data_6KSF
# 
_entry.id   6KSF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.327 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6KSF         
WWPDB D_1300013559 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6KSF 
_pdbx_database_status.recvd_initial_deposition_date   2019-08-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, H.'    1 0000-0001-6741-293X 
'Zhang, M.' 2 0000-0002-6042-7036 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CN 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Cell Res.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1001-0602 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            30 
_citation.language                  ? 
_citation.page_first                197 
_citation.page_last                 210 
_citation.title                     'Mammalian ALKBH1 serves as an N6-mA demethylase of unpairing DNA.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41422-019-0237-5 
_citation.pdbx_database_id_PubMed   32051560 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhang, M.'     1  ?                   
primary 'Yang, S.'      2  ?                   
primary 'Nelakanti, R.' 3  ?                   
primary 'Zhao, W.'      4  ?                   
primary 'Liu, G.'       5  ?                   
primary 'Li, Z.'        6  ?                   
primary 'Liu, X.'       7  ?                   
primary 'Wu, T.'        8  ?                   
primary 'Xiao, A.'      9  ?                   
primary 'Li, H.'        10 0000-0001-6741-293X 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6KSF 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     67.482 
_cell.length_a_esd                 ? 
_cell.length_b                     67.482 
_cell.length_b_esd                 ? 
_cell.length_c                     263.641 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6KSF 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Alpha-ketoglutarate-dependent dioxygenase alkB homolog 1'                                                       
38087.344 1  ? ? BRD4-Bromo2             ? 
2 polymer     syn 
;DNA (5'-D(*DGP*DCP*DTP*DGP*DAP*DGP*DTP*DGP*DCP*DCP*DCP*DGP*DCP*DGP*DTP*DGP*DCP*DTP*DGP*DGP*DAP*DTP*DCP*DC)-3')
;
7378.727  1  ? ? 'histone H2A.Z peptide' ? 
3 polymer     syn 
;DNA (5'-D(*DGP*DGP*DAP*DTP*DCP*DCP*DAP*DGP*DCP*DAP*DCP*DGP*DCP*DCP*DAP*DCP*DTP*DCP*DAP*DGP*DC)-3')
;
6378.126  1  ? ? ?                       ? 
4 non-polymer syn 'CHLORIDE ION'                                                                                                   
35.453    2  ? ? ?                       ? 
5 non-polymer syn 'SUCCINIC ACID'                                                                                                  
118.088   1  ? ? ?                       ? 
6 non-polymer syn propane-1-thiol                                                                                                  
76.161    1  ? ? ?                       ? 
7 water       nat water                                                                                                            
18.015    63 ? ? ?                       ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;EDAFRKLFRFYRQSRPGTADLGAVIDFSEAHLARSPKPGVPQVVRFPLNVSSVTERDAERVGLEPVSKWRAYGLEGYPGF
IFIPNPFLPGCQRHWVKQCLKLYSQKPNVSNLDKHMTKEETQGLWEQSKEVLRSKEVTKRRPRSLLERLRWVTLGYHYNW
DSKKYSADHYTPFPSDLAFLSEQVATACGFQGFQAEAGILNYYRLDSTLGIHVDRCELDHSKPLLSFSFGQSAIFLLGGL
KRDEAPTAMFMHSGDIMVMSGFSRLLNHAVPRVLPHPDGESLPHSLETPLPAVLPSNSLVEPSSVEDWQVCATYLRTARV
NMTVRQVLATGQDFPL
;
;EDAFRKLFRFYRQSRPGTADLGAVIDFSEAHLARSPKPGVPQVVRFPLNVSSVTERDAERVGLEPVSKWRAYGLEGYPGF
IFIPNPFLPGCQRHWVKQCLKLYSQKPNVSNLDKHMTKEETQGLWEQSKEVLRSKEVTKRRPRSLLERLRWVTLGYHYNW
DSKKYSADHYTPFPSDLAFLSEQVATACGFQGFQAEAGILNYYRLDSTLGIHVDRCELDHSKPLLSFSFGQSAIFLLGGL
KRDEAPTAMFMHSGDIMVMSGFSRLLNHAVPRVLPHPDGESLPHSLETPLPAVLPSNSLVEPSSVEDWQVCATYLRTARV
NMTVRQVLATGQDFPL
;
A ? 
2 polydeoxyribonucleotide no no 
;(DG)(DC)(DT)(DG)(DA)(DG)(DT)(DG)(DC)(DC)(DC)(DG)(DC)(DG)(DT)(DG)(DC)(DT)(DG)(DG)
(DA)(DT)(DC)(DC)
;
GCTGAGTGCCCGCGTGCTGGATCC B ? 
3 polydeoxyribonucleotide no no 
;(DG)(DG)(DA)(DT)(DC)(DC)(DA)(DG)(DC)(DA)(DC)(DG)(DC)(DC)(DA)(DC)(DT)(DC)(DA)(DG)
(DC)
;
GGATCCAGCACGCCACTCAGC C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ASP n 
1 3   ALA n 
1 4   PHE n 
1 5   ARG n 
1 6   LYS n 
1 7   LEU n 
1 8   PHE n 
1 9   ARG n 
1 10  PHE n 
1 11  TYR n 
1 12  ARG n 
1 13  GLN n 
1 14  SER n 
1 15  ARG n 
1 16  PRO n 
1 17  GLY n 
1 18  THR n 
1 19  ALA n 
1 20  ASP n 
1 21  LEU n 
1 22  GLY n 
1 23  ALA n 
1 24  VAL n 
1 25  ILE n 
1 26  ASP n 
1 27  PHE n 
1 28  SER n 
1 29  GLU n 
1 30  ALA n 
1 31  HIS n 
1 32  LEU n 
1 33  ALA n 
1 34  ARG n 
1 35  SER n 
1 36  PRO n 
1 37  LYS n 
1 38  PRO n 
1 39  GLY n 
1 40  VAL n 
1 41  PRO n 
1 42  GLN n 
1 43  VAL n 
1 44  VAL n 
1 45  ARG n 
1 46  PHE n 
1 47  PRO n 
1 48  LEU n 
1 49  ASN n 
1 50  VAL n 
1 51  SER n 
1 52  SER n 
1 53  VAL n 
1 54  THR n 
1 55  GLU n 
1 56  ARG n 
1 57  ASP n 
1 58  ALA n 
1 59  GLU n 
1 60  ARG n 
1 61  VAL n 
1 62  GLY n 
1 63  LEU n 
1 64  GLU n 
1 65  PRO n 
1 66  VAL n 
1 67  SER n 
1 68  LYS n 
1 69  TRP n 
1 70  ARG n 
1 71  ALA n 
1 72  TYR n 
1 73  GLY n 
1 74  LEU n 
1 75  GLU n 
1 76  GLY n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  ILE n 
1 82  PHE n 
1 83  ILE n 
1 84  PRO n 
1 85  ASN n 
1 86  PRO n 
1 87  PHE n 
1 88  LEU n 
1 89  PRO n 
1 90  GLY n 
1 91  CYS n 
1 92  GLN n 
1 93  ARG n 
1 94  HIS n 
1 95  TRP n 
1 96  VAL n 
1 97  LYS n 
1 98  GLN n 
1 99  CYS n 
1 100 LEU n 
1 101 LYS n 
1 102 LEU n 
1 103 TYR n 
1 104 SER n 
1 105 GLN n 
1 106 LYS n 
1 107 PRO n 
1 108 ASN n 
1 109 VAL n 
1 110 SER n 
1 111 ASN n 
1 112 LEU n 
1 113 ASP n 
1 114 LYS n 
1 115 HIS n 
1 116 MET n 
1 117 THR n 
1 118 LYS n 
1 119 GLU n 
1 120 GLU n 
1 121 THR n 
1 122 GLN n 
1 123 GLY n 
1 124 LEU n 
1 125 TRP n 
1 126 GLU n 
1 127 GLN n 
1 128 SER n 
1 129 LYS n 
1 130 GLU n 
1 131 VAL n 
1 132 LEU n 
1 133 ARG n 
1 134 SER n 
1 135 LYS n 
1 136 GLU n 
1 137 VAL n 
1 138 THR n 
1 139 LYS n 
1 140 ARG n 
1 141 ARG n 
1 142 PRO n 
1 143 ARG n 
1 144 SER n 
1 145 LEU n 
1 146 LEU n 
1 147 GLU n 
1 148 ARG n 
1 149 LEU n 
1 150 ARG n 
1 151 TRP n 
1 152 VAL n 
1 153 THR n 
1 154 LEU n 
1 155 GLY n 
1 156 TYR n 
1 157 HIS n 
1 158 TYR n 
1 159 ASN n 
1 160 TRP n 
1 161 ASP n 
1 162 SER n 
1 163 LYS n 
1 164 LYS n 
1 165 TYR n 
1 166 SER n 
1 167 ALA n 
1 168 ASP n 
1 169 HIS n 
1 170 TYR n 
1 171 THR n 
1 172 PRO n 
1 173 PHE n 
1 174 PRO n 
1 175 SER n 
1 176 ASP n 
1 177 LEU n 
1 178 ALA n 
1 179 PHE n 
1 180 LEU n 
1 181 SER n 
1 182 GLU n 
1 183 GLN n 
1 184 VAL n 
1 185 ALA n 
1 186 THR n 
1 187 ALA n 
1 188 CYS n 
1 189 GLY n 
1 190 PHE n 
1 191 GLN n 
1 192 GLY n 
1 193 PHE n 
1 194 GLN n 
1 195 ALA n 
1 196 GLU n 
1 197 ALA n 
1 198 GLY n 
1 199 ILE n 
1 200 LEU n 
1 201 ASN n 
1 202 TYR n 
1 203 TYR n 
1 204 ARG n 
1 205 LEU n 
1 206 ASP n 
1 207 SER n 
1 208 THR n 
1 209 LEU n 
1 210 GLY n 
1 211 ILE n 
1 212 HIS n 
1 213 VAL n 
1 214 ASP n 
1 215 ARG n 
1 216 CYS n 
1 217 GLU n 
1 218 LEU n 
1 219 ASP n 
1 220 HIS n 
1 221 SER n 
1 222 LYS n 
1 223 PRO n 
1 224 LEU n 
1 225 LEU n 
1 226 SER n 
1 227 PHE n 
1 228 SER n 
1 229 PHE n 
1 230 GLY n 
1 231 GLN n 
1 232 SER n 
1 233 ALA n 
1 234 ILE n 
1 235 PHE n 
1 236 LEU n 
1 237 LEU n 
1 238 GLY n 
1 239 GLY n 
1 240 LEU n 
1 241 LYS n 
1 242 ARG n 
1 243 ASP n 
1 244 GLU n 
1 245 ALA n 
1 246 PRO n 
1 247 THR n 
1 248 ALA n 
1 249 MET n 
1 250 PHE n 
1 251 MET n 
1 252 HIS n 
1 253 SER n 
1 254 GLY n 
1 255 ASP n 
1 256 ILE n 
1 257 MET n 
1 258 VAL n 
1 259 MET n 
1 260 SER n 
1 261 GLY n 
1 262 PHE n 
1 263 SER n 
1 264 ARG n 
1 265 LEU n 
1 266 LEU n 
1 267 ASN n 
1 268 HIS n 
1 269 ALA n 
1 270 VAL n 
1 271 PRO n 
1 272 ARG n 
1 273 VAL n 
1 274 LEU n 
1 275 PRO n 
1 276 HIS n 
1 277 PRO n 
1 278 ASP n 
1 279 GLY n 
1 280 GLU n 
1 281 SER n 
1 282 LEU n 
1 283 PRO n 
1 284 HIS n 
1 285 SER n 
1 286 LEU n 
1 287 GLU n 
1 288 THR n 
1 289 PRO n 
1 290 LEU n 
1 291 PRO n 
1 292 ALA n 
1 293 VAL n 
1 294 LEU n 
1 295 PRO n 
1 296 SER n 
1 297 ASN n 
1 298 SER n 
1 299 LEU n 
1 300 VAL n 
1 301 GLU n 
1 302 PRO n 
1 303 SER n 
1 304 SER n 
1 305 VAL n 
1 306 GLU n 
1 307 ASP n 
1 308 TRP n 
1 309 GLN n 
1 310 VAL n 
1 311 CYS n 
1 312 ALA n 
1 313 THR n 
1 314 TYR n 
1 315 LEU n 
1 316 ARG n 
1 317 THR n 
1 318 ALA n 
1 319 ARG n 
1 320 VAL n 
1 321 ASN n 
1 322 MET n 
1 323 THR n 
1 324 VAL n 
1 325 ARG n 
1 326 GLN n 
1 327 VAL n 
1 328 LEU n 
1 329 ALA n 
1 330 THR n 
1 331 GLY n 
1 332 GLN n 
1 333 ASP n 
1 334 PHE n 
1 335 PRO n 
1 336 LEU n 
2 1   DG  n 
2 2   DC  n 
2 3   DT  n 
2 4   DG  n 
2 5   DA  n 
2 6   DG  n 
2 7   DT  n 
2 8   DG  n 
2 9   DC  n 
2 10  DC  n 
2 11  DC  n 
2 12  DG  n 
2 13  DC  n 
2 14  DG  n 
2 15  DT  n 
2 16  DG  n 
2 17  DC  n 
2 18  DT  n 
2 19  DG  n 
2 20  DG  n 
2 21  DA  n 
2 22  DT  n 
2 23  DC  n 
2 24  DC  n 
3 1   DG  n 
3 2   DG  n 
3 3   DA  n 
3 4   DT  n 
3 5   DC  n 
3 6   DC  n 
3 7   DA  n 
3 8   DG  n 
3 9   DC  n 
3 10  DA  n 
3 11  DC  n 
3 12  DG  n 
3 13  DC  n 
3 14  DC  n 
3 15  DA  n 
3 16  DC  n 
3 17  DT  n 
3 18  DC  n 
3 19  DA  n 
3 20  DG  n 
3 21  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   336 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ALKBH1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pRSFDuet 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 24 'Homo sapiens' ? 9606 ? 
3 1 sample 1 21 'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 6KSF 6KSF ? 1 ? 1 
2 PDB 6KSF 6KSF ? 2 ? 1 
3 PDB 6KSF 6KSF ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6KSF A 1 ? 336 ? 6KSF 20 ? 355 ? 20 355 
2 2 6KSF B 1 ? 24  ? 6KSF 1  ? 24  ? 1  24  
3 3 6KSF C 1 ? 21  ? 6KSF 1  ? 21  ? 1  21  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION'                       ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
SIN non-polymer         . 'SUCCINIC ACID'                      ? 'C4 H6 O4'        118.088 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
XL3 non-polymer         . propane-1-thiol                      ? 'C3 H8 S'         76.161  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6KSF 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.89 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.51 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              4.2 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M NaCl, 0.1 M phosphate citrate, pH 4.2,10% PEG3000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             100 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      mirrors 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-06-23 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9791 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9791 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6KSF 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.400 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       24642 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.800 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  8.200 
_reflns.pdbx_Rmerge_I_obs                0.079 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.100 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.779 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.084 
_reflns.pdbx_Rpim_I_all                  0.027 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         202846 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.400 2.440  ? ? ? ? ? ? 1183 97.800 ? ? ? ? 0.716 ? ? ? ? ? ? ? ? 8.600 ? 0.433 ? ? 0.756 0.236 ? 1  1 0.896 ? 
2.440 2.490  ? ? ? ? ? ? 1192 98.300 ? ? ? ? 0.638 ? ? ? ? ? ? ? ? 8.400 ? 0.460 ? ? 0.674 0.211 ? 2  1 0.875 ? 
2.490 2.530  ? ? ? ? ? ? 1188 98.300 ? ? ? ? 0.600 ? ? ? ? ? ? ? ? 8.400 ? 0.438 ? ? 0.635 0.200 ? 3  1 0.904 ? 
2.530 2.590  ? ? ? ? ? ? 1201 98.500 ? ? ? ? 0.526 ? ? ? ? ? ? ? ? 8.200 ? 0.450 ? ? 0.557 0.177 ? 4  1 0.909 ? 
2.590 2.640  ? ? ? ? ? ? 1202 98.400 ? ? ? ? 0.421 ? ? ? ? ? ? ? ? 8.200 ? 0.466 ? ? 0.447 0.143 ? 5  1 0.942 ? 
2.640 2.700  ? ? ? ? ? ? 1204 98.900 ? ? ? ? 0.326 ? ? ? ? ? ? ? ? 7.700 ? 0.479 ? ? 0.346 0.114 ? 6  1 0.959 ? 
2.700 2.770  ? ? ? ? ? ? 1189 98.800 ? ? ? ? 0.314 ? ? ? ? ? ? ? ? 8.400 ? 0.487 ? ? 0.332 0.106 ? 7  1 0.969 ? 
2.770 2.850  ? ? ? ? ? ? 1199 97.600 ? ? ? ? 0.255 ? ? ? ? ? ? ? ? 8.600 ? 0.496 ? ? 0.270 0.084 ? 8  1 0.974 ? 
2.850 2.930  ? ? ? ? ? ? 1231 99.400 ? ? ? ? 0.206 ? ? ? ? ? ? ? ? 8.400 ? 0.510 ? ? 0.218 0.069 ? 9  1 0.980 ? 
2.930 3.020  ? ? ? ? ? ? 1199 99.300 ? ? ? ? 0.157 ? ? ? ? ? ? ? ? 8.500 ? 0.578 ? ? 0.166 0.053 ? 10 1 0.988 ? 
3.020 3.130  ? ? ? ? ? ? 1223 99.300 ? ? ? ? 0.130 ? ? ? ? ? ? ? ? 8.300 ? 0.617 ? ? 0.138 0.044 ? 11 1 0.991 ? 
3.130 3.260  ? ? ? ? ? ? 1234 99.400 ? ? ? ? 0.093 ? ? ? ? ? ? ? ? 7.900 ? 0.776 ? ? 0.099 0.032 ? 12 1 0.996 ? 
3.260 3.410  ? ? ? ? ? ? 1229 98.800 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 8.200 ? 0.940 ? ? 0.080 0.025 ? 13 1 0.997 ? 
3.410 3.580  ? ? ? ? ? ? 1232 99.500 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 8.500 ? 0.998 ? ? 0.078 0.025 ? 14 1 0.996 ? 
3.580 3.810  ? ? ? ? ? ? 1235 99.300 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 8.500 ? 1.005 ? ? 0.072 0.023 ? 15 1 0.997 ? 
3.810 4.100  ? ? ? ? ? ? 1246 99.300 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 8.000 ? 1.189 ? ? 0.066 0.022 ? 16 1 0.997 ? 
4.100 4.520  ? ? ? ? ? ? 1277 99.400 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 8.300 ? 1.289 ? ? 0.060 0.020 ? 17 1 0.998 ? 
4.520 5.170  ? ? ? ? ? ? 1273 99.300 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 8.300 ? 1.289 ? ? 0.055 0.018 ? 18 1 0.998 ? 
5.170 6.510  ? ? ? ? ? ? 1295 98.800 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 8.000 ? 1.192 ? ? 0.056 0.019 ? 19 1 0.998 ? 
6.510 50.000 ? ? ? ? ? ? 1410 97.100 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 7.300 ? 1.400 ? ? 0.051 0.018 ? 20 1 0.998 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                117.330 
_refine.B_iso_mean                               57.3443 
_refine.B_iso_min                                24.680 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6KSF 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.4 
_refine.ls_d_res_low                             32.8880 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     24541 
_refine.ls_number_reflns_R_free                  1203 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.7600 
_refine.ls_percent_reflns_R_free                 4.9000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2302 
_refine.ls_R_factor_R_free                       0.2717 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2281 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.370 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6IMC 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            0 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.0300 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2900 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        32.8880 
_refine_hist.number_atoms_solvent             63 
_refine_hist.number_atoms_total               3661 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       380 
_refine_hist.pdbx_B_iso_mean_ligand           51.28 
_refine_hist.pdbx_B_iso_mean_solvent          48.28 
_refine_hist.pdbx_number_atoms_protein        2672 
_refine_hist.pdbx_number_atoms_nucleic_acid   912 
_refine_hist.pdbx_number_atoms_ligand         14 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.400  2.4980  . . 135 2505 98.0000 . . . 0.3084 0.0000 0.2885 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4980 2.6117  . . 151 2496 98.0000 . . . 0.3679 0.0000 0.2882 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6117 2.7493  . . 134 2520 99.0000 . . . 0.3074 0.0000 0.2739 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7493 2.9214  . . 128 2556 99.0000 . . . 0.3365 0.0000 0.2949 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9214 3.1468  . . 128 2567 99.0000 . . . 0.3148 0.0000 0.2687 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1468 3.4632  . . 126 2594 99.0000 . . . 0.2599 0.0000 0.2373 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4632 3.9636  . . 138 2634 99.0000 . . . 0.2674 0.0000 0.2281 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9636 4.9909  . . 109 2672 99.0000 . . . 0.2400 0.0000 0.1943 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9909 32.8880 . . 154 2794 98.0000 . . . 0.2443 0.0000 0.1990 . . . . . . . . . . 
# 
_struct.entry_id                     6KSF 
_struct.title                        'Crystal Structure of ALKBH1 bound to 21-mer DNA bulge' 
_struct.pdbx_descriptor              'Alpha-ketoglutarate-dependent dioxygenase alkB homolog 1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6KSF 
_struct_keywords.text            'DNA methylation, complex, demethylase, GENE REGULATION' 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
J N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 2   ? GLN A 13  ? ASP A 21  GLN A 32  1 ? 12 
HELX_P HELX_P2  AA2 ASP A 26  ? ALA A 30  ? ASP A 45  ALA A 49  5 ? 5  
HELX_P HELX_P3  AA3 ASN A 49  ? VAL A 53  ? ASN A 68  VAL A 72  5 ? 5  
HELX_P HELX_P4  AA4 THR A 54  ? VAL A 61  ? THR A 73  VAL A 80  1 ? 8  
HELX_P HELX_P5  AA5 PRO A 65  ? TRP A 69  ? PRO A 84  TRP A 88  5 ? 5  
HELX_P HELX_P6  AA6 CYS A 91  ? LYS A 101 ? CYS A 110 LYS A 120 1 ? 11 
HELX_P HELX_P7  AA7 LEU A 112 ? HIS A 115 ? LEU A 131 HIS A 134 5 ? 4  
HELX_P HELX_P8  AA8 THR A 117 ? GLN A 122 ? THR A 136 GLN A 141 1 ? 6  
HELX_P HELX_P9  AA9 GLY A 123 ? SER A 134 ? GLY A 142 SER A 153 1 ? 12 
HELX_P HELX_P10 AB1 SER A 144 ? LEU A 149 ? SER A 163 LEU A 168 1 ? 6  
HELX_P HELX_P11 AB2 PRO A 174 ? CYS A 188 ? PRO A 193 CYS A 207 1 ? 15 
HELX_P HELX_P12 AB3 GLY A 261 ? LEU A 266 ? GLY A 280 LEU A 285 5 ? 6  
HELX_P HELX_P13 AB4 PRO A 283 ? THR A 288 ? PRO A 302 THR A 307 1 ? 6  
HELX_P HELX_P14 AB5 SER A 304 ? ARG A 316 ? SER A 323 ARG A 335 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale none ? A CYS 216 SG ? ? ? 1_555 G XL3 .  SG ? ? A CYS 235 B XL3 101 1_555 ? ? ? ? ? ? ?               2.031 ? 
covale2  covale none ? B DC  10  N4 ? ? ? 1_555 G XL3 .  CA ? ? B DC  10  B XL3 101 1_555 ? ? ? ? ? ? ?               1.430 ? 
hydrog1  hydrog ?    ? B DG  1   N1 ? ? ? 1_555 C DC  21 N3 ? ? B DG  1   C DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2  hydrog ?    ? B DG  1   N2 ? ? ? 1_555 C DC  21 O2 ? ? B DG  1   C DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ?    ? B DG  1   O6 ? ? ? 1_555 C DC  21 N4 ? ? B DG  1   C DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ?    ? B DC  2   N3 ? ? ? 1_555 C DG  20 N1 ? ? B DC  2   C DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ?    ? B DC  2   N4 ? ? ? 1_555 C DG  20 O6 ? ? B DC  2   C DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ?    ? B DC  2   O2 ? ? ? 1_555 C DG  20 N2 ? ? B DC  2   C DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ?    ? B DT  3   N3 ? ? ? 1_555 C DA  19 N1 ? ? B DT  3   C DA  19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ?    ? B DT  3   O4 ? ? ? 1_555 C DA  19 N6 ? ? B DT  3   C DA  19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ?    ? B DG  4   N1 ? ? ? 1_555 C DC  18 N3 ? ? B DG  4   C DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ?    ? B DG  4   N2 ? ? ? 1_555 C DC  18 O2 ? ? B DG  4   C DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ?    ? B DG  4   O6 ? ? ? 1_555 C DC  18 N4 ? ? B DG  4   C DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ?    ? B DA  5   N1 ? ? ? 1_555 C DT  17 N3 ? ? B DA  5   C DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ?    ? B DA  5   N6 ? ? ? 1_555 C DT  17 O4 ? ? B DA  5   C DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ?    ? B DG  6   N1 ? ? ? 1_555 C DC  16 N3 ? ? B DG  6   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ?    ? B DG  6   N2 ? ? ? 1_555 C DC  16 O2 ? ? B DG  6   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ?    ? B DG  6   O6 ? ? ? 1_555 C DC  16 N4 ? ? B DG  6   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ?    ? B DT  7   N3 ? ? ? 1_555 C DA  15 N1 ? ? B DT  7   C DA  15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ?    ? B DT  7   O4 ? ? ? 1_555 C DA  15 N6 ? ? B DT  7   C DA  15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ?    ? B DG  8   N1 ? ? ? 1_555 C DC  14 N3 ? ? B DG  8   C DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ?    ? B DG  8   N2 ? ? ? 1_555 C DC  14 O2 ? ? B DG  8   C DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21 hydrog ?    ? B DG  8   O6 ? ? ? 1_555 C DC  14 N4 ? ? B DG  8   C DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22 hydrog ?    ? B DC  11  N4 ? ? ? 1_555 C DA  15 N3 ? ? B DC  11  C DA  15  1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ?     ? 
hydrog23 hydrog ?    ? B DC  11  N4 ? ? ? 1_555 C DC  16 O2 ? ? B DC  11  C DC  16  1_555 ? ? ? ? ? ? 'DC-DC MISPAIR' ?     ? 
hydrog24 hydrog ?    ? B DG  12  N1 ? ? ? 1_555 C DC  13 N3 ? ? B DG  12  C DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25 hydrog ?    ? B DG  12  N2 ? ? ? 1_555 C DC  13 O2 ? ? B DG  12  C DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26 hydrog ?    ? B DG  12  O6 ? ? ? 1_555 C DC  13 N4 ? ? B DG  12  C DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27 hydrog ?    ? B DC  13  N3 ? ? ? 1_555 C DG  12 N1 ? ? B DC  13  C DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28 hydrog ?    ? B DC  13  N4 ? ? ? 1_555 C DG  12 O6 ? ? B DC  13  C DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29 hydrog ?    ? B DC  13  O2 ? ? ? 1_555 C DG  12 N2 ? ? B DC  13  C DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30 hydrog ?    ? B DG  14  N1 ? ? ? 1_555 C DC  11 N3 ? ? B DG  14  C DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31 hydrog ?    ? B DG  14  N2 ? ? ? 1_555 C DC  11 O2 ? ? B DG  14  C DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32 hydrog ?    ? B DG  14  O6 ? ? ? 1_555 C DC  11 N4 ? ? B DG  14  C DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33 hydrog ?    ? B DT  15  N3 ? ? ? 1_555 C DA  10 N1 ? ? B DT  15  C DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34 hydrog ?    ? B DT  15  O4 ? ? ? 1_555 C DA  10 N6 ? ? B DT  15  C DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35 hydrog ?    ? B DG  16  N1 ? ? ? 1_555 C DC  9  N3 ? ? B DG  16  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36 hydrog ?    ? B DG  16  N2 ? ? ? 1_555 C DC  9  O2 ? ? B DG  16  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37 hydrog ?    ? B DG  16  O6 ? ? ? 1_555 C DC  9  N4 ? ? B DG  16  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38 hydrog ?    ? B DC  17  N3 ? ? ? 1_555 C DG  8  N1 ? ? B DC  17  C DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39 hydrog ?    ? B DC  17  N4 ? ? ? 1_555 C DG  8  O6 ? ? B DC  17  C DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40 hydrog ?    ? B DC  17  O2 ? ? ? 1_555 C DG  8  N2 ? ? B DC  17  C DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41 hydrog ?    ? B DT  18  N3 ? ? ? 1_555 C DA  7  N1 ? ? B DT  18  C DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42 hydrog ?    ? B DT  18  O4 ? ? ? 1_555 C DA  7  N6 ? ? B DT  18  C DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43 hydrog ?    ? B DG  19  N1 ? ? ? 1_555 C DC  6  N3 ? ? B DG  19  C DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44 hydrog ?    ? B DG  19  N2 ? ? ? 1_555 C DC  6  O2 ? ? B DG  19  C DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45 hydrog ?    ? B DG  19  O6 ? ? ? 1_555 C DC  6  N4 ? ? B DG  19  C DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46 hydrog ?    ? B DG  20  N1 ? ? ? 1_555 C DC  5  N3 ? ? B DG  20  C DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47 hydrog ?    ? B DG  20  N2 ? ? ? 1_555 C DC  5  O2 ? ? B DG  20  C DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48 hydrog ?    ? B DG  20  O6 ? ? ? 1_555 C DC  5  N4 ? ? B DG  20  C DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49 hydrog ?    ? B DA  21  N1 ? ? ? 1_555 C DT  4  N3 ? ? B DA  21  C DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50 hydrog ?    ? B DA  21  N6 ? ? ? 1_555 C DT  4  O4 ? ? B DA  21  C DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51 hydrog ?    ? B DT  22  N3 ? ? ? 1_555 C DA  3  N1 ? ? B DT  22  C DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52 hydrog ?    ? B DT  22  O4 ? ? ? 1_555 C DA  3  N6 ? ? B DT  22  C DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53 hydrog ?    ? B DC  23  N3 ? ? ? 1_555 C DG  2  N1 ? ? B DC  23  C DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54 hydrog ?    ? B DC  23  N4 ? ? ? 1_555 C DG  2  O6 ? ? B DC  23  C DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55 hydrog ?    ? B DC  23  O2 ? ? ? 1_555 C DG  2  N2 ? ? B DC  23  C DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56 hydrog ?    ? B DC  24  N3 ? ? ? 1_555 C DG  1  N1 ? ? B DC  24  C DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57 hydrog ?    ? B DC  24  N4 ? ? ? 1_555 C DG  1  O6 ? ? B DC  24  C DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58 hydrog ?    ? B DC  24  O2 ? ? ? 1_555 C DG  1  N2 ? ? B DC  24  C DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 37  A . ? LYS 56  A PRO 38  A ? PRO 57  A 1 -0.33 
2 PRO 38  A . ? PRO 57  A GLY 39  A ? GLY 58  A 1 7.72  
3 LYS 106 A . ? LYS 125 A PRO 107 A ? PRO 126 A 1 5.77  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 7 ? 
AA3 ? 7 ? 
AA4 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA3 6 7 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 43  ? ARG A 45  ? VAL A 62  ARG A 64  
AA1 2 TYR A 72  ? LEU A 74  ? TYR A 91  LEU A 93  
AA2 1 PHE A 80  ? ILE A 83  ? PHE A 99  ILE A 102 
AA2 2 ILE A 256 ? MET A 259 ? ILE A 275 MET A 278 
AA2 3 LEU A 224 ? GLY A 230 ? LEU A 243 GLY A 249 
AA2 4 ARG A 319 ? ARG A 325 ? ARG A 338 ARG A 344 
AA2 5 ALA A 197 ? TYR A 203 ? ALA A 216 TYR A 222 
AA2 6 TRP A 151 ? ASN A 159 ? TRP A 170 ASN A 178 
AA2 7 VAL A 109 ? SER A 110 ? VAL A 128 SER A 129 
AA3 1 PHE A 80  ? ILE A 83  ? PHE A 99  ILE A 102 
AA3 2 ILE A 256 ? MET A 259 ? ILE A 275 MET A 278 
AA3 3 LEU A 224 ? GLY A 230 ? LEU A 243 GLY A 249 
AA3 4 ARG A 319 ? ARG A 325 ? ARG A 338 ARG A 344 
AA3 5 ALA A 197 ? TYR A 203 ? ALA A 216 TYR A 222 
AA3 6 TRP A 151 ? ASN A 159 ? TRP A 170 ASN A 178 
AA3 7 LYS A 164 ? THR A 171 ? LYS A 183 THR A 190 
AA4 1 LEU A 209 ? HIS A 212 ? LEU A 228 HIS A 231 
AA4 2 HIS A 268 ? VAL A 273 ? HIS A 287 VAL A 292 
AA4 3 ALA A 233 ? LEU A 237 ? ALA A 252 LEU A 256 
AA4 4 THR A 247 ? MET A 251 ? THR A 266 MET A 270 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 44  ? N VAL A 63  O GLY A 73  ? O GLY A 92  
AA2 1 2 N ILE A 83  ? N ILE A 102 O ILE A 256 ? O ILE A 275 
AA2 2 3 O MET A 259 ? O MET A 278 N LEU A 224 ? N LEU A 243 
AA2 3 4 N PHE A 229 ? N PHE A 248 O VAL A 320 ? O VAL A 339 
AA2 4 5 O ARG A 319 ? O ARG A 338 N TYR A 203 ? N TYR A 222 
AA2 5 6 O LEU A 200 ? O LEU A 219 N VAL A 152 ? N VAL A 171 
AA2 6 7 O THR A 153 ? O THR A 172 N VAL A 109 ? N VAL A 128 
AA3 1 2 N ILE A 83  ? N ILE A 102 O ILE A 256 ? O ILE A 275 
AA3 2 3 O MET A 259 ? O MET A 278 N LEU A 224 ? N LEU A 243 
AA3 3 4 N PHE A 229 ? N PHE A 248 O VAL A 320 ? O VAL A 339 
AA3 4 5 O ARG A 319 ? O ARG A 338 N TYR A 203 ? N TYR A 222 
AA3 5 6 O LEU A 200 ? O LEU A 219 N VAL A 152 ? N VAL A 171 
AA3 6 7 N ASN A 159 ? N ASN A 178 O LYS A 164 ? O LYS A 183 
AA4 1 2 N LEU A 209 ? N LEU A 228 O VAL A 270 ? O VAL A 289 
AA4 2 3 O ALA A 269 ? O ALA A 288 N LEU A 236 ? N LEU A 255 
AA4 3 4 N PHE A 235 ? N PHE A 254 O MET A 249 ? O MET A 268 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CL  401 ? 3 'binding site for residue CL A 401'  
AC2 Software A CL  402 ? 2 'binding site for residue CL A 402'  
AC3 Software A SIN 403 ? 7 'binding site for residue SIN A 403' 
AC4 Software B XL3 101 ? 6 'binding site for residue XL3 B 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 ASP A 214 ? ASP A 233 . ? 1_555 ? 
