? -2.662  -45.121 54.892  1.00 62.83  ? 308  ARG C O     1 
ATOM   6007  C  CB    . ARG C 2  308  ? 0.224   -46.396 53.671  1.00 60.67  ? 308  ARG C CB    1 
ATOM   6008  C  CG    . ARG C 2  308  ? -0.382  -47.783 53.753  1.00 59.02  ? 308  ARG C CG    1 
ATOM   6009  C  CD    . ARG C 2  308  ? -0.873  -48.077 55.151  1.00 71.08  ? 308  ARG C CD    1 
ATOM   6010  N  NE    . ARG C 2  308  ? -0.008  -47.478 56.163  1.00 77.78  ? 308  ARG C NE    1 
ATOM   6011  C  CZ    . ARG C 2  308  ? -0.255  -47.521 57.467  1.00 78.14  ? 308  ARG C CZ    1 
ATOM   6012  N  NH1   . ARG C 2  308  ? -1.340  -48.140 57.909  1.00 71.99  ? 308  ARG C NH1   1 
ATOM   6013  N  NH2   . ARG C 2  308  ? 0.580   -46.948 58.325  1.00 77.95  ? 308  ARG C NH2   1 
ATOM   6014  N  N     . TYR C 2  309  ? -0.756  -44.149 55.600  1.00 71.87  ? 309  TYR C N     1 
ATOM   6015  C  CA    . TYR C 2  309  ? -1.364  -43.661 56.833  1.00 60.63  ? 309  TYR C CA    1 
ATOM   6016  C  C     . TYR C 2  309  ? -2.483  -42.669 56.539  1.00 62.05  ? 309  TYR C C     1 
ATOM   6017  O  O     . TYR C 2  309  ? -3.499  -42.646 57.242  1.00 64.77  ? 309  TYR C O     1 
ATOM   6018  C  CB    . TYR C 2  309  ? -0.297  -43.023 57.725  1.00 53.27  ? 309  TYR C CB    1 
ATOM   6019  C  CG    . TYR C 2  309  ? -0.685  -42.911 59.186  1.00 62.66  ? 309  TYR C CG    1 
ATOM   6020  C  CD1   . TYR C 2  309  ? -1.607  -41.962 59.616  1.00 61.16  ? 309  TYR C CD1   1 
ATOM   6021  C  CD2   . TYR C 2  309  ? -0.129  -43.757 60.137  1.00 62.18  ? 309  TYR C CD2   1 
ATOM   6022  C  CE1   . TYR C 2  309  ? -1.962  -41.859 60.949  1.00 50.54  ? 309  TYR C CE1   1 
ATOM   6023  C  CE2   . TYR C 2  309  ? -0.479  -43.659 61.471  1.00 57.41  ? 309  TYR C CE2   1 
ATOM   6024  C  CZ    . TYR C 2  309  ? -1.395  -42.710 61.870  1.00 50.53  ? 309  TYR C CZ    1 
ATOM   6025  O  OH    . TYR C 2  309  ? -1.743  -42.616 63.198  1.00 55.79  ? 309  TYR C OH    1 
ATOM   6026  N  N     . LEU C 2  310  ? -2.320  -41.844 55.501  1.00 60.24  ? 310  LEU C N     1 
ATOM   6027  C  CA    . LEU C 2  310  ? -3.361  -40.877 55.160  1.00 60.65  ? 310  LEU C CA    1 
ATOM   6028  C  C     . LEU C 2  310  ? -4.634  -41.579 54.707  1.00 68.45  ? 310  LEU C C     1 
ATOM   6029  O  O     . LEU C 2  310  ? -5.733  -41.263 55.182  1.00 72.53  ? 310  LEU C O     1 
ATOM   6030  C  CB    . LEU C 2  310  ? -2.864  -39.918 54.077  1.00 57.54  ? 310  LEU C CB    1 
ATOM   6031  C  CG    . LEU C 2  310  ? -3.912  -38.946 53.519  1.00 58.10  ? 310  LEU C CG    1 
ATOM   6032  C  CD1   . LEU C 2  310  ? -4.502  -38.084 54.622  1.00 60.09  ? 310  LEU C CD1   1 
ATOM   6033  C  CD2   . LEU C 2  310  ? -3.329  -38.075 52.412  1.00 66.00  ? 310  LEU C CD2   1 
ATOM   6034  N  N     . PHE C 2  311  ? -4.504  -42.538 53.787  1.00 69.22  ? 311  PHE C N     1 
ATOM   6035  C  CA    . PHE C 2  311  ? -5.677  -43.279 53.329  1.00 76.10  ? 311  PHE C CA    1 
ATOM   6036  C  C     . PHE C 2  311  ? -6.312  -44.060 54.474  1.00 79.40  ? 311  PHE C C     1 
ATOM   6037  O  O     . PHE C 2  311  ? -7.543  -44.165 54.557  1.00 79.23  ? 311  PHE C O     1 
ATOM   6038  C  CB    . PHE C 2  311  ? -5.300  -44.215 52.178  1.00 81.80  ? 311  PHE C CB    1 
ATOM   6039  C  CG    . PHE C 2  311  ? -5.102  -43.511 50.860  1.00 88.94  ? 311  PHE C CG    1 
ATOM   6040  C  CD1   . PHE C 2  311  ? -5.580  -42.224 50.664  1.00 89.18  ? 311  PHE C CD1   1 
ATOM   6041  C  CD2   . PHE C 2  311  ? -4.445  -44.141 49.814  1.00 87.33  ? 311  PHE C CD2   1 
ATOM   6042  C  CE1   . PHE C 2  311  ? -5.401  -41.576 49.455  1.00 86.96  ? 311  PHE C CE1   1 
ATOM   6043  C  CE2   . PHE C 2  311  ? -4.264  -43.498 48.602  1.00 90.40  ? 311  PHE C CE2   1 
ATOM   6044  C  CZ    . PHE C 2  311  ? -4.742  -42.214 48.423  1.00 92.44  ? 311  PHE C CZ    1 
ATOM   6045  N  N     . ALA C 2  312  ? -5.489  -44.599 55.378  1.00 78.34  ? 312  ALA C N     1 
ATOM   6046  C  CA    . ALA C 2  312  ? -6.020  -45.356 56.507  1.00 79.63  ? 312  ALA C CA    1 
ATOM   6047  C  C     . ALA C 2  312  ? -6.806  -44.456 57.452  1.00 73.50  ? 312  ALA C C     1 
ATOM   6048  O  O     . ALA C 2  312  ? -7.910  -44.807 57.886  1.00 75.11  ? 312  ALA C O     1 
ATOM   6049  C  CB    . ALA C 2  312  ? -4.880  -46.060 57.246  1.00 77.49  ? 312  ALA C CB    1 
ATOM   6050  N  N     . LEU C 2  313  ? -6.252  -43.287 57.787  1.00 70.69  ? 313  LEU C N     1 
ATOM   6051  C  CA    . LEU C 2  313  ? -6.976  -42.347 58.633  1.00 72.75  ? 313  LEU C CA    1 
ATOM   6052  C  C     . LEU C 2  313  ? -8.252  -41.868 57.955  1.00 74.49  ? 313  LEU C C     1 
ATOM   6053  O  O     . LEU C 2  313  ? -9.268  -41.649 58.626  1.00 76.74  ? 313  LEU C O     1 
ATOM   6054  C  CB    . LEU C 2  313  ? -6.079  -41.160 58.997  1.00 72.20  ? 313  LEU C CB    1 
ATOM   6055  C  CG    . LEU C 2  313  ? -6.717  -40.032 59.819  1.00 68.59  ? 313  LEU C CG    1 
ATOM   6056  C  CD1   . LEU C 2  313  ? -7.204  -40.539 61.165  1.00 68.15  ? 313  LEU C CD1   1 
ATOM   6057  C  CD2   . LEU C 2  313  ? -5.744  -38.883 60.006  1.00 68.63  ? 313  LEU C CD2   1 
ATOM   6058  N  N     . THR C 2  314  ? -8.228  -41.719 56.628  1.00 74.21  ? 314  THR C N     1 
ATOM   6059  C  CA    . THR C 2  314  ? -9.421  -41.267 55.922  1.00 83.67  ? 314  THR C CA    1 
ATOM   6060  C  C     . THR C 2  314  ? -10.516 -42.327 55.951  1.00 86.89  ? 314  THR C C     1 
ATOM   6061  O  O     . THR C 2  314  ? -11.689 -42.008 56.175  1.00 78.65  ? 314  THR C O     1 
ATOM   6062  C  CB    . THR C 2  314  ? -9.069  -40.899 54.482  1.00 77.36  ? 314  THR C CB    1 
ATOM   6063  O  OG1   . THR C 2  314  ? -7.880  -40.101 54.475  1.00 71.81  ? 314  THR C OG1   1 
ATOM   6064  C  CG2   . THR C 2  314  ? -10.205 -40.108 53.848  1.00 75.91  ? 314  THR C CG2   1 
ATOM   6065  N  N     . ALA C 2  315  ? -10.154 -43.595 55.729  1.00 86.67  ? 315  ALA C N     1 
ATOM   6066  C  CA    . ALA C 2  315  ? -11.164 -44.648 55.708  1.00 83.64  ? 315  ALA C CA    1 
ATOM   6067  C  C     . ALA C 2  315  ? -11.750 -44.893 57.091  1.00 74.43  ? 315  ALA C C     1 
ATOM   6068  O  O     . ALA C 2  315  ? -12.891 -45.354 57.209  1.00 70.30  ? 315  ALA C O     1 
ATOM   6069  C  CB    . ALA C 2  315  ? -10.574 -45.944 55.141  1.00 84.15  ? 315  ALA C CB    1 
ATOM   6070  N  N     . GLY C 2  316  ? -10.993 -44.594 58.138  1.00 73.25  ? 316  GLY C N     1 
ATOM   6071  C  CA    . GLY C 2  316  ? -11.420 -44.857 59.491  1.00 71.54  ? 316  GLY C CA    1 
ATOM   6072  C  C     . GLY C 2  316  ? -10.852 -46.117 60.100  1.00 72.83  ? 316  GLY C C     1 
ATOM   6073  O  O     . GLY C 2  316  ? -11.275 -46.498 61.199  1.00 73.79  ? 316  GLY C O     1 
ATOM   6074  N  N     . VAL C 2  317  ? -9.917  -46.774 59.423  1.00 69.24  ? 317  VAL C N     1 
ATOM   6075  C  CA    . VAL C 2  317  ? -9.399  -48.049 59.925  1.00 73.86  ? 317  VAL C CA    1 
ATOM   6076  C  C     . VAL C 2  317  ? -8.670  -47.809 61.241  1.00 71.05  ? 317  VAL C C     1 
ATOM   6077  O  O     . VAL C 2  317  ? -7.970  -46.791 61.385  1.00 71.90  ? 317  VAL C O     1 
ATOM   6078  C  CB    . VAL C 2  317  ? -8.493  -48.719 58.882  1.00 74.49  ? 317  VAL C CB    1 
ATOM   6079  C  CG1   . VAL C 2  317  ? -8.491  -47.943 57.581  1.00 69.26  ? 317  VAL C CG1   1 
ATOM   6080  C  CG2   . VAL C 2  317  ? -7.078  -48.945 59.408  1.00 72.98  ? 317  VAL C CG2   1 
ATOM   6081  N  N     . PRO C 2  318  ? -8.818  -48.703 62.214  1.00 72.53  ? 318  PRO C N     1 
ATOM   6082  C  CA    . PRO C 2  318  ? -8.337  -48.433 63.573  1.00 71.25  ? 318  PRO C CA    1 
ATOM   6083  C  C     . PRO C 2  318  ? -6.819  -48.383 63.640  1.00 68.92  ? 318  PRO C C     1 
ATOM   6084  O  O     . PRO C 2  318  ? -6.110  -48.924 62.789  1.00 74.37  ? 318  PRO C O     1 
ATOM   6085  C  CB    . PRO C 2  318  ? -8.886  -49.613 64.384  1.00 70.26  ? 318  PRO C CB    1 
ATOM   6086  C  CG    . PRO C 2  318  ? -9.968  -50.216 63.526  1.00 80.38  ? 318  PRO C CG    1 
ATOM   6087  C  CD    . PRO C 2  318  ? -9.554  -49.972 62.117  1.00 78.15  ? 318  PRO C CD    1 
ATOM   6088  N  N     . GLY C 2  319  ? -6.325  -47.724 64.686  1.00 67.18  ? 319  GLY C N     1 
ATOM   6089  C  CA    . GLY C 2  319  ? -4.900  -47.514 64.852  1.00 75.25  ? 319  GLY C CA    1 
ATOM   6090  C  C     . GLY C 2  319  ? -4.348  -46.309 64.125  1.00 72.65  ? 319  GLY C C     1 
ATOM   6091  O  O     . GLY C 2  319  ? -3.123  -46.186 63.991  1.00 65.01  ? 319  GLY C O     1 
ATOM   6092  N  N     . HIS C 2  320  ? -5.214  -45.421 63.644  1.00 71.30  ? 320  HIS C N     1 
ATOM   6093  C  CA    . HIS C 2  320  ? -4.804  -44.232 62.910  1.00 63.68  ? 320  HIS C CA    1 
ATOM   6094  C  C     . HIS C 2  320  ? -5.596  -43.047 63.438  1.00 57.75  ? 320  HIS C C     1 
ATOM   6095  O  O     . HIS C 2  320  ? -6.830  -43.040 63.375  1.00 54.98  ? 320  HIS C O     1 
ATOM   6096  C  CB    . HIS C 2  320  ? -5.012  -44.422 61.405  1.00 61.61  ? 320  HIS C CB    1 
ATOM   6097  C  CG    . HIS C 2  320  ? -4.291  -45.612 60.850  1.00 65.55  ? 320  HIS C CG    1 
ATOM   6098  N  ND1   . HIS C 2  320  ? -4.908  -46.826 60.635  1.00 70.37  ? 320  HIS C ND1   1 
ATOM   6099  C  CD2   . HIS C 2  320  ? -2.998  -45.780 60.485  1.00 64.74  ? 320  HIS C CD2   1 
ATOM   6100  C  CE1   . HIS C 2  320  ? -4.029  -47.686 60.153  1.00 69.58  ? 320  HIS C CE1   1 
ATOM   6101  N  NE2   . HIS C 2  320  ? -2.862  -47.076 60.052  1.00 62.70  ? 320  HIS C NE2   1 
ATOM   6102  N  N     . GLU C 2  321  ? -4.885  -42.052 63.961  1.00 57.72  ? 321  GLU C N     1 
ATOM   6103  C  CA    . GLU C 2  321  ? -5.511  -40.948 64.668  1.00 57.12  ? 321  GLU C CA    1 
ATOM   6104  C  C     . GLU C 2  321  ? -4.835  -39.638 64.291  1.00 61.60  ? 321  GLU C C     1 
ATOM   6105  O  O     . GLU C 2  321  ? -3.710  -39.610 63.782  1.00 55.54  ? 321  GLU C O     1 
ATOM   6106  C  CB    . GLU C 2  321  ? -5.448  -41.152 66.184  1.00 58.71  ? 321  GLU C CB    1 
ATOM   6107  C  CG    . GLU C 2  321  ? -4.031  -41.181 66.721  1.00 59.92  ? 321  GLU C CG    1 
ATOM   6108  C  CD    . GLU C 2  321  ? -3.975  -41.507 68.191  1.00 71.21  ? 321  GLU C CD    1 
ATOM   6109  O  OE1   . GLU C 2  321  ? -5.051  -41.689 68.801  1.00 75.68  ? 321  GLU C OE1   1 
ATOM   6110  O  OE2   . GLU C 2  321  ? -2.855  -41.585 68.735  1.00 78.42  ? 321  GLU C OE2   1 
ATOM   6111  N  N     . VAL C 2  322  ? -5.555  -38.547 64.550  1.00 61.83  ? 322  VAL C N     1 
ATOM   6112  C  CA    . VAL C 2  322  ? -5.122  -37.186 64.248  1.00 58.14  ? 322  VAL C CA    1 
ATOM   6113  C  C     . VAL C 2  322  ? -4.161  -36.733 65.344  1.00 62.49  ? 322  VAL C C     1 
ATOM   6114  O  O     . VAL C 2  322  ? -4.053  -37.387 66.385  1.00 68.17  ? 322  VAL C O     1 
ATOM   6115  C  CB    . VAL C 2  322  ? -6.353  -36.267 64.092  1.00 57.46  ? 322  VAL C CB    1 
ATOM   6116  C  CG1   . VAL C 2  322  ? -6.504  -35.268 65.240  1.00 67.59  ? 322  VAL C CG1   1 
ATOM   6117  C  CG2   . VAL C 2  322  ? -6.353  -35.598 62.734  1.00 60.72  ? 322  VAL C CG2   1 
ATOM   6118  N  N     . ASP C 2  323  ? -3.428  -35.642 65.113  1.00 59.92  ? 323  ASP C N     1 
ATOM   6119  C  CA    . ASP C 2  323  ? -2.340  -35.238 65.995  1.00 59.88  ? 323  ASP C CA    1 
ATOM   6120  C  C     . ASP C 2  323  ? -2.626  -33.890 66.647  1.00 57.41  ? 323  ASP C C     1 
ATOM   6121  O  O     . ASP C 2  323  ? -3.182  -32.983 66.019  1.00 47.65  ? 323  ASP C O     1 
ATOM   6122  C  CB    . ASP C 2  323  ? -1.013  -35.170 65.234  1.00 58.75  ? 323  ASP C CB    1 
ATOM   6123  C  CG    . ASP C 2  323  ? -0.551  -36.527 64.753  1.00 62.90  ? 323  ASP C CG    1 
ATOM   6124  O  OD1   . ASP C 2  323  ? -0.145  -37.346 65.606  1.00 65.45  ? 323  ASP C OD1   1 
ATOM   6125  O  OD2   . ASP C 2  323  ? -0.613  -36.780 63.528  1.00 65.31  ? 323  ASP C OD2   1 
ATOM   6126  N  N     . ASP C 2  324  ? -2.241  -33.775 67.918  1.00 52.09  ? 324  ASP C N     1 
ATOM   6127  C  CA    . ASP C 2  324  ? -2.327  -32.526 68.670  1.00 45.00  ? 324  ASP C CA    1 
ATOM   6128  C  C     . ASP C 2  324  ? -0.995  -31.805 68.501  1.00 54.27  ? 324  ASP C C     1 
ATOM   6129  O  O     . ASP C 2  324  ? 0.026   -32.244 69.041  1.00 57.88  ? 324  ASP C O     1 
ATOM   6130  C  CB    . ASP C 2  324  ? -2.626  -32.813 70.141  1.00 39.85  ? 324  ASP C CB    1 
ATOM   6131  C  CG    . ASP C 2  324  ? -2.976  -31.559 70.942  1.00 44.79  ? 324  ASP C CG    1 
ATOM   6132  O  OD1   . ASP C 2  324  ? -2.564  -30.446 70.559  1.00 52.15  ? 324  ASP C OD1   1 
ATOM   6133  O  OD2   . ASP C 2  324  ? -3.662  -31.696 71.978  1.00 41.70  ? 324  ASP C OD2   1 
ATOM   6134  N  N     . ILE C 2  325  ? -0.995  -30.704 67.745  1.00 50.50  ? 325  ILE C N     1 
ATOM   6135  C  CA    . ILE C 2  325  ? 0.267   -30.035 67.441  1.00 46.60  ? 325  ILE C CA    1 
ATOM   6136  C  C     . ILE C 2  325  ? 0.768   -29.170 68.590  1.00 49.46  ? 325  ILE C C     1 
ATOM   6137  O  O     . ILE C 2  325  ? 1.932   -28.751 68.571  1.00 55.27  ? 325  ILE C O     1 
ATOM   6138  C  CB    . ILE C 2  325  ? 0.148   -29.191 66.164  1.00 47.80  ? 325  ILE C CB    1 
ATOM   6139  C  CG1   . ILE C 2  325  ? -0.835  -28.041 66.368  1.00 50.05  ? 325  ILE C CG1   1 
ATOM   6140  C  CG2   . ILE C 2  325  ? -0.289  -30.060 65.000  1.00 53.57  ? 325  ILE C CG2   1 
ATOM   6141  C  CD1   . ILE C 2  325  ? -0.991  -27.169 65.147  1.00 49.01  ? 325  ILE C CD1   1 
ATOM   6142  N  N     . ASP C 2  326  ? -0.073  -28.882 69.586  1.00 46.10  ? 326  ASP C N     1 
ATOM   6143  C  CA    . ASP C 2  326  ? 0.357   -28.181 70.788  1.00 45.03  ? 326  ASP C CA    1 
ATOM   6144  C  C     . ASP C 2  326  ? 0.777   -29.132 71.898  1.00 40.73  ? 326  ASP C C     1 
ATOM   6145  O  O     . ASP C 2  326  ? 1.329   -28.679 72.907  1.00 38.36  ? 326  ASP C O     1 
ATOM   6146  C  CB    . ASP C 2  326  ? -0.760  -27.265 71.295  1.00 47.29  ? 326  ASP C CB    1 
ATOM   6147  C  CG    . ASP C 2  326  ? -1.241  -26.299 70.235  1.00 49.20  ? 326  ASP C CG    1 
ATOM   6148  O  OD1   . ASP C 2  326  ? -0.415  -25.885 69.393  1.00 50.26  ? 326  ASP C OD1   1 
ATOM   6149  O  OD2   . ASP C 2  326  ? -2.443  -25.960 70.240  1.00 50.67  ? 326  ASP C OD2   1 
ATOM   6150  N  N     . HIS C 2  327  ? 0.514   -30.427 71.728  1.00 39.30  ? 327  HIS C N     1 
ATOM   6151  C  CA    . HIS C 2  327  ? 0.991   -31.454 72.646  1.00 40.90  ? 327  HIS C CA    1 
ATOM   6152  C  C     . HIS C 2  327  ? 2.504   -31.371 72.782  1.00 38.50  ? 327  HIS C C     1 
ATOM   6153  O  O     . HIS C 2  327  ? 3.222   -31.237 71.789  1.00 42.68  ? 327  HIS C O     1 
ATOM   6154  C  CB    . HIS C 2  327  ? 0.581   -32.827 72.108  1.00 39.93  ? 327  HIS C CB    1 
ATOM   6155  C  CG    . HIS C 2  327  ? 0.654   -33.941 73.105  1.00 33.38  ? 327  HIS C CG    1 
ATOM   6156  N  ND1   . HIS C 2  327  ? 1.844   -34.496 73.522  1.00 33.43  ? 327  HIS C ND1   1 
ATOM   6157  C  CD2   . HIS C 2  327  ? -0.325  -34.648 73.718  1.00 34.25  ? 327  HIS C CD2   1 
ATOM   6158  C  CE1   . HIS C 2  327  ? 1.595   -35.478 74.370  1.00 33.04  ? 327  HIS C CE1   1 
ATOM   6159  N  NE2   . HIS C 2  327  ? 0.287   -35.590 74.506  1.00 31.43  ? 327  HIS C NE2   1 
ATOM   6160  N  N     . LEU C 2  328  ? 2.996   -31.455 74.017  1.00 31.48  ? 328  LEU C N     1 
ATOM   6161  C  CA    . LEU C 2  328  ? 4.429   -31.307 74.246  1.00 33.54  ? 328  LEU C CA    1 
ATOM   6162  C  C     . LEU C 2  328  ? 5.233   -32.520 73.796  1.00 36.42  ? 328  LEU C C     1 
ATOM   6163  O  O     . LEU C 2  328  ? 6.457   -32.525 73.957  1.00 38.83  ? 328  LEU C O     1 
ATOM   6164  C  CB    . LEU C 2  328  ? 4.713   -31.011 75.721  1.00 36.96  ? 328  LEU C CB    1 
ATOM   6165  C  CG    . LEU C 2  328  ? 4.385   -29.583 76.166  1.00 33.51  ? 328  LEU C CG    1 
ATOM   6166  C  CD1   . LEU C 2  328  ? 5.070   -29.251 77.482  1.00 29.71  ? 328  LEU C CD1   1 
ATOM   6167  C  CD2   . LEU C 2  328  ? 4.759   -28.574 75.086  1.00 32.89  ? 328  LEU C CD2   1 
ATOM   6168  N  N     . GLY C 2  329  ? 4.578   -33.546 73.250  1.00 36.20  ? 329  GLY C N     1 
ATOM   6169  C  CA    . GLY C 2  329  ? 5.282   -34.564 72.493  1.00 37.21  ? 329  GLY C CA    1 
ATOM   6170  C  C     . GLY C 2  329  ? 5.531   -34.184 71.050  1.00 39.72  ? 329  GLY C C     1 
ATOM   6171  O  O     . GLY C 2  329  ? 6.357   -34.816 70.385  1.00 45.87  ? 329  GLY C O     1 
ATOM   6172  N  N     . ASN C 2  330  ? 4.827   -33.167 70.551  1.00 37.78  ? 330  ASN C N     1 
ATOM   6173  C  CA    . ASN C 2  330  ? 5.008   -32.665 69.197  1.00 42.66  ? 330  ASN C CA    1 
ATOM   6174  C  C     . ASN C 2  330  ? 5.617   -31.268 69.153  1.00 37.69  ? 330  ASN C C     1 
ATOM   6175  O  O     . ASN C 2  330  ? 5.827   -30.733 68.060  1.00 37.11  ? 330  ASN C O     1 
ATOM   6176  C  CB    . ASN C 2  330  ? 3.669   -32.674 68.452  1.00 45.78  ? 330  ASN C CB    1 
ATOM   6177  C  CG    . ASN C 2  330  ? 3.078   -34.066 68.334  1.00 45.78  ? 330  ASN C CG    1 
ATOM   6178  O  OD1   . ASN C 2  330  ? 3.804   -35.063 68.336  1.00 49.05  ? 330  ASN C OD1   1 
ATOM   6179  N  ND2   . ASN C 2  330  ? 1.758   -34.142 68.228  1.00 48.01  ? 330  ASN C ND2   1 
ATOM   6180  N  N     . ARG C 2  331  ? 5.893   -30.661 70.306  1.00 34.29  ? 331  ARG C N     1 
ATOM   6181  C  CA    . ARG C 2  331  ? 6.621   -29.403 70.394  1.00 32.51  ? 331  ARG C CA    1 
ATOM   6182  C  C     . ARG C 2  331  ? 7.936   -29.659 71.110  1.00 33.88  ? 331  ARG C C     1 
ATOM   6183  O  O     . ARG C 2  331  ? 7.944   -30.214 72.214  1.00 39.99  ? 331  ARG C O     1 
ATOM   6184  C  CB    . ARG C 2  331  ? 5.830   -28.331 71.152  1.00 32.67  ? 331  ARG C CB    1 
ATOM   6185  C  CG    . ARG C 2  331  ? 4.542   -27.872 70.492  1.00 38.82  ? 331  ARG C CG    1 
ATOM   6186  C  CD    . ARG C 2  331  ? 3.872   -26.777 71.327  1.00 44.18  ? 331  ARG C CD    1 
ATOM   6187  N  NE    . ARG C 2  331  ? 4.380   -25.440 71.018  1.00 37.84  ? 331  ARG C NE    1 
ATOM   6188  C  CZ    . ARG C 2  331  ? 4.234   -24.378 71.807  1.00 34.02  ? 331  ARG C CZ    1 
ATOM   6189  N  NH1   . ARG C 2  331  ? 3.610   -24.485 72.971  1.00 33.92  ? 331  ARG C NH1   1 
ATOM   6190  N  NH2   . ARG C 2  331  ? 4.727   -23.207 71.438  1.00 39.73  ? 331  ARG C NH2   1 
ATOM   6191  N  N     . ARG C 2  332  ? 9.040   -29.250 70.492  1.00 35.33  ? 332  ARG C N     1 
ATOM   6192  C  CA    . ARG C 2  332  ? 10.364  -29.448 71.063  1.00 32.52  ? 332  ARG C CA    1 
ATOM   6193  C  C     . ARG C 2  332  ? 11.045  -28.104 71.301  1.00 32.08  ? 332  ARG C C     1 
ATOM   6194  O  O     . ARG C 2  332  ? 10.539  -27.040 70.924  1.00 32.78  ? 332  ARG C O     1 
ATOM   6195  C  CB    . ARG C 2  332  ? 11.229  -30.341 70.162  1.00 34.74  ? 332  ARG C CB    1 
ATOM   6196  C  CG    . ARG C 2  332  ? 11.430  -29.814 68.749  1.00 36.29  ? 332  ARG C CG    1 
ATOM   6197  C  CD    . ARG C 2  332  ? 12.378  -30.700 67.942  1.00 35.88  ? 332  ARG C CD    1 
ATOM   6198  N  NE    . ARG C 2  332  ? 13.662  -30.894 68.615  1.00 34.34  ? 332  ARG C NE    1 
ATOM   6199  C  CZ    . ARG C 2  332  ? 14.707  -30.082 68.486  1.00 32.92  ? 332  ARG C CZ    1 
ATOM   6200  N  NH1   . ARG C 2  332  ? 14.632  -29.014 67.707  1.00 33.73  ? 332  ARG C NH1   1 
ATOM   6201  N  NH2   . ARG C 2  332  ? 15.832  -30.337 69.139  1.00 34.68  ? 332  ARG C NH2   1 
ATOM   6202  N  N     . ILE C 2  333  ? 12.210  -28.175 71.942  1.00 29.21  ? 333  ILE C N     1 
ATOM   6203  C  CA    . ILE C 2  333  ? 12.954  -27.003 72.387  1.00 30.68  ? 333  ILE C CA    1 
ATOM   6204  C  C     . ILE C 2  333  ? 14.293  -26.971 71.667  1.00 38.34  ? 333  ILE C C     1 
ATOM   6205  O  O     . ILE C 2  333  ? 15.072  -27.928 71.748  1.00 42.77  ? 333  ILE C O     1 
ATOM   6206  C  CB    . ILE C 2  333  ? 13.172  -27.005 73.906  1.00 32.06  ? 333  ILE C CB    1 
ATOM   6207  C  CG1   . ILE C 2  333  ? 11.838  -27.138 74.643  1.00 32.52  ? 333  ILE C CG1   1 
ATOM   6208  C  CG2   . ILE C 2  333  ? 13.907  -25.747 74.330  1.00 28.92  ? 333  ILE C CG2   1 
ATOM   6209  C  CD1   . ILE C 2  333  ? 10.932  -25.941 74.492  1.00 30.81  ? 333  ILE C CD1   1 
ATOM   6210  N  N     . ARG C 2  334  ? 14.557  -25.869 70.972  1.00 38.33  ? 334  ARG C N     1 
ATOM   6211  C  CA    . ARG C 2  334  ? 15.867  -25.586 70.402  1.00 31.76  ? 334  ARG C CA    1 
ATOM   6212  C  C     . ARG C 2  334  ? 16.658  -24.779 71.422  1.00 33.18  ? 334  ARG C C     1 
ATOM   6213  O  O     . ARG C 2  334  ? 16.361  -23.601 71.652  1.00 36.87  ? 334  ARG C O     1 
ATOM   6214  C  CB    . ARG C 2  334  ? 15.728  -24.814 69.096  1.00 36.98  ? 334  ARG C CB    1 
ATOM   6215  C  CG    . ARG C 2  334  ? 14.557  -25.234 68.234  1.00 35.95  ? 334  ARG C CG    1 
ATOM   6216  C  CD    . ARG C 2  334  ? 14.638  -24.559 66.880  1.00 38.53  ? 334  ARG C CD    1 
ATOM   6217  N  NE    . ARG C 2  334  ? 15.799  -25.032 66.134  1.00 39.68  ? 334  ARG C NE    1 
ATOM   6218  C  CZ    . ARG C 2  334  ? 16.321  -24.411 65.084  1.00 48.65  ? 334  ARG C CZ    1 
ATOM   6219  N  NH1   . ARG C 2  334  ? 15.791  -23.274 64.651  1.00 54.90  ? 334  ARG C NH1   1 
ATOM   6220  N  NH2   . ARG C 2  334  ? 17.378  -24.928 64.472  1.00 51.98  ? 334  ARG C NH2   1 
ATOM   6221  N  N     . THR C 2  335  ? 17.655  -25.412 72.036  1.00 30.31  ? 335  THR C N     1 
ATOM   6222  C  CA    . THR C 2  335  ? 18.470  -24.765 73.050  1.00 28.53  ? 335  THR C CA    1 
ATOM   6223  C  C     . THR C 2  335  ? 19.559  -23.922 72.389  1.00 31.46  ? 335  THR C C     1 
ATOM   6224  O  O     . THR C 2  335  ? 19.653  -23.832 71.162  1.00 37.14  ? 335  THR C O     1 
ATOM   6225  C  CB    . THR C 2  335  ? 19.062  -25.809 73.994  1.00 32.06  ? 335  THR C CB    1 
ATOM   6226  O  OG1   . THR C 2  335  ? 19.429  -26.978 73.250  1.00 30.34  ? 335  THR C OG1   1 
ATOM   6227  C  CG2   . THR C 2  335  ? 18.048  -26.195 75.054  1.00 34.72  ? 335  THR C CG2   1 
ATOM   6228  N  N     . VAL C 2  336  ? 20.396  -23.294 73.219  1.00 32.09  ? 336  VAL C N     1 
ATOM   6229  C  CA    . VAL C 2  336  ? 21.398  -22.355 72.715  1.00 30.96  ? 336  VAL C CA    1 
ATOM   6230  C  C     . VAL C 2  336  ? 22.343  -23.041 71.733  1.00 33.07  ? 336  VAL C C     1 
ATOM   6231  O  O     . VAL C 2  336  ? 22.681  -22.484 70.678  1.00 38.96  ? 336  VAL C O     1 
ATOM   6232  C  CB    . VAL C 2  336  ? 22.163  -21.719 73.891  1.00 27.08  ? 336  VAL C CB    1 
ATOM   6233  C  CG1   . VAL C 2  336  ? 22.510  -22.771 74.931  1.00 29.55  ? 336  VAL C CG1   1 
ATOM   6234  C  CG2   . VAL C 2  336  ? 23.417  -21.027 73.400  1.00 28.90  ? 336  VAL C CG2   1 
ATOM   6235  N  N     . GLY C 2  337  ? 22.779  -24.259 72.058  1.00 27.90  ? 337  GLY C N     1 
ATOM   6236  C  CA    . GLY C 2  337  ? 23.701  -24.963 71.183  1.00 30.41  ? 337  GLY C CA    1 
ATOM   6237  C  C     . GLY C 2  337  ? 23.139  -25.188 69.794  1.00 34.07  ? 337  GLY C C     1 
ATOM   6238  O  O     . GLY C 2  337  ? 23.838  -25.001 68.797  1.00 35.10  ? 337  GLY C O     1 
ATOM   6239  N  N     . GLU C 2  338  ? 21.863  -25.568 69.707  1.00 36.09  ? 338  GLU C N     1 
ATOM   6240  C  CA    . GLU C 2  338  ? 21.256  -25.827 68.405  1.00 38.08  ? 338  GLU C CA    1 
ATOM   6241  C  C     . GLU C 2  338  ? 21.177  -24.557 67.560  1.00 44.35  ? 338  GLU C C     1 
ATOM   6242  O  O     . GLU C 2  338  ? 21.472  -24.586 66.359  1.00 51.23  ? 338  GLU C O     1 
ATOM   6243  C  CB    . GLU C 2  338  ? 19.871  -26.444 68.590  1.00 30.48  ? 338  GLU C CB    1 
ATOM   6244  C  CG    . GLU C 2  338  ? 19.169  -26.794 67.288  1.00 42.76  ? 338  GLU C CG    1 
ATOM   6245  C  CD    . GLU C 2  338  ? 17.888  -27.585 67.500  1.00 49.65  ? 338  GLU C CD    1 
ATOM   6246  O  OE1   . GLU C 2  338  ? 17.664  -28.077 68.629  1.00 47.83  ? 338  GLU C OE1   1 
ATOM   6247  O  OE2   . GLU C 2  338  ? 17.104  -27.715 66.535  1.00 45.58  ? 338  GLU C OE2   1 
ATOM   6248  N  N     . LEU C 2  339  ? 20.802  -23.429 68.168  1.00 37.02  ? 339  LEU C N     1 
ATOM   6249  C  CA    . LEU C 2  339  ? 20.684  -22.182 67.414  1.00 38.64  ? 339  LEU C CA    1 
ATOM   6250  C  C     . LEU C 2  339  ? 22.049  -21.685 66.956  1.00 41.56  ? 339  LEU C C     1 
ATOM   6251  O  O     . LEU C 2  339  ? 22.222  -21.271 65.796  1.00 49.34  ? 339  LEU C O     1 
ATOM   6252  C  CB    . LEU C 2  339  ? 19.992  -21.124 68.268  1.00 38.53  ? 339  LEU C CB    1 
ATOM   6253  C  CG    . LEU C 2  339  ? 18.766  -21.606 69.040  1.00 37.47  ? 339  LEU C CG    1 
ATOM   6254  C  CD1   . LEU C 2  339  ? 18.393  -20.599 70.117  1.00 36.92  ? 339  LEU C CD1   1 
ATOM   6255  C  CD2   . LEU C 2  339  ? 17.599  -21.865 68.101  1.00 31.36  ? 339  LEU C CD2   1 
ATOM   6256  N  N     . MET C 2  340  ? 23.024  -21.684 67.870  1.00 37.15  ? 340  MET C N     1 
ATOM   6257  C  CA    . MET C 2  340  ? 24.384  -21.324 67.490  1.00 41.40  ? 340  MET C CA    1 
ATOM   6258  C  C     . MET C 2  340  ? 24.896  -22.230 66.377  1.00 43.34  ? 340  MET C C     1 
ATOM   6259  O  O     . MET C 2  340  ? 25.555  -21.763 65.443  1.00 44.35  ? 340  MET C O     1 
ATOM   6260  C  CB    . MET C 2  340  ? 25.301  -21.382 68.711  1.00 35.36  ? 340  MET C CB    1 
ATOM   6261  C  CG    . MET C 2  340  ? 26.708  -20.848 68.484  1.00 34.11  ? 340  MET C CG    1 
ATOM   6262  S  SD    . MET C 2  340  ? 27.817  -21.980 67.605  1.00 47.31  ? 340  MET C SD    1 
ATOM   6263  C  CE    . MET C 2  340  ? 27.505  -23.510 68.479  1.00 43.03  ? 340  MET C CE    1 
ATOM   6264  N  N     . THR C 2  341  ? 24.589  -23.528 66.447  1.00 40.63  ? 341  THR C N     1 
ATOM   6265  C  CA    . THR C 2  341  ? 25.023  -24.447 65.402  1.00 42.58  ? 341  THR C CA    1 
ATOM   6266  C  C     . THR C 2  341  ? 24.341  -24.141 64.075  1.00 47.07  ? 341  THR C C     1 
ATOM   6267  O  O     . THR C 2  341  ? 24.951  -24.287 63.012  1.00 55.04  ? 341  THR C O     1 
ATOM   6268  C  CB    . THR C 2  341  ? 24.744  -25.885 65.831  1.00 38.75  ? 341  THR C CB    1 
ATOM   6269  O  OG1   . THR C 2  341  ? 25.308  -26.105 67.128  1.00 36.38  ? 341  THR C OG1   1 
ATOM   6270  C  CG2   . THR C 2  341  ? 25.358  -26.863 64.851  1.00 38.47  ? 341  THR C CG2   1 
ATOM   6271  N  N     . ASP C 2  342  ? 23.079  -23.712 64.113  1.00 43.24  ? 342  ASP C N     1 
ATOM   6272  C  CA    . ASP C 2  342  ? 22.390  -23.339 62.881  1.00 44.90  ? 342  ASP C CA    1 
ATOM   6273  C  C     . ASP C 2  342  ? 23.066  -22.151 62.210  1.00 46.61  ? 342  ASP C C     1 
ATOM   6274  O  O     . ASP C 2  342  ? 23.359  -22.179 61.005  1.00 56.60  ? 342  ASP C O     1 
ATOM   6275  C  CB    . ASP C 2  342  ? 20.925  -23.029 63.173  1.00 46.36  ? 342  ASP C CB    1 
ATOM   6276  C  CG    . ASP C 2  342  ? 20.020  -24.198 62.873  1.00 61.18  ? 342  ASP C CG    1 
ATOM   6277  O  OD1   . ASP C 2  342  ? 20.308  -25.313 63.362  1.00 67.38  ? 342  ASP C OD1   1 
ATOM   6278  O  OD2   . ASP C 2  342  ? 19.019  -24.003 62.152  1.00 62.23  ? 342  ASP C OD2   1 
ATOM   6279  N  N     . GLN C 2  343  ? 23.320  -21.090 62.976  1.00 45.18  ? 343  GLN C N     1 
ATOM   6280  C  CA    . GLN C 2  343  ? 23.989  -19.935 62.379  1.00 48.10  ? 343  GLN C CA    1 
ATOM   6281  C  C     . GLN C 2  343  ? 25.429  -20.261 61.987  1.00 55.09  ? 343  GLN C C     1 
ATOM   6282  O  O     . GLN C 2  343  ? 25.962  -19.682 61.028  1.00 61.99  ? 343  GLN C O     1 
ATOM   6283  C  CB    . GLN C 2  343  ? 23.935  -18.737 63.324  1.00 49.96  ? 343  GLN C CB    1 
ATOM   6284  C  CG    . GLN C 2  343  ? 22.527  -18.191 63.510  1.00 54.07  ? 343  GLN C CG    1 
ATOM   6285  C  CD    . GLN C 2  343  ? 21.775  -18.054 62.194  1.00 55.16  ? 343  GLN C CD    1 
ATOM   6286  O  OE1   . GLN C 2  343  ? 20.798  -18.764 61.948  1.00 51.41  ? 343  GLN C OE1   1 
ATOM   6287  N  NE2   . GLN C 2  343  ? 22.224  -17.134 61.346  1.00 53.36  ? 343  GLN C NE2   1 
ATOM   6288  N  N     . PHE C 2  344  ? 26.059  -21.202 62.694  1.00 47.92  ? 344  PHE C N     1 
ATOM   6289  C  CA    . PHE C 2  344  ? 27.382  -21.674 62.307  1.00 49.47  ? 344  PHE C CA    1 
ATOM   6290  C  C     . PHE C 2  344  ? 27.337  -22.381 60.958  1.00 48.43  ? 344  PHE C C     1 
ATOM   6291  O  O     . PHE C 2  344  ? 28.209  -22.171 60.108  1.00 48.03  ? 344  PHE C O     1 
ATOM   6292  C  CB    . PHE C 2  344  ? 27.922  -22.607 63.390  1.00 45.27  ? 344  PHE C CB    1 
ATOM   6293  C  CG    . PHE C 2  344  ? 29.385  -22.902 63.268  1.00 48.23  ? 344  PHE C CG    1 
ATOM   6294  C  CD1   . PHE C 2  344  ? 30.324  -22.040 63.809  1.00 48.45  ? 344  PHE C CD1   1 
ATOM   6295  C  CD2   . PHE C 2  344  ? 29.823  -24.044 62.624  1.00 48.29  ? 344  PHE C CD2   1 
ATOM   6296  C  CE1   . PHE C 2  344  ? 31.672  -22.309 63.704  1.00 46.77  ? 344  PHE C CE1   1 
ATOM   6297  C  CE2   . PHE C 2  344  ? 31.167  -24.321 62.515  1.00 48.44  ? 344  PHE C CE2   1 
ATOM   6298  C  CZ    . PHE C 2  344  ? 32.094  -23.452 63.056  1.00 52.58  ? 344  PHE C CZ    1 
ATOM   6299  N  N     . ARG C 2  345  ? 26.322  -23.223 60.749  1.00 47.36  ? 345  ARG C N     1 
ATOM   6300  C  CA    . ARG C 2  345  ? 26.135  -23.883 59.462  1.00 47.12  ? 345  ARG C CA    1 
ATOM   6301  C  C     . ARG C 2  345  ? 25.910  -22.863 58.354  1.00 46.90  ? 345  ARG C C     1 
ATOM   6302  O  O     . ARG C 2  345  ? 26.413  -23.025 57.235  1.00 49.49  ? 345  ARG C O     1 
ATOM   6303  C  CB    . ARG C 2  345  ? 24.955  -24.849 59.543  1.00 43.17  ? 345  ARG C CB    1 
ATOM   6304  C  CG    . ARG C 2  345  ? 24.845  -25.795 58.367  1.00 54.84  ? 345  ARG C CG    1 
ATOM   6305  C  CD    . ARG C 2  345  ? 23.428  -26.332 58.218  1.00 81.80  ? 345  ARG C CD    1 
ATOM   6306  N  NE    . ARG C 2  345  ? 22.603  -25.476 57.365  1.00 94.20  ? 345  ARG C NE    1 
ATOM   6307  C  CZ    . ARG C 2  345  ? 21.614  -24.697 57.799  1.00 92.72  ? 345  ARG C CZ    1 
ATOM   6308  N  NH1   . ARG C 2  345  ? 21.304  -24.661 59.090  1.00 84.02  ? 345  ARG C NH1   1 
ATOM   6309  N  NH2   . ARG C 2  345  ? 20.927  -23.958 56.935  1.00 83.41  ? 345  ARG C NH2   1 
ATOM   6310  N  N     . VAL C 2  346  ? 25.161  -21.799 58.650  1.00 45.39  ? 346  VAL C N     1 
ATOM   6311  C  CA    . VAL C 2  346  ? 24.926  -20.753 57.652  1.00 53.24  ? 346  VAL C CA    1 
ATOM   6312  C  C     . VAL C 2  346  ? 26.240  -20.078 57.260  1.00 57.71  ? 346  VAL C C     1 
ATOM   6313  O  O     . VAL C 2  346  ? 26.571  -19.955 56.068  1.00 62.18  ? 346  VAL C O     1 
ATOM   6314  C  CB    . VAL C 2  346  ? 23.900  -19.733 58.177  1.00 45.58  ? 346  VAL C CB    1 
ATOM   6315  C  CG1   . VAL C 2  346  ? 23.730  -18.591 57.189  1.00 48.52  ? 346  VAL C CG1   1 
ATOM   6316  C  CG2   . VAL C 2  346  ? 22.574  -20.420 58.430  1.00 47.05  ? 346  VAL C CG2   1 
ATOM   6317  N  N     . GLY C 2  347  ? 26.999  -19.611 58.258  1.00 53.16  ? 347  GLY C N     1 
ATOM   6318  C  CA    . GLY C 2  347  ? 28.284  -18.988 57.973  1.00 52.40  ? 347  GLY C CA    1 
ATOM   6319  C  C     . GLY C 2  347  ? 29.246  -19.916 57.256  1.00 54.47  ? 347  GLY C C     1 
ATOM   6320  O  O     . GLY C 2  347  ? 30.019  -19.480 56.399  1.00 60.41  ? 347  GLY C O     1 
ATOM   6321  N  N     . LEU C 2  348  ? 29.190  -21.211 57.573  1.00 57.67  ? 348  LEU C N     1 
ATOM   6322  C  CA    . LEU C 2  348  ? 30.047  -22.187 56.909  1.00 50.66  ? 348  LEU C CA    1 
ATOM   6323  C  C     . LEU C 2  348  ? 29.646  -22.379 55.454  1.00 53.08  ? 348  LEU C C     1 
ATOM   6324  O  O     . LEU C 2  348  ? 30.506  -22.549 54.586  1.00 60.98  ? 348  LEU C O     1 
ATOM   6325  C  CB    . LEU C 2  348  ? 29.990  -23.515 57.658  1.00 49.80  ? 348  LEU C CB    1 
ATOM   6326  C  CG    . LEU C 2  348  ? 31.323  -24.113 58.095  1.00 51.89  ? 348  LEU C CG    1 
ATOM   6327  C  CD1   . LEU C 2  348  ? 32.139  -23.081 58.852  1.00 52.02  ? 348  LEU C CD1   1 
ATOM   6328  C  CD2   . LEU C 2  348  ? 31.078  -25.343 58.952  1.00 49.39  ? 348  LEU C CD2   1 
ATOM   6329  N  N     . ALA C 2  349  ? 28.345  -22.363 55.164  1.00 53.39  ? 349  ALA C N     1 
ATOM   6330  C  CA    . ALA C 2  349  ? 27.911  -22.461 53.775  1.00 55.74  ? 349  ALA C CA    1 
ATOM   6331  C  C     . ALA C 2  349  ? 28.350  -21.239 52.976  1.00 55.43  ? 349  ALA C C     1 
ATOM   6332  O  O     . ALA C 2  349  ? 28.735  -21.357 51.805  1.00 57.97  ? 349  ALA C O     1 
ATOM   6333  C  CB    . ALA C 2  349  ? 26.396  -22.637 53.706  1.00 62.59  ? 349  ALA C CB    1 
ATOM   6334  N  N     . ARG C 2  350  ? 28.297  -20.054 53.590  1.00 53.81  ? 350  ARG C N     1 
ATOM   6335  C  CA    . ARG C 2  350  ? 28.827  -18.871 52.912  1.00 57.63  ? 350  ARG C CA    1 
ATOM   6336  C  C     . ARG C 2  350  ? 30.327  -19.004 52.672  1.00 63.31  ? 350  ARG C C     1 
ATOM   6337  O  O     . ARG C 2  350  ? 30.831  -18.656 51.593  1.00 75.79  ? 350  ARG C O     1 
ATOM   6338  C  CB    . ARG C 2  350  ? 28.520  -17.610 53.717  1.00 53.44  ? 350  ARG C CB    1 
ATOM   6339  C  CG    . ARG C 2  350  ? 27.051  -17.235 53.707  1.00 58.08  ? 350  ARG C CG    1 
ATOM   6340  C  CD    . ARG C 2  350  ? 26.740  -16.169 54.741  1.00 67.31  ? 350  ARG C CD    1 
ATOM   6341  N  NE    . ARG C 2  350  ? 25.302  -16.046 54.967  1.00 71.03  ? 350  ARG C NE    1 
ATOM   6342  C  CZ    . ARG C 2  350  ? 24.756  -15.330 55.945  1.00 68.66  ? 350  ARG C CZ    1 
ATOM   6343  N  NH1   . ARG C 2  350  ? 25.529  -14.667 56.799  1.00 63.96  ? 350  ARG C NH1   1 
ATOM   6344  N  NH2   . ARG C 2  350  ? 23.436  -15.280 56.070  1.00 63.01  ? 350  ARG C NH2   1 
ATOM   6345  N  N     . LEU C 2  351  ? 31.056  -19.516 53.667  1.00 61.97  ? 351  LEU C N     1 
ATOM   6346  C  CA    . LEU C 2  351  ? 32.479  -19.789 53.492  1.00 64.65  ? 351  LEU C CA    1 
ATOM   6347  C  C     . LEU C 2  351  ? 32.720  -20.777 52.353  1.00 64.56  ? 351  LEU C C     1 
ATOM   6348  O  O     . LEU C 2  351  ? 33.710  -20.666 51.626  1.00 63.92  ? 351  LEU C O     1 
ATOM   6349  C  CB    . LEU C 2  351  ? 33.065  -20.310 54.806  1.00 58.91  ? 351  LEU C CB    1 
ATOM   6350  C  CG    . LEU C 2  351  ? 34.503  -20.820 54.871  1.00 53.29  ? 351  LEU C CG    1 
ATOM   6351  C  CD1   . LEU C 2  351  ? 35.111  -20.451 56.206  1.00 60.06  ? 351  LEU C CD1   1 
ATOM   6352  C  CD2   . LEU C 2  351  ? 34.547  -22.324 54.689  1.00 50.05  ? 351  LEU C CD2   1 
ATOM   6353  N  N     . ALA C 2  352  ? 31.815  -21.742 52.175  1.00 67.18  ? 352  ALA C N     1 
ATOM   6354  C  CA    . ALA C 2  352  ? 31.974  -22.733 51.110  1.00 72.32  ? 352  ALA C CA    1 
ATOM   6355  C  C     . ALA C 2  352  ? 31.732  -22.119 49.736  1.00 74.78  ? 352  ALA C C     1 
ATOM   6356  O  O     . ALA C 2  352  ? 32.430  -22.451 48.767  1.00 79.82  ? 352  ALA C O     1 
ATOM   6357  C  CB    . ALA C 2  352  ? 31.027  -23.909 51.340  1.00 70.08  ? 352  ALA C CB    1 
ATOM   6358  N  N     . ARG C 2  353  ? 30.724  -21.251 49.624  1.00 79.59  ? 353  ARG C N     1 
ATOM   6359  C  CA    . ARG C 2  353  ? 30.547  -20.499 48.385  1.00 82.18  ? 353  ARG C CA    1 
ATOM   6360  C  C     . ARG C 2  353  ? 31.800  -19.695 48.064  1.00 82.08  ? 353  ARG C C     1 
ATOM   6361  O  O     . ARG C 2  353  ? 32.274  -19.693 46.920  1.00 85.62  ? 353  ARG C O     1 
ATOM   6362  C  CB    . ARG C 2  353  ? 29.327  -19.582 48.483  1.00 82.43  ? 353  ARG C CB    1 
ATOM   6363  C  CG    . ARG C 2  353  ? 29.117  -18.696 47.258  1.00 94.25  ? 353  ARG C CG    1 
ATOM   6364  C  CD    . ARG C 2  353  ? 29.422  -17.231 47.558  1.00 102.35 ? 353  ARG C CD    1 
ATOM   6365  N  NE    . ARG C 2  353  ? 29.782  -16.477 46.356  1.00 108.67 ? 353  ARG C NE    1 
ATOM   6366  C  CZ    . ARG C 2  353  ? 28.907  -15.894 45.542  1.00 108.29 ? 353  ARG C CZ    1 
ATOM   6367  N  NH1   . ARG C 2  353  ? 27.606  -15.976 45.792  1.00 104.88 ? 353  ARG C NH1   1 
ATOM   6368  N  NH2   . ARG C 2  353  ? 29.333  -15.229 44.475  1.00 97.01  ? 353  ARG C NH2   1 
ATOM   6369  N  N     . GLY C 2  354  ? 32.365  -19.026 49.073  1.00 81.11  ? 354  GLY C N     1 
ATOM   6370  C  CA    . GLY C 2  354  ? 33.619  -18.317 48.866  1.00 82.43  ? 354  GLY C CA    1 
ATOM   6371  C  C     . GLY C 2  354  ? 34.750  -19.236 48.437  1.00 86.68  ? 354  GLY C C     1 
ATOM   6372  O  O     . GLY C 2  354  ? 35.582  -18.867 47.606  1.00 87.45  ? 354  GLY C O     1 
ATOM   6373  N  N     . VAL C 2  355  ? 34.789  -20.451 48.991  1.00 85.53  ? 355  VAL C N     1 
ATOM   6374  C  CA    . VAL C 2  355  ? 35.855  -21.397 48.665  1.00 74.23  ? 355  VAL C CA    1 
ATOM   6375  C  C     . VAL C 2  355  ? 35.764  -21.831 47.206  1.00 83.36  ? 355  VAL C C     1 
ATOM   6376  O  O     . VAL C 2  355  ? 36.770  -21.863 46.489  1.00 91.66  ? 355  VAL C O     1 
ATOM   6377  C  CB    . VAL C 2  355  ? 35.812  -22.604 49.620  1.00 64.74  ? 355  VAL C CB    1 
ATOM   6378  C  CG1   . VAL C 2  355  ? 36.574  -23.775 49.033  1.00 60.82  ? 355  VAL C CG1   1 
ATOM   6379  C  CG2   . VAL C 2  355  ? 36.400  -22.227 50.968  1.00 66.65  ? 355  VAL C CG2   1 
ATOM   6380  N  N     . ARG C 2  356  ? 34.562  -22.176 46.741  1.00 85.50  ? 356  ARG C N     1 
ATOM   6381  C  CA    . ARG C 2  356  ? 34.410  -22.541 45.332  1.00 84.84  ? 356  ARG C CA    1 
ATOM   6382  C  C     . ARG C 2  356  ? 34.713  -21.355 44.418  1.00 92.31  ? 356  ARG C C     1 
ATOM   6383  O  O     . ARG C 2  356  ? 35.358  -21.511 43.368  1.00 92.25  ? 356  ARG C O     1 
ATOM   6384  C  CB    . ARG C 2  356  ? 33.005  -23.082 45.073  1.00 79.03  ? 356  ARG C CB    1 
ATOM   6385  C  CG    . ARG C 2  356  ? 32.861  -24.568 45.354  1.00 82.54  ? 356  ARG C CG    1 
ATOM   6386  C  CD    . ARG C 2  356  ? 31.422  -25.023 45.207  1.00 91.34  ? 356  ARG C CD    1 
ATOM   6387  N  NE    . ARG C 2  356  ? 30.592  -24.560 46.317  1.00 104.35 ? 356  ARG C NE    1 
ATOM   6388  C  CZ    . ARG C 2  356  ? 30.189  -25.332 47.322  1.00 94.48  ? 356  ARG C CZ    1 
ATOM   6389  N  NH1   . ARG C 2  356  ? 29.438  -24.823 48.290  1.00 76.21  ? 356  ARG C NH1   1 
ATOM   6390  N  NH2   . ARG C 2  356  ? 30.529  -26.614 47.356  1.00 93.34  ? 356  ARG C NH2   1 
ATOM   6391  N  N     . GLU C 2  357  ? 34.265  -20.158 44.812  1.00 93.69  ? 357  GLU C N     1 
ATOM   6392  C  CA    . GLU C 2  357  ? 34.556  -18.949 44.048  1.00 97.85  ? 357  GLU C CA    1 
ATOM   6393  C  C     . GLU C 2  357  ? 36.060  -18.709 43.936  1.00 98.06  ? 357  GLU C C     1 
ATOM   6394  O  O     . GLU C 2  357  ? 36.550  -18.265 42.891  1.00 101.68 ? 357  GLU C O     1 
ATOM   6395  C  CB    . GLU C 2  357  ? 33.855  -17.762 44.709  1.00 99.34  ? 357  GLU C CB    1 
ATOM   6396  C  CG    . GLU C 2  357  ? 33.985  -16.433 43.997  1.00 102.37 ? 357  GLU C CG    1 
ATOM   6397  C  CD    . GLU C 2  357  ? 33.218  -15.335 44.712  1.00 100.90 ? 357  GLU C CD    1 
ATOM   6398  O  OE1   . GLU C 2  357  ? 32.431  -15.657 45.627  1.00 92.22  ? 357  GLU C OE1   1 
ATOM   6399  O  OE2   . GLU C 2  357  ? 33.405  -14.151 44.365  1.00 102.92 ? 357  GLU C OE2   1 
ATOM   6400  N  N     . ARG C 2  358  ? 36.806  -18.999 45.006  1.00 94.66  ? 358  ARG C N     1 