2  AC1 3 ARG A 264 ? ARG A 283 . ? 1_555 ? 
3  AC1 3 ARG A 325 ? ARG A 344 . ? 1_555 ? 
4  AC2 2 PHE A 262 ? PHE A 281 . ? 1_555 ? 
5  AC2 2 PHE A 262 ? PHE A 281 . ? 7_465 ? 
6  AC3 7 ASN A 201 ? ASN A 220 . ? 1_555 ? 
7  AC3 7 LEU A 209 ? LEU A 228 . ? 1_555 ? 
8  AC3 7 HIS A 212 ? HIS A 231 . ? 1_555 ? 
9  AC3 7 ASP A 214 ? ASP A 233 . ? 1_555 ? 
10 AC3 7 HIS A 268 ? HIS A 287 . ? 1_555 ? 
11 AC3 7 ARG A 325 ? ARG A 344 . ? 1_555 ? 
12 AC3 7 DC  B 10  ? DC  B 10  . ? 1_555 ? 
13 AC4 6 TYR A 158 ? TYR A 177 . ? 1_555 ? 
14 AC4 6 TYR A 165 ? TYR A 184 . ? 1_555 ? 
15 AC4 6 ASP A 214 ? ASP A 233 . ? 1_555 ? 
16 AC4 6 CYS A 216 ? CYS A 235 . ? 1_555 ? 
17 AC4 6 ARG A 325 ? ARG A 344 . ? 1_555 ? 
18 AC4 6 DC  B 10  ? DC  B 10  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6KSF 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.014819 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014819 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003793 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLU A 1 1   ? -33.305 38.977  18.304  1.00 60.68  ? 20  GLU A N     1 
ATOM   2    C  CA    . GLU A 1 1   ? -32.609 38.921  17.023  1.00 63.72  ? 20  GLU A CA    1 
ATOM   3    C  C     . GLU A 1 1   ? -32.411 37.483  16.544  1.00 63.21  ? 20  GLU A C     1 
ATOM   4    O  O     . GLU A 1 1   ? -33.245 36.935  15.822  1.00 59.57  ? 20  GLU A O     1 
ATOM   5    C  CB    . GLU A 1 1   ? -31.264 39.632  17.122  1.00 55.78  ? 20  GLU A CB    1 
ATOM   6    N  N     . ASP A 1 2   ? -31.295 36.880  16.958  1.00 61.83  ? 21  ASP A N     1 
ATOM   7    C  CA    . ASP A 1 2   ? -30.889 35.551  16.492  1.00 50.16  ? 21  ASP A CA    1 
ATOM   8    C  C     . ASP A 1 2   ? -31.543 34.470  17.356  1.00 46.50  ? 21  ASP A C     1 
ATOM   9    O  O     . ASP A 1 2   ? -30.912 33.813  18.185  1.00 46.26  ? 21  ASP A O     1 
ATOM   10   C  CB    . ASP A 1 2   ? -29.369 35.438  16.503  1.00 51.41  ? 21  ASP A CB    1 
ATOM   11   C  CG    . ASP A 1 2   ? -28.756 35.943  17.801  1.00 59.22  ? 21  ASP A CG    1 
ATOM   12   O  OD1   . ASP A 1 2   ? -29.401 36.764  18.488  1.00 54.21  ? 21  ASP A OD1   1 
ATOM   13   O  OD2   . ASP A 1 2   ? -27.628 35.521  18.134  1.00 69.51  ? 21  ASP A OD2   1 
ATOM   14   N  N     . ALA A 1 3   ? -32.844 34.279  17.122  1.00 46.05  ? 22  ALA A N     1 
ATOM   15   C  CA    . ALA A 1 3   ? -33.634 33.386  17.966  1.00 45.06  ? 22  ALA A CA    1 
ATOM   16   C  C     . ALA A 1 3   ? -33.180 31.933  17.845  1.00 44.09  ? 22  ALA A C     1 
ATOM   17   O  O     . ALA A 1 3   ? -33.118 31.210  18.849  1.00 45.17  ? 22  ALA A O     1 
ATOM   18   C  CB    . ALA A 1 3   ? -35.114 33.515  17.613  1.00 47.51  ? 22  ALA A CB    1 
ATOM   19   N  N     . PHE A 1 4   ? -32.870 31.482  16.626  1.00 41.93  ? 23  PHE A N     1 
ATOM   20   C  CA    . PHE A 1 4   ? -32.485 30.087  16.439  1.00 43.18  ? 23  PHE A CA    1 
ATOM   21   C  C     . PHE A 1 4   ? -31.181 29.780  17.159  1.00 43.23  ? 23  PHE A C     1 
ATOM   22   O  O     . PHE A 1 4   ? -31.054 28.729  17.794  1.00 39.47  ? 23  PHE A O     1 
ATOM   23   C  CB    . PHE A 1 4   ? -32.370 29.766  14.947  1.00 39.21  ? 23  PHE A CB    1 
ATOM   24   C  CG    . PHE A 1 4   ? -32.594 28.314  14.601  1.00 32.83  ? 23  PHE A CG    1 
ATOM   25   C  CD1   . PHE A 1 4   ? -32.092 27.296  15.396  1.00 37.29  ? 23  PHE A CD1   1 
ATOM   26   C  CD2   . PHE A 1 4   ? -33.308 27.971  13.465  1.00 35.82  ? 23  PHE A CD2   1 
ATOM   27   C  CE1   . PHE A 1 4   ? -32.293 25.971  15.066  1.00 31.99  ? 23  PHE A CE1   1 
ATOM   28   C  CE2   . PHE A 1 4   ? -33.512 26.646  13.129  1.00 34.64  ? 23  PHE A CE2   1 
ATOM   29   C  CZ    . PHE A 1 4   ? -33.002 25.645  13.931  1.00 33.95  ? 23  PHE A CZ    1 
ATOM   30   N  N     . ARG A 1 5   ? -30.203 30.685  17.078  1.00 45.56  ? 24  ARG A N     1 
ATOM   31   C  CA    . ARG A 1 5   ? -28.944 30.482  17.789  1.00 46.23  ? 24  ARG A CA    1 
ATOM   32   C  C     . ARG A 1 5   ? -29.173 30.373  19.293  1.00 43.39  ? 24  ARG A C     1 
ATOM   33   O  O     . ARG A 1 5   ? -28.627 29.482  19.958  1.00 45.53  ? 24  ARG A O     1 
ATOM   34   C  CB    . ARG A 1 5   ? -27.979 31.627  17.480  1.00 50.62  ? 24  ARG A CB    1 
ATOM   35   C  CG    . ARG A 1 5   ? -26.796 31.253  16.608  1.00 58.09  ? 24  ARG A CG    1 
ATOM   36   C  CD    . ARG A 1 5   ? -25.769 32.377  16.609  1.00 71.86  ? 24  ARG A CD    1 
ATOM   37   N  NE    . ARG A 1 5   ? -25.444 32.842  15.264  1.00 78.57  ? 24  ARG A NE    1 
ATOM   38   C  CZ    . ARG A 1 5   ? -24.266 32.662  14.674  1.00 79.42  ? 24  ARG A CZ    1 
ATOM   39   N  NH1   . ARG A 1 5   ? -24.059 33.120  13.447  1.00 80.96  ? 24  ARG A NH1   1 
ATOM   40   N  NH2   . ARG A 1 5   ? -23.293 32.031  15.316  1.00 79.78  ? 24  ARG A NH2   1 
ATOM   41   N  N     . LYS A 1 6   ? -29.991 31.273  19.845  1.00 43.25  ? 25  LYS A N     1 
ATOM   42   C  CA    . LYS A 1 6   ? -30.221 31.278  21.287  1.00 48.54  ? 25  LYS A CA    1 
ATOM   43   C  C     . LYS A 1 6   ? -30.922 30.003  21.740  1.00 45.83  ? 25  LYS A C     1 
ATOM   44   O  O     . LYS A 1 6   ? -30.533 29.394  22.745  1.00 41.46  ? 25  LYS A O     1 
ATOM   45   C  CB    . LYS A 1 6   ? -31.026 32.516  21.687  1.00 42.49  ? 25  LYS A CB    1 
ATOM   46   C  CG    . LYS A 1 6   ? -30.285 33.836  21.480  1.00 44.58  ? 25  LYS A CG    1 
ATOM   47   C  CD    . LYS A 1 6   ? -30.779 34.914  22.451  1.00 53.90  ? 25  LYS A CD    1 
ATOM   48   C  CE    . LYS A 1 6   ? -32.031 35.627  21.952  1.00 44.32  ? 25  LYS A CE    1 
ATOM   49   N  NZ    . LYS A 1 6   ? -32.924 36.113  23.064  1.00 53.70  ? 25  LYS A NZ    1 
ATOM   50   N  N     . LEU A 1 7   ? -31.948 29.567  21.002  1.00 40.94  ? 26  LEU A N     1 
ATOM   51   C  CA    . LEU A 1 7   ? -32.646 28.347  21.398  1.00 40.70  ? 26  LEU A CA    1 
ATOM   52   C  C     . LEU A 1 7   ? -31.791 27.106  21.170  1.00 38.56  ? 26  LEU A C     1 
ATOM   53   O  O     . LEU A 1 7   ? -31.892 26.134  21.933  1.00 42.33  ? 26  LEU A O     1 
ATOM   54   C  CB    . LEU A 1 7   ? -33.974 28.243  20.655  1.00 38.45  ? 26  LEU A CB    1 
ATOM   55   C  CG    . LEU A 1 7   ? -35.068 29.069  21.336  1.00 48.35  ? 26  LEU A CG    1 
ATOM   56   C  CD1   . LEU A 1 7   ? -36.166 29.466  20.367  1.00 41.81  ? 26  LEU A CD1   1 
ATOM   57   C  CD2   . LEU A 1 7   ? -35.645 28.291  22.515  1.00 42.39  ? 26  LEU A CD2   1 
ATOM   58   N  N     . PHE A 1 8   ? -30.937 27.123  20.144  1.00 38.95  ? 27  PHE A N     1 
ATOM   59   C  CA    . PHE A 1 8   ? -30.004 26.026  19.922  1.00 40.28  ? 27  PHE A CA    1 
ATOM   60   C  C     . PHE A 1 8   ? -29.058 25.879  21.102  1.00 45.58  ? 27  PHE A C     1 
ATOM   61   O  O     . PHE A 1 8   ? -28.824 24.768  21.592  1.00 48.03  ? 27  PHE A O     1 
ATOM   62   C  CB    . PHE A 1 8   ? -29.221 26.267  18.629  1.00 37.17  ? 27  PHE A CB    1 
ATOM   63   C  CG    . PHE A 1 8   ? -28.211 25.196  18.316  1.00 38.41  ? 27  PHE A CG    1 
ATOM   64   C  CD1   . PHE A 1 8   ? -28.582 24.064  17.612  1.00 33.75  ? 27  PHE A CD1   1 
ATOM   65   C  CD2   . PHE A 1 8   ? -26.889 25.330  18.710  1.00 37.95  ? 27  PHE A CD2   1 
ATOM   66   C  CE1   . PHE A 1 8   ? -27.657 23.082  17.319  1.00 30.22  ? 27  PHE A CE1   1 
ATOM   67   C  CE2   . PHE A 1 8   ? -25.958 24.349  18.420  1.00 34.13  ? 27  PHE A CE2   1 
ATOM   68   C  CZ    . PHE A 1 8   ? -26.344 23.224  17.727  1.00 36.98  ? 27  PHE A CZ    1 
ATOM   69   N  N     . ARG A 1 9   ? -28.502 26.999  21.574  1.00 44.20  ? 28  ARG A N     1 
ATOM   70   C  CA    . ARG A 1 9   ? -27.652 26.948  22.758  1.00 47.71  ? 28  ARG A CA    1 
ATOM   71   C  C     . ARG A 1 9   ? -28.441 26.500  23.982  1.00 44.09  ? 28  ARG A C     1 
ATOM   72   O  O     . ARG A 1 9   ? -27.933 25.733  24.807  1.00 45.47  ? 28  ARG A O     1 
ATOM   73   C  CB    . ARG A 1 9   ? -26.998 28.306  23.006  1.00 50.24  ? 28  ARG A CB    1 
ATOM   74   C  CG    . ARG A 1 9   ? -25.640 28.477  22.338  1.00 62.45  ? 28  ARG A CG    1 
ATOM   75   C  CD    . ARG A 1 9   ? -25.734 29.376  21.118  1.00 61.76  ? 28  ARG A CD    1 
ATOM   76   N  NE    . ARG A 1 9   ? -26.185 30.719  21.479  1.00 69.84  ? 28  ARG A NE    1 
ATOM   77   C  CZ    . ARG A 1 9   ? -25.463 31.822  21.315  1.00 69.06  ? 28  ARG A CZ    1 
ATOM   78   N  NH1   . ARG A 1 9   ? -24.252 31.752  20.778  1.00 71.98  ? 28  ARG A NH1   1 
ATOM   79   N  NH2   . ARG A 1 9   ? -25.960 32.998  21.676  1.00 60.53  ? 28  ARG A NH2   1 
ATOM   80   N  N     . PHE A 1 10  ? -29.688 26.960  24.112  1.00 40.89  ? 29  PHE A N     1 
ATOM   81   C  CA    . PHE A 1 10  ? -30.506 26.567  25.256  1.00 38.37  ? 29  PHE A CA    1 
ATOM   82   C  C     . PHE A 1 10  ? -30.676 25.056  25.320  1.00 49.12  ? 29  PHE A C     1 
ATOM   83   O  O     . PHE A 1 10  ? -30.446 24.437  26.365  1.00 50.55  ? 29  PHE A O     1 
ATOM   84   C  CB    . PHE A 1 10  ? -31.869 27.254  25.194  1.00 37.13  ? 29  PHE A CB    1 
ATOM   85   C  CG    . PHE A 1 10  ? -32.857 26.729  26.200  1.00 46.01  ? 29  PHE A CG    1 
ATOM   86   C  CD1   . PHE A 1 10  ? -32.771 27.097  27.534  1.00 47.91  ? 29  PHE A CD1   1 
ATOM   87   C  CD2   . PHE A 1 10  ? -33.870 25.865  25.812  1.00 46.20  ? 29  PHE A CD2   1 
ATOM   88   C  CE1   . PHE A 1 10  ? -33.679 26.612  28.463  1.00 49.70  ? 29  PHE A CE1   1 
ATOM   89   C  CE2   . PHE A 1 10  ? -34.783 25.376  26.735  1.00 48.64  ? 29  PHE A CE2   1 
ATOM   90   C  CZ    . PHE A 1 10  ? -34.687 25.751  28.063  1.00 54.28  ? 29  PHE A CZ    1 
ATOM   91   N  N     . TYR A 1 11  ? -31.077 24.440  24.207  1.00 50.91  ? 30  TYR A N     1 
ATOM   92   C  CA    . TYR A 1 11  ? -31.296 22.997  24.221  1.00 43.02  ? 30  TYR A CA    1 
ATOM   93   C  C     . TYR A 1 11  ? -30.001 22.200  24.182  1.00 42.86  ? 30  TYR A C     1 
ATOM   94   O  O     . TYR A 1 11  ? -29.997 21.040  24.602  1.00 50.96  ? 30  TYR A O     1 
ATOM   95   C  CB    . TYR A 1 11  ? -32.205 22.581  23.063  1.00 46.82  ? 30  TYR A CB    1 
ATOM   96   C  CG    . TYR A 1 11  ? -33.639 22.999  23.274  1.00 42.80  ? 30  TYR A CG    1 
ATOM   97   C  CD1   . TYR A 1 11  ? -34.411 22.412  24.269  1.00 37.78  ? 30  TYR A CD1   1 
ATOM   98   C  CD2   . TYR A 1 11  ? -34.217 23.988  22.494  1.00 38.56  ? 30  TYR A CD2   1 
ATOM   99   C  CE1   . TYR A 1 11  ? -35.717 22.793  24.475  1.00 38.82  ? 30  TYR A CE1   1 
ATOM   100  C  CE2   . TYR A 1 11  ? -35.527 24.376  22.694  1.00 45.75  ? 30  TYR A CE2   1 
ATOM   101  C  CZ    . TYR A 1 11  ? -36.273 23.774  23.686  1.00 39.04  ? 30  TYR A CZ    1 
ATOM   102  O  OH    . TYR A 1 11  ? -37.578 24.158  23.890  1.00 41.70  ? 30  TYR A OH    1 
ATOM   103  N  N     . ARG A 1 12  ? -28.905 22.784  23.698  1.00 43.01  ? 31  ARG A N     1 
ATOM   104  C  CA    . ARG A 1 12  ? -27.622 22.093  23.776  1.00 50.93  ? 31  ARG A CA    1 
ATOM   105  C  C     . ARG A 1 12  ? -27.149 21.994  25.220  1.00 56.77  ? 31  ARG A C     1 
ATOM   106  O  O     . ARG A 1 12  ? -26.765 20.916  25.690  1.00 56.44  ? 31  ARG A O     1 
ATOM   107  C  CB    . ARG A 1 12  ? -26.577 22.811  22.923  1.00 48.35  ? 31  ARG A CB    1 
ATOM   108  C  CG    . ARG A 1 12  ? -25.273 22.040  22.779  1.00 52.29  ? 31  ARG A CG    1 
ATOM   109  C  CD    . ARG A 1 12  ? -24.073 22.947  22.971  1.00 62.36  ? 31  ARG A CD    1 
ATOM   110  N  NE    . ARG A 1 12  ? -24.063 24.054  22.021  1.00 62.41  ? 31  ARG A NE    1 
ATOM   111  C  CZ    . ARG A 1 12  ? -23.463 25.219  22.244  1.00 68.68  ? 31  ARG A CZ    1 
ATOM   112  N  NH1   . ARG A 1 12  ? -22.835 25.431  23.393  1.00 70.27  ? 31  ARG A NH1   1 
ATOM   113  N  NH2   . ARG A 1 12  ? -23.503 26.177  21.326  1.00 65.97  ? 31  ARG A NH2   1 
ATOM   114  N  N     . GLN A 1 13  ? -27.174 23.114  25.940  1.00 62.02  ? 32  GLN A N     1 
ATOM   115  C  CA    . GLN A 1 13  ? -26.785 23.153  27.343  1.00 63.41  ? 32  GLN A CA    1 
ATOM   116  C  C     . GLN A 1 13  ? -27.854 22.584  28.261  1.00 69.25  ? 32  GLN A C     1 
ATOM   117  O  O     . GLN A 1 13  ? -27.685 22.629  29.485  1.00 78.09  ? 32  GLN A O     1 
ATOM   118  C  CB    . GLN A 1 13  ? -26.453 24.589  27.755  1.00 59.26  ? 32  GLN A CB    1 
ATOM   119  C  CG    . GLN A 1 13  ? -25.296 25.193  26.974  1.00 64.40  ? 32  GLN A CG    1 
ATOM   120  C  CD    . GLN A 1 13  ? -25.012 26.630  27.363  1.00 69.41  ? 32  GLN A CD    1 
ATOM   121  O  OE1   . GLN A 1 13  ? -25.898 27.345  27.836  1.00 74.69  ? 32  GLN A OE1   1 
ATOM   122  N  NE2   . GLN A 1 13  ? -23.770 27.061  27.168  1.00 69.16  ? 32  GLN A NE2   1 
ATOM   123  N  N     . SER A 1 14  ? -28.949 22.074  27.702  1.00 66.06  ? 33  SER A N     1 
ATOM   124  C  CA    . SER A 1 14  ? -29.934 21.354  28.493  1.00 68.60  ? 33  SER A CA    1 
ATOM   125  C  C     . SER A 1 14  ? -29.280 20.156  29.158  1.00 76.11  ? 33  SER A C     1 
ATOM   126  O  O     . SER A 1 14  ? -28.687 19.307  28.487  1.00 79.98  ? 33  SER A O     1 
ATOM   127  C  CB    . SER A 1 14  ? -31.096 20.893  27.611  1.00 63.04  ? 33  SER A CB    1 
ATOM   128  O  OG    . SER A 1 14  ? -32.073 21.906  27.462  1.00 70.37  ? 33  SER A OG    1 
ATOM   129  N  N     . ARG A 1 15  ? -29.365 20.100  30.476  1.00 84.40  ? 34  ARG A N     1 
ATOM   130  C  CA    . ARG A 1 15  ? -28.999 18.902  31.226  1.00 89.97  ? 34  ARG A CA    1 
ATOM   131  C  C     . ARG A 1 15  ? -30.253 18.483  31.971  1.00 93.53  ? 34  ARG A C     1 
ATOM   132  O  O     . ARG A 1 15  ? -30.690 19.214  32.880  1.00 96.16  ? 34  ARG A O     1 
ATOM   133  C  CB    . ARG A 1 15  ? -27.842 19.173  32.190  1.00 83.94  ? 34  ARG A CB    1 
ATOM   134  C  CG    . ARG A 1 15  ? -26.674 19.944  31.570  1.00 80.05  ? 34  ARG A CG    1 
ATOM   135  C  CD    . ARG A 1 15  ? -25.557 19.026  31.083  1.00 76.32  ? 34  ARG A CD    1 
ATOM   136  N  NE    . ARG A 1 15  ? -25.126 19.342  29.721  1.00 78.04  ? 34  ARG A NE    1 
ATOM   137  C  CZ    . ARG A 1 15  ? -24.292 20.328  29.400  1.00 77.31  ? 34  ARG A CZ    1 
ATOM   138  N  NH1   . ARG A 1 15  ? -23.961 20.531  28.130  1.00 72.91  ? 34  ARG A NH1   1 
ATOM   139  N  NH2   . ARG A 1 15  ? -23.792 21.117  30.341  1.00 77.62  ? 34  ARG A NH2   1 
ATOM   140  N  N     . PRO A 1 16  ? -30.894 17.350  31.602  1.00 98.30  ? 35  PRO A N     1 
ATOM   141  C  CA    . PRO A 1 16  ? -32.186 16.982  32.206  1.00 102.45 ? 35  PRO A CA    1 
ATOM   142  C  C     . PRO A 1 16  ? -32.237 17.202  33.709  1.00 101.02 ? 35  PRO A C     1 
ATOM   143  O  O     . PRO A 1 16  ? -31.717 16.407  34.498  1.00 94.61  ? 35  PRO A O     1 
ATOM   144  C  CB    . PRO A 1 16  ? -32.322 15.500  31.842  1.00 104.60 ? 35  PRO A CB    1 
ATOM   145  C  CG    . PRO A 1 16  ? -31.637 15.408  30.513  1.00 95.15  ? 35  PRO A CG    1 
ATOM   146  C  CD    . PRO A 1 16  ? -30.471 16.377  30.577  1.00 89.99  ? 35  PRO A CD    1 
ATOM   147  N  N     . GLY A 1 17  ? -32.861 18.312  34.095  1.00 98.89  ? 36  GLY A N     1 
ATOM   148  C  CA    . GLY A 1 17  ? -32.808 18.819  35.450  1.00 97.23  ? 36  GLY A CA    1 
ATOM   149  C  C     . GLY A 1 17  ? -32.417 20.283  35.454  1.00 98.94  ? 36  GLY A C     1 
ATOM   150  O  O     . GLY A 1 17  ? -32.855 21.054  36.313  1.00 99.23  ? 36  GLY A O     1 
ATOM   151  N  N     . THR A 1 18  ? -31.591 20.676  34.481  1.00 95.81  ? 37  THR A N     1 
ATOM   152  C  CA    . THR A 1 18  ? -31.162 22.067  34.363  1.00 95.70  ? 37  THR A CA    1 
ATOM   153  C  C     . THR A 1 18  ? -32.209 22.910  33.643  1.00 96.16  ? 37  THR A C     1 
ATOM   154  O  O     . THR A 1 18  ? -32.676 23.925  34.171  1.00 92.85  ? 37  THR A O     1 
ATOM   155  C  CB    . THR A 1 18  ? -29.817 22.148  33.627  1.00 97.42  ? 37  THR A CB    1 
ATOM   156  O  OG1   . THR A 1 18  ? -28.790 21.541  34.423  1.00 99.37  ? 37  THR A OG1   1 
ATOM   157  C  CG2   . THR A 1 18  ? -29.447 23.600  33.337  1.00 86.76  ? 37  THR A CG2   1 
ATOM   158  N  N     . ALA A 1 19  ? -32.591 22.501  32.434  1.00 93.20  ? 38  ALA A N     1 
ATOM   159  C  CA    . ALA A 1 19  ? -33.460 23.286  31.572  1.00 78.94  ? 38  ALA A CA    1 
ATOM   160  C  C     . ALA A 1 19  ? -34.820 22.620  31.404  1.00 75.03  ? 38  ALA A C     1 
ATOM   161  O  O     . ALA A 1 19  ? -34.973 21.403  31.546  1.00 71.94  ? 38  ALA A O     1 
ATOM   162  C  CB    . ALA A 1 19  ? -32.816 23.503  30.201  1.00 73.99  ? 38  ALA A CB    1 
ATOM   163  N  N     . ASP A 1 20  ? -35.807 23.450  31.078  1.00 66.79  ? 39  ASP A N     1 
ATOM   164  C  CA    . ASP A 1 20  ? -37.196 23.027  30.955  1.00 66.37  ? 39  ASP A CA    1 
ATOM   165  C  C     . ASP A 1 20  ? -37.462 22.554  29.529  1.00 64.10  ? 39  ASP A C     1 
ATOM   166  O  O     . ASP A 1 20  ? -37.225 23.295  28.569  1.00 60.36  ? 39  ASP A O     1 
ATOM   167  C  CB    . ASP A 1 20  ? -38.123 24.184  31.331  1.00 62.94  ? 39  ASP A CB    1 
ATOM   168  C  CG    . ASP A 1 20  ? -39.573 23.768  31.435  1.00 63.06  ? 39  ASP A CG    1 
ATOM   169  O  OD1   . ASP A 1 20  ? -39.857 22.556  31.353  1.00 69.09  ? 39  ASP A OD1   1 
ATOM   170  O  OD2   . ASP A 1 20  ? -40.432 24.661  31.598  1.00 66.84  ? 39  ASP A OD2   1 
ATOM   171  N  N     . LEU A 1 21  ? -37.952 21.320  29.393  1.00 61.86  ? 40  LEU A N     1 
ATOM   172  C  CA    . LEU A 1 21  ? -38.293 20.743  28.100  1.00 52.17  ? 40  LEU A CA    1 
ATOM   173  C  C     . LEU A 1 21  ? -39.793 20.766  27.826  1.00 50.56  ? 40  LEU A C     1 
ATOM   174  O  O     . LEU A 1 21  ? -40.282 19.959  27.029  1.00 54.93  ? 40  LEU A O     1 
ATOM   175  C  CB    . LEU A 1 21  ? -37.776 19.307  28.008  1.00 45.16  ? 40  LEU A CB    1 
ATOM   176  C  CG    . LEU A 1 21  ? -36.285 19.064  28.233  1.00 54.11  ? 40  LEU A CG    1 
ATOM   177  C  CD1   . LEU A 1 21  ? -35.982 17.585  28.109  1.00 47.64  ? 40  LEU A CD1   1 
ATOM   178  C  CD2   . LEU A 1 21  ? -35.443 19.870  27.256  1.00 50.82  ? 40  LEU A CD2   1 
ATOM   179  N  N     . GLY A 1 22  ? -40.533 21.674  28.467  1.00 48.58  ? 41  GLY A N     1 
ATOM   180  C  CA    . GLY A 1 22  ? -41.979 21.675  28.320  1.00 47.67  ? 41  GLY A CA    1 
ATOM   181  C  C     . GLY A 1 22  ? -42.459 22.075  26.938  1.00 52.21  ? 41  GLY A C     1 
ATOM   182  O  O     . GLY A 1 22  ? -43.562 21.698  26.530  1.00 55.32  ? 41  GLY A O     1 
ATOM   183  N  N     . ALA A 1 23  ? -41.656 22.839  26.204  1.00 48.35  ? 42  ALA A N     1 
ATOM   184  C  CA    . ALA A 1 23  ? -42.044 23.316  24.884  1.00 48.31  ? 42  ALA A CA    1 
ATOM   185  C  C     . ALA A 1 23  ? -41.677 22.346  23.771  1.00 44.10  ? 42  ALA A C     1 
ATOM   186  O  O     . ALA A 1 23  ? -42.037 22.586  22.615  1.00 52.65  ? 42  ALA A O     1 
ATOM   187  C  CB    . ALA A 1 23  ? -41.411 24.683  24.608  1.00 47.52  ? 42  ALA A CB    1 
ATOM   188  N  N     . VAL A 1 24  ? -40.976 21.265  24.087  1.00 39.33  ? 43  VAL A N     1 
ATOM   189  C  CA    . VAL A 1 24  ? -40.578 20.291  23.079  1.00 42.97  ? 43  VAL A CA    1 
ATOM   190  C  C     . VAL A 1 24  ? -41.762 19.389  22.766  1.00 43.39  ? 43  VAL A C     1 
ATOM   191  O  O     . VAL A 1 24  ? -42.349 18.780  23.667  1.00 47.73  ? 43  VAL A O     1 
ATOM   192  C  CB    . VAL A 1 24  ? -39.368 19.478  23.561  1.00 41.85  ? 43  VAL A CB    1 
ATOM   193  C  CG1   . VAL A 1 24  ? -38.890 18.540  22.472  1.00 37.35  ? 43  VAL A CG1   1 
ATOM   194  C  CG2   . VAL A 1 24  ? -38.253 20.410  23.995  1.00 40.23  ? 43  VAL A CG2   1 
ATOM   195  N  N     . ILE A 1 25  ? -42.114 19.298  21.488  1.00 42.99  ? 44  ILE A N     1 
ATOM   196  C  CA    . ILE A 1 25  ? -43.269 18.514  21.068  1.00 39.27  ? 44  ILE A CA    1 
ATOM   197  C  C     . ILE A 1 25  ? -42.917 17.034  21.109  1.00 37.82  ? 44  ILE A C     1 
ATOM   198  O  O     . ILE A 1 25  ? -41.867 16.616  20.606  1.00 47.21  ? 44  ILE A O     1 
ATOM   199  C  CB    . ILE A 1 25  ? -43.727 18.930  19.662  1.00 43.23  ? 44  ILE A CB    1 
ATOM   200  C  CG1   . ILE A 1 25  ? -44.167 20.395  19.652  1.00 38.87  ? 44  ILE A CG1   1 
ATOM   201  C  CG2   . ILE A 1 25  ? -44.851 18.026  19.178  1.00 38.78  ? 44  ILE A CG2   1 
ATOM   202  C  CD1   . ILE A 1 25  ? -44.552 20.887  18.278  1.00 44.40  ? 44  ILE A CD1   1 
ATOM   203  N  N     . ASP A 1 26  ? -43.794 16.239  21.705  1.00 40.11  ? 45  ASP A N     1 
ATOM   204  C  CA    . ASP A 1 26  ? -43.659 14.787  21.750  1.00 48.39  ? 45  ASP A CA    1 
ATOM   205  C  C     . ASP A 1 26  ? -44.794 14.204  20.914  1.00 49.28  ? 45  ASP A C     1 
ATOM   206  O  O     . ASP A 1 26  ? -45.939 14.137  21.368  1.00 54.76  ? 45  ASP A O     1 
ATOM   207  C  CB    . ASP A 1 26  ? -43.697 14.278  23.190  1.00 49.08  ? 45  ASP A CB    1 
ATOM   208  C  CG    . ASP A 1 26  ? -43.286 12.824  23.308  1.00 54.43  ? 45  ASP A CG    1 
ATOM   209  O  OD1   . ASP A 1 26  ? -43.282 12.110  22.284  1.00 56.33  ? 45  ASP A OD1   1 
ATOM   210  O  OD2   . ASP A 1 26  ? -42.968 12.389  24.434  1.00 60.47  ? 45  ASP A OD2   1 
ATOM   211  N  N     . PHE A 1 27  ? -44.473 13.781  19.690  1.00 49.25  ? 46  PHE A N     1 
ATOM   212  C  CA    . PHE A 1 27  ? -45.500 13.253  18.800  1.00 51.73  ? 46  PHE A CA    1 
ATOM   213  C  C     . PHE A 1 27  ? -46.011 11.885  19.236  1.00 55.64  ? 46  PHE A C     1 
ATOM   214  O  O     . PHE A 1 27  ? -47.028 11.427  18.706  1.00 59.15  ? 46  PHE A O     1 
ATOM   215  C  CB    . PHE A 1 27  ? -44.975 13.182  17.362  1.00 43.72  ? 46  PHE A CB    1 
ATOM   216  C  CG    . PHE A 1 27  ? -44.807 14.529  16.702  1.00 40.89  ? 46  PHE A CG    1 
ATOM   217  C  CD1   . PHE A 1 27  ? -45.905 15.219  16.210  1.00 42.12  ? 46  PHE A CD1   1 
ATOM   218  C  CD2   . PHE A 1 27  ? -43.550 15.093  16.555  1.00 40.56  ? 46  PHE A CD2   1 
ATOM   219  C  CE1   . PHE A 1 27  ? -45.754 16.455  15.598  1.00 45.00  ? 46  PHE A CE1   1 
ATOM   220  C  CE2   . PHE A 1 27  ? -43.390 16.329  15.941  1.00 39.52  ? 46  PHE A CE2   1 
ATOM   221  C  CZ    . PHE A 1 27  ? -44.493 17.011  15.463  1.00 41.51  ? 46  PHE A CZ    1 
ATOM   222  N  N     . SER A 1 28  ? -45.339 11.226  20.184  1.00 58.41  ? 47  SER A N     1 
ATOM   223  C  CA    . SER A 1 28  ? -45.852 9.964   20.710  1.00 62.55  ? 47  SER A CA    1 
ATOM   224  C  C     . SER A 1 28  ? -47.086 10.180  21.576  1.00 65.65  ? 47  SER A C     1 
ATOM   225  O  O     . SER A 1 28  ? -47.940 9.290   21.672  1.00 64.83  ? 47  SER A O     1 
ATOM   226  C  CB    . SER A 1 28  ? -44.762 9.247   21.502  1.00 57.42  ? 47  SER A CB    1 
ATOM   227  O  OG    . SER A 1 28  ? -43.692 8.876   20.649  1.00 63.85  ? 47  SER A OG    1 
ATOM   228  N  N     . GLU A 1 29  ? -47.194 11.344  22.212  1.00 64.49  ? 48  GLU A N     1 
ATOM   229  C  CA    . GLU A 1 29  ? -48.401 11.735  22.926  1.00 67.88  ? 48  GLU A CA    1 
ATOM   230  C  C     . GLU A 1 29  ? -48.935 13.026  22.323  1.00 72.88  ? 48  GLU A C     1 
ATOM   231  O  O     . GLU A 1 29  ? -49.013 14.054  23.004  1.00 79.73  ? 48  GLU A O     1 
ATOM   232  C  CB    . GLU A 1 29  ? -48.111 11.902  24.417  1.00 73.15  ? 48  GLU A CB    1 
ATOM   233  C  CG    . GLU A 1 29  ? -47.604 10.636  25.080  1.00 78.61  ? 48  GLU A CG    1 
ATOM   234  C  CD    . GLU A 1 29  ? -46.540 10.911  26.120  1.00 83.67  ? 48  GLU A CD    1 
ATOM   235  O  OE1   . GLU A 1 29  ? -46.309 12.098  26.439  1.00 82.64  ? 48  GLU A OE1   1 
ATOM   236  O  OE2   . GLU A 1 29  ? -45.927 9.939   26.612  1.00 91.28  ? 48  GLU A OE2   1 
ATOM   237  N  N     . ALA A 1 30  ? -49.304 12.973  21.043  1.00 73.83  ? 49  ALA A N     1 
ATOM   238  C  CA    . ALA A 1 30  ? -49.617 14.182  20.293  1.00 76.94  ? 49  ALA A CA    1 
ATOM   239  C  C     . ALA A 1 30  ? -50.827 14.901  20.878  1.00 89.13  ? 49  ALA A C     1 
ATOM   240  O  O     . ALA A 1 30  ? -51.792 14.275  21.326  1.00 88.20  ? 49  ALA A O     1 
ATOM   241  C  CB    . ALA A 1 30  ? -49.869 13.839  18.825  1.00 67.60  ? 49  ALA A CB    1 
ATOM   242  N  N     . HIS A 1 31  ? -50.765 16.233  20.867  1.00 92.99  ? 50  HIS A N     1 
ATOM   243  C  CA    . HIS A 1 31  ? -51.838 17.069  21.391  1.00 95.61  ? 50  HIS A CA    1 
ATOM   244  C  C     . HIS A 1 31  ? -53.101 16.947  20.551  1.00 100.54 ? 50  HIS A C     1 
ATOM   245  O  O     . HIS A 1 31  ? -54.116 16.422  21.025  1.00 103.96 ? 50  HIS A O     1 
ATOM   246  C  CB    . HIS A 1 31  ? -51.399 18.534  21.448  1.00 95.52  ? 50  HIS A CB    1 
ATOM   247  C  CG    . HIS A 1 31  ? -50.847 18.951  22.776  1.00 99.84  ? 50  HIS A CG    1 
ATOM   248  N  ND1   . HIS A 1 31  ? -50.313 20.202  22.998  1.00 99.32  ? 50  HIS A ND1   1 
ATOM   249  C  CD2   . HIS A 1 31  ? -50.751 18.287  23.952  1.00 100.97 ? 50  HIS A CD2   1 
ATOM   250  C  CE1   . HIS A 1 31  ? -49.909 20.291  24.252  1.00 104.42 ? 50  HIS A CE1   1 
ATOM   251  N  NE2   . HIS A 1 31  ? -50.163 19.142  24.853  1.00 107.54 ? 50  HIS A NE2   1 
ATOM   252  N  N     . LEU A 1 32  ? -53.044 17.456  19.315  1.00 93.66  ? 51  LEU A N     1 
ATOM   253  C  CA    . LEU A 1 32  ? -54.172 17.527  18.385  1.00 93.97  ? 51  LEU A CA    1 
ATOM   254  C  C     . LEU A 1 32  ? -55.207 18.551  18.844  1.00 101.51 ? 51  LEU A C     1 
ATOM   255  O  O     . LEU A 1 32  ? -56.066 18.962  18.056  1.00 102.60 ? 51  LEU A O     1 
ATOM   256  C  CB    . LEU A 1 32  ? -54.823 16.151  18.188  1.00 90.42  ? 51  LEU A CB    1 
ATOM   257  C  CG    . LEU A 1 32  ? -54.285 15.252  17.071  1.00 83.35  ? 51  LEU A CG    1 
ATOM   258  C  CD1   . LEU A 1 32  ? -54.970 15.570  15.751  1.00 74.52  ? 51  LEU A CD1   1 
ATOM   259  C  CD2   . LEU A 1 32  ? -52.775 15.389  16.931  1.00 74.55  ? 51  LEU A CD2   1 
ATOM   260  N  N     . ALA A 1 33  ? -55.132 18.971  20.107  1.00 103.11 ? 52  ALA A N     1 
ATOM   261  C  CA    . ALA A 1 33  ? -55.972 20.056  20.591  1.00 103.41 ? 52  ALA A CA    1 
ATOM   262  C  C     . ALA A 1 33  ? -55.672 21.333  19.813  1.00 105.22 ? 52  ALA A C     1 
ATOM   263  O  O     . ALA A 1 33  ? -54.542 21.573  19.381  1.00 107.98 ? 52  ALA A O     1 
ATOM   264  C  CB    . ALA A 1 33  ? -55.747 20.281  22.088  1.00 103.29 ? 52  ALA A CB    1 
ATOM   265  N  N     . ARG A 1 34  ? -56.702 22.157  19.632  1.00 104.88 ? 53  ARG A N     1 
ATOM   266  C  CA    . ARG A 1 34  ? -56.601 23.330  18.767  1.00 104.61 ? 53  ARG A CA    1 
ATOM   267  C  C     . ARG A 1 34  ? -55.904 24.464  19.511  1.00 108.54 ? 53  ARG A C     1 
ATOM   268  O  O     . ARG A 1 34  ? -56.473 25.052  20.439  1.00 108.71 ? 53  ARG A O     1 
ATOM   269  C  CB    . ARG A 1 34  ? -57.984 23.753  18.284  1.00 104.32 ? 53  ARG A CB    1 
ATOM   270  C  CG    . ARG A 1 34  ? -58.075 23.900  16.777  1.00 97.13  ? 53  ARG A CG    1 
ATOM   271  C  CD    . ARG A 1 34  ? -59.074 22.924  16.181  1.00 92.35  ? 53  ARG A CD    1 
ATOM   272  N  NE    . ARG A 1 34  ? -58.539 22.260  14.996  1.00 95.61  ? 53  ARG A NE    1 
ATOM   273  C  CZ    . ARG A 1 34  ? -59.284 21.690  14.054  1.00 96.97  ? 53  ARG A CZ    1 
ATOM   274  N  NH1   . ARG A 1 34  ? -58.706 21.107  13.012  1.00 93.68  ? 53  ARG A NH1   1 
ATOM   275  N  NH2   . ARG A 1 34  ? -60.607 21.712  14.143  1.00 94.95  ? 53  ARG A NH2   1 
ATOM   276  N  N     . SER A 1 35  ? -54.677 24.770  19.095  1.00 107.83 ? 54  SER A N     1 
ATOM   277  C  CA    . SER A 1 35  ? -53.888 25.867  19.644  1.00 109.60 ? 54  SER A CA    1 
ATOM   278  C  C     . SER A 1 35  ? -53.788 25.836  21.172  1.00 114.83 ? 54  SER A C     1 
ATOM   279  O  O     . SER A 1 35  ? -54.274 26.748  21.849  1.00 117.33 ? 54  SER A O     1 
ATOM   280  C  CB    . SER A 1 35  ? -54.440 27.206  19.173  1.00 104.42 ? 54  SER A CB    1 
ATOM   281  N  N     . PRO A 1 36  ? -53.150 24.804  21.752  1.00 113.48 ? 55  PRO A N     1 
ATOM   282  C  CA    . PRO A 1 36  ? -52.989 24.777  23.212  1.00 113.45 ? 55  PRO A CA    1 
ATOM   283  C  C     . PRO A 1 36  ? -51.753 25.536  23.679  1.00 110.01 ? 55  PRO A C     1 
ATOM   284  O  O     . PRO A 1 36  ? -51.134 25.178  24.686  1.00 108.86 ? 55  PRO A O     1 
ATOM   285  C  CB    . PRO A 1 36  ? -52.890 23.280  23.520  1.00 106.17 ? 55  PRO A CB    1 
ATOM   286  C  CG    . PRO A 1 36  ? -52.241 22.710  22.308  1.00 105.34 ? 55  PRO A CG    1 
ATOM   287  C  CD    . PRO A 1 36  ? -52.652 23.564  21.127  1.00 108.09 ? 55  PRO A CD    1 
ATOM   288  N  N     . LYS A 1 37  ? -51.391 26.589  22.941  1.00 107.05 ? 56  LYS A N     1 
ATOM   289  C  CA    . LYS A 1 37  ? -50.312 27.520  23.259  1.00 107.78 ? 56  LYS A CA    1 
ATOM   290  C  C     . LYS A 1 37  ? -50.720 28.866  22.646  1.00 108.16 ? 56  LYS A C     1 
ATOM   291  O  O     . LYS A 1 37  ? -51.908 29.202  22.752  1.00 106.86 ? 56  LYS A O     1 
ATOM   292  C  CB    . LYS A 1 37  ? -48.972 26.952  22.781  1.00 102.25 ? 56  LYS A CB    1 
ATOM   293  C  CG    . LYS A 1 37  ? -48.259 26.044  23.801  1.00 103.68 ? 56  LYS A CG    1 
ATOM   294  C  CD    . LYS A 1 37  ? -47.462 26.818  24.867  1.00 104.29 ? 56  LYS A CD    1 
ATOM   295  C  CE    . LYS A 1 37  ? -48.319 27.292  26.046  1.00 103.28 ? 56  LYS A CE    1 
ATOM   296  N  NZ    . LYS A 1 37  ? -49.015 26.171  26.740  1.00 108.07 ? 56  LYS A NZ    1 
ATOM   297  N  N     . PRO A 1 38  ? -49.840 29.689  22.007  1.00 104.74 ? 57  PRO A N     1 
ATOM   298  C  CA    . PRO A 1 38  ? -48.444 29.911  21.569  1.00 101.86 ? 57  PRO A CA    1 
ATOM   299  C  C     . PRO A 1 38  ? -47.388 29.765  22.679  1.00 102.35 ? 57  PRO A C     1 
ATOM   300  O  O     . PRO A 1 38  ? -47.767 29.770  23.850  1.00 103.65 ? 57  PRO A O     1 
ATOM   301  C  CB    . PRO A 1 38  ? -48.489 31.353  21.042  1.00 98.07  ? 57  PRO A CB    1 
ATOM   302  C  CG    . PRO A 1 38  ? -49.842 31.496  20.520  1.00 96.30  ? 57  PRO A CG    1 
ATOM   303  C  CD    . PRO A 1 38  ? -50.695 30.796  21.532  1.00 104.15 ? 57  PRO A CD    1 
ATOM   304  N  N     . GLY A 1 39  ? -46.101 29.651  22.338  1.00 96.45  ? 58  GLY A N     1 
ATOM   305  C  CA    . GLY A 1 39  ? -45.595 29.815  20.982  1.00 89.38  ? 58  GLY A CA    1 
ATOM   306  C  C     . GLY A 1 39  ? -45.557 28.593  20.086  1.00 82.65  ? 58  GLY A C     1 
ATOM   307  O  O     . GLY A 1 39  ? -45.168 28.689  18.922  1.00 78.49  ? 58  GLY A O     1 
ATOM   308  N  N     . VAL A 1 40  ? -45.965 27.448  20.616  1.00 83.97  ? 59  VAL A N     1 
ATOM   309  C  CA    . VAL A 1 40  ? -45.886 26.201  19.844  1.00 78.51  ? 59  VAL A CA    1 
ATOM   310  C  C     . VAL A 1 40  ? -46.959 26.207  18.762  1.00 75.42  ? 59  VAL A C     1 
ATOM   311  O  O     . VAL A 1 40  ? -48.110 26.596  19.040  1.00 80.20  ? 59  VAL A O     1 
ATOM   312  C  CB    . VAL A 1 40  ? -46.043 24.994  20.771  1.00 84.92  ? 59  VAL A CB    1 
ATOM   313  C  CG1   . VAL A 1 40  ? -45.943 23.700  19.979  1.00 73.04  ? 59  VAL A CG1   1 
ATOM   314  C  CG2   . VAL A 1 40  ? -44.992 25.032  21.874  1.00 79.19  ? 59  VAL A CG2   1 
ATOM   315  N  N     . PRO A 1 41  ? -46.647 25.808  17.532  1.00 65.75  ? 60  PRO A N     1 
ATOM   316  C  CA    . PRO A 1 41  ? -47.689 25.713  16.506  1.00 58.17  ? 60  PRO A CA    1 
ATOM   317  C  C     . PRO A 1 41  ? -48.583 24.507  16.738  1.00 59.15  ? 60  PRO A C     1 
ATOM   318  O  O     . PRO A 1 41  ? -48.256 23.580  17.482  1.00 62.55  ? 60  PRO A O     1 
ATOM   319  C  CB    . PRO A 1 41  ? -46.898 25.570  15.203  1.00 53.84  ? 60  PRO A CB    1 
ATOM   320  C  CG    . PRO A 1 41  ? -45.608 24.950  15.624  1.00 56.97  ? 60  PRO A CG    1 
ATOM   321  C  CD    . PRO A 1 41  ? -45.309 25.516  16.988  1.00 61.24  ? 60  PRO A CD    1 
ATOM   322  N  N     . GLN A 1 42  ? -49.732 24.535  16.073  1.00 55.45  ? 61  GLN A N     1 
ATOM   323  C  CA    . GLN A 1 42  ? -50.701 23.459  16.202  1.00 47.34  ? 61  GLN A CA    1 
ATOM   324  C  C     . GLN A 1 42  ? -50.205 22.196  15.509  1.00 47.77  ? 61  GLN A C     1 
ATOM   325  O  O     . GLN A 1 42  ? -49.613 22.249  14.427  1.00 46.58  ? 61  GLN A O     1 
ATOM   326  C  CB    . GLN A 1 42  ? -52.044 23.892  15.615  1.00 52.12  ? 61  GLN A CB    1 
ATOM   327  C  CG    . GLN A 1 42  ? -52.913 22.739  15.150  1.00 62.66  ? 61  GLN A CG    1 
ATOM   328  C  CD    . GLN A 1 42  ? -54.364 23.128  14.978  1.00 77.16  ? 61  GLN A CD    1 
ATOM   329  O  OE1   . GLN A 1 42  ? -55.246 22.562  15.623  1.00 89.30  ? 61  GLN A OE1   1 
ATOM   330  N  NE2   . GLN A 1 42  ? -54.622 24.097  14.105  1.00 71.67  ? 61  GLN A NE2   1 
ATOM   331  N  N     . VAL A 1 43  ? -50.440 21.055  16.149  1.00 47.92  ? 62  VAL A N     1 
ATOM   332  C  CA    . VAL A 1 43  ? -50.160 19.753  15.560  1.00 41.84  ? 62  VAL A CA    1 
ATOM   333  C  C     . VAL A 1 43  ? -51.408 19.280  14.831  1.00 51.89  ? 62  VAL A C     1 
ATOM   334  O  O     . VAL A 1 43  ? -52.511 19.305  15.391  1.00 55.66  ? 62  VAL A O     1 
ATOM   335  C  CB    . VAL A 1 43  ? -49.737 18.745  16.639  1.00 42.44  ? 62  VAL A CB    1 
ATOM   336  C  CG1   . VAL A 1 43  ? -49.505 17.372  16.023  1.00 42.02  ? 62  VAL A CG1   1 
ATOM   337  C  CG2   . VAL A 1 43  ? -48.496 19.240  17.367  1.00 41.69  ? 62  VAL A CG2   1 
ATOM   338  N  N     . VAL A 1 44  ? -51.246 18.855  13.581  1.00 48.68  ? 63  VAL A N     1 
ATOM   339  C  CA    . VAL A 1 44  ? -52.364 18.372  12.782  1.00 50.90  ? 63  VAL A CA    1 
ATOM   340  C  C     . VAL A 1 44  ? -52.094 16.931  12.383  1.00 52.29  ? 63  VAL A C     1 
ATOM   341  O  O     . VAL A 1 44  ? -50.943 16.508  12.253  1.00 51.61  ? 63  VAL A O     1 
ATOM   342  C  CB    . VAL A 1 44  ? -52.613 19.247  11.532  1.00 49.33  ? 63  VAL A CB    1 
ATOM   343  C  CG1   . VAL A 1 44  ? -53.248 20.570  11.928  1.00 50.75  ? 63  VAL A CG1   1 
ATOM   344  C  CG2   . VAL A 1 44  ? -51.317 19.485  10.786  1.00 46.49  ? 63  VAL A CG2   1 
ATOM   345  N  N     . ARG A 1 45  ? -53.167 16.172  12.204  1.00 50.01  ? 64  ARG A N     1 
ATOM   346  C  CA    . ARG A 1 45  ? -53.053 14.799  11.742  1.00 51.63  ? 64  ARG A CA    1 
ATOM   347  C  C     . ARG A 1 45  ? -52.850 14.779  10.231  1.00 51.40  ? 64  ARG A C     1 
ATOM   348  O  O     . ARG A 1 45  ? -53.477 15.548  9.498   1.00 48.68  ? 64  ARG A O     1 
ATOM   349  C  CB    . ARG A 1 45  ? -54.308 14.013  12.128  1.00 56.19  ? 64  ARG A CB    1 
ATOM   350  C  CG    . ARG A 1 45  ? -54.326 12.569  11.672  1.00 61.70  ? 64  ARG A CG    1 
ATOM   351  C  CD    . ARG A 1 45  ? -53.366 11.698  12.472  1.00 60.27  ? 64  ARG A CD    1 
ATOM   352  N  NE    . ARG A 1 45  ? -52.513 10.915  11.583  1.00 65.06  ? 64  ARG A NE    1 
ATOM   353  C  CZ    . ARG A 1 45  ? -52.908 9.822   10.937  1.00 66.15  ? 64  ARG A CZ    1 
ATOM   354  N  NH1   . ARG A 1 45  ? -52.062 9.179   10.140  1.00 57.05  ? 64  ARG A NH1   1 
ATOM   355  N  NH2   . ARG A 1 45  ? -54.148 9.372   11.086  1.00 72.35  ? 64  ARG A NH2   1 
ATOM   356  N  N     . PHE A 1 46  ? -51.964 13.903  9.762   1.00 48.38  ? 65  PHE A N     1 
ATOM   357  C  CA    . PHE A 1 46  ? -51.668 13.814  8.337   1.00 50.73  ? 65  PHE A CA    1 
ATOM   358  C  C     . PHE A 1 46  ? -52.237 12.520  7.777   1.00 52.28  ? 65  PHE A C     1 
ATOM   359  O  O     . PHE A 1 46  ? -51.779 11.433  8.162   1.00 54.22  ? 65  PHE A O     1 
ATOM   360  C  CB    . PHE A 1 46  ? -50.159 13.888  8.087   1.00 42.85  ? 65  PHE A CB    1 
ATOM   361  C  CG    . PHE A 1 46  ? -49.773 13.632  6.656   1.00 43.30  ? 65  PHE A CG    1 
ATOM   362  C  CD1   . PHE A 1 46  ? -49.806 14.654  5.722   1.00 42.65  ? 65  PHE A CD1   1 
ATOM   363  C  CD2   . PHE A 1 46  ? -49.387 12.369  6.243   1.00 42.79  ? 65  PHE A CD2   1 
ATOM   364  C  CE1   . PHE A 1 46  ? -49.460 14.421  4.406   1.00 42.24  ? 65  PHE A CE1   1 
ATOM   365  C  CE2   . PHE A 1 46  ? -49.041 12.129  4.927   1.00 43.10  ? 65  PHE A CE2   1 
ATOM   366  C  CZ    . PHE A 1 46  ? -49.077 13.154  4.009   1.00 40.48  ? 65  PHE A CZ    1 
ATOM   367  N  N     . PRO A 1 47  ? -53.214 12.578  6.873   1.00 55.22  ? 66  PRO A N     1 
ATOM   368  C  CA    . PRO A 1 47  ? -53.821 11.342  6.355   1.00 53.15  ? 66  PRO A CA    1 
ATOM   369  C  C     . PRO A 1 47  ? -52.862 10.589  5.442   1.00 50.96  ? 66  PRO A C     1 
ATOM   370  O  O     . PRO A 1 47  ? -52.314 11.151  4.491   1.00 48.00  ? 66  PRO A O     1 
ATOM   371  C  CB    . PRO A 1 47  ? -55.052 11.842  5.587   1.00 54.44  ? 66  PRO A CB    1 
ATOM   372  C  CG    . PRO A 1 47  ? -55.284 13.246  6.081   1.00 61.20  ? 66  PRO A CG    1 
ATOM   373  C  CD    . PRO A 1 47  ? -53.926 13.780  6.409   1.00 57.31  ? 66  PRO A CD    1 
ATOM   374  N  N     . LEU A 1 48  ? -52.683 9.305   5.727   1.00 51.66  ? 67  LEU A N     1 
ATOM   375  C  CA    . LEU A 1 48  ? -51.792 8.445   4.962   1.00 49.50  ? 67  LEU A CA    1 
ATOM   376  C  C     . LEU A 1 48  ? -52.559 7.647   3.915   1.00 61.51  ? 67  LEU A C     1 
ATOM   377  O  O     . LEU A 1 48  ? -53.787 7.541   3.947   1.00 63.09  ? 67  LEU A O     1 
ATOM   378  C  CB    . LEU A 1 48  ? -51.043 7.488   5.889   1.00 44.95  ? 67  LEU A CB    1 
ATOM   379  C  CG    . LEU A 1 48  ? -49.941 8.114   6.735   1.00 43.92  ? 67  LEU A CG    1 
ATOM   380  C  CD1   . LEU A 1 48  ? -49.425 7.118   7.747   1.00 44.02  ? 67  LEU A CD1   1 
ATOM   381  C  CD2   . LEU A 1 48  ? -48.814 8.592   5.837   1.00 48.61  ? 67  LEU A CD2   1 
ATOM   382  N  N     . ASN A 1 49  ? -51.802 7.080   2.977   1.00 61.93  ? 68  ASN A N     1 
ATOM   383  C  CA    . ASN A 1 49  ? -52.344 6.194   1.949   1.00 60.90  ? 68  ASN A CA    1 
ATOM   384  C  C     . ASN A 1 49  ? -52.290 4.771   2.490   1.00 60.58  ? 68  ASN A C     1 
ATOM   385  O  O     . ASN A 1 49  ? -51.325 4.035   2.275   1.00 61.43  ? 68  ASN A O     1 
ATOM   386  C  CB    . ASN A 1 49  ? -51.561 6.334   0.652   1.00 62.01  ? 68  ASN A CB    1 
ATOM   387  C  CG    . ASN A 1 49  ? -51.846 7.637   -0.062  1.00 71.94  ? 68  ASN A CG    1 
ATOM   388  O  OD1   . ASN A 1 49  ? -52.512 8.524   0.478   1.00 81.36  ? 68  ASN A OD1   1 
ATOM   389  N  ND2   . ASN A 1 49  ? -51.343 7.763   -1.286  1.00 66.53  ? 68  ASN A ND2   1 
ATOM   390  N  N     . VAL A 1 50  ? -53.352 4.380   3.197   1.00 58.42  ? 69  VAL A N     1 
ATOM   391  C  CA    . VAL A 1 50  ? -53.367 3.095   3.891   1.00 59.03  ? 69  VAL A CA    1 
ATOM   392  C  C     . VAL A 1 50  ? -53.298 1.935   2.901   1.00 61.50  ? 69  VAL A C     1 
ATOM   393  O  O     . VAL A 1 50  ? -52.662 0.908   3.171   1.00 65.06  ? 69  VAL A O     1 
ATOM   394  C  CB    . VAL A 1 50  ? -54.612 3.010   4.792   1.00 60.10  ? 69  VAL A CB    1 
ATOM   395  C  CG1   . VAL A 1 50  ? -54.815 1.596   5.303   1.00 61.66  ? 69  VAL A CG1   1 
ATOM   396  C  CG2   . VAL A 1 50  ? -54.488 3.992   5.951   1.00 51.22  ? 69  VAL A CG2   1 
ATOM   397  N  N     . SER A 1 51  ? -53.927 2.080   1.740   1.00 55.66  ? 70  SER A N     1 
ATOM   398  C  CA    . SER A 1 51  ? -53.996 0.996   0.769   1.00 55.97  ? 70  SER A CA    1 
ATOM   399  C  C     . SER A 1 51  ? -52.830 0.984   -0.211  1.00 56.62  ? 70  SER A C     1 
ATOM   400  O  O     . SER A 1 51  ? -52.782 0.106   -1.079  1.00 61.01  ? 70  SER A O     1 
ATOM   401  C  CB    . SER A 1 51  ? -55.315 1.077   -0.006  1.00 59.33  ? 70  SER A CB    1 
ATOM   402  O  OG    . SER A 1 51  ? -55.521 2.385   -0.514  1.00 62.50  ? 70  SER A OG    1 
ATOM   403  N  N     . SER A 1 52  ? -51.888 1.920   -0.095  1.00 56.25  ? 71  SER A N     1 
ATOM   404  C  CA    . SER A 1 52  ? -50.816 2.025   -1.078  1.00 59.07  ? 71  SER A CA    1 
ATOM   405  C  C     . SER A 1 52  ? -49.689 1.026   -0.854  1.00 53.37  ? 71  SER A C     1 
ATOM   406  O  O     . SER A 1 52  ? -48.908 0.781   -1.780  1.00 53.62  ? 71  SER A O     1 
ATOM   407  C  CB    . SER A 1 52  ? -50.242 3.443   -1.082  1.00 64.32  ? 71  SER A CB    1 
ATOM   408  O  OG    . SER A 1 52  ? -51.148 4.351   -1.683  1.00 73.95  ? 71  SER A OG    1 
ATOM   409  N  N     . VAL A 1 53  ? -49.573 0.458   0.342   1.00 45.36  ? 72  VAL A N     1 
ATOM   410  C  CA    . VAL A 1 53  ? -48.514 -0.494  0.658   1.00 54.32  ? 72  VAL A CA    1 
ATOM   411  C  C     . VAL A 1 53  ? -49.157 -1.722  1.282   1.00 55.74  ? 72  VAL A C     1 
ATOM   412  O  O     . VAL A 1 53  ? -49.859 -1.612  2.295   1.00 53.00  ? 72  VAL A O     1 
ATOM   413  C  CB    . VAL A 1 53  ? -47.457 0.098   1.609   1.00 56.87  ? 72  VAL A CB    1 
ATOM   414  C  CG1   . VAL A 1 53  ? -46.377 -0.933  1.904   1.00 52.00  ? 72  VAL A CG1   1 
ATOM   415  C  CG2   . VAL A 1 53  ? -46.842 1.358   1.015   1.00 52.09  ? 72  VAL A CG2   1 
ATOM   416  N  N     . THR A 1 54  ? -48.922 -2.885  0.680   1.00 54.13  ? 73  THR A N     1 
ATOM   417  C  CA    . THR A 1 54  ? -49.432 -4.126  1.244   1.00 56.92  ? 73  THR A CA    1 
ATOM   418  C  C     . THR A 1 54  ? -48.752 -4.413  2.576   1.00 59.99  ? 73  THR A C     1 
ATOM   419  O  O     . THR A 1 54  ? -47.570 -4.113  2.772   1.00 57.80  ? 73  THR A O     1 
ATOM   420  C  CB    . THR A 1 54  ? -49.199 -5.293  0.287   1.00 51.61  ? 73  THR A CB    1 
ATOM   421  O  OG1   . THR A 1 54  ? -47.796 -5.578  0.215   1.00 50.34  ? 73  THR A OG1   1 
ATOM   422  C  CG2   . THR A 1 54  ? -49.711 -4.952  -1.104  1.00 50.17  ? 73  THR A CG2   1 
ATOM   423  N  N     . GLU A 1 55  ? -49.516 -5.000  3.502   1.00 58.43  ? 74  GLU A N     1 
ATOM   424  C  CA    . GLU A 1 55  ? -48.958 -5.334  4.807   1.00 56.53  ? 74  GLU A CA    1 
ATOM   425  C  C     . GLU A 1 55  ? -47.742 -6.244  4.680   1.00 61.55  ? 74  GLU A C     1 
ATOM   426  O  O     . GLU A 1 55  ? -46.845 -6.202  5.530   1.00 64.32  ? 74  GLU A O     1 
ATOM   427  C  CB    . GLU A 1 55  ? -50.029 -5.980  5.686   1.00 56.32  ? 74  GLU A CB    1 
ATOM   428  C  CG    . GLU A 1 55  ? -51.253 -5.096  5.907   1.00 67.05  ? 74  GLU A CG    1 
ATOM   429  C  CD    . GLU A 1 55  ? -52.151 -5.600  7.025   1.00 73.32  ? 74  GLU A CD    1 
ATOM   430  O  OE1   . GLU A 1 55  ? -53.074 -4.861  7.434   1.00 73.37  ? 74  GLU A OE1   1 
ATOM   431  O  OE2   . GLU A 1 55  ? -51.930 -6.734  7.498   1.00 77.20  ? 74  GLU A OE2   1 
ATOM   432  N  N     . ARG A 1 56  ? -47.676 -7.049  3.617   1.00 58.84  ? 75  ARG A N     1 
ATOM   433  C  CA    . ARG A 1 56  ? -46.521 -7.921  3.428   1.00 57.89  ? 75  ARG A CA    1 
ATOM   434  C  C     . ARG A 1 56  ? -45.287 -7.125  3.021   1.00 58.43  ? 75  ARG A C     1 
ATOM   435  O  O     . ARG A 1 56  ? -44.177 -7.408  3.490   1.00 56.41  ? 75  ARG A O     1 
ATOM   436  C  CB    . ARG A 1 56  ? -46.836 -8.997  2.389   1.00 52.36  ? 75  ARG A CB    1 
ATOM   437  C  CG    . ARG A 1 56  ? -45.691 -9.969  2.149   1.00 51.25  ? 75  ARG A CG    1 
ATOM   438  C  CD    . ARG A 1 56  ? -46.090 -11.094 1.210   1.00 52.40  ? 75  ARG A CD    1 
ATOM   439  N  NE    . ARG A 1 56  ? -44.978 -12.009 0.969   1.00 51.31  ? 75  ARG A NE    1 
ATOM   440  C  CZ    . ARG A 1 56  ? -44.705 -13.065 1.730   1.00 59.49  ? 75  ARG A CZ    1 
ATOM   441  N  NH1   . ARG A 1 56  ? -45.466 -13.346 2.781   1.00 50.50  ? 75  ARG A NH1   1 
ATOM   442  N  NH2   . ARG A 1 56  ? -43.670 -13.843 1.440   1.00 54.81  ? 75  ARG A NH2   1 
ATOM   443  N  N     . ASP A 1 57  ? -45.455 -6.133  2.143   1.00 60.26  ? 76  ASP A N     1 
ATOM   444  C  CA    . ASP A 1 57  ? -44.336 -5.261  1.801   1.00 57.83  ? 76  ASP A CA    1 
ATOM   445  C  C     . ASP A 1 57  ? -43.861 -4.475  3.017   1.00 51.13  ? 76  ASP A C     1 
ATOM   446  O  O     . ASP A 1 57  ? -42.658 -4.244  3.184   1.00 47.81  ? 76  ASP A O     1 
ATOM   447  C  CB    . ASP A 1 57  ? -44.731 -4.316  0.667   1.00 54.20  ? 76  ASP A CB    1 
ATOM   448  C  CG    . ASP A 1 57  ? -44.603 -4.963  -0.698  1.00 58.91  ? 76  ASP A CG    1 
ATOM   449  O  OD1   . ASP A 1 57  ? -43.612 -5.693  -0.915  1.00 51.35  ? 76  ASP A OD1   1 
ATOM   450  O  OD2   . ASP A 1 57  ? -45.490 -4.744  -1.553  1.00 60.85  ? 76  ASP A OD2   1 
ATOM   451  N  N     . ALA A 1 58  ? -44.792 -4.064  3.882   1.00 49.50  ? 77  ALA A N     1 
ATOM   452  C  CA    . ALA A 1 58  ? -44.405 -3.363  5.100   1.00 51.94  ? 77  ALA A CA    1 
ATOM   453  C  C     . ALA A 1 58  ? -43.660 -4.287  6.055   1.00 57.60  ? 77  ALA A C     1 
ATOM   454  O  O     . ALA A 1 58  ? -42.684 -3.874  6.693   1.00 58.22  ? 77  ALA A O     1 
ATOM   455  C  CB    . ALA A 1 58  ? -45.639 -2.767  5.776   1.00 46.61  ? 77  ALA A CB    1 
ATOM   456  N  N     . GLU A 1 59  ? -44.094 -5.547  6.154   1.00 59.42  ? 78  GLU A N     1 
ATOM   457  C  CA    . GLU A 1 59  ? -43.457 -6.479  7.077   1.00 56.05  ? 78  GLU A CA    1 
ATOM   458  C  C     . GLU A 1 59  ? -42.082 -6.910  6.588   1.00 54.19  ? 78  GLU A C     1 
ATOM   459  O  O     . GLU A 1 59  ? -41.175 -7.114  7.402   1.00 59.22  ? 78  GLU A O     1 
ATOM   460  C  CB    . GLU A 1 59  ? -44.352 -7.699  7.297   1.00 66.08  ? 78  GLU A CB    1 
ATOM   461  C  CG    . GLU A 1 59  ? -43.804 -8.692  8.313   1.00 68.01  ? 78  GLU A CG    1 
ATOM   462  C  CD    . GLU A 1 59  ? -44.872 -9.608  8.878   1.00 77.08  ? 78  GLU A CD    1 
ATOM   463  O  OE1   . GLU A 1 59  ? -46.059 -9.211  8.882   1.00 71.69  ? 78  GLU A OE1   1 
ATOM   464  O  OE2   . GLU A 1 59  ? -44.522 -10.725 9.318   1.00 83.00  ? 78  GLU A OE2   1 
ATOM   465  N  N     . ARG A 1 60  ? -41.900 -7.045  5.272   1.00 48.69  ? 79  ARG A N     1 
ATOM   466  C  CA    . ARG A 1 60  ? -40.598 -7.437  4.748   1.00 48.57  ? 79  ARG A CA    1 
ATOM   467  C  C     . ARG A 1 60  ? -39.498 -6.453  5.127   1.00 55.66  ? 79  ARG A C     1 
ATOM   468  O  O     . ARG A 1 60  ? -38.324 -6.839  5.160   1.00 57.11  ? 79  ARG A O     1 
ATOM   469  C  CB    . ARG A 1 60  ? -40.662 -7.583  3.228   1.00 52.73  ? 79  ARG A CB    1 
ATOM   470  C  CG    . ARG A 1 60  ? -41.456 -8.785  2.741   1.00 56.63  ? 79  ARG A CG    1 
ATOM   471  C  CD    . ARG A 1 60  ? -41.615 -8.747  1.236   1.00 49.76  ? 79  ARG A CD    1 
ATOM   472  N  NE    . ARG A 1 60  ? -40.329 -8.780  0.544   1.00 53.34  ? 79  ARG A NE    1 
ATOM   473  C  CZ    . ARG A 1 60  ? -40.156 -8.393  -0.717  1.00 56.38  ? 79  ARG A CZ    1 