ATOM   6401  C  CA    . ARG C 2  358  ? 38.261  -18.892 44.988  1.00 91.07  ? 358  ARG C CA    1 
ATOM   6402  C  C     . ARG C 2  358  ? 38.921  -20.047 44.247  1.00 91.07  ? 358  ARG C C     1 
ATOM   6403  O  O     . ARG C 2  358  ? 40.075  -19.919 43.826  1.00 83.88  ? 358  ARG C O     1 
ATOM   6404  C  CB    . ARG C 2  358  ? 38.803  -18.834 46.419  1.00 82.75  ? 358  ARG C CB    1 
ATOM   6405  C  CG    . ARG C 2  358  ? 39.639  -17.604 46.741  1.00 80.30  ? 358  ARG C CG    1 
ATOM   6406  C  CD    . ARG C 2  358  ? 38.794  -16.507 47.359  1.00 72.49  ? 358  ARG C CD    1 
ATOM   6407  N  NE    . ARG C 2  358  ? 37.974  -17.016 48.453  1.00 80.08  ? 358  ARG C NE    1 
ATOM   6408  C  CZ    . ARG C 2  358  ? 37.130  -16.274 49.164  1.00 91.27  ? 358  ARG C CZ    1 
ATOM   6409  N  NH1   . ARG C 2  358  ? 36.997  -14.981 48.901  1.00 98.57  ? 358  ARG C NH1   1 
ATOM   6410  N  NH2   . ARG C 2  358  ? 36.418  -16.825 50.139  1.00 86.99  ? 358  ARG C NH2   1 
ATOM   6411  N  N     . MET C 2  359  ? 38.227  -21.178 44.106  1.00 90.27  ? 359  MET C N     1 
ATOM   6412  C  CA    . MET C 2  359  ? 38.756  -22.290 43.324  1.00 95.79  ? 359  MET C CA    1 
ATOM   6413  C  C     . MET C 2  359  ? 38.621  -22.047 41.829  1.00 103.77 ? 359  MET C C     1 
ATOM   6414  O  O     . MET C 2  359  ? 39.417  -22.577 41.046  1.00 106.81 ? 359  MET C O     1 
ATOM   6415  C  CB    . MET C 2  359  ? 38.052  -23.597 43.697  1.00 91.79  ? 359  MET C CB    1 
ATOM   6416  C  CG    . MET C 2  359  ? 38.480  -24.178 45.033  1.00 91.54  ? 359  MET C CG    1 
ATOM   6417  S  SD    . MET C 2  359  ? 37.989  -25.904 45.227  1.00 98.57  ? 359  MET C SD    1 
ATOM   6418  C  CE    . MET C 2  359  ? 36.229  -25.785 44.947  1.00 97.76  ? 359  MET C CE    1 
ATOM   6419  N  N     . LEU C 2  360  ? 37.623  -21.263 41.412  1.00 102.21 ? 360  LEU C N     1 
ATOM   6420  C  CA    . LEU C 2  360  ? 37.535  -20.912 39.997  1.00 100.61 ? 360  LEU C CA    1 
ATOM   6421  C  C     . LEU C 2  360  ? 38.631  -19.928 39.596  1.00 99.69  ? 360  LEU C C     1 
ATOM   6422  O  O     . LEU C 2  360  ? 39.296  -20.116 38.570  1.00 93.86  ? 360  LEU C O     1 
ATOM   6423  C  CB    . LEU C 2  360  ? 36.157  -20.336 39.671  1.00 99.12  ? 360  LEU C CB    1 
ATOM   6424  C  CG    . LEU C 2  360  ? 35.045  -21.341 39.362  1.00 92.98  ? 360  LEU C CG    1 
ATOM   6425  C  CD1   . LEU C 2  360  ? 33.970  -20.679 38.523  1.00 89.49  ? 360  LEU C CD1   1 
ATOM   6426  C  CD2   . LEU C 2  360  ? 35.582  -22.596 38.682  1.00 73.19  ? 360  LEU C CD2   1 
ATOM   6427  N  N     . MET C 2  361  ? 38.843  -18.885 40.393  1.00 107.08 ? 361  MET C N     1 
ATOM   6428  C  CA    . MET C 2  361  ? 39.773  -17.813 40.063  1.00 114.33 ? 361  MET C CA    1 
ATOM   6429  C  C     . MET C 2  361  ? 41.135  -18.056 40.703  1.00 126.28 ? 361  MET C C     1 
ATOM   6430  O  O     . MET C 2  361  ? 41.223  -18.518 41.845  1.00 124.06 ? 361  MET C O     1 
ATOM   6431  C  CB    . MET C 2  361  ? 39.221  -16.463 40.528  1.00 107.01 ? 361  MET C CB    1 
ATOM   6432  C  CG    . MET C 2  361  ? 37.862  -16.109 39.951  1.00 107.86 ? 361  MET C CG    1 
ATOM   6433  S  SD    . MET C 2  361  ? 37.940  -15.677 38.204  1.00 125.47 ? 361  MET C SD    1 
ATOM   6434  C  CE    . MET C 2  361  ? 39.069  -14.285 38.252  1.00 108.05 ? 361  MET C CE    1 
ATOM   6435  N  N     . GLY C 2  362  ? 42.193  -17.733 39.967  1.00 129.60 ? 362  GLY C N     1 
ATOM   6436  C  CA    . GLY C 2  362  ? 43.548  -17.790 40.483  1.00 130.26 ? 362  GLY C CA    1 
ATOM   6437  C  C     . GLY C 2  362  ? 44.337  -18.955 39.907  1.00 128.43 ? 362  GLY C C     1 
ATOM   6438  O  O     . GLY C 2  362  ? 43.835  -19.771 39.132  1.00 129.80 ? 362  GLY C O     1 
ATOM   6439  N  N     . SER C 2  363  ? 45.603  -19.014 40.318  1.00 122.52 ? 363  SER C N     1 
ATOM   6440  C  CA    . SER C 2  363  ? 46.503  -20.059 39.844  1.00 126.19 ? 363  SER C CA    1 
ATOM   6441  C  C     . SER C 2  363  ? 46.019  -21.432 40.294  1.00 127.63 ? 363  SER C C     1 
ATOM   6442  O  O     . SER C 2  363  ? 45.776  -21.661 41.482  1.00 120.28 ? 363  SER C O     1 
ATOM   6443  C  CB    . SER C 2  363  ? 47.921  -19.801 40.357  1.00 121.76 ? 363  SER C CB    1 
ATOM   6444  O  OG    . SER C 2  363  ? 48.411  -18.556 39.891  1.00 110.78 ? 363  SER C OG    1 
ATOM   6445  N  N     . GLU C 2  364  ? 45.884  -22.349 39.333  1.00 136.70 ? 364  GLU C N     1 
ATOM   6446  C  CA    . GLU C 2  364  ? 45.383  -23.689 39.627  1.00 138.56 ? 364  GLU C CA    1 
ATOM   6447  C  C     . GLU C 2  364  ? 46.434  -24.574 40.289  1.00 142.05 ? 364  GLU C C     1 
ATOM   6448  O  O     . GLU C 2  364  ? 46.090  -25.411 41.132  1.00 138.31 ? 364  GLU C O     1 
ATOM   6449  C  CB    . GLU C 2  364  ? 44.887  -24.354 38.341  1.00 136.71 ? 364  GLU C CB    1 
ATOM   6450  C  CG    . GLU C 2  364  ? 43.512  -23.898 37.880  1.00 134.24 ? 364  GLU C CG    1 
ATOM   6451  C  CD    . GLU C 2  364  ? 42.408  -24.400 38.784  1.00 125.24 ? 364  GLU C CD    1 
ATOM   6452  O  OE1   . GLU C 2  364  ? 41.506  -23.603 39.117  1.00 116.66 ? 364  GLU C OE1   1 
ATOM   6453  O  OE2   . GLU C 2  364  ? 42.448  -25.589 39.166  1.00 113.78 ? 364  GLU C OE2   1 
ATOM   6454  N  N     . ASP C 2  365  ? 47.708  -24.409 39.927  1.00 142.29 ? 365  ASP C N     1 
ATOM   6455  C  CA    . ASP C 2  365  ? 48.750  -25.285 40.454  1.00 136.98 ? 365  ASP C CA    1 
ATOM   6456  C  C     . ASP C 2  365  ? 49.114  -24.929 41.889  1.00 130.56 ? 365  ASP C C     1 
ATOM   6457  O  O     . ASP C 2  365  ? 49.326  -25.823 42.716  1.00 127.75 ? 365  ASP C O     1 
ATOM   6458  C  CB    . ASP C 2  365  ? 49.987  -25.229 39.556  1.00 137.45 ? 365  ASP C CB    1 
ATOM   6459  C  CG    . ASP C 2  365  ? 51.127  -26.091 40.074  1.00 135.91 ? 365  ASP C CG    1 
ATOM   6460  O  OD1   . ASP C 2  365  ? 50.866  -27.244 40.481  1.00 133.28 ? 365  ASP C OD1   1 
ATOM   6461  O  OD2   . ASP C 2  365  ? 52.288  -25.623 40.063  1.00 134.72 ? 365  ASP C OD2   1 
ATOM   6462  N  N     . SER C 2  366  ? 49.194  -23.636 42.202  1.00 124.69 ? 366  SER C N     1 
ATOM   6463  C  CA    . SER C 2  366  ? 49.592  -23.170 43.526  1.00 124.70 ? 366  SER C CA    1 
ATOM   6464  C  C     . SER C 2  366  ? 48.348  -22.687 44.261  1.00 118.37 ? 366  SER C C     1 
ATOM   6465  O  O     . SER C 2  366  ? 47.851  -21.587 44.002  1.00 113.84 ? 366  SER C O     1 
ATOM   6466  C  CB    . SER C 2  366  ? 50.641  -22.065 43.421  1.00 118.29 ? 366  SER C CB    1 
ATOM   6467  O  OG    . SER C 2  366  ? 50.129  -20.930 42.743  1.00 108.39 ? 366  SER C OG    1 
ATOM   6468  N  N     . LEU C 2  367  ? 47.858  -23.507 45.192  1.00 111.49 ? 367  LEU C N     1 
ATOM   6469  C  CA    . LEU C 2  367  ? 46.736  -23.138 46.045  1.00 98.65  ? 367  LEU C CA    1 
ATOM   6470  C  C     . LEU C 2  367  ? 46.885  -23.830 47.389  1.00 100.71 ? 367  LEU C C     1 
ATOM   6471  O  O     . LEU C 2  367  ? 47.098  -25.044 47.441  1.00 97.35  ? 367  LEU C O     1 
ATOM   6472  C  CB    . LEU C 2  367  ? 45.395  -23.518 45.412  1.00 92.28  ? 367  LEU C CB    1 
ATOM   6473  C  CG    . LEU C 2  367  ? 44.751  -22.500 44.475  1.00 99.31  ? 367  LEU C CG    1 
ATOM   6474  C  CD1   . LEU C 2  367  ? 43.335  -22.925 44.118  1.00 91.19  ? 367  LEU C CD1   1 
ATOM   6475  C  CD2   . LEU C 2  367  ? 44.762  -21.107 45.090  1.00 91.64  ? 367  LEU C CD2   1 
ATOM   6476  N  N     . THR C 2  368  ? 46.775  -23.060 48.461  1.00 93.20  ? 368  THR C N     1 
ATOM   6477  C  CA    . THR C 2  368  ? 46.803  -23.570 49.820  1.00 86.48  ? 368  THR C CA    1 
ATOM   6478  C  C     . THR C 2  368  ? 45.439  -23.382 50.465  1.00 87.42  ? 368  THR C C     1 
ATOM   6479  O  O     . THR C 2  368  ? 44.641  -22.552 50.014  1.00 82.03  ? 368  THR C O     1 
ATOM   6480  C  CB    . THR C 2  368  ? 47.876  -22.860 50.663  1.00 77.07  ? 368  THR C CB    1 
ATOM   6481  O  OG1   . THR C 2  368  ? 47.784  -21.441 50.475  1.00 64.74  ? 368  THR C OG1   1 
ATOM   6482  C  CG2   . THR C 2  368  ? 49.257  -23.340 50.276  1.00 67.47  ? 368  THR C CG2   1 
ATOM   6483  N  N     . PRO C 2  369  ? 45.119  -24.161 51.506  1.00 78.93  ? 369  PRO C N     1 
ATOM   6484  C  CA    . PRO C 2  369  ? 43.869  -23.911 52.239  1.00 68.14  ? 369  PRO C CA    1 
ATOM   6485  C  C     . PRO C 2  369  ? 43.759  -22.481 52.737  1.00 70.94  ? 369  PRO C C     1 
ATOM   6486  O  O     . PRO C 2  369  ? 42.661  -21.913 52.737  1.00 70.85  ? 369  PRO C O     1 
ATOM   6487  C  CB    . PRO C 2  369  ? 43.940  -24.920 53.392  1.00 67.14  ? 369  PRO C CB    1 
ATOM   6488  C  CG    . PRO C 2  369  ? 44.800  -26.016 52.879  1.00 66.61  ? 369  PRO C CG    1 
ATOM   6489  C  CD    . PRO C 2  369  ? 45.831  -25.343 52.023  1.00 75.45  ? 369  PRO C CD    1 
ATOM   6490  N  N     . ALA C 2  370  ? 44.881  -21.875 53.138  1.00 68.89  ? 370  ALA C N     1 
ATOM   6491  C  CA    . ALA C 2  370  ? 44.858  -20.495 53.613  1.00 71.96  ? 370  ALA C CA    1 
ATOM   6492  C  C     . ALA C 2  370  ? 44.453  -19.521 52.511  1.00 79.04  ? 370  ALA C C     1 
ATOM   6493  O  O     . ALA C 2  370  ? 43.793  -18.511 52.788  1.00 80.93  ? 370  ALA C O     1 
ATOM   6494  C  CB    . ALA C 2  370  ? 46.226  -20.117 54.185  1.00 65.93  ? 370  ALA C CB    1 
ATOM   6495  N  N     . LYS C 2  371  ? 44.831  -19.806 51.262  1.00 81.00  ? 371  LYS C N     1 
ATOM   6496  C  CA    . LYS C 2  371  ? 44.449  -18.949 50.144  1.00 77.61  ? 371  LYS C CA    1 
ATOM   6497  C  C     . LYS C 2  371  ? 42.987  -19.124 49.757  1.00 80.45  ? 371  LYS C C     1 
ATOM   6498  O  O     . LYS C 2  371  ? 42.378  -18.189 49.224  1.00 84.93  ? 371  LYS C O     1 
ATOM   6499  C  CB    . LYS C 2  371  ? 45.332  -19.237 48.930  1.00 83.22  ? 371  LYS C CB    1 
ATOM   6500  C  CG    . LYS C 2  371  ? 46.757  -18.709 49.029  1.00 92.17  ? 371  LYS C CG    1 
ATOM   6501  C  CD    . LYS C 2  371  ? 47.549  -19.074 47.782  1.00 95.41  ? 371  LYS C CD    1 
ATOM   6502  C  CE    . LYS C 2  371  ? 48.989  -18.605 47.885  1.00 83.09  ? 371  LYS C CE    1 
ATOM   6503  N  NZ    . LYS C 2  371  ? 49.817  -19.115 46.757  1.00 81.51  ? 371  LYS C NZ    1 
ATOM   6504  N  N     . LEU C 2  372  ? 42.409  -20.300 50.019  1.00 79.13  ? 372  LEU C N     1 
ATOM   6505  C  CA    . LEU C 2  372  ? 41.042  -20.583 49.591  1.00 78.17  ? 372  LEU C CA    1 
ATOM   6506  C  C     . LEU C 2  372  ? 40.010  -20.090 50.600  1.00 72.31  ? 372  LEU C C     1 
ATOM   6507  O  O     . LEU C 2  372  ? 38.938  -19.614 50.209  1.00 73.38  ? 372  LEU C O     1 
ATOM   6508  C  CB    . LEU C 2  372  ? 40.873  -22.086 49.355  1.00 73.91  ? 372  LEU C CB    1 
ATOM   6509  C  CG    . LEU C 2  372  ? 40.641  -22.593 47.928  1.00 69.65  ? 372  LEU C CG    1 
ATOM   6510  C  CD1   . LEU C 2  372  ? 41.228  -21.642 46.905  1.00 80.81  ? 372  LEU C CD1   1 
ATOM   6511  C  CD2   . LEU C 2  372  ? 41.223  -23.985 47.764  1.00 64.90  ? 372  LEU C CD2   1 
ATOM   6512  N  N     . VAL C 2  373  ? 40.307  -20.197 51.891  1.00 68.81  ? 373  VAL C N     1 
ATOM   6513  C  CA    . VAL C 2  373  ? 39.331  -19.922 52.938  1.00 65.01  ? 373  VAL C CA    1 
ATOM   6514  C  C     . VAL C 2  373  ? 39.421  -18.457 53.343  1.00 66.84  ? 373  VAL C C     1 
ATOM   6515  O  O     . VAL C 2  373  ? 40.480  -17.986 53.774  1.00 63.96  ? 373  VAL C O     1 
ATOM   6516  C  CB    . VAL C 2  373  ? 39.549  -20.839 54.151  1.00 64.98  ? 373  VAL C CB    1 
ATOM   6517  C  CG1   . VAL C 2  373  ? 38.753  -20.345 55.342  1.00 62.02  ? 373  VAL C CG1   1 
ATOM   6518  C  CG2   . VAL C 2  373  ? 39.160  -22.270 53.813  1.00 59.46  ? 373  VAL C CG2   1 
ATOM   6519  N  N     . ASN C 2  374  ? 38.309  -17.738 53.202  1.00 68.73  ? 374  ASN C N     1 
ATOM   6520  C  CA    . ASN C 2  374  ? 38.129  -16.425 53.810  1.00 68.49  ? 374  ASN C CA    1 
ATOM   6521  C  C     . ASN C 2  374  ? 37.204  -16.613 55.007  1.00 73.18  ? 374  ASN C C     1 
ATOM   6522  O  O     . ASN C 2  374  ? 36.019  -16.919 54.839  1.00 78.52  ? 374  ASN C O     1 
ATOM   6523  C  CB    . ASN C 2  374  ? 37.553  -15.421 52.813  1.00 66.91  ? 374  ASN C CB    1 
ATOM   6524  C  CG    . ASN C 2  374  ? 37.339  -14.047 53.423  1.00 73.90  ? 374  ASN C CG    1 
ATOM   6525  O  OD1   . ASN C 2  374  ? 37.905  -13.722 54.464  1.00 76.74  ? 374  ASN C OD1   1 
ATOM   6526  N  ND2   . ASN C 2  374  ? 36.516  -13.233 52.772  1.00 76.83  ? 374  ASN C ND2   1 
ATOM   6527  N  N     . SER C 2  375  ? 37.751  -16.444 56.213  1.00 71.01  ? 375  SER C N     1 
ATOM   6528  C  CA    . SER C 2  375  ? 36.996  -16.751 57.425  1.00 65.71  ? 375  SER C CA    1 
ATOM   6529  C  C     . SER C 2  375  ? 35.833  -15.790 57.636  1.00 68.23  ? 375  SER C C     1 
ATOM   6530  O  O     . SER C 2  375  ? 34.827  -16.165 58.251  1.00 67.30  ? 375  SER C O     1 
ATOM   6531  C  CB    . SER C 2  375  ? 37.927  -16.727 58.640  1.00 67.12  ? 375  SER C CB    1 
ATOM   6532  O  OG    . SER C 2  375  ? 38.619  -15.493 58.747  1.00 72.11  ? 375  SER C OG    1 
ATOM   6533  N  N     . ARG C 2  376  ? 35.947  -14.563 57.119  1.00 74.25  ? 376  ARG C N     1 
ATOM   6534  C  CA    . ARG C 2  376  ? 35.047  -13.451 57.454  1.00 73.25  ? 376  ARG C CA    1 
ATOM   6535  C  C     . ARG C 2  376  ? 33.555  -13.775 57.457  1.00 65.50  ? 376  ARG C C     1 
ATOM   6536  O  O     . ARG C 2  376  ? 32.876  -13.364 58.408  1.00 63.21  ? 376  ARG C O     1 
ATOM   6537  C  CB    . ARG C 2  376  ? 35.331  -12.280 56.501  1.00 76.61  ? 376  ARG C CB    1 
ATOM   6538  C  CG    . ARG C 2  376  ? 36.318  -11.256 57.045  1.00 87.43  ? 376  ARG C CG    1 
ATOM   6539  C  CD    . ARG C 2  376  ? 37.733  -11.815 57.166  1.00 89.25  ? 376  ARG C CD    1 
ATOM   6540  N  NE    . ARG C 2  376  ? 38.693  -10.785 57.561  1.00 93.59  ? 376  ARG C NE    1 
ATOM   6541  C  CZ    . ARG C 2  376  ? 39.035  -10.523 58.819  1.00 89.90  ? 376  ARG C CZ    1 
ATOM   6542  N  NH1   . ARG C 2  376  ? 38.496  -11.220 59.811  1.00 90.45  ? 376  ARG C NH1   1 
ATOM   6543  N  NH2   . ARG C 2  376  ? 39.916  -9.567  59.085  1.00 79.73  ? 376  ARG C NH2   1 
ATOM   6544  N  N     . PRO C 2  377  ? 32.975  -14.455 56.455  1.00 60.55  ? 377  PRO C N     1 
ATOM   6545  C  CA    . PRO C 2  377  ? 31.516  -14.685 56.503  1.00 62.53  ? 377  PRO C CA    1 
ATOM   6546  C  C     . PRO C 2  377  ? 31.057  -15.505 57.697  1.00 61.92  ? 377  PRO C C     1 
ATOM   6547  O  O     . PRO C 2  377  ? 29.997  -15.219 58.270  1.00 68.54  ? 377  PRO C O     1 
ATOM   6548  C  CB    . PRO C 2  377  ? 31.233  -15.404 55.176  1.00 63.42  ? 377  PRO C CB    1 
ATOM   6549  C  CG    . PRO C 2  377  ? 32.535  -15.968 54.755  1.00 59.42  ? 377  PRO C CG    1 
ATOM   6550  C  CD    . PRO C 2  377  ? 33.555  -14.973 55.203  1.00 65.91  ? 377  PRO C CD    1 
ATOM   6551  N  N     . LEU C 2  378  ? 31.824  -16.524 58.086  1.00 56.09  ? 378  LEU C N     1 
ATOM   6552  C  CA    . LEU C 2  378  ? 31.485  -17.302 59.273  1.00 51.38  ? 378  LEU C CA    1 
ATOM   6553  C  C     . LEU C 2  378  ? 31.525  -16.437 60.531  1.00 52.51  ? 378  LEU C C     1 
ATOM   6554  O  O     . LEU C 2  378  ? 30.605  -16.477 61.362  1.00 55.18  ? 378  LEU C O     1 
ATOM   6555  C  CB    . LEU C 2  378  ? 32.443  -18.482 59.395  1.00 52.78  ? 378  LEU C CB    1 
ATOM   6556  C  CG    . LEU C 2  378  ? 32.448  -19.269 60.702  1.00 52.26  ? 378  LEU C CG    1 
ATOM   6557  C  CD1   . LEU C 2  378  ? 31.126  -19.984 60.895  1.00 55.83  ? 378  LEU C CD1   1 
ATOM   6558  C  CD2   . LEU C 2  378  ? 33.601  -20.255 60.706  1.00 51.32  ? 378  LEU C CD2   1 
ATOM   6559  N  N     . GLU C 2  379  ? 32.605  -15.669 60.703  1.00 53.48  ? 379  GLU C N     1 
ATOM   6560  C  CA    . GLU C 2  379  ? 32.671  -14.722 61.811  1.00 60.25  ? 379  GLU C CA    1 
ATOM   6561  C  C     . GLU C 2  379  ? 31.445  -13.820 61.830  1.00 59.69  ? 379  GLU C C     1 
ATOM   6562  O  O     . GLU C 2  379  ? 30.840  -13.595 62.882  1.00 56.09  ? 379  GLU C O     1 
ATOM   6563  C  CB    . GLU C 2  379  ? 33.932  -13.865 61.714  1.00 66.23  ? 379  GLU C CB    1 
ATOM   6564  C  CG    . GLU C 2  379  ? 35.226  -14.595 61.425  1.00 65.59  ? 379  GLU C CG    1 
ATOM   6565  C  CD    . GLU C 2  379  ? 36.395  -13.631 61.279  1.00 73.63  ? 379  GLU C CD    1 
ATOM   6566  O  OE1   . GLU C 2  379  ? 37.223  -13.811 60.358  1.00 69.88  ? 379  GLU C OE1   1 
ATOM   6567  O  OE2   . GLU C 2  379  ? 36.473  -12.679 62.084  1.00 80.73  ? 379  GLU C OE2   1 
ATOM   6568  N  N     . ALA C 2  380  ? 31.084  -13.274 60.667  1.00 57.22  ? 380  ALA C N     1 
ATOM   6569  C  CA    . ALA C 2  380  ? 29.953  -12.357 60.593  1.00 54.96  ? 380  ALA C CA    1 
ATOM   6570  C  C     . ALA C 2  380  ? 28.654  -13.040 60.999  1.00 59.83  ? 380  ALA C C     1 
ATOM   6571  O  O     . ALA C 2  380  ? 27.842  -12.450 61.714  1.00 60.62  ? 380  ALA C O     1 
ATOM   6572  C  CB    . ALA C 2  380  ? 29.838  -11.775 59.190  1.00 49.13  ? 380  ALA C CB    1 
ATOM   6573  N  N     . ALA C 2  381  ? 28.437  -14.280 60.554  1.00 56.22  ? 381  ALA C N     1 
ATOM   6574  C  CA    . ALA C 2  381  ? 27.225  -15.002 60.942  1.00 52.92  ? 381  ALA C CA    1 
ATOM   6575  C  C     . ALA C 2  381  ? 27.157  -15.193 62.452  1.00 52.74  ? 381  ALA C C     1 
ATOM   6576  O  O     . ALA C 2  381  ? 26.116  -14.947 63.078  1.00 50.64  ? 381  ALA C O     1 
ATOM   6577  C  CB    . ALA C 2  381  ? 27.162  -16.351 60.232  1.00 48.41  ? 381  ALA C CB    1 
ATOM   6578  N  N     . ILE C 2  382  ? 28.263  -15.632 63.059  1.00 53.88  ? 382  ILE C N     1 
ATOM   6579  C  CA    . ILE C 2  382  ? 28.266  -15.840 64.507  1.00 47.66  ? 382  ILE C CA    1 
ATOM   6580  C  C     . ILE C 2  382  ? 28.029  -14.522 65.238  1.00 49.66  ? 382  ILE C C     1 
ATOM   6581  O  O     . ILE C 2  382  ? 27.319  -14.472 66.253  1.00 50.55  ? 382  ILE C O     1 
ATOM   6582  C  CB    . ILE C 2  382  ? 29.579  -16.507 64.952  1.00 41.10  ? 382  ILE C CB    1 
ATOM   6583  C  CG1   . ILE C 2  382  ? 29.786  -17.825 64.212  1.00 44.82  ? 382  ILE C CG1   1 
ATOM   6584  C  CG2   . ILE C 2  382  ? 29.565  -16.759 66.445  1.00 40.54  ? 382  ILE C CG2   1 
ATOM   6585  C  CD1   . ILE C 2  382  ? 30.997  -18.604 64.680  1.00 53.89  ? 382  ILE C CD1   1 
ATOM   6586  N  N     . ARG C 2  383  ? 28.619  -13.437 64.735  1.00 52.93  ? 383  ARG C N     1 
ATOM   6587  C  CA    . ARG C 2  383  ? 28.448  -12.127 65.356  1.00 56.38  ? 383  ARG C CA    1 
ATOM   6588  C  C     . ARG C 2  383  ? 27.001  -11.652 65.250  1.00 57.60  ? 383  ARG C C     1 
ATOM   6589  O  O     . ARG C 2  383  ? 26.435  -11.130 66.219  1.00 52.12  ? 383  ARG C O     1 
ATOM   6590  C  CB    . ARG C 2  383  ? 29.411  -11.132 64.709  1.00 58.90  ? 383  ARG C CB    1 
ATOM   6591  C  CG    . ARG C 2  383  ? 29.370  -9.718  65.273  1.00 68.01  ? 383  ARG C CG    1 
ATOM   6592  C  CD    . ARG C 2  383  ? 30.569  -8.892  64.791  1.00 74.62  ? 383  ARG C CD    1 
ATOM   6593  N  NE    . ARG C 2  383  ? 30.802  -9.026  63.353  1.00 77.53  ? 383  ARG C NE    1 
ATOM   6594  C  CZ    . ARG C 2  383  ? 31.815  -9.700  62.813  1.00 71.90  ? 383  ARG C CZ    1 
ATOM   6595  N  NH1   . ARG C 2  383  ? 32.706  -10.305 63.589  1.00 65.39  ? 383  ARG C NH1   1 
ATOM   6596  N  NH2   . ARG C 2  383  ? 31.939  -9.768  61.495  1.00 74.73  ? 383  ARG C NH2   1 
ATOM   6597  N  N     . GLU C 2  384  ? 26.390  -11.818 64.072  1.00 56.31  ? 384  GLU C N     1 
ATOM   6598  C  CA    . GLU C 2  384  ? 24.977  -11.497 63.903  1.00 58.93  ? 384  GLU C CA    1 
ATOM   6599  C  C     . GLU C 2  384  ? 24.114  -12.305 64.859  1.00 57.43  ? 384  GLU C C     1 
ATOM   6600  O  O     . GLU C 2  384  ? 23.114  -11.796 65.378  1.00 57.46  ? 384  GLU C O     1 
ATOM   6601  C  CB    . GLU C 2  384  ? 24.547  -11.756 62.456  1.00 57.37  ? 384  GLU C CB    1 
ATOM   6602  C  CG    . GLU C 2  384  ? 25.155  -10.810 61.426  1.00 76.72  ? 384  GLU C CG    1 
ATOM   6603  C  CD    . GLU C 2  384  ? 25.084  -11.365 60.007  1.00 92.25  ? 384  GLU C CD    1 
ATOM   6604  O  OE1   . GLU C 2  384  ? 24.409  -12.398 59.804  1.00 88.65  ? 384  GLU C OE1   1 
ATOM   6605  O  OE2   . GLU C 2  384  ? 25.707  -10.776 59.095  1.00 86.33  ? 384  GLU C OE2   1 
ATOM   6606  N  N     . PHE C 2  385  ? 24.486  -13.560 65.113  1.00 55.64  ? 385  PHE C N     1 
ATOM   6607  C  CA    . PHE C 2  385  ? 23.709  -14.364 66.049  1.00 48.64  ? 385  PHE C CA    1 
ATOM   6608  C  C     . PHE C 2  385  ? 23.843  -13.846 67.473  1.00 45.51  ? 385  PHE C C     1 
ATOM   6609  O  O     . PHE C 2  385  ? 22.842  -13.685 68.175  1.00 48.83  ? 385  PHE C O     1 
ATOM   6610  C  CB    . PHE C 2  385  ? 24.138  -15.828 65.986  1.00 47.62  ? 385  PHE C CB    1 
ATOM   6611  C  CG    . PHE C 2  385  ? 23.463  -16.698 67.008  1.00 44.15  ? 385  PHE C CG    1 
ATOM   6612  C  CD1   . PHE C 2  385  ? 22.096  -16.897 66.967  1.00 46.69  ? 385  PHE C CD1   1 
ATOM   6613  C  CD2   . PHE C 2  385  ? 24.196  -17.317 68.007  1.00 44.45  ? 385  PHE C CD2   1 
ATOM   6614  C  CE1   . PHE C 2  385  ? 21.468  -17.696 67.898  1.00 41.36  ? 385  PHE C CE1   1 
ATOM   6615  C  CE2   . PHE C 2  385  ? 23.575  -18.124 68.944  1.00 39.85  ? 385  PHE C CE2   1 
ATOM   6616  C  CZ    . PHE C 2  385  ? 22.210  -18.313 68.888  1.00 43.10  ? 385  PHE C CZ    1 
ATOM   6617  N  N     . PHE C 2  386  ? 25.059  -13.574 67.920  1.00 44.56  ? 386  PHE C N     1 
ATOM   6618  C  CA    . PHE C 2  386  ? 25.246  -13.201 69.315  1.00 46.02  ? 386  PHE C CA    1 
ATOM   6619  C  C     . PHE C 2  386  ? 24.992  -11.726 69.594  1.00 52.66  ? 386  PHE C C     1 
ATOM   6620  O  O     . PHE C 2  386  ? 25.015  -11.324 70.763  1.00 50.29  ? 386  PHE C O     1 
ATOM   6621  C  CB    . PHE C 2  386  ? 26.649  -13.581 69.781  1.00 46.75  ? 386  PHE C CB    1 
ATOM   6622  C  CG    . PHE C 2  386  ? 26.797  -15.036 70.070  1.00 43.92  ? 386  PHE C CG    1 
ATOM   6623  C  CD1   . PHE C 2  386  ? 26.491  -15.535 71.321  1.00 42.31  ? 386  PHE C CD1   1 
ATOM   6624  C  CD2   . PHE C 2  386  ? 27.205  -15.911 69.083  1.00 44.14  ? 386  PHE C CD2   1 
ATOM   6625  C  CE1   . PHE C 2  386  ? 26.611  -16.881 71.590  1.00 45.44  ? 386  PHE C CE1   1 
ATOM   6626  C  CE2   . PHE C 2  386  ? 27.330  -17.262 69.345  1.00 43.13  ? 386  PHE C CE2   1 
ATOM   6627  C  CZ    . PHE C 2  386  ? 27.029  -17.747 70.599  1.00 42.32  ? 386  PHE C CZ    1 
ATOM   6628  N  N     . SER C 2  387  ? 24.740  -10.909 68.571  1.00 63.06  ? 387  SER C N     1 
ATOM   6629  C  CA    . SER C 2  387  ? 24.470  -9.491  68.777  1.00 63.33  ? 387  SER C CA    1 
ATOM   6630  C  C     . SER C 2  387  ? 23.042  -9.109  68.410  1.00 59.77  ? 387  SER C C     1 
ATOM   6631  O  O     . SER C 2  387  ? 22.327  -8.526  69.231  1.00 61.89  ? 387  SER C O     1 
ATOM   6632  C  CB    . SER C 2  387  ? 25.467  -8.642  67.977  1.00 57.51  ? 387  SER C CB    1 
ATOM   6633  O  OG    . SER C 2  387  ? 26.800  -8.917  68.367  1.00 48.27  ? 387  SER C OG    1 
ATOM   6634  N  N     . ARG C 2  388  ? 22.599  -9.434  67.199  1.00 53.53  ? 388  ARG C N     1 
ATOM   6635  C  CA    . ARG C 2  388  ? 21.331  -8.939  66.688  1.00 60.01  ? 388  ARG C CA    1 
ATOM   6636  C  C     . ARG C 2  388  ? 20.284  -10.032 66.495  1.00 54.48  ? 388  ARG C C     1 
ATOM   6637  O  O     . ARG C 2  388  ? 19.316  -9.819  65.755  1.00 52.83  ? 388  ARG C O     1 
ATOM   6638  C  CB    . ARG C 2  388  ? 21.572  -8.181  65.383  1.00 68.20  ? 388  ARG C CB    1 
ATOM   6639  C  CG    . ARG C 2  388  ? 22.130  -6.780  65.596  1.00 68.85  ? 388  ARG C CG    1 
ATOM   6640  C  CD    . ARG C 2  388  ? 22.848  -6.260  64.364  1.00 95.31  ? 388  ARG C CD    1 
ATOM   6641  N  NE    . ARG C 2  388  ? 24.266  -6.608  64.383  1.00 102.30 ? 388  ARG C NE    1 
ATOM   6642  C  CZ    . ARG C 2  388  ? 25.196  -5.902  65.021  1.00 104.04 ? 388  ARG C CZ    1 
ATOM   6643  N  NH1   . ARG C 2  388  ? 24.856  -4.811  65.695  1.00 91.54  ? 388  ARG C NH1   1 
ATOM   6644  N  NH2   . ARG C 2  388  ? 26.466  -6.288  64.987  1.00 93.26  ? 388  ARG C NH2   1 
ATOM   6645  N  N     . SER C 2  389  ? 20.442  -11.188 67.136  1.00 49.31  ? 389  SER C N     1 
ATOM   6646  C  CA    . SER C 2  389  ? 19.395  -12.200 67.105  1.00 49.25  ? 389  SER C CA    1 
ATOM   6647  C  C     . SER C 2  389  ? 18.290  -11.858 68.095  1.00 50.70  ? 389  SER C C     1 
ATOM   6648  O  O     . SER C 2  389  ? 18.508  -11.162 69.091  1.00 54.70  ? 389  SER C O     1 
ATOM   6649  C  CB    . SER C 2  389  ? 19.956  -13.585 67.424  1.00 44.44  ? 389  SER C CB    1 
ATOM   6650  O  OG    . SER C 2  389  ? 18.923  -14.557 67.511  1.00 36.78  ? 389  SER C OG    1 
ATOM   6651  N  N     . GLN C 2  390  ? 17.091  -12.362 67.813  1.00 51.03  ? 390  GLN C N     1 
ATOM   6652  C  CA    . GLN C 2  390  ? 15.961  -12.119 68.697  1.00 46.45  ? 390  GLN C CA    1 
ATOM   6653  C  C     . GLN C 2  390  ? 15.982  -13.008 69.931  1.00 49.78  ? 390  GLN C C     1 
ATOM   6654  O  O     . GLN C 2  390  ? 15.390  -12.640 70.951  1.00 55.15  ? 390  GLN C O     1 
ATOM   6655  C  CB    . GLN C 2  390  ? 14.652  -12.314 67.936  1.00 57.34  ? 390  GLN C CB    1 
ATOM   6656  C  CG    . GLN C 2  390  ? 14.444  -11.296 66.831  1.00 75.51  ? 390  GLN C CG    1 
ATOM   6657  C  CD    . GLN C 2  390  ? 13.191  -11.565 66.029  1.00 92.28  ? 390  GLN C CD    1 
ATOM   6658  O  OE1   . GLN C 2  390  ? 12.576  -12.625 66.156  1.00 97.71  ? 390  GLN C OE1   1 
ATOM   6659  N  NE2   . GLN C 2  390  ? 12.802  -10.605 65.197  1.00 87.27  ? 390  GLN C NE2   1 
ATOM   6660  N  N     . LEU C 2  391  ? 16.638  -14.164 69.861  1.00 47.95  ? 391  LEU C N     1 
ATOM   6661  C  CA    . LEU C 2  391  ? 16.809  -15.023 71.023  1.00 36.50  ? 391  LEU C CA    1 
ATOM   6662  C  C     . LEU C 2  391  ? 18.034  -14.653 71.844  1.00 36.92  ? 391  LEU C C     1 
ATOM   6663  O  O     . LEU C 2  391  ? 18.210  -15.185 72.943  1.00 38.62  ? 391  LEU C O     1 
ATOM   6664  C  CB    . LEU C 2  391  ? 16.894  -16.488 70.585  1.00 28.36  ? 391  LEU C CB    1 
ATOM   6665  C  CG    . LEU C 2  391  ? 15.603  -16.964 69.919  1.00 37.61  ? 391  LEU C CG    1 
ATOM   6666  C  CD1   . LEU C 2  391  ? 15.738  -18.359 69.354  1.00 37.91  ? 391  LEU C CD1   1 
ATOM   6667  C  CD2   . LEU C 2  391  ? 14.462  -16.906 70.918  1.00 44.43  ? 391  LEU C CD2   1 
ATOM   6668  N  N     . SER C 2  392  ? 18.873  -13.753 71.339  1.00 39.22  ? 392  SER C N     1 
ATOM   6669  C  CA    . SER C 2  392  ? 20.012  -13.233 72.085  1.00 36.89  ? 392  SER C CA    1 
ATOM   6670  C  C     . SER C 2  392  ? 19.566  -11.957 72.783  1.00 38.98  ? 392  SER C C     1 
ATOM   6671  O  O     . SER C 2  392  ? 19.383  -10.920 72.137  1.00 43.36  ? 392  SER C O     1 
ATOM   6672  C  CB    . SER C 2  392  ? 21.191  -12.966 71.154  1.00 40.22  ? 392  SER C CB    1 
ATOM   6673  O  OG    . SER C 2  392  ? 22.319  -12.504 71.870  1.00 41.28  ? 392  SER C OG    1 
ATOM   6674  N  N     . GLN C 2  393  ? 19.395  -12.027 74.099  1.00 37.73  ? 393  GLN C N     1 
ATOM   6675  C  CA    . GLN C 2  393  ? 18.815  -10.938 74.863  1.00 38.97  ? 393  GLN C CA    1 
ATOM   6676  C  C     . GLN C 2  393  ? 19.831  -10.383 75.850  1.00 38.10  ? 393  GLN C C     1 
ATOM   6677  O  O     . GLN C 2  393  ? 20.718  -11.097 76.328  1.00 37.03  ? 393  GLN C O     1 
ATOM   6678  C  CB    . GLN C 2  393  ? 17.553  -11.407 75.605  1.00 33.43  ? 393  GLN C CB    1 
ATOM   6679  C  CG    . GLN C 2  393  ? 16.460  -11.933 74.679  1.00 34.57  ? 393  GLN C CG    1 
ATOM   6680  C  CD    . GLN C 2  393  ? 15.253  -12.467 75.431  1.00 45.74  ? 393  GLN C CD    1 
ATOM   6681  O  OE1   . GLN C 2  393  ? 15.321  -12.733 76.632  1.00 50.09  ? 393  GLN C OE1   1 
ATOM   6682  N  NE2   . GLN C 2  393  ? 14.138  -12.627 74.725  1.00 44.70  ? 393  GLN C NE2   1 
ATOM   6683  N  N     . PHE C 2  394  ? 19.705  -9.090  76.128  1.00 39.66  ? 394  PHE C N     1 
ATOM   6684  C  CA    . PHE C 2  394  ? 20.489  -8.467  77.181  1.00 39.72  ? 394  PHE C CA    1 
ATOM   6685  C  C     . PHE C 2  394  ? 20.182  -9.154  78.505  1.00 39.30  ? 394  PHE C C     1 
ATOM   6686  O  O     . PHE C 2  394  ? 19.026  -9.198  78.934  1.00 45.77  ? 394  PHE C O     1 
ATOM   6687  C  CB    . PHE C 2  394  ? 20.162  -6.975  77.246  1.00 40.68  ? 394  PHE C CB    1 
ATOM   6688  C  CG    . PHE C 2  394  ? 21.193  -6.153  77.963  1.00 47.37  ? 394  PHE C CG    1 
ATOM   6689  C  CD1   . PHE C 2  394  ? 22.502  -6.113  77.514  1.00 55.15  ? 394  PHE C CD1   1 
ATOM   6690  C  CD2   . PHE C 2  394  ? 20.846  -5.394  79.069  1.00 47.58  ? 394  PHE C CD2   1 
ATOM   6691  C  CE1   . PHE C 2  394  ? 23.451  -5.348  78.167  1.00 61.32  ? 394  PHE C CE1   1 
ATOM   6692  C  CE2   . PHE C 2  394  ? 21.789  -4.627  79.725  1.00 50.57  ? 394  PHE C CE2   1 
ATOM   6693  C  CZ    . PHE C 2  394  ? 23.093  -4.603  79.274  1.00 58.10  ? 394  PHE C CZ    1 
ATOM   6694  N  N     . LYS C 2  395  ? 21.210  -9.718  79.134  1.00 33.25  ? 395  LYS C N     1 
ATOM   6695  C  CA    . LYS C 2  395  ? 21.012  -10.486 80.356  1.00 33.71  ? 395  LYS C CA    1 
ATOM   6696  C  C     . LYS C 2  395  ? 20.408  -9.621  81.453  1.00 36.31  ? 395  LYS C C     1 
ATOM   6697  O  O     . LYS C 2  395  ? 20.730  -8.437  81.583  1.00 36.17  ? 395  LYS C O     1 
ATOM   6698  C  CB    . LYS C 2  395  ? 22.344  -11.073 80.827  1.00 42.05  ? 395  LYS C CB    1 
ATOM   6699  C  CG    . LYS C 2  395  ? 22.302  -11.820 82.151  1.00 33.51  ? 395  LYS C CG    1 
ATOM   6700  C  CD    . LYS C 2  395  ? 23.692  -12.313 82.513  1.00 32.90  ? 395  LYS C CD    1 
ATOM   6701  C  CE    . LYS C 2  395  ? 23.708  -13.060 83.826  1.00 36.43  ? 395  LYS C CE    1 
ATOM   6702  N  NZ    . LYS C 2  395  ? 25.090  -13.469 84.202  1.00 40.37  ? 395  LYS C NZ    1 
ATOM   6703  N  N     . ASP C 2  396  ? 19.517  -10.219 82.240  1.00 39.40  ? 396  ASP C N     1 
ATOM   6704  C  CA    . ASP C 2  396  ? 18.924  -9.566  83.401  1.00 42.00  ? 396  ASP C CA    1 
ATOM   6705  C  C     . ASP C 2  396  ? 19.710  -9.982  84.641  1.00 38.73  ? 396  ASP C C     1 
ATOM   6706  O  O     . ASP C 2  396  ? 19.591  -11.120 85.104  1.00 34.23  ? 396  ASP C O     1 
ATOM   6707  C  CB    . ASP C 2  396  ? 17.447  -9.932  83.533  1.00 37.64  ? 396  ASP C CB    1 
ATOM   6708  C  CG    . ASP C 2  396  ? 16.745  -9.136  84.619  1.00 50.32  ? 396  ASP C CG    1 
ATOM   6709  O  OD1   . ASP C 2  396  ? 17.347  -8.170  85.135  1.00 51.18  ? 396  ASP C OD1   1 
ATOM   6710  O  OD2   . ASP C 2  396  ? 15.591  -9.479  84.961  1.00 56.91  ? 396  ASP C OD2   1 
ATOM   6711  N  N     . GLU C 2  397  ? 20.516  -9.060  85.174  1.00 38.69  ? 397  GLU C N     1 
ATOM   6712  C  CA    . GLU C 2  397  ? 21.315  -9.296  86.372  1.00 40.59  ? 397  GLU C CA    1 
ATOM   6713  C  C     . GLU C 2  397  ? 20.776  -8.567  87.597  1.00 45.90  ? 397  GLU C C     1 
ATOM   6714  O  O     . GLU C 2  397  ? 21.509  -8.430  88.584  1.00 45.16  ? 397  GLU C O     1 
ATOM   6715  C  CB    . GLU C 2  397  ? 22.768  -8.867  86.157  1.00 41.94  ? 397  GLU C CB    1 
ATOM   6716  C  CG    . GLU C 2  397  ? 23.406  -9.285  84.853  1.00 42.10  ? 397  GLU C CG    1 
ATOM   6717  C  CD    . GLU C 2  397  ? 24.885  -8.924  84.803  1.00 51.34  ? 397  GLU C CD    1 
ATOM   6718  O  OE1   . GLU C 2  397  ? 25.719  -9.763  85.208  1.00 54.36  ? 397  GLU C OE1   1 
ATOM   6719  O  OE2   . GLU C 2  397  ? 25.215  -7.798  84.374  1.00 52.98  ? 397  GLU C OE2   1 
ATOM   6720  N  N     . THR C 2  398  ? 19.536  -8.065  87.543  1.00 41.96  ? 398  THR C N     1 
ATOM   6721  C  CA    . THR C 2  398  ? 18.989  -7.239  88.619  1.00 37.24  ? 398  THR C CA    1 
ATOM   6722  C  C     . THR C 2  398  ? 19.254  -7.852  89.986  1.00 36.85  ? 398  THR C C     1 
ATOM   6723  O  O     . THR C 2  398  ? 19.813  -7.201  90.880  1.00 36.07  ? 398  THR C O     1 
ATOM   6724  C  CB    . THR C 2  398  ? 17.489  -7.042  88.404  1.00 35.58  ? 398  THR C CB    1 
ATOM   6725  O  OG1   . THR C 2  398  ? 17.251  -6.650  87.049  1.00 38.88  ? 398  THR C OG1   1 
ATOM   6726  C  CG2   . THR C 2  398  ? 16.965  -5.963  89.332  1.00 34.54  ? 398  THR C CG2   1 
ATOM   6727  N  N     . ASN C 2  399  ? 18.861  -9.108  90.154  1.00 34.11  ? 399  ASN C N     1 
ATOM   6728  C  CA    . ASN C 2  399  ? 19.286  -9.961  91.255  1.00 32.94  ? 399  ASN C CA    1 
ATOM   6729  C  C     . ASN C 2  399  ? 19.641  -11.312 90.664  1.00 37.85  ? 399  ASN C C     1 
ATOM   6730  O  O     . ASN C 2  399  ? 19.419  -11.543 89.474  1.00 34.31  ? 399  ASN C O     1 
ATOM   6731  C  CB    . ASN C 2  399  ? 18.185  -10.084 92.317  1.00 27.53  ? 399  ASN C CB    1 
ATOM   6732  C  CG    . ASN C 2  399  ? 16.915  -10.689 91.772  1.00 32.05  ? 399  ASN C CG    1 
ATOM   6733  O  OD1   . ASN C 2  399  ? 16.830  -11.895 91.558  1.00 32.36  ? 399  ASN C OD1   1 
ATOM   6734  N  ND2   . ASN C 2  399  ? 15.912  -9.852  91.555  1.00 31.20  ? 399  ASN C ND2   1 
ATOM   6735  N  N     . PRO C 2  400  ? 20.231  -12.223 91.447  1.00 34.82  ? 400  PRO C N     1 
ATOM   6736  C  CA    . PRO C 2  400  ? 20.646  -13.515 90.863  1.00 30.40  ? 400  PRO C CA    1 
ATOM   6737  C  C     . PRO C 2  400  ? 19.494  -14.335 90.298  1.00 31.20  ? 400  PRO C C     1 
ATOM   6738  O  O     . PRO C 2  400  ? 19.639  -14.976 89.241  1.00 36.37  ? 400  PRO C O     1 
ATOM   6739  C  CB    . PRO C 2  400  ? 21.323  -14.215 92.048  1.00 35.55  ? 400  PRO C CB    1 
ATOM   6740  C  CG    . PRO C 2  400  ? 21.805  -13.085 92.914  1.00 32.76  ? 400  PRO C CG    1 
ATOM   6741  C  CD    . PRO C 2  400  ? 20.744  -12.045 92.815  1.00 27.98  ? 400  PRO C CD    1 
ATOM   6742  N  N     . LEU C 2  401  ? 18.342  -14.322 90.977  1.00 27.25  ? 401  LEU C N     1 
ATOM   6743  C  CA    . LEU C 2  401  ? 17.167  -15.013 90.459  1.00 30.04  ? 401  LEU C CA    1 
ATOM   6744  C  C     . LEU C 2  401  ? 16.773  -14.490 89.084  1.00 36.16  ? 401  LEU C C     1 
ATOM   6745  O  O     . LEU C 2  401  ? 16.255  -15.253 88.259  1.00 34.78  ? 401  LEU C O     1 
ATOM   6746  C  CB    . LEU C 2  401  ? 16.009  -14.877 91.446  1.00 27.09  ? 401  LEU C CB    1 
ATOM   6747  C  CG    . LEU C 2  401  ? 14.630  -15.389 91.034  1.00 29.47  ? 401  LEU C CG    1 
ATOM   6748  C  CD1   . LEU C 2  401  ? 14.663  -16.891 90.810  1.00 29.95  ? 401  LEU C CD1   1 
ATOM   6749  C  CD2   . LEU C 2  401  ? 13.588  -15.014 92.080  1.00 25.55  ? 401  LEU C CD2   1 
ATOM   6750  N  N     . SER C 2  402  ? 17.029  -13.205 88.809  1.00 35.14  ? 402  SER C N     1 
ATOM   6751  C  CA    . SER C 2  402  ? 16.761  -12.662 87.479  1.00 36.41  ? 402  SER C CA    1 
ATOM   6752  C  C     . SER C 2  402  ? 17.527  -13.435 86.411  1.00 38.49  ? 402  SER C C     1 
ATOM   6753  O  O     . SER C 2  402  ? 16.942  -13.897 85.425  1.00 40.59  ? 402  SER C O     1 
ATOM   6754  C  CB    . SER C 2  402  ? 17.127  -11.176 87.426  1.00 37.91  ? 402  SER C CB    1 
ATOM   6755  O  OG    . SER C 2  402  ? 17.031  -10.565 88.701  1.00 37.17  ? 402  SER C OG    1 
ATOM   6756  N  N     . SER C 2  403  ? 18.843  -13.584 86.598  1.00 36.88  ? 403  SER C N     1 
ATOM   6757  C  CA    . SER C 2  403  ? 19.667  -14.302 85.631  1.00 31.85  ? 403  SER C CA    1 
ATOM   6758  C  C     . SER C 2  403  ? 19.252  -15.762 85.525  1.00 33.86  ? 403  SER C C     1 
ATOM   6759  O  O     . SER C 2  403  ? 19.166  -16.313 84.419  1.00 31.33  ? 403  SER C O     1 
ATOM   6760  C  CB    . SER C 2  403  ? 21.139  -14.199 86.023  1.00 30.20  ? 403  SER C CB    1 
ATOM   6761  O  OG    . SER C 2  403  ? 21.491  -12.862 86.318  1.00 36.46  ? 403  SER C OG    1 
ATOM   6762  N  N     . LEU C 2  404  ? 18.999  -16.411 86.666  1.00 32.56  ? 404  LEU C N     1 
ATOM   6763  C  CA    . LEU C 2  404  ? 18.594  -17.816 86.632  1.00 32.92  ? 404  LEU C CA    1 
ATOM   6764  C  C     . LEU C 2  404  ? 17.314  -18.000 85.816  1.00 33.69  ? 404  LEU C C     1 
ATOM   6765  O  O     . LEU C 2  404  ? 17.251  -18.843 84.905  1.00 30.40  ? 404  LEU C O     1 
ATOM   6766  C  CB    . LEU C 2  404  ? 18.425  -18.336 88.061  1.00 30.97  ? 404  LEU C CB    1 
ATOM   6767  C  CG    . LEU C 2  404  ? 18.172  -19.824 88.303  1.00 29.82  ? 404  LEU C CG    1 
ATOM   6768  C  CD1   . LEU C 2  404  ? 19.278  -20.672 87.710  1.00 33.72  ? 404  LEU C CD1   1 
ATOM   6769  C  CD2   . LEU C 2  404  ? 18.054  -20.084 89.792  1.00 33.32  ? 404  LEU C CD2   1 
ATOM   6770  N  N     . ARG C 2  405  ? 16.288  -17.189 86.104  1.00 35.59  ? 405  ARG C N     1 
ATOM   6771  C  CA    . ARG C 2  405  ? 15.038  -17.284 85.357  1.00 33.29  ? 405  ARG C CA    1 
ATOM   6772  C  C     . ARG C 2  405  ? 15.247  -16.969 83.883  1.00 38.97  ? 405  ARG C C     1 
ATOM   6773  O  O     . ARG C 2  405  ? 14.707  -17.662 83.011  1.00 38.04  ? 405  ARG C O     1 
ATOM   6774  C  CB    . ARG C 2  405  ? 13.993  -16.341 85.943  1.00 33.19  ? 405  ARG C CB    1 
ATOM   6775  C  CG    . ARG C 2  405  ? 12.652  -16.474 85.256  1.00 43.34  ? 405  ARG C CG    1 
ATOM   6776  C  CD    . ARG C 2  405  ? 11.750  -15.282 85.499  1.00 43.40  ? 405  ARG C CD    1 
ATOM   6777  N  NE    . ARG C 2  405  ? 11.950  -14.226 84.512  1.00 48.14  ? 405  ARG C NE    1 
ATOM   6778  C  CZ    . ARG C 2  405  ? 11.047  -13.292 84.238  1.00 48.68  ? 405  ARG C CZ    1 
ATOM   6779  N  NH1   . ARG C 2  405  ? 9.880   -13.292 84.873  1.00 38.32  ? 405  ARG C NH1   1 
ATOM   6780  N  NH2   . ARG C 2  405  ? 11.304  -12.363 83.326  1.00 47.63  ? 405  ARG C NH2   1 
ATOM   6781  N  N     . HIS C 2  406  ? 16.015  -15.916 83.586  1.00 36.00  ? 406  HIS C N     1 
ATOM   6782  C  CA    . HIS C 2  406  ? 16.306  -15.562 82.203  1.00 31.47  ? 406  HIS C CA    1 
ATOM   6783  C  C     . HIS C 2  406  ? 16.918  -16.739 81.461  1.00 31.59  ? 406  HIS C C     1 
ATOM   6784  O  O     . HIS C 2  406  ? 16.593  -16.989 80.296  1.00 36.11  ? 406  HIS C O     1 
ATOM   6785  C  CB    . HIS C 2  406  ? 17.245  -14.355 82.167  1.00 30.96  ? 406  HIS C CB    1 
ATOM   6786  C  CG    . HIS C 2  406  ? 17.244  -13.619 80.864  1.00 33.73  ? 406  HIS C CG    1 
ATOM   6787  N  ND1   . HIS C 2  406  ? 17.939  -12.443 80.677  1.00 37.80  ? 406  HIS C ND1   1 
ATOM   6788  C  CD2   . HIS C 2  406  ? 16.632  -13.885 79.685  1.00 34.27  ? 406  HIS C CD2   1 
ATOM   6789  C  CE1   . HIS C 2  406  ? 17.758  -12.018 79.439  1.00 39.22  ? 406  HIS C CE1   1 
ATOM   6790  N  NE2   . HIS C 2  406  ? 16.968  -12.875 78.816  1.00 34.81  ? 406  HIS C NE2   1 
ATOM   6791  N  N     . LYS C 2  407  ? 17.796  -17.485 82.130  1.00 29.98  ? 407  LYS C N     1 
ATOM   6792  C  CA    . LYS C 2  407  ? 18.399  -18.649 81.499  1.00 28.49  ? 407  LYS C CA    1 
ATOM   6793  C  C     . LYS C 2  407  ? 17.420  -19.808 81.370  1.00 29.07  ? 407  LYS C C     1 
ATOM   6794  O  O     . LYS C 2  407  ? 17.625  -20.681 80.519  1.00 29.47  ? 407  LYS C O     1 
ATOM   6795  C  CB    . LYS C 2  407  ? 19.645  -19.070 82.279  1.00 26.10  ? 407  LYS C CB    1 
ATOM   6796  C  CG    . LYS C 2  407  ? 20.799  -18.084 82.137  1.00 28.90  ? 407  LYS C CG    1 