ATOM   474  N  NH1   . ARG A 1 60  ? -41.186 -7.932  -1.417  1.00 54.98  ? 79  ARG A NH1   1 
ATOM   475  N  NH2   . ARG A 1 60  ? -38.955 -8.455  -1.275  1.00 47.50  ? 79  ARG A NH2   1 
ATOM   476  N  N     . VAL A 1 61  ? -39.844 -5.196  5.410   1.00 54.82  ? 80  VAL A N     1 
ATOM   477  C  CA    . VAL A 1 61  ? -38.872 -4.191  5.826   1.00 52.65  ? 80  VAL A CA    1 
ATOM   478  C  C     . VAL A 1 61  ? -39.046 -3.798  7.286   1.00 50.85  ? 80  VAL A C     1 
ATOM   479  O  O     . VAL A 1 61  ? -38.392 -2.856  7.748   1.00 51.98  ? 80  VAL A O     1 
ATOM   480  C  CB    . VAL A 1 61  ? -38.916 -2.947  4.923   1.00 45.14  ? 80  VAL A CB    1 
ATOM   481  C  CG1   . VAL A 1 61  ? -38.560 -3.318  3.504   1.00 49.39  ? 80  VAL A CG1   1 
ATOM   482  C  CG2   . VAL A 1 61  ? -40.282 -2.283  4.981   1.00 43.79  ? 80  VAL A CG2   1 
ATOM   483  N  N     . GLY A 1 62  ? -39.919 -4.483  8.021   1.00 51.35  ? 81  GLY A N     1 
ATOM   484  C  CA    . GLY A 1 62  ? -40.030 -4.304  9.455   1.00 45.30  ? 81  GLY A CA    1 
ATOM   485  C  C     . GLY A 1 62  ? -41.047 -3.288  9.920   1.00 50.92  ? 81  GLY A C     1 
ATOM   486  O  O     . GLY A 1 62  ? -41.038 -2.928  11.104  1.00 48.66  ? 81  GLY A O     1 
ATOM   487  N  N     . LEU A 1 63  ? -41.929 -2.824  9.045   1.00 49.69  ? 82  LEU A N     1 
ATOM   488  C  CA    . LEU A 1 63  ? -42.874 -1.772  9.386   1.00 47.04  ? 82  LEU A CA    1 
ATOM   489  C  C     . LEU A 1 63  ? -44.236 -2.355  9.735   1.00 50.77  ? 82  LEU A C     1 
ATOM   490  O  O     . LEU A 1 63  ? -44.643 -3.390  9.205   1.00 53.36  ? 82  LEU A O     1 
ATOM   491  C  CB    . LEU A 1 63  ? -43.021 -0.787  8.226   1.00 46.08  ? 82  LEU A CB    1 
ATOM   492  C  CG    . LEU A 1 63  ? -41.732 -0.075  7.804   1.00 49.12  ? 82  LEU A CG    1 
ATOM   493  C  CD1   . LEU A 1 63  ? -41.886 0.664   6.474   1.00 45.51  ? 82  LEU A CD1   1 
ATOM   494  C  CD2   . LEU A 1 63  ? -41.275 0.879   8.897   1.00 40.81  ? 82  LEU A CD2   1 
ATOM   495  N  N     . GLU A 1 64  ? -44.941 -1.675  10.638  1.00 49.12  ? 83  GLU A N     1 
ATOM   496  C  CA    . GLU A 1 64  ? -46.334 -1.995  10.882  1.00 51.40  ? 83  GLU A CA    1 
ATOM   497  C  C     . GLU A 1 64  ? -47.142 -1.767  9.607   1.00 60.21  ? 83  GLU A C     1 
ATOM   498  O  O     . GLU A 1 64  ? -46.665 -1.143  8.653   1.00 57.79  ? 83  GLU A O     1 
ATOM   499  C  CB    . GLU A 1 64  ? -46.897 -1.128  12.009  1.00 51.27  ? 83  GLU A CB    1 
ATOM   500  C  CG    . GLU A 1 64  ? -46.231 -1.323  13.346  1.00 58.94  ? 83  GLU A CG    1 
ATOM   501  C  CD    . GLU A 1 64  ? -46.634 -2.618  14.020  1.00 64.27  ? 83  GLU A CD    1 
ATOM   502  O  OE1   . GLU A 1 64  ? -45.901 -3.061  14.930  1.00 68.14  ? 83  GLU A OE1   1 
ATOM   503  O  OE2   . GLU A 1 64  ? -47.677 -3.194  13.648  1.00 68.00  ? 83  GLU A OE2   1 
ATOM   504  N  N     . PRO A 1 65  ? -48.369 -2.280  9.567   1.00 59.02  ? 84  PRO A N     1 
ATOM   505  C  CA    . PRO A 1 65  ? -49.280 -1.917  8.480   1.00 52.68  ? 84  PRO A CA    1 
ATOM   506  C  C     . PRO A 1 65  ? -49.566 -0.426  8.496   1.00 52.14  ? 84  PRO A C     1 
ATOM   507  O  O     . PRO A 1 65  ? -49.744 0.179   9.556   1.00 56.54  ? 84  PRO A O     1 
ATOM   508  C  CB    . PRO A 1 65  ? -50.536 -2.736  8.785   1.00 59.31  ? 84  PRO A CB    1 
ATOM   509  C  CG    . PRO A 1 65  ? -50.034 -3.888  9.600   1.00 63.47  ? 84  PRO A CG    1 
ATOM   510  C  CD    . PRO A 1 65  ? -48.943 -3.316  10.440  1.00 58.99  ? 84  PRO A CD    1 
ATOM   511  N  N     . VAL A 1 66  ? -49.626 0.163   7.297   1.00 50.48  ? 85  VAL A N     1 
ATOM   512  C  CA    . VAL A 1 66  ? -49.841 1.602   7.175   1.00 49.46  ? 85  VAL A CA    1 
ATOM   513  C  C     . VAL A 1 66  ? -51.140 2.019   7.850   1.00 54.97  ? 85  VAL A C     1 
ATOM   514  O  O     . VAL A 1 66  ? -51.277 3.166   8.294   1.00 53.73  ? 85  VAL A O     1 
ATOM   515  C  CB    . VAL A 1 66  ? -49.811 2.010   5.691   1.00 54.22  ? 85  VAL A CB    1 
ATOM   516  C  CG1   . VAL A 1 66  ? -49.886 3.524   5.548   1.00 54.67  ? 85  VAL A CG1   1 
ATOM   517  C  CG2   . VAL A 1 66  ? -48.560 1.463   5.024   1.00 44.25  ? 85  VAL A CG2   1 
ATOM   518  N  N     . SER A 1 67  ? -52.105 1.102   7.957   1.00 56.46  ? 86  SER A N     1 
ATOM   519  C  CA    . SER A 1 67  ? -53.336 1.400   8.679   1.00 53.15  ? 86  SER A CA    1 
ATOM   520  C  C     . SER A 1 67  ? -53.081 1.702   10.148  1.00 54.39  ? 86  SER A C     1 
ATOM   521  O  O     . SER A 1 67  ? -53.899 2.379   10.779  1.00 60.39  ? 86  SER A O     1 
ATOM   522  C  CB    . SER A 1 67  ? -54.317 0.233   8.556   1.00 55.28  ? 86  SER A CB    1 
ATOM   523  O  OG    . SER A 1 67  ? -53.784 -0.949  9.128   1.00 61.40  ? 86  SER A OG    1 
ATOM   524  N  N     . LYS A 1 68  ? -51.967 1.225   10.702  1.00 54.46  ? 87  LYS A N     1 
ATOM   525  C  CA    . LYS A 1 68  ? -51.656 1.431   12.110  1.00 57.26  ? 87  LYS A CA    1 
ATOM   526  C  C     . LYS A 1 68  ? -50.764 2.641   12.362  1.00 57.06  ? 87  LYS A C     1 
ATOM   527  O  O     . LYS A 1 68  ? -50.650 3.074   13.515  1.00 53.81  ? 87  LYS A O     1 
ATOM   528  C  CB    . LYS A 1 68  ? -50.992 0.179   12.693  1.00 56.66  ? 87  LYS A CB    1 
ATOM   529  C  CG    . LYS A 1 68  ? -51.962 -0.957  12.986  1.00 63.15  ? 87  LYS A CG    1 
ATOM   530  C  CD    . LYS A 1 68  ? -51.249 -2.145  13.615  1.00 70.79  ? 87  LYS A CD    1 
ATOM   531  C  CE    . LYS A 1 68  ? -52.238 -3.157  14.185  1.00 74.31  ? 87  LYS A CE    1 
ATOM   532  N  NZ    . LYS A 1 68  ? -53.194 -3.664  13.161  1.00 60.06  ? 87  LYS A NZ    1 
ATOM   533  N  N     . TRP A 1 69  ? -50.132 3.193   11.330  1.00 51.91  ? 88  TRP A N     1 
ATOM   534  C  CA    . TRP A 1 69  ? -49.282 4.358   11.523  1.00 44.89  ? 88  TRP A CA    1 
ATOM   535  C  C     . TRP A 1 69  ? -50.114 5.566   11.933  1.00 47.25  ? 88  TRP A C     1 
ATOM   536  O  O     . TRP A 1 69  ? -51.281 5.706   11.558  1.00 49.16  ? 88  TRP A O     1 
ATOM   537  C  CB    . TRP A 1 69  ? -48.513 4.704   10.245  1.00 42.42  ? 88  TRP A CB    1 
ATOM   538  C  CG    . TRP A 1 69  ? -47.624 3.632   9.699   1.00 41.10  ? 88  TRP A CG    1 
ATOM   539  C  CD1   . TRP A 1 69  ? -47.534 2.337   10.116  1.00 43.17  ? 88  TRP A CD1   1 
ATOM   540  C  CD2   . TRP A 1 69  ? -46.696 3.770   8.617   1.00 43.02  ? 88  TRP A CD2   1 
ATOM   541  N  NE1   . TRP A 1 69  ? -46.610 1.659   9.357   1.00 45.97  ? 88  TRP A NE1   1 
ATOM   542  C  CE2   . TRP A 1 69  ? -46.082 2.518   8.430   1.00 42.30  ? 88  TRP A CE2   1 
ATOM   543  C  CE3   . TRP A 1 69  ? -46.328 4.832   7.785   1.00 41.90  ? 88  TRP A CE3   1 
ATOM   544  C  CZ2   . TRP A 1 69  ? -45.118 2.299   7.449   1.00 43.01  ? 88  TRP A CZ2   1 
ATOM   545  C  CZ3   . TRP A 1 69  ? -45.372 4.614   6.814   1.00 38.70  ? 88  TRP A CZ3   1 
ATOM   546  C  CH2   . TRP A 1 69  ? -44.778 3.357   6.652   1.00 43.23  ? 88  TRP A CH2   1 
ATOM   547  N  N     . ARG A 1 70  ? -49.495 6.443   12.716  1.00 48.38  ? 89  ARG A N     1 
ATOM   548  C  CA    . ARG A 1 70  ? -50.024 7.769   13.002  1.00 51.13  ? 89  ARG A CA    1 
ATOM   549  C  C     . ARG A 1 70  ? -48.991 8.784   12.537  1.00 51.66  ? 89  ARG A C     1 
ATOM   550  O  O     . ARG A 1 70  ? -47.832 8.726   12.958  1.00 54.35  ? 89  ARG A O     1 
ATOM   551  C  CB    . ARG A 1 70  ? -50.331 7.937   14.491  1.00 51.29  ? 89  ARG A CB    1 
ATOM   552  C  CG    . ARG A 1 70  ? -51.525 7.127   14.966  1.00 56.79  ? 89  ARG A CG    1 
ATOM   553  C  CD    . ARG A 1 70  ? -52.775 7.485   14.169  1.00 65.23  ? 89  ARG A CD    1 
ATOM   554  N  NE    . ARG A 1 70  ? -53.944 6.707   14.577  1.00 67.91  ? 89  ARG A NE    1 
ATOM   555  C  CZ    . ARG A 1 70  ? -54.309 5.554   14.022  1.00 66.42  ? 89  ARG A CZ    1 
ATOM   556  N  NH1   . ARG A 1 70  ? -55.389 4.920   14.459  1.00 65.65  ? 89  ARG A NH1   1 
ATOM   557  N  NH2   . ARG A 1 70  ? -53.597 5.033   13.031  1.00 57.75  ? 89  ARG A NH2   1 
ATOM   558  N  N     . ALA A 1 71  ? -49.400 9.693   11.658  1.00 52.38  ? 90  ALA A N     1 
ATOM   559  C  CA    . ALA A 1 71  ? -48.510 10.704  11.111  1.00 42.23  ? 90  ALA A CA    1 
ATOM   560  C  C     . ALA A 1 71  ? -49.057 12.089  11.420  1.00 48.47  ? 90  ALA A C     1 
ATOM   561  O  O     . ALA A 1 71  ? -50.272 12.298  11.470  1.00 51.59  ? 90  ALA A O     1 
ATOM   562  C  CB    . ALA A 1 71  ? -48.335 10.533  9.600   1.00 38.35  ? 90  ALA A CB    1 
ATOM   563  N  N     . TYR A 1 72  ? -48.153 13.045  11.610  1.00 41.37  ? 91  TYR A N     1 
ATOM   564  C  CA    . TYR A 1 72  ? -48.554 14.390  11.987  1.00 39.11  ? 91  TYR A CA    1 
ATOM   565  C  C     . TYR A 1 72  ? -47.754 15.423  11.208  1.00 43.85  ? 91  TYR A C     1 
ATOM   566  O  O     . TYR A 1 72  ? -46.647 15.157  10.734  1.00 43.86  ? 91  TYR A O     1 
ATOM   567  C  CB    . TYR A 1 72  ? -48.373 14.621  13.493  1.00 40.72  ? 91  TYR A CB    1 
ATOM   568  C  CG    . TYR A 1 72  ? -49.041 13.568  14.349  1.00 49.64  ? 91  TYR A CG    1 
ATOM   569  C  CD1   . TYR A 1 72  ? -48.359 12.416  14.722  1.00 46.82  ? 91  TYR A CD1   1 
ATOM   570  C  CD2   . TYR A 1 72  ? -50.352 13.723  14.782  1.00 51.53  ? 91  TYR A CD2   1 
ATOM   571  C  CE1   . TYR A 1 72  ? -48.962 11.451  15.498  1.00 51.63  ? 91  TYR A CE1   1 
ATOM   572  C  CE2   . TYR A 1 72  ? -50.964 12.759  15.561  1.00 52.72  ? 91  TYR A CE2   1 
ATOM   573  C  CZ    . TYR A 1 72  ? -50.264 11.627  15.915  1.00 53.48  ? 91  TYR A CZ    1 
ATOM   574  O  OH    . TYR A 1 72  ? -50.865 10.666  16.689  1.00 53.54  ? 91  TYR A OH    1 
ATOM   575  N  N     . GLY A 1 73  ? -48.351 16.605  11.070  1.00 39.00  ? 92  GLY A N     1 
ATOM   576  C  CA    . GLY A 1 73  ? -47.653 17.776  10.591  1.00 38.79  ? 92  GLY A CA    1 
ATOM   577  C  C     . GLY A 1 73  ? -47.830 18.928  11.565  1.00 41.59  ? 92  GLY A C     1 
ATOM   578  O  O     . GLY A 1 73  ? -48.500 18.803  12.592  1.00 45.78  ? 92  GLY A O     1 
ATOM   579  N  N     . LEU A 1 74  ? -47.223 20.055  11.208  1.00 35.06  ? 93  LEU A N     1 
ATOM   580  C  CA    . LEU A 1 74  ? -47.276 21.265  12.012  1.00 35.41  ? 93  LEU A CA    1 
ATOM   581  C  C     . LEU A 1 74  ? -47.801 22.401  11.150  1.00 37.23  ? 93  LEU A C     1 
ATOM   582  O  O     . LEU A 1 74  ? -47.311 22.612  10.035  1.00 37.85  ? 93  LEU A O     1 
ATOM   583  C  CB    . LEU A 1 74  ? -45.896 21.619  12.575  1.00 35.51  ? 93  LEU A CB    1 
ATOM   584  C  CG    . LEU A 1 74  ? -45.231 20.588  13.492  1.00 37.88  ? 93  LEU A CG    1 
ATOM   585  C  CD1   . LEU A 1 74  ? -43.868 21.079  13.964  1.00 39.32  ? 93  LEU A CD1   1 
ATOM   586  C  CD2   . LEU A 1 74  ? -46.126 20.276  14.681  1.00 43.75  ? 93  LEU A CD2   1 
ATOM   587  N  N     . GLU A 1 75  ? -48.797 23.122  11.663  1.00 43.08  ? 94  GLU A N     1 
ATOM   588  C  CA    . GLU A 1 75  ? -49.340 24.261  10.938  1.00 42.58  ? 94  GLU A CA    1 
ATOM   589  C  C     . GLU A 1 75  ? -48.254 25.304  10.727  1.00 41.07  ? 94  GLU A C     1 
ATOM   590  O  O     . GLU A 1 75  ? -47.508 25.635  11.652  1.00 38.92  ? 94  GLU A O     1 
ATOM   591  C  CB    . GLU A 1 75  ? -50.522 24.863  11.696  1.00 43.88  ? 94  GLU A CB    1 
ATOM   592  C  CG    . GLU A 1 75  ? -51.868 24.371  11.198  1.00 53.95  ? 94  GLU A CG    1 
ATOM   593  C  CD    . GLU A 1 75  ? -52.221 24.946  9.842   1.00 47.38  ? 94  GLU A CD    1 
ATOM   594  O  OE1   . GLU A 1 75  ? -51.996 26.155  9.640   1.00 42.26  ? 94  GLU A OE1   1 
ATOM   595  O  OE2   . GLU A 1 75  ? -52.712 24.190  8.978   1.00 54.81  ? 94  GLU A OE2   1 
ATOM   596  N  N     . GLY A 1 76  ? -48.160 25.813  9.501   1.00 37.63  ? 95  GLY A N     1 
ATOM   597  C  CA    . GLY A 1 76  ? -47.093 26.716  9.136   1.00 32.00  ? 95  GLY A CA    1 
ATOM   598  C  C     . GLY A 1 76  ? -45.862 26.041  8.573   1.00 35.04  ? 95  GLY A C     1 
ATOM   599  O  O     . GLY A 1 76  ? -44.955 26.739  8.105   1.00 35.26  ? 95  GLY A O     1 
ATOM   600  N  N     . TYR A 1 77  ? -45.800 24.709  8.601   1.00 34.62  ? 96  TYR A N     1 
ATOM   601  C  CA    . TYR A 1 77  ? -44.677 23.944  8.058   1.00 37.05  ? 96  TYR A CA    1 
ATOM   602  C  C     . TYR A 1 77  ? -45.162 22.943  7.014   1.00 33.29  ? 96  TYR A C     1 
ATOM   603  O  O     . TYR A 1 77  ? -45.051 21.727  7.212   1.00 32.64  ? 96  TYR A O     1 
ATOM   604  C  CB    . TYR A 1 77  ? -43.928 23.212  9.170   1.00 34.26  ? 96  TYR A CB    1 
ATOM   605  C  CG    . TYR A 1 77  ? -43.350 24.106  10.240  1.00 33.66  ? 96  TYR A CG    1 
ATOM   606  C  CD1   . TYR A 1 77  ? -44.107 24.488  11.345  1.00 39.81  ? 96  TYR A CD1   1 
ATOM   607  C  CD2   . TYR A 1 77  ? -42.044 24.563  10.151  1.00 30.24  ? 96  TYR A CD2   1 
ATOM   608  C  CE1   . TYR A 1 77  ? -43.571 25.307  12.331  1.00 38.04  ? 96  TYR A CE1   1 
ATOM   609  C  CE2   . TYR A 1 77  ? -41.504 25.375  11.124  1.00 33.75  ? 96  TYR A CE2   1 
ATOM   610  C  CZ    . TYR A 1 77  ? -42.266 25.743  12.211  1.00 34.86  ? 96  TYR A CZ    1 
ATOM   611  O  OH    . TYR A 1 77  ? -41.709 26.555  13.171  1.00 40.08  ? 96  TYR A OH    1 
ATOM   612  N  N     . PRO A 1 78  ? -45.703 23.411  5.889   1.00 31.02  ? 97  PRO A N     1 
ATOM   613  C  CA    . PRO A 1 78  ? -46.143 22.467  4.857   1.00 28.42  ? 97  PRO A CA    1 
ATOM   614  C  C     . PRO A 1 78  ? -44.965 21.676  4.308   1.00 33.49  ? 97  PRO A C     1 
ATOM   615  O  O     . PRO A 1 78  ? -43.861 22.201  4.139   1.00 31.43  ? 97  PRO A O     1 
ATOM   616  C  CB    . PRO A 1 78  ? -46.773 23.371  3.790   1.00 27.96  ? 97  PRO A CB    1 
ATOM   617  C  CG    . PRO A 1 78  ? -46.143 24.699  3.993   1.00 30.33  ? 97  PRO A CG    1 
ATOM   618  C  CD    . PRO A 1 78  ? -45.891 24.813  5.468   1.00 29.35  ? 97  PRO A CD    1 
ATOM   619  N  N     . GLY A 1 79  ? -45.210 20.396  4.035   1.00 30.10  ? 98  GLY A N     1 
ATOM   620  C  CA    . GLY A 1 79  ? -44.173 19.504  3.566   1.00 33.93  ? 98  GLY A CA    1 
ATOM   621  C  C     . GLY A 1 79  ? -43.425 18.756  4.648   1.00 31.59  ? 98  GLY A C     1 
ATOM   622  O  O     . GLY A 1 79  ? -42.484 18.016  4.331   1.00 33.63  ? 98  GLY A O     1 
ATOM   623  N  N     . PHE A 1 80  ? -43.806 18.917  5.909   1.00 32.51  ? 99  PHE A N     1 
ATOM   624  C  CA    . PHE A 1 80  ? -43.178 18.221  7.025   1.00 32.77  ? 99  PHE A CA    1 
ATOM   625  C  C     . PHE A 1 80  ? -44.147 17.178  7.565   1.00 29.45  ? 99  PHE A C     1 
ATOM   626  O  O     . PHE A 1 80  ? -45.266 17.517  7.960   1.00 32.71  ? 99  PHE A O     1 
ATOM   627  C  CB    . PHE A 1 80  ? -42.783 19.212  8.121   1.00 34.06  ? 99  PHE A CB    1 
ATOM   628  C  CG    . PHE A 1 80  ? -42.233 18.565  9.359   1.00 29.11  ? 99  PHE A CG    1 
ATOM   629  C  CD1   . PHE A 1 80  ? -40.911 18.159  9.413   1.00 36.09  ? 99  PHE A CD1   1 
ATOM   630  C  CD2   . PHE A 1 80  ? -43.033 18.373  10.470  1.00 33.92  ? 99  PHE A CD2   1 
ATOM   631  C  CE1   . PHE A 1 80  ? -40.396 17.565  10.551  1.00 38.90  ? 99  PHE A CE1   1 
ATOM   632  C  CE2   . PHE A 1 80  ? -42.524 17.782  11.615  1.00 38.19  ? 99  PHE A CE2   1 
ATOM   633  C  CZ    . PHE A 1 80  ? -41.205 17.375  11.653  1.00 37.03  ? 99  PHE A CZ    1 
ATOM   634  N  N     . ILE A 1 81  ? -43.716 15.918  7.582   1.00 31.40  ? 100 ILE A N     1 
ATOM   635  C  CA    . ILE A 1 81  ? -44.480 14.813  8.149   1.00 34.69  ? 100 ILE A CA    1 
ATOM   636  C  C     . ILE A 1 81  ? -43.618 14.139  9.205   1.00 37.42  ? 100 ILE A C     1 
ATOM   637  O  O     . ILE A 1 81  ? -42.439 13.862  8.960   1.00 35.03  ? 100 ILE A O     1 
ATOM   638  C  CB    . ILE A 1 81  ? -44.896 13.792  7.075   1.00 35.60  ? 100 ILE A CB    1 
ATOM   639  C  CG1   . ILE A 1 81  ? -45.666 14.467  5.943   1.00 34.42  ? 100 ILE A CG1   1 
ATOM   640  C  CG2   . ILE A 1 81  ? -45.720 12.669  7.699   1.00 33.86  ? 100 ILE A CG2   1 
ATOM   641  C  CD1   . ILE A 1 81  ? -45.726 13.622  4.683   1.00 31.38  ? 100 ILE A CD1   1 
ATOM   642  N  N     . PHE A 1 82  ? -44.206 13.864  10.367  1.00 39.73  ? 101 PHE A N     1 
ATOM   643  C  CA    . PHE A 1 82  ? -43.535 13.160  11.452  1.00 36.07  ? 101 PHE A CA    1 
ATOM   644  C  C     . PHE A 1 82  ? -44.306 11.880  11.743  1.00 40.27  ? 101 PHE A C     1 
ATOM   645  O  O     . PHE A 1 82  ? -45.485 11.933  12.106  1.00 35.99  ? 101 PHE A O     1 
ATOM   646  C  CB    . PHE A 1 82  ? -43.450 14.037  12.704  1.00 39.48  ? 101 PHE A CB    1 
ATOM   647  C  CG    . PHE A 1 82  ? -42.539 13.493  13.776  1.00 38.91  ? 101 PHE A CG    1 
ATOM   648  C  CD1   . PHE A 1 82  ? -42.930 12.420  14.558  1.00 37.86  ? 101 PHE A CD1   1 
ATOM   649  C  CD2   . PHE A 1 82  ? -41.297 14.066  14.011  1.00 41.93  ? 101 PHE A CD2   1 
ATOM   650  C  CE1   . PHE A 1 82  ? -42.100 11.920  15.545  1.00 42.61  ? 101 PHE A CE1   1 
ATOM   651  C  CE2   . PHE A 1 82  ? -40.463 13.568  15.003  1.00 42.11  ? 101 PHE A CE2   1 
ATOM   652  C  CZ    . PHE A 1 82  ? -40.866 12.494  15.770  1.00 39.93  ? 101 PHE A CZ    1 
ATOM   653  N  N     . ILE A 1 83  ? -43.639 10.738  11.595  1.00 37.33  ? 102 ILE A N     1 
ATOM   654  C  CA    . ILE A 1 83  ? -44.224 9.424   11.848  1.00 36.93  ? 102 ILE A CA    1 
ATOM   655  C  C     . ILE A 1 83  ? -43.553 8.816   13.075  1.00 37.25  ? 102 ILE A C     1 
ATOM   656  O  O     . ILE A 1 83  ? -42.422 8.315   12.970  1.00 31.94  ? 102 ILE A O     1 
ATOM   657  C  CB    . ILE A 1 83  ? -44.058 8.502   10.630  1.00 34.13  ? 102 ILE A CB    1 
ATOM   658  C  CG1   . ILE A 1 83  ? -44.543 9.197   9.355   1.00 37.12  ? 102 ILE A CG1   1 
ATOM   659  C  CG2   . ILE A 1 83  ? -44.793 7.192   10.846  1.00 36.04  ? 102 ILE A CG2   1 
ATOM   660  C  CD1   . ILE A 1 83  ? -44.246 8.423   8.093   1.00 37.64  ? 102 ILE A CD1   1 
ATOM   661  N  N     . PRO A 1 84  ? -44.188 8.852   14.249  1.00 37.33  ? 103 PRO A N     1 
ATOM   662  C  CA    . PRO A 1 84  ? -43.642 8.126   15.400  1.00 36.65  ? 103 PRO A CA    1 
ATOM   663  C  C     . PRO A 1 84  ? -43.454 6.656   15.068  1.00 37.69  ? 103 PRO A C     1 
ATOM   664  O  O     . PRO A 1 84  ? -44.175 6.093   14.242  1.00 43.10  ? 103 PRO A O     1 
ATOM   665  C  CB    . PRO A 1 84  ? -44.708 8.321   16.484  1.00 37.69  ? 103 PRO A CB    1 
ATOM   666  C  CG    . PRO A 1 84  ? -45.424 9.559   16.092  1.00 40.70  ? 103 PRO A CG    1 
ATOM   667  C  CD    . PRO A 1 84  ? -45.412 9.595   14.592  1.00 37.33  ? 103 PRO A CD    1 
ATOM   668  N  N     . ASN A 1 85  ? -42.459 6.044   15.724  1.00 37.64  ? 104 ASN A N     1 
ATOM   669  C  CA    . ASN A 1 85  ? -41.987 4.672   15.539  1.00 43.34  ? 104 ASN A CA    1 
ATOM   670  C  C     . ASN A 1 85  ? -43.023 3.757   14.892  1.00 43.07  ? 104 ASN A C     1 
ATOM   671  O  O     . ASN A 1 85  ? -43.888 3.203   15.582  1.00 45.16  ? 104 ASN A O     1 
ATOM   672  C  CB    . ASN A 1 85  ? -41.552 4.091   16.888  1.00 42.61  ? 104 ASN A CB    1 
ATOM   673  C  CG    . ASN A 1 85  ? -41.092 2.648   16.787  1.00 43.23  ? 104 ASN A CG    1 
ATOM   674  O  OD1   . ASN A 1 85  ? -40.693 2.178   15.720  1.00 45.94  ? 104 ASN A OD1   1 
ATOM   675  N  ND2   . ASN A 1 85  ? -41.150 1.935   17.904  1.00 50.11  ? 104 ASN A ND2   1 
ATOM   676  N  N     . PRO A 1 86  ? -42.973 3.586   13.572  1.00 42.72  ? 105 PRO A N     1 
ATOM   677  C  CA    . PRO A 1 86  ? -43.885 2.661   12.885  1.00 43.19  ? 105 PRO A CA    1 
ATOM   678  C  C     . PRO A 1 86  ? -43.338 1.253   12.704  1.00 45.52  ? 105 PRO A C     1 
ATOM   679  O  O     . PRO A 1 86  ? -43.926 0.479   11.943  1.00 44.77  ? 105 PRO A O     1 
ATOM   680  C  CB    . PRO A 1 86  ? -44.050 3.339   11.520  1.00 41.75  ? 105 PRO A CB    1 
ATOM   681  C  CG    . PRO A 1 86  ? -42.682 3.905   11.257  1.00 36.96  ? 105 PRO A CG    1 
ATOM   682  C  CD    . PRO A 1 86  ? -42.130 4.328   12.616  1.00 43.86  ? 105 PRO A CD    1 
ATOM   683  N  N     . PHE A 1 87  ? -42.234 0.913   13.359  1.00 48.43  ? 106 PHE A N     1 
ATOM   684  C  CA    . PHE A 1 87  ? -41.604 -0.378  13.147  1.00 49.44  ? 106 PHE A CA    1 
ATOM   685  C  C     . PHE A 1 87  ? -42.292 -1.464  13.964  1.00 48.46  ? 106 PHE A C     1 
ATOM   686  O  O     . PHE A 1 87  ? -42.805 -1.219  15.061  1.00 45.85  ? 106 PHE A O     1 
ATOM   687  C  CB    . PHE A 1 87  ? -40.119 -0.312  13.504  1.00 41.57  ? 106 PHE A CB    1 
ATOM   688  C  CG    . PHE A 1 87  ? -39.296 0.450   12.507  1.00 43.57  ? 106 PHE A CG    1 
ATOM   689  C  CD1   . PHE A 1 87  ? -39.129 1.819   12.628  1.00 44.75  ? 106 PHE A CD1   1 
ATOM   690  C  CD2   . PHE A 1 87  ? -38.704 -0.201  11.440  1.00 40.07  ? 106 PHE A CD2   1 
ATOM   691  C  CE1   . PHE A 1 87  ? -38.380 2.522   11.706  1.00 38.50  ? 106 PHE A CE1   1 
ATOM   692  C  CE2   . PHE A 1 87  ? -37.954 0.495   10.518  1.00 46.42  ? 106 PHE A CE2   1 
ATOM   693  C  CZ    . PHE A 1 87  ? -37.790 1.860   10.652  1.00 40.23  ? 106 PHE A CZ    1 
ATOM   694  N  N     . LEU A 1 88  ? -42.316 -2.670  13.401  1.00 49.19  ? 107 LEU A N     1 
ATOM   695  C  CA    . LEU A 1 88  ? -42.760 -3.833  14.148  1.00 56.28  ? 107 LEU A CA    1 
ATOM   696  C  C     . LEU A 1 88  ? -41.789 -4.103  15.298  1.00 59.08  ? 107 LEU A C     1 
ATOM   697  O  O     . LEU A 1 88  ? -40.595 -3.801  15.194  1.00 52.04  ? 107 LEU A O     1 
ATOM   698  C  CB    . LEU A 1 88  ? -42.849 -5.055  13.235  1.00 53.46  ? 107 LEU A CB    1 
ATOM   699  C  CG    . LEU A 1 88  ? -43.952 -5.084  12.172  1.00 49.80  ? 107 LEU A CG    1 
ATOM   700  C  CD1   . LEU A 1 88  ? -43.624 -6.091  11.086  1.00 49.70  ? 107 LEU A CD1   1 
ATOM   701  C  CD2   . LEU A 1 88  ? -45.291 -5.417  12.796  1.00 42.02  ? 107 LEU A CD2   1 
ATOM   702  N  N     . PRO A 1 89  ? -42.277 -4.659  16.407  1.00 56.89  ? 108 PRO A N     1 
ATOM   703  C  CA    . PRO A 1 89  ? -41.401 -4.892  17.563  1.00 58.52  ? 108 PRO A CA    1 
ATOM   704  C  C     . PRO A 1 89  ? -40.192 -5.735  17.185  1.00 53.09  ? 108 PRO A C     1 
ATOM   705  O  O     . PRO A 1 89  ? -40.319 -6.780  16.545  1.00 60.89  ? 108 PRO A O     1 
ATOM   706  C  CB    . PRO A 1 89  ? -42.314 -5.617  18.562  1.00 59.02  ? 108 PRO A CB    1 
ATOM   707  C  CG    . PRO A 1 89  ? -43.490 -6.094  17.759  1.00 55.74  ? 108 PRO A CG    1 
ATOM   708  C  CD    . PRO A 1 89  ? -43.661 -5.087  16.669  1.00 61.43  ? 108 PRO A CD    1 
ATOM   709  N  N     . GLY A 1 90  ? -39.009 -5.251  17.566  1.00 50.45  ? 109 GLY A N     1 
ATOM   710  C  CA    . GLY A 1 90  ? -37.761 -5.930  17.296  1.00 51.72  ? 109 GLY A CA    1 
ATOM   711  C  C     . GLY A 1 90  ? -37.126 -5.637  15.952  1.00 55.96  ? 109 GLY A C     1 
ATOM   712  O  O     . GLY A 1 90  ? -35.996 -6.081  15.711  1.00 52.97  ? 109 GLY A O     1 
ATOM   713  N  N     . CYS A 1 91  ? -37.800 -4.900  15.070  1.00 53.59  ? 110 CYS A N     1 
ATOM   714  C  CA    . CYS A 1 91  ? -37.303 -4.735  13.710  1.00 48.75  ? 110 CYS A CA    1 
ATOM   715  C  C     . CYS A 1 91  ? -36.308 -3.591  13.553  1.00 47.23  ? 110 CYS A C     1 