ATOM   6797  C  CD    . LYS C 2  407  ? 21.743  -18.131 83.326  1.00 33.61  ? 407  LYS C CD    1 
ATOM   6798  C  CE    . LYS C 2  407  ? 22.735  -16.975 83.287  1.00 34.40  ? 407  LYS C CE    1 
ATOM   6799  N  NZ    . LYS C 2  407  ? 23.439  -16.792 84.592  1.00 37.27  ? 407  LYS C NZ    1 
ATOM   6800  N  N     . ARG C 2  408  ? 16.356  -19.836 82.174  1.00 33.21  ? 408  ARG C N     1 
ATOM   6801  C  CA    . ARG C 2  408  ? 15.357  -20.897 82.070  1.00 29.18  ? 408  ARG C CA    1 
ATOM   6802  C  C     . ARG C 2  408  ? 14.130  -20.513 81.243  1.00 30.30  ? 408  ARG C C     1 
ATOM   6803  O  O     . ARG C 2  408  ? 13.122  -21.223 81.302  1.00 29.02  ? 408  ARG C O     1 
ATOM   6804  C  CB    . ARG C 2  408  ? 14.910  -21.347 83.461  1.00 26.20  ? 408  ARG C CB    1 
ATOM   6805  C  CG    . ARG C 2  408  ? 16.007  -21.992 84.282  1.00 27.79  ? 408  ARG C CG    1 
ATOM   6806  C  CD    . ARG C 2  408  ? 15.555  -22.255 85.710  1.00 35.72  ? 408  ARG C CD    1 
ATOM   6807  N  NE    . ARG C 2  408  ? 14.513  -23.274 85.782  1.00 34.46  ? 408  ARG C NE    1 
ATOM   6808  C  CZ    . ARG C 2  408  ? 14.760  -24.577 85.850  1.00 38.94  ? 408  ARG C CZ    1 
ATOM   6809  N  NH1   . ARG C 2  408  ? 13.762  -25.445 85.911  1.00 41.75  ? 408  ARG C NH1   1 
ATOM   6810  N  NH2   . ARG C 2  408  ? 16.011  -25.012 85.853  1.00 38.15  ? 408  ARG C NH2   1 
ATOM   6811  N  N     . ARG C 2  409  ? 14.187  -19.429 80.469  1.00 33.74  ? 409  ARG C N     1 
ATOM   6812  C  CA    . ARG C 2  409  ? 13.034  -19.005 79.682  1.00 32.52  ? 409  ARG C CA    1 
ATOM   6813  C  C     . ARG C 2  409  ? 12.875  -19.850 78.416  1.00 33.85  ? 409  ARG C C     1 
ATOM   6814  O  O     . ARG C 2  409  ? 13.820  -20.475 77.923  1.00 33.15  ? 409  ARG C O     1 
ATOM   6815  C  CB    . ARG C 2  409  ? 13.150  -17.533 79.285  1.00 34.63  ? 409  ARG C CB    1 
ATOM   6816  C  CG    . ARG C 2  409  ? 13.312  -16.557 80.438  1.00 41.94  ? 409  ARG C CG    1 
ATOM   6817  C  CD    . ARG C 2  409  ? 12.081  -15.683 80.616  1.00 46.41  ? 409  ARG C CD    1 
ATOM   6818  N  NE    . ARG C 2  409  ? 11.023  -16.364 81.357  1.00 53.44  ? 409  ARG C NE    1 
ATOM   6819  C  CZ    . ARG C 2  409  ? 9.818   -15.850 81.582  1.00 50.03  ? 409  ARG C CZ    1 
ATOM   6820  N  NH1   . ARG C 2  409  ? 9.509   -14.645 81.118  1.00 52.17  ? 409  ARG C NH1   1 
ATOM   6821  N  NH2   . ARG C 2  409  ? 8.919   -16.543 82.269  1.00 43.37  ? 409  ARG C NH2   1 
ATOM   6822  N  N     . ILE C 2  410  ? 11.653  -19.838 77.879  1.00 33.09  ? 410  ILE C N     1 
ATOM   6823  C  CA    . ILE C 2  410  ? 11.293  -20.522 76.638  1.00 31.54  ? 410  ILE C CA    1 
ATOM   6824  C  C     . ILE C 2  410  ? 10.446  -19.560 75.817  1.00 31.47  ? 410  ILE C C     1 
ATOM   6825  O  O     . ILE C 2  410  ? 9.424   -19.069 76.305  1.00 33.70  ? 410  ILE C O     1 
ATOM   6826  C  CB    . ILE C 2  410  ? 10.503  -21.821 76.889  1.00 28.46  ? 410  ILE C CB    1 
ATOM   6827  C  CG1   . ILE C 2  410  ? 11.278  -22.771 77.800  1.00 27.81  ? 410  ILE C CG1   1 
ATOM   6828  C  CG2   . ILE C 2  410  ? 10.158  -22.501 75.578  1.00 26.67  ? 410  ILE C CG2   1 
ATOM   6829  C  CD1   . ILE C 2  410  ? 10.492  -23.999 78.193  1.00 28.96  ? 410  ILE C CD1   1 
ATOM   6830  N  N     . SER C 2  411  ? 10.850  -19.297 74.578  1.00 29.90  ? 411  SER C N     1 
ATOM   6831  C  CA    . SER C 2  411  ? 10.115  -18.385 73.712  1.00 32.60  ? 411  SER C CA    1 
ATOM   6832  C  C     . SER C 2  411  ? 9.582   -19.124 72.493  1.00 32.71  ? 411  SER C C     1 
ATOM   6833  O  O     . SER C 2  411  ? 10.228  -20.040 71.978  1.00 33.99  ? 411  SER C O     1 
ATOM   6834  C  CB    . SER C 2  411  ? 10.990  -17.210 73.261  1.00 35.70  ? 411  SER C CB    1 
ATOM   6835  O  OG    . SER C 2  411  ? 10.236  -16.294 72.482  1.00 41.34  ? 411  SER C OG    1 
ATOM   6836  N  N     . ALA C 2  412  ? 8.391   -18.726 72.047  1.00 39.26  ? 412  ALA C N     1 
ATOM   6837  C  CA    . ALA C 2  412  ? 7.809   -19.232 70.813  1.00 43.39  ? 412  ALA C CA    1 
ATOM   6838  C  C     . ALA C 2  412  ? 8.076   -18.324 69.625  1.00 54.48  ? 412  ALA C C     1 
ATOM   6839  O  O     . ALA C 2  412  ? 7.752   -18.697 68.493  1.00 59.22  ? 412  ALA C O     1 
ATOM   6840  C  CB    . ALA C 2  412  ? 6.297   -19.424 70.975  1.00 49.83  ? 412  ALA C CB    1 
ATOM   6841  N  N     . LEU C 2  413  ? 8.649   -17.148 69.859  1.00 59.41  ? 413  LEU C N     1 
ATOM   6842  C  CA    . LEU C 2  413  ? 9.009   -16.214 68.805  1.00 62.15  ? 413  LEU C CA    1 
ATOM   6843  C  C     . LEU C 2  413  ? 10.426  -16.526 68.327  1.00 67.27  ? 413  LEU C C     1 
ATOM   6844  O  O     . LEU C 2  413  ? 10.989  -17.579 68.634  1.00 65.59  ? 413  LEU C O     1 
ATOM   6845  C  CB    . LEU C 2  413  ? 8.884   -14.774 69.302  1.00 64.25  ? 413  LEU C CB    1 
ATOM   6846  C  CG    . LEU C 2  413  ? 7.572   -14.304 69.945  1.00 61.85  ? 413  LEU C CG    1 
ATOM   6847  C  CD1   . LEU C 2  413  ? 6.357   -14.859 69.203  1.00 54.82  ? 413  LEU C CD1   1 
ATOM   6848  C  CD2   . LEU C 2  413  ? 7.524   -14.631 71.439  1.00 47.22  ? 413  LEU C CD2   1 
ATOM   6849  N  N     . GLY C 2  414  ? 11.017  -15.613 67.560  1.00 74.90  ? 414  GLY C N     1 
ATOM   6850  C  CA    . GLY C 2  414  ? 12.390  -15.753 67.137  1.00 71.89  ? 414  GLY C CA    1 
ATOM   6851  C  C     . GLY C 2  414  ? 12.522  -16.223 65.702  1.00 87.95  ? 414  GLY C C     1 
ATOM   6852  O  O     . GLY C 2  414  ? 11.528  -16.428 64.997  1.00 91.07  ? 414  GLY C O     1 
ATOM   6853  N  N     . PRO C 2  415  ? 13.763  -16.394 65.243  1.00 89.69  ? 415  PRO C N     1 
ATOM   6854  C  CA    . PRO C 2  415  ? 13.992  -16.849 63.863  1.00 83.95  ? 415  PRO C CA    1 
ATOM   6855  C  C     . PRO C 2  415  ? 13.419  -18.241 63.632  1.00 82.40  ? 415  PRO C C     1 
ATOM   6856  O  O     . PRO C 2  415  ? 13.753  -19.196 64.338  1.00 82.83  ? 415  PRO C O     1 
ATOM   6857  C  CB    . PRO C 2  415  ? 15.520  -16.840 63.737  1.00 85.88  ? 415  PRO C CB    1 
ATOM   6858  C  CG    . PRO C 2  415  ? 15.992  -15.905 64.813  1.00 82.74  ? 415  PRO C CG    1 
ATOM   6859  C  CD    . PRO C 2  415  ? 15.019  -16.069 65.939  1.00 82.71  ? 415  PRO C CD    1 
ATOM   6860  N  N     . GLY C 2  416  ? 12.567  -18.354 62.614  1.00 77.17  ? 416  GLY C N     1 
ATOM   6861  C  CA    . GLY C 2  416  ? 11.828  -19.573 62.365  1.00 84.58  ? 416  GLY C CA    1 
ATOM   6862  C  C     . GLY C 2  416  ? 10.642  -19.796 63.277  1.00 81.01  ? 416  GLY C C     1 
ATOM   6863  O  O     . GLY C 2  416  ? 9.892   -20.759 63.070  1.00 77.29  ? 416  GLY C O     1 
ATOM   6864  N  N     . GLY C 2  417  ? 10.443  -18.940 64.275  1.00 72.21  ? 417  GLY C N     1 
ATOM   6865  C  CA    . GLY C 2  417  ? 9.347   -19.082 65.205  1.00 75.78  ? 417  GLY C CA    1 
ATOM   6866  C  C     . GLY C 2  417  ? 8.099   -18.359 64.742  1.00 78.04  ? 417  GLY C C     1 
ATOM   6867  O  O     . GLY C 2  417  ? 8.006   -17.857 63.621  1.00 81.54  ? 417  GLY C O     1 
ATOM   6868  N  N     . LEU C 2  418  ? 7.118   -18.320 65.638  1.00 81.93  ? 418  LEU C N     1 
ATOM   6869  C  CA    . LEU C 2  418  ? 5.861   -17.638 65.367  1.00 80.12  ? 418  LEU C CA    1 
ATOM   6870  C  C     . LEU C 2  418  ? 6.077   -16.137 65.225  1.00 82.67  ? 418  LEU C C     1 
ATOM   6871  O  O     . LEU C 2  418  ? 7.022   -15.564 65.776  1.00 80.35  ? 418  LEU C O     1 
ATOM   6872  C  CB    . LEU C 2  418  ? 4.856   -17.902 66.491  1.00 69.22  ? 418  LEU C CB    1 
ATOM   6873  C  CG    . LEU C 2  418  ? 4.257   -19.299 66.629  1.00 53.84  ? 418  LEU C CG    1 
ATOM   6874  C  CD1   . LEU C 2  418  ? 3.700   -19.483 68.023  1.00 54.14  ? 418  LEU C CD1   1 
ATOM   6875  C  CD2   . LEU C 2  418  ? 3.169   -19.497 65.600  1.00 57.18  ? 418  LEU C CD2   1 
ATOM   6876  N  N     . THR C 2  419  ? 5.187   -15.504 64.471  1.00 83.48  ? 419  THR C N     1 
ATOM   6877  C  CA    . THR C 2  419  ? 5.089   -14.054 64.421  1.00 87.48  ? 419  THR C CA    1 
ATOM   6878  C  C     . THR C 2  419  ? 3.860   -13.613 65.205  1.00 78.50  ? 419  THR C C     1 
ATOM   6879  O  O     . THR C 2  419  ? 2.786   -14.210 65.084  1.00 76.78  ? 419  THR C O     1 
ATOM   6880  C  CB    . THR C 2  419  ? 5.013   -13.556 62.977  1.00 90.31  ? 419  THR C CB    1 
ATOM   6881  O  OG1   . THR C 2  419  ? 4.208   -14.453 62.202  1.00 90.05  ? 419  THR C OG1   1 
ATOM   6882  C  CG2   . THR C 2  419  ? 6.410   -13.473 62.368  1.00 92.13  ? 419  THR C CG2   1 
ATOM   6883  N  N     . ARG C 2  420  ? 4.029   -12.578 66.023  1.00 70.21  ? 420  ARG C N     1 
ATOM   6884  C  CA    . ARG C 2  420  ? 2.956   -12.136 66.898  1.00 72.07  ? 420  ARG C CA    1 
ATOM   6885  C  C     . ARG C 2  420  ? 1.768   -11.642 66.078  1.00 90.70  ? 420  ARG C C     1 
ATOM   6886  O  O     . ARG C 2  420  ? 1.885   -11.331 64.889  1.00 94.68  ? 420  ARG C O     1 
ATOM   6887  C  CB    . ARG C 2  420  ? 3.450   -11.037 67.837  1.00 74.00  ? 420  ARG C CB    1 
ATOM   6888  C  CG    . ARG C 2  420  ? 2.775   -11.030 69.198  1.00 69.36  ? 420  ARG C CG    1 
ATOM   6889  C  CD    . ARG C 2  420  ? 3.584   -10.205 70.181  1.00 60.71  ? 420  ARG C CD    1 
ATOM   6890  N  NE    . ARG C 2  420  ? 5.020   -10.380 69.963  1.00 69.33  ? 420  ARG C NE    1 
ATOM   6891  C  CZ    . ARG C 2  420  ? 5.968   -9.799  70.692  1.00 74.32  ? 420  ARG C CZ    1 
ATOM   6892  N  NH1   . ARG C 2  420  ? 7.247   -10.016 70.419  1.00 70.30  ? 420  ARG C NH1   1 
ATOM   6893  N  NH2   . ARG C 2  420  ? 5.639   -9.004  71.700  1.00 76.71  ? 420  ARG C NH2   1 
ATOM   6894  N  N     . GLU C 2  421  ? 0.598   -11.634 66.726  1.00 96.73  ? 421  GLU C N     1 
ATOM   6895  C  CA    . GLU C 2  421  ? -0.679  -11.208 66.152  1.00 100.24 ? 421  GLU C CA    1 
ATOM   6896  C  C     . GLU C 2  421  ? -1.167  -12.223 65.124  1.00 93.52  ? 421  GLU C C     1 
ATOM   6897  O  O     . GLU C 2  421  ? -2.309  -12.148 64.656  1.00 96.26  ? 421  GLU C O     1 
ATOM   6898  C  CB    . GLU C 2  421  ? -0.576  -9.814  65.523  1.00 100.22 ? 421  GLU C CB    1 
ATOM   6899  C  CG    . GLU C 2  421  ? -0.049  -8.737  66.456  1.00 99.71  ? 421  GLU C CG    1 
ATOM   6900  C  CD    . GLU C 2  421  ? 0.336   -7.469  65.717  1.00 105.83 ? 421  GLU C CD    1 
ATOM   6901  O  OE1   . GLU C 2  421  ? 0.965   -6.587  66.340  1.00 106.08 ? 421  GLU C OE1   1 
ATOM   6902  O  OE2   . GLU C 2  421  ? 0.013   -7.358  64.513  1.00 98.18  ? 421  GLU C OE2   1 
ATOM   6903  N  N     . ARG C 2  422  ? -0.310  -13.180 64.781  1.00 84.43  ? 422  ARG C N     1 
ATOM   6904  C  CA    . ARG C 2  422  ? -0.705  -14.387 64.076  1.00 84.36  ? 422  ARG C CA    1 
ATOM   6905  C  C     . ARG C 2  422  ? -0.761  -15.573 65.025  1.00 85.07  ? 422  ARG C C     1 
ATOM   6906  O  O     . ARG C 2  422  ? -1.120  -16.679 64.611  1.00 77.79  ? 422  ARG C O     1 
ATOM   6907  C  CB    . ARG C 2  422  ? 0.261   -14.682 62.922  1.00 86.12  ? 422  ARG C CB    1 
ATOM   6908  C  CG    . ARG C 2  422  ? 1.169   -13.519 62.504  1.00 95.68  ? 422  ARG C CG    1 
ATOM   6909  C  CD    . ARG C 2  422  ? 0.412   -12.359 61.867  1.00 97.30  ? 422  ARG C CD    1 
ATOM   6910  N  NE    . ARG C 2  422  ? 1.282   -11.511 61.049  1.00 99.68  ? 422  ARG C NE    1 
ATOM   6911  C  CZ    . ARG C 2  422  ? 2.036   -10.522 61.523  1.00 92.21  ? 422  ARG C CZ    1 
ATOM   6912  N  NH1   . ARG C 2  422  ? 2.789   -9.808  60.699  1.00 93.71  ? 422  ARG C NH1   1 
ATOM   6913  N  NH2   . ARG C 2  422  ? 2.042   -10.248 62.820  1.00 85.59  ? 422  ARG C NH2   1 
ATOM   6914  N  N     . ALA C 2  423  ? -0.406  -15.353 66.287  1.00 77.49  ? 423  ALA C N     1 
ATOM   6915  C  CA    . ALA C 2  423  ? -0.461  -16.370 67.326  1.00 63.54  ? 423  ALA C CA    1 
ATOM   6916  C  C     . ALA C 2  423  ? -1.794  -16.227 68.047  1.00 68.52  ? 423  ALA C C     1 
ATOM   6917  O  O     . ALA C 2  423  ? -2.038  -15.222 68.721  1.00 65.06  ? 423  ALA C O     1 
ATOM   6918  C  CB    . ALA C 2  423  ? 0.711   -16.214 68.290  1.00 63.88  ? 423  ALA C CB    1 
ATOM   6919  N  N     . GLY C 2  424  ? -2.658  -17.225 67.894  1.00 76.30  ? 424  GLY C N     1 
ATOM   6920  C  CA    . GLY C 2  424  ? -3.981  -17.211 68.488  1.00 71.41  ? 424  GLY C CA    1 
ATOM   6921  C  C     . GLY C 2  424  ? -3.978  -17.684 69.923  1.00 66.29  ? 424  GLY C C     1 
ATOM   6922  O  O     . GLY C 2  424  ? -2.993  -17.532 70.653  1.00 62.82  ? 424  GLY C O     1 
ATOM   6923  N  N     . PHE C 2  425  ? -5.105  -18.262 70.339  1.00 64.58  ? 425  PHE C N     1 
ATOM   6924  C  CA    . PHE C 2  425  ? -5.219  -18.764 71.702  1.00 59.95  ? 425  PHE C CA    1 
ATOM   6925  C  C     . PHE C 2  425  ? -4.517  -20.105 71.883  1.00 55.37  ? 425  PHE C C     1 
ATOM   6926  O  O     . PHE C 2  425  ? -4.037  -20.402 72.983  1.00 58.76  ? 425  PHE C O     1 
ATOM   6927  C  CB    . PHE C 2  425  ? -6.691  -18.888 72.092  1.00 58.90  ? 425  PHE C CB    1 
ATOM   6928  C  CG    . PHE C 2  425  ? -7.424  -17.579 72.111  1.00 59.49  ? 425  PHE C CG    1 
ATOM   6929  C  CD1   . PHE C 2  425  ? -8.009  -17.081 70.959  1.00 63.48  ? 425  PHE C CD1   1 
ATOM   6930  C  CD2   . PHE C 2  425  ? -7.529  -16.846 73.282  1.00 60.32  ? 425  PHE C CD2   1 
ATOM   6931  C  CE1   . PHE C 2  425  ? -8.686  -15.877 70.973  1.00 69.17  ? 425  PHE C CE1   1 
ATOM   6932  C  CE2   . PHE C 2  425  ? -8.204  -15.641 73.304  1.00 61.12  ? 425  PHE C CE2   1 
ATOM   6933  C  CZ    . PHE C 2  425  ? -8.784  -15.156 72.148  1.00 65.93  ? 425  PHE C CZ    1 
ATOM   6934  N  N     . ASP C 2  426  ? -4.437  -20.914 70.824  1.00 47.53  ? 426  ASP C N     1 
ATOM   6935  C  CA    . ASP C 2  426  ? -3.919  -22.271 70.964  1.00 48.50  ? 426  ASP C CA    1 
ATOM   6936  C  C     . ASP C 2  426  ? -2.460  -22.274 71.402  1.00 52.10  ? 426  ASP C C     1 
ATOM   6937  O  O     . ASP C 2  426  ? -2.075  -23.030 72.303  1.00 56.59  ? 426  ASP C O     1 
ATOM   6938  C  CB    . ASP C 2  426  ? -4.083  -23.026 69.647  1.00 54.27  ? 426  ASP C CB    1 
ATOM   6939  C  CG    . ASP C 2  426  ? -5.515  -23.042 69.165  1.00 61.37  ? 426  ASP C CG    1 
ATOM   6940  O  OD1   . ASP C 2  426  ? -6.426  -22.989 70.018  1.00 59.92  ? 426  ASP C OD1   1 
ATOM   6941  O  OD2   . ASP C 2  426  ? -5.729  -23.101 67.935  1.00 68.44  ? 426  ASP C OD2   1 
ATOM   6942  N  N     . VAL C 2  427  ? -1.631  -21.435 70.779  1.00 54.16  ? 427  VAL C N     1 
ATOM   6943  C  CA    . VAL C 2  427  ? -0.208  -21.416 71.106  1.00 50.77  ? 427  VAL C CA    1 
ATOM   6944  C  C     . VAL C 2  427  ? 0.028   -20.904 72.522  1.00 49.19  ? 427  VAL C C     1 
ATOM   6945  O  O     . VAL C 2  427  ? 0.968   -21.341 73.200  1.00 41.67  ? 427  VAL C O     1 
ATOM   6946  C  CB    . VAL C 2  427  ? 0.550   -20.570 70.070  1.00 52.12  ? 427  VAL C CB    1 
ATOM   6947  C  CG1   . VAL C 2  427  ? 0.649   -21.312 68.770  1.00 53.19  ? 427  VAL C CG1   1 
ATOM   6948  C  CG2   . VAL C 2  427  ? -0.168  -19.253 69.851  1.00 57.58  ? 427  VAL C CG2   1 
ATOM   6949  N  N     . ARG C 2  428  ? -0.808  -19.974 72.990  1.00 48.60  ? 428  ARG C N     1 
ATOM   6950  C  CA    . ARG C 2  428  ? -0.648  -19.394 74.315  1.00 43.81  ? 428  ARG C CA    1 
ATOM   6951  C  C     . ARG C 2  428  ? -1.291  -20.244 75.399  1.00 44.03  ? 428  ARG C C     1 
ATOM   6952  O  O     . ARG C 2  428  ? -0.943  -20.092 76.576  1.00 44.92  ? 428  ARG C O     1 
ATOM   6953  C  CB    . ARG C 2  428  ? -1.248  -17.986 74.346  1.00 41.21  ? 428  ARG C CB    1 
ATOM   6954  C  CG    . ARG C 2  428  ? -0.966  -17.167 73.100  1.00 46.90  ? 428  ARG C CG    1 
ATOM   6955  C  CD    . ARG C 2  428  ? -1.801  -15.899 73.079  1.00 46.24  ? 428  ARG C CD    1 
ATOM   6956  N  NE    . ARG C 2  428  ? -0.970  -14.707 73.189  1.00 42.15  ? 428  ARG C NE    1 
ATOM   6957  C  CZ    . ARG C 2  428  ? -0.516  -14.017 72.150  1.00 42.80  ? 428  ARG C CZ    1 
ATOM   6958  N  NH1   . ARG C 2  428  ? -0.819  -14.395 70.917  1.00 51.62  ? 428  ARG C NH1   1 
ATOM   6959  N  NH2   . ARG C 2  428  ? 0.238   -12.947 72.346  1.00 46.27  ? 428  ARG C NH2   1 
ATOM   6960  N  N     . ASP C 2  429  ? -2.213  -21.128 75.028  1.00 36.90  ? 429  ASP C N     1 
ATOM   6961  C  CA    . ASP C 2  429  ? -2.873  -21.989 75.995  1.00 39.18  ? 429  ASP C CA    1 
ATOM   6962  C  C     . ASP C 2  429  ? -1.851  -22.802 76.776  1.00 38.11  ? 429  ASP C C     1 
ATOM   6963  O  O     . ASP C 2  429  ? -0.744  -23.065 76.304  1.00 37.57  ? 429  ASP C O     1 
ATOM   6964  C  CB    . ASP C 2  429  ? -3.844  -22.932 75.279  1.00 47.12  ? 429  ASP C CB    1 
ATOM   6965  C  CG    . ASP C 2  429  ? -5.288  -22.491 75.401  1.00 55.03  ? 429  ASP C CG    1 
ATOM   6966  O  OD1   . ASP C 2  429  ? -5.664  -22.004 76.489  1.00 56.19  ? 429  ASP C OD1   1 
ATOM   6967  O  OD2   . ASP C 2  429  ? -6.048  -22.635 74.416  1.00 56.33  ? 429  ASP C OD2   1 
ATOM   6968  N  N     . VAL C 2  430  ? -2.226  -23.202 77.985  1.00 39.65  ? 430  VAL C N     1 
ATOM   6969  C  CA    . VAL C 2  430  ? -1.474  -24.223 78.703  1.00 40.24  ? 430  VAL C CA    1 
ATOM   6970  C  C     . VAL C 2  430  ? -2.107  -25.567 78.366  1.00 36.30  ? 430  VAL C C     1 
ATOM   6971  O  O     . VAL C 2  430  ? -3.310  -25.779 78.572  1.00 31.66  ? 430  VAL C O     1 
ATOM   6972  C  CB    . VAL C 2  430  ? -1.415  -23.947 80.221  1.00 38.02  ? 430  VAL C CB    1 
ATOM   6973  C  CG1   . VAL C 2  430  ? -2.046  -22.622 80.554  1.00 39.49  ? 430  VAL C CG1   1 
ATOM   6974  C  CG2   . VAL C 2  430  ? -1.993  -25.074 81.076  1.00 29.43  ? 430  VAL C CG2   1 
ATOM   6975  N  N     . HIS C 2  431  ? -1.312  -26.428 77.743  1.00 35.21  ? 431  HIS C N     1 
ATOM   6976  C  CA    . HIS C 2  431  ? -1.727  -27.759 77.355  1.00 34.58  ? 431  HIS C CA    1 
ATOM   6977  C  C     . HIS C 2  431  ? -1.721  -28.667 78.574  1.00 35.58  ? 431  HIS C C     1 
ATOM   6978  O  O     . HIS C 2  431  ? -1.012  -28.419 79.552  1.00 38.70  ? 431  HIS C O     1 
ATOM   6979  C  CB    . HIS C 2  431  ? -0.782  -28.299 76.287  1.00 35.25  ? 431  HIS C CB    1 
ATOM   6980  C  CG    . HIS C 2  431  ? -1.386  -29.355 75.423  1.00 41.92  ? 431  HIS C CG    1 
ATOM   6981  N  ND1   . HIS C 2  431  ? -1.257  -30.701 75.690  1.00 41.59  ? 431  HIS C ND1   1 
ATOM   6982  C  CD2   . HIS C 2  431  ? -2.133  -29.262 74.298  1.00 41.98  ? 431  HIS C CD2   1 
ATOM   6983  C  CE1   . HIS C 2  431  ? -1.897  -31.391 74.763  1.00 43.44  ? 431  HIS C CE1   1 
ATOM   6984  N  NE2   . HIS C 2  431  ? -2.437  -30.542 73.907  1.00 41.43  ? 431  HIS C NE2   1 
ATOM   6985  N  N     . ARG C 2  432  ? -2.524  -29.730 78.515  1.00 32.32  ? 432  ARG C N     1 
ATOM   6986  C  CA    . ARG C 2  432  ? -2.523  -30.683 79.618  1.00 38.32  ? 432  ARG C CA    1 
ATOM   6987  C  C     . ARG C 2  432  ? -1.133  -31.261 79.836  1.00 43.64  ? 432  ARG C C     1 
ATOM   6988  O  O     . ARG C 2  432  ? -0.766  -31.606 80.967  1.00 42.87  ? 432  ARG C O     1 
ATOM   6989  C  CB    . ARG C 2  432  ? -3.538  -31.794 79.359  1.00 40.09  ? 432  ARG C CB    1 
ATOM   6990  C  CG    . ARG C 2  432  ? -3.253  -32.660 78.150  1.00 36.31  ? 432  ARG C CG    1 
ATOM   6991  C  CD    . ARG C 2  432  ? -4.190  -33.851 78.125  1.00 34.25  ? 432  ARG C CD    1 
ATOM   6992  N  NE    . ARG C 2  432  ? -3.972  -34.709 76.966  1.00 35.78  ? 432  ARG C NE    1 
ATOM   6993  C  CZ    . ARG C 2  432  ? -3.049  -35.663 76.909  1.00 40.41  ? 432  ARG C CZ    1 
ATOM   6994  N  NH1   . ARG C 2  432  ? -2.249  -35.879 77.946  1.00 40.73  ? 432  ARG C NH1   1 
ATOM   6995  N  NH2   . ARG C 2  432  ? -2.922  -36.399 75.812  1.00 40.83  ? 432  ARG C NH2   1 
ATOM   6996  N  N     . THR C 2  433  ? -0.342  -31.341 78.767  1.00 39.29  ? 433  THR C N     1 
ATOM   6997  C  CA    . THR C 2  433  ? 1.020   -31.844 78.807  1.00 35.34  ? 433  THR C CA    1 
ATOM   6998  C  C     . THR C 2  433  ? 2.000   -30.860 79.428  1.00 34.77  ? 433  THR C C     1 
ATOM   6999  O  O     . THR C 2  433  ? 3.149   -31.238 79.676  1.00 39.89  ? 433  THR C O     1 
ATOM   7000  C  CB    . THR C 2  433  ? 1.461   -32.201 77.389  1.00 35.15  ? 433  THR C CB    1 
ATOM   7001  O  OG1   . THR C 2  433  ? 1.354   -31.044 76.552  1.00 37.16  ? 433  THR C OG1   1 
ATOM   7002  C  CG2   . THR C 2  433  ? 0.557   -33.276 76.826  1.00 38.48  ? 433  THR C CG2   1 
ATOM   7003  N  N     . HIS C 2  434  ? 1.580   -29.618 79.687  1.00 33.43  ? 434  HIS C N     1 
ATOM   7004  C  CA    . HIS C 2  434  ? 2.446   -28.679 80.393  1.00 35.74  ? 434  HIS C CA    1 
ATOM   7005  C  C     . HIS C 2  434  ? 2.760   -29.154 81.801  1.00 38.59  ? 434  HIS C C     1 
ATOM   7006  O  O     . HIS C 2  434  ? 3.738   -28.690 82.398  1.00 36.42  ? 434  HIS C O     1 
ATOM   7007  C  CB    . HIS C 2  434  ? 1.802   -27.289 80.447  1.00 31.51  ? 434  HIS C CB    1 
ATOM   7008  C  CG    . HIS C 2  434  ? 2.010   -26.477 79.208  1.00 34.26  ? 434  HIS C CG    1 
ATOM   7009  N  ND1   . HIS C 2  434  ? 2.017   -27.031 77.946  1.00 34.30  ? 434  HIS C ND1   1 
ATOM   7010  C  CD2   . HIS C 2  434  ? 2.220   -25.151 79.037  1.00 36.43  ? 434  HIS C CD2   1 
ATOM   7011  C  CE1   . HIS C 2  434  ? 2.221   -26.082 77.051  1.00 30.58  ? 434  HIS C CE1   1 
ATOM   7012  N  NE2   . HIS C 2  434  ? 2.348   -24.932 77.687  1.00 38.13  ? 434  HIS C NE2   1 
ATOM   7013  N  N     . TYR C 2  435  ? 1.953   -30.067 82.336  1.00 38.50  ? 435  TYR C N     1 
ATOM   7014  C  CA    . TYR C 2  435  ? 2.145   -30.552 83.693  1.00 37.79  ? 435  TYR C CA    1 
ATOM   7015  C  C     . TYR C 2  435  ? 3.557   -31.092 83.876  1.00 40.54  ? 435  TYR C C     1 
ATOM   7016  O  O     . TYR C 2  435  ? 4.008   -31.963 83.128  1.00 42.98  ? 435  TYR C O     1 
ATOM   7017  C  CB    . TYR C 2  435  ? 1.114   -31.636 84.001  1.00 35.53  ? 435  TYR C CB    1 
ATOM   7018  C  CG    . TYR C 2  435  ? 1.100   -32.068 85.444  1.00 34.41  ? 435  TYR C CG    1 
ATOM   7019  C  CD1   . TYR C 2  435  ? 0.326   -31.400 86.378  1.00 32.54  ? 435  TYR C CD1   1 
ATOM   7020  C  CD2   . TYR C 2  435  ? 1.864   -33.142 85.873  1.00 39.80  ? 435  TYR C CD2   1 
ATOM   7021  C  CE1   . TYR C 2  435  ? 0.311   -31.791 87.698  1.00 36.93  ? 435  TYR C CE1   1 
ATOM   7022  C  CE2   . TYR C 2  435  ? 1.853   -33.540 87.194  1.00 41.10  ? 435  TYR C CE2   1 
ATOM   7023  C  CZ    . TYR C 2  435  ? 1.076   -32.863 88.099  1.00 37.11  ? 435  TYR C CZ    1 
ATOM   7024  O  OH    . TYR C 2  435  ? 1.070   -33.264 89.413  1.00 43.69  ? 435  TYR C OH    1 
ATOM   7025  N  N     . GLY C 2  436  ? 4.262   -30.557 84.867  1.00 38.25  ? 436  GLY C N     1 
ATOM   7026  C  CA    . GLY C 2  436  ? 5.596   -31.011 85.174  1.00 35.68  ? 436  GLY C CA    1 
ATOM   7027  C  C     . GLY C 2  436  ? 6.681   -30.509 84.254  1.00 35.32  ? 436  GLY C C     1 
ATOM   7028  O  O     . GLY C 2  436  ? 7.863   -30.703 84.564  1.00 47.38  ? 436  GLY C O     1 
ATOM   7029  N  N     . ARG C 2  437  ? 6.335   -29.861 83.141  1.00 35.83  ? 437  ARG C N     1 
ATOM   7030  C  CA    . ARG C 2  437  ? 7.320   -29.429 82.156  1.00 36.27  ? 437  ARG C CA    1 
ATOM   7031  C  C     . ARG C 2  437  ? 7.423   -27.914 82.048  1.00 32.40  ? 437  ARG C C     1 
ATOM   7032  O  O     . ARG C 2  437  ? 8.508   -27.353 82.222  1.00 30.31  ? 437  ARG C O     1 
ATOM   7033  C  CB    . ARG C 2  437  ? 6.970   -30.042 80.797  1.00 36.32  ? 437  ARG C CB    1 
ATOM   7034  C  CG    . ARG C 2  437  ? 6.986   -31.548 80.825  1.00 37.16  ? 437  ARG C CG    1 
ATOM   7035  C  CD    . ARG C 2  437  ? 6.360   -32.166 79.596  1.00 34.37  ? 437  ARG C CD    1 
ATOM   7036  N  NE    . ARG C 2  437  ? 6.452   -33.620 79.674  1.00 43.37  ? 437  ARG C NE    1 
ATOM   7037  C  CZ    . ARG C 2  437  ? 5.554   -34.394 80.273  1.00 42.19  ? 437  ARG C CZ    1 
ATOM   7038  N  NH1   . ARG C 2  437  ? 4.483   -33.857 80.840  1.00 43.68  ? 437  ARG C NH1   1 
ATOM   7039  N  NH2   . ARG C 2  437  ? 5.726   -35.707 80.304  1.00 40.45  ? 437  ARG C NH2   1 
ATOM   7040  N  N     . ILE C 2  438  ? 6.318   -27.230 81.771  1.00 32.17  ? 438  ILE C N     1 
ATOM   7041  C  CA    . ILE C 2  438  ? 6.306   -25.785 81.587  1.00 30.82  ? 438  ILE C CA    1 
ATOM   7042  C  C     . ILE C 2  438  ? 5.394   -25.184 82.640  1.00 34.67  ? 438  ILE C C     1 
ATOM   7043  O  O     . ILE C 2  438  ? 4.249   -25.622 82.794  1.00 44.28  ? 438  ILE C O     1 
ATOM   7044  C  CB    . ILE C 2  438  ? 5.832   -25.400 80.175  1.00 35.16  ? 438  ILE C CB    1 
ATOM   7045  C  CG1   . ILE C 2  438  ? 6.706   -26.074 79.119  1.00 36.97  ? 438  ILE C CG1   1 
ATOM   7046  C  CG2   . ILE C 2  438  ? 5.860   -23.898 80.002  1.00 35.63  ? 438  ILE C CG2   1 
ATOM   7047  C  CD1   . ILE C 2  438  ? 6.245   -25.816 77.707  1.00 33.06  ? 438  ILE C CD1   1 
ATOM   7048  N  N     . CYS C 2  439  ? 5.896   -24.184 83.355  1.00 35.55  ? 439  CYS C N     1 
ATOM   7049  C  CA    . CYS C 2  439  ? 5.131   -23.626 84.457  1.00 34.62  ? 439  CYS C CA    1 
ATOM   7050  C  C     . CYS C 2  439  ? 3.853   -22.979 83.933  1.00 34.56  ? 439  CYS C C     1 
ATOM   7051  O  O     . CYS C 2  439  ? 3.885   -22.267 82.922  1.00 35.50  ? 439  CYS C O     1 
ATOM   7052  C  CB    . CYS C 2  439  ? 5.947   -22.595 85.234  1.00 38.45  ? 439  CYS C CB    1 
ATOM   7053  S  SG    . CYS C 2  439  ? 4.992   -21.752 86.524  1.00 38.54  ? 439  CYS C SG    1 
ATOM   7054  N  N     . PRO C 2  440  ? 2.713   -23.216 84.592  1.00 31.18  ? 440  PRO C N     1 
ATOM   7055  C  CA    . PRO C 2  440  ? 1.452   -22.615 84.142  1.00 36.92  ? 440  PRO C CA    1 
ATOM   7056  C  C     . PRO C 2  440  ? 1.211   -21.190 84.610  1.00 36.85  ? 440  PRO C C     1 
ATOM   7057  O  O     . PRO C 2  440  ? 0.252   -20.568 84.127  1.00 39.28  ? 440  PRO C O     1 
ATOM   7058  C  CB    . PRO C 2  440  ? 0.401   -23.550 84.743  1.00 29.28  ? 440  PRO C CB    1 
ATOM   7059  C  CG    . PRO C 2  440  ? 1.030   -24.019 86.008  1.00 31.19  ? 440  PRO C CG    1 
ATOM   7060  C  CD    . PRO C 2  440  ? 2.511   -24.133 85.730  1.00 33.38  ? 440  PRO C CD    1 
ATOM   7061  N  N     . VAL C 2  441  ? 2.002   -20.650 85.537  1.00 33.50  ? 441  VAL C N     1 
ATOM   7062  C  CA    . VAL C 2  441  ? 1.752   -19.322 86.075  1.00 33.27  ? 441  VAL C CA    1 
ATOM   7063  C  C     . VAL C 2  441  ? 2.778   -18.305 85.583  1.00 28.90  ? 441  VAL C C     1 
ATOM   7064  O  O     . VAL C 2  441  ? 2.413   -17.179 85.242  1.00 29.82  ? 441  VAL C O     1 
ATOM   7065  C  CB    . VAL C 2  441  ? 1.664   -19.343 87.624  1.00 27.82  ? 441  VAL C CB    1 
ATOM   7066  C  CG1   . VAL C 2  441  ? 1.865   -20.750 88.161  1.00 30.22  ? 441  VAL C CG1   1 
ATOM   7067  C  CG2   . VAL C 2  441  ? 2.640   -18.377 88.263  1.00 29.35  ? 441  VAL C CG2   1 
ATOM   7068  N  N     . GLU C 2  442  ? 4.058   -18.669 85.518  1.00 26.05  ? 442  GLU C N     1 
ATOM   7069  C  CA    . GLU C 2  442  ? 5.071   -17.680 85.158  1.00 26.22  ? 442  GLU C CA    1 
ATOM   7070  C  C     . GLU C 2  442  ? 5.046   -17.429 83.652  1.00 32.47  ? 442  GLU C C     1 
ATOM   7071  O  O     . GLU C 2  442  ? 5.479   -18.277 82.864  1.00 36.25  ? 442  GLU C O     1 
ATOM   7072  C  CB    . GLU C 2  442  ? 6.460   -18.110 85.608  1.00 29.32  ? 442  GLU C CB    1 
ATOM   7073  C  CG    . GLU C 2  442  ? 7.462   -16.985 85.458  1.00 33.57  ? 442  GLU C CG    1 
ATOM   7074  C  CD    . GLU C 2  442  ? 8.898   -17.451 85.518  1.00 41.90  ? 442  GLU C CD    1 
ATOM   7075  O  OE1   . GLU C 2  442  ? 9.326   -17.960 86.577  1.00 41.75  ? 442  GLU C OE1   1 
ATOM   7076  O  OE2   . GLU C 2  442  ? 9.603   -17.302 84.496  1.00 47.13  ? 442  GLU C OE2   1 
ATOM   7077  N  N     . THR C 2  443  ? 4.593   -16.234 83.258  1.00 33.63  ? 443  THR C N     1 
ATOM   7078  C  CA    . THR C 2  443  ? 4.416   -15.806 81.876  1.00 32.38  ? 443  THR C CA    1 
ATOM   7079  C  C     . THR C 2  443  ? 4.121   -14.307 81.908  1.00 34.89  ? 443  THR C C     1 
ATOM   7080  O  O     . THR C 2  443  ? 3.656   -13.802 82.934  1.00 32.30  ? 443  THR C O     1 
ATOM   7081  C  CB    . THR C 2  443  ? 3.295   -16.611 81.203  1.00 31.90  ? 443  THR C CB    1 
ATOM   7082  O  OG1   . THR C 2  443  ? 3.250   -16.316 79.799  1.00 36.31  ? 443  THR C OG1   1 
ATOM   7083  C  CG2   . THR C 2  443  ? 1.943   -16.301 81.820  1.00 31.52  ? 443  THR C CG2   1 
ATOM   7084  N  N     . PRO C 2  444  ? 4.395   -13.553 80.845  1.00 42.37  ? 444  PRO C N     1 
ATOM   7085  C  CA    . PRO C 2  444  ? 4.167   -12.104 80.908  1.00 38.10  ? 444  PRO C CA    1 
ATOM   7086  C  C     . PRO C 2  444  ? 2.690   -11.747 80.843  1.00 31.22  ? 444  PRO C C     1 
ATOM   7087  O  O     . PRO C 2  444  ? 1.863   -12.491 80.309  1.00 29.56  ? 444  PRO C O     1 
ATOM   7088  C  CB    . PRO C 2  444  ? 4.910   -11.569 79.676  1.00 42.61  ? 444  PRO C CB    1 
ATOM   7089  C  CG    . PRO C 2  444  ? 5.869   -12.629 79.292  1.00 42.62  ? 444  PRO C CG    1 
ATOM   7090  C  CD    . PRO C 2  444  ? 5.183   -13.923 79.657  1.00 39.34  ? 444  PRO C CD    1 
ATOM   7091  N  N     . GLU C 2  445  ? 2.368   -10.581 81.398  1.00 30.25  ? 445  GLU C N     1 
ATOM   7092  C  CA    . GLU C 2  445  ? 1.076   -9.962  81.151  1.00 32.83  ? 445  GLU C CA    1 
ATOM   7093  C  C     . GLU C 2  445  ? 1.139   -9.156  79.860  1.00 35.81  ? 445  GLU C C     1 
ATOM   7094  O  O     . GLU C 2  445  ? 2.148   -8.512  79.559  1.00 36.10  ? 445  GLU C O     1 
ATOM   7095  C  CB    . GLU C 2  445  ? 0.666   -9.041  82.303  1.00 39.64  ? 445  GLU C CB    1 
ATOM   7096  C  CG    . GLU C 2  445  ? 1.087   -9.487  83.690  1.00 37.20  ? 445  GLU C CG    1 
ATOM   7097  C  CD    . GLU C 2  445  ? 0.796   -8.435  84.755  1.00 45.62  ? 445  GLU C CD    1 
ATOM   7098  O  OE1   . GLU C 2  445  ? -0.250  -7.756  84.660  1.00 44.22  ? 445  GLU C OE1   1 
ATOM   7099  O  OE2   . GLU C 2  445  ? 1.620   -8.277  85.682  1.00 46.49  ? 445  GLU C OE2   1 
ATOM   7100  N  N     . GLY C 2  446  ? 0.053   -9.188  79.097  1.00 36.41  ? 446  GLY C N     1 
ATOM   7101  C  CA    . GLY C 2  446  ? 0.001   -8.431  77.863  1.00 37.74  ? 446  GLY C CA    1 
ATOM   7102  C  C     . GLY C 2  446  ? 0.249   -9.250  76.613  1.00 37.32  ? 446  GLY C C     1 
ATOM   7103  O  O     . GLY C 2  446  ? -0.037  -10.449 76.569  1.00 39.02  ? 446  GLY C O     1 
ATOM   7104  N  N     . ALA C 2  447  ? 0.807   -8.598  75.591  1.00 41.54  ? 447  ALA C N     1 
ATOM   7105  C  CA    . ALA C 2  447  ? 0.897   -9.191  74.262  1.00 34.97  ? 447  ALA C CA    1 
ATOM   7106  C  C     . ALA C 2  447  ? 1.751   -10.453 74.223  1.00 35.73  ? 447  ALA C C     1 
ATOM   7107  O  O     . ALA C 2  447  ? 1.557   -11.293 73.337  1.00 37.90  ? 447  ALA C O     1 
ATOM   7108  C  CB    . ALA C 2  447  ? 1.447   -8.158  73.277  1.00 36.17  ? 447  ALA C CB    1 
ATOM   7109  N  N     . ASN C 2  448  ? 2.680   -10.619 75.157  1.00 35.54  ? 448  ASN C N     1 
ATOM   7110  C  CA    . ASN C 2  448  ? 3.570   -11.768 75.141  1.00 39.32  ? 448  ASN C CA    1 
ATOM   7111  C  C     . ASN C 2  448  ? 3.032   -12.960 75.925  1.00 39.99  ? 448  ASN C C     1 
ATOM   7112  O  O     . ASN C 2  448  ? 3.752   -13.953 76.080  1.00 38.92  ? 448  ASN C O     1 
ATOM   7113  C  CB    . ASN C 2  448  ? 4.945   -11.376 75.686  1.00 43.99  ? 448  ASN C CB    1 
ATOM   7114  C  CG    . ASN C 2  448  ? 5.860   -10.824 74.616  1.00 45.97  ? 448  ASN C CG    1 
ATOM   7115  O  OD1   . ASN C 2  448  ? 5.697   -11.115 73.432  1.00 46.22  ? 448  ASN C OD1   1 
ATOM   7116  N  ND2   . ASN C 2  448  ? 6.839   -10.031 75.030  1.00 54.67  ? 448  ASN C ND2   1 
ATOM   7117  N  N     . ILE C 2  449  ? 1.789   -12.898 76.410  1.00 35.91  ? 449  ILE C N     1 
ATOM   7118  C  CA    . ILE C 2  449  ? 1.293   -13.927 77.318  1.00 36.54  ? 449  ILE C CA    1 
ATOM   7119  C  C     . ILE C 2  449  ? 1.219   -15.265 76.595  1.00 37.96  ? 449  ILE C C     1 
ATOM   7120  O  O     . ILE C 2  449  ? 0.749   -15.351 75.453  1.00 43.36  ? 449  ILE C O     1 
ATOM   7121  C  CB    . ILE C 2  449  ? -0.070  -13.528 77.900  1.00 34.79  ? 449  ILE C CB    1 
ATOM   7122  C  CG1   . ILE C 2  449  ? -0.520  -14.570 78.925  1.00 39.84  ? 449  ILE C CG1   1 
ATOM   7123  C  CG2   . ILE C 2  449  ? -1.115  -13.379 76.805  1.00 35.30  ? 449  ILE C CG2   1 
ATOM   7124  C  CD1   . ILE C 2  449  ? -1.852  -14.279 79.559  1.00 37.64  ? 449  ILE C CD1   1 
ATOM   7125  N  N     . GLY C 2  450  ? 1.704   -16.317 77.252  1.00 32.92  ? 450  GLY C N     1 
ATOM   7126  C  CA    . GLY C 2  450  ? 1.704   -17.640 76.677  1.00 40.34  ? 450  GLY C CA    1 
ATOM   7127  C  C     . GLY C 2  450  ? 2.773   -17.897 75.639  1.00 38.17  ? 450  GLY C C     1 
ATOM   7128  O  O     . GLY C 2  450  ? 3.009   -19.062 75.293  1.00 40.91  ? 450  GLY C O     1 
ATOM   7129  N  N     . LEU C 2  451  ? 3.423   -16.851 75.121  1.00 39.39  ? 451  LEU C N     1 
ATOM   7130  C  CA    . LEU C 2  451  ? 4.519   -17.001 74.170  1.00 39.46  ? 451  LEU C CA    1 
ATOM   7131  C  C     . LEU C 2  451  ? 5.869   -17.139 74.865  1.00 37.46  ? 451  LEU C C     1 
ATOM   7132  O  O     . LEU C 2  451  ? 6.712   -17.923 74.419  1.00 34.69  ? 451  LEU C O     1 
ATOM   7133  C  CB    . LEU C 2  451  ? 4.537   -15.813 73.211  1.00 34.54  ? 451  LEU C CB    1 
ATOM   7134  C  CG    . LEU C 2  451  ? 3.266   -15.629 72.386  1.00 33.95  ? 451  LEU C CG    1 
ATOM   7135  C  CD1   . LEU C 2  451  ? 3.358   -14.384 71.521  1.00 46.62  ? 451  LEU C CD1   1 
ATOM   7136  C  CD2   . LEU C 2  451  ? 3.008   -16.856 71.532  1.00 35.28  ? 451  LEU C CD2   1 
ATOM   7137  N  N     . ILE C 2  452  ? 6.089   -16.392 75.947  1.00 33.98  ? 452  ILE C N     1 
ATOM   7138  C  CA    . ILE C 2  452  ? 7.258   -16.558 76.805  1.00 32.07  ? 452  ILE C CA    1 
ATOM   7139  C  C     . ILE C 2  452  ? 6.818   -17.343 78.033  1.00 35.07  ? 452  ILE C C     1 
ATOM   7140  O  O     . ILE C 2  452  ? 5.816   -16.998 78.671  1.00 38.14  ? 452  ILE C O     1 
ATOM   7141  C  CB    . ILE C 2  452  ? 7.867   -15.202 77.207  1.00 38.43  ? 452  ILE C CB    1 
ATOM   7142  C  CG1   . ILE C 2  452  ? 7.993   -14.267 76.000  1.00 33.34  ? 452  ILE C CG1   1 
ATOM   7143  C  CG2   . ILE C 2  452  ? 9.232   -15.400 77.857  1.00 33.15  ? 452  ILE C CG2   1 
ATOM   7144  C  CD1   . ILE C 2  452  ? 9.097   -14.645 75.046  1.00 43.71  ? 452  ILE C CD1   1 
ATOM   7145  N  N     . THR C 2  453  ? 7.554   -18.402 78.359  1.00 38.40  ? 453  THR C N     1 
ATOM   7146  C  CA    . THR C 2  453  ? 7.210   -19.304 79.450  1.00 37.69  ? 453  THR C CA    1 
ATOM   7147  C  C     . THR C 2  453  ? 8.492   -19.695 80.176  1.00 38.79  ? 453  THR C C     1 
ATOM   7148  O  O     . THR C 2  453  ? 9.590   -19.272 79.804  1.00 41.61  ? 453  THR C O     1 
ATOM   7149  C  CB    . THR C 2  453  ? 6.467   -20.541 78.930  1.00 39.72  ? 453  THR C CB    1 
ATOM   7150  O  OG1   . THR C 2  453  ? 7.202   -21.126 77.846  1.00 36.71  ? 453  THR C OG1   1 
ATOM   7151  C  CG2   . THR C 2  453  ? 5.064   -20.171 78.453  1.00 37.40  ? 453  THR C CG2   1 
ATOM   7152  N  N     . SER C 2  454  ? 8.359   -20.523 81.213  1.00 41.24  ? 454  SER C N     1 
ATOM   7153  C  CA    . SER C 2  454  ? 9.502   -20.893 82.037  1.00 37.83  ? 454  SER C CA    1 
ATOM   7154  C  C     . SER C 2  454  ? 9.553   -22.399 82.250  1.00 33.34  ? 454  SER C C     1 
ATOM   7155  O  O     . SER C 2  454  ? 8.517   -23.060 82.372  1.00 33.63  ? 454  SER C O     1 
ATOM   7156  C  CB    . SER C 2  454  ? 9.464   -20.185 83.387  1.00 33.09  ? 454  SER C CB    1 
ATOM   7157  O  OG    . SER C 2  454  ? 10.756  -20.152 83.967  1.00 38.28  ? 454  SER C OG    1 
ATOM   7158  N  N     . LEU C 2  455  ? 10.772  -22.929 82.288  1.00 33.07  ? 455  LEU C N     1 
ATOM   7159  C  CA    . LEU C 2  455  ? 10.983  -24.351 82.513  1.00 33.30  ? 455  LEU C CA    1 
ATOM   7160  C  C     . LEU C 2  455  ? 10.635  -24.718 83.947  1.00 34.63  ? 455  LEU C C     1 
ATOM   7161  O  O     . LEU C 2  455  ? 10.998  -24.007 84.889  1.00 37.80  ? 455  LEU C O     1 
ATOM   7162  C  CB    . LEU C 2  455  ? 12.440  -24.715 82.229  1.00 32.08  ? 455  LEU C CB    1 
ATOM   7163  C  CG    . LEU C 2  455  ? 12.776  -25.943 81.382  1.00 32.08  ? 455  LEU C CG    1 
ATOM   7164  C  CD1   . LEU C 2  455  ? 13.896  -26.729 82.037  1.00 37.42  ? 455  LEU C CD1   1 
ATOM   7165  C  CD2   . LEU C 2  455  ? 11.562  -26.810 81.131  1.00 33.72  ? 455  LEU C CD2   1 
ATOM   7166  N  N     . ALA C 2  456  ? 9.938   -25.843 84.112  1.00 35.73  ? 456  ALA C N     1 
ATOM   7167  C  CA    . ALA C 2  456  ? 9.576   -26.309 85.443  1.00 38.30  ? 456  ALA C CA    1 
ATOM   7168  C  C     . ALA C 2  456  ? 10.824  -26.672 86.245  1.00 41.34  ? 456  ALA C C     1 
ATOM   7169  O  O     . ALA C 2  456  ? 11.900  -26.928 85.695  1.00 45.11  ? 456  ALA C O     1 
ATOM   7170  C  CB    . ALA C 2  456  ? 8.636   -27.512 85.362  1.00 35.61  ? 456  ALA C CB    1 
ATOM   7171  N  N     . ALA C 2  457  ? 10.659  -26.704 87.570  1.00 35.56  ? 457  ALA C N     1 
ATOM   7172  C  CA    . ALA C 2  457  ? 11.806  -26.857 88.458  1.00 37.16  ? 457  ALA C CA    1 
ATOM   7173  C  C     . ALA C 2  457  ? 12.486  -28.211 88.278  1.00 44.36  ? 457  ALA C C     1 
ATOM   7174  O  O     . ALA C 2  457  ? 13.720  -28.292 88.246  1.00 50.47  ? 457  ALA C O     1 
ATOM   7175  C  CB    . ALA C 2  457  ? 11.372  -26.655 89.909  1.00 39.26  ? 457  ALA C CB    1 
ATOM   7176  N  N     . TYR C 2  458  ? 11.707  -29.284 88.162  1.00 42.22  ? 458  TYR C N     1 
ATOM   7177  C  CA    . TYR C 2  458  ? 12.269  -30.617 87.980  1.00 40.76  ? 458  TYR C CA    1 
ATOM   7178  C  C     . TYR C 2  458  ? 12.378  -31.025 86.518  1.00 51.67  ? 458  TYR C C     1 
ATOM   7179  O  O     . TYR C 2  458  ? 12.880  -32.119 86.234  1.00 50.55  ? 458  TYR C O     1 
ATOM   7180  C  CB    . TYR C 2  458  ? 11.432  -31.653 88.730  1.00 37.46  ? 458  TYR C CB    1 
ATOM   7181  C  CG    . TYR C 2  458  ? 11.814  -31.820 90.181  1.00 42.04  ? 458  TYR C CG    1 
ATOM   7182  C  CD1   . TYR C 2  458  ? 12.896  -32.607 90.546  1.00 45.78  ? 458  TYR C CD1   1 
ATOM   7183  C  CD2   . TYR C 2  458  ? 11.090  -31.194 91.187  1.00 41.73  ? 458  TYR C CD2   1 
ATOM   7184  C  CE1   . TYR C 2  458  ? 13.247  -32.766 91.873  1.00 44.92  ? 458  TYR C CE1   1 
ATOM   7185  C  CE2   . TYR C 2  458  ? 11.433  -31.348 92.515  1.00 41.60  ? 458  TYR C CE2   1 
ATOM   7186  C  CZ    . TYR C 2  458  ? 12.513  -32.134 92.853  1.00 45.41  ? 458  TYR C CZ    1 
ATOM   7187  O  OH    . TYR C 2  458  ? 12.859  -32.287 94.176  1.00 48.68  ? 458  TYR C OH    1 
ATOM   7188  N  N     . ALA C 2  459  ? 11.936  -30.175 85.593  1.00 51.00  ? 459  ALA C N     1 
ATOM   7189  C  CA    . ALA C 2  459  ? 11.888  -30.530 84.183  1.00 43.77  ? 459  ALA C CA    1 
ATOM   7190  C  C     . ALA C 2  459  ? 13.280  -30.542 83.560  1.00 45.55  ? 459  ALA C C     1 
ATOM   7191  O  O     . ALA C 2  459  ? 14.179  -29.798 83.965  1.00 43.37  ? 459  ALA C O     1 
ATOM   7192  C  CB    . ALA C 2  459  ? 10.989  -29.558 83.422  1.00 36.58  ? 459  ALA C CB    1 
ATOM   7193  N  N     . ARG C 2  460  ? 13.443  -31.401 82.556  1.00 42.80  ? 460  ARG C N     1 
ATOM   7194  C  CA    . ARG C 2  460  ? 14.693  -31.548 81.828  1.00 37.89  ? 460  ARG C CA    1 
ATOM   7195  C  C     . ARG C 2  460  ? 14.404  -31.650 80.337  1.00 39.02  ? 460  ARG C C     1 
ATOM   7196  O  O     . ARG C 2  460  ? 13.367  -32.177 79.927  1.00 37.57  ? 460  ARG C O     1 
ATOM   7197  C  CB    . ARG C 2  460  ? 15.469  -32.787 82.282  1.00 42.57  ? 460  ARG C CB    1 
ATOM   7198  C  CG    . ARG C 2  460  ? 16.195  -32.639 83.598  1.00 46.61  ? 460  ARG C CG    1 
ATOM   7199  C  CD    . ARG C 2  460  ? 17.195  -33.767 83.749  1.00 54.45  ? 460  ARG C CD    1 
ATOM   7200  N  NE    . ARG C 2  460  ? 17.983  -33.657 84.972  1.00 66.17  ? 460  ARG C NE    1 
ATOM   7201  C  CZ    . ARG C 2  460  ? 18.948  -34.505 85.306  1.00 67.98  ? 460  ARG C CZ    1 
ATOM   7202  N  NH1   . ARG C 2  460  ? 19.238  -35.520 84.503  1.00 67.70  ? 460  ARG C NH1   1 
ATOM   7203  N  NH2   . ARG C 2  460  ? 19.621  -34.343 86.438  1.00 62.52  ? 460  ARG C NH2   1 
ATOM   7204  N  N     . VAL C 2  461  ? 15.338  -31.148 79.530  1.00 40.11  ? 461  VAL C N     1 
ATOM   7205  C  CA    . VAL C 2  461  ? 15.272  -31.239 78.075  1.00 31.02  ? 461  VAL C CA    1 
ATOM   7206  C  C     . VAL C 2  461  ? 16.180  -32.374 77.627  1.00 35.05  ? 461  VAL C C     1 
ATOM   7207  O  O     . VAL C 2  461  ? 17.368  -32.398 77.971  1.00 33.75  ? 461  VAL C O     1 
ATOM   7208  C  CB    . VAL C 2  461  ? 15.689  -29.914 77.414  1.00 26.87  ? 461  VAL C CB    1 
ATOM   7209  C  CG1   . VAL C 2  461  ? 15.362  -29.938 75.935  1.00 34.80  ? 461  VAL C CG1   1 
ATOM   7210  C  CG2   . VAL C 2  461  ? 15.011  -28.734 78.101  1.00 31.45  ? 461  VAL C CG2   1 
ATOM   7211  N  N     . ASP C 2  462  ? 15.633  -33.313 76.858  1.00 39.80  ? 462  ASP C N     1 
ATOM   7212  C  CA    . ASP C 2  462  ? 16.397  -34.481 76.434  1.00 44.49  ? 462  ASP C CA    1 
ATOM   7213  C  C     . ASP C 2  462  ? 17.239  -34.158 75.197  1.00 52.10  ? 462  ASP C C     1 
ATOM   7214  O  O     . ASP C 2  462  ? 17.333  -33.011 74.747  1.00 47.43  ? 462  ASP C O     1 
ATOM   7215  C  CB    . ASP C 2  462  ? 15.470  -35.670 76.186  1.00 43.91  ? 462  ASP C CB    1 
ATOM   7216  C  CG    . ASP C 2  462  ? 14.358  -35.364 75.191  1.00 49.65  ? 462  ASP C CG    1 
ATOM   7217  O  OD1   . ASP C 2  462  ? 14.615  -34.686 74.171  1.00 51.18  ? 462  ASP C OD1   1 
ATOM   7218  O  OD2   . ASP C 2  462  ? 13.221  -35.831 75.418  1.00 48.36  ? 462  ASP C OD2   1 
ATOM   7219  N  N     . GLU C 2  463  ? 17.857  -35.195 74.624  1.00 53.20  ? 463  GLU C N     1 
ATOM   7220  C  CA    . GLU C 2  463  ? 18.752  -34.997 73.491  1.00 51.83  ? 463  GLU C CA    1 
ATOM   7221  C  C     . GLU C 2  463  ? 17.990  -34.640 72.223  1.00 50.00  ? 463  GLU C C     1 
ATOM   7222  O  O     . GLU C 2  463  ? 18.500  -33.883 71.389  1.00 51.66  ? 463  GLU C O     1 
ATOM   7223  C  CB    . GLU C 2  463  ? 19.600  -36.250 73.281  1.00 58.82  ? 463  GLU C CB    1 
ATOM   7224  C  CG    . GLU C 2  463  ? 20.371  -36.659 74.526  1.00 68.62  ? 463  GLU C CG    1 
ATOM   7225  C  CD    . GLU C 2  463  ? 21.387  -37.748 74.260  1.00 81.31  ? 463  GLU C CD    1 
ATOM   7226  O  OE1   . GLU C 2  463  ? 21.696  -38.513 75.199  1.00 94.68  ? 463  GLU C OE1   1 
ATOM   7227  O  OE2   . GLU C 2  463  ? 21.878  -37.839 73.115  1.00 78.19  ? 463  GLU C OE2   1 
ATOM   7228  N  N     . LEU C 2  464  ? 16.771  -35.154 72.062  1.00 51.27  ? 464  LEU C N     1 
ATOM   7229  C  CA    . LEU C 2  464  ? 15.956  -34.777 70.914  1.00 52.89  ? 464  LEU C CA    1 
ATOM   7230  C  C     . LEU C 2  464  ? 15.284  -33.423 71.093  1.00 50.44  ? 464  LEU C C     1 
ATOM   7231  O  O     . LEU C 2  464  ? 14.727  -32.896 70.123  1.00 47.96  ? 464  LEU C O     1 
ATOM   7232  C  CB    . LEU C 2  464  ? 14.891  -35.843 70.633  1.00 50.34  ? 464  LEU C CB    1 
ATOM   7233  C  CG    . LEU C 2  464  ? 15.375  -37.266 70.339  1.00 48.57  ? 464  LEU C CG    1 
ATOM   7234  C  CD1   . LEU C 2  464  ? 14.305  -38.051 69.604  1.00 48.88  ? 464  LEU C CD1   1 
ATOM   7235  C  CD2   . LEU C 2  464  ? 16.687  -37.277 69.569  1.00 54.89  ? 464  LEU C CD2   1 
ATOM   7236  N  N     . GLY C 2  465  ? 15.321  -32.850 72.299  1.00 47.24  ? 465  GLY C N     1 
ATOM   7237  C  CA    . GLY C 2  465  ? 14.801  -31.521 72.538  1.00 41.65  ? 465  GLY C CA    1 
ATOM   7238  C  C     . GLY C 2  465  ? 13.446  -31.462 73.203  1.00 38.98  ? 465  GLY C C     1 
ATOM   7239  O  O     . GLY C 2  465  ? 12.896  -30.364 73.341  1.00 35.02  ? 465  GLY C O     1 
ATOM   7240  N  N     . PHE C 2  466  ? 12.891  -32.598 73.615  1.00 43.15  ? 466  PHE C N     1 
ATOM   7241  C  CA    . PHE C 2  466  ? 11.624  -32.631 74.328  1.00 37.25  ? 466  PHE C CA    1 
ATOM   7242  C  C     . PHE C 2  466  ? 11.849  -32.467 75.827  1.00 41.65  ? 466  PHE C C     1 
ATOM   7243  O  O     . PHE C 2  466  ? 12.871  -32.897 76.374  1.00 38.66  ? 466  PHE C O     1 
ATOM   7244  C  CB    . PHE C 2  466  ? 10.885  -33.939 74.050  1.00 31.35  ? 466  PHE C CB    1 
ATOM   7245  C  CG    . PHE C 2  466  ? 10.642  -34.195 72.594  1.00 36.43  ? 466  PHE C CG    1 
ATOM   7246  C  CD1   . PHE C 2  466  ? 9.649   -33.511 71.918  1.00 33.44  ? 466  PHE C CD1   1 
ATOM   7247  C  CD2   . PHE C 2  466  ? 11.412  -35.112 71.898  1.00 44.96  ? 466  PHE C CD2   1 
ATOM   7248  C  CE1   . PHE C 2  466  ? 9.422   -33.740 70.573  1.00 38.31  ? 466  PHE C CE1   1 
ATOM   7249  C  CE2   . PHE C 2  466  ? 11.189  -35.349 70.552  1.00 45.01  ? 466  PHE C CE2   1 
ATOM   7250  C  CZ    . PHE C 2  466  ? 10.193  -34.661 69.889  1.00 41.74  ? 466  PHE C CZ    1 
ATOM   7251  N  N     . ILE C 2  467  ? 10.881  -31.837 76.491  1.00 45.45  ? 467  ILE C N     1 
ATOM   7252  C  CA    . ILE C 2  467  ? 10.936  -31.631 77.934  1.00 35.03  ? 467  ILE C CA    1 
ATOM   7253  C  C     . ILE C 2  467  ? 10.381  -32.866 78.631  1.00 28.82  ? 467  ILE C C     1 
ATOM   7254  O  O     . ILE C 2  467  ? 9.293   -33.345 78.296  1.00 28.64  ? 467  ILE C O     1 
ATOM   7255  C  CB    . ILE C 2  467  ? 10.155  -30.372 78.341  1.00 33.18  ? 467  ILE C CB    1 
ATOM   7256  C  CG1   . ILE C 2  467  ? 10.537  -29.186 77.453  1.00 29.64  ? 467  ILE C CG1   1 
ATOM   7257  C  CG2   . ILE C 2  467  ? 10.420  -30.029 79.795  1.00 34.11  ? 467  ILE C CG2   1 
ATOM   7258  C  CD1   . ILE C 2  467  ? 9.779   -27.922 77.785  1.00 28.44  ? 467  ILE C CD1   1 
ATOM   7259  N  N     . ARG C 2  468  ? 11.126  -33.379 79.604  1.00 35.22  ? 468  ARG C N     1 
ATOM   7260  C  CA    . ARG C 2  468  ? 10.743  -34.566 80.350  1.00 37.77  ? 468  ARG C CA    1 
ATOM   7261  C  C     . ARG C 2  468  ? 10.563  -34.210 81.817  1.00 38.68  ? 468  ARG C C     1 
ATOM   7262  O  O     . ARG C 2  468  ? 11.264  -33.345 82.352  1.00 38.89  ? 468  ARG C O     1 
ATOM   7263  C  CB    . ARG C 2  468  ? 11.794  -35.674 80.220  1.00 37.39  ? 468  ARG C CB    1 
ATOM   7264  C  CG    . ARG C 2  468  ? 12.075  -36.103 78.792  1.00 38.66  ? 468  ARG C CG    1 
ATOM   7265  C  CD    . ARG C 2  468  ? 13.355  -36.927 78.706  1.00 44.49  ? 468  ARG C CD    1 
ATOM   7266  N  NE    . ARG C 2  468  ? 13.110  -38.365 78.758  1.00 44.09  ? 468  ARG C NE    1 
ATOM   7267  C  CZ    . ARG C 2  468  ? 13.009  -39.144 77.685  1.00 39.53  ? 468  ARG C CZ    1 
ATOM   7268  N  NH1   . ARG C 2  468  ? 13.134  -38.626 76.471  1.00 35.37  ? 468  ARG C NH1   1 
ATOM   7269  N  NH2   . ARG C 2  468  ? 12.784  -40.442 77.826  1.00 48.06  ? 468  ARG C NH2   1 
ATOM   7270  N  N     . THR C 2  469  ? 9.619   -34.890 82.466  1.00 40.74  ? 469  THR C N     1 
ATOM   7271  C  CA    . THR C 2  469  ? 9.399   -34.646 83.884  1.00 41.30  ? 469  THR C CA    1 
ATOM   7272  C  C     . THR C 2  469  ? 9.540   -35.949 84.666  1.00 36.17  ? 469  THR C C     1 
ATOM   7273  O  O     . THR C 2  469  ? 9.274   -37.028 84.128  1.00 39.21  ? 469  THR C O     1 
ATOM   7274  C  CB    . THR C 2  469  ? 8.016   -34.023 84.136  1.00 40.88  ? 469  THR C CB    1 
ATOM   7275  O  OG1   . THR C 2  469  ? 7.863   -33.719 85.527  1.00 37.26  ? 469  THR C OG1   1 
ATOM   7276  C  CG2   . THR C 2  469  ? 6.903   -34.956 83.691  1.00 42.08  ? 469  THR C CG2   1 
ATOM   7277  N  N     . PRO C 2  470  ? 10.011  -35.889 85.910  1.00 38.59  ? 470  PRO C N     1 
ATOM   7278  C  CA    . PRO C 2  470  ? 10.262  -37.122 86.660  1.00 41.19  ? 470  PRO C CA    1 
ATOM   7279  C  C     . PRO C 2  470  ? 9.010   -37.680 87.319  1.00 40.55  ? 470  PRO C C     1 
ATOM   7280  O  O     . PRO C 2  470  ? 8.092   -36.951 87.701  1.00 39.96  ? 470  PRO C O     1 
ATOM   7281  C  CB    . PRO C 2  470  ? 11.288  -36.687 87.712  1.00 38.56  ? 470  PRO C CB    1 
ATOM   7282  C  CG    . PRO C 2  470  ? 10.981  -35.259 87.943  1.00 36.74  ? 470  PRO C CG    1 
ATOM   7283  C  CD    . PRO C 2  470  ? 10.545  -34.707 86.610  1.00 41.57  ? 470  PRO C CD    1 
ATOM   7284  N  N     . TYR C 2  471  ? 8.991   -39.006 87.442  1.00 43.32  ? 471  TYR C N     1 
ATOM   7285  C  CA    . TYR C 2  471  ? 7.940   -39.723 88.145  1.00 41.37  ? 471  TYR C CA    1 
ATOM   7286  C  C     . TYR C 2  471  ? 8.572   -40.872 88.917  1.00 49.55  ? 471  TYR C C     1 
ATOM   7287  O  O     . TYR C 2  471  ? 9.724   -41.238 88.680  1.00 48.92  ? 471  TYR C O     1 
ATOM   7288  C  CB    . TYR C 2  471  ? 6.866   -40.239 87.180  1.00 39.41  ? 471  TYR C CB    1 
ATOM   7289  C  CG    . TYR C 2  471  ? 6.027   -39.140 86.564  1.00 49.60  ? 471  TYR C CG    1 
ATOM   7290  C  CD1   . TYR C 2  471  ? 5.184   -38.364 87.351  1.00 43.88  ? 471  TYR C CD1   1 
ATOM   7291  C  CD2   . TYR C 2  471  ? 6.081   -38.872 85.199  1.00 47.65  ? 471  TYR C CD2   1 
ATOM   7292  C  CE1   . TYR C 2  471  ? 4.411   -37.357 86.800  1.00 37.72  ? 471  TYR C CE1   1 
ATOM   7293  C  CE2   . TYR C 2  471  ? 5.307   -37.867 84.637  1.00 45.79  ? 471  TYR C CE2   1 
ATOM   7294  C  CZ    . TYR C 2  471  ? 4.475   -37.111 85.445  1.00 42.70  ? 471  TYR C CZ    1 
ATOM   7295  O  OH    . TYR C 2  471  ? 3.704   -36.106 84.904  1.00 40.41  ? 471  TYR C OH    1 
ATOM   7296  N  N     . ARG C 2  472  ? 7.809   -41.437 89.852  1.00 57.76  ? 472  ARG C N     1 
ATOM   7297  C  CA    . ARG C 2  472  ? 8.253   -42.537 90.695  1.00 51.19  ? 472  ARG C CA    1 
ATOM   7298  C  C     . ARG C 2  472  ? 7.530   -43.815 90.304  1.00 54.46  ? 472  ARG C C     1 
ATOM   7299  O  O     . ARG C 2  472  ? 6.310   -43.809 90.104  1.00 57.96  ? 472  ARG C O     1 
ATOM   7300  C  CB    . ARG C 2  472  ? 7.991   -42.245 92.175  1.00 50.12  ? 472  ARG C CB    1 
ATOM   7301  C  CG    . ARG C 2  472  ? 9.084   -41.455 92.857  1.00 58.77  ? 472  ARG C CG    1 
ATOM   7302  C  CD    . ARG C 2  472  ? 9.093   -41.705 94.356  1.00 64.62  ? 472  ARG C CD    1 
ATOM   7303  N  NE    . ARG C 2  472  ? 8.092   -40.917 95.071  1.00 78.69  ? 472  ARG C NE    1 
ATOM   7304  C  CZ    . ARG C 2  472  ? 7.924   -40.941 96.392  1.00 87.54  ? 472  ARG C CZ    1 
ATOM   7305  N  NH1   . ARG C 2  472  ? 8.687   -41.720 97.150  1.00 79.27  ? 472  ARG C NH1   1 
ATOM   7306  N  NH2   . ARG C 2  472  ? 6.989   -40.187 96.957  1.00 91.30  ? 472  ARG C NH2   1 
ATOM   7307  N  N     . ARG C 2  473  ? 8.292   -44.903 90.207  1.00 53.17  ? 473  ARG C N     1 
ATOM   7308  C  CA    . ARG C 2  473  ? 7.729   -46.208 89.894  1.00 54.12  ? 473  ARG C CA    1 
ATOM   7309  C  C     . ARG C 2  473  ? 6.877   -46.715 91.050  1.00 55.85  ? 473  ARG C C     1 
ATOM   7310  O  O     . ARG C 2  473  ? 7.271   -46.626 92.217  1.00 57.96  ? 473  ARG C O     1 
ATOM   7311  C  CB    . ARG C 2  473  ? 8.852   -47.201 89.599  1.00 59.01  ? 473  ARG C CB    1 
ATOM   7312  C  CG    . ARG C 2  473  ? 8.383   -48.609 89.285  1.00 64.70  ? 473  ARG C CG    1 
ATOM   7313  C  CD    . ARG C 2  473  ? 8.122   -48.787 87.801  1.00 59.77  ? 473  ARG C CD    1 
ATOM   7314  N  NE    . ARG C 2  473  ? 9.344   -48.623 87.021  1.00 51.59  ? 473  ARG C NE    1 
ATOM   7315  C  CZ    . ARG C 2  473  ? 9.394   -48.681 85.695  1.00 64.60  ? 473  ARG C CZ    1 
ATOM   7316  N  NH1   . ARG C 2  473  ? 8.286   -48.902 85.000  1.00 65.35  ? 473  ARG C NH1   1 
ATOM   7317  N  NH2   . ARG C 2  473  ? 10.550  -48.518 85.064  1.00 70.15  ? 473  ARG C NH2   1 
ATOM   7318  N  N     . VAL C 2  474  ? 5.700   -47.246 90.722  1.00 54.60  ? 474  VAL C N     1 
ATOM   7319  C  CA    . VAL C 2  474  ? 4.794   -47.835 91.703  1.00 63.14  ? 474  VAL C CA    1 
ATOM   7320  C  C     . VAL C 2  474  ? 4.425   -49.234 91.228  1.00 67.26  ? 474  VAL C C     1 
ATOM   7321  O  O     . VAL C 2  474  ? 3.775   -49.388 90.186  1.00 71.42  ? 474  VAL C O     1 
ATOM   7322  C  CB    . VAL C 2  474  ? 3.532   -46.983 91.913  1.00 57.04  ? 474  VAL C CB    1 
ATOM   7323  C  CG1   . VAL C 2  474  ? 2.588   -47.675 92.872  1.00 57.36  ? 474  VAL C CG1   1 
ATOM   7324  C  CG2   . VAL C 2  474  ? 3.904   -45.608 92.440  1.00 57.92  ? 474  VAL C CG2   1 
ATOM   7325  N  N     . VAL C 2  475  ? 4.838   -50.250 91.984  1.00 71.67  ? 475  VAL C N     1 
ATOM   7326  C  CA    . VAL C 2  475  ? 4.595   -51.648 91.642  1.00 71.38  ? 475  VAL C CA    1 
ATOM   7327  C  C     . VAL C 2  475  ? 3.805   -52.285 92.774  1.00 74.97  ? 475  VAL C C     1 
ATOM   7328  O  O     . VAL C 2  475  ? 4.313   -52.419 93.896  1.00 70.40  ? 475  VAL C O     1 
ATOM   7329  C  CB    . VAL C 2  475  ? 5.903   -52.415 91.397  1.00 68.76  ? 475  VAL C CB    1 
ATOM   7330  C  CG1   . VAL C 2  475  ? 5.609   -53.882 91.158  1.00 78.17  ? 475  VAL C CG1   1 
ATOM   7331  C  CG2   . VAL C 2  475  ? 6.647   -51.822 90.215  1.00 72.82  ? 475  VAL C CG2   1 
ATOM   7332  N  N     . GLY C 2  476  ? 2.573   -52.688 92.478  1.00 69.20  ? 476  GLY C N     1 
ATOM   7333  C  CA    . GLY C 2  476  ? 1.735   -53.326 93.482  1.00 65.54  ? 476  GLY C CA    1 
ATOM   7334  C  C     . GLY C 2  476  ? 1.439   -52.444 94.673  1.00 67.60  ? 476  GLY C C     1 
ATOM   7335  O  O     . GLY C 2  476  ? 1.402   -52.930 95.810  1.00 71.41  ? 476  GLY C O     1 
ATOM   7336  N  N     . GLY C 2  477  ? 1.235   -51.151 94.440  1.00 66.43  ? 477  GLY C N     1 
ATOM   7337  C  CA    . GLY C 2  477  ? 0.963   -50.222 95.515  1.00 66.28  ? 477  GLY C CA    1 
ATOM   7338  C  C     . GLY C 2  477  ? 2.167   -49.805 96.326  1.00 65.62  ? 477  GLY C C     1 
ATOM   7339  O  O     . GLY C 2  477  ? 1.997   -49.129 97.348  1.00 69.03  ? 477  GLY C O     1 
ATOM   7340  N  N     . VAL C 2  478  ? 3.375   -50.181 95.912  1.00 64.47  ? 478  VAL C N     1 
ATOM   7341  C  CA    . VAL C 2  478  ? 4.602   -49.834 96.620  1.00 67.05  ? 478  VAL C CA    1 
ATOM   7342  C  C     . VAL C 2  478  ? 5.336   -48.767 95.819  1.00 66.83  ? 478  VAL C C     1 
ATOM   7343  O  O     . VAL C 2  478  ? 5.628   -48.962 94.632  1.00 58.41  ? 478  VAL C O     1 
ATOM   7344  C  CB    . VAL C 2  478  ? 5.498   -51.066 96.841  1.00 65.00  ? 478  VAL C CB    1 
ATOM   7345  C  CG1   . VAL C 2  478  ? 6.529   -50.783 97.925  1.00 56.63  ? 478  VAL C CG1   1 
ATOM   7346  C  CG2   . VAL C 2  478  ? 4.657   -52.283 97.189  1.00 64.34  ? 478  VAL C CG2   1 
ATOM   7347  N  N     . VAL C 2  479  ? 5.642   -47.649 96.469  1.00 66.24  ? 479  VAL C N     1 
ATOM   7348  C  CA    . VAL C 2  479  ? 6.321   -46.529 95.825  1.00 67.01  ? 479  VAL C CA    1 
ATOM   7349  C  C     . VAL C 2  479  ? 7.824   -46.736 95.956  1.00 66.38  ? 479  VAL C C     1 
ATOM   7350  O  O     . VAL C 2  479  ? 8.366   -46.723 97.066  1.00 68.68  ? 479  VAL C O     1 
ATOM   7351  C  CB    . VAL C 2  479  ? 5.893   -45.189 96.444  1.00 61.94  ? 479  VAL C CB    1 
ATOM   7352  C  CG1   . VAL C 2  479  ? 6.619   -44.039 95.769  1.00 57.85  ? 479  VAL C CG1   1 
ATOM   7353  C  CG2   . VAL C 2  479  ? 4.390   -45.009 96.334  1.00 59.88  ? 479  VAL C CG2   1 
ATOM   7354  N  N     . THR C 2  480  ? 8.501   -46.923 94.826  1.00 56.51  ? 480  THR C N     1 
ATOM   7355  C  CA    . THR C 2  480  ? 9.942   -47.126 94.841  1.00 61.97  ? 480  THR C CA    1 
ATOM   7356  C  C     . THR C 2  480  ? 10.668  -45.782 94.849  1.00 68.98  ? 480  THR C C     1 
ATOM   7357  O  O     . THR C 2  480  ? 10.061  -44.711 94.758  1.00 72.55  ? 480  THR C O     1 
ATOM   7358  C  CB    . THR C 2  480  ? 10.384  -47.948 93.635  1.00 59.05  ? 480  THR C CB    1 
ATOM   7359  O  OG1   . THR C 2  480  ? 10.455  -47.095 92.486  1.00 67.94  ? 480  THR C OG1   1 
ATOM   7360  C  CG2   . THR C 2  480  ? 9.400   -49.071 93.364  1.00 60.34  ? 480  THR C CG2   1 
ATOM   7361  N  N     . ASP C 2  481  ? 11.992  -45.840 94.957  1.00 64.30  ? 481  ASP C N     1 
ATOM   7362  C  CA    . ASP C 2  481  ? 12.833  -44.667 94.779  1.00 59.95  ? 481  ASP C CA    1 
ATOM   7363  C  C     . ASP C 2  481  ? 13.388  -44.571 93.368  1.00 69.73  ? 481  ASP C C     1 
ATOM   7364  O  O     . ASP C 2  481  ? 14.128  -43.629 93.065  1.00 69.97  ? 481  ASP C O     1 
ATOM   7365  C  CB    . ASP C 2  481  ? 13.976  -44.670 95.793  1.00 66.43  ? 481  ASP C CB    1 
ATOM   7366  C  CG    . ASP C 2  481  ? 13.498  -44.392 97.201  1.00 80.93  ? 481  ASP C CG    1 
ATOM   7367  O  OD1   . ASP C 2  481  ? 12.415  -43.782 97.352  1.00 72.02  ? 481  ASP C OD1   1 
ATOM   7368  O  OD2   . ASP C 2  481  ? 14.205  -44.782 98.155  1.00 90.11  ? 481  ASP C OD2   1 
ATOM   7369  N  N     . GLU C 2  482  ? 13.055  -45.531 92.509  1.00 69.71  ? 482  GLU C N     1 
ATOM   7370  C  CA    . GLU C 2  482  ? 13.379  -45.444 91.092  1.00 61.05  ? 482  GLU C CA    1 
ATOM   7371  C  C     . GLU C 2  482  ? 12.540  -44.347 90.453  1.00 60.23  ? 482  GLU C C     1 
ATOM   7372  O  O     . GLU C 2  482  ? 11.307  -44.389 90.514  1.00 59.92  ? 482  GLU C O     1 
ATOM   7373  C  CB    . GLU C 2  482  ? 13.115  -46.786 90.413  1.00 64.97  ? 482  GLU C CB    1 
ATOM   7374  C  CG    . GLU C 2  482  ? 13.143  -46.741 88.890  1.00 72.19  ? 482  GLU C CG    1 
ATOM   7375  C  CD    . GLU C 2  482  ? 12.560  -47.994 88.259  1.00 73.21  ? 482  GLU C CD    1 
ATOM   7376  O  OE1   . GLU C 2  482  ? 12.510  -48.069 87.010  1.00 61.68  ? 482  GLU C OE1   1 
ATOM   7377  O  OE2   . GLU C 2  482  ? 12.148  -48.901 89.015  1.00 73.73  ? 482  GLU C OE2   1 
ATOM   7378  N  N     . VAL C 2  483  ? 13.196  -43.365 89.844  1.00 55.79  ? 483  VAL C N     1 
ATOM   7379  C  CA    . VAL C 2  483  ? 12.509  -42.257 89.197  1.00 53.03  ? 483  VAL C CA    1 
ATOM   7380  C  C     . VAL C 2  483  ? 12.838  -42.289 87.711  1.00 44.74  ? 483  VAL C C     1 
ATOM   7381  O  O     . VAL C 2  483  ? 13.977  -42.564 87.317  1.00 48.38  ? 483  VAL C O     1 
ATOM   7382  C  CB    . VAL C 2  483  ? 12.873  -40.904 89.849  1.00 45.52  ? 483  VAL C CB    1 
ATOM   7383  C  CG1   . VAL C 2  483  ? 13.951  -41.094 90.902  1.00 44.76  ? 483  VAL C CG1   1 
ATOM   7384  C  CG2   . VAL C 2  483  ? 13.279  -39.869 88.823  1.00 42.45  ? 483  VAL C CG2   1 
ATOM   7385  N  N     . VAL C 2  484  ? 11.818  -42.045 86.896  1.00 42.38  ? 484  VAL C N     1 
ATOM   7386  C  CA    . VAL C 2  484  ? 11.899  -42.115 85.443  1.00 50.14  ? 484  VAL C CA    1 
ATOM   7387  C  C     . VAL C 2  484  ? 11.451  -40.776 84.879  1.00 50.22  ? 484  VAL C C     1 
ATOM   7388  O  O     . VAL C 2  484  ? 10.384  -40.272 85.246  1.00 53.40  ? 484  VAL C O     1 
ATOM   7389  C  CB    . VAL C 2  484  ? 11.030  -43.258 84.887  1.00 46.02  ? 484  VAL C CB    1 
ATOM   7390  C  CG1   . VAL C 2  484  ? 10.998  -43.220 83.369  1.00 52.77  ? 484  VAL C CG1   1 
ATOM   7391  C  CG2   . VAL C 2  484  ? 11.544  -44.600 85.392  1.00 46.49  ? 484  VAL C CG2   1 
ATOM   7392  N  N     . TYR C 2  485  ? 12.271  -40.191 84.011  1.00 43.48  ? 485  TYR C N     1 
ATOM   7393  C  CA    . TYR C 2  485  ? 11.914  -38.957 83.325  1.00 39.51  ? 485  TYR C CA    1 
ATOM   7394  C  C     . TYR C 2  485  ? 11.175  -39.293 82.037  1.00 39.81  ? 485  TYR C C     1 
ATOM   7395  O  O     . TYR C 2  485  ? 11.679  -40.056 81.208  1.00 40.19  ? 485  TYR C O     1 
ATOM   7396  C  CB    . TYR C 2  485  ? 13.159  -38.129 83.019  1.00 37.41  ? 485  TYR C CB    1 
ATOM   7397  C  CG    . TYR C 2  485  ? 13.623  -37.263 84.163  1.00 34.84  ? 485  TYR C CG    1 
ATOM   7398  C  CD1   . TYR C 2  485  ? 14.465  -37.762 85.142  1.00 34.71  ? 485  TYR C CD1   1 
ATOM   7399  C  CD2   . TYR C 2  485  ? 13.225  -35.939 84.254  1.00 41.54  ? 485  TYR C CD2   1 
ATOM   7400  C  CE1   . TYR C 2  485  ? 14.894  -36.963 86.185  1.00 42.04  ? 485  TYR C CE1   1 
ATOM   7401  C  CE2   . TYR C 2  485  ? 13.650  -35.135 85.287  1.00 40.90  ? 485  TYR C CE2   1 
ATOM   7402  C  CZ    . TYR C 2  485  ? 14.480  -35.650 86.252  1.00 41.97  ? 485  TYR C CZ    1 
ATOM   7403  O  OH    . TYR C 2  485  ? 14.897  -34.842 87.285  1.00 47.17  ? 485  TYR C OH    1 
ATOM   7404  N  N     . MET C 2  486  ? 9.992   -38.716 81.863  1.00 40.75  ? 486  MET C N     1 
ATOM   7405  C  CA    . MET C 2  486  ? 9.132   -39.064 80.742  1.00 42.52  ? 486  MET C CA    1 
ATOM   7406  C  C     . MET C 2  486  ? 8.881   -37.872 79.830  1.00 38.71  ? 486  MET C C     1 
ATOM   7407  O  O     . MET C 2  486  ? 8.787   -36.726 80.289  1.00 37.30  ? 486  MET C O     1 
ATOM   7408  C  CB    . MET C 2  486  ? 7.785   -39.604 81.221  1.00 46.74  ? 486  MET C CB    1 
ATOM   7409  C  CG    . MET C 2  486  ? 7.869   -40.844 82.077  1.00 47.41  ? 486  MET C CG    1 
ATOM   7410  S  SD    . MET C 2  486  ? 6.221   -41.478 82.434  1.00 56.82  ? 486  MET C SD    1 
ATOM   7411  C  CE    . MET C 2  486  ? 6.620   -42.665 83.704  1.00 54.99  ? 486  MET C CE    1 
ATOM   7412  N  N     . THR C 2  487  ? 8.790   -38.165 78.533  1.00 43.08  ? 487  THR C N     1 
ATOM   7413  C  CA    . THR C 2  487  ? 8.128   -37.292 77.577  1.00 42.37  ? 487  THR C CA    1 
ATOM   7414  C  C     . THR C 2  487  ? 6.621   -37.346 77.800  1.00 46.08  ? 487  THR C C     1 
ATOM   7415  O  O     . THR C 2  487  ? 6.102   -38.239 78.474  1.00 50.34  ? 487  THR C O     1 
ATOM   7416  C  CB    . THR C 2  487  ? 8.440   -37.716 76.140  1.00 40.55  ? 487  THR C CB    1 
ATOM   7417  O  OG1   . THR C 2  487  ? 7.995   -39.064 75.934  1.00 41.47  ? 487  THR C OG1   1 
ATOM   7418  C  CG2   . THR C 2  487  ? 9.931   -37.628 75.859  1.00 42.92  ? 487  THR C CG2   1 
ATOM   7419  N  N     . ALA C 2  488  ? 5.911   -36.378 77.219  1.00 42.71  ? 488  ALA C N     1 
ATOM   7420  C  CA    . ALA C 2  488  ? 4.456   -36.378 77.346  1.00 45.25  ? 488  ALA C CA    1 
ATOM   7421  C  C     . ALA C 2  488  ? 3.842   -37.592 76.655  1.00 46.03  ? 488  ALA C C     1 
ATOM   7422  O  O     . ALA C 2  488  ? 2.842   -38.149 77.130  1.00 50.84  ? 488  ALA C O     1 
ATOM   7423  C  CB    . ALA C 2  488  ? 3.881   -35.079 76.788  1.00 42.03  ? 488  ALA C CB    1 
ATOM   7424  N  N     . THR C 2  489  ? 4.441   -38.028 75.541  1.00 39.96  ? 489  THR C N     1 
ATOM   7425  C  CA    . THR C 2  489  ? 3.959   -39.217 74.844  1.00 40.55  ? 489  THR C CA    1 
ATOM   7426  C  C     . THR C 2  489  ? 4.085   -40.460 75.715  1.00 47.80  ? 489  THR C C     1 
ATOM   7427  O  O     . THR C 2  489  ? 3.187   -41.311 75.736  1.00 44.92  ? 489  THR C O     1 
ATOM   7428  C  CB    . THR C 2  489  ? 4.730   -39.401 73.539  1.00 37.47  ? 489  THR C CB    1 
ATOM   7429  O  OG1   . THR C 2  489  ? 4.529   -38.259 72.699  1.00 43.14  ? 489  THR C OG1   1 
ATOM   7430  C  CG2   . THR C 2  489  ? 4.258   -40.646 72.812  1.00 46.58  ? 489  THR C CG2   1 
ATOM   7431  N  N     . GLU C 2  490  ? 5.202   -40.589 76.435  1.00 49.61  ? 490  GLU C N     1 
ATOM   7432  C  CA    . GLU C 2  490  ? 5.348   -41.687 77.384  1.00 49.67  ? 490  GLU C CA    1 
ATOM   7433  C  C     . GLU C 2  490  ? 4.398   -41.521 78.562  1.00 50.25  ? 490  GLU C C     1 
ATOM   7434  O  O     . GLU C 2  490  ? 3.805   -42.499 79.033  1.00 54.19  ? 490  GLU C O     1 
ATOM   7435  C  CB    . GLU C 2  490  ? 6.796   -41.770 77.872  1.00 49.74  ? 490  GLU C CB    1 
ATOM   7436  C  CG    . GLU C 2  490  ? 7.641   -42.815 77.162  1.00 59.23  ? 490  GLU C CG    1 
ATOM   7437  C  CD    . GLU C 2  490  ? 7.185   -44.232 77.462  1.00 71.03  ? 490  GLU C CD    1 
ATOM   7438  O  OE1   . GLU C 2  490  ? 6.827   -44.963 76.511  1.00 69.65  ? 490  GLU C OE1   1 
ATOM   7439  O  OE2   . GLU C 2  490  ? 7.179   -44.612 78.653  1.00 66.98  ? 490  GLU C OE2   1 
ATOM   7440  N  N     . GLU C 2  491  ? 4.240   -40.285 79.043  1.00 48.88  ? 491  GLU C N     1 
ATOM   7441  C  CA    . GLU C 2  491  ? 3.390   -40.026 80.202  1.00 50.94  ? 491  GLU C CA    1 
ATOM   7442  C  C     . GLU C 2  491  ? 1.945   -40.437 79.941  1.00 48.05  ? 491  GLU C C     1 
ATOM   7443  O  O     . GLU C 2  491  ? 1.272   -40.961 80.836  1.00 43.42  ? 491  GLU C O     1 
ATOM   7444  C  CB    . GLU C 2  491  ? 3.469   -38.545 80.574  1.00 46.46  ? 491  GLU C CB    1 
ATOM   7445  C  CG    . GLU C 2  491  ? 2.630   -38.138 81.769  1.00 43.55  ? 491  GLU C CG    1 
ATOM   7446  C  CD    . GLU C 2  491  ? 2.693   -36.650 82.024  1.00 43.57  ? 491  GLU C CD    1 
ATOM   7447  O  OE1   . GLU C 2  491  ? 1.673   -35.959 81.811  1.00 45.47  ? 491  GLU C OE1   1 
ATOM   7448  O  OE2   . GLU C 2  491  ? 3.773   -36.168 82.420  1.00 45.73  ? 491  GLU C OE2   1 
ATOM   7449  N  N     . ASP C 2  492  ? 1.452   -40.216 78.720  1.00 46.16  ? 492  ASP C N     1 
ATOM   7450  C  CA    . ASP C 2  492  ? 0.065   -40.557 78.417  1.00 48.00  ? 492  ASP C CA    1 
ATOM   7451  C  C     . ASP C 2  492  ? -0.219  -42.057 78.468  1.00 54.57  ? 492  ASP C C     1 
ATOM   7452  O  O     . ASP C 2  492  ? -1.382  -42.444 78.304  1.00 54.39  ? 492  ASP C O     1 
ATOM   7453  C  CB    . ASP C 2  492  ? -0.335  -40.015 77.041  1.00 47.73  ? 492  ASP C CB    1 
ATOM   7454  C  CG    . ASP C 2  492  ? -0.453  -38.502 77.016  1.00 51.38  ? 492  ASP C CG    1 
ATOM   7455  O  OD1   . ASP C 2  492  ? -0.591  -37.893 78.102  1.00 47.25  ? 492  ASP C OD1   1 
ATOM   7456  O  OD2   . ASP C 2  492  ? -0.394  -37.922 75.909  1.00 50.98  ? 492  ASP C OD2   1 
ATOM   7457  N  N     . ARG C 2  493  ? 0.786   -42.905 78.685  1.00 55.07  ? 493  ARG C N     1 
ATOM   7458  C  CA    . ARG C 2  493  ? 0.589   -44.349 78.725  1.00 54.22  ? 493  ARG C CA    1 
ATOM   7459  C  C     . ARG C 2  493  ? 0.339   -44.882 80.128  1.00 59.82  ? 493  ARG C C     1 
ATOM   7460  O  O     . ARG C 2  493  ? 0.099   -46.084 80.281  1.00 67.02  ? 493  ARG C O     1 
ATOM   7461  C  CB    . ARG C 2  493  ? 1.805   -45.071 78.127  1.00 51.26  ? 493  ARG C CB    1 
ATOM   7462  C  CG    . ARG C 2  493  ? 2.226   -44.555 76.763  1.00 62.06  ? 493  ARG C CG    1 
ATOM   7463  C  CD    . ARG C 2  493  ? 3.369   -45.370 76.173  1.00 64.34  ? 493  ARG C CD    1 
ATOM   7464  N  NE    . ARG C 2  493  ? 2.933   -46.691 75.729  1.00 65.98  ? 493  ARG C NE    1 
ATOM   7465  C  CZ    . ARG C 2  493  ? 3.158   -47.817 76.398  1.00 71.56  ? 493  ARG C CZ    1 
ATOM   7466  N  NH1   . ARG C 2  493  ? 3.824   -47.786 77.545  1.00 70.37  ? 493  ARG C NH1   1 
ATOM   7467  N  NH2   . ARG C 2  493  ? 2.722   -48.975 75.918  1.00 71.92  ? 493  ARG C NH2   1 
ATOM   7468  N  N     . TYR C 2  494  ? 0.389   -44.035 81.153  1.00 55.37  ? 494  TYR C N     1 
ATOM   7469  C  CA    . TYR C 2  494  ? 0.341   -44.507 82.526  1.00 55.42  ? 494  TYR C CA    1 
ATOM   7470  C  C     . TYR C 2  494  ? -0.712  -43.753 83.325  1.00 55.38  ? 494  TYR C C     1 
ATOM   7471  O  O     . TYR C 2  494  ? -1.142  -42.654 82.963  1.00 53.84  ? 494  TYR C O     1 
ATOM   7472  C  CB    . TYR C 2  494  ? 1.708   -44.365 83.210  1.00 52.51  ? 494  TYR C CB    1 
ATOM   7473  C  CG    . TYR C 2  494  ? 2.837   -44.964 82.413  1.00 51.55  ? 494  TYR C CG    1 
ATOM   7474  C  CD1   . TYR C 2  494  ? 2.839   -46.311 82.090  1.00 53.48  ? 494  TYR C CD1   1 
ATOM   7475  C  CD2   . TYR C 2  494  ? 3.900   -44.184 81.982  1.00 54.51  ? 494  TYR C CD2   1 
ATOM   7476  C  CE1   . TYR C 2  494  ? 3.867   -46.868 81.359  1.00 63.07  ? 494  TYR C CE1   1 
ATOM   7477  C  CE2   . TYR C 2  494  ? 4.937   -44.731 81.252  1.00 61.93  ? 494  TYR C CE2   1 
ATOM   7478  C  CZ    . TYR C 2  494  ? 4.915   -46.076 80.942  1.00 66.21  ? 494  TYR C CZ    1 
ATOM   7479  O  OH    . TYR C 2  494  ? 5.942   -46.634 80.213  1.00 66.19  ? 494  TYR C OH    1 
ATOM   7480  N  N     . THR C 2  495  ? -1.129  -44.386 84.416  1.00 46.77  ? 495  THR C N     1 
ATOM   7481  C  CA    . THR C 2  495  ? -1.965  -43.774 85.435  1.00 44.68  ? 495  THR C CA    1 
ATOM   7482  C  C     . THR C 2  495  ? -1.036  -43.296 86.544  1.00 46.13  ? 495  THR C C     1 
ATOM   7483  O  O     . THR C 2  495  ? -0.337  -44.110 87.157  1.00 51.58  ? 495  THR C O     1 
ATOM   7484  C  CB    . THR C 2  495  ? -2.988  -44.780 85.967  1.00 48.97  ? 495  THR C CB    1 
ATOM   7485  O  OG1   . THR C 2  495  ? -3.753  -45.312 84.878  1.00 45.96  ? 495  THR C OG1   1 
ATOM   7486  C  CG2   . THR C 2  495  ? -3.928  -44.127 86.960  1.00 51.84  ? 495  THR C CG2   1 
ATOM   7487  N  N     . ILE C 2  496  ? -1.005  -41.988 86.786  1.00 43.82  ? 496  ILE C N     1 
ATOM   7488  C  CA    . ILE C 2  496  ? 0.017   -41.391 87.646  1.00 42.23  ? 496  ILE C CA    1 
ATOM   7489  C  C     . ILE C 2  496  ? -0.648  -40.703 88.831  1.00 44.64  ? 496  ILE C C     1 
ATOM   7490  O  O     . ILE C 2  496  ? -1.412  -39.748 88.650  1.00 45.20  ? 496  ILE C O     1 
ATOM   7491  C  CB    . ILE C 2  496  ? 0.900   -40.404 86.872  1.00 45.54  ? 496  ILE C CB    1 
ATOM   7492  C  CG1   . ILE C 2  496  ? 1.471   -41.080 85.624  1.00 42.94  ? 496  ILE C CG1   1 
ATOM   7493  C  CG2   . ILE C 2  496  ? 2.013   -39.882 87.769  1.00 43.99  ? 496  ILE C CG2   1 
ATOM   7494  C  CD1   . ILE C 2  496  ? 2.324   -40.169 84.777  1.00 44.81  ? 496  ILE C CD1   1 
ATOM   7495  N  N     . ALA C 2  497  ? -0.328  -41.168 90.038  1.00 43.23  ? 497  ALA C N     1 
ATOM   7496  C  CA    . ALA C 2  497  ? -0.932  -40.672 91.265  1.00 40.92  ? 497  ALA C CA    1 
ATOM   7497  C  C     . ALA C 2  497  ? -0.287  -39.361 91.716  1.00 46.84  ? 497  ALA C C     1 
ATOM   7498  O  O     . ALA C 2  497  ? 0.836   -39.021 91.331  1.00 43.09  ? 497  ALA C O     1 
ATOM   7499  C  CB    . ALA C 2  497  ? -0.814  -41.717 92.372  1.00 36.71  ? 497  ALA C CB    1 
ATOM   7500  N  N     . GLN C 2  498  ? -1.012  -38.635 92.566  1.00 47.57  ? 498  GLN C N     1 
ATOM   7501  C  CA    . GLN C 2  498  ? -0.564  -37.338 93.058  1.00 43.29  ? 498  GLN C CA    1 
ATOM   7502  C  C     . GLN C 2  498  ? 0.444   -37.492 94.192  1.00 41.91  ? 498  GLN C C     1 
ATOM   7503  O  O     . GLN C 2  498  ? 0.446   -38.484 94.923  1.00 46.19  ? 498  GLN C O     1 
ATOM   7504  C  CB    . GLN C 2  498  ? -1.756  -36.509 93.534  1.00 40.35  ? 498  GLN C CB    1 
ATOM   7505  C  CG    . GLN C 2  498  ? -2.647  -36.010 92.406  1.00 48.68  ? 498  GLN C CG    1 
ATOM   7506  C  CD    . GLN C 2  498  ? -2.033  -34.844 91.649  1.00 45.62  ? 498  GLN C CD    1 
ATOM   7507  O  OE1   . GLN C 2  498  ? -1.513  -33.905 92.253  1.00 48.38  ? 498  GLN C OE1   1 
ATOM   7508  N  NE2   . GLN C 2  498  ? -2.086  -34.903 90.321  1.00 34.86  ? 498  GLN C NE2   1 
ATOM   7509  N  N     . ALA C 2  499  ? 1.295   -36.474 94.346  1.00 42.35  ? 499  ALA C N     1 
ATOM   7510  C  CA    . ALA C 2  499  ? 2.413   -36.560 95.278  1.00 47.40  ? 499  ALA C CA    1 
ATOM   7511  C  C     . ALA C 2  499  ? 1.973   -36.528 96.736  1.00 54.69  ? 499  ALA C C     1 
ATOM   7512  O  O     . ALA C 2  499  ? 2.723   -36.984 97.606  1.00 54.70  ? 499  ALA C O     1 
ATOM   7513  C  CB    . ALA C 2  499  ? 3.403   -35.425 95.011  1.00 46.59  ? 499  ALA C CB    1 
ATOM   7514  N  N     . ASN C 2  500  ? 0.790   -36.000 97.025  1.00 53.65  ? 500  ASN C N     1 
ATOM   7515  C  CA    . ASN C 2  500  ? 0.271   -35.968 98.384  1.00 52.86  ? 500  ASN C CA    1 
ATOM   7516  C  C     . ASN C 2  500  ? -0.419  -37.269 98.781  1.00 61.29  ? 500  ASN C C     1 
ATOM   7517  O  O     . ASN C 2  500  ? -1.040  -37.324 99.848  1.00 68.46  ? 500  ASN C O     1 
ATOM   7518  C  CB    . ASN C 2  500  ? -0.699  -34.792 98.548  1.00 62.07  ? 500  ASN C CB    1 
ATOM   7519  C  CG    . ASN C 2  500  ? -2.022  -35.008 97.814  1.00 70.18  ? 500  ASN C CG    1 
ATOM   7520  O  OD1   . ASN C 2  500  ? -2.103  -35.784 96.863  1.00 72.54  ? 500  ASN C OD1   1 
ATOM   7521  N  ND2   . ASN C 2  500  ? -3.065  -34.312 98.258  1.00 72.08  ? 500  ASN C ND2   1 
ATOM   7522  N  N     . THR C 2  501  ? -0.328  -38.303 97.952  1.00 56.53  ? 501  THR C N     1 
ATOM   7523  C  CA    . THR C 2  501  ? -1.007  -39.558 98.239  1.00 55.58  ? 501  THR C CA    1 
ATOM   7524  C  C     . THR C 2  501  ? -0.485  -40.145 99.548  1.00 60.27  ? 501  THR C C     1 
ATOM   7525  O  O     . THR C 2  501  ? 0.738   -40.224 99.738  1.00 58.65  ? 501  THR C O     1 
ATOM   7526  C  CB    . THR C 2  501  ? -0.803  -40.546 97.089  1.00 56.76  ? 501  THR C CB    1 
ATOM   7527  O  OG1   . THR C 2  501  ? -1.460  -40.052 95.915  1.00 53.79  ? 501  THR C OG1   1 
ATOM   7528  C  CG2   . THR C 2  501  ? -1.378  -41.904 97.440  1.00 66.15  ? 501  THR C CG2   1 
ATOM   7529  N  N     . PRO C 2  502  ? -1.365  -40.551 100.469 1.00 67.50  ? 502  PRO C N     1 
ATOM   7530  C  CA    . PRO C 2  502  ? -0.904  -41.030 101.780 1.00 66.94  ? 502  PRO C CA    1 
ATOM   7531  C  C     . PRO C 2  502  ? -0.048  -42.282 101.662 1.00 68.29  ? 502  PRO C C     1 
ATOM   7532  O  O     . PRO C 2  502  ? -0.388  -43.226 100.944 1.00 60.87  ? 502  PRO C O     1 
ATOM   7533  C  CB    . PRO C 2  502  ? -2.208  -41.318 102.532 1.00 60.67  ? 502  PRO C CB    1 
ATOM   7534  C  CG    . PRO C 2  502  ? -3.260  -40.554 101.806 1.00 62.86  ? 502  PRO C CG    1 
ATOM   7535  C  CD    . PRO C 2  502  ? -2.834  -40.530 100.374 1.00 65.95  ? 502  PRO C CD    1 
ATOM   7536  N  N     . LEU C 2  503  ? 1.067   -42.284 102.392 1.00 69.35  ? 503  LEU C N     1 
ATOM   7537  C  CA    . LEU C 2  503  ? 2.045   -43.364 102.336 1.00 71.00  ? 503  LEU C CA    1 
ATOM   7538  C  C     . LEU C 2  503  ? 2.435   -43.759 103.751 1.00 79.06  ? 503  LEU C C     1 
ATOM   7539  O  O     . LEU C 2  503  ? 2.924   -42.924 104.519 1.00 86.66  ? 503  LEU C O     1 
ATOM   7540  C  CB    . LEU C 2  503  ? 3.292   -42.949 101.544 1.00 60.09  ? 503  LEU C CB    1 
ATOM   7541  C  CG    . LEU C 2  503  ? 3.127   -42.503 100.088 1.00 63.92  ? 503  LEU C CG    1 
ATOM   7542  C  CD1   . LEU C 2  503  ? 4.466   -42.064 99.519  1.00 66.42  ? 503  LEU C CD1   1 
ATOM   7543  C  CD2   . LEU C 2  503  ? 2.513   -43.603 99.232  1.00 58.35  ? 503  LEU C CD2   1 
ATOM   7544  N  N     . GLU C 2  504  ? 2.216   -45.026 104.094 1.00 77.65  ? 504  GLU C N     1 
ATOM   7545  C  CA    . GLU C 2  504  ? 2.795   -45.628 105.290 1.00 80.68  ? 504  GLU C CA    1 
ATOM   7546  C  C     . GLU C 2  504  ? 4.016   -46.423 104.845 1.00 78.03  ? 504  GLU C C     1 
ATOM   7547  O  O     . GLU C 2  504  ? 3.884   -47.489 104.236 1.00 76.80  ? 504  GLU C O     1 
ATOM   7548  C  CB    . GLU C 2  504  ? 1.780   -46.508 106.018 1.00 82.10  ? 504  GLU C CB    1 
ATOM   7549  C  CG    . GLU C 2  504  ? 0.893   -47.344 105.107 1.00 86.67  ? 504  GLU C CG    1 
ATOM   7550  C  CD    . GLU C 2  504  ? -0.198  -48.071 105.872 1.00 92.51  ? 504  GLU C CD    1 
ATOM   7551  O  OE1   . GLU C 2  504  ? -0.389  -47.763 107.069 1.00 82.02  ? 504  GLU C OE1   1 
ATOM   7552  O  OE2   . GLU C 2  504  ? -0.863  -48.948 105.278 1.00 89.09  ? 504  GLU C OE2   1 
ATOM   7553  N  N     . GLY C 2  505  ? 5.202   -45.898 105.137 1.00 72.49  ? 505  GLY C N     1 
ATOM   7554  C  CA    . GLY C 2  505  ? 6.403   -46.465 104.547 1.00 71.53  ? 505  GLY C CA    1 
ATOM   7555  C  C     . GLY C 2  505  ? 6.423   -46.175 103.059 1.00 72.37  ? 505  GLY C C     1 
ATOM   7556  O  O     . GLY C 2  505  ? 6.250   -45.030 102.628 1.00 76.83  ? 505  GLY C O     1 
ATOM   7557  N  N     . ASN C 2  506  ? 6.621   -47.216 102.253 1.00 65.46  ? 506  ASN C N     1 
ATOM   7558  C  CA    . ASN C 2  506  ? 6.621   -47.088 100.803 1.00 61.93  ? 506  ASN C CA    1 
ATOM   7559  C  C     . ASN C 2  506  ? 5.304   -47.518 100.172 1.00 65.42  ? 506  ASN C C     1 
ATOM   7560  O  O     . ASN C 2  506  ? 5.213   -47.582 98.941  1.00 63.68  ? 506  ASN C O     1 
ATOM   7561  C  CB    . ASN C 2  506  ? 7.767   -47.902 100.199 1.00 69.26  ? 506  ASN C CB    1 
ATOM   7562  C  CG    . ASN C 2  506  ? 9.120   -47.268 100.439 1.00 79.26  ? 506  ASN C CG    1 
ATOM   7563  O  OD1   . ASN C 2  506  ? 9.720   -47.444 101.500 1.00 84.90  ? 506  ASN C OD1   1 
ATOM   7564  N  ND2   . ASN C 2  506  ? 9.612   -46.530 99.450  1.00 74.21  ? 506  ASN C ND2   1 
ATOM   7565  N  N     . ARG C 2  507  ? 4.286   -47.810 100.977 1.00 62.41  ? 507  ARG C N     1 
ATOM   7566  C  CA    . ARG C 2  507  ? 3.031   -48.359 100.484 1.00 66.92  ? 507  ARG C CA    1 
ATOM   7567  C  C     . ARG C 2  507  ? 1.928   -47.310 100.533 1.00 62.98  ? 507  ARG C C     1 
ATOM   7568  O  O     . ARG C 2  507  ? 1.861   -46.509 101.470 1.00 66.48  ? 507  ARG C O     1 
ATOM   7569  C  CB    . ARG C 2  507  ? 2.615   -49.588 101.298 1.00 77.86  ? 507  ARG C CB    1 
ATOM   7570  C  CG    . ARG C 2  507  ? 1.317   -50.237 100.834 1.00 76.72  ? 507  ARG C CG    1 
ATOM   7571  C  CD    . ARG C 2  507  ? 1.008   -51.497 101.630 1.00 85.14  ? 507  ARG C CD    1 
ATOM   7572  N  NE    . ARG C 2  507  ? 2.041   -52.516 101.455 1.00 99.29  ? 507  ARG C NE    1 
ATOM   7573  C  CZ    . ARG C 2  507  ? 2.063   -53.395 100.457 1.00 98.78  ? 507  ARG C CZ    1 
ATOM   7574  N  NH1   . ARG C 2  507  ? 1.108   -53.384 99.535  1.00 88.98  ? 507  ARG C NH1   1 
ATOM   7575  N  NH2   . ARG C 2  507  ? 3.044   -54.286 100.378 1.00 91.41  ? 507  ARG C NH2   1 
ATOM   7576  N  N     . ILE C 2  508  ? 1.064   -47.329 99.517  1.00 59.24  ? 508  ILE C N     1 
ATOM   7577  C  CA    . ILE C 2  508  ? -0.072  -46.417 99.462  1.00 63.22  ? 508  ILE C CA    1 
ATOM   7578  C  C     . ILE C 2  508  ? -1.096  -46.824 100.513 1.00 65.04  ? 508  ILE C C     1 
ATOM   7579  O  O     . ILE C 2  508  ? -1.533  -47.981 100.561 1.00 64.77  ? 508  ILE C O     1 
ATOM   7580  C  CB    . ILE C 2  508  ? -0.688  -46.415 98.056  1.00 67.59  ? 508  ILE C CB    1 
ATOM   7581  C  CG1   . ILE C 2  508  ? 0.353   -45.990 97.017  1.00 65.42  ? 508  ILE C CG1   1 
ATOM   7582  C  CG2   . ILE C 2  508  ? -1.906  -45.506 98.005  1.00 64.38  ? 508  ILE C CG2   1 
ATOM   7583  C  CD1   . ILE C 2  508  ? -0.163  -46.003 95.594  1.00 62.54  ? 508  ILE C CD1   1 
ATOM   7584  N  N     . ALA C 2  509  ? -1.493  -45.870 101.353 1.00 68.08  ? 509  ALA C N     1 
ATOM   7585  C  CA    . ALA C 2  509  ? -2.338  -46.149 102.506 1.00 67.02  ? 509  ALA C CA    1 
ATOM   7586  C  C     . ALA C 2  509  ? -3.811  -45.833 102.277 1.00 63.18  ? 509  ALA C C     1 