ATOM   716  O  O     . CYS A 1 91  ? -35.594 -3.551  12.544  1.00 43.61  ? 110 CYS A O     1 
ATOM   717  C  CB    . CYS A 1 91  ? -38.476 -4.537  12.747  1.00 51.98  ? 110 CYS A CB    1 
ATOM   718  S  SG    . CYS A 1 91  ? -39.509 -6.016  12.579  1.00 61.02  ? 110 CYS A SG    1 
ATOM   719  N  N     . GLN A 1 92  ? -36.237 -2.665  14.514  1.00 46.49  ? 111 GLN A N     1 
ATOM   720  C  CA    . GLN A 1 92  ? -35.222 -1.617  14.439  1.00 45.15  ? 111 GLN A CA    1 
ATOM   721  C  C     . GLN A 1 92  ? -33.819 -2.198  14.551  1.00 50.47  ? 111 GLN A C     1 
ATOM   722  O  O     . GLN A 1 92  ? -32.858 -1.607  14.037  1.00 48.36  ? 111 GLN A O     1 
ATOM   723  C  CB    . GLN A 1 92  ? -35.445 -0.573  15.534  1.00 43.12  ? 111 GLN A CB    1 
ATOM   724  C  CG    . GLN A 1 92  ? -36.761 0.185   15.429  1.00 41.59  ? 111 GLN A CG    1 
ATOM   725  C  CD    . GLN A 1 92  ? -36.971 1.152   16.579  1.00 45.05  ? 111 GLN A CD    1 
ATOM   726  O  OE1   . GLN A 1 92  ? -36.019 1.745   17.087  1.00 46.90  ? 111 GLN A OE1   1 
ATOM   727  N  NE2   . GLN A 1 92  ? -38.220 1.313   16.999  1.00 47.74  ? 111 GLN A NE2   1 
ATOM   728  N  N     . ARG A 1 93  ? -33.686 -3.356  15.210  1.00 48.56  ? 112 ARG A N     1 
ATOM   729  C  CA    . ARG A 1 93  ? -32.366 -3.935  15.439  1.00 46.44  ? 112 ARG A CA    1 
ATOM   730  C  C     . ARG A 1 93  ? -31.672 -4.267  14.128  1.00 43.94  ? 112 ARG A C     1 
ATOM   731  O  O     . ARG A 1 93  ? -30.463 -4.048  13.986  1.00 49.52  ? 112 ARG A O     1 
ATOM   732  C  CB    . ARG A 1 93  ? -32.483 -5.181  16.317  1.00 49.82  ? 112 ARG A CB    1 
ATOM   733  C  CG    . ARG A 1 93  ? -32.878 -4.879  17.752  1.00 57.18  ? 112 ARG A CG    1 
ATOM   734  C  CD    . ARG A 1 93  ? -32.777 -6.106  18.641  1.00 57.57  ? 112 ARG A CD    1 
ATOM   735  N  NE    . ARG A 1 93  ? -34.083 -6.703  18.899  1.00 60.59  ? 112 ARG A NE    1 
ATOM   736  C  CZ    . ARG A 1 93  ? -34.524 -7.816  18.321  1.00 68.18  ? 112 ARG A CZ    1 
ATOM   737  N  NH1   . ARG A 1 93  ? -33.758 -8.462  17.449  1.00 70.45  ? 112 ARG A NH1   1 
ATOM   738  N  NH2   . ARG A 1 93  ? -35.729 -8.286  18.620  1.00 59.50  ? 112 ARG A NH2   1 
ATOM   739  N  N     . HIS A 1 94  ? -32.421 -4.780  13.151  1.00 43.34  ? 113 HIS A N     1 
ATOM   740  C  CA    . HIS A 1 94  ? -31.810 -5.132  11.874  1.00 44.90  ? 113 HIS A CA    1 
ATOM   741  C  C     . HIS A 1 94  ? -31.232 -3.906  11.174  1.00 46.77  ? 113 HIS A C     1 
ATOM   742  O  O     . HIS A 1 94  ? -30.110 -3.950  10.657  1.00 48.45  ? 113 HIS A O     1 
ATOM   743  C  CB    . HIS A 1 94  ? -32.828 -5.829  10.975  1.00 48.74  ? 113 HIS A CB    1 
ATOM   744  C  CG    . HIS A 1 94  ? -32.338 -6.048  9.580   1.00 45.40  ? 113 HIS A CG    1 
ATOM   745  N  ND1   . HIS A 1 94  ? -31.434 -7.036  9.255   1.00 52.98  ? 113 HIS A ND1   1 
ATOM   746  C  CD2   . HIS A 1 94  ? -32.610 -5.392  8.427   1.00 48.67  ? 113 HIS A CD2   1 
ATOM   747  C  CE1   . HIS A 1 94  ? -31.176 -6.984  7.961   1.00 55.13  ? 113 HIS A CE1   1 
ATOM   748  N  NE2   . HIS A 1 94  ? -31.877 -5.995  7.435   1.00 54.87  ? 113 HIS A NE2   1 
ATOM   749  N  N     . TRP A 1 95  ? -31.970 -2.794  11.164  1.00 44.34  ? 114 TRP A N     1 
ATOM   750  C  CA    . TRP A 1 95  ? -31.484 -1.602  10.471  1.00 47.55  ? 114 TRP A CA    1 
ATOM   751  C  C     . TRP A 1 95  ? -30.335 -0.941  11.228  1.00 42.84  ? 114 TRP A C     1 
ATOM   752  O  O     . TRP A 1 95  ? -29.373 -0.458  10.613  1.00 41.34  ? 114 TRP A O     1 
ATOM   753  C  CB    . TRP A 1 95  ? -32.640 -0.628  10.250  1.00 44.71  ? 114 TRP A CB    1 
ATOM   754  C  CG    . TRP A 1 95  ? -33.698 -1.218  9.374   1.00 43.21  ? 114 TRP A CG    1 
ATOM   755  C  CD1   . TRP A 1 95  ? -34.964 -1.576  9.736   1.00 42.12  ? 114 TRP A CD1   1 
ATOM   756  C  CD2   . TRP A 1 95  ? -33.563 -1.560  7.991   1.00 38.80  ? 114 TRP A CD2   1 
ATOM   757  N  NE1   . TRP A 1 95  ? -35.632 -2.107  8.657   1.00 40.34  ? 114 TRP A NE1   1 
ATOM   758  C  CE2   . TRP A 1 95  ? -34.793 -2.107  7.574   1.00 41.51  ? 114 TRP A CE2   1 
ATOM   759  C  CE3   . TRP A 1 95  ? -32.524 -1.449  7.062   1.00 40.23  ? 114 TRP A CE3   1 
ATOM   760  C  CZ2   . TRP A 1 95  ? -35.014 -2.537  6.267   1.00 42.56  ? 114 TRP A CZ2   1 
ATOM   761  C  CZ3   . TRP A 1 95  ? -32.742 -1.877  5.766   1.00 44.85  ? 114 TRP A CZ3   1 
ATOM   762  C  CH2   . TRP A 1 95  ? -33.978 -2.413  5.379   1.00 46.05  ? 114 TRP A CH2   1 
ATOM   763  N  N     . VAL A 1 96  ? -30.412 -0.916  12.561  1.00 40.19  ? 115 VAL A N     1 
ATOM   764  C  CA    . VAL A 1 96  ? -29.265 -0.494  13.364  1.00 46.45  ? 115 VAL A CA    1 
ATOM   765  C  C     . VAL A 1 96  ? -28.025 -1.286  12.971  1.00 45.16  ? 115 VAL A C     1 
ATOM   766  O  O     . VAL A 1 96  ? -26.960 -0.719  12.695  1.00 44.64  ? 115 VAL A O     1 
ATOM   767  C  CB    . VAL A 1 96  ? -29.567 -0.654  14.864  1.00 48.83  ? 115 VAL A CB    1 
ATOM   768  C  CG1   . VAL A 1 96  ? -28.281 -0.571  15.660  1.00 50.17  ? 115 VAL A CG1   1 
ATOM   769  C  CG2   . VAL A 1 96  ? -30.557 0.395   15.327  1.00 45.39  ? 115 VAL A CG2   1 
ATOM   770  N  N     . LYS A 1 97  ? -28.149 -2.617  12.943  1.00 44.46  ? 116 LYS A N     1 
ATOM   771  C  CA    . LYS A 1 97  ? -27.006 -3.460  12.616  1.00 45.09  ? 116 LYS A CA    1 
ATOM   772  C  C     . LYS A 1 97  ? -26.502 -3.185  11.207  1.00 45.36  ? 116 LYS A C     1 
ATOM   773  O  O     . LYS A 1 97  ? -25.289 -3.146  10.972  1.00 53.35  ? 116 LYS A O     1 
ATOM   774  C  CB    . LYS A 1 97  ? -27.377 -4.934  12.769  1.00 49.69  ? 116 LYS A CB    1 
ATOM   775  C  CG    . LYS A 1 97  ? -26.227 -5.874  12.468  1.00 53.20  ? 116 LYS A CG    1 
ATOM   776  C  CD    . LYS A 1 97  ? -26.720 -7.263  12.110  1.00 68.43  ? 116 LYS A CD    1 
ATOM   777  C  CE    . LYS A 1 97  ? -27.524 -7.255  10.816  1.00 66.02  ? 116 LYS A CE    1 
ATOM   778  N  NZ    . LYS A 1 97  ? -27.941 -8.629  10.412  1.00 66.50  ? 116 LYS A NZ    1 
ATOM   779  N  N     . GLN A 1 98  ? -27.417 -3.002  10.252  1.00 46.12  ? 117 GLN A N     1 
ATOM   780  C  CA    . GLN A 1 98  ? -27.008 -2.638  8.900   1.00 47.78  ? 117 GLN A CA    1 
ATOM   781  C  C     . GLN A 1 98  ? -26.166 -1.369  8.910   1.00 48.18  ? 117 GLN A C     1 
ATOM   782  O  O     . GLN A 1 98  ? -25.146 -1.283  8.214   1.00 46.79  ? 117 GLN A O     1 
ATOM   783  C  CB    . GLN A 1 98  ? -28.236 -2.454  8.003   1.00 51.08  ? 117 GLN A CB    1 
ATOM   784  C  CG    . GLN A 1 98  ? -29.073 -3.709  7.786   1.00 48.53  ? 117 GLN A CG    1 
ATOM   785  C  CD    . GLN A 1 98  ? -28.315 -4.804  7.065   1.00 53.74  ? 117 GLN A CD    1 
ATOM   786  O  OE1   . GLN A 1 98  ? -27.663 -5.639  7.692   1.00 57.46  ? 117 GLN A OE1   1 
ATOM   787  N  NE2   . GLN A 1 98  ? -28.396 -4.806  5.740   1.00 48.37  ? 117 GLN A NE2   1 
ATOM   788  N  N     . CYS A 1 99  ? -26.570 -0.378  9.709   1.00 40.82  ? 118 CYS A N     1 
ATOM   789  C  CA    . CYS A 1 99  ? -25.810 0.868   9.776   1.00 48.14  ? 118 CYS A CA    1 
ATOM   790  C  C     . CYS A 1 99  ? -24.443 0.663   10.422  1.00 47.15  ? 118 CYS A C     1 
ATOM   791  O  O     . CYS A 1 99  ? -23.444 1.232   9.968   1.00 43.08  ? 118 CYS A O     1 
ATOM   792  C  CB    . CYS A 1 99  ? -26.601 1.926   10.541  1.00 47.61  ? 118 CYS A CB    1 
ATOM   793  S  SG    . CYS A 1 99  ? -28.041 2.533   9.657   1.00 49.18  ? 118 CYS A SG    1 
ATOM   794  N  N     . LEU A 1 100 ? -24.378 -0.143  11.481  1.00 46.29  ? 119 LEU A N     1 
ATOM   795  C  CA    . LEU A 1 100 ? -23.140 -0.250  12.245  1.00 45.23  ? 119 LEU A CA    1 
ATOM   796  C  C     . LEU A 1 100 ? -22.107 -1.130  11.544  1.00 48.39  ? 119 LEU A C     1 
ATOM   797  O  O     . LEU A 1 100 ? -20.944 -0.736  11.407  1.00 45.18  ? 119 LEU A O     1 
ATOM   798  C  CB    . LEU A 1 100 ? -23.439 -0.771  13.653  1.00 43.89  ? 119 LEU A CB    1 
ATOM   799  C  CG    . LEU A 1 100 ? -24.319 0.153   14.504  1.00 43.01  ? 119 LEU A CG    1 
ATOM   800  C  CD1   . LEU A 1 100 ? -24.546 -0.422  15.888  1.00 49.06  ? 119 LEU A CD1   1 
ATOM   801  C  CD2   . LEU A 1 100 ? -23.719 1.546   14.604  1.00 40.01  ? 119 LEU A CD2   1 
ATOM   802  N  N     . LYS A 1 101 ? -22.503 -2.314  11.078  1.00 53.29  ? 120 LYS A N     1 
ATOM   803  C  CA    . LYS A 1 101 ? -21.516 -3.256  10.556  1.00 55.89  ? 120 LYS A CA    1 
ATOM   804  C  C     . LYS A 1 101 ? -21.484 -3.344  9.038   1.00 50.65  ? 120 LYS A C     1 
ATOM   805  O  O     . LYS A 1 101 ? -20.405 -3.513  8.465   1.00 57.71  ? 120 LYS A O     1 
ATOM   806  C  CB    . LYS A 1 101 ? -21.744 -4.656  11.137  1.00 59.15  ? 120 LYS A CB    1 
ATOM   807  C  CG    . LYS A 1 101 ? -23.037 -5.330  10.753  1.00 64.00  ? 120 LYS A CG    1 
ATOM   808  C  CD    . LYS A 1 101 ? -23.057 -6.774  11.245  1.00 63.93  ? 120 LYS A CD    1 
ATOM   809  C  CE    . LYS A 1 101 ? -21.961 -7.605  10.591  1.00 63.72  ? 120 LYS A CE    1 
ATOM   810  N  NZ    . LYS A 1 101 ? -22.085 -9.057  10.921  1.00 65.37  ? 120 LYS A NZ    1 
ATOM   811  N  N     . LEU A 1 102 ? -22.626 -3.235  8.363   1.00 58.57  ? 121 LEU A N     1 
ATOM   812  C  CA    . LEU A 1 102 ? -22.653 -3.448  6.918   1.00 52.28  ? 121 LEU A CA    1 
ATOM   813  C  C     . LEU A 1 102 ? -22.373 -2.160  6.148   1.00 53.70  ? 121 LEU A C     1 
ATOM   814  O  O     . LEU A 1 102 ? -21.418 -2.091  5.368   1.00 56.69  ? 121 LEU A O     1 
ATOM   815  C  CB    . LEU A 1 102 ? -24.000 -4.044  6.499   1.00 57.63  ? 121 LEU A CB    1 
ATOM   816  C  CG    . LEU A 1 102 ? -23.919 -5.284  5.605   1.00 64.16  ? 121 LEU A CG    1 
ATOM   817  C  CD1   . LEU A 1 102 ? -25.309 -5.844  5.343   1.00 72.55  ? 121 LEU A CD1   1 
ATOM   818  C  CD2   . LEU A 1 102 ? -23.206 -4.972  4.298   1.00 59.44  ? 121 LEU A CD2   1 
ATOM   819  N  N     . TYR A 1 103 ? -23.199 -1.131  6.355   1.00 49.14  ? 122 TYR A N     1 
ATOM   820  C  CA    . TYR A 1 103 ? -23.053 0.094   5.577   1.00 48.43  ? 122 TYR A CA    1 
ATOM   821  C  C     . TYR A 1 103 ? -21.746 0.816   5.873   1.00 52.21  ? 122 TYR A C     1 
ATOM   822  O  O     . TYR A 1 103 ? -21.341 1.685   5.093   1.00 56.02  ? 122 TYR A O     1 
ATOM   823  C  CB    . TYR A 1 103 ? -24.227 1.035   5.846   1.00 49.47  ? 122 TYR A CB    1 
ATOM   824  C  CG    . TYR A 1 103 ? -25.591 0.465   5.533   1.00 48.45  ? 122 TYR A CG    1 
ATOM   825  C  CD1   . TYR A 1 103 ? -25.752 -0.531  4.579   1.00 49.43  ? 122 TYR A CD1   1 
ATOM   826  C  CD2   . TYR A 1 103 ? -26.721 0.927   6.193   1.00 46.40  ? 122 TYR A CD2   1 
ATOM   827  C  CE1   . TYR A 1 103 ? -27.001 -1.051  4.292   1.00 41.55  ? 122 TYR A CE1   1 
ATOM   828  C  CE2   . TYR A 1 103 ? -27.975 0.412   5.915   1.00 43.16  ? 122 TYR A CE2   1 
ATOM   829  C  CZ    . TYR A 1 103 ? -28.108 -0.575  4.964   1.00 44.94  ? 122 TYR A CZ    1 
ATOM   830  O  OH    . TYR A 1 103 ? -29.354 -1.088  4.687   1.00 46.37  ? 122 TYR A OH    1 
ATOM   831  N  N     . SER A 1 104 ? -21.081 0.483   6.981   1.00 57.68  ? 123 SER A N     1 
ATOM   832  C  CA    . SER A 1 104 ? -19.821 1.129   7.332   1.00 55.28  ? 123 SER A CA    1 
ATOM   833  C  C     . SER A 1 104 ? -18.641 0.608   6.524   1.00 58.46  ? 123 SER A C     1 
ATOM   834  O  O     . SER A 1 104 ? -17.636 1.316   6.393   1.00 52.88  ? 123 SER A O     1 
ATOM   835  C  CB    . SER A 1 104 ? -19.538 0.947   8.824   1.00 49.85  ? 123 SER A CB    1 
ATOM   836  O  OG    . SER A 1 104 ? -19.557 -0.423  9.180   1.00 55.06  ? 123 SER A OG    1 
ATOM   837  N  N     . GLN A 1 105 ? -18.734 -0.600  5.980   1.00 59.36  ? 124 GLN A N     1 
ATOM   838  C  CA    . GLN A 1 105 ? -17.608 -1.174  5.266   1.00 64.75  ? 124 GLN A CA    1 
ATOM   839  C  C     . GLN A 1 105 ? -17.582 -0.696  3.817   1.00 65.69  ? 124 GLN A C     1 
ATOM   840  O  O     . GLN A 1 105 ? -18.568 -0.178  3.284   1.00 63.31  ? 124 GLN A O     1 
ATOM   841  C  CB    . GLN A 1 105 ? -17.658 -2.701  5.317   1.00 65.72  ? 124 GLN A CB    1 
ATOM   842  C  CG    . GLN A 1 105 ? -17.723 -3.278  6.727   1.00 68.29  ? 124 GLN A CG    1 
ATOM   843  C  CD    . GLN A 1 105 ? -16.450 -3.044  7.531   1.00 80.31  ? 124 GLN A CD    1 
ATOM   844  O  OE1   . GLN A 1 105 ? -16.095 -1.907  7.850   1.00 73.96  ? 124 GLN A OE1   1 
ATOM   845  N  NE2   . GLN A 1 105 ? -15.761 -4.130  7.870   1.00 83.78  ? 124 GLN A NE2   1 
ATOM   846  N  N     . LYS A 1 106 ? -16.418 -0.871  3.185   1.00 69.51  ? 125 LYS A N     1 
ATOM   847  C  CA    . LYS A 1 106 ? -16.249 -0.518  1.788   1.00 61.70  ? 125 LYS A CA    1 
ATOM   848  C  C     . LYS A 1 106 ? -17.232 -1.312  0.929   1.00 68.94  ? 125 LYS A C     1 
ATOM   849  O  O     . LYS A 1 106 ? -17.698 -2.382  1.331   1.00 68.39  ? 125 LYS A O     1 
ATOM   850  C  CB    . LYS A 1 106 ? -14.808 -0.781  1.354   1.00 68.03  ? 125 LYS A CB    1 
ATOM   851  C  CG    . LYS A 1 106 ? -13.781 0.039   2.119   1.00 77.03  ? 125 LYS A CG    1 
ATOM   852  C  CD    . LYS A 1 106 ? -12.685 0.553   1.201   1.00 81.96  ? 125 LYS A CD    1 
ATOM   853  C  CE    . LYS A 1 106 ? -13.254 1.491   0.143   1.00 82.56  ? 125 LYS A CE    1 
ATOM   854  N  NZ    . LYS A 1 106 ? -13.942 2.671   0.744   1.00 73.28  ? 125 LYS A NZ    1 
ATOM   855  N  N     . PRO A 1 107 ? -17.568 -0.810  -0.273  1.00 72.56  ? 126 PRO A N     1 
ATOM   856  C  CA    . PRO A 1 107 ? -17.041 0.371   -0.972  1.00 68.36  ? 126 PRO A CA    1 
ATOM   857  C  C     . PRO A 1 107 ? -17.552 1.715   -0.452  1.00 70.70  ? 126 PRO A C     1 
ATOM   858  O  O     . PRO A 1 107 ? -17.157 2.751   -0.989  1.00 68.66  ? 126 PRO A O     1 
ATOM   859  C  CB    . PRO A 1 107 ? -17.515 0.149   -2.407  1.00 68.51  ? 126 PRO A CB    1 
ATOM   860  C  CG    . PRO A 1 107 ? -18.804 -0.567  -2.242  1.00 68.47  ? 126 PRO A CG    1 
ATOM   861  C  CD    . PRO A 1 107 ? -18.610 -1.487  -1.067  1.00 69.07  ? 126 PRO A CD    1 
ATOM   862  N  N     . ASN A 1 108 ? -18.409 1.702   0.568   1.00 65.71  ? 127 ASN A N     1 
ATOM   863  C  CA    . ASN A 1 108 ? -18.943 2.948   1.104   1.00 61.37  ? 127 ASN A CA    1 
ATOM   864  C  C     . ASN A 1 108 ? -17.829 3.799   1.704   1.00 65.54  ? 127 ASN A C     1 
ATOM   865  O  O     . ASN A 1 108 ? -16.905 3.288   2.344   1.00 73.54  ? 127 ASN A O     1 
ATOM   866  C  CB    . ASN A 1 108 ? -20.012 2.656   2.157   1.00 57.26  ? 127 ASN A CB    1 
ATOM   867  C  CG    . ASN A 1 108 ? -21.172 1.854   1.599   1.00 59.11  ? 127 ASN A CG    1 
ATOM   868  O  OD1   . ASN A 1 108 ? -21.454 1.899   0.401   1.00 59.19  ? 127 ASN A OD1   1 
ATOM   869  N  ND2   . ASN A 1 108 ? -21.855 1.120   2.467   1.00 58.79  ? 127 ASN A ND2   1 
ATOM   870  N  N     . VAL A 1 109 ? -17.922 5.107   1.492   1.00 59.68  ? 128 VAL A N     1 
ATOM   871  C  CA    . VAL A 1 109 ? -16.924 6.055   1.975   1.00 56.11  ? 128 VAL A CA    1 
ATOM   872  C  C     . VAL A 1 109 ? -17.386 6.621   3.310   1.00 60.24  ? 128 VAL A C     1 
ATOM   873  O  O     . VAL A 1 109 ? -18.524 7.087   3.437   1.00 58.04  ? 128 VAL A O     1 
ATOM   874  C  CB    . VAL A 1 109 ? -16.695 7.179   0.950   1.00 62.71  ? 128 VAL A CB    1 
ATOM   875  C  CG1   . VAL A 1 109 ? -15.828 8.278   1.545   1.00 63.73  ? 128 VAL A CG1   1 
ATOM   876  C  CG2   . VAL A 1 109 ? -16.064 6.621   -0.317  1.00 60.09  ? 128 VAL A CG2   1 
ATOM   877  N  N     . SER A 1 110 ? -16.505 6.584   4.306   1.00 60.70  ? 129 SER A N     1 
ATOM   878  C  CA    . SER A 1 110 ? -16.769 7.126   5.632   1.00 49.58  ? 129 SER A CA    1 
ATOM   879  C  C     . SER A 1 110 ? -15.706 8.162   5.979   1.00 54.74  ? 129 SER A C     1 
ATOM   880  O  O     . SER A 1 110 ? -14.754 8.385   5.228   1.00 61.15  ? 129 SER A O     1 
ATOM   881  C  CB    . SER A 1 110 ? -16.794 6.016   6.683   1.00 52.82  ? 129 SER A CB    1 
ATOM   882  O  OG    . SER A 1 110 ? -15.479 5.573   6.965   1.00 54.19  ? 129 SER A OG    1 
ATOM   883  N  N     . ASN A 1 111 ? -15.878 8.800   7.140   1.00 53.43  ? 130 ASN A N     1 
ATOM   884  C  CA    . ASN A 1 111 ? -14.857 9.723   7.624   1.00 53.73  ? 130 ASN A CA    1 
ATOM   885  C  C     . ASN A 1 111 ? -13.556 8.996   7.942   1.00 54.70  ? 130 ASN A C     1 
ATOM   886  O  O     . ASN A 1 111 ? -12.472 9.577   7.807   1.00 59.46  ? 130 ASN A O     1 
ATOM   887  C  CB    . ASN A 1 111 ? -15.366 10.480  8.854   1.00 51.16  ? 130 ASN A CB    1 
ATOM   888  C  CG    . ASN A 1 111 ? -15.578 9.576   10.055  1.00 51.87  ? 130 ASN A CG    1 
ATOM   889  O  OD1   . ASN A 1 111 ? -16.619 8.934   10.192  1.00 50.11  ? 130 ASN A OD1   1 
ATOM   890  N  ND2   . ASN A 1 111 ? -14.590 9.530   10.940  1.00 52.11  ? 130 ASN A ND2   1 
ATOM   891  N  N     . LEU A 1 112 ? -13.642 7.723   8.337   1.00 50.85  ? 131 LEU A N     1 
ATOM   892  C  CA    . LEU A 1 112 ? -12.453 6.942   8.657   1.00 57.54  ? 131 LEU A CA    1 
ATOM   893  C  C     . LEU A 1 112 ? -11.489 6.831   7.483   1.00 66.05  ? 131 LEU A C     1 
ATOM   894  O  O     . LEU A 1 112 ? -10.297 6.587   7.698   1.00 69.52  ? 131 LEU A O     1 
ATOM   895  C  CB    . LEU A 1 112 ? -12.865 5.546   9.124   1.00 51.94  ? 131 LEU A CB    1 
ATOM   896  C  CG    . LEU A 1 112 ? -13.763 5.541   10.360  1.00 51.85  ? 131 LEU A CG    1 
ATOM   897  C  CD1   . LEU A 1 112 ? -14.172 4.127   10.730  1.00 53.11  ? 131 LEU A CD1   1 
ATOM   898  C  CD2   . LEU A 1 112 ? -13.053 6.221   11.521  1.00 53.81  ? 131 LEU A CD2   1 
ATOM   899  N  N     . ASP A 1 113 ? -11.971 7.002   6.251   1.00 64.83  ? 132 ASP A N     1 
ATOM   900  C  CA    . ASP A 1 113 ? -11.108 6.928   5.080   1.00 62.86  ? 132 ASP A CA    1 
ATOM   901  C  C     . ASP A 1 113 ? -10.256 8.175   4.888   1.00 69.12  ? 132 ASP A C     1 
ATOM   902  O  O     . ASP A 1 113 ? -9.371  8.167   4.026   1.00 71.92  ? 132 ASP A O     1 
ATOM   903  C  CB    . ASP A 1 113 ? -11.944 6.691   3.818   1.00 58.99  ? 132 ASP A CB    1 
ATOM   904  C  CG    . ASP A 1 113 ? -12.715 5.386   3.864   1.00 67.60  ? 132 ASP A CG    1 
ATOM   905  O  OD1   . ASP A 1 113 ? -12.263 4.448   4.555   1.00 71.18  ? 132 ASP A OD1   1 
ATOM   906  O  OD2   . ASP A 1 113 ? -13.773 5.296   3.205   1.00 69.51  ? 132 ASP A OD2   1 
ATOM   907  N  N     . LYS A 1 114 ? -10.495 9.240   5.660   1.00 66.10  ? 133 LYS A N     1 
ATOM   908  C  CA    . LYS A 1 114 ? -9.728  10.468  5.472   1.00 68.00  ? 133 LYS A CA    1 
ATOM   909  C  C     . LYS A 1 114 ? -8.240  10.242  5.716   1.00 80.79  ? 133 LYS A C     1 
ATOM   910  O  O     . LYS A 1 114 ? -7.398  10.734  4.955   1.00 84.29  ? 133 LYS A O     1 
ATOM   911  C  CB    . LYS A 1 114 ? -10.264 11.569  6.388   1.00 75.24  ? 133 LYS A CB    1 
ATOM   912  C  CG    . LYS A 1 114 ? -11.595 12.168  5.941   1.00 75.23  ? 133 LYS A CG    1 
ATOM   913  C  CD    . LYS A 1 114 ? -11.395 13.348  4.999   1.00 78.31  ? 133 LYS A CD    1 
ATOM   914  C  CE    . LYS A 1 114 ? -11.032 14.618  5.763   1.00 80.90  ? 133 LYS A CE    1 
ATOM   915  N  NZ    . LYS A 1 114 ? -12.163 15.112  6.607   1.00 76.10  ? 133 LYS A NZ    1 
ATOM   916  N  N     . HIS A 1 115 ? -7.893  9.496   6.764   1.00 77.21  ? 134 HIS A N     1 
ATOM   917  C  CA    . HIS A 1 115 ? -6.493  9.267   7.111   1.00 84.65  ? 134 HIS A CA    1 
ATOM   918  C  C     . HIS A 1 115 ? -6.261  7.817   7.516   1.00 85.10  ? 134 HIS A C     1 
ATOM   919  O  O     . HIS A 1 115 ? -5.514  7.527   8.455   1.00 84.10  ? 134 HIS A O     1 
ATOM   920  C  CB    . HIS A 1 115 ? -6.038  10.217  8.217   1.00 85.50  ? 134 HIS A CB    1 
ATOM   921  C  CG    . HIS A 1 115 ? -5.721  11.597  7.731   1.00 87.78  ? 134 HIS A CG    1 
ATOM   922  N  ND1   . HIS A 1 115 ? -4.431  12.071  7.626   1.00 87.88  ? 134 HIS A ND1   1 
ATOM   923  C  CD2   . HIS A 1 115 ? -6.526  12.602  7.313   1.00 87.51  ? 134 HIS A CD2   1 
ATOM   924  C  CE1   . HIS A 1 115 ? -4.455  13.311  7.170   1.00 87.91  ? 134 HIS A CE1   1 
ATOM   925  N  NE2   . HIS A 1 115 ? -5.715  13.657  6.971   1.00 87.96  ? 134 HIS A NE2   1 
ATOM   926  N  N     . MET A 1 116 ? -6.894  6.888   6.805   1.00 84.73  ? 135 MET A N     1 
ATOM   927  C  CA    . MET A 1 116 ? -6.667  5.462   6.999   1.00 82.48  ? 135 MET A CA    1 
ATOM   928  C  C     . MET A 1 116 ? -6.841  4.761   5.658   1.00 88.55  ? 135 MET A C     1 
ATOM   929  O  O     . MET A 1 116 ? -7.180  5.383   4.647   1.00 90.85  ? 135 MET A O     1 
ATOM   930  C  CB    . MET A 1 116 ? -7.616  4.874   8.048   1.00 82.73  ? 135 MET A CB    1 
ATOM   931  C  CG    . MET A 1 116 ? -7.241  5.160   9.491   1.00 84.90  ? 135 MET A CG    1 
ATOM   932  S  SD    . MET A 1 116 ? -8.505  4.564   10.630  1.00 91.51  ? 135 MET A SD    1 
ATOM   933  C  CE    . MET A 1 116 ? -8.689  2.875   10.060  1.00 89.11  ? 135 MET A CE    1 
ATOM   934  N  N     . THR A 1 117 ? -6.604  3.453   5.659   1.00 92.13  ? 136 THR A N     1 
ATOM   935  C  CA    . THR A 1 117 ? -6.813  2.609   4.494   1.00 93.11  ? 136 THR A CA    1 
ATOM   936  C  C     . THR A 1 117 ? -7.730  1.453   4.866   1.00 94.54  ? 136 THR A C     1 
ATOM   937  O  O     . THR A 1 117 ? -8.099  1.268   6.028   1.00 95.16  ? 136 THR A O     1 
ATOM   938  C  CB    . THR A 1 117 ? -5.487  2.067   3.944   1.00 94.74  ? 136 THR A CB    1 
ATOM   939  O  OG1   . THR A 1 117 ? -5.504  0.633   3.977   1.00 95.52  ? 136 THR A OG1   1 
ATOM   940  C  CG2   . THR A 1 117 ? -4.313  2.575   4.770   1.00 91.31  ? 136 THR A CG2   1 
ATOM   941  N  N     . LYS A 1 118 ? -8.081  0.653   3.863   1.00 91.89  ? 137 LYS A N     1 
ATOM   942  C  CA    . LYS A 1 118 ? -8.980  -0.478  4.084   1.00 92.57  ? 137 LYS A CA    1 
ATOM   943  C  C     . LYS A 1 118 ? -8.347  -1.598  4.917   1.00 95.77  ? 137 LYS A C     1 
ATOM   944  O  O     . LYS A 1 118 ? -8.922  -2.697  4.955   1.00 93.19  ? 137 LYS A O     1 
ATOM   945  C  CB    . LYS A 1 118 ? -9.460  -1.025  2.739   1.00 93.19  ? 137 LYS A CB    1 
ATOM   946  C  CG    . LYS A 1 118 ? -8.337  -1.426  1.796   1.00 95.14  ? 137 LYS A CG    1 
ATOM   947  C  CD    . LYS A 1 118 ? -8.797  -1.475  0.341   1.00 93.88  ? 137 LYS A CD    1 
ATOM   948  C  CE    . LYS A 1 118 ? -9.661  -2.694  0.043   1.00 91.37  ? 137 LYS A CE    1 
ATOM   949  N  NZ    . LYS A 1 118 ? -11.091 -2.509  0.421   1.00 87.69  ? 137 LYS A NZ    1 
ATOM   950  N  N     . GLU A 1 119 ? -7.210  -1.329  5.564   1.00 96.08  ? 138 GLU A N     1 
ATOM   951  C  CA    . GLU A 1 119 ? -6.548  -2.285  6.444   1.00 98.40  ? 138 GLU A CA    1 
ATOM   952  C  C     . GLU A 1 119 ? -7.478  -2.731  7.564   1.00 97.12  ? 138 GLU A C     1 
ATOM   953  O  O     . GLU A 1 119 ? -8.210  -3.716  7.417   1.00 91.45  ? 138 GLU A O     1 
ATOM   954  C  CB    . GLU A 1 119 ? -5.267  -1.675  7.023   1.00 99.33  ? 138 GLU A CB    1 
ATOM   955  C  CG    . GLU A 1 119 ? -5.214  -0.149  6.979   1.00 97.18  ? 138 GLU A CG    1 
ATOM   956  C  CD    . GLU A 1 119 ? -5.447  0.508   8.330   1.00 98.50  ? 138 GLU A CD    1 
ATOM   957  O  OE1   . GLU A 1 119 ? -6.244  -0.023  9.129   1.00 95.77  ? 138 GLU A OE1   1 