ATOM   7587  O  O     . ALA C 2  509  ? -4.623  -46.054 103.183 1.00 73.82  ? 509  ALA C O     1 
ATOM   7588  C  CB    . ALA C 2  509  ? -1.828  -45.374 103.726 1.00 65.44  ? 509  ALA C CB    1 
ATOM   7589  N  N     . ALA C 2  510  ? -4.181  -45.331 101.103 1.00 54.48  ? 510  ALA C N     1 
ATOM   7590  C  CA    . ALA C 2  510  ? -5.560  -44.971 100.802 1.00 52.70  ? 510  ALA C CA    1 
ATOM   7591  C  C     . ALA C 2  510  ? -6.132  -45.927 99.765  1.00 54.51  ? 510  ALA C C     1 
ATOM   7592  O  O     . ALA C 2  510  ? -5.443  -46.306 98.816  1.00 62.32  ? 510  ALA C O     1 
ATOM   7593  C  CB    . ALA C 2  510  ? -5.651  -43.533 100.285 1.00 56.99  ? 510  ALA C CB    1 
ATOM   7594  N  N     . GLU C 2  511  ? -7.395  -46.316 99.945  1.00 56.72  ? 511  GLU C N     1 
ATOM   7595  C  CA    . GLU C 2  511  ? -8.054  -47.164 98.959  1.00 63.76  ? 511  GLU C CA    1 
ATOM   7596  C  C     . GLU C 2  511  ? -8.594  -46.377 97.772  1.00 64.84  ? 511  GLU C C     1 
ATOM   7597  O  O     . GLU C 2  511  ? -8.981  -46.986 96.766  1.00 67.04  ? 511  GLU C O     1 
ATOM   7598  C  CB    . GLU C 2  511  ? -9.186  -47.965 99.614  1.00 67.08  ? 511  GLU C CB    1 
ATOM   7599  C  CG    . GLU C 2  511  ? -8.809  -49.409 99.974  1.00 83.68  ? 511  GLU C CG    1 
ATOM   7600  C  CD    . GLU C 2  511  ? -8.267  -50.209 98.783  1.00 100.10 ? 511  GLU C CD    1 
ATOM   7601  O  OE1   . GLU C 2  511  ? -7.308  -50.993 98.971  1.00 90.95  ? 511  GLU C OE1   1 
ATOM   7602  O  OE2   . GLU C 2  511  ? -8.794  -50.053 97.658  1.00 94.29  ? 511  GLU C OE2   1 
ATOM   7603  N  N     . ARG C 2  512  ? -8.621  -45.049 97.855  1.00 58.40  ? 512  ARG C N     1 
ATOM   7604  C  CA    . ARG C 2  512  ? -9.007  -44.197 96.737  1.00 59.07  ? 512  ARG C CA    1 
ATOM   7605  C  C     . ARG C 2  512  ? -7.901  -43.173 96.523  1.00 51.99  ? 512  ARG C C     1 
ATOM   7606  O  O     . ARG C 2  512  ? -7.547  -42.429 97.446  1.00 43.07  ? 512  ARG C O     1 
ATOM   7607  C  CB    . ARG C 2  512  ? -10.360 -43.524 96.986  1.00 70.40  ? 512  ARG C CB    1 
ATOM   7608  C  CG    . ARG C 2  512  ? -11.528 -44.506 96.948  1.00 68.04  ? 512  ARG C CG    1 
ATOM   7609  C  CD    . ARG C 2  512  ? -12.852 -43.851 97.310  1.00 76.51  ? 512  ARG C CD    1 
ATOM   7610  N  NE    . ARG C 2  512  ? -13.366 -42.989 96.247  1.00 89.94  ? 512  ARG C NE    1 
ATOM   7611  C  CZ    . ARG C 2  512  ? -13.326 -41.659 96.268  1.00 88.36  ? 512  ARG C CZ    1 
ATOM   7612  N  NH1   . ARG C 2  512  ? -12.794 -41.020 97.303  1.00 79.99  ? 512  ARG C NH1   1 
ATOM   7613  N  NH2   . ARG C 2  512  ? -13.824 -40.967 95.252  1.00 80.80  ? 512  ARG C NH2   1 
ATOM   7614  N  N     . VAL C 2  513  ? -7.351  -43.156 95.310  1.00 50.81  ? 513  VAL C N     1 
ATOM   7615  C  CA    . VAL C 2  513  ? -6.127  -42.437 94.974  1.00 50.55  ? 513  VAL C CA    1 
ATOM   7616  C  C     . VAL C 2  513  ? -6.427  -41.467 93.839  1.00 46.09  ? 513  VAL C C     1 
ATOM   7617  O  O     . VAL C 2  513  ? -7.074  -41.841 92.856  1.00 45.83  ? 513  VAL C O     1 
ATOM   7618  C  CB    . VAL C 2  513  ? -5.006  -43.411 94.569  1.00 45.74  ? 513  VAL C CB    1 
ATOM   7619  C  CG1   . VAL C 2  513  ? -3.825  -42.661 93.997  1.00 46.41  ? 513  VAL C CG1   1 
ATOM   7620  C  CG2   . VAL C 2  513  ? -4.585  -44.261 95.747  1.00 52.01  ? 513  VAL C CG2   1 
ATOM   7621  N  N     . VAL C 2  514  ? -5.962  -40.228 93.974  1.00 45.68  ? 514  VAL C N     1 
ATOM   7622  C  CA    . VAL C 2  514  ? -6.137  -39.220 92.931  1.00 48.77  ? 514  VAL C CA    1 
ATOM   7623  C  C     . VAL C 2  514  ? -4.994  -39.352 91.931  1.00 42.81  ? 514  VAL C C     1 
ATOM   7624  O  O     . VAL C 2  514  ? -3.817  -39.272 92.305  1.00 38.54  ? 514  VAL C O     1 
ATOM   7625  C  CB    . VAL C 2  514  ? -6.191  -37.802 93.521  1.00 49.31  ? 514  VAL C CB    1 
ATOM   7626  C  CG1   . VAL C 2  514  ? -6.314  -36.763 92.404  1.00 40.52  ? 514  VAL C CG1   1 
ATOM   7627  C  CG2   . VAL C 2  514  ? -7.348  -37.674 94.493  1.00 45.99  ? 514  VAL C CG2   1 
ATOM   7628  N  N     . ALA C 2  515  ? -5.333  -39.540 90.656  1.00 42.89  ? 515  ALA C N     1 
ATOM   7629  C  CA    . ALA C 2  515  ? -4.332  -39.774 89.630  1.00 42.71  ? 515  ALA C CA    1 
ATOM   7630  C  C     . ALA C 2  515  ? -4.765  -39.094 88.338  1.00 46.66  ? 515  ALA C C     1 
ATOM   7631  O  O     . ALA C 2  515  ? -5.857  -38.527 88.237  1.00 46.34  ? 515  ALA C O     1 
ATOM   7632  C  CB    . ALA C 2  515  ? -4.113  -41.275 89.412  1.00 44.12  ? 515  ALA C CB    1 
ATOM   7633  N  N     . ARG C 2  516  ? -3.891  -39.168 87.341  1.00 44.36  ? 516  ARG C N     1 
ATOM   7634  C  CA    . ARG C 2  516  ? -4.151  -38.655 86.006  1.00 44.05  ? 516  ARG C CA    1 
ATOM   7635  C  C     . ARG C 2  516  ? -3.960  -39.772 84.993  1.00 45.10  ? 516  ARG C C     1 
ATOM   7636  O  O     . ARG C 2  516  ? -3.041  -40.592 85.120  1.00 46.78  ? 516  ARG C O     1 
ATOM   7637  C  CB    . ARG C 2  516  ? -3.228  -37.475 85.658  1.00 44.24  ? 516  ARG C CB    1 
ATOM   7638  C  CG    . ARG C 2  516  ? -3.401  -36.269 86.561  1.00 43.12  ? 516  ARG C CG    1 
ATOM   7639  C  CD    . ARG C 2  516  ? -2.361  -35.185 86.291  1.00 41.21  ? 516  ARG C CD    1 
ATOM   7640  N  NE    . ARG C 2  516  ? -0.993  -35.671 86.458  1.00 37.68  ? 516  ARG C NE    1 
ATOM   7641  C  CZ    . ARG C 2  516  ? -0.112  -35.768 85.469  1.00 39.13  ? 516  ARG C CZ    1 
ATOM   7642  N  NH1   . ARG C 2  516  ? -0.447  -35.398 84.241  1.00 44.41  ? 516  ARG C NH1   1 
ATOM   7643  N  NH2   . ARG C 2  516  ? 1.107   -36.224 85.707  1.00 41.58  ? 516  ARG C NH2   1 
ATOM   7644  N  N     . ARG C 2  517  ? -4.860  -39.810 84.013  1.00 43.69  ? 517  ARG C N     1 
ATOM   7645  C  CA    . ARG C 2  517  ? -4.726  -40.624 82.809  1.00 44.54  ? 517  ARG C CA    1 
ATOM   7646  C  C     . ARG C 2  517  ? -4.874  -39.678 81.628  1.00 49.12  ? 517  ARG C C     1 
ATOM   7647  O  O     . ARG C 2  517  ? -5.960  -39.129 81.409  1.00 44.05  ? 517  ARG C O     1 
ATOM   7648  C  CB    . ARG C 2  517  ? -5.780  -41.728 82.745  1.00 47.45  ? 517  ARG C CB    1 
ATOM   7649  C  CG    . ARG C 2  517  ? -5.558  -42.887 83.688  1.00 54.87  ? 517  ARG C CG    1 
ATOM   7650  C  CD    . ARG C 2  517  ? -6.794  -43.774 83.705  1.00 64.06  ? 517  ARG C CD    1 
ATOM   7651  N  NE    . ARG C 2  517  ? -6.661  -44.924 84.594  1.00 61.34  ? 517  ARG C NE    1 
ATOM   7652  C  CZ    . ARG C 2  517  ? -7.685  -45.674 84.988  1.00 64.13  ? 517  ARG C CZ    1 
ATOM   7653  N  NH1   . ARG C 2  517  ? -8.914  -45.386 84.580  1.00 66.19  ? 517  ARG C NH1   1 
ATOM   7654  N  NH2   . ARG C 2  517  ? -7.484  -46.707 85.794  1.00 70.31  ? 517  ARG C NH2   1 
ATOM   7655  N  N     . LYS C 2  518  ? -3.791  -39.490 80.874  1.00 51.62  ? 518  LYS C N     1 
ATOM   7656  C  CA    . LYS C 2  518  ? -3.747  -38.511 79.786  1.00 46.09  ? 518  LYS C CA    1 
ATOM   7657  C  C     . LYS C 2  518  ? -4.268  -37.156 80.258  1.00 47.19  ? 518  LYS C C     1 
ATOM   7658  O  O     . LYS C 2  518  ? -5.128  -36.536 79.631  1.00 46.93  ? 518  LYS C O     1 
ATOM   7659  C  CB    . LYS C 2  518  ? -4.525  -38.992 78.561  1.00 42.86  ? 518  LYS C CB    1 
ATOM   7660  C  CG    . LYS C 2  518  ? -3.906  -40.179 77.831  1.00 52.56  ? 518  LYS C CG    1 
ATOM   7661  C  CD    . LYS C 2  518  ? -4.627  -40.457 76.511  1.00 67.85  ? 518  LYS C CD    1 
ATOM   7662  C  CE    . LYS C 2  518  ? -4.012  -41.638 75.768  1.00 67.45  ? 518  LYS C CE    1 
ATOM   7663  N  NZ    . LYS C 2  518  ? -4.179  -42.929 76.495  1.00 73.95  ? 518  LYS C NZ    1 
ATOM   7664  N  N     . GLY C 2  519  ? -3.750  -36.711 81.399  1.00 47.32  ? 519  GLY C N     1 
ATOM   7665  C  CA    . GLY C 2  519  ? -4.132  -35.429 81.954  1.00 51.44  ? 519  GLY C CA    1 
ATOM   7666  C  C     . GLY C 2  519  ? -5.487  -35.424 82.636  1.00 51.94  ? 519  GLY C C     1 
ATOM   7667  O  O     . GLY C 2  519  ? -5.762  -34.550 83.465  1.00 48.09  ? 519  GLY C O     1 
ATOM   7668  N  N     . GLU C 2  520  ? -6.340  -36.381 82.291  1.00 48.05  ? 520  GLU C N     1 
ATOM   7669  C  CA    . GLU C 2  520  ? -7.677  -36.438 82.871  1.00 49.48  ? 520  GLU C CA    1 
ATOM   7670  C  C     . GLU C 2  520  ? -7.584  -36.880 84.327  1.00 48.49  ? 520  GLU C C     1 
ATOM   7671  O  O     . GLU C 2  520  ? -6.974  -37.917 84.615  1.00 50.58  ? 520  GLU C O     1 
ATOM   7672  C  CB    . GLU C 2  520  ? -8.561  -37.403 82.077  1.00 54.94  ? 520  GLU C CB    1 
ATOM   7673  C  CG    . GLU C 2  520  ? -10.049 -37.290 82.362  1.00 55.09  ? 520  GLU C CG    1 
ATOM   7674  C  CD    . GLU C 2  520  ? -10.683 -36.055 81.733  1.00 72.97  ? 520  GLU C CD    1 
ATOM   7675  O  OE1   . GLU C 2  520  ? -11.555 -35.433 82.379  1.00 69.19  ? 520  GLU C OE1   1 
ATOM   7676  O  OE2   . GLU C 2  520  ? -10.316 -35.707 80.588  1.00 82.80  ? 520  GLU C OE2   1 
ATOM   7677  N  N     . PRO C 2  521  ? -8.131  -36.113 85.268  1.00 45.13  ? 521  PRO C N     1 
ATOM   7678  C  CA    . PRO C 2  521  ? -8.144  -36.555 86.668  1.00 46.38  ? 521  PRO C CA    1 
ATOM   7679  C  C     . PRO C 2  521  ? -9.118  -37.704 86.887  1.00 48.33  ? 521  PRO C C     1 
ATOM   7680  O  O     . PRO C 2  521  ? -10.235 -37.707 86.361  1.00 46.38  ? 521  PRO C O     1 
ATOM   7681  C  CB    . PRO C 2  521  ? -8.577  -35.297 87.427  1.00 44.68  ? 521  PRO C CB    1 
ATOM   7682  C  CG    . PRO C 2  521  ? -8.169  -34.164 86.518  1.00 46.84  ? 521  PRO C CG    1 
ATOM   7683  C  CD    . PRO C 2  521  ? -8.439  -34.681 85.140  1.00 42.10  ? 521  PRO C CD    1 
ATOM   7684  N  N     . VAL C 2  522  ? -8.686  -38.682 87.686  1.00 49.22  ? 522  VAL C N     1 
ATOM   7685  C  CA    . VAL C 2  522  ? -9.461  -39.897 87.918  1.00 50.79  ? 522  VAL C CA    1 
ATOM   7686  C  C     . VAL C 2  522  ? -9.134  -40.443 89.306  1.00 51.10  ? 522  VAL C C     1 
ATOM   7687  O  O     . VAL C 2  522  ? -8.004  -40.329 89.793  1.00 45.00  ? 522  VAL C O     1 
ATOM   7688  C  CB    . VAL C 2  522  ? -9.194  -40.951 86.813  1.00 45.46  ? 522  VAL C CB    1 
ATOM   7689  C  CG1   . VAL C 2  522  ? -7.734  -41.369 86.808  1.00 45.37  ? 522  VAL C CG1   1 
ATOM   7690  C  CG2   . VAL C 2  522  ? -10.107 -42.159 86.979  1.00 55.97  ? 522  VAL C CG2   1 
ATOM   7691  N  N     . ILE C 2  523  ? -10.144 -41.033 89.950  1.00 51.95  ? 523  ILE C N     1 
ATOM   7692  C  CA    . ILE C 2  523  ? -9.985  -41.708 91.235  1.00 47.90  ? 523  ILE C CA    1 
ATOM   7693  C  C     . ILE C 2  523  ? -9.805  -43.196 90.974  1.00 46.88  ? 523  ILE C C     1 
ATOM   7694  O  O     . ILE C 2  523  ? -10.583 -43.805 90.226  1.00 47.76  ? 523  ILE C O     1 
ATOM   7695  C  CB    . ILE C 2  523  ? -11.183 -41.444 92.159  1.00 45.94  ? 523  ILE C CB    1 
ATOM   7696  C  CG1   . ILE C 2  523  ? -11.471 -39.944 92.228  1.00 46.54  ? 523  ILE C CG1   1 
ATOM   7697  C  CG2   . ILE C 2  523  ? -10.903 -41.980 93.557  1.00 53.88  ? 523  ILE C CG2   1 
ATOM   7698  C  CD1   . ILE C 2  523  ? -10.328 -39.118 92.812  1.00 49.19  ? 523  ILE C CD1   1 
ATOM   7699  N  N     . VAL C 2  524  ? -8.789  -43.786 91.601  1.00 43.18  ? 524  VAL C N     1 
ATOM   7700  C  CA    . VAL C 2  524  ? -8.240  -45.053 91.139  1.00 46.45  ? 524  VAL C CA    1 
ATOM   7701  C  C     . VAL C 2  524  ? -7.701  -45.841 92.330  1.00 52.51  ? 524  VAL C C     1 
ATOM   7702  O  O     . VAL C 2  524  ? -7.350  -45.270 93.365  1.00 53.77  ? 524  VAL C O     1 
ATOM   7703  C  CB    . VAL C 2  524  ? -7.165  -44.774 90.059  1.00 47.89  ? 524  VAL C CB    1 
ATOM   7704  C  CG1   . VAL C 2  524  ? -5.777  -45.199 90.506  1.00 51.57  ? 524  VAL C CG1   1 
ATOM   7705  C  CG2   . VAL C 2  524  ? -7.569  -45.404 88.748  1.00 54.82  ? 524  VAL C CG2   1 
ATOM   7706  N  N     . SER C 2  525  ? -7.670  -47.174 92.190  1.00 50.90  ? 525  SER C N     1 
ATOM   7707  C  CA    . SER C 2  525  ? -7.190  -48.063 93.244  1.00 53.04  ? 525  SER C CA    1 
ATOM   7708  C  C     . SER C 2  525  ? -5.666  -48.050 93.315  1.00 57.54  ? 525  SER C C     1 
ATOM   7709  O  O     . SER C 2  525  ? -4.996  -47.744 92.326  1.00 63.23  ? 525  SER C O     1 
ATOM   7710  C  CB    . SER C 2  525  ? -7.668  -49.493 92.996  1.00 59.55  ? 525  SER C CB    1 
ATOM   7711  O  OG    . SER C 2  525  ? -9.062  -49.550 92.766  1.00 74.06  ? 525  SER C OG    1 
ATOM   7712  N  N     . PRO C 2  526  ? -5.088  -48.381 94.477  1.00 54.82  ? 526  PRO C N     1 
ATOM   7713  C  CA    . PRO C 2  526  ? -3.623  -48.535 94.533  1.00 55.96  ? 526  PRO C CA    1 
ATOM   7714  C  C     . PRO C 2  526  ? -3.101  -49.606 93.592  1.00 59.90  ? 526  PRO C C     1 
ATOM   7715  O  O     . PRO C 2  526  ? -1.970  -49.496 93.102  1.00 62.17  ? 526  PRO C O     1 
ATOM   7716  C  CB    . PRO C 2  526  ? -3.357  -48.898 96.000  1.00 49.92  ? 526  PRO C CB    1 
ATOM   7717  C  CG    . PRO C 2  526  ? -4.536  -48.400 96.736  1.00 53.82  ? 526  PRO C CG    1 
ATOM   7718  C  CD    . PRO C 2  526  ? -5.707  -48.520 95.805  1.00 56.51  ? 526  PRO C CD    1 
ATOM   7719  N  N     . GLU C 2  527  ? -3.897  -50.643 93.318  1.00 62.78  ? 527  GLU C N     1 
ATOM   7720  C  CA    . GLU C 2  527  ? -3.486  -51.662 92.358  1.00 63.24  ? 527  GLU C CA    1 
ATOM   7721  C  C     . GLU C 2  527  ? -3.347  -51.087 90.955  1.00 59.54  ? 527  GLU C C     1 
ATOM   7722  O  O     . GLU C 2  527  ? -2.615  -51.641 90.127  1.00 60.37  ? 527  GLU C O     1 
ATOM   7723  C  CB    . GLU C 2  527  ? -4.486  -52.822 92.352  1.00 59.31  ? 527  GLU C CB    1 
ATOM   7724  C  CG    . GLU C 2  527  ? -4.557  -53.632 93.647  1.00 64.75  ? 527  GLU C CG    1 
ATOM   7725  C  CD    . GLU C 2  527  ? -5.587  -53.105 94.641  1.00 70.83  ? 527  GLU C CD    1 
ATOM   7726  O  OE1   . GLU C 2  527  ? -6.376  -52.206 94.281  1.00 71.07  ? 527  GLU C OE1   1 
ATOM   7727  O  OE2   . GLU C 2  527  ? -5.608  -53.598 95.790  1.00 73.52  ? 527  GLU C OE2   1 
ATOM   7728  N  N     . GLU C 2  528  ? -4.035  -49.983 90.671  1.00 56.54  ? 528  GLU C N     1 
ATOM   7729  C  CA    . GLU C 2  528  ? -4.026  -49.377 89.348  1.00 61.14  ? 528  GLU C CA    1 
ATOM   7730  C  C     . GLU C 2  528  ? -2.914  -48.352 89.159  1.00 61.03  ? 528  GLU C C     1 
ATOM   7731  O  O     . GLU C 2  528  ? -2.692  -47.907 88.027  1.00 55.26  ? 528  GLU C O     1 
ATOM   7732  C  CB    . GLU C 2  528  ? -5.378  -48.708 89.070  1.00 54.01  ? 528  GLU C CB    1 
ATOM   7733  C  CG    . GLU C 2  528  ? -6.580  -49.632 89.181  1.00 56.09  ? 528  GLU C CG    1 
ATOM   7734  C  CD    . GLU C 2  528  ? -7.894  -48.898 88.979  1.00 60.31  ? 528  GLU C CD    1 
ATOM   7735  O  OE1   . GLU C 2  528  ? -8.515  -48.499 89.988  1.00 64.38  ? 528  GLU C OE1   1 
ATOM   7736  O  OE2   . GLU C 2  528  ? -8.299  -48.706 87.811  1.00 57.98  ? 528  GLU C OE2   1 
ATOM   7737  N  N     . VAL C 2  529  ? -2.215  -47.970 90.225  1.00 52.59  ? 529  VAL C N     1 
ATOM   7738  C  CA    . VAL C 2  529  ? -1.252  -46.874 90.161  1.00 51.79  ? 529  VAL C CA    1 
ATOM   7739  C  C     . VAL C 2  529  ? 0.065   -47.383 89.589  1.00 52.08  ? 529  VAL C C     1 
ATOM   7740  O  O     . VAL C 2  529  ? 0.720   -48.248 90.180  1.00 58.54  ? 529  VAL C O     1 
ATOM   7741  C  CB    . VAL C 2  529  ? -1.047  -46.244 91.546  1.00 55.83  ? 529  VAL C CB    1 
ATOM   7742  C  CG1   . VAL C 2  529  ? 0.163   -45.323 91.543  1.00 51.55  ? 529  VAL C CG1   1 
ATOM   7743  C  CG2   . VAL C 2  529  ? -2.293  -45.480 91.962  1.00 56.05  ? 529  VAL C CG2   1 
ATOM   7744  N  N     . GLU C 2  530  ? 0.458   -46.842 88.435  1.00 48.29  ? 530  GLU C N     1 
ATOM   7745  C  CA    . GLU C 2  530  ? 1.725   -47.196 87.808  1.00 48.02  ? 530  GLU C CA    1 
ATOM   7746  C  C     . GLU C 2  530  ? 2.866   -46.286 88.249  1.00 53.04  ? 530  GLU C C     1 
ATOM   7747  O  O     . GLU C 2  530  ? 3.980   -46.763 88.493  1.00 58.01  ? 530  GLU C O     1 
ATOM   7748  C  CB    . GLU C 2  530  ? 1.583   -47.156 86.284  1.00 48.57  ? 530  GLU C CB    1 
ATOM   7749  C  CG    . GLU C 2  530  ? 0.818   -48.330 85.691  1.00 52.66  ? 530  GLU C CG    1 
ATOM   7750  C  CD    . GLU C 2  530  ? 0.080   -47.960 84.418  1.00 59.10  ? 530  GLU C CD    1 
ATOM   7751  O  OE1   . GLU C 2  530  ? -0.686  -46.975 84.447  1.00 64.13  ? 530  GLU C OE1   1 
ATOM   7752  O  OE2   . GLU C 2  530  ? 0.269   -48.642 83.389  1.00 62.34  ? 530  GLU C OE2   1 
ATOM   7753  N  N     . PHE C 2  531  ? 2.614   -44.982 88.354  1.00 50.30  ? 531  PHE C N     1 
ATOM   7754  C  CA    . PHE C 2  531  ? 3.634   -44.012 88.729  1.00 48.35  ? 531  PHE C CA    1 
ATOM   7755  C  C     . PHE C 2  531  ? 3.028   -42.989 89.682  1.00 46.49  ? 531  PHE C C     1 
ATOM   7756  O  O     . PHE C 2  531  ? 1.813   -42.942 89.890  1.00 44.96  ? 531  PHE C O     1 
ATOM   7757  C  CB    . PHE C 2  531  ? 4.231   -43.314 87.498  1.00 45.13  ? 531  PHE C CB    1 
ATOM   7758  C  CG    . PHE C 2  531  ? 5.064   -44.214 86.629  1.00 54.60  ? 531  PHE C CG    1 
ATOM   7759  C  CD1   . PHE C 2  531  ? 6.409   -44.414 86.905  1.00 55.89  ? 531  PHE C CD1   1 
ATOM   7760  C  CD2   . PHE C 2  531  ? 4.507   -44.858 85.532  1.00 56.17  ? 531  PHE C CD2   1 
ATOM   7761  C  CE1   . PHE C 2  531  ? 7.185   -45.242 86.106  1.00 49.59  ? 531  PHE C CE1   1 
ATOM   7762  C  CE2   . PHE C 2  531  ? 5.278   -45.689 84.729  1.00 52.50  ? 531  PHE C CE2   1 
ATOM   7763  C  CZ    . PHE C 2  531  ? 6.619   -45.880 85.017  1.00 48.48  ? 531  PHE C CZ    1 
ATOM   7764  N  N     . MET C 2  532  ? 3.893   -42.163 90.266  1.00 43.74  ? 532  MET C N     1 
ATOM   7765  C  CA    . MET C 2  532  ? 3.458   -41.156 91.227  1.00 43.09  ? 532  MET C CA    1 
ATOM   7766  C  C     . MET C 2  532  ? 4.370   -39.937 91.145  1.00 43.17  ? 532  MET C C     1 
ATOM   7767  O  O     . MET C 2  532  ? 5.573   -40.076 90.933  1.00 42.69  ? 532  MET C O     1 
ATOM   7768  C  CB    . MET C 2  532  ? 3.447   -41.729 92.648  1.00 45.02  ? 532  MET C CB    1 
ATOM   7769  C  CG    . MET C 2  532  ? 3.115   -40.721 93.734  1.00 40.29  ? 532  MET C CG    1 
ATOM   7770  S  SD    . MET C 2  532  ? 3.225   -41.458 95.370  1.00 51.22  ? 532  MET C SD    1 
ATOM   7771  C  CE    . MET C 2  532  ? 3.299   -40.003 96.409  1.00 57.83  ? 532  MET C CE    1 
ATOM   7772  N  N     . ASP C 2  533  ? 3.795   -38.747 91.324  1.00 42.50  ? 533  ASP C N     1 
ATOM   7773  C  CA    . ASP C 2  533  ? 4.558   -37.510 91.197  1.00 39.44  ? 533  ASP C CA    1 
ATOM   7774  C  C     . ASP C 2  533  ? 5.706   -37.456 92.200  1.00 41.50  ? 533  ASP C C     1 
ATOM   7775  O  O     . ASP C 2  533  ? 5.659   -38.064 93.273  1.00 52.88  ? 533  ASP C O     1 
ATOM   7776  C  CB    . ASP C 2  533  ? 3.652   -36.296 91.404  1.00 42.03  ? 533  ASP C CB    1 
ATOM   7777  C  CG    . ASP C 2  533  ? 2.626   -36.137 90.306  1.00 42.89  ? 533  ASP C CG    1 
ATOM   7778  O  OD1   . ASP C 2  533  ? 2.784   -36.765 89.237  1.00 44.53  ? 533  ASP C OD1   1 
ATOM   7779  O  OD2   . ASP C 2  533  ? 1.663   -35.372 90.516  1.00 47.94  ? 533  ASP C OD2   1 
ATOM   7780  N  N     . VAL C 2  534  ? 6.747   -36.706 91.840  1.00 38.10  ? 534  VAL C N     1 
ATOM   7781  C  CA    . VAL C 2  534  ? 7.901   -36.561 92.725  1.00 45.61  ? 534  VAL C CA    1 
ATOM   7782  C  C     . VAL C 2  534  ? 7.620   -35.538 93.809  1.00 44.36  ? 534  VAL C C     1 
ATOM   7783  O  O     . VAL C 2  534  ? 7.975   -35.735 94.978  1.00 50.53  ? 534  VAL C O     1 
ATOM   7784  C  CB    . VAL C 2  534  ? 9.150   -36.188 91.906  1.00 45.65  ? 534  VAL C CB    1 
ATOM   7785  C  CG1   . VAL C 2  534  ? 10.233  -35.606 92.805  1.00 38.98  ? 534  VAL C CG1   1 
ATOM   7786  C  CG2   . VAL C 2  534  ? 9.658   -37.398 91.152  1.00 41.40  ? 534  VAL C CG2   1 
ATOM   7787  N  N     . SER C 2  535  ? 6.968   -34.445 93.440  1.00 39.32  ? 535  SER C N     1 
ATOM   7788  C  CA    . SER C 2  535  ? 6.723   -33.330 94.342  1.00 42.64  ? 535  SER C CA    1 
ATOM   7789  C  C     . SER C 2  535  ? 5.756   -32.358 93.662  1.00 38.00  ? 535  SER C C     1 
ATOM   7790  O  O     . SER C 2  535  ? 5.645   -32.343 92.429  1.00 42.17  ? 535  SER C O     1 
ATOM   7791  C  CB    . SER C 2  535  ? 8.033   -32.614 94.715  1.00 48.02  ? 535  SER C CB    1 
ATOM   7792  O  OG    . SER C 2  535  ? 7.797   -31.318 95.245  1.00 38.26  ? 535  SER C OG    1 
ATOM   7793  N  N     . PRO C 2  536  ? 5.036   -31.554 94.440  1.00 39.92  ? 536  PRO C N     1 
ATOM   7794  C  CA    . PRO C 2  536  ? 4.298   -30.443 93.823  1.00 40.53  ? 536  PRO C CA    1 
ATOM   7795  C  C     . PRO C 2  536  ? 5.213   -29.443 93.142  1.00 38.79  ? 536  PRO C C     1 
ATOM   7796  O  O     . PRO C 2  536  ? 4.796   -28.798 92.172  1.00 41.17  ? 536  PRO C O     1 
ATOM   7797  C  CB    . PRO C 2  536  ? 3.549   -29.824 95.009  1.00 38.68  ? 536  PRO C CB    1 
ATOM   7798  C  CG    . PRO C 2  536  ? 4.293   -30.315 96.232  1.00 42.04  ? 536  PRO C CG    1 
ATOM   7799  C  CD    . PRO C 2  536  ? 4.764   -31.675 95.882  1.00 45.22  ? 536  PRO C CD    1 
ATOM   7800  N  N     . LYS C 2  537  ? 6.459   -29.319 93.609  1.00 34.63  ? 537  LYS C N     1 
ATOM   7801  C  CA    . LYS C 2  537  ? 7.379   -28.354 93.021  1.00 35.02  ? 537  LYS C CA    1 
ATOM   7802  C  C     . LYS C 2  537  ? 7.547   -28.578 91.524  1.00 42.22  ? 537  LYS C C     1 
ATOM   7803  O  O     . LYS C 2  537  ? 7.749   -27.615 90.774  1.00 42.74  ? 537  LYS C O     1 
ATOM   7804  C  CB    . LYS C 2  537  ? 8.739   -28.425 93.717  1.00 37.51  ? 537  LYS C CB    1 
ATOM   7805  C  CG    . LYS C 2  537  ? 8.690   -28.267 95.226  1.00 46.82  ? 537  LYS C CG    1 
ATOM   7806  C  CD    . LYS C 2  537  ? 10.085  -28.380 95.830  1.00 45.45  ? 537  LYS C CD    1 
ATOM   7807  C  CE    . LYS C 2  537  ? 10.030  -28.570 97.339  1.00 58.99  ? 537  LYS C CE    1 
ATOM   7808  N  NZ    . LYS C 2  537  ? 9.312   -27.454 98.016  1.00 60.99  ? 537  LYS C NZ    1 
ATOM   7809  N  N     . GLN C 2  538  ? 7.443   -29.827 91.063  1.00 35.27  ? 538  GLN C N     1 
ATOM   7810  C  CA    . GLN C 2  538  ? 7.657   -30.097 89.647  1.00 41.77  ? 538  GLN C CA    1 
ATOM   7811  C  C     . GLN C 2  538  ? 6.582   -29.488 88.757  1.00 39.36  ? 538  GLN C C     1 
ATOM   7812  O  O     . GLN C 2  538  ? 6.776   -29.435 87.539  1.00 48.81  ? 538  GLN C O     1 
ATOM   7813  C  CB    . GLN C 2  538  ? 7.746   -31.605 89.393  1.00 45.77  ? 538  GLN C CB    1 
ATOM   7814  C  CG    . GLN C 2  538  ? 6.422   -32.353 89.401  1.00 42.61  ? 538  GLN C CG    1 
ATOM   7815  C  CD    . GLN C 2  538  ? 6.573   -33.794 88.933  1.00 39.64  ? 538  GLN C CD    1 
ATOM   7816  O  OE1   . GLN C 2  538  ? 6.014   -34.716 89.525  1.00 46.74  ? 538  GLN C OE1   1 
ATOM   7817  N  NE2   . GLN C 2  538  ? 7.330   -33.990 87.862  1.00 41.35  ? 538  GLN C NE2   1 
ATOM   7818  N  N     . VAL C 2  539  ? 5.470   -29.018 89.324  1.00 35.27  ? 539  VAL C N     1 
ATOM   7819  C  CA    . VAL C 2  539  ? 4.429   -28.413 88.501  1.00 36.97  ? 539  VAL C CA    1 
ATOM   7820  C  C     . VAL C 2  539  ? 4.742   -26.960 88.150  1.00 35.56  ? 539  VAL C C     1 
ATOM   7821  O  O     . VAL C 2  539  ? 4.247   -26.458 87.132  1.00 34.32  ? 539  VAL C O     1 
ATOM   7822  C  CB    . VAL C 2  539  ? 3.068   -28.534 89.212  1.00 39.65  ? 539  VAL C CB    1 
ATOM   7823  C  CG1   . VAL C 2  539  ? 1.938   -27.994 88.349  1.00 35.47  ? 539  VAL C CG1   1 
ATOM   7824  C  CG2   . VAL C 2  539  ? 2.793   -29.985 89.576  1.00 38.23  ? 539  VAL C CG2   1 
ATOM   7825  N  N     . PHE C 2  540  ? 5.579   -26.279 88.932  1.00 32.26  ? 540  PHE C N     1 
ATOM   7826  C  CA    . PHE C 2  540  ? 5.789   -24.844 88.783  1.00 32.79  ? 540  PHE C CA    1 
ATOM   7827  C  C     . PHE C 2  540  ? 7.257   -24.517 88.540  1.00 37.72  ? 540  PHE C C     1 
ATOM   7828  O  O     . PHE C 2  540  ? 8.152   -25.343 88.744  1.00 39.95  ? 540  PHE C O     1 
ATOM   7829  C  CB    . PHE C 2  540  ? 5.288   -24.089 90.017  1.00 31.37  ? 540  PHE C CB    1 
ATOM   7830  C  CG    . PHE C 2  540  ? 3.883   -24.420 90.388  1.00 32.11  ? 540  PHE C CG    1 
ATOM   7831  C  CD1   . PHE C 2  540  ? 2.828   -23.712 89.845  1.00 34.09  ? 540  PHE C CD1   1 
ATOM   7832  C  CD2   . PHE C 2  540  ? 3.614   -25.455 91.267  1.00 30.95  ? 540  PHE C CD2   1 
ATOM   7833  C  CE1   . PHE C 2  540  ? 1.528   -24.020 90.178  1.00 40.12  ? 540  PHE C CE1   1 
ATOM   7834  C  CE2   . PHE C 2  540  ? 2.320   -25.773 91.605  1.00 34.64  ? 540  PHE C CE2   1 
ATOM   7835  C  CZ    . PHE C 2  540  ? 1.272   -25.054 91.063  1.00 46.05  ? 540  PHE C CZ    1 
ATOM   7836  N  N     . SER C 2  541  ? 7.484   -23.276 88.114  1.00 36.22  ? 541  SER C N     1 
ATOM   7837  C  CA    . SER C 2  541  ? 8.821   -22.779 87.813  1.00 35.53  ? 541  SER C CA    1 
ATOM   7838  C  C     . SER C 2  541  ? 9.583   -22.520 89.107  1.00 31.94  ? 541  SER C C     1 
ATOM   7839  O  O     . SER C 2  541  ? 9.123   -22.820 90.211  1.00 37.12  ? 541  SER C O     1 
ATOM   7840  C  CB    . SER C 2  541  ? 8.737   -21.510 86.970  1.00 39.13  ? 541  SER C CB    1 
ATOM   7841  O  OG    . SER C 2  541  ? 8.214   -20.441 87.739  1.00 34.78  ? 541  SER C OG    1 
ATOM   7842  N  N     . VAL C 2  542  ? 10.773  -21.934 88.975  1.00 30.77  ? 542  VAL C N     1 
ATOM   7843  C  CA    . VAL C 2  542  ? 11.550  -21.565 90.154  1.00 32.80  ? 542  VAL C CA    1 
ATOM   7844  C  C     . VAL C 2  542  ? 10.892  -20.394 90.878  1.00 32.81  ? 542  VAL C C     1 
ATOM   7845  O  O     . VAL C 2  542  ? 10.667  -20.438 92.093  1.00 31.04  ? 542  VAL C O     1 
ATOM   7846  C  CB    . VAL C 2  542  ? 13.006  -21.252 89.764  1.00 30.89  ? 542  VAL C CB    1 
ATOM   7847  C  CG1   . VAL C 2  542  ? 13.718  -20.523 90.890  1.00 28.13  ? 542  VAL C CG1   1 
ATOM   7848  C  CG2   . VAL C 2  542  ? 13.744  -22.538 89.416  1.00 33.53  ? 542  VAL C CG2   1 
ATOM   7849  N  N     . ASN C 2  543  ? 10.552  -19.337 90.136  1.00 32.28  ? 543  ASN C N     1 
ATOM   7850  C  CA    . ASN C 2  543  ? 9.962   -18.154 90.757  1.00 29.77  ? 543  ASN C CA    1 
ATOM   7851  C  C     . ASN C 2  543  ? 8.627   -18.475 91.412  1.00 30.84  ? 543  ASN C C     1 
ATOM   7852  O  O     . ASN C 2  543  ? 8.332   -17.988 92.510  1.00 33.38  ? 543  ASN C O     1 
ATOM   7853  C  CB    . ASN C 2  543  ? 9.790   -17.053 89.717  1.00 29.85  ? 543  ASN C CB    1 
ATOM   7854  C  CG    . ASN C 2  543  ? 11.087  -16.671 89.068  1.00 31.92  ? 543  ASN C CG    1 
ATOM   7855  O  OD1   . ASN C 2  543  ? 11.620  -17.412 88.242  1.00 36.60  ? 543  ASN C OD1   1 
ATOM   7856  N  ND2   . ASN C 2  543  ? 11.613  -15.513 89.438  1.00 27.52  ? 543  ASN C ND2   1 
ATOM   7857  N  N     . THR C 2  544  ? 7.800   -19.284 90.750  1.00 30.59  ? 544  THR C N     1 
ATOM   7858  C  CA    . THR C 2  544  ? 6.523   -19.667 91.336  1.00 31.00  ? 544  THR C CA    1 
ATOM   7859  C  C     . THR C 2  544  ? 6.717   -20.548 92.566  1.00 37.01  ? 544  THR C C     1 
ATOM   7860  O  O     . THR C 2  544  ? 5.892   -20.517 93.488  1.00 36.10  ? 544  THR C O     1 
ATOM   7861  C  CB    . THR C 2  544  ? 5.671   -20.379 90.290  1.00 30.58  ? 544  THR C CB    1 
ATOM   7862  O  OG1   . THR C 2  544  ? 5.646   -19.594 89.094  1.00 30.40  ? 544  THR C OG1   1 
ATOM   7863  C  CG2   . THR C 2  544  ? 4.251   -20.567 90.795  1.00 29.19  ? 544  THR C CG2   1 
ATOM   7864  N  N     . ASN C 2  545  ? 7.805   -21.321 92.609  1.00 34.86  ? 545  ASN C N     1 
ATOM   7865  C  CA    . ASN C 2  545  ? 8.100   -22.136 93.781  1.00 32.17  ? 545  ASN C CA    1 
ATOM   7866  C  C     . ASN C 2  545  ? 8.568   -21.313 94.973  1.00 34.05  ? 545  ASN C C     1 
ATOM   7867  O  O     . ASN C 2  545  ? 8.689   -21.867 96.070  1.00 36.62  ? 545  ASN C O     1 
ATOM   7868  C  CB    . ASN C 2  545  ? 9.157   -23.186 93.446  1.00 28.64  ? 545  ASN C CB    1 
ATOM   7869  C  CG    . ASN C 2  545  ? 8.552   -24.477 92.944  1.00 35.05  ? 545  ASN C CG    1 
ATOM   7870  O  OD1   . ASN C 2  545  ? 8.052   -25.281 93.728  1.00 39.78  ? 545  ASN C OD1   1 
ATOM   7871  N  ND2   . ASN C 2  545  ? 8.599   -24.687 91.634  1.00 34.47  ? 545  ASN C ND2   1 
ATOM   7872  N  N     . LEU C 2  546  ? 8.839   -20.024 94.788  1.00 28.78  ? 546  LEU C N     1 
ATOM   7873  C  CA    . LEU C 2  546  ? 9.268   -19.156 95.872  1.00 28.03  ? 546  LEU C CA    1 
ATOM   7874  C  C     . LEU C 2  546  ? 8.109   -18.447 96.559  1.00 36.17  ? 546  LEU C C     1 
ATOM   7875  O  O     . LEU C 2  546  ? 8.347   -17.625 97.451  1.00 35.23  ? 546  LEU C O     1 
ATOM   7876  C  CB    . LEU C 2  546  ? 10.266  -18.123 95.350  1.00 26.22  ? 546  LEU C CB    1 
ATOM   7877  C  CG    . LEU C 2  546  ? 11.603  -18.712 94.912  1.00 31.74  ? 546  LEU C CG    1 
ATOM   7878  C  CD1   . LEU C 2  546  ? 12.540  -17.619 94.433  1.00 29.52  ? 546  LEU C CD1   1 
ATOM   7879  C  CD2   . LEU C 2  546  ? 12.221  -19.499 96.056  1.00 33.31  ? 546  LEU C CD2   1 
ATOM   7880  N  N     . ILE C 2  547  ? 6.872   -18.746 96.173  1.00 37.18  ? 547  ILE C N     1 
ATOM   7881  C  CA    . ILE C 2  547  ? 5.686   -18.130 96.759  1.00 33.36  ? 547  ILE C CA    1 
ATOM   7882  C  C     . ILE C 2  547  ? 5.136   -19.085 97.818  1.00 35.06  ? 547  ILE C C     1 
ATOM   7883  O  O     . ILE C 2  547  ? 4.573   -20.132 97.457  1.00 32.70  ? 547  ILE C O     1 
ATOM   7884  C  CB    . ILE C 2  547  ? 4.625   -17.825 95.698  1.00 30.21  ? 547  ILE C CB    1 
ATOM   7885  C  CG1   . ILE C 2  547  ? 5.196   -16.922 94.614  1.00 31.49  ? 547  ILE C CG1   1 
ATOM   7886  C  CG2   . ILE C 2  547  ? 3.410   -17.171 96.338  1.00 34.08  ? 547  ILE C CG2   1 
ATOM   7887  C  CD1   . ILE C 2  547  ? 4.206   -16.613 93.520  1.00 33.40  ? 547  ILE C CD1   1 
ATOM   7888  N  N     . PRO C 2  548  ? 5.268   -18.774 99.105  1.00 37.16  ? 548  PRO C N     1 
ATOM   7889  C  CA    . PRO C 2  548  ? 4.617   -19.595 100.131 1.00 38.47  ? 548  PRO C CA    1 
ATOM   7890  C  C     . PRO C 2  548  ? 3.107   -19.436 100.075 1.00 36.29  ? 548  PRO C C     1 
ATOM   7891  O  O     . PRO C 2  548  ? 2.577   -18.424 99.614  1.00 37.23  ? 548  PRO C O     1 
ATOM   7892  C  CB    . PRO C 2  548  ? 5.188   -19.046 101.443 1.00 36.21  ? 548  PRO C CB    1 
ATOM   7893  C  CG    . PRO C 2  548  ? 5.605   -17.649 101.115 1.00 30.06  ? 548  PRO C CG    1 
ATOM   7894  C  CD    . PRO C 2  548  ? 6.063   -17.679 99.688  1.00 33.34  ? 548  PRO C CD    1 
ATOM   7895  N  N     . PHE C 2  549  ? 2.411   -20.470 100.552 1.00 34.87  ? 549  PHE C N     1 
ATOM   7896  C  CA    . PHE C 2  549  ? 0.946   -20.497 100.559 1.00 34.16  ? 549  PHE C CA    1 
ATOM   7897  C  C     . PHE C 2  549  ? 0.379   -20.270 99.161  1.00 36.06  ? 549  PHE C C     1 
ATOM   7898  O  O     . PHE C 2  549  ? -0.665  -19.633 98.994  1.00 33.19  ? 549  PHE C O     1 
ATOM   7899  C  CB    . PHE C 2  549  ? 0.373   -19.469 101.534 1.00 32.77  ? 549  PHE C CB    1 
ATOM   7900  C  CG    . PHE C 2  549  ? 0.814   -19.663 102.950 1.00 36.61  ? 549  PHE C CG    1 
ATOM   7901  C  CD1   . PHE C 2  549  ? 0.451   -20.803 103.649 1.00 40.72  ? 549  PHE C CD1   1 
ATOM   7902  C  CD2   . PHE C 2  549  ? 1.574   -18.697 103.591 1.00 33.19  ? 549  PHE C CD2   1 
ATOM   7903  C  CE1   . PHE C 2  549  ? 0.845   -20.986 104.962 1.00 37.05  ? 549  PHE C CE1   1 
ATOM   7904  C  CE2   . PHE C 2  549  ? 1.971   -18.870 104.903 1.00 36.16  ? 549  PHE C CE2   1 
ATOM   7905  C  CZ    . PHE C 2  549  ? 1.603   -20.019 105.590 1.00 43.07  ? 549  PHE C CZ    1 
ATOM   7906  N  N     . LEU C 2  550  ? 1.080   -20.787 98.148  1.00 34.58  ? 550  LEU C N     1 
ATOM   7907  C  CA    . LEU C 2  550  ? 0.659   -20.606 96.762  1.00 34.51  ? 550  LEU C CA    1 
ATOM   7908  C  C     . LEU C 2  550  ? -0.736  -21.169 96.510  1.00 34.97  ? 550  LEU C C     1 
ATOM   7909  O  O     . LEU C 2  550  ? -1.488  -20.618 95.698  1.00 33.08  ? 550  LEU C O     1 
ATOM   7910  C  CB    . LEU C 2  550  ? 1.679   -21.259 95.827  1.00 38.90  ? 550  LEU C CB    1 
ATOM   7911  C  CG    . LEU C 2  550  ? 1.367   -21.346 94.332  1.00 32.09  ? 550  LEU C CG    1 
ATOM   7912  C  CD1   . LEU C 2  550  ? 1.308   -19.964 93.710  1.00 33.27  ? 550  LEU C CD1   1 
ATOM   7913  C  CD2   . LEU C 2  550  ? 2.403   -22.209 93.636  1.00 34.19  ? 550  LEU C CD2   1 
ATOM   7914  N  N     . GLU C 2  551  ? -1.105  -22.252 97.201  1.00 39.48  ? 551  GLU C N     1 
ATOM   7915  C  CA    . GLU C 2  551  ? -2.426  -22.846 97.023  1.00 36.56  ? 551  GLU C CA    1 
ATOM   7916  C  C     . GLU C 2  551  ? -3.547  -21.915 97.464  1.00 35.10  ? 551  GLU C C     1 
ATOM   7917  O  O     . GLU C 2  551  ? -4.710  -22.160 97.124  1.00 36.56  ? 551  GLU C O     1 
ATOM   7918  C  CB    . GLU C 2  551  ? -2.522  -24.169 97.788  1.00 35.06  ? 551  GLU C CB    1 
ATOM   7919  C  CG    . GLU C 2  551  ? -2.333  -24.055 99.298  1.00 36.34  ? 551  GLU C CG    1 
ATOM   7920  C  CD    . GLU C 2  551  ? -0.871  -24.032 99.717  1.00 39.79  ? 551  GLU C CD    1 
ATOM   7921  O  OE1   . GLU C 2  551  ? -0.596  -24.068 100.937 1.00 43.82  ? 551  GLU C OE1   1 
ATOM   7922  O  OE2   . GLU C 2  551  ? 0.006   -23.984 98.830  1.00 39.58  ? 551  GLU C OE2   1 
ATOM   7923  N  N     . HIS C 2  552  ? -3.227  -20.861 98.212  1.00 33.03  ? 552  HIS C N     1 
ATOM   7924  C  CA    . HIS C 2  552  ? -4.209  -19.888 98.663  1.00 34.62  ? 552  HIS C CA    1 
ATOM   7925  C  C     . HIS C 2  552  ? -4.237  -18.638 97.793  1.00 38.38  ? 552  HIS C C     1 
ATOM   7926  O  O     . HIS C 2  552  ? -4.927  -17.674 98.138  1.00 42.15  ? 552  HIS C O     1 
ATOM   7927  C  CB    . HIS C 2  552  ? -3.939  -19.506 100.120 1.00 31.21  ? 552  HIS C CB    1 
ATOM   7928  C  CG    . HIS C 2  552  ? -3.869  -20.681 101.047 1.00 37.99  ? 552  HIS C CG    1 
ATOM   7929  N  ND1   . HIS C 2  552  ? -4.986  -21.224 101.645 1.00 35.24  ? 552  HIS C ND1   1 
ATOM   7930  C  CD2   . HIS C 2  552  ? -2.817  -21.415 101.481 1.00 37.53  ? 552  HIS C CD2   1 
ATOM   7931  C  CE1   . HIS C 2  552  ? -4.626  -22.242 102.406 1.00 33.52  ? 552  HIS C CE1   1 
ATOM   7932  N  NE2   . HIS C 2  552  ? -3.315  -22.377 102.326 1.00 35.54  ? 552  HIS C NE2   1 
ATOM   7933  N  N     . ASP C 2  553  ? -3.509  -18.632 96.677  1.00 32.90  ? 553  ASP C N     1 
ATOM   7934  C  CA    . ASP C 2  553  ? -3.411  -17.470 95.805  1.00 29.09  ? 553  ASP C CA    1 
ATOM   7935  C  C     . ASP C 2  553  ? -4.027  -17.781 94.451  1.00 29.99  ? 553  ASP C C     1 
ATOM   7936  O  O     . ASP C 2  553  ? -3.721  -18.815 93.850  1.00 29.61  ? 553  ASP C O     1 
ATOM   7937  C  CB    . ASP C 2  553  ? -1.956  -17.033 95.614  1.00 27.72  ? 553  ASP C CB    1 
ATOM   7938  C  CG    . ASP C 2  553  ? -1.351  -16.454 96.872  1.00 31.86  ? 553  ASP C CG    1 
ATOM   7939  O  OD1   . ASP C 2  553  ? -2.114  -15.896 97.689  1.00 33.32  ? 553  ASP C OD1   1 
ATOM   7940  O  OD2   . ASP C 2  553  ? -0.118  -16.569 97.051  1.00 31.13  ? 553  ASP C OD2   1 
ATOM   7941  N  N     . ASP C 2  554  ? -4.879  -16.878 93.969  1.00 30.51  ? 554  ASP C N     1 
ATOM   7942  C  CA    . ASP C 2  554  ? -5.366  -16.965 92.600  1.00 29.44  ? 554  ASP C CA    1 
ATOM   7943  C  C     . ASP C 2  554  ? -4.195  -16.878 91.628  1.00 31.69  ? 554  ASP C C     1 
ATOM   7944  O  O     . ASP C 2  554  ? -3.208  -16.179 91.872  1.00 32.79  ? 554  ASP C O     1 
ATOM   7945  C  CB    . ASP C 2  554  ? -6.372  -15.850 92.319  1.00 31.23  ? 554  ASP C CB    1 
ATOM   7946  C  CG    . ASP C 2  554  ? -6.969  -15.937 90.931  1.00 35.03  ? 554  ASP C CG    1 
ATOM   7947  O  OD1   . ASP C 2  554  ? -7.015  -17.049 90.365  1.00 35.18  ? 554  ASP C OD1   1 
ATOM   7948  O  OD2   . ASP C 2  554  ? -7.382  -14.885 90.401  1.00 41.70  ? 554  ASP C OD2   1 
ATOM   7949  N  N     . ALA C 2  555  ? -4.321  -17.594 90.507  1.00 35.13  ? 555  ALA C N     1 
ATOM   7950  C  CA    . ALA C 2  555  ? -3.186  -17.786 89.609  1.00 32.56  ? 555  ALA C CA    1 
ATOM   7951  C  C     . ALA C 2  555  ? -2.662  -16.472 89.037  1.00 32.17  ? 555  ALA C C     1 
ATOM   7952  O  O     . ALA C 2  555  ? -1.480  -16.380 88.691  1.00 33.53  ? 555  ALA C O     1 
ATOM   7953  C  CB    . ALA C 2  555  ? -3.572  -18.737 88.477  1.00 31.77  ? 555  ALA C CB    1 
ATOM   7954  N  N     . ASN C 2  556  ? -3.509  -15.446 88.939  1.00 30.47  ? 556  ASN C N     1 
ATOM   7955  C  CA    . ASN C 2  556  ? -3.078  -14.195 88.318  1.00 30.37  ? 556  ASN C CA    1 
ATOM   7956  C  C     . ASN C 2  556  ? -2.128  -13.418 89.226  1.00 31.25  ? 556  ASN C C     1 
ATOM   7957  O  O     . ASN C 2  556  ? -1.046  -12.994 88.799  1.00 37.79  ? 556  ASN C O     1 
ATOM   7958  C  CB    . ASN C 2  556  ? -4.296  -13.355 87.949  1.00 32.46  ? 556  ASN C CB    1 
ATOM   7959  C  CG    . ASN C 2  556  ? -5.248  -14.094 87.032  1.00 43.11  ? 556  ASN C CG    1 
ATOM   7960  O  OD1   . ASN C 2  556  ? -5.135  -14.019 85.807  1.00 48.06  ? 556  ASN C OD1   1 
ATOM   7961  N  ND2   . ASN C 2  556  ? -6.189  -14.827 87.621  1.00 39.67  ? 556  ASN C ND2   1 
ATOM   7962  N  N     . ARG C 2  557  ? -2.507  -13.223 90.488  1.00 26.93  ? 557  ARG C N     1 
ATOM   7963  C  CA    . ARG C 2  557  ? -1.596  -12.554 91.410  1.00 29.38  ? 557  ARG C CA    1 
ATOM   7964  C  C     . ARG C 2  557  ? -0.394  -13.432 91.746  1.00 32.82  ? 557  ARG C C     1 
ATOM   7965  O  O     . ARG C 2  557  ? 0.688   -12.914 92.055  1.00 32.00  ? 557  ARG C O     1 
ATOM   7966  C  CB    . ARG C 2  557  ? -2.349  -12.134 92.669  1.00 31.47  ? 557  ARG C CB    1 
ATOM   7967  C  CG    . ARG C 2  557  ? -3.333  -11.010 92.410  1.00 30.35  ? 557  ARG C CG    1 
ATOM   7968  C  CD    . ARG C 2  557  ? -2.606  -9.722  92.063  1.00 28.34  ? 557  ARG C CD    1 
ATOM   7969  N  NE    . ARG C 2  557  ? -3.482  -8.770  91.388  1.00 28.38  ? 557  ARG C NE    1 
ATOM   7970  C  CZ    . ARG C 2  557  ? -3.250  -7.463  91.308  1.00 27.64  ? 557  ARG C CZ    1 
ATOM   7971  N  NH1   . ARG C 2  557  ? -2.171  -6.940  91.875  1.00 26.76  ? 557  ARG C NH1   1 
ATOM   7972  N  NH2   . ARG C 2  557  ? -4.109  -6.676  90.673  1.00 26.91  ? 557  ARG C NH2   1 
ATOM   7973  N  N     . ALA C 2  558  ? -0.554  -14.756 91.678  1.00 29.69  ? 558  ALA C N     1 
ATOM   7974  C  CA    . ALA C 2  558  ? 0.603   -15.639 91.767  1.00 30.89  ? 558  ALA C CA    1 
ATOM   7975  C  C     . ALA C 2  558  ? 1.583   -15.349 90.639  1.00 33.04  ? 558  ALA C C     1 
ATOM   7976  O  O     . ALA C 2  558  ? 2.793   -15.233 90.862  1.00 33.19  ? 558  ALA C O     1 
ATOM   7977  C  CB    . ALA C 2  558  ? 0.157   -17.099 91.731  1.00 27.48  ? 558  ALA C CB    1 
ATOM   7978  N  N     . LEU C 2  559  ? 1.068   -15.243 89.413  1.00 30.66  ? 559  LEU C N     1 
ATOM   7979  C  CA    . LEU C 2  559  ? 1.884   -14.821 88.282  1.00 30.45  ? 559  LEU C CA    1 
ATOM   7980  C  C     . LEU C 2  559  ? 2.598   -13.510 88.585  1.00 31.89  ? 559  LEU C C     1 
ATOM   7981  O  O     . LEU C 2  559  ? 3.790   -13.353 88.300  1.00 31.17  ? 559  LEU C O     1 
ATOM   7982  C  CB    . LEU C 2  559  ? 0.996   -14.687 87.038  1.00 24.95  ? 559  LEU C CB    1 
ATOM   7983  C  CG    . LEU C 2  559  ? 1.481   -13.951 85.786  1.00 24.04  ? 559  LEU C CG    1 
ATOM   7984  C  CD1   . LEU C 2  559  ? 0.770   -14.519 84.588  1.00 23.13  ? 559  LEU C CD1   1 
ATOM   7985  C  CD2   . LEU C 2  559  ? 1.209   -12.460 85.866  1.00 26.84  ? 559  LEU C CD2   1 
ATOM   7986  N  N     . MET C 2  560  ? 1.868   -12.549 89.151  1.00 32.42  ? 560  MET C N     1 
ATOM   7987  C  CA    . MET C 2  560  ? 2.446   -11.225 89.359  1.00 30.68  ? 560  MET C CA    1 
ATOM   7988  C  C     . MET C 2  560  ? 3.589   -11.274 90.360  1.00 30.99  ? 560  MET C C     1 
ATOM   7989  O  O     . MET C 2  560  ? 4.652   -10.691 90.125  1.00 35.52  ? 560  MET C O     1 
ATOM   7990  C  CB    . MET C 2  560  ? 1.373   -10.237 89.807  1.00 28.59  ? 560  MET C CB    1 
ATOM   7991  C  CG    . MET C 2  560  ? 0.342   -9.972  88.738  1.00 30.87  ? 560  MET C CG    1 
ATOM   7992  S  SD    . MET C 2  560  ? -0.611  -8.489  89.050  1.00 35.27  ? 560  MET C SD    1 
ATOM   7993  C  CE    . MET C 2  560  ? -2.004  -8.763  87.956  1.00 35.25  ? 560  MET C CE    1 
ATOM   7994  N  N     . GLY C 2  561  ? 3.393   -11.961 91.486  1.00 29.59  ? 561  GLY C N     1 
ATOM   7995  C  CA    . GLY C 2  561  ? 4.475   -12.088 92.453  1.00 33.18  ? 561  GLY C CA    1 
ATOM   7996  C  C     . GLY C 2  561  ? 5.657   -12.863 91.899  1.00 34.04  ? 561  GLY C C     1 
ATOM   7997  O  O     . GLY C 2  561  ? 6.820   -12.473 92.087  1.00 36.12  ? 561  GLY C O     1 
ATOM   7998  N  N     . SER C 2  562  ? 5.372   -13.963 91.197  1.00 32.73  ? 562  SER C N     1 
ATOM   7999  C  CA    . SER C 2  562  ? 6.412   -14.758 90.557  1.00 32.36  ? 562  SER C CA    1 
ATOM   8000  C  C     . SER C 2  562  ? 7.268   -13.896 89.637  1.00 33.86  ? 562  SER C C     1 
ATOM   8001  O  O     . SER C 2  562  ? 8.503   -13.950 89.684  1.00 32.61  ? 562  SER C O     1 
ATOM   8002  C  CB    . SER C 2  562  ? 5.756   -15.907 89.788  1.00 28.27  ? 562  SER C CB    1 
ATOM   8003  O  OG    . SER C 2  562  ? 6.705   -16.856 89.350  1.00 32.16  ? 562  SER C OG    1 
ATOM   8004  N  N     . ASN C 2  563  ? 6.623   -13.069 88.812  1.00 32.32  ? 563  ASN C N     1 
ATOM   8005  C  CA    . ASN C 2  563  ? 7.362   -12.209 87.894  1.00 27.63  ? 563  ASN C CA    1 
ATOM   8006  C  C     . ASN C 2  563  ? 8.126   -11.130 88.645  1.00 27.19  ? 563  ASN C C     1 
ATOM   8007  O  O     . ASN C 2  563  ? 9.321   -10.920 88.409  1.00 29.58  ? 563  ASN C O     1 
ATOM   8008  C  CB    . ASN C 2  563  ? 6.408   -11.580 86.880  1.00 27.30  ? 563  ASN C CB    1 
ATOM   8009  C  CG    . ASN C 2  563  ? 6.019   -12.538 85.776  1.00 37.53  ? 563  ASN C CG    1 
ATOM   8010  O  OD1   . ASN C 2  563  ? 6.825   -13.363 85.338  1.00 41.55  ? 563  ASN C OD1   1 
ATOM   8011  N  ND2   . ASN C 2  563  ? 4.780   -12.434 85.316  1.00 37.27  ? 563  ASN C ND2   1 
ATOM   8012  N  N     . MET C 2  564  ? 7.453   -10.436 89.561  1.00 31.32  ? 564  MET C N     1 
ATOM   8013  C  CA    . MET C 2  564  ? 8.067   -9.298  90.227  1.00 32.30  ? 564  MET C CA    1 
ATOM   8014  C  C     . MET C 2  564  ? 9.248   -9.700  91.090  1.00 33.05  ? 564  MET C C     1 
ATOM   8015  O  O     . MET C 2  564  ? 10.074  -8.843  91.418  1.00 35.28  ? 564  MET C O     1 
ATOM   8016  C  CB    . MET C 2  564  ? 7.025   -8.557  91.064  1.00 23.20  ? 564  MET C CB    1 
ATOM   8017  C  CG    . MET C 2  564  ? 6.036   -7.791  90.220  1.00 26.98  ? 564  MET C CG    1 
ATOM   8018  S  SD    . MET C 2  564  ? 4.863   -6.848  91.191  1.00 31.79  ? 564  MET C SD    1 
ATOM   8019  C  CE    . MET C 2  564  ? 4.036   -8.156  92.087  1.00 34.77  ? 564  MET C CE    1 
ATOM   8020  N  N     . GLN C 2  565  ? 9.356   -10.977 91.465  1.00 30.63  ? 565  GLN C N     1 
ATOM   8021  C  CA    . GLN C 2  565  ? 10.538  -11.382 92.216  1.00 30.59  ? 565  GLN C CA    1 
ATOM   8022  C  C     . GLN C 2  565  ? 11.823  -11.106 91.438  1.00 33.78  ? 565  GLN C C     1 
ATOM   8023  O  O     . GLN C 2  565  ? 12.851  -10.785 92.041  1.00 36.86  ? 565  GLN C O     1 
ATOM   8024  C  CB    . GLN C 2  565  ? 10.436  -12.853 92.610  1.00 29.05  ? 565  GLN C CB    1 
ATOM   8025  C  CG    . GLN C 2  565  ? 9.682   -13.066 93.913  1.00 25.02  ? 565  GLN C CG    1 
ATOM   8026  C  CD    . GLN C 2  565  ? 9.520   -14.527 94.267  1.00 27.78  ? 565  GLN C CD    1 
ATOM   8027  O  OE1   . GLN C 2  565  ? 10.036  -14.989 95.284  1.00 29.58  ? 565  GLN C OE1   1 
ATOM   8028  N  NE2   . GLN C 2  565  ? 8.790   -15.263 93.435  1.00 27.20  ? 565  GLN C NE2   1 
ATOM   8029  N  N     . THR C 2  566  ? 11.785  -11.182 90.106  1.00 38.64  ? 566  THR C N     1 
ATOM   8030  C  CA    . THR C 2  566  ? 12.980  -10.880 89.324  1.00 36.97  ? 566  THR C CA    1 
ATOM   8031  C  C     . THR C 2  566  ? 13.271  -9.389  89.249  1.00 36.70  ? 566  THR C C     1 
ATOM   8032  O  O     . THR C 2  566  ? 14.372  -9.007  88.842  1.00 41.42  ? 566  THR C O     1 
ATOM   8033  C  CB    . THR C 2  566  ? 12.859  -11.425 87.898  1.00 32.85  ? 566  THR C CB    1 
ATOM   8034  O  OG1   . THR C 2  566  ? 12.126  -10.497 87.090  1.00 33.81  ? 566  THR C OG1   1 
ATOM   8035  C  CG2   . THR C 2  566  ? 12.138  -12.752 87.902  1.00 28.84  ? 566  THR C CG2   1 
ATOM   8036  N  N     . GLN C 2  567  ? 12.311  -8.543  89.608  1.00 33.90  ? 567  GLN C N     1 
ATOM   8037  C  CA    . GLN C 2  567  ? 12.517  -7.105  89.636  1.00 34.81  ? 567  GLN C CA    1 
ATOM   8038  C  C     . GLN C 2  567  ? 12.958  -6.614  91.008  1.00 34.96  ? 567  GLN C C     1 
ATOM   8039  O  O     . GLN C 2  567  ? 13.045  -5.401  91.221  1.00 35.70  ? 567  GLN C O     1 
ATOM   8040  C  CB    . GLN C 2  567  ? 11.238  -6.386  89.195  1.00 35.22  ? 567  GLN C CB    1 
ATOM   8041  C  CG    . GLN C 2  567  ? 10.645  -6.947  87.904  1.00 40.07  ? 567  GLN C CG    1 
ATOM   8042  C  CD    . GLN C 2  567  ? 9.381   -6.231  87.458  1.00 48.28  ? 567  GLN C CD    1 
ATOM   8043  O  OE1   . GLN C 2  567  ? 9.013   -5.187  88.001  1.00 49.55  ? 567  GLN C OE1   1 
ATOM   8044  N  NE2   . GLN C 2  567  ? 8.708   -6.794  86.457  1.00 46.71  ? 567  GLN C NE2   1 
ATOM   8045  N  N     . ALA C 2  568  ? 13.246  -7.527  91.932  1.00 35.25  ? 568  ALA C N     1 
ATOM   8046  C  CA    . ALA C 2  568  ? 13.644  -7.144  93.281  1.00 34.66  ? 568  ALA C CA    1 
ATOM   8047  C  C     . ALA C 2  568  ? 15.079  -6.632  93.292  1.00 34.24  ? 568  ALA C C     1 
ATOM   8048  O  O     . ALA C 2  568  ? 15.988  -7.274  92.755  1.00 32.37  ? 568  ALA C O     1 
ATOM   8049  C  CB    . ALA C 2  568  ? 13.497  -8.327  94.237  1.00 33.00  ? 568  ALA C CB    1 
ATOM   8050  N  N     . VAL C 2  569  ? 15.277  -5.476  93.915  1.00 32.45  ? 569  VAL C N     1 
ATOM   8051  C  CA    . VAL C 2  569  ? 16.581  -4.825  93.979  1.00 27.18  ? 569  VAL C CA    1 
ATOM   8052  C  C     . VAL C 2  569  ? 17.352  -5.379  95.169  1.00 35.33  ? 569  VAL C C     1 
ATOM   8053  O  O     . VAL C 2  569  ? 16.784  -5.514  96.265  1.00 37.41  ? 569  VAL C O     1 
ATOM   8054  C  CB    . VAL C 2  569  ? 16.431  -3.301  94.081  1.00 30.25  ? 569  VAL C CB    1 
ATOM   8055  C  CG1   . VAL C 2  569  ? 17.791  -2.643  94.189  1.00 32.14  ? 569  VAL C CG1   1 
ATOM   8056  C  CG2   . VAL C 2  569  ? 15.663  -2.768  92.888  1.00 32.10  ? 569  VAL C CG2   1 
ATOM   8057  N  N     . PRO C 2  570  ? 18.627  -5.733  95.000  1.00 34.70  ? 570  PRO C N     1 
ATOM   8058  C  CA    . PRO C 2  570  ? 19.440  -6.146  96.151  1.00 31.60  ? 570  PRO C CA    1 
ATOM   8059  C  C     . PRO C 2  570  ? 19.635  -4.990  97.122  1.00 33.35  ? 570  PRO C C     1 
ATOM   8060  O  O     . PRO C 2  570  ? 20.068  -3.901  96.739  1.00 34.27  ? 570  PRO C O     1 
ATOM   8061  C  CB    . PRO C 2  570  ? 20.765  -6.579  95.512  1.00 30.55  ? 570  PRO C CB    1 
ATOM   8062  C  CG    . PRO C 2  570  ? 20.422  -6.893  94.100  1.00 32.91  ? 570  PRO C CG    1 
ATOM   8063  C  CD    . PRO C 2  570  ? 19.335  -5.932  93.727  1.00 34.08  ? 570  PRO C CD    1 
ATOM   8064  N  N     . LEU C 2  571  ? 19.310  -5.236  98.385  1.00 34.07  ? 571  LEU C N     1 
ATOM   8065  C  CA    . LEU C 2  571  ? 19.391  -4.226  99.428  1.00 32.07  ? 571  LEU C CA    1 
ATOM   8066  C  C     . LEU C 2  571  ? 20.639  -4.452  100.268 1.00 33.43  ? 571  LEU C C     1 
ATOM   8067  O  O     . LEU C 2  571  ? 21.115  -5.581  100.407 1.00 34.88  ? 571  LEU C O     1 
ATOM   8068  C  CB    . LEU C 2  571  ? 18.147  -4.267  100.313 1.00 31.65  ? 571  LEU C CB    1 
ATOM   8069  C  CG    . LEU C 2  571  ? 16.841  -4.215  99.522  1.00 32.98  ? 571  LEU C CG    1 
ATOM   8070  C  CD1   . LEU C 2  571  ? 15.649  -4.527  100.406 1.00 36.19  ? 571  LEU C CD1   1 
ATOM   8071  C  CD2   . LEU C 2  571  ? 16.690  -2.850  98.868  1.00 37.20  ? 571  LEU C CD2   1 
ATOM   8072  N  N     . ILE C 2  572  ? 21.177  -3.360  100.817 1.00 31.03  ? 572  ILE C N     1 
ATOM   8073  C  CA    . ILE C 2  572  ? 22.395  -3.463  101.616 1.00 30.48  ? 572  ILE C CA    1 
ATOM   8074  C  C     . ILE C 2  572  ? 22.160  -4.343  102.835 1.00 33.98  ? 572  ILE C C     1 
ATOM   8075  O  O     . ILE C 2  572  ? 23.033  -5.124  103.235 1.00 35.98  ? 572  ILE C O     1 
ATOM   8076  C  CB    . ILE C 2  572  ? 22.901  -2.064  102.014 1.00 32.02  ? 572  ILE C CB    1 
ATOM   8077  C  CG1   . ILE C 2  572  ? 21.797  -1.271  102.711 1.00 36.97  ? 572  ILE C CG1   1 
ATOM   8078  C  CG2   . ILE C 2  572  ? 23.422  -1.321  100.792 1.00 36.89  ? 572  ILE C CG2   1 
ATOM   8079  C  CD1   . ILE C 2  572  ? 22.218  0.113   103.149 1.00 38.43  ? 572  ILE C CD1   1 
ATOM   8080  N  N     . ARG C 2  573  ? 20.972  -4.243  103.435 1.00 35.68  ? 573  ARG C N     1 
ATOM   8081  C  CA    . ARG C 2  573  ? 20.606  -5.030  104.605 1.00 38.88  ? 573  ARG C CA    1 
ATOM   8082  C  C     . ARG C 2  573  ? 19.581  -6.111  104.277 1.00 38.33  ? 573  ARG C C     1 
ATOM   8083  O  O     . ARG C 2  573  ? 18.806  -6.503  105.156 1.00 41.07  ? 573  ARG C O     1 
ATOM   8084  C  CB    . ARG C 2  573  ? 20.067  -4.123  105.711 1.00 38.72  ? 573  ARG C CB    1 
ATOM   8085  C  CG    . ARG C 2  573  ? 20.974  -2.967  106.090 1.00 38.87  ? 573  ARG C CG    1 
ATOM   8086  C  CD    . ARG C 2  573  ? 20.563  -2.377  107.429 1.00 36.92  ? 573  ARG C CD    1 
ATOM   8087  N  NE    . ARG C 2  573  ? 20.523  -3.407  108.462 1.00 35.55  ? 573  ARG C NE    1 
ATOM   8088  C  CZ    . ARG C 2  573  ? 20.154  -3.191  109.718 1.00 45.02  ? 573  ARG C CZ    1 
ATOM   8089  N  NH1   . ARG C 2  573  ? 19.793  -1.973  110.099 1.00 45.86  ? 573  ARG C NH1   1 
ATOM   8090  N  NH2   . ARG C 2  573  ? 20.144  -4.192  110.591 1.00 56.51  ? 573  ARG C NH2   1 
ATOM   8091  N  N     . ALA C 2  574  ? 19.554  -6.587  103.028 1.00 33.34  ? 574  ALA C N     1 
ATOM   8092  C  CA    . ALA C 2  574  ? 18.523  -7.522  102.584 1.00 38.60  ? 574  ALA C CA    1 
ATOM   8093  C  C     . ALA C 2  574  ? 18.509  -8.783  103.445 1.00 40.46  ? 574  ALA C C     1 
ATOM   8094  O  O     . ALA C 2  574  ? 19.554  -9.273  103.884 1.00 37.86  ? 574  ALA C O     1 
ATOM   8095  C  CB    . ALA C 2  574  ? 18.739  -7.888  101.113 1.00 37.81  ? 574  ALA C CB    1 
ATOM   8096  N  N     . GLN C 2  575  ? 17.308  -9.306  103.688 1.00 33.95  ? 575  GLN C N     1 
ATOM   8097  C  CA    . GLN C 2  575  ? 17.123  -10.478 104.528 1.00 34.44  ? 575  GLN C CA    1 
ATOM   8098  C  C     . GLN C 2  575  ? 16.314  -11.534 103.793 1.00 39.61  ? 575  GLN C C     1 
ATOM   8099  O  O     . GLN C 2  575  ? 15.491  -11.223 102.928 1.00 41.90  ? 575  GLN C O     1 
ATOM   8100  C  CB    . GLN C 2  575  ? 16.404  -10.125 105.829 1.00 41.72  ? 575  GLN C CB    1 
ATOM   8101  C  CG    . GLN C 2  575  ? 16.555  -8.683  106.246 1.00 39.34  ? 575  GLN C CG    1 
ATOM   8102  C  CD    . GLN C 2  575  ? 15.572  -8.299  107.322 1.00 40.04  ? 575  GLN C CD    1 
ATOM   8103  O  OE1   . GLN C 2  575  ? 14.533  -7.707  107.039 1.00 42.55  ? 575  GLN C OE1   1 
ATOM   8104  N  NE2   . GLN C 2  575  ? 15.891  -8.635  108.567 1.00 44.85  ? 575  GLN C NE2   1 
ATOM   8105  N  N     . ALA C 2  576  ? 16.565  -12.792 104.146 1.00 39.08  ? 576  ALA C N     1 
ATOM   8106  C  CA    . ALA C 2  576  ? 15.737  -13.873 103.650 1.00 36.13  ? 576  ALA C CA    1 
ATOM   8107  C  C     . ALA C 2  576  ? 14.364  -13.816 104.321 1.00 44.77  ? 576  ALA C C     1 
ATOM   8108  O  O     . ALA C 2  576  ? 14.245  -13.374 105.466 1.00 50.14  ? 576  ALA C O     1 
ATOM   8109  C  CB    . ALA C 2  576  ? 16.394  -15.221 103.920 1.00 36.53  ? 576  ALA C CB    1 
ATOM   8110  N  N     . PRO C 2  577  ? 13.315  -14.266 103.632 1.00 43.27  ? 577  PRO C N     1 
ATOM   8111  C  CA    . PRO C 2  577  ? 11.963  -14.174 104.204 1.00 40.28  ? 577  PRO C CA    1 
ATOM   8112  C  C     . PRO C 2  577  ? 11.830  -15.012 105.470 1.00 41.39  ? 577  PRO C C     1 
ATOM   8113  O  O     . PRO C 2  577  ? 12.474  -16.052 105.616 1.00 41.07  ? 577  PRO C O     1 
ATOM   8114  C  CB    . PRO C 2  577  ? 11.067  -14.716 103.081 1.00 40.38  ? 577  PRO C CB    1 
ATOM   8115  C  CG    . PRO C 2  577  ? 11.907  -14.677 101.847 1.00 37.43  ? 577  PRO C CG    1 
ATOM   8116  C  CD    . PRO C 2  577  ? 13.310  -14.884 102.296 1.00 37.83  ? 577  PRO C CD    1 
ATOM   8117  N  N     . VAL C 2  578  ? 10.987  -14.547 106.401 1.00 41.50  ? 578  VAL C N     1 
ATOM   8118  C  CA    . VAL C 2  578  ? 10.715  -15.365 107.586 1.00 45.05  ? 578  VAL C CA    1 
ATOM   8119  C  C     . VAL C 2  578  ? 9.823   -16.545 107.243 1.00 45.12  ? 578  VAL C C     1 
ATOM   8120  O  O     . VAL C 2  578  ? 9.868   -17.572 107.934 1.00 50.50  ? 578  VAL C O     1 
ATOM   8121  C  CB    . VAL C 2  578  ? 10.090  -14.566 108.748 1.00 43.75  ? 578  VAL C CB    1 
ATOM   8122  C  CG1   . VAL C 2  578  ? 10.135  -13.076 108.488 1.00 40.91  ? 578  VAL C CG1   1 
ATOM   8123  C  CG2   . VAL C 2  578  ? 8.655   -14.998 109.041 1.00 46.46  ? 578  VAL C CG2   1 
ATOM   8124  N  N     . VAL C 2  579  ? 9.030   -16.437 106.183 1.00 34.05  ? 579  VAL C N     1 
ATOM   8125  C  CA    . VAL C 2  579  ? 8.246   -17.552 105.669 1.00 37.71  ? 579  VAL C CA    1 
ATOM   8126  C  C     . VAL C 2  579  ? 8.860   -17.936 104.329 1.00 37.91  ? 579  VAL C C     1 
ATOM   8127  O  O     . VAL C 2  579  ? 8.723   -17.204 103.342 1.00 45.03  ? 579  VAL C O     1 
ATOM   8128  C  CB    . VAL C 2  579  ? 6.758   -17.198 105.525 1.00 43.49  ? 579  VAL C CB    1 
ATOM   8129  C  CG1   . VAL C 2  579  ? 5.934   -18.451 105.178 1.00 39.18  ? 579  VAL C CG1   1 
ATOM   8130  C  CG2   . VAL C 2  579  ? 6.226   -16.552 106.793 1.00 42.32  ? 579  VAL C CG2   1 
ATOM   8131  N  N     . MET C 2  580  ? 9.536   -19.081 104.288 1.00 36.33  ? 580  MET C N     1 
ATOM   8132  C  CA    . MET C 2  580  ? 10.243  -19.541 103.102 1.00 37.05  ? 580  MET C CA    1 
ATOM   8133  C  C     . MET C 2  580  ? 9.590   -20.797 102.547 1.00 38.22  ? 580  MET C C     1 
ATOM   8134  O  O     . MET C 2  580  ? 8.862   -21.505 103.245 1.00 38.09  ? 580  MET C O     1 
ATOM   8135  C  CB    . MET C 2  580  ? 11.714  -19.833 103.406 1.00 41.42  ? 580  MET C CB    1 
ATOM   8136  C  CG    . MET C 2  580  ? 12.525  -18.610 103.741 1.00 45.10  ? 580  MET C CG    1 
ATOM   8137  S  SD    . MET C 2  580  ? 14.187  -19.040 104.271 1.00 47.69  ? 580  MET C SD    1 
ATOM   8138  C  CE    . MET C 2  580  ? 13.841  -19.916 105.792 1.00 51.16  ? 580  MET C CE    1 
ATOM   8139  N  N     . THR C 2  581  ? 9.868   -21.074 101.276 1.00 36.25  ? 581  THR C N     1 
ATOM   8140  C  CA    . THR C 2  581  ? 9.363   -22.281 100.640 1.00 40.91  ? 581  THR C CA    1 
ATOM   8141  C  C     . THR C 2  581  ? 10.367  -23.420 100.657 1.00 43.86  ? 581  THR C C     1 
ATOM   8142  O  O     . THR C 2  581  ? 9.987   -24.560 100.370 1.00 51.05  ? 581  THR C O     1 
ATOM   8143  C  CB    . THR C 2  581  ? 8.954   -21.999 99.191  1.00 41.60  ? 581  THR C CB    1 
ATOM   8144  O  OG1   . THR C 2  581  ? 10.105  -21.609 98.432  1.00 39.56  ? 581  THR C OG1   1 
ATOM   8145  C  CG2   . THR C 2  581  ? 7.911   -20.894 99.135  1.00 37.35  ? 581  THR C CG2   1 
ATOM   8146  N  N     . GLY C 2  582  ? 11.628  -23.143 100.982 1.00 38.76  ? 582  GLY C N     1 
ATOM   8147  C  CA    . GLY C 2  582  ? 12.665  -24.151 101.001 1.00 44.83  ? 582  GLY C CA    1 
ATOM   8148  C  C     . GLY C 2  582  ? 13.550  -24.185 99.775  1.00 47.63  ? 582  GLY C C     1 
ATOM   8149  O  O     . GLY C 2  582  ? 14.539  -24.929 99.768  1.00 48.49  ? 582  GLY C O     1 
ATOM   8150  N  N     . LEU C 2  583  ? 13.226  -23.414 98.741  1.00 43.27  ? 583  LEU C N     1 
ATOM   8151  C  CA    . LEU C 2  583  ? 14.066  -23.324 97.555  1.00 39.39  ? 583  LEU C CA    1 
ATOM   8152  C  C     . LEU C 2  583  ? 15.129  -22.240 97.662  1.00 44.26  ? 583  LEU C C     1 
ATOM   8153  O  O     . LEU C 2  583  ? 15.997  -22.157 96.786  1.00 43.43  ? 583  LEU C O     1 
ATOM   8154  C  CB    . LEU C 2  583  ? 13.215  -23.045 96.310  1.00 36.66  ? 583  LEU C CB    1 
ATOM   8155  C  CG    . LEU C 2  583  ? 12.299  -24.119 95.721  1.00 44.65  ? 583  LEU C CG    1 
ATOM   8156  C  CD1   . LEU C 2  583  ? 12.538  -24.196 94.218  1.00 37.59  ? 583  LEU C CD1   1 
ATOM   8157  C  CD2   . LEU C 2  583  ? 12.471  -25.477 96.387  1.00 46.35  ? 583  LEU C CD2   1 
ATOM   8158  N  N     . GLU C 2  584  ? 15.080  -21.412 98.710  1.00 41.89  ? 584  GLU C N     1 
ATOM   8159  C  CA    . GLU C 2  584  ? 15.866  -20.182 98.738  1.00 40.73  ? 584  GLU C CA    1 
ATOM   8160  C  C     . GLU C 2  584  ? 17.368  -20.446 98.758  1.00 47.73  ? 584  GLU C C     1 
ATOM   8161  O  O     . GLU C 2  584  ? 18.146  -19.583 98.338  1.00 47.52  ? 584  GLU C O     1 
ATOM   8162  C  CB    . GLU C 2  584  ? 15.469  -19.334 99.946  1.00 41.98  ? 584  GLU C CB    1 
ATOM   8163  C  CG    . GLU C 2  584  ? 14.066  -18.755 99.875  1.00 40.95  ? 584  GLU C CG    1 
ATOM   8164  C  CD    . GLU C 2  584  ? 12.983  -19.771 100.191 1.00 45.55  ? 584  GLU C CD    1 
ATOM   8165  O  OE1   . GLU C 2  584  ? 11.796  -19.464 99.957  1.00 44.54  ? 584  GLU C OE1   1 
ATOM   8166  O  OE2   . GLU C 2  584  ? 13.314  -20.873 100.676 1.00 50.25  ? 584  GLU C OE2   1 
ATOM   8167  N  N     . GLU C 2  585  ? 17.797  -21.613 99.247  1.00 50.82  ? 585  GLU C N     1 
ATOM   8168  C  CA    . GLU C 2  585  ? 19.225  -21.916 99.297  1.00 46.44  ? 585  GLU C CA    1 
ATOM   8169  C  C     . GLU C 2  585  ? 19.736  -22.409 97.948  1.00 45.62  ? 585  GLU C C     1 
ATOM   8170  O  O     . GLU C 2  585  ? 20.789  -21.966 97.471  1.00 44.74  ? 585  GLU C O     1 
ATOM   8171  C  CB    . GLU C 2  585  ? 19.506  -22.950 100.391 1.00 52.53  ? 585  GLU C CB    1 
ATOM   8172  C  CG    . GLU C 2  585  ? 19.427  -22.390 101.807 1.00 55.47  ? 585  GLU C CG    1 
ATOM   8173  C  CD    . GLU C 2  585  ? 19.742  -23.425 102.878 1.00 63.66  ? 585  GLU C CD    1 
ATOM   8174  O  OE1   . GLU C 2  585  ? 19.041  -24.457 102.938 1.00 67.88  ? 585  GLU C OE1   1 
ATOM   8175  O  OE2   . GLU C 2  585  ? 20.696  -23.209 103.659 1.00 64.89  ? 585  GLU C OE2   1 
ATOM   8176  N  N     . ARG C 2  586  ? 18.999  -23.331 97.322  1.00 43.30  ? 586  ARG C N     1 
ATOM   8177  C  CA    . ARG C 2  586  ? 19.397  -23.829 96.011  1.00 43.57  ? 586  ARG C CA    1 
ATOM   8178  C  C     . ARG C 2  586  ? 19.381  -22.726 94.962  1.00 43.13  ? 586  ARG C C     1 
ATOM   8179  O  O     . ARG C 2  586  ? 20.192  -22.749 94.032  1.00 44.61  ? 586  ARG C O     1 
ATOM   8180  C  CB    . ARG C 2  586  ? 18.483  -24.977 95.581  1.00 45.18  ? 586  ARG C CB    1 
ATOM   8181  C  CG    . ARG C 2  586  ? 18.841  -26.324 96.181  1.00 48.99  ? 586  ARG C CG    1 
ATOM   8182  C  CD    . ARG C 2  586  ? 20.213  -26.795 95.720  1.00 46.33  ? 586  ARG C CD    1 
ATOM   8183  N  NE    . ARG C 2  586  ? 20.366  -26.754 94.266  1.00 54.23  ? 586  ARG C NE    1 
ATOM   8184  C  CZ    . ARG C 2  586  ? 19.907  -27.684 93.432  1.00 52.59  ? 586  ARG C CZ    1 
ATOM   8185  N  NH1   . ARG C 2  586  ? 19.246  -28.734 93.903  1.00 53.59  ? 586  ARG C NH1   1 
ATOM   8186  N  NH2   . ARG C 2  586  ? 20.104  -27.565 92.124  1.00 42.91  ? 586  ARG C NH2   1 
ATOM   8187  N  N     . VAL C 2  587  ? 18.464  -21.762 95.080  1.00 45.52  ? 587  VAL C N     1 
ATOM   8188  C  CA    . VAL C 2  587  ? 18.432  -20.660 94.121  1.00 37.67  ? 587  VAL C CA    1 
ATOM   8189  C  C     . VAL C 2  587  ? 19.716  -19.850 94.213  1.00 38.56  ? 587  VAL C C     1 
ATOM   8190  O  O     . VAL C 2  587  ? 20.285  -19.442 93.194  1.00 45.68  ? 587  VAL C O     1 
ATOM   8191  C  CB    . VAL C 2  587  ? 17.184  -19.785 94.343  1.00 35.69  ? 587  VAL C CB    1 
ATOM   8192  C  CG1   . VAL C 2  587  ? 17.289  -18.496 93.551  1.00 35.51  ? 587  VAL C CG1   1 
ATOM   8193  C  CG2   . VAL C 2  587  ? 15.931  -20.542 93.935  1.00 31.78  ? 587  VAL C CG2   1 
ATOM   8194  N  N     . VAL C 2  588  ? 20.207  -19.624 95.432  1.00 34.98  ? 588  VAL C N     1 
ATOM   8195  C  CA    . VAL C 2  588  ? 21.477  -18.923 95.588  1.00 40.93  ? 588  VAL C CA    1 
ATOM   8196  C  C     . VAL C 2  588  ? 22.620  -19.772 95.050  1.00 45.36  ? 588  VAL C C     1 
ATOM   8197  O  O     . VAL C 2  588  ? 23.494  -19.278 94.325  1.00 43.26  ? 588  VAL C O     1 
ATOM   8198  C  CB    . VAL C 2  588  ? 21.698  -18.537 97.062  1.00 37.25  ? 588  VAL C CB    1 
ATOM   8199  C  CG1   . VAL C 2  588  ? 23.135  -18.096 97.295  1.00 36.97  ? 588  VAL C CG1   1 
ATOM   8200  C  CG2   . VAL C 2  588  ? 20.737  -17.430 97.461  1.00 35.67  ? 588  VAL C CG2   1 
ATOM   8201  N  N     . ARG C 2  589  ? 22.620  -21.065 95.374  1.00 45.21  ? 589  ARG C N     1 
ATOM   8202  C  CA    . ARG C 2  589  ? 23.756  -21.908 95.017  1.00 43.86  ? 589  ARG C CA    1 
ATOM   8203  C  C     . ARG C 2  589  ? 23.869  -22.075 93.507  1.00 41.14  ? 589  ARG C C     1 
ATOM   8204  O  O     . ARG C 2  589  ? 24.961  -21.960 92.940  1.00 47.89  ? 589  ARG C O     1 
ATOM   8205  C  CB    . ARG C 2  589  ? 23.646  -23.268 95.703  1.00 41.24  ? 589  ARG C CB    1 
ATOM   8206  C  CG    . ARG C 2  589  ? 24.810  -24.195 95.405  1.00 43.47  ? 589  ARG C CG    1 
ATOM   8207  C  CD    . ARG C 2  589  ? 24.707  -25.492 96.183  1.00 49.69  ? 589  ARG C CD    1 
ATOM   8208  N  NE    . ARG C 2  589  ? 24.913  -25.290 97.614  1.00 59.99  ? 589  ARG C NE    1 
ATOM   8209  C  CZ    . ARG C 2  589  ? 26.106  -25.271 98.198  1.00 59.30  ? 589  ARG C CZ    1 
ATOM   8210  N  NH1   . ARG C 2  589  ? 27.202  -25.438 97.471  1.00 65.87  ? 589  ARG C NH1   1 
ATOM   8211  N  NH2   . ARG C 2  589  ? 26.206  -25.083 99.508  1.00 61.08  ? 589  ARG C NH2   1 
ATOM   8212  N  N     . ASP C 2  590  ? 22.748  -22.338 92.836  1.00 37.74  ? 590  ASP C N     1 
ATOM   8213  C  CA    . ASP C 2  590  ? 22.773  -22.603 91.405  1.00 42.66  ? 590  ASP C CA    1 
ATOM   8214  C  C     . ASP C 2  590  ? 22.948  -21.339 90.575  1.00 46.72  ? 590  ASP C C     1 
ATOM   8215  O  O     . ASP C 2  590  ? 23.361  -21.429 89.413  1.00 50.05  ? 590  ASP C O     1 
ATOM   8216  C  CB    . ASP C 2  590  ? 21.498  -23.343 90.992  1.00 40.86  ? 590  ASP C CB    1 
ATOM   8217  C  CG    . ASP C 2  590  ? 21.562  -24.831 91.304  1.00 44.07  ? 590  ASP C CG    1 
ATOM   8218  O  OD1   . ASP C 2  590  ? 22.038  -25.191 92.404  1.00 39.13  ? 590  ASP C OD1   1 
ATOM   8219  O  OD2   . ASP C 2  590  ? 21.138  -25.643 90.453  1.00 41.46  ? 590  ASP C OD2   1 
ATOM   8220  N  N     . SER C 2  591  ? 22.663  -20.171 91.144  1.00 44.64  ? 591  SER C N     1 
ATOM   8221  C  CA    . SER C 2  591  ? 22.905  -18.903 90.467  1.00 46.94  ? 591  SER C CA    1 
ATOM   8222  C  C     . SER C 2  591  ? 24.360  -18.460 90.536  1.00 46.88  ? 591  SER C C     1 
ATOM   8223  O  O     . SER C 2  591  ? 24.697  -17.421 89.958  1.00 48.41  ? 591  SER C O     1 
ATOM   8224  C  CB    . SER C 2  591  ? 22.027  -17.808 91.071  1.00 46.03  ? 591  SER C CB    1 
ATOM   8225  O  OG    . SER C 2  591  ? 22.486  -17.469 92.369  1.00 50.51  ? 591  SER C OG    1 
ATOM   8226  N  N     . LEU C 2  592  ? 25.214  -19.212 91.233  1.00 47.31  ? 592  LEU C N     1 
ATOM   8227  C  CA    . LEU C 2  592  ? 26.613  -18.840 91.450  1.00 45.54  ? 592  LEU C CA    1 
ATOM   8228  C  C     . LEU C 2  592  ? 26.736  -17.432 92.026  1.00 47.63  ? 592  LEU C C     1 
ATOM   8229  O  O     . LEU C 2  592  ? 27.689  -16.704 91.738  1.00 50.90  ? 592  LEU C O     1 
ATOM   8230  C  CB    . LEU C 2  592  ? 27.426  -18.979 90.162  1.00 39.57  ? 592  LEU C CB    1 
ATOM   8231  C  CG    . LEU C 2  592  ? 27.480  -20.404 89.610  1.00 44.69  ? 592  LEU C CG    1 
ATOM   8232  C  CD1   . LEU C 2  592  ? 28.353  -20.468 88.369  1.00 52.25  ? 592  LEU C CD1   1 
ATOM   8233  C  CD2   . LEU C 2  592  ? 27.980  -21.375 90.669  1.00 54.22  ? 592  LEU C CD2   1 
ATOM   8234  N  N     . ALA C 2  593  ? 25.762  -17.044 92.852  1.00 48.71  ? 593  ALA C N     1 
ATOM   8235  C  CA    . ALA C 2  593  ? 25.796  -15.735 93.496  1.00 62.17  ? 593  ALA C CA    1 
ATOM   8236  C  C     . ALA C 2  593  ? 26.814  -15.703 94.630  1.00 67.34  ? 593  ALA C C     1 
ATOM   8237  O  O     . ALA C 2  593  ? 27.675  -14.817 94.682  1.00 56.07  ? 593  ALA C O     1 
ATOM   8238  C  CB    . ALA C 2  593  ? 24.404  -15.377 94.023  1.00 54.19  ? 593  ALA C CB    1 
ATOM   8239  N  N     . ALA C 2  594  ? 26.729  -16.671 95.539  1.00 63.40  ? 594  ALA C N     1 
ATOM   8240  C  CA    . ALA C 2  594  ? 27.560  -16.726 96.728  1.00 56.58  ? 594  ALA C CA    1 
ATOM   8241  C  C     . ALA C 2  594  ? 28.768  -17.631 96.494  1.00 53.37  ? 594  ALA C C     1 
ATOM   8242  O  O     . ALA C 2  594  ? 28.935  -18.235 95.431  1.00 52.59  ? 594  ALA C O     1 
ATOM   8243  C  CB    . ALA C 2  594  ? 26.731  -17.201 97.922  1.00 52.02  ? 594  ALA C CB    1 
ATOM   8244  N  N     . LEU C 2  595  ? 29.617  -17.727 97.513  1.00 53.61  ? 595  LEU C N     1 
ATOM   8245  C  CA    . LEU C 2  595  ? 30.835  -18.523 97.465  1.00 53.81  ? 595  LEU C CA    1 
ATOM   8246  C  C     . LEU C 2  595  ? 30.731  -19.689 98.435  1.00 51.26  ? 595  LEU C C     1 
ATOM   8247  O  O     . LEU C 2  595  ? 30.194  -19.542 99.537  1.00 51.94  ? 595  LEU C O     1 
ATOM   8248  C  CB    . LEU C 2  595  ? 32.059  -17.676 97.811  1.00 57.09  ? 595  LEU C CB    1 
ATOM   8249  C  CG    . LEU C 2  595  ? 32.952  -17.332 96.625  1.00 51.63  ? 595  LEU C CG    1 
ATOM   8250  C  CD1   . LEU C 2  595  ? 34.131  -16.490 97.076  1.00 55.28  ? 595  LEU C CD1   1 
ATOM   8251  C  CD2   . LEU C 2  595  ? 33.419  -18.614 95.961  1.00 55.28  ? 595  LEU C CD2   1 
ATOM   8252  N  N     . TYR C 2  596  ? 31.256  -20.841 98.029  1.00 58.11  ? 596  TYR C N     1 
ATOM   8253  C  CA    . TYR C 2  596  ? 31.182  -22.048 98.837  1.00 62.63  ? 596  TYR C CA    1 
ATOM   8254  C  C     . TYR C 2  596  ? 32.558  -22.691 98.949  1.00 66.86  ? 596  TYR C C     1 
ATOM   8255  O  O     . TYR C 2  596  ? 33.472  -22.397 98.172  1.00 72.73  ? 596  TYR C O     1 
ATOM   8256  C  CB    . TYR C 2  596  ? 30.165  -23.042 98.255  1.00 57.14  ? 596  TYR C CB    1 
ATOM   8257  C  CG    . TYR C 2  596  ? 28.770  -22.465 98.167  1.00 53.67  ? 596  TYR C CG    1 
ATOM   8258  C  CD1   . TYR C 2  596  ? 28.018  -22.253 99.312  1.00 54.63  ? 596  TYR C CD1   1 
ATOM   8259  C  CD2   . TYR C 2  596  ? 28.216  -22.113 96.944  1.00 55.74  ? 596  TYR C CD2   1 
ATOM   8260  C  CE1   . TYR C 2  596  ? 26.749  -21.719 99.245  1.00 53.77  ? 596  TYR C CE1   1 
ATOM   8261  C  CE2   . TYR C 2  596  ? 26.943  -21.578 96.866  1.00 51.66  ? 596  TYR C CE2   1 
ATOM   8262  C  CZ    . TYR C 2  596  ? 26.216  -21.383 98.022  1.00 52.31  ? 596  TYR C CZ    1 
ATOM   8263  O  OH    . TYR C 2  596  ? 24.948  -20.850 97.967  1.00 54.67  ? 596  TYR C OH    1 
ATOM   8264  N  N     . ALA C 2  597  ? 32.698  -23.569 99.942  1.00 60.33  ? 597  ALA C N     1 
ATOM   8265  C  CA    . ALA C 2  597  ? 33.957  -24.259 100.178 1.00 68.81  ? 597  ALA C CA    1 
ATOM   8266  C  C     . ALA C 2  597  ? 34.099  -25.439 99.224  1.00 75.12  ? 597  ALA C C     1 
ATOM   8267  O  O     . ALA C 2  597  ? 33.213  -26.296 99.144  1.00 67.23  ? 597  ALA C O     1 
ATOM   8268  C  CB    . ALA C 2  597  ? 34.041  -24.734 101.627 1.00 66.78  ? 597  ALA C CB    1 
ATOM   8269  N  N     . GLU C 2  598  ? 35.224  -25.481 98.504  1.00 75.52  ? 598  GLU C N     1 
ATOM   8270  C  CA    . GLU C 2  598  ? 35.440  -26.537 97.520  1.00 80.33  ? 598  GLU C CA    1 
ATOM   8271  C  C     . GLU C 2  598  ? 35.682  -27.882 98.193  1.00 85.66  ? 598  GLU C C     1 
ATOM   8272  O  O     . GLU C 2  598  ? 35.244  -28.924 97.691  1.00 89.59  ? 598  GLU C O     1 
ATOM   8273  C  CB    . GLU C 2  598  ? 36.613  -26.168 96.614  1.00 90.58  ? 598  GLU C CB    1 
ATOM   8274  C  CG    . GLU C 2  598  ? 36.914  -27.178 95.524  1.00 92.23  ? 598  GLU C CG    1 
ATOM   8275  C  CD    . GLU C 2  598  ? 38.084  -26.753 94.663  1.00 104.91 ? 598  GLU C CD    1 
ATOM   8276  O  OE1   . GLU C 2  598  ? 38.523  -25.589 94.790  1.00 100.05 ? 598  GLU C OE1   1 
ATOM   8277  O  OE2   . GLU C 2  598  ? 38.568  -27.580 93.862  1.00 117.49 ? 598  GLU C OE2   1 
ATOM   8278  N  N     . GLU C 2  599  ? 36.380  -27.879 99.326  1.00 86.42  ? 599  GLU C N     1 
ATOM   8279  C  CA    . GLU C 2  599  ? 36.633  -29.084 100.102 1.00 84.95  ? 599  GLU C CA    1 
ATOM   8280  C  C     . GLU C 2  599  ? 36.665  -28.687 101.572 1.00 79.74  ? 599  GLU C C     1 
ATOM   8281  O  O     . GLU C 2  599  ? 36.538  -27.509 101.916 1.00 81.05  ? 599  GLU C O     1 
ATOM   8282  C  CB    . GLU C 2  599  ? 37.940  -29.757 99.665  1.00 94.54  ? 599  GLU C CB    1 
ATOM   8283  C  CG    . GLU C 2  599  ? 37.957  -31.273 99.811  1.00 106.67 ? 599  GLU C CG    1 
ATOM   8284  C  CD    . GLU C 2  599  ? 37.236  -31.981 98.676  1.00 105.90 ? 599  GLU C CD    1 
ATOM   8285  O  OE1   . GLU C 2  599  ? 37.186  -31.418 97.561  1.00 97.53  ? 599  GLU C OE1   1 
ATOM   8286  O  OE2   . GLU C 2  599  ? 36.719  -33.098 98.898  1.00 103.96 ? 599  GLU C OE2   1 
ATOM   8287  N  N     . ASP C 2  600  ? 36.827  -29.675 102.446 1.00 83.05  ? 600  ASP C N     1 
ATOM   8288  C  CA    . ASP C 2  600  ? 36.969  -29.379 103.865 1.00 78.11  ? 600  ASP C CA    1 
ATOM   8289  C  C     . ASP C 2  600  ? 38.298  -28.673 104.114 1.00 79.42  ? 600  ASP C C     1 
ATOM   8290  O  O     . ASP C 2  600  ? 39.257  -28.829 103.355 1.00 85.74  ? 600  ASP C O     1 
ATOM   8291  C  CB    . ASP C 2  600  ? 36.887  -30.662 104.697 1.00 78.18  ? 600  ASP C CB    1 
ATOM   8292  C  CG    . ASP C 2  600  ? 35.714  -31.546 104.302 1.00 80.86  ? 600  ASP C CG    1 
ATOM   8293  O  OD1   . ASP C 2  600  ? 35.853  -32.324 103.335 1.00 93.62  ? 600  ASP C OD1   1 
ATOM   8294  O  OD2   . ASP C 2  600  ? 34.654  -31.463 104.957 1.00 72.52  ? 600  ASP C OD2   1 
ATOM   8295  N  N     . GLY C 2  601  ? 38.350  -27.877 105.177 1.00 77.29  ? 601  GLY C N     1 
ATOM   8296  C  CA    . GLY C 2  601  ? 39.581  -27.187 105.501 1.00 81.24  ? 601  GLY C CA    1 
ATOM   8297  C  C     . GLY C 2  601  ? 39.369  -26.122 106.559 1.00 75.80  ? 601  GLY C C     1 
ATOM   8298  O  O     . GLY C 2  601  ? 38.297  -26.014 107.158 1.00 73.42  ? 601  GLY C O     1 
ATOM   8299  N  N     . GLU C 2  602  ? 40.427  -25.342 106.776 1.00 76.91  ? 602  GLU C N     1 
ATOM   8300  C  CA    . GLU C 2  602  ? 40.450  -24.266 107.758 1.00 77.41  ? 602  GLU C CA    1 
ATOM   8301  C  C     . GLU C 2  602  ? 40.718  -22.941 107.057 1.00 68.16  ? 602  GLU C C     1 
ATOM   8302  O  O     . GLU C 2  602  ? 41.570  -22.860 106.167 1.00 62.21  ? 602  GLU C O     1 
ATOM   8303  C  CB    . GLU C 2  602  ? 41.518  -24.521 108.834 1.00 77.91  ? 602  GLU C CB    1 
ATOM   8304  C  CG    . GLU C 2  602  ? 41.590  -23.456 109.925 1.00 77.93  ? 602  GLU C CG    1 
ATOM   8305  C  CD    . GLU C 2  602  ? 42.673  -23.740 110.955 1.00 80.92  ? 602  GLU C CD    1 
ATOM   8306  O  OE1   . GLU C 2  602  ? 43.293  -24.822 110.886 1.00 86.71  ? 602  GLU C OE1   1 
ATOM   8307  O  OE2   . GLU C 2  602  ? 42.906  -22.881 111.834 1.00 70.74  ? 602  GLU C OE2   1 
ATOM   8308  N  N     . VAL C 2  603  ? 39.995  -21.904 107.471 1.00 66.06  ? 603  VAL C N     1 
ATOM   8309  C  CA    . VAL C 2  603  ? 40.088  -20.591 106.841 1.00 64.90  ? 603  VAL C CA    1 
ATOM   8310  C  C     . VAL C 2  603  ? 41.336  -19.877 107.346 1.00 68.52  ? 603  VAL C C     1 
ATOM   8311  O  O     . VAL C 2  603  ? 41.473  -19.615 108.546 1.00 66.10  ? 603  VAL C O     1 
ATOM   8312  C  CB    . VAL C 2  603  ? 38.832  -19.757 107.119 1.00 61.49  ? 603  VAL C CB    1 
ATOM   8313  C  CG1   . VAL C 2  603  ? 38.936  -18.410 106.430 1.00 64.03  ? 603  VAL C CG1   1 
ATOM   8314  C  CG2   . VAL C 2  603  ? 37.591  -20.508 106.664 1.00 64.18  ? 603  VAL C CG2   1 
ATOM   8315  N  N     . ALA C 2  604  ? 42.242  -19.546 106.424 1.00 66.95  ? 604  ALA C N     1 
ATOM   8316  C  CA    . ALA C 2  604  ? 43.505  -18.924 106.806 1.00 69.33  ? 604  ALA C CA    1 
ATOM   8317  C  C     . ALA C 2  604  ? 43.374  -17.410 106.936 1.00 65.96  ? 604  ALA C C     1 
ATOM   8318  O  O     . ALA C 2  604  ? 43.819  -16.823 107.929 1.00 60.51  ? 604  ALA C O     1 
ATOM   8319  C  CB    . ALA C 2  604  ? 44.590  -19.284 105.789 1.00 68.13  ? 604  ALA C CB    1 
ATOM   8320  N  N     . LYS C 2  605  ? 42.765  -16.764 105.944 1.00 62.88  ? 605  LYS C N     1 
ATOM   8321  C  CA    . LYS C 2  605  ? 42.678  -15.311 105.900 1.00 59.71  ? 605  LYS C CA    1 
ATOM   8322  C  C     . LYS C 2  605  ? 41.259  -14.880 105.561 1.00 64.54  ? 605  LYS C C     1 
ATOM   8323  O  O     . LYS C 2  605  ? 40.587  -15.522 104.751 1.00 68.54  ? 605  LYS C O     1 
ATOM   8324  C  CB    . LYS C 2  605  ? 43.651  -14.722 104.876 1.00 63.01  ? 605  LYS C CB    1 
ATOM   8325  C  CG    . LYS C 2  605  ? 45.118  -14.925 105.209 1.00 60.86  ? 605  LYS C CG    1 
ATOM   8326  C  CD    . LYS C 2  605  ? 46.005  -14.263 104.167 1.00 68.07  ? 605  LYS C CD    1 
ATOM   8327  C  CE    . LYS C 2  605  ? 47.479  -14.439 104.496 1.00 76.98  ? 605  LYS C CE    1 
ATOM   8328  N  NZ    . LYS C 2  605  ? 48.358  -13.853 103.443 1.00 69.28  ? 605  LYS C NZ    1 
ATOM   8329  N  N     . VAL C 2  606  ? 40.819  -13.776 106.164 1.00 63.85  ? 606  VAL C N     1 
ATOM   8330  C  CA    . VAL C 2  606  ? 39.492  -13.214 105.931 1.00 58.97  ? 606  VAL C CA    1 
ATOM   8331  C  C     . VAL C 2  606  ? 39.631  -11.714 105.711 1.00 60.38  ? 606  VAL C C     1 
ATOM   8332  O  O     . VAL C 2  606  ? 40.213  -11.007 106.540 1.00 56.70  ? 606  VAL C O     1 
ATOM   8333  C  CB    . VAL C 2  606  ? 38.522  -13.494 107.095 1.00 58.46  ? 606  VAL C CB    1 
ATOM   8334  C  CG1   . VAL C 2  606  ? 37.240  -12.695 106.920 1.00 58.80  ? 606  VAL C CG1   1 
ATOM   8335  C  CG2   . VAL C 2  606  ? 38.208  -14.979 107.170 1.00 59.40  ? 606  VAL C CG2   1 
ATOM   8336  N  N     . ASP C 2  607  ? 39.074  -11.231 104.607 1.00 69.74  ? 607  ASP C N     1 
ATOM   8337  C  CA    . ASP C 2  607  ? 39.199  -9.834  104.231 1.00 68.42  ? 607  ASP C CA    1 
ATOM   8338  C  C     . ASP C 2  607  ? 37.921  -9.404  103.527 1.00 66.11  ? 607  ASP C C     1 
ATOM   8339  O  O     . ASP C 2  607  ? 37.183  -10.227 102.976 1.00 64.55  ? 607  ASP C O     1 
ATOM   8340  C  CB    . ASP C 2  607  ? 40.411  -9.623  103.317 1.00 63.80  ? 607  ASP C CB    1 
ATOM   8341  C  CG    . ASP C 2  607  ? 40.909  -8.200  103.326 1.00 66.14  ? 607  ASP C CG    1 
ATOM   8342  O  OD1   . ASP C 2  607  ? 40.708  -7.510  104.348 1.00 70.29  ? 607  ASP C OD1   1 
ATOM   8343  O  OD2   . ASP C 2  607  ? 41.500  -7.772  102.311 1.00 68.48  ? 607  ASP C OD2   1 
ATOM   8344  N  N     . GLY C 2  608  ? 37.661  -8.098  103.544 1.00 61.72  ? 608  GLY C N     1 
ATOM   8345  C  CA    . GLY C 2  608  ? 36.631  -7.586  102.661 1.00 58.00  ? 608  GLY C CA    1 
ATOM   8346  C  C     . GLY C 2  608  ? 36.942  -7.788  101.193 1.00 64.26  ? 608  GLY C C     1 
ATOM   8347  O  O     . GLY C 2  608  ? 36.055  -7.603  100.350 1.00 67.05  ? 608  GLY C O     1 
ATOM   8348  N  N     . ASN C 2  609  ? 38.177  -8.172  100.872 1.00 61.77  ? 609  ASN C N     1 
ATOM   8349  C  CA    . ASN C 2  609  ? 38.619  -8.415  99.507  1.00 54.71  ? 609  ASN C CA    1 
ATOM   8350  C  C     . ASN C 2  609  ? 38.770  -9.897  99.187  1.00 56.93  ? 609  ASN C C     1 
ATOM   8351  O  O     . ASN C 2  609  ? 38.235  -10.363 98.178  1.00 60.26  ? 609  ASN C O     1 
ATOM   8352  C  CB    . ASN C 2  609  ? 39.946  -7.690  99.262  1.00 57.69  ? 609  ASN C CB    1 
ATOM   8353  C  CG    . ASN C 2  609  ? 39.829  -6.186  99.438  1.00 58.01  ? 609  ASN C CG    1 
ATOM   8354  O  OD1   . ASN C 2  609  ? 38.805  -5.593  99.098  1.00 53.97  ? 609  ASN C OD1   1 
ATOM   8355  N  ND2   . ASN C 2  609  ? 40.875  -5.563  99.972  1.00 56.88  ? 609  ASN C ND2   1 
ATOM   8356  N  N     . ARG C 2  610  ? 39.499  -10.649 100.011 1.00 59.37  ? 610  ARG C N     1 
ATOM   8357  C  CA    . ARG C 2  610  ? 39.777  -12.046 99.710  1.00 62.88  ? 610  ARG C CA    1 
ATOM   8358  C  C     . ARG C 2  610  ? 39.540  -12.925 100.932 1.00 58.70  ? 610  ARG C C     1 
ATOM   8359  O  O     . ARG C 2  610  ? 39.573  -12.466 102.076 1.00 55.83  ? 610  ARG C O     1 
ATOM   8360  C  CB    . ARG C 2  610  ? 41.219  -12.247 99.211  1.00 65.25  ? 610  ARG C CB    1 
ATOM   8361  C  CG    . ARG C 2  610  ? 42.221  -12.584 100.307 1.00 67.95  ? 610  ARG C CG    1 
ATOM   8362  C  CD    . ARG C 2  610  ? 42.707  -11.340 101.028 1.00 74.62  ? 610  ARG C CD    1 
ATOM   8363  N  NE    . ARG C 2  610  ? 42.941  -11.592 102.447 1.00 72.17  ? 610  ARG C NE    1 
ATOM   8364  C  CZ    . ARG C 2  610  ? 43.593  -10.765 103.256 1.00 70.61  ? 610  ARG C CZ    1 
ATOM   8365  N  NH1   . ARG C 2  610  ? 43.746  -11.075 104.535 1.00 66.54  ? 610  ARG C NH1   1 
ATOM   8366  N  NH2   . ARG C 2  610  ? 44.094  -9.629  102.788 1.00 70.81  ? 610  ARG C NH2   1 
ATOM   8367  N  N     . ILE C 2  611  ? 39.298  -14.207 100.660 1.00 57.40  ? 611  ILE C N     1 
ATOM   8368  C  CA    . ILE C 2  611  ? 39.203  -15.247 101.680 1.00 57.60  ? 611  ILE C CA    1 
ATOM   8369  C  C     . ILE C 2  611  ? 40.163  -16.359 101.287 1.00 64.61  ? 611  ILE C C     1 
ATOM   8370  O  O     . ILE C 2  611  ? 40.009  -16.966 100.222 1.00 64.79  ? 611  ILE C O     1 
ATOM   8371  C  CB    . ILE C 2  611  ? 37.774  -15.800 101.822 1.00 53.81  ? 611  ILE C CB    1 
ATOM   8372  C  CG1   . ILE C 2  611  ? 36.786  -14.688 102.168 1.00 55.63  ? 611  ILE C CG1   1 
ATOM   8373  C  CG2   . ILE C 2  611  ? 37.723  -16.885 102.889 1.00 49.90  ? 611  ILE C CG2   1 
ATOM   8374  C  CD1   . ILE C 2  611  ? 35.364  -15.175 102.279 1.00 51.27  ? 611  ILE C CD1   1 
ATOM   8375  N  N     . VAL C 2  612  ? 41.146  -16.630 102.136 1.00 64.59  ? 612  VAL C N     1 
ATOM   8376  C  CA    . VAL C 2  612  ? 42.165  -17.636 101.857 1.00 60.23  ? 612  VAL C CA    1 