ATOM   958  O  OE2   . GLU A 1 119 ? -4.829  1.562   8.591   1.00 95.81  ? 138 GLU A OE2   1 
ATOM   959  N  N     . GLU A 1 120 ? -7.452  -2.022  8.691   1.00 97.17  ? 139 GLU A N     1 
ATOM   960  C  CA    . GLU A 1 120 ? -8.385  -2.319  9.768   1.00 97.59  ? 139 GLU A CA    1 
ATOM   961  C  C     . GLU A 1 120 ? -9.746  -1.672  9.554   1.00 93.02  ? 139 GLU A C     1 
ATOM   962  O  O     . GLU A 1 120 ? -10.694 -2.024  10.264  1.00 91.50  ? 139 GLU A O     1 
ATOM   963  C  CB    . GLU A 1 120 ? -7.804  -1.880  11.117  1.00 100.27 ? 139 GLU A CB    1 
ATOM   964  C  CG    . GLU A 1 120 ? -7.840  -2.964  12.190  1.00 98.50  ? 139 GLU A CG    1 
ATOM   965  C  CD    . GLU A 1 120 ? -6.969  -4.163  11.849  1.00 103.72 ? 139 GLU A CD    1 
ATOM   966  O  OE1   . GLU A 1 120 ? -6.003  -4.001  11.071  1.00 101.60 ? 139 GLU A OE1   1 
ATOM   967  O  OE2   . GLU A 1 120 ? -7.252  -5.269  12.359  1.00 101.86 ? 139 GLU A OE2   1 
ATOM   968  N  N     . THR A 1 121 ? -9.864  -0.742  8.597   1.00 91.13  ? 140 THR A N     1 
ATOM   969  C  CA    . THR A 1 121 ? -11.174 -0.208  8.236   1.00 86.39  ? 140 THR A CA    1 
ATOM   970  C  C     . THR A 1 121 ? -12.151 -1.333  7.931   1.00 80.97  ? 140 THR A C     1 
ATOM   971  O  O     . THR A 1 121 ? -13.318 -1.284  8.338   1.00 85.46  ? 140 THR A O     1 
ATOM   972  C  CB    . THR A 1 121 ? -11.052 0.729   7.033   1.00 85.95  ? 140 THR A CB    1 
ATOM   973  O  OG1   . THR A 1 121 ? -10.210 1.838   7.371   1.00 87.12  ? 140 THR A OG1   1 
ATOM   974  C  CG2   . THR A 1 121 ? -12.419 1.249   6.616   1.00 78.31  ? 140 THR A CG2   1 
ATOM   975  N  N     . GLN A 1 122 ? -11.684 -2.368  7.233   1.00 86.54  ? 141 GLN A N     1 
ATOM   976  C  CA    . GLN A 1 122 ? -12.508 -3.547  7.007   1.00 84.31  ? 141 GLN A CA    1 
ATOM   977  C  C     . GLN A 1 122 ? -12.643 -4.400  8.264   1.00 80.88  ? 141 GLN A C     1 
ATOM   978  O  O     . GLN A 1 122 ? -13.532 -5.256  8.324   1.00 79.40  ? 141 GLN A O     1 
ATOM   979  C  CB    . GLN A 1 122 ? -11.925 -4.376  5.862   1.00 88.25  ? 141 GLN A CB    1 
ATOM   980  C  CG    . GLN A 1 122 ? -12.965 -5.117  5.035   1.00 93.70  ? 141 GLN A CG    1 
ATOM   981  C  CD    . GLN A 1 122 ? -12.342 -6.033  3.996   1.00 87.09  ? 141 GLN A CD    1 
ATOM   982  O  OE1   . GLN A 1 122 ? -12.434 -7.257  4.099   1.00 80.05  ? 141 GLN A OE1   1 
ATOM   983  N  NE2   . GLN A 1 122 ? -11.709 -5.444  2.986   1.00 87.17  ? 141 GLN A NE2   1 
ATOM   984  N  N     . GLY A 1 123 ? -11.794 -4.180  9.267   1.00 78.23  ? 142 GLY A N     1 
ATOM   985  C  CA    . GLY A 1 123 ? -11.855 -4.947  10.497  1.00 75.91  ? 142 GLY A CA    1 
ATOM   986  C  C     . GLY A 1 123 ? -12.479 -4.191  11.653  1.00 77.02  ? 142 GLY A C     1 
ATOM   987  O  O     . GLY A 1 123 ? -12.211 -4.495  12.819  1.00 75.43  ? 142 GLY A O     1 
ATOM   988  N  N     . LEU A 1 124 ? -13.318 -3.201  11.336  1.00 74.74  ? 143 LEU A N     1 
ATOM   989  C  CA    . LEU A 1 124 ? -14.005 -2.429  12.369  1.00 68.71  ? 143 LEU A CA    1 
ATOM   990  C  C     . LEU A 1 124 ? -14.877 -3.327  13.241  1.00 62.12  ? 143 LEU A C     1 
ATOM   991  O  O     . LEU A 1 124 ? -14.808 -3.286  14.481  1.00 67.29  ? 143 LEU A O     1 
ATOM   992  C  CB    . LEU A 1 124 ? -14.840 -1.332  11.699  1.00 61.19  ? 143 LEU A CB    1 
ATOM   993  C  CG    . LEU A 1 124 ? -15.768 -0.406  12.491  1.00 60.50  ? 143 LEU A CG    1 
ATOM   994  C  CD1   . LEU A 1 124 ? -15.888 0.922   11.766  1.00 56.99  ? 143 LEU A CD1   1 
ATOM   995  C  CD2   . LEU A 1 124 ? -17.152 -1.011  12.681  1.00 50.23  ? 143 LEU A CD2   1 
ATOM   996  N  N     . TRP A 1 125 ? -15.709 -4.149  12.603  1.00 61.62  ? 144 TRP A N     1 
ATOM   997  C  CA    . TRP A 1 125 ? -16.635 -4.988  13.351  1.00 65.01  ? 144 TRP A CA    1 
ATOM   998  C  C     . TRP A 1 125 ? -15.893 -6.039  14.162  1.00 66.94  ? 144 TRP A C     1 
ATOM   999  O  O     . TRP A 1 125 ? -16.254 -6.308  15.314  1.00 67.00  ? 144 TRP A O     1 
ATOM   1000 C  CB    . TRP A 1 125 ? -17.632 -5.645  12.398  1.00 56.51  ? 144 TRP A CB    1 
ATOM   1001 C  CG    . TRP A 1 125 ? -18.857 -6.115  13.089  1.00 58.76  ? 144 TRP A CG    1 
ATOM   1002 C  CD1   . TRP A 1 125 ? -19.278 -7.402  13.231  1.00 63.02  ? 144 TRP A CD1   1 
ATOM   1003 C  CD2   . TRP A 1 125 ? -19.822 -5.299  13.762  1.00 58.91  ? 144 TRP A CD2   1 
ATOM   1004 N  NE1   . TRP A 1 125 ? -20.455 -7.440  13.942  1.00 65.19  ? 144 TRP A NE1   1 
ATOM   1005 C  CE2   . TRP A 1 125 ? -20.810 -6.160  14.278  1.00 57.72  ? 144 TRP A CE2   1 
ATOM   1006 C  CE3   . TRP A 1 125 ? -19.954 -3.922  13.966  1.00 55.99  ? 144 TRP A CE3   1 
ATOM   1007 C  CZ2   . TRP A 1 125 ? -21.910 -5.691  14.989  1.00 61.88  ? 144 TRP A CZ2   1 
ATOM   1008 C  CZ3   . TRP A 1 125 ? -21.048 -3.459  14.670  1.00 53.32  ? 144 TRP A CZ3   1 
ATOM   1009 C  CH2   . TRP A 1 125 ? -22.011 -4.339  15.173  1.00 56.06  ? 144 TRP A CH2   1 
ATOM   1010 N  N     . GLU A 1 126 ? -14.850 -6.639  13.582  1.00 72.93  ? 145 GLU A N     1 
ATOM   1011 C  CA    . GLU A 1 126 ? -14.083 -7.638  14.317  1.00 75.07  ? 145 GLU A CA    1 
ATOM   1012 C  C     . GLU A 1 126 ? -13.345 -7.007  15.491  1.00 72.45  ? 145 GLU A C     1 
ATOM   1013 O  O     . GLU A 1 126 ? -13.209 -7.628  16.550  1.00 70.43  ? 145 GLU A O     1 
ATOM   1014 C  CB    . GLU A 1 126 ? -13.107 -8.349  13.379  1.00 77.64  ? 145 GLU A CB    1 
ATOM   1015 C  CG    . GLU A 1 126 ? -12.545 -9.651  13.940  1.00 79.64  ? 145 GLU A CG    1 
ATOM   1016 C  CD    . GLU A 1 126 ? -13.635 -10.618 14.367  1.00 83.77  ? 145 GLU A CD    1 
ATOM   1017 O  OE1   . GLU A 1 126 ? -13.671 -10.986 15.560  1.00 79.68  ? 145 GLU A OE1   1 
ATOM   1018 O  OE2   . GLU A 1 126 ? -14.463 -11.002 13.511  1.00 85.89  ? 145 GLU A OE2   1 
ATOM   1019 N  N     . GLN A 1 127 ? -12.869 -5.770  15.325  1.00 68.91  ? 146 GLN A N     1 
ATOM   1020 C  CA    . GLN A 1 127 ? -12.220 -5.069  16.428  1.00 67.20  ? 146 GLN A CA    1 
ATOM   1021 C  C     . GLN A 1 127 ? -13.189 -4.849  17.583  1.00 68.97  ? 146 GLN A C     1 
ATOM   1022 O  O     . GLN A 1 127 ? -12.857 -5.114  18.746  1.00 68.56  ? 146 GLN A O     1 
ATOM   1023 C  CB    . GLN A 1 127 ? -11.650 -3.740  15.933  1.00 67.48  ? 146 GLN A CB    1 
ATOM   1024 C  CG    . GLN A 1 127 ? -11.313 -2.767  17.045  1.00 67.82  ? 146 GLN A CG    1 
ATOM   1025 C  CD    . GLN A 1 127 ? -10.596 -1.535  16.539  1.00 74.19  ? 146 GLN A CD    1 
ATOM   1026 O  OE1   . GLN A 1 127 ? -10.167 -1.480  15.385  1.00 77.93  ? 146 GLN A OE1   1 
ATOM   1027 N  NE2   . GLN A 1 127 ? -10.455 -0.539  17.403  1.00 73.19  ? 146 GLN A NE2   1 
ATOM   1028 N  N     . SER A 1 128 ? -14.400 -4.370  17.284  1.00 66.74  ? 147 SER A N     1 
ATOM   1029 C  CA    . SER A 1 128 ? -15.381 -4.184  18.353  1.00 61.44  ? 147 SER A CA    1 
ATOM   1030 C  C     . SER A 1 128 ? -15.767 -5.516  18.993  1.00 62.52  ? 147 SER A C     1 
ATOM   1031 O  O     . SER A 1 128 ? -15.918 -5.610  20.223  1.00 69.56  ? 147 SER A O     1 
ATOM   1032 C  CB    . SER A 1 128 ? -16.616 -3.462  17.818  1.00 64.49  ? 147 SER A CB    1 
ATOM   1033 O  OG    . SER A 1 128 ? -16.297 -2.133  17.441  1.00 58.22  ? 147 SER A OG    1 
ATOM   1034 N  N     . LYS A 1 129 ? -15.922 -6.562  18.176  1.00 63.90  ? 148 LYS A N     1 
ATOM   1035 C  CA    . LYS A 1 129 ? -16.251 -7.881  18.708  1.00 69.91  ? 148 LYS A CA    1 
ATOM   1036 C  C     . LYS A 1 129 ? -15.171 -8.368  19.666  1.00 71.92  ? 148 LYS A C     1 
ATOM   1037 O  O     . LYS A 1 129 ? -15.471 -8.848  20.765  1.00 69.92  ? 148 LYS A O     1 
ATOM   1038 C  CB    . LYS A 1 129 ? -16.449 -8.872  17.560  1.00 66.25  ? 148 LYS A CB    1 
ATOM   1039 C  CG    . LYS A 1 129 ? -17.790 -8.743  16.851  1.00 66.15  ? 148 LYS A CG    1 
ATOM   1040 C  CD    . LYS A 1 129 ? -17.791 -9.472  15.514  1.00 70.21  ? 148 LYS A CD    1 
ATOM   1041 C  CE    . LYS A 1 129 ? -17.517 -10.957 15.673  1.00 74.44  ? 148 LYS A CE    1 
ATOM   1042 N  NZ    . LYS A 1 129 ? -17.430 -11.643 14.352  1.00 68.31  ? 148 LYS A NZ    1 
ATOM   1043 N  N     . GLU A 1 130 ? -13.902 -8.237  19.268  1.00 72.53  ? 149 GLU A N     1 
ATOM   1044 C  CA    . GLU A 1 130 ? -12.800 -8.625  20.142  1.00 72.81  ? 149 GLU A CA    1 
ATOM   1045 C  C     . GLU A 1 130 ? -12.788 -7.789  21.414  1.00 72.94  ? 149 GLU A C     1 
ATOM   1046 O  O     . GLU A 1 130 ? -12.468 -8.299  22.495  1.00 73.68  ? 149 GLU A O     1 
ATOM   1047 C  CB    . GLU A 1 130 ? -11.468 -8.495  19.402  1.00 72.85  ? 149 GLU A CB    1 
ATOM   1048 C  CG    . GLU A 1 130 ? -11.251 -9.560  18.337  1.00 82.62  ? 149 GLU A CG    1 
ATOM   1049 C  CD    . GLU A 1 130 ? -10.186 -9.177  17.323  1.00 85.09  ? 149 GLU A CD    1 
ATOM   1050 O  OE1   . GLU A 1 130 ? -9.897  -10.001 16.429  1.00 82.73  ? 149 GLU A OE1   1 
ATOM   1051 O  OE2   . GLU A 1 130 ? -9.643  -8.054  17.413  1.00 80.13  ? 149 GLU A OE2   1 
ATOM   1052 N  N     . VAL A 1 131 ? -13.133 -6.503  21.309  1.00 69.63  ? 150 VAL A N     1 
ATOM   1053 C  CA    . VAL A 1 131 ? -13.229 -5.673  22.507  1.00 71.18  ? 150 VAL A CA    1 
ATOM   1054 C  C     . VAL A 1 131 ? -14.251 -6.257  23.473  1.00 74.35  ? 150 VAL A C     1 
ATOM   1055 O  O     . VAL A 1 131 ? -14.036 -6.273  24.692  1.00 79.76  ? 150 VAL A O     1 
ATOM   1056 C  CB    . VAL A 1 131 ? -13.569 -4.217  22.137  1.00 68.36  ? 150 VAL A CB    1 
ATOM   1057 C  CG1   . VAL A 1 131 ? -14.012 -3.442  23.373  1.00 63.55  ? 150 VAL A CG1   1 
ATOM   1058 C  CG2   . VAL A 1 131 ? -12.370 -3.540  21.499  1.00 67.50  ? 150 VAL A CG2   1 
ATOM   1059 N  N     . LEU A 1 132 ? -15.369 -6.768  22.950  1.00 70.41  ? 151 LEU A N     1 
ATOM   1060 C  CA    . LEU A 1 132 ? -16.398 -7.270  23.857  1.00 71.45  ? 151 LEU A CA    1 
ATOM   1061 C  C     . LEU A 1 132 ? -16.023 -8.610  24.489  1.00 69.32  ? 151 LEU A C     1 
ATOM   1062 O  O     . LEU A 1 132 ? -16.453 -8.897  25.612  1.00 71.80  ? 151 LEU A O     1 
ATOM   1063 C  CB    . LEU A 1 132 ? -17.738 -7.376  23.137  1.00 73.07  ? 151 LEU A CB    1 
ATOM   1064 C  CG    . LEU A 1 132 ? -18.625 -6.161  23.425  1.00 72.58  ? 151 LEU A CG    1 
ATOM   1065 C  CD1   . LEU A 1 132 ? -18.582 -5.163  22.274  1.00 73.14  ? 151 LEU A CD1   1 
ATOM   1066 C  CD2   . LEU A 1 132 ? -20.055 -6.575  23.754  1.00 69.99  ? 151 LEU A CD2   1 
ATOM   1067 N  N     . ARG A 1 133 ? -15.244 -9.448  23.797  1.00 72.59  ? 152 ARG A N     1 
ATOM   1068 C  CA    . ARG A 1 133 ? -14.837 -10.721 24.389  1.00 78.87  ? 152 ARG A CA    1 
ATOM   1069 C  C     . ARG A 1 133 ? -13.874 -10.504 25.549  1.00 80.17  ? 152 ARG A C     1 
ATOM   1070 O  O     . ARG A 1 133 ? -14.046 -11.077 26.631  1.00 77.10  ? 152 ARG A O     1 
ATOM   1071 C  CB    . ARG A 1 133 ? -14.178 -11.620 23.345  1.00 81.06  ? 152 ARG A CB    1 
ATOM   1072 C  CG    . ARG A 1 133 ? -14.839 -11.669 21.997  1.00 78.63  ? 152 ARG A CG    1 
ATOM   1073 C  CD    . ARG A 1 133 ? -13.823 -12.165 20.988  1.00 80.68  ? 152 ARG A CD    1 
ATOM   1074 N  NE    . ARG A 1 133 ? -14.365 -12.284 19.641  1.00 84.60  ? 152 ARG A NE    1 
ATOM   1075 C  CZ    . ARG A 1 133 ? -13.624 -12.536 18.568  1.00 86.17  ? 152 ARG A CZ    1 
ATOM   1076 N  NH1   . ARG A 1 133 ? -12.312 -12.691 18.688  1.00 84.87  ? 152 ARG A NH1   1 
ATOM   1077 N  NH2   . ARG A 1 133 ? -14.194 -12.631 17.374  1.00 85.35  ? 152 ARG A NH2   1 
ATOM   1078 N  N     . SER A 1 134 ? -12.842 -9.685  25.332  1.00 83.37  ? 153 SER A N     1 
ATOM   1079 C  CA    . SER A 1 134 ? -11.783 -9.471  26.309  1.00 82.96  ? 153 SER A CA    1 
ATOM   1080 C  C     . SER A 1 134 ? -12.248 -8.712  27.545  1.00 84.13  ? 153 SER A C     1 
ATOM   1081 O  O     . SER A 1 134 ? -11.451 -8.538  28.475  1.00 86.32  ? 153 SER A O     1 
ATOM   1082 C  CB    . SER A 1 134 ? -10.625 -8.712  25.654  1.00 81.90  ? 153 SER A CB    1 
ATOM   1083 O  OG    . SER A 1 134 ? -10.301 -9.260  24.387  1.00 81.64  ? 153 SER A OG    1 
ATOM   1084 N  N     . LYS A 1 135 ? -13.504 -8.262  27.578  1.00 82.59  ? 154 LYS A N     1 
ATOM   1085 C  CA    . LYS A 1 135 ? -14.025 -7.374  28.618  1.00 85.06  ? 154 LYS A CA    1 
ATOM   1086 C  C     . LYS A 1 135 ? -13.173 -6.120  28.785  1.00 85.36  ? 154 LYS A C     1 
ATOM   1087 O  O     . LYS A 1 135 ? -13.230 -5.459  29.829  1.00 82.64  ? 154 LYS A O     1 
ATOM   1088 C  CB    . LYS A 1 135 ? -14.172 -8.098  29.962  1.00 85.01  ? 154 LYS A CB    1 
ATOM   1089 C  CG    . LYS A 1 135 ? -15.256 -9.168  29.975  1.00 85.11  ? 154 LYS A CG    1 
ATOM   1090 C  CD    . LYS A 1 135 ? -15.732 -9.437  31.394  1.00 82.75  ? 154 LYS A CD    1 
ATOM   1091 C  CE    . LYS A 1 135 ? -15.446 -10.867 31.820  1.00 78.38  ? 154 LYS A CE    1 
ATOM   1092 N  NZ    . LYS A 1 135 ? -16.304 -11.843 31.094  1.00 76.62  ? 154 LYS A NZ    1 
ATOM   1093 N  N     . GLU A 1 136 ? -12.390 -5.775  27.761  1.00 86.98  ? 155 GLU A N     1 
ATOM   1094 C  CA    . GLU A 1 136 ? -11.603 -4.549  27.749  1.00 87.02  ? 155 GLU A CA    1 
ATOM   1095 C  C     . GLU A 1 136 ? -12.486 -3.351  27.426  1.00 86.39  ? 155 GLU A C     1 
ATOM   1096 O  O     . GLU A 1 136 ? -12.002 -2.342  26.902  1.00 80.65  ? 155 GLU A O     1 
ATOM   1097 C  CB    . GLU A 1 136 ? -10.463 -4.645  26.729  1.00 84.07  ? 155 GLU A CB    1 
ATOM   1098 C  CG    . GLU A 1 136 ? -9.172  -5.261  27.256  1.00 86.80  ? 155 GLU A CG    1 
ATOM   1099 C  CD    . GLU A 1 136 ? -8.060  -5.271  26.217  1.00 91.01  ? 155 GLU A CD    1 
ATOM   1100 O  OE1   . GLU A 1 136 ? -8.346  -4.995  25.031  1.00 88.90  ? 155 GLU A OE1   1 
ATOM   1101 O  OE2   . GLU A 1 136 ? -6.900  -5.553  26.587  1.00 93.53  ? 155 GLU A OE2   1 
ATOM   1102 N  N     . VAL A 1 137 ? -13.778 -3.451  27.730  1.00 86.96  ? 156 VAL A N     1 
ATOM   1103 C  CA    . VAL A 1 137 ? -14.719 -2.398  27.363  1.00 86.04  ? 156 VAL A CA    1 
ATOM   1104 C  C     . VAL A 1 137 ? -14.756 -1.296  28.417  1.00 85.70  ? 156 VAL A C     1 
ATOM   1105 O  O     . VAL A 1 137 ? -14.869 -0.114  28.080  1.00 80.57  ? 156 VAL A O     1 
ATOM   1106 C  CB    . VAL A 1 137 ? -16.116 -3.003  27.098  1.00 83.39  ? 156 VAL A CB    1 
ATOM   1107 C  CG1   . VAL A 1 137 ? -16.813 -3.414  28.393  1.00 87.14  ? 156 VAL A CG1   1 
ATOM   1108 C  CG2   . VAL A 1 137 ? -16.970 -2.036  26.294  1.00 83.78  ? 156 VAL A CG2   1 
ATOM   1109 N  N     . THR A 1 138 ? -14.645 -1.652  29.700  1.00 86.51  ? 157 THR A N     1 
ATOM   1110 C  CA    . THR A 1 138 ? -14.417 -0.641  30.727  1.00 86.52  ? 157 THR A CA    1 
ATOM   1111 C  C     . THR A 1 138 ? -12.959 -0.214  30.773  1.00 81.87  ? 157 THR A C     1 
ATOM   1112 O  O     . THR A 1 138 ? -12.667 0.939   31.112  1.00 78.70  ? 157 THR A O     1 
ATOM   1113 C  CB    . THR A 1 138 ? -14.832 -1.162  32.108  1.00 84.29  ? 157 THR A CB    1 
ATOM   1114 O  OG1   . THR A 1 138 ? -15.096 -2.571  32.037  1.00 88.98  ? 157 THR A OG1   1 
ATOM   1115 C  CG2   . THR A 1 138 ? -16.064 -0.431  32.619  1.00 77.71  ? 157 THR A CG2   1 
ATOM   1116 N  N     . LYS A 1 139 ? -12.051 -1.129  30.429  1.00 79.90  ? 158 LYS A N     1 
ATOM   1117 C  CA    . LYS A 1 139 ? -10.617 -0.878  30.480  1.00 76.27  ? 158 LYS A CA    1 
ATOM   1118 C  C     . LYS A 1 139 ? -10.244 0.335   29.641  1.00 76.06  ? 158 LYS A C     1 
ATOM   1119 O  O     . LYS A 1 139 ? -10.877 0.630   28.626  1.00 79.81  ? 158 LYS A O     1 
ATOM   1120 C  CB    . LYS A 1 139 ? -9.855  -2.113  29.984  1.00 73.72  ? 158 LYS A CB    1 
ATOM   1121 C  CG    . LYS A 1 139 ? -8.743  -2.559  30.907  1.00 78.07  ? 158 LYS A CG    1 
ATOM   1122 C  CD    . LYS A 1 139 ? -7.425  -2.682  30.166  1.00 77.97  ? 158 LYS A CD    1 
ATOM   1123 C  CE    . LYS A 1 139 ? -6.340  -3.244  31.067  1.00 68.59  ? 158 LYS A CE    1 
ATOM   1124 N  NZ    . LYS A 1 139 ? -6.688  -4.607  31.548  1.00 70.91  ? 158 LYS A NZ    1 
ATOM   1125 N  N     . ARG A 1 140 ? -9.205  1.044   30.076  1.00 69.77  ? 159 ARG A N     1 
ATOM   1126 C  CA    . ARG A 1 140 ? -8.710  2.181   29.315  1.00 65.17  ? 159 ARG A CA    1 
ATOM   1127 C  C     . ARG A 1 140 ? -8.082  1.699   28.012  1.00 62.19  ? 159 ARG A C     1 
ATOM   1128 O  O     . ARG A 1 140 ? -7.310  0.736   28.002  1.00 66.87  ? 159 ARG A O     1 
ATOM   1129 C  CB    . ARG A 1 140 ? -7.693  2.962   30.138  1.00 64.72  ? 159 ARG A CB    1 
ATOM   1130 C  CG    . ARG A 1 140 ? -7.299  4.289   29.535  1.00 58.60  ? 159 ARG A CG    1 
ATOM   1131 C  CD    . ARG A 1 140 ? -5.912  4.688   29.998  1.00 56.73  ? 159 ARG A CD    1 
ATOM   1132 N  NE    . ARG A 1 140 ? -5.579  6.054   29.612  1.00 61.72  ? 159 ARG A NE    1 
ATOM   1133 C  CZ    . ARG A 1 140 ? -4.345  6.549   29.608  1.00 64.07  ? 159 ARG A CZ    1 
ATOM   1134 N  NH1   . ARG A 1 140 ? -3.320  5.784   29.959  1.00 63.51  ? 159 ARG A NH1   1 
ATOM   1135 N  NH2   . ARG A 1 140 ? -4.133  7.807   29.243  1.00 64.07  ? 159 ARG A NH2   1 
ATOM   1136 N  N     . ARG A 1 141 ? -8.409  2.370   26.916  1.00 58.24  ? 160 ARG A N     1 
ATOM   1137 C  CA    . ARG A 1 141 ? -8.000  1.943   25.585  1.00 62.71  ? 160 ARG A CA    1 
ATOM   1138 C  C     . ARG A 1 141 ? -8.245  3.096   24.616  1.00 58.72  ? 160 ARG A C     1 
ATOM   1139 O  O     . ARG A 1 141 ? -9.021  4.005   24.920  1.00 53.42  ? 160 ARG A O     1 
ATOM   1140 C  CB    . ARG A 1 141 ? -8.780  0.699   25.137  1.00 58.83  ? 160 ARG A CB    1 
ATOM   1141 C  CG    . ARG A 1 141 ? -10.279 0.874   25.259  1.00 57.90  ? 160 ARG A CG    1 
ATOM   1142 C  CD    . ARG A 1 141 ? -11.038 -0.301  24.682  1.00 65.31  ? 160 ARG A CD    1 
ATOM   1143 N  NE    . ARG A 1 141 ? -12.473 -0.157  24.904  1.00 68.55  ? 160 ARG A NE    1 
ATOM   1144 C  CZ    . ARG A 1 141 ? -13.286 0.523   24.102  1.00 67.60  ? 160 ARG A CZ    1 
ATOM   1145 N  NH1   . ARG A 1 141 ? -12.807 1.119   23.020  1.00 65.71  ? 160 ARG A NH1   1 
ATOM   1146 N  NH2   . ARG A 1 141 ? -14.579 0.607   24.382  1.00 68.85  ? 160 ARG A NH2   1 
ATOM   1147 N  N     . PRO A 1 142 ? -7.595  3.080   23.455  1.00 54.18  ? 161 PRO A N     1 
ATOM   1148 C  CA    . PRO A 1 142 ? -7.939  4.057   22.420  1.00 59.25  ? 161 PRO A CA    1 
ATOM   1149 C  C     . PRO A 1 142 ? -9.301  3.743   21.821  1.00 59.23  ? 161 PRO A C     1 
ATOM   1150 O  O     . PRO A 1 142 ? -9.720  2.584   21.747  1.00 56.26  ? 161 PRO A O     1 
ATOM   1151 C  CB    . PRO A 1 142 ? -6.818  3.893   21.389  1.00 58.35  ? 161 PRO A CB    1 
ATOM   1152 C  CG    . PRO A 1 142 ? -6.355  2.489   21.570  1.00 59.43  ? 161 PRO A CG    1 
ATOM   1153 C  CD    . PRO A 1 142 ? -6.491  2.197   23.036  1.00 53.78  ? 161 PRO A CD    1 
ATOM   1154 N  N     . ARG A 1 143 ? -10.000 4.799   21.407  1.00 56.89  ? 162 ARG A N     1 
ATOM   1155 C  CA    . ARG A 1 143 ? -11.341 4.636   20.862  1.00 58.22  ? 162 ARG A CA    1 
ATOM   1156 C  C     . ARG A 1 143 ? -11.316 3.686   19.674  1.00 50.96  ? 162 ARG A C     1 
ATOM   1157 O  O     . ARG A 1 143 ? -10.418 3.745   18.830  1.00 48.23  ? 162 ARG A O     1 
ATOM   1158 C  CB    . ARG A 1 143 ? -11.912 5.990   20.443  1.00 62.05  ? 162 ARG A CB    1 
ATOM   1159 C  CG    . ARG A 1 143 ? -11.573 7.104   21.406  1.00 66.99  ? 162 ARG A CG    1 
ATOM   1160 C  CD    . ARG A 1 143 ? -12.714 8.095   21.583  1.00 63.24  ? 162 ARG A CD    1 
ATOM   1161 N  NE    . ARG A 1 143 ? -14.005 7.433   21.752  1.00 75.23  ? 162 ARG A NE    1 
ATOM   1162 C  CZ    . ARG A 1 143 ? -14.367 6.731   22.825  1.00 77.87  ? 162 ARG A CZ    1 
ATOM   1163 N  NH1   . ARG A 1 143 ? -13.532 6.577   23.846  1.00 81.17  ? 162 ARG A NH1   1 
ATOM   1164 N  NH2   . ARG A 1 143 ? -15.569 6.173   22.872  1.00 74.24  ? 162 ARG A NH2   1 
ATOM   1165 N  N     . SER A 1 144 ? -12.297 2.790   19.624  1.00 49.76  ? 163 SER A N     1 
ATOM   1166 C  CA    . SER A 1 144 ? -12.364 1.840   18.528  1.00 54.90  ? 163 SER A CA    1 
ATOM   1167 C  C     . SER A 1 144 ? -12.731 2.552   17.227  1.00 55.52  ? 163 SER A C     1 
ATOM   1168 O  O     . SER A 1 144 ? -13.139 3.717   17.211  1.00 48.63  ? 163 SER A O     1 
ATOM   1169 C  CB    . SER A 1 144 ? -13.380 0.739   18.827  1.00 47.37  ? 163 SER A CB    1 
ATOM   1170 O  OG    . SER A 1 144 ? -14.694 1.265   18.888  1.00 55.54  ? 163 SER A OG    1 
ATOM   1171 N  N     . LEU A 1 145 ? -12.566 1.829   16.118  1.00 57.47  ? 164 LEU A N     1 
ATOM   1172 C  CA    . LEU A 1 145 ? -13.003 2.351   14.830  1.00 52.85  ? 164 LEU A CA    1 
ATOM   1173 C  C     . LEU A 1 145 ? -14.500 2.624   14.836  1.00 54.63  ? 164 LEU A C     1 
ATOM   1174 O  O     . LEU A 1 145 ? -14.954 3.650   14.317  1.00 59.34  ? 164 LEU A O     1 
ATOM   1175 C  CB    . LEU A 1 145 ? -12.633 1.372   13.720  1.00 53.76  ? 164 LEU A CB    1 
ATOM   1176 C  CG    . LEU A 1 145 ? -11.130 1.128   13.592  1.00 63.14  ? 164 LEU A CG    1 
ATOM   1177 C  CD1   . LEU A 1 145 ? -10.849 0.056   12.565  1.00 70.40  ? 164 LEU A CD1   1 
ATOM   1178 C  CD2   . LEU A 1 145 ? -10.415 2.418   13.229  1.00 64.71  ? 164 LEU A CD2   1 
ATOM   1179 N  N     . LEU A 1 146 ? -15.279 1.721   15.434  1.00 51.40  ? 165 LEU A N     1 
ATOM   1180 C  CA    . LEU A 1 146 ? -16.715 1.943   15.563  1.00 51.60  ? 165 LEU A CA    1 
ATOM   1181 C  C     . LEU A 1 146 ? -17.008 3.220   16.341  1.00 52.23  ? 165 LEU A C     1 
ATOM   1182 O  O     . LEU A 1 146 ? -17.937 3.964   16.005  1.00 57.65  ? 165 LEU A O     1 
ATOM   1183 C  CB    . LEU A 1 146 ? -17.365 0.736   16.239  1.00 50.04  ? 165 LEU A CB    1 
ATOM   1184 C  CG    . LEU A 1 146 ? -18.863 0.824   16.520  1.00 54.85  ? 165 LEU A CG    1 
ATOM   1185 C  CD1   . LEU A 1 146 ? -19.643 1.021   15.229  1.00 50.32  ? 165 LEU A CD1   1 
ATOM   1186 C  CD2   . LEU A 1 146 ? -19.334 -0.422  17.255  1.00 51.93  ? 165 LEU A CD2   1 
ATOM   1187 N  N     . GLU A 1 147 ? -16.221 3.498   17.378  1.00 52.87  ? 166 GLU A N     1 
ATOM   1188 C  CA    . GLU A 1 147 ? -16.434 4.698   18.176  1.00 56.27  ? 166 GLU A CA    1 
ATOM   1189 C  C     . GLU A 1 147 ? -15.928 5.958   17.487  1.00 45.10  ? 166 GLU A C     1 
ATOM   1190 O  O     . GLU A 1 147 ? -16.304 7.063   17.892  1.00 41.47  ? 166 GLU A O     1 
ATOM   1191 C  CB    . GLU A 1 147 ? -15.764 4.539   19.544  1.00 53.62  ? 166 GLU A CB    1 
ATOM   1192 C  CG    . GLU A 1 147 ? -16.447 3.512   20.434  1.00 53.87  ? 166 GLU A CG    1 
ATOM   1193 C  CD    . GLU A 1 147 ? -15.602 3.096   21.624  1.00 63.94  ? 166 GLU A CD    1 
ATOM   1194 O  OE1   . GLU A 1 147 ? -14.356 3.156   21.533  1.00 64.06  ? 166 GLU A OE1   1 
ATOM   1195 O  OE2   . GLU A 1 147 ? -16.188 2.705   22.653  1.00 68.05  ? 166 GLU A OE2   1 
ATOM   1196 N  N     . ARG A 1 148 ? -15.091 5.821   16.462  1.00 47.60  ? 167 ARG A N     1 
ATOM   1197 C  CA    . ARG A 1 148 ? -14.615 6.965   15.700  1.00 49.74  ? 167 ARG A CA    1 
ATOM   1198 C  C     . ARG A 1 148 ? -15.428 7.212   14.437  1.00 49.92  ? 167 ARG A C     1 
ATOM   1199 O  O     . ARG A 1 148 ? -15.227 8.239   13.780  1.00 47.87  ? 167 ARG A O     1 