ATOM   8377  C  C     . VAL C 2  612  ? 41.895  -18.841 102.743 1.00 62.46  ? 612  VAL C C     1 
ATOM   8378  O  O     . VAL C 2  612  ? 41.830  -18.712 103.972 1.00 62.69  ? 612  VAL C O     1 
ATOM   8379  C  CB    . VAL C 2  612  ? 43.580  -17.086 102.080 1.00 61.66  ? 612  VAL C CB    1 
ATOM   8380  C  CG1   . VAL C 2  612  ? 44.610  -18.068 101.556 1.00 66.93  ? 612  VAL C CG1   1 
ATOM   8381  C  CG2   . VAL C 2  612  ? 43.730  -15.737 101.397 1.00 63.66  ? 612  VAL C CG2   1 
ATOM   8382  N  N     . VAL C 2  613  ? 41.759  -20.010 102.118 1.00 63.88  ? 613  VAL C N     1 
ATOM   8383  C  CA    . VAL C 2  613  ? 41.356  -21.245 102.779 1.00 68.43  ? 613  VAL C CA    1 
ATOM   8384  C  C     . VAL C 2  613  ? 42.430  -22.302 102.558 1.00 76.89  ? 613  VAL C C     1 
ATOM   8385  O  O     . VAL C 2  613  ? 42.899  -22.498 101.428 1.00 75.81  ? 613  VAL C O     1 
ATOM   8386  C  CB    . VAL C 2  613  ? 39.993  -21.738 102.259 1.00 62.00  ? 613  VAL C CB    1 
ATOM   8387  C  CG1   . VAL C 2  613  ? 39.751  -23.183 102.660 1.00 70.13  ? 613  VAL C CG1   1 
ATOM   8388  C  CG2   . VAL C 2  613  ? 38.883  -20.849 102.783 1.00 65.43  ? 613  VAL C CG2   1 
ATOM   8389  N  N     . ARG C 2  614  ? 42.816  -22.979 103.638 1.00 81.94  ? 614  ARG C N     1 
ATOM   8390  C  CA    . ARG C 2  614  ? 43.705  -24.132 103.586 1.00 85.33  ? 614  ARG C CA    1 
ATOM   8391  C  C     . ARG C 2  614  ? 42.859  -25.399 103.618 1.00 88.85  ? 614  ARG C C     1 
ATOM   8392  O  O     . ARG C 2  614  ? 42.177  -25.666 104.614 1.00 85.40  ? 614  ARG C O     1 
ATOM   8393  C  CB    . ARG C 2  614  ? 44.686  -24.115 104.757 1.00 89.52  ? 614  ARG C CB    1 
ATOM   8394  C  CG    . ARG C 2  614  ? 45.516  -25.382 104.891 1.00 89.69  ? 614  ARG C CG    1 
ATOM   8395  C  CD    . ARG C 2  614  ? 46.568  -25.234 105.977 1.00 90.94  ? 614  ARG C CD    1 
ATOM   8396  N  NE    . ARG C 2  614  ? 47.435  -24.085 105.731 1.00 97.25  ? 614  ARG C NE    1 
ATOM   8397  C  CZ    . ARG C 2  614  ? 48.483  -24.101 104.913 1.00 96.28  ? 614  ARG C CZ    1 
ATOM   8398  N  NH1   . ARG C 2  614  ? 49.214  -23.007 104.749 1.00 89.57  ? 614  ARG C NH1   1 
ATOM   8399  N  NH2   . ARG C 2  614  ? 48.798  -25.210 104.256 1.00 90.91  ? 614  ARG C NH2   1 
ATOM   8400  N  N     . TYR C 2  615  ? 42.904  -26.175 102.537 1.00 88.34  ? 615  TYR C N     1 
ATOM   8401  C  CA    . TYR C 2  615  ? 42.100  -27.381 102.425 1.00 89.62  ? 615  TYR C CA    1 
ATOM   8402  C  C     . TYR C 2  615  ? 42.815  -28.572 103.066 1.00 89.74  ? 615  TYR C C     1 
ATOM   8403  O  O     . TYR C 2  615  ? 43.942  -28.467 103.557 1.00 88.25  ? 615  TYR C O     1 
ATOM   8404  C  CB    . TYR C 2  615  ? 41.760  -27.662 100.961 1.00 86.04  ? 615  TYR C CB    1 
ATOM   8405  C  CG    . TYR C 2  615  ? 40.708  -26.734 100.393 1.00 89.08  ? 615  TYR C CG    1 
ATOM   8406  C  CD1   . TYR C 2  615  ? 39.469  -26.603 101.007 1.00 90.38  ? 615  TYR C CD1   1 
ATOM   8407  C  CD2   . TYR C 2  615  ? 40.954  -25.981 99.251  1.00 91.48  ? 615  TYR C CD2   1 
ATOM   8408  C  CE1   . TYR C 2  615  ? 38.503  -25.754 100.498 1.00 85.10  ? 615  TYR C CE1   1 
ATOM   8409  C  CE2   . TYR C 2  615  ? 39.989  -25.129 98.733  1.00 87.29  ? 615  TYR C CE2   1 
ATOM   8410  C  CZ    . TYR C 2  615  ? 38.766  -25.022 99.363  1.00 80.41  ? 615  TYR C CZ    1 
ATOM   8411  N  N     . GLU C 2  616  ? 42.140  -29.728 103.066 1.00 90.09  ? 616  GLU C N     1 
ATOM   8412  C  CA    . GLU C 2  616  ? 42.715  -30.935 103.652 1.00 86.47  ? 616  GLU C CA    1 
ATOM   8413  C  C     . GLU C 2  616  ? 43.941  -31.415 102.892 1.00 93.28  ? 616  GLU C C     1 
ATOM   8414  O  O     . GLU C 2  616  ? 44.762  -32.146 103.456 1.00 100.53 ? 616  GLU C O     1 
ATOM   8415  C  CB    . GLU C 2  616  ? 41.673  -32.056 103.701 1.00 82.77  ? 616  GLU C CB    1 
ATOM   8416  C  CG    . GLU C 2  616  ? 40.507  -31.812 104.657 1.00 95.07  ? 616  GLU C CG    1 
ATOM   8417  C  CD    . GLU C 2  616  ? 40.902  -31.897 106.125 1.00 101.02 ? 616  GLU C CD    1 
ATOM   8418  O  OE1   . GLU C 2  616  ? 41.621  -30.997 106.610 1.00 101.45 ? 616  GLU C OE1   1 
ATOM   8419  O  OE2   . GLU C 2  616  ? 40.489  -32.866 106.797 1.00 99.36  ? 616  GLU C OE2   1 
ATOM   8420  N  N     . ASP C 2  617  ? 44.082  -31.025 101.625 1.00 93.49  ? 617  ASP C N     1 
ATOM   8421  C  CA    . ASP C 2  617  ? 45.277  -31.348 100.859 1.00 92.30  ? 617  ASP C CA    1 
ATOM   8422  C  C     . ASP C 2  617  ? 46.496  -30.554 101.310 1.00 94.26  ? 617  ASP C C     1 
ATOM   8423  O  O     . ASP C 2  617  ? 47.616  -30.892 100.911 1.00 90.93  ? 617  ASP C O     1 
ATOM   8424  C  CB    . ASP C 2  617  ? 45.019  -31.090 99.374  1.00 87.01  ? 617  ASP C CB    1 
ATOM   8425  C  CG    . ASP C 2  617  ? 43.538  -31.060 99.036  1.00 90.21  ? 617  ASP C CG    1 
ATOM   8426  O  OD1   . ASP C 2  617  ? 42.739  -31.665 99.787  1.00 93.90  ? 617  ASP C OD1   1 
ATOM   8427  O  OD2   . ASP C 2  617  ? 43.168  -30.432 98.021  1.00 91.52  ? 617  ASP C OD2   1 
ATOM   8428  N  N     . GLY C 2  618  ? 46.306  -29.521 102.133 1.00 91.90  ? 618  GLY C N     1 
ATOM   8429  C  CA    . GLY C 2  618  ? 47.364  -28.614 102.503 1.00 89.62  ? 618  GLY C CA    1 
ATOM   8430  C  C     . GLY C 2  618  ? 47.503  -27.410 101.596 1.00 88.52  ? 618  GLY C C     1 
ATOM   8431  O  O     . GLY C 2  618  ? 48.125  -26.421 101.995 1.00 87.66  ? 618  GLY C O     1 
ATOM   8432  N  N     . ARG C 2  619  ? 46.935  -27.466 100.393 1.00 83.81  ? 619  ARG C N     1 
ATOM   8433  C  CA    . ARG C 2  619  ? 47.028  -26.361 99.451  1.00 81.82  ? 619  ARG C CA    1 
ATOM   8434  C  C     . ARG C 2  619  ? 46.265  -25.146 99.964  1.00 82.02  ? 619  ARG C C     1 
ATOM   8435  O  O     . ARG C 2  619  ? 45.257  -25.263 100.666 1.00 87.31  ? 619  ARG C O     1 
ATOM   8436  C  CB    . ARG C 2  619  ? 46.490  -26.783 98.082  1.00 86.54  ? 619  ARG C CB    1 
ATOM   8437  C  CG    . ARG C 2  619  ? 45.055  -27.282 98.102  1.00 82.70  ? 619  ARG C CG    1 
ATOM   8438  C  CD    . ARG C 2  619  ? 44.659  -27.877 96.758  1.00 81.64  ? 619  ARG C CD    1 
ATOM   8439  N  NE    . ARG C 2  619  ? 43.299  -28.410 96.779  1.00 79.65  ? 619  ARG C NE    1 
ATOM   8440  C  CZ    . ARG C 2  619  ? 42.250  -27.811 96.224  1.00 84.73  ? 619  ARG C CZ    1 
ATOM   8441  N  NH1   . ARG C 2  619  ? 41.049  -28.370 96.298  1.00 86.84  ? 619  ARG C NH1   1 
ATOM   8442  N  NH2   . ARG C 2  619  ? 42.400  -26.658 95.588  1.00 88.15  ? 619  ARG C NH2   1 
ATOM   8443  N  N     . LEU C 2  620  ? 46.764  -23.970 99.606  1.00 77.84  ? 620  LEU C N     1 
ATOM   8444  C  CA    . LEU C 2  620  ? 46.199  -22.699 100.037 1.00 75.32  ? 620  LEU C CA    1 
ATOM   8445  C  C     . LEU C 2  620  ? 45.536  -22.045 98.831  1.00 73.30  ? 620  LEU C C     1 
ATOM   8446  O  O     . LEU C 2  620  ? 46.222  -21.626 97.892  1.00 68.64  ? 620  LEU C O     1 
ATOM   8447  C  CB    . LEU C 2  620  ? 47.285  -21.802 100.628 1.00 72.17  ? 620  LEU C CB    1 
ATOM   8448  C  CG    . LEU C 2  620  ? 46.861  -20.868 101.760 1.00 72.11  ? 620  LEU C CG    1 
ATOM   8449  C  CD1   . LEU C 2  620  ? 46.559  -21.670 103.006 1.00 74.87  ? 620  LEU C CD1   1 
ATOM   8450  C  CD2   . LEU C 2  620  ? 47.929  -19.818 102.035 1.00 72.15  ? 620  LEU C CD2   1 
ATOM   8451  N  N     . VAL C 2  621  ? 44.208  -21.956 98.857  1.00 69.53  ? 621  VAL C N     1 
ATOM   8452  C  CA    . VAL C 2  621  ? 43.435  -21.377 97.764  1.00 66.38  ? 621  VAL C CA    1 
ATOM   8453  C  C     . VAL C 2  621  ? 42.921  -20.016 98.209  1.00 64.42  ? 621  VAL C C     1 
ATOM   8454  O  O     . VAL C 2  621  ? 42.385  -19.878 99.314  1.00 67.26  ? 621  VAL C O     1 
ATOM   8455  C  CB    . VAL C 2  621  ? 42.274  -22.293 97.343  1.00 68.41  ? 621  VAL C CB    1 
ATOM   8456  C  CG1   . VAL C 2  621  ? 41.536  -21.703 96.144  1.00 63.17  ? 621  VAL C CG1   1 
ATOM   8457  C  CG2   . VAL C 2  621  ? 42.792  -23.684 97.024  1.00 74.07  ? 621  VAL C CG2   1 
ATOM   8458  N  N     . GLU C 2  622  ? 43.078  -19.016 97.350  1.00 58.03  ? 622  GLU C N     1 
ATOM   8459  C  CA    . GLU C 2  622  ? 42.669  -17.651 97.649  1.00 59.41  ? 622  GLU C CA    1 
ATOM   8460  C  C     . GLU C 2  622  ? 41.486  -17.282 96.763  1.00 62.69  ? 622  GLU C C     1 
ATOM   8461  O  O     . GLU C 2  622  ? 41.612  -17.256 95.535  1.00 67.32  ? 622  GLU C O     1 
ATOM   8462  C  CB    . GLU C 2  622  ? 43.831  -16.682 97.437  1.00 56.36  ? 622  GLU C CB    1 
ATOM   8463  C  CG    . GLU C 2  622  ? 43.491  -15.231 97.705  1.00 59.97  ? 622  GLU C CG    1 
ATOM   8464  C  CD    . GLU C 2  622  ? 44.674  -14.313 97.482  1.00 68.16  ? 622  GLU C CD    1 
ATOM   8465  O  OE1   . GLU C 2  622  ? 45.048  -13.579 98.421  1.00 63.85  ? 622  GLU C OE1   1 
ATOM   8466  O  OE2   . GLU C 2  622  ? 45.237  -14.335 96.367  1.00 89.56  ? 622  GLU C OE2   1 
ATOM   8467  N  N     . TYR C 2  623  ? 40.340  -17.000 97.386  1.00 66.46  ? 623  TYR C N     1 
ATOM   8468  C  CA    . TYR C 2  623  ? 39.139  -16.602 96.673  1.00 56.16  ? 623  TYR C CA    1 
ATOM   8469  C  C     . TYR C 2  623  ? 39.014  -15.089 96.721  1.00 54.31  ? 623  TYR C C     1 
ATOM   8470  O  O     . TYR C 2  623  ? 38.817  -14.531 97.812  1.00 54.48  ? 623  TYR C O     1 
ATOM   8471  C  CB    . TYR C 2  623  ? 37.906  -17.254 97.293  1.00 49.00  ? 623  TYR C CB    1 
ATOM   8472  C  CG    . TYR C 2  623  ? 37.922  -18.763 97.253  1.00 54.84  ? 623  TYR C CG    1 
ATOM   8473  C  CD1   . TYR C 2  623  ? 37.497  -19.448 96.123  1.00 54.71  ? 623  TYR C CD1   1 
ATOM   8474  C  CD2   . TYR C 2  623  ? 38.353  -19.504 98.345  1.00 58.29  ? 623  TYR C CD2   1 
ATOM   8475  C  CE1   . TYR C 2  623  ? 37.504  -20.828 96.079  1.00 58.36  ? 623  TYR C CE1   1 
ATOM   8476  C  CE2   . TYR C 2  623  ? 38.364  -20.887 98.311  1.00 62.02  ? 623  TYR C CE2   1 
ATOM   8477  C  CZ    . TYR C 2  623  ? 37.939  -21.543 97.174  1.00 63.91  ? 623  TYR C CZ    1 
ATOM   8478  O  OH    . TYR C 2  623  ? 37.947  -22.918 97.126  1.00 67.02  ? 623  TYR C OH    1 
ATOM   8479  N  N     . PRO C 2  624  ? 39.144  -14.387 95.602  1.00 49.59  ? 624  PRO C N     1 
ATOM   8480  C  CA    . PRO C 2  624  ? 38.846  -12.954 95.593  1.00 53.77  ? 624  PRO C CA    1 
ATOM   8481  C  C     . PRO C 2  624  ? 37.348  -12.711 95.547  1.00 51.24  ? 624  PRO C C     1 
ATOM   8482  O  O     . PRO C 2  624  ? 36.579  -13.499 94.990  1.00 52.69  ? 624  PRO C O     1 
ATOM   8483  C  CB    . PRO C 2  624  ? 39.525  -12.463 94.310  1.00 46.64  ? 624  PRO C CB    1 
ATOM   8484  C  CG    . PRO C 2  624  ? 39.452  -13.643 93.406  1.00 51.08  ? 624  PRO C CG    1 
ATOM   8485  C  CD    . PRO C 2  624  ? 39.624  -14.859 94.293  1.00 44.11  ? 624  PRO C CD    1 
ATOM   8486  N  N     . LEU C 2  625  ? 36.938  -11.600 96.145  1.00 47.21  ? 625  LEU C N     1 
ATOM   8487  C  CA    . LEU C 2  625  ? 35.529  -11.248 96.252  1.00 49.11  ? 625  LEU C CA    1 
ATOM   8488  C  C     . LEU C 2  625  ? 35.220  -10.102 95.300  1.00 47.91  ? 625  LEU C C     1 
ATOM   8489  O  O     . LEU C 2  625  ? 35.840  -9.036  95.380  1.00 50.53  ? 625  LEU C O     1 
ATOM   8490  C  CB    . LEU C 2  625  ? 35.165  -10.868 97.688  1.00 52.84  ? 625  LEU C CB    1 
ATOM   8491  C  CG    . LEU C 2  625  ? 35.369  -11.960 98.742  1.00 48.89  ? 625  LEU C CG    1 
ATOM   8492  C  CD1   . LEU C 2  625  ? 35.131  -11.401 100.128 1.00 53.15  ? 625  LEU C CD1   1 
ATOM   8493  C  CD2   . LEU C 2  625  ? 34.458  -13.146 98.481  1.00 46.18  ? 625  LEU C CD2   1 
ATOM   8494  N  N     . ARG C 2  626  ? 34.270  -10.333 94.398  1.00 49.65  ? 626  ARG C N     1 
ATOM   8495  C  CA    . ARG C 2  626  ? 33.737  -9.257  93.578  1.00 53.32  ? 626  ARG C CA    1 
ATOM   8496  C  C     . ARG C 2  626  ? 33.104  -8.210  94.482  1.00 57.13  ? 626  ARG C C     1 
ATOM   8497  O  O     . ARG C 2  626  ? 32.226  -8.529  95.287  1.00 62.11  ? 626  ARG C O     1 
ATOM   8498  C  CB    . ARG C 2  626  ? 32.709  -9.817  92.595  1.00 56.41  ? 626  ARG C CB    1 
ATOM   8499  C  CG    . ARG C 2  626  ? 32.038  -8.780  91.716  1.00 60.09  ? 626  ARG C CG    1 
ATOM   8500  C  CD    . ARG C 2  626  ? 31.137  -9.428  90.671  1.00 64.77  ? 626  ARG C CD    1 
ATOM   8501  N  NE    . ARG C 2  626  ? 31.871  -10.358 89.817  1.00 84.46  ? 626  ARG C NE    1 
ATOM   8502  C  CZ    . ARG C 2  626  ? 31.781  -11.682 89.899  1.00 86.26  ? 626  ARG C CZ    1 
ATOM   8503  N  NH1   . ARG C 2  626  ? 30.978  -12.239 90.797  1.00 78.14  ? 626  ARG C NH1   1 
ATOM   8504  N  NH2   . ARG C 2  626  ? 32.491  -12.448 89.081  1.00 83.02  ? 626  ARG C NH2   1 
ATOM   8505  N  N     . ARG C 2  627  ? 33.560  -6.963  94.368  1.00 58.24  ? 627  ARG C N     1 
ATOM   8506  C  CA    . ARG C 2  627  ? 33.176  -5.910  95.304  1.00 53.76  ? 627  ARG C CA    1 
ATOM   8507  C  C     . ARG C 2  627  ? 32.674  -4.683  94.557  1.00 50.73  ? 627  ARG C C     1 
ATOM   8508  O  O     . ARG C 2  627  ? 33.438  -4.038  93.831  1.00 57.23  ? 627  ARG C O     1 
ATOM   8509  C  CB    . ARG C 2  627  ? 34.349  -5.540  96.214  1.00 53.26  ? 627  ARG C CB    1 
ATOM   8510  C  CG    . ARG C 2  627  ? 34.415  -6.376  97.480  1.00 55.71  ? 627  ARG C CG    1 
ATOM   8511  C  CD    . ARG C 2  627  ? 33.136  -6.212  98.275  1.00 54.35  ? 627  ARG C CD    1 
ATOM   8512  N  NE    . ARG C 2  627  ? 33.222  -6.820  99.596  1.00 58.68  ? 627  ARG C NE    1 
ATOM   8513  C  CZ    . ARG C 2  627  ? 32.329  -6.627  100.561 1.00 64.93  ? 627  ARG C CZ    1 
ATOM   8514  N  NH1   . ARG C 2  627  ? 31.285  -5.836  100.349 1.00 64.81  ? 627  ARG C NH1   1 
ATOM   8515  N  NH2   . ARG C 2  627  ? 32.478  -7.218  101.739 1.00 65.47  ? 627  ARG C NH2   1 
ATOM   8516  N  N     . PHE C 2  628  ? 31.393  -4.362  94.752  1.00 45.63  ? 628  PHE C N     1 
ATOM   8517  C  CA    . PHE C 2  628  ? 30.752  -3.167  94.197  1.00 51.96  ? 628  PHE C CA    1 
ATOM   8518  C  C     . PHE C 2  628  ? 30.900  -3.094  92.676  1.00 54.41  ? 628  PHE C C     1 
ATOM   8519  O  O     . PHE C 2  628  ? 31.266  -2.062  92.110  1.00 58.63  ? 628  PHE C O     1 
ATOM   8520  C  CB    . PHE C 2  628  ? 31.287  -1.899  94.867  1.00 51.61  ? 628  PHE C CB    1 
ATOM   8521  C  CG    . PHE C 2  628  ? 31.051  -1.855  96.349  1.00 49.35  ? 628  PHE C CG    1 
ATOM   8522  C  CD1   . PHE C 2  628  ? 29.840  -1.419  96.859  1.00 51.52  ? 628  PHE C CD1   1 
ATOM   8523  C  CD2   . PHE C 2  628  ? 32.038  -2.254  97.232  1.00 51.37  ? 628  PHE C CD2   1 
ATOM   8524  C  CE1   . PHE C 2  628  ? 29.620  -1.379  98.224  1.00 54.37  ? 628  PHE C CE1   1 
ATOM   8525  C  CE2   . PHE C 2  628  ? 31.826  -2.217  98.596  1.00 54.21  ? 628  PHE C CE2   1 
ATOM   8526  C  CZ    . PHE C 2  628  ? 30.615  -1.779  99.094  1.00 55.10  ? 628  PHE C CZ    1 
ATOM   8527  N  N     . TYR C 2  629  ? 30.595  -4.204  92.013  1.00 56.30  ? 629  TYR C N     1 
ATOM   8528  C  CA    . TYR C 2  629  ? 30.604  -4.263  90.559  1.00 57.49  ? 629  TYR C CA    1 
ATOM   8529  C  C     . TYR C 2  629  ? 29.233  -3.881  90.019  1.00 49.51  ? 629  TYR C C     1 
ATOM   8530  O  O     . TYR C 2  629  ? 28.203  -4.228  90.604  1.00 49.48  ? 629  TYR C O     1 
ATOM   8531  C  CB    . TYR C 2  629  ? 30.993  -5.662  90.076  1.00 67.10  ? 629  TYR C CB    1 
ATOM   8532  C  CG    . TYR C 2  629  ? 32.488  -5.875  89.924  1.00 78.32  ? 629  TYR C CG    1 
ATOM   8533  C  CD1   . TYR C 2  629  ? 33.356  -5.669  90.992  1.00 72.19  ? 629  TYR C CD1   1 
ATOM   8534  C  CD2   . TYR C 2  629  ? 33.028  -6.296  88.714  1.00 87.79  ? 629  TYR C CD2   1 
ATOM   8535  C  CE1   . TYR C 2  629  ? 34.721  -5.868  90.856  1.00 82.93  ? 629  TYR C CE1   1 
ATOM   8536  C  CE2   . TYR C 2  629  ? 34.392  -6.498  88.568  1.00 98.82  ? 629  TYR C CE2   1 
ATOM   8537  C  CZ    . TYR C 2  629  ? 35.233  -6.283  89.641  1.00 96.96  ? 629  TYR C CZ    1 
ATOM   8538  O  OH    . TYR C 2  629  ? 36.587  -6.484  89.492  1.00 92.39  ? 629  TYR C OH    1 
ATOM   8539  N  N     . ARG C 2  630  ? 29.227  -3.160  88.901  1.00 49.47  ? 630  ARG C N     1 
ATOM   8540  C  CA    . ARG C 2  630  ? 27.991  -2.692  88.288  1.00 44.80  ? 630  ARG C CA    1 
ATOM   8541  C  C     . ARG C 2  630  ? 27.439  -3.767  87.361  1.00 45.14  ? 630  ARG C C     1 
ATOM   8542  O  O     . ARG C 2  630  ? 28.136  -4.226  86.449  1.00 55.45  ? 630  ARG C O     1 
ATOM   8543  C  CB    . ARG C 2  630  ? 28.221  -1.398  87.513  1.00 43.49  ? 630  ARG C CB    1 
ATOM   8544  C  CG    . ARG C 2  630  ? 26.962  -0.875  86.858  1.00 44.51  ? 630  ARG C CG    1 
ATOM   8545  C  CD    . ARG C 2  630  ? 27.261  0.188   85.820  1.00 48.03  ? 630  ARG C CD    1 
ATOM   8546  N  NE    . ARG C 2  630  ? 26.034  0.846   85.388  1.00 50.25  ? 630  ARG C NE    1 
ATOM   8547  C  CZ    . ARG C 2  630  ? 25.228  0.375   84.444  1.00 51.11  ? 630  ARG C CZ    1 
ATOM   8548  N  NH1   . ARG C 2  630  ? 24.127  1.041   84.126  1.00 56.83  ? 630  ARG C NH1   1 
ATOM   8549  N  NH2   . ARG C 2  630  ? 25.521  -0.758  83.818  1.00 40.32  ? 630  ARG C NH2   1 
ATOM   8550  N  N     . SER C 2  631  ? 26.186  -4.155  87.585  1.00 42.29  ? 631  SER C N     1 
ATOM   8551  C  CA    . SER C 2  631  ? 25.541  -5.166  86.765  1.00 45.08  ? 631  SER C CA    1 
ATOM   8552  C  C     . SER C 2  631  ? 24.902  -4.518  85.539  1.00 44.69  ? 631  SER C C     1 
ATOM   8553  O  O     . SER C 2  631  ? 24.962  -3.302  85.340  1.00 44.03  ? 631  SER C O     1 
ATOM   8554  C  CB    . SER C 2  631  ? 24.500  -5.932  87.577  1.00 44.20  ? 631  SER C CB    1 
ATOM   8555  O  OG    . SER C 2  631  ? 23.354  -5.130  87.801  1.00 48.34  ? 631  SER C OG    1 
ATOM   8556  N  N     . ASN C 2  632  ? 24.265  -5.350  84.710  1.00 42.34  ? 632  ASN C N     1 
ATOM   8557  C  CA    . ASN C 2  632  ? 23.661  -4.852  83.477  1.00 48.21  ? 632  ASN C CA    1 
ATOM   8558  C  C     . ASN C 2  632  ? 22.572  -3.824  83.752  1.00 49.81  ? 632  ASN C C     1 
ATOM   8559  O  O     . ASN C 2  632  ? 22.385  -2.892  82.960  1.00 48.88  ? 632  ASN C O     1 
ATOM   8560  C  CB    . ASN C 2  632  ? 23.096  -6.013  82.658  1.00 46.84  ? 632  ASN C CB    1 
ATOM   8561  C  CG    . ASN C 2  632  ? 24.124  -6.628  81.721  1.00 48.79  ? 632  ASN C CG    1 
ATOM   8562  O  OD1   . ASN C 2  632  ? 25.169  -6.034  81.445  1.00 48.50  ? 632  ASN C OD1   1 
ATOM   8563  N  ND2   . ASN C 2  632  ? 23.824  -7.819  81.218  1.00 42.30  ? 632  ASN C ND2   1 
ATOM   8564  N  N     . GLN C 2  633  ? 21.852  -3.971  84.863  1.00 47.20  ? 633  GLN C N     1 
ATOM   8565  C  CA    . GLN C 2  633  ? 20.775  -3.061  85.221  1.00 43.16  ? 633  GLN C CA    1 
ATOM   8566  C  C     . GLN C 2  633  ? 21.200  -2.027  86.253  1.00 42.77  ? 633  GLN C C     1 
ATOM   8567  O  O     . GLN C 2  633  ? 20.348  -1.305  86.778  1.00 46.16  ? 633  GLN C O     1 
ATOM   8568  C  CB    . GLN C 2  633  ? 19.569  -3.846  85.732  1.00 41.01  ? 633  GLN C CB    1 
ATOM   8569  C  CG    . GLN C 2  633  ? 18.827  -4.608  84.644  1.00 42.69  ? 633  GLN C CG    1 
ATOM   8570  C  CD    . GLN C 2  633  ? 19.605  -5.800  84.131  1.00 42.82  ? 633  GLN C CD    1 
ATOM   8571  O  OE1   . GLN C 2  633  ? 20.528  -6.282  84.789  1.00 44.90  ? 633  GLN C OE1   1 
ATOM   8572  N  NE2   . GLN C 2  633  ? 19.240  -6.282  82.949  1.00 43.41  ? 633  GLN C NE2   1 
ATOM   8573  N  N     . GLY C 2  634  ? 22.491  -1.938  86.554  1.00 39.47  ? 634  GLY C N     1 
ATOM   8574  C  CA    . GLY C 2  634  ? 22.977  -0.944  87.482  1.00 46.06  ? 634  GLY C CA    1 
ATOM   8575  C  C     . GLY C 2  634  ? 22.889  -1.322  88.943  1.00 45.05  ? 634  GLY C C     1 
ATOM   8576  O  O     . GLY C 2  634  ? 23.329  -0.538  89.792  1.00 42.79  ? 634  GLY C O     1 
ATOM   8577  N  N     . THR C 2  635  ? 22.337  -2.486  89.272  1.00 40.06  ? 635  THR C N     1 
ATOM   8578  C  CA    . THR C 2  635  ? 22.346  -2.936  90.654  1.00 36.08  ? 635  THR C CA    1 
ATOM   8579  C  C     . THR C 2  635  ? 23.763  -3.330  91.060  1.00 43.18  ? 635  THR C C     1 
ATOM   8580  O  O     . THR C 2  635  ? 24.578  -3.749  90.233  1.00 42.94  ? 635  THR C O     1 
ATOM   8581  C  CB    . THR C 2  635  ? 21.382  -4.109  90.847  1.00 36.14  ? 635  THR C CB    1 
ATOM   8582  O  OG1   . THR C 2  635  ? 21.790  -5.218  90.037  1.00 44.29  ? 635  THR C OG1   1 
ATOM   8583  C  CG2   . THR C 2  635  ? 19.975  -3.705  90.451  1.00 36.94  ? 635  THR C CG2   1 
ATOM   8584  N  N     . ALA C 2  636  ? 24.057  -3.177  92.348  1.00 47.89  ? 636  ALA C N     1 
ATOM   8585  C  CA    . ALA C 2  636  ? 25.392  -3.452  92.860  1.00 43.81  ? 636  ALA C CA    1 
ATOM   8586  C  C     . ALA C 2  636  ? 25.581  -4.946  93.078  1.00 43.21  ? 636  ALA C C     1 
ATOM   8587  O  O     . ALA C 2  636  ? 24.723  -5.614  93.663  1.00 50.63  ? 636  ALA C O     1 
ATOM   8588  C  CB    . ALA C 2  636  ? 25.627  -2.695  94.165  1.00 43.54  ? 636  ALA C CB    1 
ATOM   8589  N  N     . LEU C 2  637  ? 26.703  -5.470  92.603  1.00 44.57  ? 637  LEU C N     1 
ATOM   8590  C  CA    . LEU C 2  637  ? 27.090  -6.855  92.837  1.00 50.86  ? 637  LEU C CA    1 
ATOM   8591  C  C     . LEU C 2  637  ? 28.331  -6.842  93.715  1.00 54.75  ? 637  LEU C C     1 
ATOM   8592  O  O     . LEU C 2  637  ? 29.407  -6.438  93.262  1.00 57.47  ? 637  LEU C O     1 
ATOM   8593  C  CB    . LEU C 2  637  ? 27.365  -7.588  91.526  1.00 49.02  ? 637  LEU C CB    1 
ATOM   8594  C  CG    . LEU C 2  637  ? 26.298  -7.544  90.439  1.00 51.51  ? 637  LEU C CG    1 
ATOM   8595  C  CD1   . LEU C 2  637  ? 26.639  -8.552  89.363  1.00 48.35  ? 637  LEU C CD1   1 
ATOM   8596  C  CD2   . LEU C 2  637  ? 24.909  -7.785  91.016  1.00 51.82  ? 637  LEU C CD2   1 
ATOM   8597  N  N     . ASP C 2  638  ? 28.189  -7.275  94.965  1.00 58.20  ? 638  ASP C N     1 
ATOM   8598  C  CA    . ASP C 2  638  ? 29.352  -7.396  95.832  1.00 61.29  ? 638  ASP C CA    1 
ATOM   8599  C  C     . ASP C 2  638  ? 29.175  -8.583  96.763  1.00 57.15  ? 638  ASP C C     1 
ATOM   8600  O  O     . ASP C 2  638  ? 28.074  -8.851  97.250  1.00 56.06  ? 638  ASP C O     1 
ATOM   8601  C  CB    . ASP C 2  638  ? 29.613  -6.116  96.640  1.00 56.67  ? 638  ASP C CB    1 
ATOM   8602  C  CG    . ASP C 2  638  ? 28.474  -5.757  97.561  1.00 64.95  ? 638  ASP C CG    1 
ATOM   8603  O  OD1   . ASP C 2  638  ? 27.327  -6.174  97.293  1.00 81.03  ? 638  ASP C OD1   1 
ATOM   8604  O  OD2   . ASP C 2  638  ? 28.729  -5.037  98.551  1.00 65.69  ? 638  ASP C OD2   1 
ATOM   8605  N  N     . GLN C 2  639  ? 30.272  -9.289  96.993  1.00 56.26  ? 639  GLN C N     1 
ATOM   8606  C  CA    . GLN C 2  639  ? 30.293  -10.464 97.844  1.00 52.38  ? 639  GLN C CA    1 
ATOM   8607  C  C     . GLN C 2  639  ? 30.881  -10.084 99.192  1.00 59.59  ? 639  GLN C C     1 
ATOM   8608  O  O     . GLN C 2  639  ? 31.959  -9.483  99.258  1.00 61.61  ? 639  GLN C O     1 
ATOM   8609  C  CB    . GLN C 2  639  ? 31.110  -11.584 97.199  1.00 58.46  ? 639  GLN C CB    1 
ATOM   8610  C  CG    . GLN C 2  639  ? 30.692  -11.901 95.775  1.00 56.86  ? 639  GLN C CG    1 
ATOM   8611  C  CD    . GLN C 2  639  ? 31.555  -12.969 95.142  1.00 54.59  ? 639  GLN C CD    1 
ATOM   8612  O  OE1   . GLN C 2  639  ? 32.630  -12.681 94.617  1.00 57.18  ? 639  GLN C OE1   1 
ATOM   8613  N  NE2   . GLN C 2  639  ? 31.086  -14.212 95.186  1.00 55.54  ? 639  GLN C NE2   1 
ATOM   8614  N  N     . ARG C 2  640  ? 30.167  -10.419 100.257 1.00 59.85  ? 640  ARG C N     1 
ATOM   8615  C  CA    . ARG C 2  640  ? 30.630  -10.140 101.600 1.00 53.39  ? 640  ARG C CA    1 
ATOM   8616  C  C     . ARG C 2  640  ? 31.083  -11.431 102.258 1.00 56.70  ? 640  ARG C C     1 
ATOM   8617  O  O     . ARG C 2  640  ? 30.369  -12.440 102.176 1.00 53.77  ? 640  ARG C O     1 
ATOM   8618  C  CB    . ARG C 2  640  ? 29.522  -9.484  102.435 1.00 58.15  ? 640  ARG C CB    1 
ATOM   8619  C  CG    . ARG C 2  640  ? 29.261  -8.013  102.108 1.00 64.73  ? 640  ARG C CG    1 
ATOM   8620  C  CD    . ARG C 2  640  ? 28.414  -7.835  100.854 1.00 63.78  ? 640  ARG C CD    1 
ATOM   8621  N  NE    . ARG C 2  640  ? 27.158  -8.577  100.934 1.00 63.91  ? 640  ARG C NE    1 
ATOM   8622  C  CZ    . ARG C 2  640  ? 26.064  -8.130  101.543 1.00 69.89  ? 640  ARG C CZ    1 
ATOM   8623  N  NH1   . ARG C 2  640  ? 24.967  -8.876  101.568 1.00 61.04  ? 640  ARG C NH1   1 
ATOM   8624  N  NH2   . ARG C 2  640  ? 26.068  -6.939  102.131 1.00 73.82  ? 640  ARG C NH2   1 
ATOM   8625  N  N     . PRO C 2  641  ? 32.255  -11.447 102.893 1.00 56.08  ? 641  PRO C N     1 
ATOM   8626  C  CA    . PRO C 2  641  ? 32.718  -12.671 103.557 1.00 49.43  ? 641  PRO C CA    1 
ATOM   8627  C  C     . PRO C 2  641  ? 31.849  -13.009 104.761 1.00 51.47  ? 641  PRO C C     1 
ATOM   8628  O  O     . PRO C 2  641  ? 31.477  -12.134 105.548 1.00 45.65  ? 641  PRO C O     1 
ATOM   8629  C  CB    . PRO C 2  641  ? 34.151  -12.322 103.975 1.00 49.79  ? 641  PRO C CB    1 
ATOM   8630  C  CG    . PRO C 2  641  ? 34.141  -10.844 104.119 1.00 50.94  ? 641  PRO C CG    1 
ATOM   8631  C  CD    . PRO C 2  641  ? 33.206  -10.335 103.060 1.00 53.63  ? 641  PRO C CD    1 
ATOM   8632  N  N     . ARG C 2  642  ? 31.512  -14.294 104.887 1.00 50.59  ? 642  ARG C N     1 
ATOM   8633  C  CA    . ARG C 2  642  ? 30.648  -14.776 105.959 1.00 55.92  ? 642  ARG C CA    1 
ATOM   8634  C  C     . ARG C 2  642  ? 31.369  -15.692 106.942 1.00 53.43  ? 642  ARG C C     1 
ATOM   8635  O  O     . ARG C 2  642  ? 30.714  -16.328 107.776 1.00 51.89  ? 642  ARG C O     1 
ATOM   8636  C  CB    . ARG C 2  642  ? 29.431  -15.495 105.371 1.00 52.19  ? 642  ARG C CB    1 
ATOM   8637  C  CG    . ARG C 2  642  ? 28.406  -14.564 104.752 1.00 46.47  ? 642  ARG C CG    1 
ATOM   8638  C  CD    . ARG C 2  642  ? 27.742  -13.696 105.808 1.00 45.96  ? 642  ARG C CD    1 
ATOM   8639  N  NE    . ARG C 2  642  ? 26.867  -12.693 105.208 1.00 53.47  ? 642  ARG C NE    1 
ATOM   8640  C  CZ    . ARG C 2  642  ? 27.229  -11.438 104.957 1.00 57.54  ? 642  ARG C CZ    1 
ATOM   8641  N  NH1   . ARG C 2  642  ? 28.452  -11.021 105.263 1.00 50.46  ? 642  ARG C NH1   1 
ATOM   8642  N  NH2   . ARG C 2  642  ? 26.366  -10.598 104.404 1.00 58.31  ? 642  ARG C NH2   1 
ATOM   8643  N  N     . VAL C 2  643  ? 32.693  -15.785 106.866 1.00 47.11  ? 643  VAL C N     1 
ATOM   8644  C  CA    . VAL C 2  643  ? 33.461  -16.645 107.750 1.00 49.55  ? 643  VAL C CA    1 
ATOM   8645  C  C     . VAL C 2  643  ? 34.534  -15.806 108.435 1.00 58.26  ? 643  VAL C C     1 
ATOM   8646  O  O     . VAL C 2  643  ? 34.821  -14.677 108.037 1.00 57.32  ? 643  VAL C O     1 
ATOM   8647  C  CB    . VAL C 2  643  ? 34.081  -17.838 107.003 1.00 45.87  ? 643  VAL C CB    1 
ATOM   8648  C  CG1   . VAL C 2  643  ? 32.991  -18.752 106.492 1.00 46.13  ? 643  VAL C CG1   1 
ATOM   8649  C  CG2   . VAL C 2  643  ? 34.938  -17.348 105.858 1.00 50.64  ? 643  VAL C CG2   1 
ATOM   8650  N  N     . VAL C 2  644  ? 35.120  -16.376 109.487 1.00 58.83  ? 644  VAL C N     1 
ATOM   8651  C  CA    . VAL C 2  644  ? 36.130  -15.697 110.286 1.00 63.13  ? 644  VAL C CA    1 
ATOM   8652  C  C     . VAL C 2  644  ? 37.402  -16.538 110.276 1.00 69.13  ? 644  VAL C C     1 
ATOM   8653  O  O     . VAL C 2  644  ? 37.382  -17.735 109.976 1.00 64.32  ? 644  VAL C O     1 
ATOM   8654  C  CB    . VAL C 2  644  ? 35.640  -15.440 111.727 1.00 69.06  ? 644  VAL C CB    1 
ATOM   8655  C  CG1   . VAL C 2  644  ? 35.606  -16.738 112.518 1.00 72.93  ? 644  VAL C CG1   1 
ATOM   8656  C  CG2   . VAL C 2  644  ? 36.492  -14.372 112.423 1.00 69.79  ? 644  VAL C CG2   1 
ATOM   8657  N  N     . VAL C 2  645  ? 38.524  -15.884 110.602 1.00 73.18  ? 645  VAL C N     1 
ATOM   8658  C  CA    . VAL C 2  645  ? 39.830  -16.536 110.560 1.00 68.01  ? 645  VAL C CA    1 
ATOM   8659  C  C     . VAL C 2  645  ? 39.847  -17.727 111.508 1.00 68.41  ? 645  VAL C C     1 
ATOM   8660  O  O     . VAL C 2  645  ? 39.380  -17.642 112.651 1.00 66.70  ? 645  VAL C O     1 
ATOM   8661  C  CB    . VAL C 2  645  ? 40.938  -15.531 110.910 1.00 56.36  ? 645  VAL C CB    1 
ATOM   8662  C  CG1   . VAL C 2  645  ? 42.307  -16.146 110.686 1.00 55.98  ? 645  VAL C CG1   1 
ATOM   8663  C  CG2   . VAL C 2  645  ? 40.784  -14.257 110.092 1.00 62.33  ? 645  VAL C CG2   1 
ATOM   8664  N  N     . GLY C 2  646  ? 40.386  -18.851 111.030 1.00 65.06  ? 646  GLY C N     1 
ATOM   8665  C  CA    . GLY C 2  646  ? 40.486  -20.057 111.820 1.00 63.30  ? 646  GLY C CA    1 
ATOM   8666  C  C     . GLY C 2  646  ? 39.256  -20.940 111.809 1.00 68.20  ? 646  GLY C C     1 
ATOM   8667  O  O     . GLY C 2  646  ? 39.311  -22.055 112.345 1.00 74.31  ? 646  GLY C O     1 
ATOM   8668  N  N     . GLN C 2  647  ? 38.155  -20.486 111.215 1.00 69.54  ? 647  GLN C N     1 
ATOM   8669  C  CA    . GLN C 2  647  ? 36.921  -21.262 111.212 1.00 67.58  ? 647  GLN C CA    1 
ATOM   8670  C  C     . GLN C 2  647  ? 37.094  -22.558 110.429 1.00 69.08  ? 647  GLN C C     1 
ATOM   8671  O  O     . GLN C 2  647  ? 37.622  -22.562 109.313 1.00 70.08  ? 647  GLN C O     1 
ATOM   8672  C  CB    . GLN C 2  647  ? 35.785  -20.429 110.618 1.00 59.99  ? 647  GLN C CB    1 
ATOM   8673  C  CG    . GLN C 2  647  ? 34.486  -21.194 110.437 1.00 60.31  ? 647  GLN C CG    1 
ATOM   8674  C  CD    . GLN C 2  647  ? 33.331  -20.299 110.034 1.00 60.12  ? 647  GLN C CD    1 
ATOM   8675  O  OE1   . GLN C 2  647  ? 33.376  -19.082 110.222 1.00 55.30  ? 647  GLN C OE1   1 
ATOM   8676  N  NE2   . GLN C 2  647  ? 32.287  -20.898 109.474 1.00 56.60  ? 647  GLN C NE2   1 
ATOM   8677  N  N     . ARG C 2  648  ? 36.645  -23.661 111.021 1.00 70.49  ? 648  ARG C N     1 
ATOM   8678  C  CA    . ARG C 2  648  ? 36.689  -24.967 110.375 1.00 76.00  ? 648  ARG C CA    1 
ATOM   8679  C  C     . ARG C 2  648  ? 35.452  -25.121 109.496 1.00 73.98  ? 648  ARG C C     1 
ATOM   8680  O  O     . ARG C 2  648  ? 34.323  -25.063 109.994 1.00 78.83  ? 648  ARG C O     1 
ATOM   8681  C  CB    . ARG C 2  648  ? 36.760  -26.080 111.422 1.00 76.79  ? 648  ARG C CB    1 
ATOM   8682  C  CG    . ARG C 2  648  ? 37.216  -27.427 110.886 1.00 76.21  ? 648  ARG C CG    1 
ATOM   8683  C  CD    . ARG C 2  648  ? 38.692  -27.400 110.528 1.00 90.39  ? 648  ARG C CD    1 
ATOM   8684  N  NE    . ARG C 2  648  ? 39.083  -28.567 109.743 1.00 100.94 ? 648  ARG C NE    1 
ATOM   8685  C  CZ    . ARG C 2  648  ? 40.286  -28.735 109.202 1.00 95.13  ? 648  ARG C CZ    1 
ATOM   8686  N  NH1   . ARG C 2  648  ? 40.553  -29.828 108.499 1.00 83.66  ? 648  ARG C NH1   1 
ATOM   8687  N  NH2   . ARG C 2  648  ? 41.223  -27.810 109.363 1.00 93.15  ? 648  ARG C NH2   1 
ATOM   8688  N  N     . VAL C 2  649  ? 35.661  -25.306 108.193 1.00 73.66  ? 649  VAL C N     1 
ATOM   8689  C  CA    . VAL C 2  649  ? 34.577  -25.382 107.219 1.00 71.17  ? 649  VAL C CA    1 
ATOM   8690  C  C     . VAL C 2  649  ? 34.619  -26.737 106.527 1.00 71.19  ? 649  VAL C C     1 
ATOM   8691  O  O     . VAL C 2  649  ? 35.698  -27.277 106.258 1.00 76.19  ? 649  VAL C O     1 
ATOM   8692  C  CB    . VAL C 2  649  ? 34.656  -24.241 106.182 1.00 67.42  ? 649  VAL C CB    1 
ATOM   8693  C  CG1   . VAL C 2  649  ? 34.357  -22.904 106.838 1.00 73.60  ? 649  VAL C CG1   1 
ATOM   8694  C  CG2   . VAL C 2  649  ? 36.023  -24.210 105.517 1.00 62.14  ? 649  VAL C CG2   1 
ATOM   8695  N  N     . ARG C 2  650  ? 33.441  -27.285 106.241 1.00 68.95  ? 650  ARG C N     1 
ATOM   8696  C  CA    . ARG C 2  650  ? 33.316  -28.516 105.480 1.00 66.05  ? 650  ARG C CA    1 
ATOM   8697  C  C     . ARG C 2  650  ? 32.989  -28.190 104.028 1.00 66.75  ? 650  ARG C C     1 
ATOM   8698  O  O     . ARG C 2  650  ? 32.815  -27.031 103.647 1.00 71.56  ? 650  ARG C O     1 
ATOM   8699  C  CB    . ARG C 2  650  ? 32.248  -29.429 106.083 1.00 73.25  ? 650  ARG C CB    1 
ATOM   8700  C  CG    . ARG C 2  650  ? 32.553  -29.910 107.485 1.00 83.17  ? 650  ARG C CG    1 
ATOM   8701  C  CD    . ARG C 2  650  ? 31.592  -31.011 107.893 1.00 96.94  ? 650  ARG C CD    1 
ATOM   8702  N  NE    . ARG C 2  650  ? 31.633  -31.265 109.328 1.00 112.38 ? 650  ARG C NE    1 
ATOM   8703  C  CZ    . ARG C 2  650  ? 30.854  -30.651 110.211 1.00 120.19 ? 650  ARG C CZ    1 
ATOM   8704  N  NH1   . ARG C 2  650  ? 29.974  -29.747 109.801 1.00 117.79 ? 650  ARG C NH1   1 
ATOM   8705  N  NH2   . ARG C 2  650  ? 30.953  -30.939 111.502 1.00 125.99 ? 650  ARG C NH2   1 
ATOM   8706  N  N     . LYS C 2  651  ? 32.891  -29.233 103.211 1.00 72.72  ? 651  LYS C N     1 
ATOM   8707  C  CA    . LYS C 2  651  ? 32.633  -29.051 101.789 1.00 77.80  ? 651  LYS C CA    1 
ATOM   8708  C  C     . LYS C 2  651  ? 31.206  -28.559 101.576 1.00 78.21  ? 651  LYS C C     1 
ATOM   8709  O  O     . LYS C 2  651  ? 30.251  -29.150 102.091 1.00 79.06  ? 651  LYS C O     1 
ATOM   8710  C  CB    . LYS C 2  651  ? 32.872  -30.362 101.041 1.00 71.70  ? 651  LYS C CB    1 
ATOM   8711  C  CG    . LYS C 2  651  ? 32.830  -30.249 99.528  1.00 66.65  ? 651  LYS C CG    1 
ATOM   8712  C  CD    . LYS C 2  651  ? 33.018  -31.609 98.876  1.00 73.39  ? 651  LYS C CD    1 
ATOM   8713  C  CE    . LYS C 2  651  ? 32.919  -31.524 97.361  1.00 80.37  ? 651  LYS C CE    1 
ATOM   8714  N  NZ    . LYS C 2  651  ? 34.020  -30.718 96.764  1.00 83.81  ? 651  LYS C NZ    1 
ATOM   8715  N  N     . GLY C 2  652  ? 31.062  -27.462 100.832 1.00 70.77  ? 652  GLY C N     1 
ATOM   8716  C  CA    . GLY C 2  652  ? 29.762  -26.888 100.558 1.00 66.63  ? 652  GLY C CA    1 
ATOM   8717  C  C     . GLY C 2  652  ? 29.298  -25.835 101.540 1.00 69.17  ? 652  GLY C C     1 
ATOM   8718  O  O     . GLY C 2  652  ? 28.196  -25.298 101.371 1.00 70.57  ? 652  GLY C O     1 
ATOM   8719  N  N     . ASP C 2  653  ? 30.092  -25.528 102.561 1.00 74.35  ? 653  ASP C N     1 
ATOM   8720  C  CA    . ASP C 2  653  ? 29.745  -24.467 103.492 1.00 72.49  ? 653  ASP C CA    1 
ATOM   8721  C  C     . ASP C 2  653  ? 29.943  -23.100 102.839 1.00 60.37  ? 653  ASP C C     1 
ATOM   8722  O  O     . ASP C 2  653  ? 30.668  -22.948 101.852 1.00 61.49  ? 653  ASP C O     1 
ATOM   8723  C  CB    . ASP C 2  653  ? 30.585  -24.577 104.765 1.00 76.97  ? 653  ASP C CB    1 
ATOM   8724  C  CG    . ASP C 2  653  ? 30.135  -25.713 105.668 1.00 71.12  ? 653  ASP C CG    1 
ATOM   8725  O  OD1   . ASP C 2  653  ? 29.545  -26.688 105.155 1.00 69.35  ? 653  ASP C OD1   1 
ATOM   8726  O  OD2   . ASP C 2  653  ? 30.358  -25.620 106.894 1.00 70.67  ? 653  ASP C OD2   1 
ATOM   8727  N  N     . LEU C 2  654  ? 29.293  -22.095 103.417 1.00 48.62  ? 654  LEU C N     1 
ATOM   8728  C  CA    . LEU C 2  654  ? 29.246  -20.765 102.825 1.00 46.80  ? 654  LEU C CA    1 
ATOM   8729  C  C     . LEU C 2  654  ? 30.504  -19.982 103.179 1.00 46.26  ? 654  LEU C C     1 
ATOM   8730  O  O     . LEU C 2  654  ? 30.769  -19.722 104.356 1.00 52.51  ? 654  LEU C O     1 
ATOM   8731  C  CB    . LEU C 2  654  ? 28.005  -20.019 103.308 1.00 44.02  ? 654  LEU C CB    1 
ATOM   8732  C  CG    . LEU C 2  654  ? 27.835  -18.596 102.780 1.00 41.56  ? 654  LEU C CG    1 
ATOM   8733  C  CD1   . LEU C 2  654  ? 27.419  -18.621 101.320 1.00 51.16  ? 654  LEU C CD1   1 
ATOM   8734  C  CD2   . LEU C 2  654  ? 26.828  -17.841 103.613 1.00 39.72  ? 654  LEU C CD2   1 
ATOM   8735  N  N     . LEU C 2  655  ? 31.271  -19.596 102.161 1.00 47.16  ? 655  LEU C N     1 
ATOM   8736  C  CA    . LEU C 2  655  ? 32.433  -18.745 102.378 1.00 44.94  ? 655  LEU C CA    1 
ATOM   8737  C  C     . LEU C 2  655  ? 32.078  -17.263 102.337 1.00 49.92  ? 655  LEU C C     1 
ATOM   8738  O  O     . LEU C 2  655  ? 32.597  -16.482 103.142 1.00 52.68  ? 655  LEU C O     1 
ATOM   8739  C  CB    . LEU C 2  655  ? 33.513  -19.056 101.340 1.00 52.51  ? 655  LEU C CB    1 
ATOM   8740  C  CG    . LEU C 2  655  ? 34.208  -20.410 101.497 1.00 53.67  ? 655  LEU C CG    1 
ATOM   8741  C  CD1   . LEU C 2  655  ? 35.269  -20.597 100.426 1.00 59.96  ? 655  LEU C CD1   1 
ATOM   8742  C  CD2   . LEU C 2  655  ? 34.819  -20.529 102.880 1.00 55.66  ? 655  LEU C CD2   1 
ATOM   8743  N  N     . ALA C 2  656  ? 31.203  -16.856 101.419 1.00 54.37  ? 656  ALA C N     1 
ATOM   8744  C  CA    . ALA C 2  656  ? 30.823  -15.456 101.295 1.00 53.50  ? 656  ALA C CA    1 
ATOM   8745  C  C     . ALA C 2  656  ? 29.435  -15.351 100.680 1.00 47.60  ? 656  ALA C C     1 
ATOM   8746  O  O     . ALA C 2  656  ? 29.037  -16.184 99.863  1.00 45.05  ? 656  ALA C O     1 
ATOM   8747  C  CB    . ALA C 2  656  ? 31.833  -14.674 100.448 1.00 56.10  ? 656  ALA C CB    1 
ATOM   8748  N  N     . ASP C 2  657  ? 28.708  -14.308 101.074 1.00 49.85  ? 657  ASP C N     1 
ATOM   8749  C  CA    . ASP C 2  657  ? 27.354  -14.067 100.589 1.00 47.75  ? 657  ASP C CA    1 
ATOM   8750  C  C     . ASP C 2  657  ? 27.390  -13.206 99.337  1.00 46.97  ? 657  ASP C C     1 
ATOM   8751  O  O     . ASP C 2  657  ? 28.025  -12.148 99.321  1.00 50.16  ? 657  ASP C O     1 
ATOM   8752  C  CB    . ASP C 2  657  ? 26.508  -13.375 101.658 1.00 47.21  ? 657  ASP C CB    1 
ATOM   8753  C  CG    . ASP C 2  657  ? 25.517  -14.308 102.314 1.00 46.20  ? 657  ASP C CG    1 
ATOM   8754  O  OD1   . ASP C 2  657  ? 25.124  -15.309 101.678 1.00 44.97  ? 657  ASP C OD1   1 
ATOM   8755  O  OD2   . ASP C 2  657  ? 25.123  -14.031 103.466 1.00 50.26  ? 657  ASP C OD2   1 
ATOM   8756  N  N     . GLY C 2  658  ? 26.689  -13.649 98.299  1.00 53.62  ? 658  GLY C N     1 
ATOM   8757  C  CA    . GLY C 2  658  ? 26.561  -12.874 97.090  1.00 57.02  ? 658  GLY C CA    1 
ATOM   8758  C  C     . GLY C 2  658  ? 25.554  -11.756 97.264  1.00 57.41  ? 658  GLY C C     1 
ATOM   8759  O  O     . GLY C 2  658  ? 25.041  -11.517 98.362  1.00 56.85  ? 658  GLY C O     1 
ATOM   8760  N  N     . PRO C 2  659  ? 25.258  -11.039 96.183  1.00 55.46  ? 659  PRO C N     1 
ATOM   8761  C  CA    . PRO C 2  659  ? 24.223  -10.003 96.258  1.00 53.04  ? 659  PRO C CA    1 
ATOM   8762  C  C     . PRO C 2  659  ? 22.846  -10.629 96.428  1.00 52.39  ? 659  PRO C C     1 
ATOM   8763  O  O     . PRO C 2  659  ? 22.555  -11.689 95.869  1.00 49.44  ? 659  PRO C O     1 
ATOM   8764  C  CB    . PRO C 2  659  ? 24.353  -9.275  94.915  1.00 53.67  ? 659  PRO C CB    1 
ATOM   8765  C  CG    . PRO C 2  659  ? 24.923  -10.305 93.994  1.00 47.90  ? 659  PRO C CG    1 
ATOM   8766  C  CD    . PRO C 2  659  ? 25.851  -11.137 94.838  1.00 54.85  ? 659  PRO C CD    1 
ATOM   8767  N  N     . ALA C 2  660  ? 22.004  -9.963  97.224  1.00 48.39  ? 660  ALA C N     1 
ATOM   8768  C  CA    . ALA C 2  660  ? 20.644  -10.426 97.513  1.00 38.96  ? 660  ALA C CA    1 
ATOM   8769  C  C     . ALA C 2  660  ? 20.653  -11.823 98.127  1.00 41.90  ? 660  ALA C C     1 
ATOM   8770  O  O     . ALA C 2  660  ? 19.849  -12.685 97.769  1.00 33.83  ? 660  ALA C O     1 
ATOM   8771  C  CB    . ALA C 2  660  ? 19.761  -10.389 96.266  1.00 31.45  ? 660  ALA C CB    1 