ATOM   1200 C  CB    . ARG A 1 148 ? -13.137 6.782   15.338  1.00 52.34  ? 167 ARG A CB    1 
ATOM   1201 C  CG    . ARG A 1 148 ? -12.203 6.819   16.542  1.00 60.64  ? 167 ARG A CG    1 
ATOM   1202 C  CD    . ARG A 1 148 ? -10.801 7.236   16.135  1.00 62.92  ? 167 ARG A CD    1 
ATOM   1203 N  NE    . ARG A 1 148 ? -10.151 6.229   15.303  1.00 65.48  ? 167 ARG A NE    1 
ATOM   1204 C  CZ    . ARG A 1 148 ? -9.019  6.430   14.637  1.00 74.22  ? 167 ARG A CZ    1 
ATOM   1205 N  NH1   . ARG A 1 148 ? -8.496  5.455   13.907  1.00 75.27  ? 167 ARG A NH1   1 
ATOM   1206 N  NH2   . ARG A 1 148 ? -8.413  7.609   14.696  1.00 75.58  ? 167 ARG A NH2   1 
ATOM   1207 N  N     . LEU A 1 149 ? -16.337 6.304   14.094  1.00 46.41  ? 168 LEU A N     1 
ATOM   1208 C  CA    . LEU A 1 149 ? -17.208 6.491   12.943  1.00 47.55  ? 168 LEU A CA    1 
ATOM   1209 C  C     . LEU A 1 149 ? -18.148 7.667   13.182  1.00 44.64  ? 168 LEU A C     1 
ATOM   1210 O  O     . LEU A 1 149 ? -18.819 7.740   14.216  1.00 45.18  ? 168 LEU A O     1 
ATOM   1211 C  CB    . LEU A 1 149 ? -18.001 5.212   12.687  1.00 46.69  ? 168 LEU A CB    1 
ATOM   1212 C  CG    . LEU A 1 149 ? -18.800 5.083   11.393  1.00 44.11  ? 168 LEU A CG    1 
ATOM   1213 C  CD1   . LEU A 1 149 ? -17.896 5.249   10.179  1.00 44.92  ? 168 LEU A CD1   1 
ATOM   1214 C  CD2   . LEU A 1 149 ? -19.507 3.737   11.356  1.00 42.70  ? 168 LEU A CD2   1 
ATOM   1215 N  N     . ARG A 1 150 ? -18.187 8.592   12.230  1.00 44.39  ? 169 ARG A N     1 
ATOM   1216 C  CA    . ARG A 1 150 ? -19.044 9.769   12.310  1.00 42.89  ? 169 ARG A CA    1 
ATOM   1217 C  C     . ARG A 1 150 ? -20.088 9.825   11.207  1.00 44.48  ? 169 ARG A C     1 
ATOM   1218 O  O     . ARG A 1 150 ? -21.248 10.145  11.480  1.00 40.83  ? 169 ARG A O     1 
ATOM   1219 C  CB    . ARG A 1 150 ? -18.195 11.049  12.264  1.00 49.10  ? 169 ARG A CB    1 
ATOM   1220 C  CG    . ARG A 1 150 ? -17.040 11.084  13.259  1.00 51.32  ? 169 ARG A CG    1 
ATOM   1221 C  CD    . ARG A 1 150 ? -17.351 11.964  14.458  1.00 50.90  ? 169 ARG A CD    1 
ATOM   1222 N  NE    . ARG A 1 150 ? -18.474 11.451  15.234  1.00 56.02  ? 169 ARG A NE    1 
ATOM   1223 C  CZ    . ARG A 1 150 ? -18.360 10.600  16.249  1.00 59.68  ? 169 ARG A CZ    1 
ATOM   1224 N  NH1   . ARG A 1 150 ? -17.163 10.158  16.623  1.00 51.88  ? 169 ARG A NH1   1 
ATOM   1225 N  NH2   . ARG A 1 150 ? -19.448 10.192  16.892  1.00 51.97  ? 169 ARG A NH2   1 
ATOM   1226 N  N     . TRP A 1 151 ? -19.714 9.527   9.965   1.00 41.55  ? 170 TRP A N     1 
ATOM   1227 C  CA    . TRP A 1 151 ? -20.664 9.602   8.867   1.00 43.84  ? 170 TRP A CA    1 
ATOM   1228 C  C     . TRP A 1 151 ? -20.254 8.643   7.759   1.00 43.48  ? 170 TRP A C     1 
ATOM   1229 O  O     . TRP A 1 151 ? -19.099 8.227   7.656   1.00 46.50  ? 170 TRP A O     1 
ATOM   1230 C  CB    . TRP A 1 151 ? -20.787 11.030  8.320   1.00 39.74  ? 170 TRP A CB    1 
ATOM   1231 C  CG    . TRP A 1 151 ? -19.484 11.642  7.909   1.00 46.18  ? 170 TRP A CG    1 
ATOM   1232 C  CD1   . TRP A 1 151 ? -18.738 12.537  8.622   1.00 48.66  ? 170 TRP A CD1   1 
ATOM   1233 C  CD2   . TRP A 1 151 ? -18.771 11.411  6.688   1.00 44.11  ? 170 TRP A CD2   1 
ATOM   1234 N  NE1   . TRP A 1 151 ? -17.607 12.877  7.921   1.00 47.32  ? 170 TRP A NE1   1 
ATOM   1235 C  CE2   . TRP A 1 151 ? -17.603 12.199  6.731   1.00 50.07  ? 170 TRP A CE2   1 
ATOM   1236 C  CE3   . TRP A 1 151 ? -19.008 10.620  5.561   1.00 48.70  ? 170 TRP A CE3   1 
ATOM   1237 C  CZ2   . TRP A 1 151 ? -16.674 12.214  5.692   1.00 52.04  ? 170 TRP A CZ2   1 
ATOM   1238 C  CZ3   . TRP A 1 151 ? -18.083 10.635  4.531   1.00 54.10  ? 170 TRP A CZ3   1 
ATOM   1239 C  CH2   . TRP A 1 151 ? -16.930 11.426  4.605   1.00 50.96  ? 170 TRP A CH2   1 
ATOM   1240 N  N     . VAL A 1 152 ? -21.235 8.305   6.926   1.00 47.27  ? 171 VAL A N     1 
ATOM   1241 C  CA    . VAL A 1 152 ? -21.062 7.413   5.782   1.00 45.77  ? 171 VAL A CA    1 
ATOM   1242 C  C     . VAL A 1 152 ? -21.912 7.941   4.634   1.00 50.00  ? 171 VAL A C     1 
ATOM   1243 O  O     . VAL A 1 152 ? -23.083 8.277   4.834   1.00 48.45  ? 171 VAL A O     1 
ATOM   1244 C  CB    . VAL A 1 152 ? -21.463 5.962   6.117   1.00 38.85  ? 171 VAL A CB    1 
ATOM   1245 C  CG1   . VAL A 1 152 ? -21.501 5.119   4.857   1.00 47.42  ? 171 VAL A CG1   1 
ATOM   1246 C  CG2   . VAL A 1 152 ? -20.509 5.355   7.133   1.00 49.36  ? 171 VAL A CG2   1 
ATOM   1247 N  N     . THR A 1 153 ? -21.334 8.018   3.439   1.00 49.50  ? 172 THR A N     1 
ATOM   1248 C  CA    . THR A 1 153 ? -22.079 8.389   2.246   1.00 48.95  ? 172 THR A CA    1 
ATOM   1249 C  C     . THR A 1 153 ? -22.493 7.139   1.476   1.00 52.96  ? 172 THR A C     1 
ATOM   1250 O  O     . THR A 1 153 ? -21.776 6.135   1.447   1.00 50.34  ? 172 THR A O     1 
ATOM   1251 C  CB    . THR A 1 153 ? -21.261 9.305   1.331   1.00 56.56  ? 172 THR A CB    1 
ATOM   1252 O  OG1   . THR A 1 153 ? -19.977 8.719   1.079   1.00 67.69  ? 172 THR A OG1   1 
ATOM   1253 C  CG2   . THR A 1 153 ? -21.078 10.679  1.961   1.00 49.24  ? 172 THR A CG2   1 
ATOM   1254 N  N     . LEU A 1 154 ? -23.668 7.210   0.852   1.00 50.41  ? 173 LEU A N     1 
ATOM   1255 C  CA    . LEU A 1 154 ? -24.223 6.121   0.057   1.00 47.78  ? 173 LEU A CA    1 
ATOM   1256 C  C     . LEU A 1 154 ? -24.740 6.678   -1.260  1.00 51.94  ? 173 LEU A C     1 
ATOM   1257 O  O     . LEU A 1 154 ? -25.318 7.767   -1.292  1.00 45.73  ? 173 LEU A O     1 
ATOM   1258 C  CB    . LEU A 1 154 ? -25.354 5.407   0.800   1.00 45.70  ? 173 LEU A CB    1 
ATOM   1259 C  CG    . LEU A 1 154 ? -25.037 4.889   2.202   1.00 48.02  ? 173 LEU A CG    1 
ATOM   1260 C  CD1   . LEU A 1 154 ? -26.294 4.351   2.854   1.00 43.82  ? 173 LEU A CD1   1 
ATOM   1261 C  CD2   . LEU A 1 154 ? -23.965 3.820   2.153   1.00 46.02  ? 173 LEU A CD2   1 
ATOM   1262 N  N     . GLY A 1 155 ? -24.550 5.919   -2.335  1.00 54.03  ? 174 GLY A N     1 
ATOM   1263 C  CA    . GLY A 1 155 ? -25.027 6.336   -3.636  1.00 49.77  ? 174 GLY A CA    1 
ATOM   1264 C  C     . GLY A 1 155 ? -24.257 7.490   -4.244  1.00 53.18  ? 174 GLY A C     1 
ATOM   1265 O  O     . GLY A 1 155 ? -23.022 7.497   -4.236  1.00 52.51  ? 174 GLY A O     1 
ATOM   1266 N  N     . TYR A 1 156 ? -24.976 8.473   -4.781  1.00 51.39  ? 175 TYR A N     1 
ATOM   1267 C  CA    . TYR A 1 156 ? -24.320 9.619   -5.390  1.00 55.22  ? 175 TYR A CA    1 
ATOM   1268 C  C     . TYR A 1 156 ? -23.755 10.538  -4.314  1.00 54.46  ? 175 TYR A C     1 
ATOM   1269 O  O     . TYR A 1 156 ? -24.340 10.707  -3.241  1.00 51.40  ? 175 TYR A O     1 
ATOM   1270 C  CB    . TYR A 1 156 ? -25.296 10.373  -6.292  1.00 53.07  ? 175 TYR A CB    1 
ATOM   1271 C  CG    . TYR A 1 156 ? -25.747 9.544   -7.474  1.00 61.19  ? 175 TYR A CG    1 
ATOM   1272 C  CD1   . TYR A 1 156 ? -24.984 9.484   -8.636  1.00 65.41  ? 175 TYR A CD1   1 
ATOM   1273 C  CD2   . TYR A 1 156 ? -26.920 8.805   -7.422  1.00 55.05  ? 175 TYR A CD2   1 
ATOM   1274 C  CE1   . TYR A 1 156 ? -25.385 8.715   -9.715  1.00 67.73  ? 175 TYR A CE1   1 
ATOM   1275 C  CE2   . TYR A 1 156 ? -27.331 8.037   -8.493  1.00 62.16  ? 175 TYR A CE2   1 
ATOM   1276 C  CZ    . TYR A 1 156 ? -26.561 7.996   -9.638  1.00 69.87  ? 175 TYR A CZ    1 
ATOM   1277 O  OH    . TYR A 1 156 ? -26.970 7.230   -10.707 1.00 68.57  ? 175 TYR A OH    1 
ATOM   1278 N  N     . HIS A 1 157 ? -22.603 11.123  -4.606  1.00 55.90  ? 176 HIS A N     1 
ATOM   1279 C  CA    . HIS A 1 157 ? -21.922 12.000  -3.672  1.00 58.35  ? 176 HIS A CA    1 
ATOM   1280 C  C     . HIS A 1 157 ? -22.136 13.450  -4.078  1.00 53.35  ? 176 HIS A C     1 
ATOM   1281 O  O     . HIS A 1 157 ? -22.237 13.776  -5.263  1.00 57.54  ? 176 HIS A O     1 
ATOM   1282 C  CB    . HIS A 1 157 ? -20.429 11.673  -3.605  1.00 57.07  ? 176 HIS A CB    1 
ATOM   1283 C  CG    . HIS A 1 157 ? -20.137 10.328  -3.016  1.00 64.03  ? 176 HIS A CG    1 
ATOM   1284 N  ND1   . HIS A 1 157 ? -18.944 9.668   -3.218  1.00 74.09  ? 176 HIS A ND1   1 
ATOM   1285 C  CD2   . HIS A 1 157 ? -20.886 9.518   -2.230  1.00 63.68  ? 176 HIS A CD2   1 
ATOM   1286 C  CE1   . HIS A 1 157 ? -18.970 8.510   -2.581  1.00 68.98  ? 176 HIS A CE1   1 
ATOM   1287 N  NE2   . HIS A 1 157 ? -20.137 8.394   -1.974  1.00 59.55  ? 176 HIS A NE2   1 
ATOM   1288 N  N     . TYR A 1 158 ? -22.218 14.313  -3.075  1.00 48.09  ? 177 TYR A N     1 
ATOM   1289 C  CA    . TYR A 1 158 ? -22.545 15.713  -3.279  1.00 53.36  ? 177 TYR A CA    1 
ATOM   1290 C  C     . TYR A 1 158 ? -21.278 16.547  -3.419  1.00 58.10  ? 177 TYR A C     1 
ATOM   1291 O  O     . TYR A 1 158 ? -20.292 16.331  -2.708  1.00 53.26  ? 177 TYR A O     1 
ATOM   1292 C  CB    . TYR A 1 158 ? -23.391 16.222  -2.112  1.00 48.68  ? 177 TYR A CB    1 
ATOM   1293 C  CG    . TYR A 1 158 ? -23.835 17.658  -2.230  1.00 52.61  ? 177 TYR A CG    1 
ATOM   1294 C  CD1   . TYR A 1 158 ? -24.604 18.084  -3.306  1.00 49.86  ? 177 TYR A CD1   1 
ATOM   1295 C  CD2   . TYR A 1 158 ? -23.508 18.583  -1.249  1.00 53.68  ? 177 TYR A CD2   1 
ATOM   1296 C  CE1   . TYR A 1 158 ? -25.021 19.399  -3.407  1.00 51.46  ? 177 TYR A CE1   1 
ATOM   1297 C  CE2   . TYR A 1 158 ? -23.919 19.897  -1.338  1.00 53.47  ? 177 TYR A CE2   1 
ATOM   1298 C  CZ    . TYR A 1 158 ? -24.676 20.300  -2.417  1.00 58.80  ? 177 TYR A CZ    1 
ATOM   1299 O  OH    . TYR A 1 158 ? -25.086 21.611  -2.499  1.00 62.26  ? 177 TYR A OH    1 
ATOM   1300 N  N     . ASN A 1 159 ? -21.314 17.501  -4.345  1.00 60.88  ? 178 ASN A N     1 
ATOM   1301 C  CA    . ASN A 1 159 ? -20.201 18.410  -4.597  1.00 54.75  ? 178 ASN A CA    1 
ATOM   1302 C  C     . ASN A 1 159 ? -20.535 19.751  -3.954  1.00 55.42  ? 178 ASN A C     1 
ATOM   1303 O  O     . ASN A 1 159 ? -21.470 20.435  -4.380  1.00 59.07  ? 178 ASN A O     1 
ATOM   1304 C  CB    . ASN A 1 159 ? -19.958 18.554  -6.100  1.00 59.36  ? 178 ASN A CB    1 
ATOM   1305 C  CG    . ASN A 1 159 ? -18.681 19.308  -6.421  1.00 64.52  ? 178 ASN A CG    1 
ATOM   1306 O  OD1   . ASN A 1 159 ? -18.444 20.407  -5.915  1.00 61.47  ? 178 ASN A OD1   1 
ATOM   1307 N  ND2   . ASN A 1 159 ? -17.849 18.717  -7.269  1.00 55.87  ? 178 ASN A ND2   1 
ATOM   1308 N  N     . TRP A 1 160 ? -19.772 20.124  -2.924  1.00 56.43  ? 179 TRP A N     1 
ATOM   1309 C  CA    . TRP A 1 160 ? -20.039 21.378  -2.228  1.00 59.44  ? 179 TRP A CA    1 
ATOM   1310 C  C     . TRP A 1 160 ? -19.714 22.597  -3.080  1.00 60.83  ? 179 TRP A C     1 
ATOM   1311 O  O     . TRP A 1 160 ? -20.231 23.687  -2.805  1.00 56.48  ? 179 TRP A O     1 
ATOM   1312 C  CB    . TRP A 1 160 ? -19.255 21.435  -0.916  1.00 58.37  ? 179 TRP A CB    1 
ATOM   1313 C  CG    . TRP A 1 160 ? -19.674 20.396  0.080   1.00 51.33  ? 179 TRP A CG    1 
ATOM   1314 C  CD1   . TRP A 1 160 ? -19.051 19.211  0.340   1.00 52.68  ? 179 TRP A CD1   1 
ATOM   1315 C  CD2   . TRP A 1 160 ? -20.816 20.447  0.944   1.00 52.57  ? 179 TRP A CD2   1 
ATOM   1316 N  NE1   . TRP A 1 160 ? -19.730 18.523  1.318   1.00 52.88  ? 179 TRP A NE1   1 
ATOM   1317 C  CE2   . TRP A 1 160 ? -20.819 19.260  1.703   1.00 54.92  ? 179 TRP A CE2   1 
ATOM   1318 C  CE3   . TRP A 1 160 ? -21.837 21.382  1.150   1.00 54.96  ? 179 TRP A CE3   1 
ATOM   1319 C  CZ2   . TRP A 1 160 ? -21.803 18.983  2.654   1.00 53.84  ? 179 TRP A CZ2   1 
ATOM   1320 C  CZ3   . TRP A 1 160 ? -22.811 21.107  2.096   1.00 49.76  ? 179 TRP A CZ3   1 
ATOM   1321 C  CH2   . TRP A 1 160 ? -22.788 19.918  2.835   1.00 51.20  ? 179 TRP A CH2   1 
ATOM   1322 N  N     . ASP A 1 161 ? -18.874 22.443  -4.104  1.00 56.65  ? 180 ASP A N     1 
ATOM   1323 C  CA    . ASP A 1 161 ? -18.566 23.566  -4.981  1.00 65.05  ? 180 ASP A CA    1 
ATOM   1324 C  C     . ASP A 1 161 ? -19.636 23.731  -6.051  1.00 64.82  ? 180 ASP A C     1 
ATOM   1325 O  O     . ASP A 1 161 ? -20.211 24.814  -6.203  1.00 64.94  ? 180 ASP A O     1 
ATOM   1326 C  CB    . ASP A 1 161 ? -17.191 23.370  -5.621  1.00 68.13  ? 180 ASP A CB    1 
ATOM   1327 C  CG    . ASP A 1 161 ? -16.105 23.133  -4.596  1.00 60.77  ? 180 ASP A CG    1 
ATOM   1328 O  OD1   . ASP A 1 161 ? -16.119 23.813  -3.547  1.00 59.36  ? 180 ASP A OD1   1 
ATOM   1329 O  OD2   . ASP A 1 161 ? -15.242 22.264  -4.839  1.00 64.22  ? 180 ASP A OD2   1 
ATOM   1330 N  N     . SER A 1 162 ? -19.919 22.658  -6.796  1.00 65.23  ? 181 SER A N     1 
ATOM   1331 C  CA    . SER A 1 162 ? -20.964 22.700  -7.812  1.00 65.20  ? 181 SER A CA    1 
ATOM   1332 C  C     . SER A 1 162 ? -22.346 22.900  -7.209  1.00 62.61  ? 181 SER A C     1 
ATOM   1333 O  O     . SER A 1 162 ? -23.265 23.320  -7.921  1.00 66.23  ? 181 SER A O     1 
ATOM   1334 C  CB    . SER A 1 162 ? -20.954 21.407  -8.631  1.00 64.46  ? 181 SER A CB    1 
ATOM   1335 O  OG    . SER A 1 162 ? -19.631 20.975  -8.898  1.00 75.01  ? 181 SER A OG    1 
ATOM   1336 N  N     . LYS A 1 163 ? -22.507 22.615  -5.915  1.00 65.04  ? 182 LYS A N     1 
ATOM   1337 C  CA    . LYS A 1 163 ? -23.819 22.535  -5.270  1.00 62.58  ? 182 LYS A CA    1 
ATOM   1338 C  C     . LYS A 1 163 ? -24.727 21.537  -5.983  1.00 61.36  ? 182 LYS A C     1 
ATOM   1339 O  O     . LYS A 1 163 ? -25.952 21.690  -5.995  1.00 62.74  ? 182 LYS A O     1 
ATOM   1340 C  CB    . LYS A 1 163 ? -24.495 23.906  -5.183  1.00 65.26  ? 182 LYS A CB    1 
ATOM   1341 C  CG    . LYS A 1 163 ? -23.831 24.871  -4.223  1.00 65.05  ? 182 LYS A CG    1 
ATOM   1342 C  CD    . LYS A 1 163 ? -24.838 25.426  -3.231  1.00 60.41  ? 182 LYS A CD    1 
ATOM   1343 C  CE    . LYS A 1 163 ? -24.215 26.513  -2.373  1.00 69.70  ? 182 LYS A CE    1 
ATOM   1344 N  NZ    . LYS A 1 163 ? -23.735 27.651  -3.209  1.00 73.96  ? 182 LYS A NZ    1 
ATOM   1345 N  N     . LYS A 1 164 ? -24.130 20.508  -6.583  1.00 56.44  ? 183 LYS A N     1 
ATOM   1346 C  CA    . LYS A 1 164 ? -24.864 19.528  -7.368  1.00 60.40  ? 183 LYS A CA    1 
ATOM   1347 C  C     . LYS A 1 164 ? -24.271 18.146  -7.132  1.00 59.73  ? 183 LYS A C     1 
ATOM   1348 O  O     . LYS A 1 164 ? -23.108 18.002  -6.746  1.00 52.82  ? 183 LYS A O     1 
ATOM   1349 C  CB    . LYS A 1 164 ? -24.833 19.877  -8.865  1.00 65.60  ? 183 LYS A CB    1 
ATOM   1350 C  CG    . LYS A 1 164 ? -25.511 21.196  -9.210  1.00 68.47  ? 183 LYS A CG    1 
ATOM   1351 C  CD    . LYS A 1 164 ? -24.993 21.772  -10.520 1.00 74.67  ? 183 LYS A CD    1 
ATOM   1352 C  CE    . LYS A 1 164 ? -25.251 20.831  -11.685 1.00 81.41  ? 183 LYS A CE    1 
ATOM   1353 N  NZ    . LYS A 1 164 ? -24.765 21.406  -12.972 1.00 77.31  ? 183 LYS A NZ    1 
ATOM   1354 N  N     . TYR A 1 165 ? -25.093 17.125  -7.363  1.00 56.43  ? 184 TYR A N     1 
ATOM   1355 C  CA    . TYR A 1 165 ? -24.631 15.748  -7.294  1.00 57.60  ? 184 TYR A CA    1 
ATOM   1356 C  C     . TYR A 1 165 ? -23.995 15.340  -8.618  1.00 59.18  ? 184 TYR A C     1 
ATOM   1357 O  O     . TYR A 1 165 ? -24.219 15.963  -9.659  1.00 63.02  ? 184 TYR A O     1 
ATOM   1358 C  CB    . TYR A 1 165 ? -25.787 14.808  -6.944  1.00 55.38  ? 184 TYR A CB    1 
ATOM   1359 C  CG    . TYR A 1 165 ? -26.216 14.914  -5.499  1.00 50.22  ? 184 TYR A CG    1 
ATOM   1360 C  CD1   . TYR A 1 165 ? -27.093 15.907  -5.085  1.00 49.31  ? 184 TYR A CD1   1 
ATOM   1361 C  CD2   . TYR A 1 165 ? -25.727 14.032  -4.545  1.00 49.17  ? 184 TYR A CD2   1 
ATOM   1362 C  CE1   . TYR A 1 165 ? -27.475 16.013  -3.761  1.00 49.83  ? 184 TYR A CE1   1 
ATOM   1363 C  CE2   . TYR A 1 165 ? -26.105 14.128  -3.224  1.00 47.63  ? 184 TYR A CE2   1 
ATOM   1364 C  CZ    . TYR A 1 165 ? -26.977 15.118  -2.836  1.00 44.76  ? 184 TYR A CZ    1 
ATOM   1365 O  OH    . TYR A 1 165 ? -27.349 15.211  -1.519  1.00 43.14  ? 184 TYR A OH    1 
ATOM   1366 N  N     . SER A 1 166 ? -23.183 14.286  -8.569  1.00 63.32  ? 185 SER A N     1 
ATOM   1367 C  CA    . SER A 1 166 ? -22.511 13.795  -9.765  1.00 72.62  ? 185 SER A CA    1 
ATOM   1368 C  C     . SER A 1 166 ? -22.267 12.299  -9.632  1.00 70.34  ? 185 SER A C     1 
ATOM   1369 O  O     . SER A 1 166 ? -22.465 11.705  -8.570  1.00 71.80  ? 185 SER A O     1 
ATOM   1370 C  CB    . SER A 1 166 ? -21.187 14.527  -10.012 1.00 76.50  ? 185 SER A CB    1 
ATOM   1371 O  OG    . SER A 1 166 ? -20.132 13.922  -9.284  1.00 81.28  ? 185 SER A OG    1 
ATOM   1372 N  N     . ALA A 1 167 ? -21.827 11.697  -10.734 1.00 70.62  ? 186 ALA A N     1 
ATOM   1373 C  CA    . ALA A 1 167 ? -21.486 10.283  -10.767 1.00 74.37  ? 186 ALA A CA    1 
ATOM   1374 C  C     . ALA A 1 167 ? -20.034 10.018  -10.397 1.00 76.37  ? 186 ALA A C     1 
ATOM   1375 O  O     . ALA A 1 167 ? -19.636 8.853   -10.307 1.00 77.13  ? 186 ALA A O     1 
ATOM   1376 C  CB    . ALA A 1 167 ? -21.778 9.701   -12.154 1.00 71.64  ? 186 ALA A CB    1 
ATOM   1377 N  N     . ASP A 1 168 ? -19.238 11.065  -10.191 1.00 77.96  ? 187 ASP A N     1 
ATOM   1378 C  CA    . ASP A 1 168 ? -17.839 10.889  -9.825  1.00 81.33  ? 187 ASP A CA    1 
ATOM   1379 C  C     . ASP A 1 168 ? -17.730 10.168  -8.488  1.00 83.28  ? 187 ASP A C     1 
ATOM   1380 O  O     . ASP A 1 168 ? -18.211 10.665  -7.464  1.00 80.68  ? 187 ASP A O     1 
ATOM   1381 C  CB    . ASP A 1 168 ? -17.140 12.246  -9.763  1.00 84.09  ? 187 ASP A CB    1 
ATOM   1382 C  CG    . ASP A 1 168 ? -17.079 12.934  -11.115 1.00 89.56  ? 187 ASP A CG    1 
ATOM   1383 O  OD1   . ASP A 1 168 ? -16.730 12.264  -12.110 1.00 85.45  ? 187 ASP A OD1   1 
ATOM   1384 O  OD2   . ASP A 1 168 ? -17.388 14.143  -11.184 1.00 88.78  ? 187 ASP A OD2   1 
ATOM   1385 N  N     . HIS A 1 169 ? -17.101 8.992   -8.510  1.00 87.79  ? 188 HIS A N     1 
ATOM   1386 C  CA    . HIS A 1 169 ? -16.933 8.153   -7.323  1.00 84.39  ? 188 HIS A CA    1 
ATOM   1387 C  C     . HIS A 1 169 ? -18.287 7.744   -6.744  1.00 75.98  ? 188 HIS A C     1 
ATOM   1388 O  O     . HIS A 1 169 ? -18.573 7.950   -5.563  1.00 74.84  ? 188 HIS A O     1 
ATOM   1389 C  CB    . HIS A 1 169 ? -16.070 8.852   -6.268  1.00 85.29  ? 188 HIS A CB    1 
ATOM   1390 C  CG    . HIS A 1 169 ? -14.726 9.276   -6.772  1.00 87.68  ? 188 HIS A CG    1 
ATOM   1391 N  ND1   . HIS A 1 169 ? -13.981 10.263  -6.162  1.00 93.23  ? 188 HIS A ND1   1 
ATOM   1392 C  CD2   . HIS A 1 169 ? -13.991 8.847   -7.826  1.00 87.40  ? 188 HIS A CD2   1 
ATOM   1393 C  CE1   . HIS A 1 169 ? -12.846 10.424  -6.819  1.00 97.03  ? 188 HIS A CE1   1 
ATOM   1394 N  NE2   . HIS A 1 169 ? -12.827 9.577   -7.833  1.00 93.76  ? 188 HIS A NE2   1 
ATOM   1395 N  N     . TYR A 1 170 ? -19.127 7.160   -7.595  1.00 75.95  ? 189 TYR A N     1 
ATOM   1396 C  CA    . TYR A 1 170 ? -20.412 6.636   -7.157  1.00 65.41  ? 189 TYR A CA    1 
ATOM   1397 C  C     . TYR A 1 170 ? -20.221 5.261   -6.532  1.00 65.66  ? 189 TYR A C     1 
ATOM   1398 O  O     . TYR A 1 170 ? -19.528 4.407   -7.092  1.00 74.91  ? 189 TYR A O     1 
ATOM   1399 C  CB    . TYR A 1 170 ? -21.390 6.547   -8.331  1.00 67.35  ? 189 TYR A CB    1 
ATOM   1400 C  CG    . TYR A 1 170 ? -22.622 5.706   -8.051  1.00 63.77  ? 189 TYR A CG    1 
ATOM   1401 C  CD1   . TYR A 1 170 ? -23.737 6.256   -7.426  1.00 63.37  ? 189 TYR A CD1   1 
ATOM   1402 C  CD2   . TYR A 1 170 ? -22.674 4.364   -8.418  1.00 59.35  ? 189 TYR A CD2   1 
ATOM   1403 C  CE1   . TYR A 1 170 ? -24.867 5.490   -7.166  1.00 62.42  ? 189 TYR A CE1   1 
ATOM   1404 C  CE2   . TYR A 1 170 ? -23.800 3.591   -8.161  1.00 62.12  ? 189 TYR A CE2   1 
ATOM   1405 C  CZ    . TYR A 1 170 ? -24.892 4.159   -7.536  1.00 61.83  ? 189 TYR A CZ    1 
ATOM   1406 O  OH    . TYR A 1 170 ? -26.013 3.398   -7.280  1.00 56.95  ? 189 TYR A OH    1 
ATOM   1407 N  N     . THR A 1 171 ? -20.835 5.050   -5.372  1.00 66.96  ? 190 THR A N     1 
ATOM   1408 C  CA    . THR A 1 171 ? -20.847 3.752   -4.727  1.00 63.88  ? 190 THR A CA    1 
ATOM   1409 C  C     . THR A 1 171 ? -22.281 3.243   -4.651  1.00 63.55  ? 190 THR A C     1 
ATOM   1410 O  O     . THR A 1 171 ? -23.184 4.013   -4.314  1.00 56.47  ? 190 THR A O     1 
ATOM   1411 C  CB    . THR A 1 171 ? -20.238 3.828   -3.319  1.00 65.60  ? 190 THR A CB    1 
ATOM   1412 O  OG1   . THR A 1 171 ? -21.003 4.730   -2.508  1.00 68.41  ? 190 THR A OG1   1 
ATOM   1413 C  CG2   . THR A 1 171 ? -18.805 4.331   -3.395  1.00 65.37  ? 190 THR A CG2   1 
ATOM   1414 N  N     . PRO A 1 172 ? -22.525 1.971   -4.965  1.00 66.88  ? 191 PRO A N     1 
ATOM   1415 C  CA    . PRO A 1 172 ? -23.909 1.497   -5.124  1.00 57.14  ? 191 PRO A CA    1 
ATOM   1416 C  C     . PRO A 1 172 ? -24.735 1.696   -3.864  1.00 56.49  ? 191 PRO A C     1 
ATOM   1417 O  O     . PRO A 1 172 ? -24.285 1.410   -2.753  1.00 58.01  ? 191 PRO A O     1 
ATOM   1418 C  CB    . PRO A 1 172 ? -23.736 0.011   -5.461  1.00 59.44  ? 191 PRO A CB    1 
ATOM   1419 C  CG    . PRO A 1 172 ? -22.361 -0.342  -4.979  1.00 56.72  ? 191 PRO A CG    1 
ATOM   1420 C  CD    . PRO A 1 172 ? -21.544 0.894   -5.183  1.00 65.33  ? 191 PRO A CD    1 
ATOM   1421 N  N     . PHE A 1 173 ? -25.956 2.189   -4.050  1.00 57.56  ? 192 PHE A N     1 
ATOM   1422 C  CA    . PHE A 1 173 ? -26.845 2.413   -2.922  1.00 50.00  ? 192 PHE A CA    1 
ATOM   1423 C  C     . PHE A 1 173 ? -27.423 1.081   -2.447  1.00 48.05  ? 192 PHE A C     1 
ATOM   1424 O  O     . PHE A 1 173 ? -27.816 0.249   -3.269  1.00 60.99  ? 192 PHE A O     1 
ATOM   1425 C  CB    . PHE A 1 173 ? -27.973 3.368   -3.320  1.00 51.19  ? 192 PHE A CB    1 
ATOM   1426 C  CG    . PHE A 1 173 ? -28.727 3.944   -2.157  1.00 47.15  ? 192 PHE A CG    1 
ATOM   1427 C  CD1   . PHE A 1 173 ? -29.782 3.252   -1.587  1.00 44.12  ? 192 PHE A CD1   1 
ATOM   1428 C  CD2   . PHE A 1 173 ? -28.385 5.182   -1.639  1.00 46.83  ? 192 PHE A CD2   1 
ATOM   1429 C  CE1   . PHE A 1 173 ? -30.479 3.778   -0.517  1.00 40.72  ? 192 PHE A CE1   1 
ATOM   1430 C  CE2   . PHE A 1 173 ? -29.079 5.716   -0.567  1.00 44.46  ? 192 PHE A CE2   1 
ATOM   1431 C  CZ    . PHE A 1 173 ? -30.129 5.012   -0.007  1.00 43.68  ? 192 PHE A CZ    1 
ATOM   1432 N  N     . PRO A 1 174 ? -27.483 0.846   -1.137  1.00 50.71  ? 193 PRO A N     1 
ATOM   1433 C  CA    . PRO A 1 174 ? -27.997 -0.438  -0.640  1.00 47.63  ? 193 PRO A CA    1 
ATOM   1434 C  C     . PRO A 1 174 ? -29.457 -0.635  -1.021  1.00 51.38  ? 193 PRO A C     1 
ATOM   1435 O  O     . PRO A 1 174 ? -30.308 0.217   -0.751  1.00 49.49  ? 193 PRO A O     1 
ATOM   1436 C  CB    . PRO A 1 174 ? -27.818 -0.327  0.879   1.00 43.86  ? 193 PRO A CB    1 
ATOM   1437 C  CG    . PRO A 1 174 ? -26.776 0.714   1.070   1.00 44.49  ? 193 PRO A CG    1 
ATOM   1438 C  CD    . PRO A 1 174 ? -26.978 1.696   -0.047  1.00 51.81  ? 193 PRO A CD    1 
ATOM   1439 N  N     . SER A 1 175 ? -29.746 -1.790  -1.632  1.00 51.65  ? 194 SER A N     1 
ATOM   1440 C  CA    . SER A 1 175 ? -31.078 -2.028  -2.181  1.00 48.54  ? 194 SER A CA    1 
ATOM   1441 C  C     . SER A 1 175 ? -32.118 -2.249  -1.090  1.00 47.51  ? 194 SER A C     1 