ATOM   8772  N  N     . SER C 2  661  ? 21.575  -12.045 99.063  1.00 46.84  ? 661  SER C N     1 
ATOM   8773  C  CA    . SER C 2  661  ? 21.723  -13.328 99.734  1.00 41.92  ? 661  SER C CA    1 
ATOM   8774  C  C     . SER C 2  661  ? 22.068  -13.083 101.194 1.00 45.29  ? 661  SER C C     1 
ATOM   8775  O  O     . SER C 2  661  ? 22.936  -12.259 101.499 1.00 48.02  ? 661  SER C O     1 
ATOM   8776  C  CB    . SER C 2  661  ? 22.808  -14.183 99.068  1.00 42.34  ? 661  SER C CB    1 
ATOM   8777  O  OG    . SER C 2  661  ? 23.059  -15.368 99.805  1.00 42.31  ? 661  SER C OG    1 
ATOM   8778  N  N     . GLU C 2  662  ? 21.382  -13.790 102.091 1.00 37.85  ? 662  GLU C N     1 
ATOM   8779  C  CA    . GLU C 2  662  ? 21.647  -13.718 103.524 1.00 36.71  ? 662  GLU C CA    1 
ATOM   8780  C  C     . GLU C 2  662  ? 21.972  -15.118 104.025 1.00 43.95  ? 662  GLU C C     1 
ATOM   8781  O  O     . GLU C 2  662  ? 21.076  -15.958 104.162 1.00 45.08  ? 662  GLU C O     1 
ATOM   8782  C  CB    . GLU C 2  662  ? 20.461  -13.132 104.286 1.00 44.92  ? 662  GLU C CB    1 
ATOM   8783  C  CG    . GLU C 2  662  ? 20.682  -13.064 105.791 1.00 47.30  ? 662  GLU C CG    1 
ATOM   8784  C  CD    . GLU C 2  662  ? 19.540  -12.390 106.524 1.00 42.72  ? 662  GLU C CD    1 
ATOM   8785  O  OE1   . GLU C 2  662  ? 18.403  -12.911 106.472 1.00 40.57  ? 662  GLU C OE1   1 
ATOM   8786  O  OE2   . GLU C 2  662  ? 19.784  -11.334 107.149 1.00 35.40  ? 662  GLU C OE2   1 
ATOM   8787  N  N     . ASN C 2  663  ? 23.254  -15.357 104.303 1.00 46.76  ? 663  ASN C N     1 
ATOM   8788  C  CA    . ASN C 2  663  ? 23.736  -16.628 104.841 1.00 42.80  ? 663  ASN C CA    1 
ATOM   8789  C  C     . ASN C 2  663  ? 23.339  -17.797 103.936 1.00 46.55  ? 663  ASN C C     1 
ATOM   8790  O  O     . ASN C 2  663  ? 22.886  -18.847 104.398 1.00 51.02  ? 663  ASN C O     1 
ATOM   8791  C  CB    . ASN C 2  663  ? 23.241  -16.837 106.275 1.00 40.56  ? 663  ASN C CB    1 
ATOM   8792  C  CG    . ASN C 2  663  ? 23.582  -15.670 107.185 1.00 48.74  ? 663  ASN C CG    1 
ATOM   8793  O  OD1   . ASN C 2  663  ? 24.560  -14.953 106.959 1.00 44.32  ? 663  ASN C OD1   1 
ATOM   8794  N  ND2   . ASN C 2  663  ? 22.773  -15.471 108.220 1.00 55.26  ? 663  ASN C ND2   1 
ATOM   8795  N  N     . GLY C 2  664  ? 23.523  -17.606 102.628 1.00 41.19  ? 664  GLY C N     1 
ATOM   8796  C  CA    . GLY C 2  664  ? 23.192  -18.616 101.643 1.00 39.64  ? 664  GLY C CA    1 
ATOM   8797  C  C     . GLY C 2  664  ? 21.724  -18.717 101.281 1.00 45.51  ? 664  GLY C C     1 
ATOM   8798  O  O     . GLY C 2  664  ? 21.370  -19.534 100.418 1.00 45.69  ? 664  GLY C O     1 
ATOM   8799  N  N     . PHE C 2  665  ? 20.859  -17.931 101.919 1.00 42.73  ? 665  PHE C N     1 
ATOM   8800  C  CA    . PHE C 2  665  ? 19.431  -17.919 101.635 1.00 38.15  ? 665  PHE C CA    1 
ATOM   8801  C  C     . PHE C 2  665  ? 19.102  -16.722 100.752 1.00 38.58  ? 665  PHE C C     1 
ATOM   8802  O  O     . PHE C 2  665  ? 19.675  -15.640 100.918 1.00 38.38  ? 665  PHE C O     1 
ATOM   8803  C  CB    . PHE C 2  665  ? 18.611  -17.850 102.927 1.00 41.87  ? 665  PHE C CB    1 
ATOM   8804  C  CG    . PHE C 2  665  ? 18.682  -19.095 103.780 1.00 44.60  ? 665  PHE C CG    1 
ATOM   8805  C  CD1   . PHE C 2  665  ? 19.774  -19.335 104.599 1.00 42.53  ? 665  PHE C CD1   1 
ATOM   8806  C  CD2   . PHE C 2  665  ? 17.640  -20.010 103.783 1.00 47.29  ? 665  PHE C CD2   1 
ATOM   8807  C  CE1   . PHE C 2  665  ? 19.832  -20.470 105.387 1.00 47.88  ? 665  PHE C CE1   1 
ATOM   8808  C  CE2   . PHE C 2  665  ? 17.693  -21.146 104.573 1.00 45.54  ? 665  PHE C CE2   1 
ATOM   8809  C  CZ    . PHE C 2  665  ? 18.790  -21.374 105.375 1.00 49.33  ? 665  PHE C CZ    1 
ATOM   8810  N  N     . LEU C 2  666  ? 18.174  -16.922 99.818  1.00 33.79  ? 666  LEU C N     1 
ATOM   8811  C  CA    . LEU C 2  666  ? 17.805  -15.866 98.883  1.00 33.02  ? 666  LEU C CA    1 
ATOM   8812  C  C     . LEU C 2  666  ? 17.148  -14.717 99.640  1.00 39.85  ? 666  LEU C C     1 
ATOM   8813  O  O     . LEU C 2  666  ? 16.155  -14.919 100.346 1.00 48.76  ? 666  LEU C O     1 
ATOM   8814  C  CB    . LEU C 2  666  ? 16.870  -16.412 97.806  1.00 32.59  ? 666  LEU C CB    1 
ATOM   8815  C  CG    . LEU C 2  666  ? 16.986  -15.893 96.365  1.00 31.33  ? 666  LEU C CG    1 
ATOM   8816  C  CD1   . LEU C 2  666  ? 15.613  -15.830 95.719  1.00 24.95  ? 666  LEU C CD1   1 
ATOM   8817  C  CD2   . LEU C 2  666  ? 17.686  -14.549 96.283  1.00 30.05  ? 666  LEU C CD2   1 
ATOM   8818  N  N     . ALA C 2  667  ? 17.704  -13.515 99.496  1.00 38.65  ? 667  ALA C N     1 
ATOM   8819  C  CA    . ALA C 2  667  ? 17.244  -12.327 100.215 1.00 36.59  ? 667  ALA C CA    1 
ATOM   8820  C  C     . ALA C 2  667  ? 16.871  -11.240 99.209  1.00 41.33  ? 667  ALA C C     1 
ATOM   8821  O  O     . ALA C 2  667  ? 17.678  -10.357 98.906  1.00 43.30  ? 667  ALA C O     1 
ATOM   8822  C  CB    . ALA C 2  667  ? 18.312  -11.838 101.180 1.00 35.75  ? 667  ALA C CB    1 
ATOM   8823  N  N     . LEU C 2  668  ? 15.628  -11.276 98.727  1.00 34.65  ? 668  LEU C N     1 
ATOM   8824  C  CA    . LEU C 2  668  ? 15.168  -10.323 97.727  1.00 31.81  ? 668  LEU C CA    1 
ATOM   8825  C  C     . LEU C 2  668  ? 14.561  -9.064  98.327  1.00 32.58  ? 668  LEU C C     1 
ATOM   8826  O  O     . LEU C 2  668  ? 14.300  -8.108  97.588  1.00 40.44  ? 668  LEU C O     1 
ATOM   8827  C  CB    . LEU C 2  668  ? 14.143  -10.984 96.801  1.00 34.45  ? 668  LEU C CB    1 
ATOM   8828  C  CG    . LEU C 2  668  ? 14.719  -12.082 95.921  1.00 31.78  ? 668  LEU C CG    1 
ATOM   8829  C  CD1   . LEU C 2  668  ? 13.667  -12.535 94.933  1.00 33.14  ? 668  LEU C CD1   1 
ATOM   8830  C  CD2   . LEU C 2  668  ? 15.940  -11.551 95.207  1.00 28.46  ? 668  LEU C CD2   1 
ATOM   8831  N  N     . GLY C 2  669  ? 14.351  -9.026  99.639  1.00 34.18  ? 669  GLY C N     1 
ATOM   8832  C  CA    . GLY C 2  669  ? 13.718  -7.876  100.257 1.00 37.00  ? 669  GLY C CA    1 
ATOM   8833  C  C     . GLY C 2  669  ? 13.892  -7.787  101.759 1.00 31.50  ? 669  GLY C C     1 
ATOM   8834  O  O     . GLY C 2  669  ? 14.865  -8.306  102.315 1.00 30.20  ? 669  GLY C O     1 
ATOM   8835  N  N     . GLN C 2  670  ? 12.950  -7.122  102.424 1.00 34.88  ? 670  GLN C N     1 
ATOM   8836  C  CA    . GLN C 2  670  ? 12.985  -6.956  103.868 1.00 32.57  ? 670  GLN C CA    1 
ATOM   8837  C  C     . GLN C 2  670  ? 11.748  -7.568  104.516 1.00 35.97  ? 670  GLN C C     1 
ATOM   8838  O  O     . GLN C 2  670  ? 10.661  -7.617  103.922 1.00 40.46  ? 670  GLN C O     1 
ATOM   8839  C  CB    . GLN C 2  670  ? 13.090  -5.475  104.257 1.00 32.08  ? 670  GLN C CB    1 
ATOM   8840  C  CG    . GLN C 2  670  ? 14.295  -5.158  105.124 1.00 37.20  ? 670  GLN C CG    1 
ATOM   8841  C  CD    . GLN C 2  670  ? 15.491  -4.728  104.312 1.00 37.10  ? 670  GLN C CD    1 
ATOM   8842  O  OE1   . GLN C 2  670  ? 15.430  -3.748  103.572 1.00 40.96  ? 670  GLN C OE1   1 
ATOM   8843  N  NE2   . GLN C 2  670  ? 16.584  -5.465  104.436 1.00 35.72  ? 670  GLN C NE2   1 
ATOM   8844  N  N     . ASN C 2  671  ? 11.925  -8.025  105.754 1.00 34.72  ? 671  ASN C N     1 
ATOM   8845  C  CA    . ASN C 2  671  ? 10.827  -8.503  106.584 1.00 32.25  ? 671  ASN C CA    1 
ATOM   8846  C  C     . ASN C 2  671  ? 10.358  -7.353  107.465 1.00 35.50  ? 671  ASN C C     1 
ATOM   8847  O  O     . ASN C 2  671  ? 11.071  -6.930  108.381 1.00 30.74  ? 671  ASN C O     1 
ATOM   8848  C  CB    . ASN C 2  671  ? 11.265  -9.698  107.419 1.00 26.14  ? 671  ASN C CB    1 
ATOM   8849  C  CG    . ASN C 2  671  ? 11.515  -10.920 106.575 1.00 36.58  ? 671  ASN C CG    1 
ATOM   8850  O  OD1   . ASN C 2  671  ? 10.674  -11.311 105.768 1.00 37.70  ? 671  ASN C OD1   1 
ATOM   8851  N  ND2   . ASN C 2  671  ? 12.676  -11.535 106.755 1.00 43.05  ? 671  ASN C ND2   1 
ATOM   8852  N  N     . VAL C 2  672  ? 9.155   -6.857  107.193 1.00 35.51  ? 672  VAL C N     1 
ATOM   8853  C  CA    . VAL C 2  672  ? 8.632   -5.679  107.868 1.00 33.25  ? 672  VAL C CA    1 
ATOM   8854  C  C     . VAL C 2  672  ? 7.367   -6.040  108.634 1.00 33.55  ? 672  VAL C C     1 
ATOM   8855  O  O     . VAL C 2  672  ? 6.641   -6.979  108.287 1.00 30.61  ? 672  VAL C O     1 
ATOM   8856  C  CB    . VAL C 2  672  ? 8.352   -4.532  106.874 1.00 30.20  ? 672  VAL C CB    1 
ATOM   8857  C  CG1   . VAL C 2  672  ? 9.648   -3.899  106.414 1.00 31.33  ? 672  VAL C CG1   1 
ATOM   8858  C  CG2   . VAL C 2  672  ? 7.585   -5.063  105.691 1.00 32.62  ? 672  VAL C CG2   1 
ATOM   8859  N  N     . LEU C 2  673  ? 7.104   -5.261  109.680 1.00 36.02  ? 673  LEU C N     1 
ATOM   8860  C  CA    . LEU C 2  673  ? 5.920   -5.415  110.516 1.00 33.21  ? 673  LEU C CA    1 
ATOM   8861  C  C     . LEU C 2  673  ? 4.771   -4.616  109.916 1.00 37.84  ? 673  LEU C C     1 
ATOM   8862  O  O     . LEU C 2  673  ? 4.889   -3.404  109.703 1.00 38.03  ? 673  LEU C O     1 
ATOM   8863  C  CB    . LEU C 2  673  ? 6.208   -4.941  111.937 1.00 34.65  ? 673  LEU C CB    1 
ATOM   8864  C  CG    . LEU C 2  673  ? 5.202   -5.278  113.028 1.00 33.22  ? 673  LEU C CG    1 
ATOM   8865  C  CD1   . LEU C 2  673  ? 5.008   -6.784  113.124 1.00 28.94  ? 673  LEU C CD1   1 
ATOM   8866  C  CD2   . LEU C 2  673  ? 5.695   -4.710  114.345 1.00 30.20  ? 673  LEU C CD2   1 
ATOM   8867  N  N     . VAL C 2  674  ? 3.656   -5.296  109.675 1.00 36.09  ? 674  VAL C N     1 
ATOM   8868  C  CA    . VAL C 2  674  ? 2.613   -4.840  108.771 1.00 32.20  ? 674  VAL C CA    1 
ATOM   8869  C  C     . VAL C 2  674  ? 1.284   -4.837  109.515 1.00 30.83  ? 674  VAL C C     1 
ATOM   8870  O  O     . VAL C 2  674  ? 1.005   -5.745  110.309 1.00 32.80  ? 674  VAL C O     1 
ATOM   8871  C  CB    . VAL C 2  674  ? 2.576   -5.751  107.522 1.00 33.07  ? 674  VAL C CB    1 
ATOM   8872  C  CG1   . VAL C 2  674  ? 1.161   -6.169  107.155 1.00 28.31  ? 674  VAL C CG1   1 
ATOM   8873  C  CG2   . VAL C 2  674  ? 3.323   -5.094  106.361 1.00 35.83  ? 674  VAL C CG2   1 
ATOM   8874  N  N     . ALA C 2  675  ? 0.487   -3.790  109.289 1.00 31.38  ? 675  ALA C N     1 
ATOM   8875  C  CA    . ALA C 2  675  ? -0.872  -3.681  109.815 1.00 31.50  ? 675  ALA C CA    1 
ATOM   8876  C  C     . ALA C 2  675  ? -1.819  -3.507  108.637 1.00 30.56  ? 675  ALA C C     1 
ATOM   8877  O  O     . ALA C 2  675  ? -1.646  -2.585  107.832 1.00 32.02  ? 675  ALA C O     1 
ATOM   8878  C  CB    . ALA C 2  675  ? -1.023  -2.511  110.794 1.00 27.02  ? 675  ALA C CB    1 
ATOM   8879  N  N     . ILE C 2  676  ? -2.809  -4.392  108.528 1.00 29.80  ? 676  ILE C N     1 
ATOM   8880  C  CA    . ILE C 2  676  ? -3.734  -4.382  107.396 1.00 29.62  ? 676  ILE C CA    1 
ATOM   8881  C  C     . ILE C 2  676  ? -4.946  -3.551  107.804 1.00 27.39  ? 676  ILE C C     1 
ATOM   8882  O  O     . ILE C 2  676  ? -5.815  -4.014  108.543 1.00 28.24  ? 676  ILE C O     1 
ATOM   8883  C  CB    . ILE C 2  676  ? -4.129  -5.795  106.965 1.00 26.18  ? 676  ILE C CB    1 
ATOM   8884  C  CG1   . ILE C 2  676  ? -2.880  -6.621  106.661 1.00 25.63  ? 676  ILE C CG1   1 
ATOM   8885  C  CG2   . ILE C 2  676  ? -5.026  -5.747  105.739 1.00 24.40  ? 676  ILE C CG2   1 
ATOM   8886  C  CD1   . ILE C 2  676  ? -3.174  -7.995  106.116 1.00 25.99  ? 676  ILE C CD1   1 
ATOM   8887  N  N     . MET C 2  677  ? -4.998  -2.316  107.318 1.00 24.94  ? 677  MET C N     1 
ATOM   8888  C  CA    . MET C 2  677  ? -6.039  -1.358  107.660 1.00 26.63  ? 677  MET C CA    1 
ATOM   8889  C  C     . MET C 2  677  ? -5.930  -0.161  106.724 1.00 32.78  ? 677  MET C C     1 
ATOM   8890  O  O     . MET C 2  677  ? -4.829  0.156   106.252 1.00 30.62  ? 677  MET C O     1 
ATOM   8891  C  CB    . MET C 2  677  ? -5.908  -0.908  109.117 1.00 25.62  ? 677  MET C CB    1 
ATOM   8892  C  CG    . MET C 2  677  ? -4.532  -0.350  109.457 1.00 28.74  ? 677  MET C CG    1 
ATOM   8893  S  SD    . MET C 2  677  ? -4.412  0.500   111.045 1.00 33.12  ? 677  MET C SD    1 
ATOM   8894  C  CE    . MET C 2  677  ? -5.484  1.916   110.780 1.00 28.84  ? 677  MET C CE    1 
ATOM   8895  N  N     . PRO C 2  678  ? -7.036  0.515   106.420 1.00 29.49  ? 678  PRO C N     1 
ATOM   8896  C  CA    . PRO C 2  678  ? -6.941  1.777   105.681 1.00 29.10  ? 678  PRO C CA    1 
ATOM   8897  C  C     . PRO C 2  678  ? -6.283  2.827   106.556 1.00 26.52  ? 678  PRO C C     1 
ATOM   8898  O  O     . PRO C 2  678  ? -6.272  2.718   107.783 1.00 33.63  ? 678  PRO C O     1 
ATOM   8899  C  CB    . PRO C 2  678  ? -8.404  2.136   105.380 1.00 32.54  ? 678  PRO C CB    1 
ATOM   8900  C  CG    . PRO C 2  678  ? -9.205  0.908   105.726 1.00 27.24  ? 678  PRO C CG    1 
ATOM   8901  C  CD    . PRO C 2  678  ? -8.425  0.181   106.767 1.00 24.00  ? 678  PRO C CD    1 
ATOM   8902  N  N     . PHE C 2  679  ? -5.703  3.841   105.920 1.00 24.41  ? 679  PHE C N     1 
ATOM   8903  C  CA    . PHE C 2  679  ? -5.103  4.939   106.676 1.00 27.19  ? 679  PHE C CA    1 
ATOM   8904  C  C     . PHE C 2  679  ? -5.342  6.254   105.939 1.00 30.85  ? 679  PHE C C     1 
ATOM   8905  O  O     . PHE C 2  679  ? -4.580  6.618   105.037 1.00 33.35  ? 679  PHE C O     1 
ATOM   8906  C  CB    . PHE C 2  679  ? -3.619  4.705   106.920 1.00 26.70  ? 679  PHE C CB    1 
ATOM   8907  C  CG    . PHE C 2  679  ? -3.065  5.536   108.034 1.00 34.45  ? 679  PHE C CG    1 
ATOM   8908  C  CD1   . PHE C 2  679  ? -3.117  5.087   109.343 1.00 33.55  ? 679  PHE C CD1   1 
ATOM   8909  C  CD2   . PHE C 2  679  ? -2.518  6.781   107.778 1.00 30.06  ? 679  PHE C CD2   1 
ATOM   8910  C  CE1   . PHE C 2  679  ? -2.617  5.856   110.373 1.00 32.58  ? 679  PHE C CE1   1 
ATOM   8911  C  CE2   . PHE C 2  679  ? -2.019  7.554   108.803 1.00 29.15  ? 679  PHE C CE2   1 
ATOM   8912  C  CZ    . PHE C 2  679  ? -2.066  7.093   110.102 1.00 32.27  ? 679  PHE C CZ    1 
ATOM   8913  N  N     . ASP C 2  680  ? -6.406  6.956   106.338 1.00 30.82  ? 680  ASP C N     1 
ATOM   8914  C  CA    . ASP C 2  680  ? -6.747  8.304   105.880 1.00 33.47  ? 680  ASP C CA    1 
ATOM   8915  C  C     . ASP C 2  680  ? -6.552  8.516   104.381 1.00 30.18  ? 680  ASP C C     1 
ATOM   8916  O  O     . ASP C 2  680  ? -6.184  9.613   103.950 1.00 26.89  ? 680  ASP C O     1 
ATOM   8917  C  CB    . ASP C 2  680  ? -5.943  9.343   106.666 1.00 33.96  ? 680  ASP C CB    1 
ATOM   8918  C  CG    . ASP C 2  680  ? -6.648  9.785   107.943 1.00 40.55  ? 680  ASP C CG    1 
ATOM   8919  O  OD1   . ASP C 2  680  ? -7.551  9.062   108.421 1.00 39.36  ? 680  ASP C OD1   1 
ATOM   8920  O  OD2   . ASP C 2  680  ? -6.308  10.867  108.464 1.00 45.69  ? 680  ASP C OD2   1 
ATOM   8921  N  N     . GLY C 2  681  ? -6.817  7.484   103.581 1.00 28.66  ? 681  GLY C N     1 
ATOM   8922  C  CA    . GLY C 2  681  ? -6.746  7.595   102.142 1.00 26.52  ? 681  GLY C CA    1 
ATOM   8923  C  C     . GLY C 2  681  ? -5.358  7.532   101.545 1.00 28.37  ? 681  GLY C C     1 
ATOM   8924  O  O     . GLY C 2  681  ? -5.228  7.646   100.320 1.00 28.96  ? 681  GLY C O     1 
ATOM   8925  N  N     . TYR C 2  682  ? -4.314  7.353   102.356 1.00 27.22  ? 682  TYR C N     1 
ATOM   8926  C  CA    . TYR C 2  682  ? -2.961  7.290   101.816 1.00 25.53  ? 682  TYR C CA    1 
ATOM   8927  C  C     . TYR C 2  682  ? -2.593  5.913   101.282 1.00 23.39  ? 682  TYR C C     1 
ATOM   8928  O  O     . TYR C 2  682  ? -1.577  5.791   100.594 1.00 26.48  ? 682  TYR C O     1 
ATOM   8929  C  CB    . TYR C 2  682  ? -1.938  7.713   102.871 1.00 26.33  ? 682  TYR C CB    1 
ATOM   8930  C  CG    . TYR C 2  682  ? -1.897  9.201   103.105 1.00 30.30  ? 682  TYR C CG    1 
ATOM   8931  C  CD1   . TYR C 2  682  ? -1.398  10.060  102.133 1.00 29.46  ? 682  TYR C CD1   1 
ATOM   8932  C  CD2   . TYR C 2  682  ? -2.348  9.750   104.298 1.00 27.32  ? 682  TYR C CD2   1 
ATOM   8933  C  CE1   . TYR C 2  682  ? -1.356  11.425  102.340 1.00 28.31  ? 682  TYR C CE1   1 
ATOM   8934  C  CE2   . TYR C 2  682  ? -2.306  11.114  104.515 1.00 28.46  ? 682  TYR C CE2   1 
ATOM   8935  C  CZ    . TYR C 2  682  ? -1.811  11.947  103.533 1.00 33.42  ? 682  TYR C CZ    1 
ATOM   8936  O  OH    . TYR C 2  682  ? -1.768  13.306  103.749 1.00 43.74  ? 682  TYR C OH    1 
ATOM   8937  N  N     . ASN C 2  683  ? -3.365  4.874   101.598 1.00 22.91  ? 683  ASN C N     1 
ATOM   8938  C  CA    . ASN C 2  683  ? -3.237  3.595   100.916 1.00 23.03  ? 683  ASN C CA    1 
ATOM   8939  C  C     . ASN C 2  683  ? -4.429  3.333   100.006 1.00 26.07  ? 683  ASN C C     1 
ATOM   8940  O  O     . ASN C 2  683  ? -4.739  2.176   99.701  1.00 26.90  ? 683  ASN C O     1 
ATOM   8941  C  CB    . ASN C 2  683  ? -3.050  2.458   101.917 1.00 25.83  ? 683  ASN C CB    1 
ATOM   8942  C  CG    . ASN C 2  683  ? -4.023  2.526   103.066 1.00 28.13  ? 683  ASN C CG    1 
ATOM   8943  O  OD1   . ASN C 2  683  ? -5.044  3.213   102.997 1.00 32.12  ? 683  ASN C OD1   1 
ATOM   8944  N  ND2   . ASN C 2  683  ? -3.714  1.805   104.140 1.00 27.54  ? 683  ASN C ND2   1 
ATOM   8945  N  N     . PHE C 2  684  ? -5.107  4.397   99.587  1.00 23.93  ? 684  PHE C N     1 
ATOM   8946  C  CA    . PHE C 2  684  ? -6.184  4.300   98.614  1.00 27.18  ? 684  PHE C CA    1 
ATOM   8947  C  C     . PHE C 2  684  ? -5.658  3.759   97.290  1.00 26.52  ? 684  PHE C C     1 
ATOM   8948  O  O     . PHE C 2  684  ? -4.656  4.247   96.762  1.00 29.03  ? 684  PHE C O     1 
ATOM   8949  C  CB    . PHE C 2  684  ? -6.812  5.683   98.436  1.00 26.94  ? 684  PHE C CB    1 
ATOM   8950  C  CG    . PHE C 2  684  ? -7.778  5.789   97.294  1.00 26.38  ? 684  PHE C CG    1 
ATOM   8951  C  CD1   . PHE C 2  684  ? -9.083  5.351   97.427  1.00 28.04  ? 684  PHE C CD1   1 
ATOM   8952  C  CD2   . PHE C 2  684  ? -7.394  6.383   96.103  1.00 28.16  ? 684  PHE C CD2   1 
ATOM   8953  C  CE1   . PHE C 2  684  ? -9.978  5.475   96.382  1.00 34.34  ? 684  PHE C CE1   1 
ATOM   8954  C  CE2   . PHE C 2  684  ? -8.282  6.516   95.055  1.00 27.20  ? 684  PHE C CE2   1 
ATOM   8955  C  CZ    . PHE C 2  684  ? -9.576  6.060   95.192  1.00 29.65  ? 684  PHE C CZ    1 
ATOM   8956  N  N     . GLU C 2  685  ? -6.328  2.731   96.773  1.00 26.28  ? 685  GLU C N     1 
ATOM   8957  C  CA    . GLU C 2  685  ? -6.031  2.140   95.468  1.00 25.99  ? 685  GLU C CA    1 
ATOM   8958  C  C     . GLU C 2  685  ? -4.575  1.680   95.371  1.00 25.87  ? 685  GLU C C     1 
ATOM   8959  O  O     . GLU C 2  685  ? -3.790  2.166   94.556  1.00 25.24  ? 685  GLU C O     1 
ATOM   8960  C  CB    . GLU C 2  685  ? -6.385  3.106   94.333  1.00 24.67  ? 685  GLU C CB    1 
ATOM   8961  C  CG    . GLU C 2  685  ? -7.878  3.235   94.059  1.00 27.88  ? 685  GLU C CG    1 
ATOM   8962  C  CD    . GLU C 2  685  ? -8.493  2.008   93.396  1.00 36.22  ? 685  GLU C CD    1 
ATOM   8963  O  OE1   . GLU C 2  685  ? -8.148  0.865   93.769  1.00 33.05  ? 685  GLU C OE1   1 
ATOM   8964  O  OE2   . GLU C 2  685  ? -9.341  2.191   92.494  1.00 42.53  ? 685  GLU C OE2   1 
ATOM   8965  N  N     . ASP C 2  686  ? -4.235  0.715   96.223  1.00 26.25  ? 686  ASP C N     1 
ATOM   8966  C  CA    . ASP C 2  686  ? -2.976  -0.026  96.225  1.00 27.37  ? 686  ASP C CA    1 
ATOM   8967  C  C     . ASP C 2  686  ? -1.775  0.824   96.612  1.00 28.06  ? 686  ASP C C     1 
ATOM   8968  O  O     . ASP C 2  686  ? -0.649  0.321   96.576  1.00 28.50  ? 686  ASP C O     1 
ATOM   8969  C  CB    . ASP C 2  686  ? -2.689  -0.695  94.872  1.00 27.43  ? 686  ASP C CB    1 
ATOM   8970  C  CG    . ASP C 2  686  ? -3.884  -1.455  94.339  1.00 36.59  ? 686  ASP C CG    1 
ATOM   8971  O  OD1   . ASP C 2  686  ? -4.483  -2.231  95.119  1.00 35.76  ? 686  ASP C OD1   1 
ATOM   8972  O  OD2   . ASP C 2  686  ? -4.237  -1.263  93.153  1.00 38.93  ? 686  ASP C OD2   1 
ATOM   8973  N  N     . ALA C 2  687  ? -1.963  2.089   96.975  1.00 23.73  ? 687  ALA C N     1 
ATOM   8974  C  CA    . ALA C 2  687  ? -0.861  2.852   97.531  1.00 21.94  ? 687  ALA C CA    1 
ATOM   8975  C  C     . ALA C 2  687  ? -0.460  2.263   98.882  1.00 28.64  ? 687  ALA C C     1 
ATOM   8976  O  O     . ALA C 2  687  ? -1.229  1.546   99.527  1.00 26.58  ? 687  ALA C O     1 
ATOM   8977  C  CB    . ALA C 2  687  ? -1.245  4.325   97.671  1.00 21.02  ? 687  ALA C CB    1 
ATOM   8978  N  N     . ILE C 2  688  ? 0.769   2.555   99.301  1.00 30.59  ? 688  ILE C N     1 
ATOM   8979  C  CA    . ILE C 2  688  ? 1.332   1.991   100.523 1.00 27.71  ? 688  ILE C CA    1 
ATOM   8980  C  C     . ILE C 2  688  ? 1.841   3.119   101.411 1.00 31.01  ? 688  ILE C C     1 
ATOM   8981  O  O     . ILE C 2  688  ? 2.360   4.125   100.916 1.00 31.60  ? 688  ILE C O     1 
ATOM   8982  C  CB    . ILE C 2  688  ? 2.463   0.990   100.212 1.00 24.05  ? 688  ILE C CB    1 
ATOM   8983  C  CG1   . ILE C 2  688  ? 1.960   -0.098  99.262  1.00 25.88  ? 688  ILE C CG1   1 
ATOM   8984  C  CG2   . ILE C 2  688  ? 2.989   0.358   101.490 1.00 28.30  ? 688  ILE C CG2   1 
ATOM   8985  C  CD1   . ILE C 2  688  ? 2.948   -1.213  99.044  1.00 25.85  ? 688  ILE C CD1   1 
ATOM   8986  N  N     . VAL C 2  689  ? 1.692   2.947   102.725 1.00 33.45  ? 689  VAL C N     1 
ATOM   8987  C  CA    . VAL C 2  689  ? 2.202   3.882   103.726 1.00 34.83  ? 689  VAL C CA    1 
ATOM   8988  C  C     . VAL C 2  689  ? 3.303   3.189   104.516 1.00 31.50  ? 689  VAL C C     1 
ATOM   8989  O  O     . VAL C 2  689  ? 3.137   2.039   104.937 1.00 30.59  ? 689  VAL C O     1 
ATOM   8990  C  CB    . VAL C 2  689  ? 1.087   4.367   104.667 1.00 26.44  ? 689  VAL C CB    1 
ATOM   8991  C  CG1   . VAL C 2  689  ? 1.602   5.483   105.544 1.00 26.04  ? 689  VAL C CG1   1 
ATOM   8992  C  CG2   . VAL C 2  689  ? -0.121  4.821   103.867 1.00 29.30  ? 689  VAL C CG2   1 
ATOM   8993  N  N     . ILE C 2  690  ? 4.421   3.889   104.733 1.00 29.05  ? 690  ILE C N     1 
ATOM   8994  C  CA    . ILE C 2  690  ? 5.574   3.314   105.413 1.00 31.46  ? 690  ILE C CA    1 
ATOM   8995  C  C     . ILE C 2  690  ? 6.007   4.206   106.571 1.00 32.11  ? 690  ILE C C     1 
ATOM   8996  O  O     . ILE C 2  690  ? 5.760   5.414   106.590 1.00 30.07  ? 690  ILE C O     1 
ATOM   8997  C  CB    . ILE C 2  690  ? 6.765   3.093   104.459 1.00 29.97  ? 690  ILE C CB    1 
ATOM   8998  C  CG1   . ILE C 2  690  ? 7.326   4.438   104.002 1.00 25.99  ? 690  ILE C CG1   1 
ATOM   8999  C  CG2   . ILE C 2  690  ? 6.349   2.243   103.273 1.00 30.41  ? 690  ILE C CG2   1 
ATOM   9000  C  CD1   . ILE C 2  690  ? 8.700   4.337   103.400 1.00 32.59  ? 690  ILE C CD1   1 
ATOM   9001  N  N     . SER C 2  691  ? 6.688   3.585   107.535 1.00 32.44  ? 691  SER C N     1 
ATOM   9002  C  CA    . SER C 2  691  ? 7.235   4.282   108.692 1.00 33.56  ? 691  SER C CA    1 
ATOM   9003  C  C     . SER C 2  691  ? 8.620   4.833   108.377 1.00 37.27  ? 691  SER C C     1 
ATOM   9004  O  O     . SER C 2  691  ? 9.444   4.157   107.751 1.00 34.87  ? 691  SER C O     1 
ATOM   9005  C  CB    . SER C 2  691  ? 7.312   3.337   109.896 1.00 40.69  ? 691  SER C CB    1 
ATOM   9006  O  OG    . SER C 2  691  ? 7.897   3.966   111.028 1.00 41.48  ? 691  SER C OG    1 
ATOM   9007  N  N     . GLU C 2  692  ? 8.873   6.066   108.828 1.00 32.48  ? 692  GLU C N     1 
ATOM   9008  C  CA    . GLU C 2  692  ? 10.182  6.681   108.632 1.00 33.27  ? 692  GLU C CA    1 
ATOM   9009  C  C     . GLU C 2  692  ? 11.301  5.864   109.265 1.00 40.04  ? 692  GLU C C     1 
ATOM   9010  O  O     . GLU C 2  692  ? 12.456  5.981   108.839 1.00 37.36  ? 692  GLU C O     1 
ATOM   9011  C  CB    . GLU C 2  692  ? 10.179  8.102   109.197 1.00 31.56  ? 692  GLU C CB    1 
ATOM   9012  C  CG    . GLU C 2  692  ? 11.344  8.971   108.746 1.00 30.72  ? 692  GLU C CG    1 
ATOM   9013  C  CD    . GLU C 2  692  ? 11.248  10.394  109.274 1.00 44.58  ? 692  GLU C CD    1 
ATOM   9014  O  OE1   . GLU C 2  692  ? 11.046  10.567  110.496 1.00 50.24  ? 692  GLU C OE1   1 
ATOM   9015  O  OE2   . GLU C 2  692  ? 11.362  11.340  108.467 1.00 45.46  ? 692  GLU C OE2   1 
ATOM   9016  N  N     . GLU C 2  693  ? 10.980  5.036   110.267 1.00 39.54  ? 693  GLU C N     1 
ATOM   9017  C  CA    . GLU C 2  693  ? 11.969  4.136   110.854 1.00 39.28  ? 693  GLU C CA    1 
ATOM   9018  C  C     . GLU C 2  693  ? 12.661  3.287   109.799 1.00 42.11  ? 693  GLU C C     1 
ATOM   9019  O  O     . GLU C 2  693  ? 13.844  2.954   109.947 1.00 46.08  ? 693  GLU C O     1 
ATOM   9020  C  CB    . GLU C 2  693  ? 11.306  3.227   111.890 1.00 44.72  ? 693  GLU C CB    1 
ATOM   9021  C  CG    . GLU C 2  693  ? 10.907  3.923   113.177 1.00 51.35  ? 693  GLU C CG    1 
ATOM   9022  C  CD    . GLU C 2  693  ? 12.107  4.382   113.987 1.00 57.90  ? 693  GLU C CD    1 
ATOM   9023  O  OE1   . GLU C 2  693  ? 12.065  5.508   114.530 1.00 55.47  ? 693  GLU C OE1   1 
ATOM   9024  O  OE2   . GLU C 2  693  ? 13.094  3.619   114.076 1.00 64.36  ? 693  GLU C OE2   1 
ATOM   9025  N  N     . LEU C 2  694  ? 11.941  2.925   108.732 1.00 40.85  ? 694  LEU C N     1 
ATOM   9026  C  CA    . LEU C 2  694  ? 12.532  2.126   107.663 1.00 39.40  ? 694  LEU C CA    1 
ATOM   9027  C  C     . LEU C 2  694  ? 13.740  2.826   107.049 1.00 39.65  ? 694  LEU C C     1 
ATOM   9028  O  O     . LEU C 2  694  ? 14.728  2.174   106.691 1.00 40.63  ? 694  LEU C O     1 
ATOM   9029  C  CB    . LEU C 2  694  ? 11.483  1.823   106.593 1.00 33.97  ? 694  LEU C CB    1 
ATOM   9030  C  CG    . LEU C 2  694  ? 10.395  0.803   106.935 1.00 31.98  ? 694  LEU C CG    1 
ATOM   9031  C  CD1   . LEU C 2  694  ? 9.379   0.738   105.815 1.00 34.23  ? 694  LEU C CD1   1 
ATOM   9032  C  CD2   . LEU C 2  694  ? 10.993  -0.568  107.182 1.00 29.96  ? 694  LEU C CD2   1 
ATOM   9033  N  N     . LEU C 2  695  ? 13.683  4.153   106.923 1.00 38.71  ? 695  LEU C N     1 
ATOM   9034  C  CA    . LEU C 2  695  ? 14.845  4.887   106.434 1.00 39.58  ? 695  LEU C CA    1 
ATOM   9035  C  C     . LEU C 2  695  ? 15.899  5.052   107.518 1.00 40.53  ? 695  LEU C C     1 
ATOM   9036  O  O     . LEU C 2  695  ? 17.094  5.127   107.210 1.00 42.53  ? 695  LEU C O     1 
ATOM   9037  C  CB    . LEU C 2  695  ? 14.430  6.260   105.902 1.00 31.06  ? 695  LEU C CB    1 
ATOM   9038  C  CG    . LEU C 2  695  ? 13.198  6.306   104.997 1.00 29.34  ? 695  LEU C CG    1 
ATOM   9039  C  CD1   . LEU C 2  695  ? 13.014  7.691   104.400 1.00 25.33  ? 695  LEU C CD1   1 
ATOM   9040  C  CD2   . LEU C 2  695  ? 13.276  5.251   103.905 1.00 31.50  ? 695  LEU C CD2   1 
ATOM   9041  N  N     . LYS C 2  696  ? 15.480  5.101   108.784 1.00 43.25  ? 696  LYS C N     1 
ATOM   9042  C  CA    . LYS C 2  696  ? 16.436  5.317   109.864 1.00 45.57  ? 696  LYS C CA    1 
ATOM   9043  C  C     . LYS C 2  696  ? 17.384  4.134   110.001 1.00 44.64  ? 696  LYS C C     1 
ATOM   9044  O  O     . LYS C 2  696  ? 18.595  4.321   110.170 1.00 50.24  ? 696  LYS C O     1 
ATOM   9045  C  CB    . LYS C 2  696  ? 15.700  5.578   111.177 1.00 44.29  ? 696  LYS C CB    1 
ATOM   9046  C  CG    . LYS C 2  696  ? 14.832  6.821   111.157 1.00 41.19  ? 696  LYS C CG    1 
ATOM   9047  C  CD    . LYS C 2  696  ? 14.014  6.943   112.430 1.00 45.79  ? 696  LYS C CD    1 
ATOM   9048  C  CE    . LYS C 2  696  ? 13.004  8.076   112.330 1.00 45.46  ? 696  LYS C CE    1 
ATOM   9049  N  NZ    . LYS C 2  696  ? 12.024  8.049   113.448 1.00 40.09  ? 696  LYS C NZ    1 
ATOM   9050  N  N     . ARG C 2  697  ? 16.860  2.913   109.927 1.00 42.65  ? 697  ARG C N     1 
ATOM   9051  C  CA    . ARG C 2  697  ? 17.702  1.728   109.968 1.00 49.54  ? 697  ARG C CA    1 
ATOM   9052  C  C     . ARG C 2  697  ? 18.049  1.214   108.577 1.00 47.67  ? 697  ARG C C     1 
ATOM   9053  O  O     . ARG C 2  697  ? 18.479  0.064   108.444 1.00 50.51  ? 697  ARG C O     1 
ATOM   9054  C  CB    . ARG C 2  697  ? 17.042  0.628   110.807 1.00 54.05  ? 697  ARG C CB    1 
ATOM   9055  C  CG    . ARG C 2  697  ? 15.662  0.165   110.364 1.00 46.33  ? 697  ARG C CG    1 
ATOM   9056  C  CD    . ARG C 2  697  ? 15.095  -0.775  111.425 1.00 46.54  ? 697  ARG C CD    1 
ATOM   9057  N  NE    . ARG C 2  697  ? 13.953  -1.564  110.971 1.00 44.83  ? 697  ARG C NE    1 
ATOM   9058  C  CZ    . ARG C 2  697  ? 12.684  -1.194  111.113 1.00 44.05  ? 697  ARG C CZ    1 
ATOM   9059  N  NH1   . ARG C 2  697  ? 12.388  -0.036  111.688 1.00 49.40  ? 697  ARG C NH1   1 
ATOM   9060  N  NH2   . ARG C 2  697  ? 11.709  -1.981  110.681 1.00 40.51  ? 697  ARG C NH2   1 
ATOM   9061  N  N     . ASP C 2  698  ? 17.870  2.047   107.548 1.00 45.73  ? 698  ASP C N     1 
ATOM   9062  C  CA    . ASP C 2  698  ? 18.295  1.758   106.175 1.00 45.14  ? 698  ASP C CA    1 
ATOM   9063  C  C     . ASP C 2  698  ? 17.645  0.499   105.613 1.00 41.36  ? 698  ASP C C     1 
ATOM   9064  O  O     . ASP C 2  698  ? 18.267  -0.240  104.845 1.00 39.89  ? 698  ASP C O     1 
ATOM   9065  C  CB    . ASP C 2  698  ? 19.819  1.659   106.062 1.00 40.93  ? 698  ASP C CB    1 
ATOM   9066  C  CG    . ASP C 2  698  ? 20.478  3.012   105.886 1.00 45.96  ? 698  ASP C CG    1 
ATOM   9067  O  OD1   . ASP C 2  698  ? 20.432  3.556   104.762 1.00 40.93  ? 698  ASP C OD1   1 
ATOM   9068  O  OD2   . ASP C 2  698  ? 21.027  3.539   106.876 1.00 55.30  ? 698  ASP C OD2   1 
ATOM   9069  N  N     . PHE C 2  699  ? 16.394  0.240   105.980 1.00 37.74  ? 699  PHE C N     1 
ATOM   9070  C  CA    . PHE C 2  699  ? 15.636  -0.796  105.298 1.00 37.35  ? 699  PHE C CA    1 
ATOM   9071  C  C     . PHE C 2  699  ? 15.218  -0.298  103.920 1.00 38.05  ? 699  PHE C C     1 
ATOM   9072  O  O     . PHE C 2  699  ? 14.851  0.869   103.753 1.00 37.36  ? 699  PHE C O     1 
ATOM   9073  C  CB    . PHE C 2  699  ? 14.415  -1.201  106.123 1.00 38.33  ? 699  PHE C CB    1 
ATOM   9074  C  CG    . PHE C 2  699  ? 14.670  -2.351  107.060 1.00 37.30  ? 699  PHE C CG    1 
ATOM   9075  C  CD1   . PHE C 2  699  ? 15.959  -2.788  107.303 1.00 33.74  ? 699  PHE C CD1   1 
ATOM   9076  C  CD2   . PHE C 2  699  ? 13.621  -3.008  107.679 1.00 40.41  ? 699  PHE C CD2   1 
ATOM   9077  C  CE1   . PHE C 2  699  ? 16.197  -3.849  108.154 1.00 34.39  ? 699  PHE C CE1   1 
ATOM   9078  C  CE2   . PHE C 2  699  ? 13.857  -4.074  108.529 1.00 38.16  ? 699  PHE C CE2   1 
ATOM   9079  C  CZ    . PHE C 2  699  ? 15.146  -4.493  108.765 1.00 31.60  ? 699  PHE C CZ    1 
ATOM   9080  N  N     . TYR C 2  700  ? 15.296  -1.187  102.927 1.00 38.53  ? 700  TYR C N     1 
ATOM   9081  C  CA    . TYR C 2  700  ? 15.018  -0.847  101.531 1.00 32.63  ? 700  TYR C CA    1 
ATOM   9082  C  C     . TYR C 2  700  ? 15.923  0.288   101.060 1.00 35.27  ? 700  TYR C C     1 
ATOM   9083  O  O     . TYR C 2  700  ? 15.466  1.310   100.545 1.00 39.58  ? 700  TYR C O     1 
ATOM   9084  C  CB    . TYR C 2  700  ? 13.544  -0.488  101.321 1.00 40.48  ? 700  TYR C CB    1 
ATOM   9085  C  CG    . TYR C 2  700  ? 12.583  -1.567  101.745 1.00 43.95  ? 700  TYR C CG    1 
ATOM   9086  C  CD1   . TYR C 2  700  ? 12.583  -2.807  101.120 1.00 38.25  ? 700  TYR C CD1   1 
ATOM   9087  C  CD2   . TYR C 2  700  ? 11.680  -1.351  102.778 1.00 37.55  ? 700  TYR C CD2   1 
ATOM   9088  C  CE1   . TYR C 2  700  ? 11.710  -3.798  101.505 1.00 35.68  ? 700  TYR C CE1   1 
ATOM   9089  C  CE2   . TYR C 2  700  ? 10.801  -2.338  103.170 1.00 36.49  ? 700  TYR C CE2   1 
ATOM   9090  C  CZ    . TYR C 2  700  ? 10.821  -3.559  102.529 1.00 36.40  ? 700  TYR C CZ    1 
ATOM   9091  O  OH    . TYR C 2  700  ? 9.951   -4.547  102.915 1.00 36.26  ? 700  TYR C OH    1 
ATOM   9092  N  N     . THR C 2  701  ? 17.223  0.108   101.267 1.00 37.84  ? 701  THR C N     1 
ATOM   9093  C  CA    . THR C 2  701  ? 18.243  1.026   100.779 1.00 39.51  ? 701  THR C CA    1 
ATOM   9094  C  C     . THR C 2  701  ? 19.190  0.243   99.882  1.00 33.40  ? 701  THR C C     1 
ATOM   9095  O  O     . THR C 2  701  ? 19.674  -0.826  100.268 1.00 34.38  ? 701  THR C O     1 
ATOM   9096  C  CB    . THR C 2  701  ? 19.007  1.683   101.935 1.00 39.98  ? 701  THR C CB    1 
ATOM   9097  O  OG1   . THR C 2  701  ? 18.098  2.449   102.739 1.00 40.42  ? 701  THR C OG1   1 
ATOM   9098  C  CG2   . THR C 2  701  ? 20.103  2.597   101.403 1.00 34.00  ? 701  THR C CG2   1 
ATOM   9099  N  N     . SER C 2  702  ? 19.443  0.760   98.686  1.00 30.84  ? 702  SER C N     1 
ATOM   9100  C  CA    . SER C 2  702  ? 20.165  -0.003  97.682  1.00 32.16  ? 702  SER C CA    1 
ATOM   9101  C  C     . SER C 2  702  ? 21.290  0.826   97.081  1.00 38.66  ? 702  SER C C     1 
ATOM   9102  O  O     . SER C 2  702  ? 21.249  2.057   97.082  1.00 38.96  ? 702  SER C O     1 
ATOM   9103  C  CB    . SER C 2  702  ? 19.216  -0.475  96.585  1.00 32.40  ? 702  SER C CB    1 
ATOM   9104  O  OG    . SER C 2  702  ? 18.359  0.580   96.190  1.00 30.65  ? 702  SER C OG    1 
ATOM   9105  N  N     . ILE C 2  703  ? 22.304  0.135   96.570  1.00 40.46  ? 703  ILE C N     1 
ATOM   9106  C  CA    . ILE C 2  703  ? 23.431  0.766   95.892  1.00 33.07  ? 703  ILE C CA    1 
ATOM   9107  C  C     . ILE C 2  703  ? 23.231  0.610   94.395  1.00 35.47  ? 703  ILE C C     1 
ATOM   9108  O  O     . ILE C 2  703  ? 22.916  -0.487  93.916  1.00 38.47  ? 703  ILE C O     1 
ATOM   9109  C  CB    . ILE C 2  703  ? 24.767  0.144   96.327  1.00 33.77  ? 703  ILE C CB    1 
ATOM   9110  C  CG1   . ILE C 2  703  ? 24.922  0.198   97.846  1.00 39.64  ? 703  ILE C CG1   1 
ATOM   9111  C  CG2   . ILE C 2  703  ? 25.920  0.859   95.661  1.00 37.17  ? 703  ILE C CG2   1 
ATOM   9112  C  CD1   . ILE C 2  703  ? 26.183  -0.462  98.342  1.00 37.37  ? 703  ILE C CD1   1 
ATOM   9113  N  N     . HIS C 2  704  ? 23.423  1.696   93.650  1.00 37.52  ? 704  HIS C N     1 
ATOM   9114  C  CA    . HIS C 2  704  ? 23.288  1.668   92.200  1.00 36.71  ? 704  HIS C CA    1 
ATOM   9115  C  C     . HIS C 2  704  ? 24.464  2.396   91.572  1.00 42.54  ? 704  HIS C C     1 
ATOM   9116  O  O     . HIS C 2  704  ? 24.784  3.517   91.974  1.00 47.86  ? 704  HIS C O     1 
ATOM   9117  C  CB    . HIS C 2  704  ? 21.975  2.311   91.758  1.00 41.57  ? 704  HIS C CB    1 
ATOM   9118  C  CG    . HIS C 2  704  ? 20.765  1.693   92.380  1.00 37.47  ? 704  HIS C CG    1 
ATOM   9119  N  ND1   . HIS C 2  704  ? 20.038  0.698   91.763  1.00 37.36  ? 704  HIS C ND1   1 
ATOM   9120  C  CD2   . HIS C 2  704  ? 20.156  1.924   93.567  1.00 33.74  ? 704  HIS C CD2   1 
ATOM   9121  C  CE1   . HIS C 2  704  ? 19.031  0.346   92.541  1.00 37.30  ? 704  HIS C CE1   1 
ATOM   9122  N  NE2   . HIS C 2  704  ? 19.079  1.076   93.641  1.00 36.62  ? 704  HIS C NE2   1 
ATOM   9123  N  N     . ILE C 2  705  ? 25.095  1.772   90.582  1.00 46.29  ? 705  ILE C N     1 
ATOM   9124  C  CA    . ILE C 2  705  ? 26.243  2.348   89.892  1.00 41.99  ? 705  ILE C CA    1 
ATOM   9125  C  C     . ILE C 2  705  ? 25.842  2.652   88.456  1.00 43.31  ? 705  ILE C C     1 
ATOM   9126  O  O     . ILE C 2  705  ? 25.203  1.827   87.792  1.00 46.22  ? 705  ILE C O     1 
ATOM   9127  C  CB    . ILE C 2  705  ? 27.461  1.410   89.945  1.00 39.29  ? 705  ILE C CB    1 
ATOM   9128  C  CG1   . ILE C 2  705  ? 27.812  1.087   91.399  1.00 39.46  ? 705  ILE C CG1   1 
ATOM   9129  C  CG2   . ILE C 2  705  ? 28.649  2.041   89.245  1.00 40.73  ? 705  ILE C CG2   1 
ATOM   9130  C  CD1   . ILE C 2  705  ? 29.045  0.230   91.553  1.00 45.04  ? 705  ILE C CD1   1 
ATOM   9131  N  N     . GLU C 2  706  ? 26.208  3.841   87.987  1.00 43.78  ? 706  GLU C N     1 
ATOM   9132  C  CA    . GLU C 2  706  ? 25.951  4.285   86.627  1.00 46.32  ? 706  GLU C CA    1 
ATOM   9133  C  C     . GLU C 2  706  ? 27.276  4.534   85.922  1.00 47.36  ? 706  GLU C C     1 
ATOM   9134  O  O     . GLU C 2  706  ? 28.243  5.000   86.540  1.00 53.30  ? 706  GLU C O     1 
ATOM   9135  C  CB    . GLU C 2  706  ? 25.102  5.561   86.614  1.00 51.37  ? 706  GLU C CB    1 
ATOM   9136  C  CG    . GLU C 2  706  ? 24.615  5.954   85.235  1.00 53.16  ? 706  GLU C CG    1 
ATOM   9137  C  CD    . GLU C 2  706  ? 23.726  4.895   84.619  1.00 60.95  ? 706  GLU C CD    1 
ATOM   9138  O  OE1   . GLU C 2  706  ? 22.690  4.560   85.235  1.00 69.97  ? 706  GLU C OE1   1 
ATOM   9139  O  OE2   . GLU C 2  706  ? 24.068  4.390   83.528  1.00 58.77  ? 706  GLU C OE2   1 
ATOM   9140  N  N     . ARG C 2  707  ? 27.314  4.226   84.629  1.00 53.51  ? 707  ARG C N     1 
ATOM   9141  C  CA    . ARG C 2  707  ? 28.511  4.362   83.810  1.00 53.93  ? 707  ARG C CA    1 
ATOM   9142  C  C     . ARG C 2  707  ? 28.355  5.548   82.866  1.00 49.14  ? 707  ARG C C     1 
ATOM   9143  O  O     . ARG C 2  707  ? 27.323  5.684   82.200  1.00 44.48  ? 707  ARG C O     1 
ATOM   9144  C  CB    . ARG C 2  707  ? 28.769  3.081   83.011  1.00 54.27  ? 707  ARG C CB    1 
ATOM   9145  C  CG    . ARG C 2  707  ? 30.180  2.969   82.470  1.00 59.19  ? 707  ARG C CG    1 
ATOM   9146  C  CD    . ARG C 2  707  ? 30.387  1.689   81.676  1.00 66.22  ? 707  ARG C CD    1 
ATOM   9147  N  NE    . ARG C 2  707  ? 30.028  1.854   80.270  1.00 79.43  ? 707  ARG C NE    1 
ATOM   9148  C  CZ    . ARG C 2  707  ? 30.516  1.108   79.284  1.00 84.85  ? 707  ARG C CZ    1 
ATOM   9149  N  NH1   . ARG C 2  707  ? 31.392  0.146   79.548  1.00 82.88  ? 707  ARG C NH1   1 
ATOM   9150  N  NH2   . ARG C 2  707  ? 30.135  1.327   78.032  1.00 86.26  ? 707  ARG C NH2   1 
ATOM   9151  N  N     . TYR C 2  708  ? 29.376  6.402   82.809  1.00 46.93  ? 708  TYR C N     1 
ATOM   9152  C  CA    . TYR C 2  708  ? 29.413  7.528   81.890  1.00 46.94  ? 708  TYR C CA    1 
ATOM   9153  C  C     . TYR C 2  708  ? 30.668  7.412   81.039  1.00 50.19  ? 708  TYR C C     1 
ATOM   9154  O  O     . TYR C 2  708  ? 31.721  6.997   81.530  1.00 46.93  ? 708  TYR C O     1 
ATOM   9155  C  CB    . TYR C 2  708  ? 29.393  8.859   82.647  1.00 40.10  ? 708  TYR C CB    1 
ATOM   9156  C  CG    . TYR C 2  708  ? 28.205  9.007   83.572  1.00 43.51  ? 708  TYR C CG    1 
ATOM   9157  C  CD1   . TYR C 2  708  ? 28.210  8.433   84.837  1.00 52.78  ? 708  TYR C CD1   1 
ATOM   9158  C  CD2   . TYR C 2  708  ? 27.078  9.721   83.184  1.00 43.18  ? 708  TYR C CD2   1 
ATOM   9159  C  CE1   . TYR C 2  708  ? 27.128  8.561   85.688  1.00 50.42  ? 708  TYR C CE1   1 
ATOM   9160  C  CE2   . TYR C 2  708  ? 25.990  9.855   84.030  1.00 42.98  ? 708  TYR C CE2   1 
ATOM   9161  C  CZ    . TYR C 2  708  ? 26.022  9.273   85.282  1.00 49.47  ? 708  TYR C CZ    1 
ATOM   9162  O  OH    . TYR C 2  708  ? 24.953  9.395   86.138  1.00 59.40  ? 708  TYR C OH    1 
ATOM   9163  N  N     . GLU C 2  709  ? 30.560  7.771   79.762  1.00 49.27  ? 709  GLU C N     1 
ATOM   9164  C  CA    . GLU C 2  709  ? 31.628  7.486   78.815  1.00 50.37  ? 709  GLU C CA    1 
ATOM   9165  C  C     . GLU C 2  709  ? 31.794  8.650   77.851  1.00 48.14  ? 709  GLU C C     1 
ATOM   9166  O  O     . GLU C 2  709  ? 30.807  9.205   77.362  1.00 47.98  ? 709  GLU C O