ATOM   1442 O  O     . SER A 1 175 ? -33.294 -1.920  -1.287  1.00 54.38  ? 194 SER A O     1 
ATOM   1443 C  CB    . SER A 1 175 ? -31.053 -3.219  -3.145  1.00 49.27  ? 194 SER A CB    1 
ATOM   1444 O  OG    . SER A 1 175 ? -30.704 -4.425  -2.488  1.00 58.89  ? 194 SER A OG    1 
ATOM   1445 N  N     . ASP A 1 176 ? -31.714 -2.787  0.064   1.00 45.84  ? 195 ASP A N     1 
ATOM   1446 C  CA    . ASP A 1 176 ? -32.673 -3.005  1.145   1.00 43.51  ? 195 ASP A CA    1 
ATOM   1447 C  C     . ASP A 1 176 ? -33.123 -1.685  1.766   1.00 45.49  ? 195 ASP A C     1 
ATOM   1448 O  O     . ASP A 1 176 ? -34.320 -1.485  2.028   1.00 44.38  ? 195 ASP A O     1 
ATOM   1449 C  CB    . ASP A 1 176 ? -32.070 -3.933  2.203   1.00 43.30  ? 195 ASP A CB    1 
ATOM   1450 C  CG    . ASP A 1 176 ? -30.782 -3.395  2.809   1.00 45.51  ? 195 ASP A CG    1 
ATOM   1451 O  OD1   . ASP A 1 176 ? -30.108 -2.558  2.173   1.00 53.99  ? 195 ASP A OD1   1 
ATOM   1452 O  OD2   . ASP A 1 176 ? -30.440 -3.824  3.933   1.00 53.20  ? 195 ASP A OD2   1 
ATOM   1453 N  N     . LEU A 1 177 ? -32.177 -0.777  2.021   1.00 41.90  ? 196 LEU A N     1 
ATOM   1454 C  CA    . LEU A 1 177 ? -32.546 0.549   2.499   1.00 47.24  ? 196 LEU A CA    1 
ATOM   1455 C  C     . LEU A 1 177 ? -33.394 1.276   1.466   1.00 40.69  ? 196 LEU A C     1 
ATOM   1456 O  O     . LEU A 1 177 ? -34.326 2.004   1.821   1.00 37.84  ? 196 LEU A O     1 
ATOM   1457 C  CB    . LEU A 1 177 ? -31.292 1.359   2.838   1.00 44.30  ? 196 LEU A CB    1 
ATOM   1458 C  CG    . LEU A 1 177 ? -31.535 2.783   3.344   1.00 44.57  ? 196 LEU A CG    1 
ATOM   1459 C  CD1   . LEU A 1 177 ? -32.396 2.764   4.598   1.00 37.65  ? 196 LEU A CD1   1 
ATOM   1460 C  CD2   . LEU A 1 177 ? -30.221 3.500   3.602   1.00 40.86  ? 196 LEU A CD2   1 
ATOM   1461 N  N     . ALA A 1 178 ? -33.095 1.073   0.180   1.00 42.58  ? 197 ALA A N     1 
ATOM   1462 C  CA    . ALA A 1 178 ? -33.903 1.671   -0.876  1.00 47.55  ? 197 ALA A CA    1 
ATOM   1463 C  C     . ALA A 1 178 ? -35.330 1.138   -0.850  1.00 43.67  ? 197 ALA A C     1 
ATOM   1464 O  O     . ALA A 1 178 ? -36.286 1.897   -1.047  1.00 43.14  ? 197 ALA A O     1 
ATOM   1465 C  CB    . ALA A 1 178 ? -33.258 1.418   -2.240  1.00 44.38  ? 197 ALA A CB    1 
ATOM   1466 N  N     . PHE A 1 179 ? -35.497 -0.160  -0.588  1.00 42.79  ? 198 PHE A N     1 
ATOM   1467 C  CA    . PHE A 1 179 ? -36.840 -0.732  -0.520  1.00 40.64  ? 198 PHE A CA    1 
ATOM   1468 C  C     . PHE A 1 179 ? -37.612 -0.187  0.674   1.00 44.62  ? 198 PHE A C     1 
ATOM   1469 O  O     . PHE A 1 179 ? -38.791 0.179   0.548   1.00 45.73  ? 198 PHE A O     1 
ATOM   1470 C  CB    . PHE A 1 179 ? -36.753 -2.259  -0.464  1.00 52.43  ? 198 PHE A CB    1 
ATOM   1471 C  CG    . PHE A 1 179 ? -38.036 -2.958  -0.821  1.00 53.03  ? 198 PHE A CG    1 
ATOM   1472 C  CD1   . PHE A 1 179 ? -38.507 -2.946  -2.124  1.00 53.25  ? 198 PHE A CD1   1 
ATOM   1473 C  CD2   . PHE A 1 179 ? -38.761 -3.642  0.139   1.00 53.61  ? 198 PHE A CD2   1 
ATOM   1474 C  CE1   . PHE A 1 179 ? -39.684 -3.594  -2.457  1.00 58.44  ? 198 PHE A CE1   1 
ATOM   1475 C  CE2   . PHE A 1 179 ? -39.937 -4.294  -0.184  1.00 56.97  ? 198 PHE A CE2   1 
ATOM   1476 C  CZ    . PHE A 1 179 ? -40.400 -4.269  -1.484  1.00 57.36  ? 198 PHE A CZ    1 
ATOM   1477 N  N     . LEU A 1 180 ? -36.964 -0.122  1.841   1.00 46.00  ? 199 LEU A N     1 
ATOM   1478 C  CA    . LEU A 1 180 ? -37.600 0.476   3.016   1.00 42.78  ? 199 LEU A CA    1 
ATOM   1479 C  C     . LEU A 1 180 ? -38.006 1.925   2.746   1.00 41.03  ? 199 LEU A C     1 
ATOM   1480 O  O     . LEU A 1 180 ? -39.133 2.346   3.059   1.00 40.11  ? 199 LEU A O     1 
ATOM   1481 C  CB    . LEU A 1 180 ? -36.652 0.397   4.213   1.00 40.10  ? 199 LEU A CB    1 
ATOM   1482 C  CG    . LEU A 1 180 ? -37.003 1.259   5.426   1.00 41.30  ? 199 LEU A CG    1 
ATOM   1483 C  CD1   . LEU A 1 180 ? -38.169 0.658   6.183   1.00 40.22  ? 199 LEU A CD1   1 
ATOM   1484 C  CD2   . LEU A 1 180 ? -35.796 1.447   6.338   1.00 40.21  ? 199 LEU A CD2   1 
ATOM   1485 N  N     . SER A 1 181 ? -37.093 2.703   2.161   1.00 39.73  ? 200 SER A N     1 
ATOM   1486 C  CA    . SER A 1 181 ? -37.380 4.102   1.866   1.00 44.97  ? 200 SER A CA    1 
ATOM   1487 C  C     . SER A 1 181 ? -38.535 4.230   0.883   1.00 42.98  ? 200 SER A C     1 
ATOM   1488 O  O     . SER A 1 181 ? -39.388 5.112   1.030   1.00 36.76  ? 200 SER A O     1 
ATOM   1489 C  CB    . SER A 1 181 ? -36.130 4.786   1.314   1.00 40.72  ? 200 SER A CB    1 
ATOM   1490 O  OG    . SER A 1 181 ? -35.033 4.625   2.194   1.00 41.29  ? 200 SER A OG    1 
ATOM   1491 N  N     . GLU A 1 182 ? -38.581 3.355   -0.125  1.00 46.01  ? 201 GLU A N     1 
ATOM   1492 C  CA    . GLU A 1 182 ? -39.673 3.407   -1.089  1.00 44.68  ? 201 GLU A CA    1 
ATOM   1493 C  C     . GLU A 1 182 ? -41.004 3.095   -0.423  1.00 41.92  ? 201 GLU A C     1 
ATOM   1494 O  O     . GLU A 1 182 ? -42.021 3.725   -0.732  1.00 44.61  ? 201 GLU A O     1 
ATOM   1495 C  CB    . GLU A 1 182 ? -39.413 2.441   -2.244  1.00 49.58  ? 201 GLU A CB    1 
ATOM   1496 C  CG    . GLU A 1 182 ? -40.435 2.564   -3.361  1.00 60.30  ? 201 GLU A CG    1 
ATOM   1497 C  CD    . GLU A 1 182 ? -40.506 1.330   -4.234  1.00 64.80  ? 201 GLU A CD    1 
ATOM   1498 O  OE1   . GLU A 1 182 ? -41.253 1.356   -5.236  1.00 76.51  ? 201 GLU A OE1   1 
ATOM   1499 O  OE2   . GLU A 1 182 ? -39.822 0.335   -3.918  1.00 62.19  ? 201 GLU A OE2   1 
ATOM   1500 N  N     . GLN A 1 183 ? -41.021 2.127   0.496   1.00 43.51  ? 202 GLN A N     1 
ATOM   1501 C  CA    . GLN A 1 183 ? -42.262 1.832   1.209   1.00 41.39  ? 202 GLN A CA    1 
ATOM   1502 C  C     . GLN A 1 183 ? -42.740 3.050   1.984   1.00 42.22  ? 202 GLN A C     1 
ATOM   1503 O  O     . GLN A 1 183 ? -43.914 3.435   1.898   1.00 44.65  ? 202 GLN A O     1 
ATOM   1504 C  CB    . GLN A 1 183 ? -42.080 0.638   2.152   1.00 49.07  ? 202 GLN A CB    1 
ATOM   1505 C  CG    . GLN A 1 183 ? -41.588 -0.643  1.485   1.00 47.58  ? 202 GLN A CG    1 
ATOM   1506 C  CD    . GLN A 1 183 ? -42.303 -0.953  0.185   1.00 52.29  ? 202 GLN A CD    1 
ATOM   1507 O  OE1   . GLN A 1 183 ? -43.531 -0.898  0.105   1.00 61.15  ? 202 GLN A OE1   1 
ATOM   1508 N  NE2   . GLN A 1 183 ? -41.532 -1.280  -0.845  1.00 51.66  ? 202 GLN A NE2   1 
ATOM   1509 N  N     . VAL A 1 184 ? -41.835 3.680   2.739   1.00 41.90  ? 203 VAL A N     1 
ATOM   1510 C  CA    . VAL A 1 184 ? -42.216 4.858   3.521   1.00 42.39  ? 203 VAL A CA    1 
ATOM   1511 C  C     . VAL A 1 184 ? -42.722 5.974   2.607   1.00 38.64  ? 203 VAL A C     1 
ATOM   1512 O  O     . VAL A 1 184 ? -43.753 6.612   2.879   1.00 32.78  ? 203 VAL A O     1 
ATOM   1513 C  CB    . VAL A 1 184 ? -41.031 5.323   4.388   1.00 41.18  ? 203 VAL A CB    1 
ATOM   1514 C  CG1   . VAL A 1 184 ? -41.371 6.608   5.112   1.00 33.56  ? 203 VAL A CG1   1 
ATOM   1515 C  CG2   . VAL A 1 184 ? -40.650 4.235   5.381   1.00 37.31  ? 203 VAL A CG2   1 
ATOM   1516 N  N     . ALA A 1 185 ? -42.017 6.213   1.499   1.00 35.05  ? 204 ALA A N     1 
ATOM   1517 C  CA    . ALA A 1 185 ? -42.400 7.288   0.591   1.00 41.62  ? 204 ALA A CA    1 
ATOM   1518 C  C     . ALA A 1 185 ? -43.776 7.034   -0.012  1.00 41.43  ? 204 ALA A C     1 
ATOM   1519 O  O     . ALA A 1 185 ? -44.640 7.918   -0.008  1.00 44.47  ? 204 ALA A O     1 
ATOM   1520 C  CB    . ALA A 1 185 ? -41.348 7.445   -0.507  1.00 39.23  ? 204 ALA A CB    1 
ATOM   1521 N  N     . THR A 1 186 ? -43.994 5.827   -0.543  1.00 40.69  ? 205 THR A N     1 
ATOM   1522 C  CA    . THR A 1 186 ? -45.308 5.478   -1.071  1.00 43.48  ? 205 THR A CA    1 
ATOM   1523 C  C     . THR A 1 186 ? -46.388 5.668   -0.016  1.00 44.28  ? 205 THR A C     1 
ATOM   1524 O  O     . THR A 1 186 ? -47.453 6.226   -0.304  1.00 45.85  ? 205 THR A O     1 
ATOM   1525 C  CB    . THR A 1 186 ? -45.305 4.038   -1.583  1.00 44.37  ? 205 THR A CB    1 
ATOM   1526 O  OG1   . THR A 1 186 ? -44.255 3.868   -2.540  1.00 40.64  ? 205 THR A OG1   1 
ATOM   1527 C  CG2   . THR A 1 186 ? -46.634 3.707   -2.242  1.00 50.71  ? 205 THR A CG2   1 
ATOM   1528 N  N     . ALA A 1 187 ? -46.121 5.232   1.220   1.00 41.90  ? 206 ALA A N     1 
ATOM   1529 C  CA    . ALA A 1 187 ? -47.110 5.375   2.282   1.00 36.95  ? 206 ALA A CA    1 
ATOM   1530 C  C     . ALA A 1 187 ? -47.461 6.833   2.535   1.00 47.47  ? 206 ALA A C     1 
ATOM   1531 O  O     . ALA A 1 187 ? -48.608 7.146   2.878   1.00 47.95  ? 206 ALA A O     1 
ATOM   1532 C  CB    . ALA A 1 187 ? -46.595 4.725   3.565   1.00 42.82  ? 206 ALA A CB    1 
ATOM   1533 N  N     . CYS A 1 188 ? -46.496 7.736   2.378   1.00 46.83  ? 207 CYS A N     1 
ATOM   1534 C  CA    . CYS A 1 188 ? -46.740 9.157   2.594   1.00 38.94  ? 207 CYS A CA    1 
ATOM   1535 C  C     . CYS A 1 188 ? -47.300 9.867   1.365   1.00 44.90  ? 207 CYS A C     1 
ATOM   1536 O  O     . CYS A 1 188 ? -47.462 11.091  1.394   1.00 42.15  ? 207 CYS A O     1 
ATOM   1537 C  CB    . CYS A 1 188 ? -45.455 9.843   3.048   1.00 38.00  ? 207 CYS A CB    1 
ATOM   1538 S  SG    . CYS A 1 188 ? -45.098 9.570   4.773   1.00 43.62  ? 207 CYS A SG    1 
ATOM   1539 N  N     . GLY A 1 189 ? -47.591 9.139   0.294   1.00 45.15  ? 208 GLY A N     1 
ATOM   1540 C  CA    . GLY A 1 189 ? -48.185 9.724   -0.888  1.00 39.23  ? 208 GLY A CA    1 
ATOM   1541 C  C     . GLY A 1 189 ? -47.222 10.091  -1.992  1.00 47.83  ? 208 GLY A C     1 
ATOM   1542 O  O     . GLY A 1 189 ? -47.631 10.765  -2.944  1.00 46.03  ? 208 GLY A O     1 
ATOM   1543 N  N     . PHE A 1 190 ? -45.962 9.680   -1.898  1.00 44.64  ? 209 PHE A N     1 
ATOM   1544 C  CA    . PHE A 1 190 ? -44.962 9.957   -2.926  1.00 45.75  ? 209 PHE A CA    1 
ATOM   1545 C  C     . PHE A 1 190 ? -44.771 8.686   -3.744  1.00 50.95  ? 209 PHE A C     1 
ATOM   1546 O  O     . PHE A 1 190 ? -44.132 7.732   -3.293  1.00 52.84  ? 209 PHE A O     1 
ATOM   1547 C  CB    . PHE A 1 190 ? -43.653 10.428  -2.300  1.00 41.35  ? 209 PHE A CB    1 
ATOM   1548 C  CG    . PHE A 1 190 ? -43.804 11.645  -1.436  1.00 41.56  ? 209 PHE A CG    1 
ATOM   1549 C  CD1   . PHE A 1 190 ? -43.766 12.914  -1.992  1.00 39.91  ? 209 PHE A CD1   1 
ATOM   1550 C  CD2   . PHE A 1 190 ? -43.991 11.522  -0.070  1.00 36.24  ? 209 PHE A CD2   1 
ATOM   1551 C  CE1   . PHE A 1 190 ? -43.912 14.035  -1.200  1.00 39.05  ? 209 PHE A CE1   1 
ATOM   1552 C  CE2   . PHE A 1 190 ? -44.138 12.641  0.727   1.00 33.25  ? 209 PHE A CE2   1 
ATOM   1553 C  CZ    . PHE A 1 190 ? -44.099 13.898  0.163   1.00 35.03  ? 209 PHE A CZ    1 
ATOM   1554 N  N     . GLN A 1 191 ? -45.327 8.673   -4.948  1.00 55.90  ? 210 GLN A N     1 
ATOM   1555 C  CA    . GLN A 1 191 ? -45.195 7.528   -5.835  1.00 55.71  ? 210 GLN A CA    1 
ATOM   1556 C  C     . GLN A 1 191 ? -43.941 7.668   -6.686  1.00 53.01  ? 210 GLN A C     1 
ATOM   1557 O  O     . GLN A 1 191 ? -43.588 8.768   -7.122  1.00 46.93  ? 210 GLN A O     1 
ATOM   1558 C  CB    . GLN A 1 191 ? -46.432 7.386   -6.726  1.00 58.36  ? 210 GLN A CB    1 
ATOM   1559 C  CG    . GLN A 1 191 ? -47.567 6.575   -6.100  1.00 63.91  ? 210 GLN A CG    1 
ATOM   1560 C  CD    . GLN A 1 191 ? -48.190 7.255   -4.892  1.00 68.94  ? 210 GLN A CD    1 
ATOM   1561 O  OE1   . GLN A 1 191 ? -48.286 8.481   -4.836  1.00 67.26  ? 210 GLN A OE1   1 
ATOM   1562 N  NE2   . GLN A 1 191 ? -48.622 6.455   -3.917  1.00 66.85  ? 210 GLN A NE2   1 
ATOM   1563 N  N     . GLY A 1 192 ? -43.262 6.545   -6.908  1.00 49.65  ? 211 GLY A N     1 
ATOM   1564 C  CA    . GLY A 1 192 ? -42.104 6.540   -7.775  1.00 47.34  ? 211 GLY A CA    1 
ATOM   1565 C  C     . GLY A 1 192 ? -40.838 7.063   -7.144  1.00 54.53  ? 211 GLY A C     1 
ATOM   1566 O  O     . GLY A 1 192 ? -39.969 7.582   -7.852  1.00 52.71  ? 211 GLY A O     1 
ATOM   1567 N  N     . PHE A 1 193 ? -40.703 6.945   -5.826  1.00 48.42  ? 212 PHE A N     1 
ATOM   1568 C  CA    . PHE A 1 193 ? -39.502 7.411   -5.153  1.00 49.08  ? 212 PHE A CA    1 
ATOM   1569 C  C     . PHE A 1 193 ? -38.394 6.377   -5.286  1.00 48.86  ? 212 PHE A C     1 
ATOM   1570 O  O     . PHE A 1 193 ? -38.616 5.184   -5.060  1.00 53.50  ? 212 PHE A O     1 
ATOM   1571 C  CB    . PHE A 1 193 ? -39.785 7.693   -3.681  1.00 49.03  ? 212 PHE A CB    1 
ATOM   1572 C  CG    . PHE A 1 193 ? -38.588 8.181   -2.924  1.00 48.81  ? 212 PHE A CG    1 
ATOM   1573 C  CD1   . PHE A 1 193 ? -38.112 9.468   -3.116  1.00 42.59  ? 212 PHE A CD1   1 
ATOM   1574 C  CD2   . PHE A 1 193 ? -37.936 7.353   -2.027  1.00 47.34  ? 212 PHE A CD2   1 
ATOM   1575 C  CE1   . PHE A 1 193 ? -37.007 9.918   -2.427  1.00 44.08  ? 212 PHE A CE1   1 
ATOM   1576 C  CE2   . PHE A 1 193 ? -36.835 7.797   -1.330  1.00 43.73  ? 212 PHE A CE2   1 
ATOM   1577 C  CZ    . PHE A 1 193 ? -36.366 9.080   -1.529  1.00 44.51  ? 212 PHE A CZ    1 
ATOM   1578 N  N     . GLN A 1 194 ? -37.203 6.837   -5.658  1.00 46.27  ? 213 GLN A N     1 
ATOM   1579 C  CA    . GLN A 1 194 ? -36.038 5.976   -5.833  1.00 47.46  ? 213 GLN A CA    1 
ATOM   1580 C  C     . GLN A 1 194 ? -34.915 6.505   -4.952  1.00 44.68  ? 213 GLN A C     1 
ATOM   1581 O  O     . GLN A 1 194 ? -34.369 7.580   -5.217  1.00 49.73  ? 213 GLN A O     1 
ATOM   1582 C  CB    . GLN A 1 194 ? -35.603 5.930   -7.297  1.00 55.76  ? 213 GLN A CB    1 
ATOM   1583 C  CG    . GLN A 1 194 ? -36.701 5.519   -8.265  1.00 64.63  ? 213 GLN A CG    1 
ATOM   1584 C  CD    . GLN A 1 194 ? -36.209 5.450   -9.698  1.00 75.22  ? 213 GLN A CD    1 
ATOM   1585 O  OE1   . GLN A 1 194 ? -35.053 5.107   -9.952  1.00 79.59  ? 213 GLN A OE1   1 
ATOM   1586 N  NE2   . GLN A 1 194 ? -37.082 5.785   -10.644 1.00 79.36  ? 213 GLN A NE2   1 
ATOM   1587 N  N     . ALA A 1 195 ? -34.575 5.755   -3.910  1.00 49.09  ? 214 ALA A N     1 
ATOM   1588 C  CA    . ALA A 1 195 ? -33.468 6.133   -3.042  1.00 43.26  ? 214 ALA A CA    1 
ATOM   1589 C  C     . ALA A 1 195 ? -32.163 6.130   -3.826  1.00 48.46  ? 214 ALA A C     1 
ATOM   1590 O  O     . ALA A 1 195 ? -31.796 5.119   -4.431  1.00 54.51  ? 214 ALA A O     1 
ATOM   1591 C  CB    . ALA A 1 195 ? -33.383 5.174   -1.860  1.00 45.85  ? 214 ALA A CB    1 
ATOM   1592 N  N     . GLU A 1 196 ? -31.462 7.264   -3.814  1.00 48.49  ? 215 GLU A N     1 
ATOM   1593 C  CA    . GLU A 1 196 ? -30.252 7.420   -4.618  1.00 49.46  ? 215 GLU A CA    1 
ATOM   1594 C  C     . GLU A 1 196 ? -29.080 8.061   -3.886  1.00 50.88  ? 215 GLU A C     1 
ATOM   1595 O  O     . GLU A 1 196 ? -27.934 7.767   -4.243  1.00 49.65  ? 215 GLU A O     1 
ATOM   1596 C  CB    . GLU A 1 196 ? -30.554 8.242   -5.878  1.00 51.79  ? 215 GLU A CB    1 
ATOM   1597 C  CG    . GLU A 1 196 ? -31.571 7.605   -6.809  1.00 58.16  ? 215 GLU A CG    1 
ATOM   1598 C  CD    . GLU A 1 196 ? -31.935 8.502   -7.972  1.00 57.97  ? 215 GLU A CD    1 
ATOM   1599 O  OE1   . GLU A 1 196 ? -32.507 7.995   -8.961  1.00 65.78  ? 215 GLU A OE1   1 
ATOM   1600 O  OE2   . GLU A 1 196 ? -31.643 9.715   -7.896  1.00 59.62  ? 215 GLU A OE2   1 
ATOM   1601 N  N     . ALA A 1 197 ? -29.301 8.932   -2.901  1.00 48.71  ? 216 ALA A N     1 
ATOM   1602 C  CA    . ALA A 1 197 ? -28.212 9.541   -2.144  1.00 40.97  ? 216 ALA A CA    1 
ATOM   1603 C  C     . ALA A 1 197 ? -28.515 9.442   -0.658  1.00 43.20  ? 216 ALA A C     1 
ATOM   1604 O  O     . ALA A 1 197 ? -29.573 9.889   -0.207  1.00 45.04  ? 216 ALA A O     1 
ATOM   1605 C  CB    . ALA A 1 197 ? -28.000 11.004  -2.541  1.00 40.20  ? 216 ALA A CB    1 
ATOM   1606 N  N     . GLY A 1 198 ? -27.587 8.877   0.103   1.00 43.51  ? 217 GLY A N     1 
ATOM   1607 C  CA    . GLY A 1 198 ? -27.815 8.627   1.511   1.00 41.62  ? 217 GLY A CA    1 
ATOM   1608 C  C     . GLY A 1 198 ? -26.672 9.114   2.375   1.00 41.85  ? 217 GLY A C     1 
ATOM   1609 O  O     . GLY A 1 198 ? -25.511 9.122   1.969   1.00 42.84  ? 217 GLY A O     1 
ATOM   1610 N  N     . ILE A 1 199 ? -27.025 9.510   3.593   1.00 37.38  ? 218 ILE A N     1 
ATOM   1611 C  CA    . ILE A 1 199 ? -26.066 9.939   4.603   1.00 38.50  ? 218 ILE A CA    1 
ATOM   1612 C  C     . ILE A 1 199 ? -26.402 9.218   5.899   1.00 39.50  ? 218 ILE A C     1 
ATOM   1613 O  O     . ILE A 1 199 ? -27.537 9.298   6.380   1.00 41.79  ? 218 ILE A O     1 
ATOM   1614 C  CB    . ILE A 1 199 ? -26.085 11.460  4.823   1.00 40.95  ? 218 ILE A CB    1 
ATOM   1615 C  CG1   . ILE A 1 199 ? -26.137 12.208  3.491   1.00 37.41  ? 218 ILE A CG1   1 
ATOM   1616 C  CG2   . ILE A 1 199 ? -24.862 11.892  5.628   1.00 38.67  ? 218 ILE A CG2   1 
ATOM   1617 C  CD1   . ILE A 1 199 ? -26.548 13.657  3.637   1.00 45.23  ? 218 ILE A CD1   1 
ATOM   1618 N  N     . LEU A 1 200 ? -25.428 8.519   6.462   1.00 40.59  ? 219 LEU A N     1 
ATOM   1619 C  CA    . LEU A 1 200 ? -25.550 7.932   7.786   1.00 40.23  ? 219 LEU A CA    1 
ATOM   1620 C  C     . LEU A 1 200 ? -24.718 8.757   8.752   1.00 38.75  ? 219 LEU A C     1 
ATOM   1621 O  O     . LEU A 1 200 ? -23.540 9.013   8.492   1.00 38.79  ? 219 LEU A O     1 
ATOM   1622 C  CB    . LEU A 1 200 ? -25.080 6.479   7.789   1.00 42.56  ? 219 LEU A CB    1 
ATOM   1623 C  CG    . LEU A 1 200 ? -25.729 5.595   6.728   1.00 47.51  ? 219 LEU A CG    1 
ATOM   1624 C  CD1   . LEU A 1 200 ? -25.199 4.192   6.861   1.00 47.44  ? 219 LEU A CD1   1 
ATOM   1625 C  CD2   . LEU A 1 200 ? -27.241 5.617   6.863   1.00 42.25  ? 219 LEU A CD2   1 
ATOM   1626 N  N     . ASN A 1 201 ? -25.329 9.178   9.853   1.00 36.90  ? 220 ASN A N     1 
ATOM   1627 C  CA    . ASN A 1 201 ? -24.668 10.014  10.845  1.00 35.03  ? 220 ASN A CA    1 
ATOM   1628 C  C     . ASN A 1 201 ? -24.683 9.313   12.194  1.00 40.92  ? 220 ASN A C     1 
ATOM   1629 O  O     . ASN A 1 201 ? -25.735 8.851   12.648  1.00 42.44  ? 220 ASN A O     1 
ATOM   1630 C  CB    . ASN A 1 201 ? -25.337 11.385  10.947  1.00 34.81  ? 220 ASN A CB    1 
ATOM   1631 C  CG    . ASN A 1 201 ? -25.148 12.215  9.696   1.00 41.00  ? 220 ASN A CG    1 
ATOM   1632 O  OD1   . ASN A 1 201 ? -24.093 12.812  9.493   1.00 39.94  ? 220 ASN A OD1   1 
ATOM   1633 N  ND2   . ASN A 1 201 ? -26.169 12.251  8.844   1.00 41.99  ? 220 ASN A ND2   1 
ATOM   1634 N  N     . TYR A 1 202 ? -23.516 9.241   12.827  1.00 37.62  ? 221 TYR A N     1 
ATOM   1635 C  CA    . TYR A 1 202 ? -23.335 8.568   14.107  1.00 40.65  ? 221 TYR A CA    1 
ATOM   1636 C  C     . TYR A 1 202 ? -22.983 9.614   15.157  1.00 39.13  ? 221 TYR A C     1 
ATOM   1637 O  O     . TYR A 1 202 ? -21.968 10.306  15.030  1.00 41.32  ? 221 TYR A O     1 
ATOM   1638 C  CB    . TYR A 1 202 ? -22.240 7.506   14.003  1.00 42.27  ? 221 TYR A CB    1 
ATOM   1639 C  CG    . TYR A 1 202 ? -22.435 6.546   12.852  1.00 38.00  ? 221 TYR A CG    1 
ATOM   1640 C  CD1   . TYR A 1 202 ? -21.966 6.851   11.579  1.00 42.43  ? 221 TYR A CD1   1 
ATOM   1641 C  CD2   . TYR A 1 202 ? -23.089 5.336   13.034  1.00 38.36  ? 221 TYR A CD2   1 
ATOM   1642 C  CE1   . TYR A 1 202 ? -22.147 5.976   10.522  1.00 40.36  ? 221 TYR A CE1   1 
ATOM   1643 C  CE2   . TYR A 1 202 ? -23.269 4.454   11.985  1.00 33.34  ? 221 TYR A CE2   1 
ATOM   1644 C  CZ    . TYR A 1 202 ? -22.797 4.779   10.731  1.00 37.67  ? 221 TYR A CZ    1 
ATOM   1645 O  OH    . TYR A 1 202 ? -22.977 3.904   9.683   1.00 39.30  ? 221 TYR A OH    1 
ATOM   1646 N  N     . TYR A 1 203 ? -23.814 9.726   16.190  1.00 37.80  ? 222 TYR A N     1 
ATOM   1647 C  CA    . TYR A 1 203 ? -23.713 10.788  17.178  1.00 40.68  ? 222 TYR A CA    1 
ATOM   1648 C  C     . TYR A 1 203 ? -23.453 10.212  18.562  1.00 44.24  ? 222 TYR A C     1 
ATOM   1649 O  O     . TYR A 1 203 ? -24.073 9.218   18.960  1.00 40.77  ? 222 TYR A O     1 
ATOM   1650 C  CB    . TYR A 1 203 ? -24.995 11.629  17.214  1.00 37.70  ? 222 TYR A CB    1 
ATOM   1651 C  CG    . TYR A 1 203 ? -25.313 12.322  15.914  1.00 40.62  ? 222 TYR A CG    1 
ATOM   1652 C  CD1   . TYR A 1 203 ? -24.530 13.377  15.459  1.00 44.01  ? 222 TYR A CD1   1 
ATOM   1653 C  CD2   . TYR A 1 203 ? -26.399 11.930  15.144  1.00 41.71  ? 222 TYR A CD2   1 
ATOM   1654 C  CE1   . TYR A 1 203 ? -24.817 14.017  14.269  1.00 41.95  ? 222 TYR A CE1   1 
ATOM   1655 C  CE2   . TYR A 1 203 ? -26.695 12.564  13.954  1.00 41.46  ? 222 TYR A CE2   1 
ATOM   1656 C  CZ    . TYR A 1 203 ? -25.902 13.606  13.521  1.00 44.07  ? 222 TYR A CZ    1 
ATOM   1657 O  OH    . TYR A 1 203 ? -26.198 14.234  12.336  1.00 44.74  ? 222 TYR A OH    1 
ATOM   1658 N  N     . ARG A 1 204 ? -22.550 10.866  19.294  1.00 41.97  ? 223 ARG A N     1 
ATOM   1659 C  CA    . ARG A 1 204 ? -22.306 10.597  20.700  1.00 45.82  ? 223 ARG A CA    1 
ATOM   1660 C  C     . ARG A 1 204 ? -23.263 11.423  21.558  1.00 44.83  ? 223 ARG A C     1 
ATOM   1661 O  O     . ARG A 1 204 ? -24.091 12.185  21.055  1.00 45.30  ? 223 ARG A O     1 
ATOM   1662 C  CB    . ARG A 1 204 ? -20.857 10.916  21.061  1.00 51.64  ? 223 ARG A CB    1 
ATOM   1663 C  CG    . ARG A 1 204 ? -19.822 10.276  20.160  1.00 57.15  ? 223 ARG A CG    1 
ATOM   1664 C  CD    . ARG A 1 204 ? -18.504 11.034  20.234  1.00 62.29  ? 223 ARG A CD    1 
ATOM   1665 N  NE    . ARG A 1 204 ? -18.027 11.172  21.608  1.00 66.17  ? 223 ARG A NE    1 
ATOM   1666 C  CZ    . ARG A 1 204 ? -17.227 10.298  22.212  1.00 76.89  ? 223 ARG A CZ    1 
ATOM   1667 N  NH1   . ARG A 1 204 ? -16.843 10.500  23.467  1.00 70.90  ? 223 ARG A NH1   1 
ATOM   1668 N  NH2   . ARG A 1 204 ? -16.810 9.220   21.560  1.00 78.82  ? 223 ARG A NH2   1 
ATOM   1669 N  N     . LEU A 1 205 ? -23.133 11.290  22.879  1.00 45.72  ? 224 LEU A N     1 
ATOM   1670 C  CA    . LEU A 1 205 ? -23.989 12.051  23.783  1.00 46.25  ? 224 LEU A CA    1 
ATOM   1671 C  C     . LEU A 1 205 ? -23.722 13.548  23.694  1.00 46.84  ? 224 LEU A C     1 
ATOM   1672 O  O     . LEU A 1 205 ? -24.631 14.350  23.934  1.00 46.69  ? 224 LEU A O     1 
ATOM   1673 C  CB    . LEU A 1 205 ? -23.798 11.566  25.218  1.00 47.89  ? 224 LEU A CB    1 
ATOM   1674 C  CG    . LEU A 1 205 ? -24.907 10.689  25.801  1.00 59.10  ? 224 LEU A CG    1 
ATOM   1675 C  CD1   . LEU A 1 205 ? -25.405 9.686   24.769  1.00 53.21  ? 224 LEU A CD1   1 
ATOM   1676 C  CD2   . LEU A 1 205 ? -24.410 9.974   27.054  1.00 48.56  ? 224 LEU A CD2   1 
ATOM   1677 N  N     . ASP A 1 206 ? -22.497 13.946  23.355  1.00 41.34  ? 225 ASP A N     1 
ATOM   1678 C  CA    . ASP A 1 206 ? -22.155 15.355  23.215  1.00 48.55  ? 225 ASP A CA    1 
ATOM   1679 C  C     . ASP A 1 206 ? -22.129 15.815  21.762  1.00 45.06  ? 225 ASP A C     1 
ATOM   1680 O  O     . ASP A 1 206 ? -21.659 16.922  21.484  1.00 48.35  ? 225 ASP A O     1 
ATOM   1681 C  CB    . ASP A 1 206 ? -20.807 15.647  23.885  1.00 44.64  ? 225 ASP A CB    1 
ATOM   1682 C  CG    . ASP A 1 206 ? -19.648 14.915  23.228  1.00 52.88  ? 225 ASP A CG    1 
ATOM   1683 O  OD1   . ASP A 1 206 ? -19.887 14.059  22.350  1.00 59.52  ? 225 ASP A OD1   1 
ATOM   1684 O  OD2   . ASP A 1 206 ? -18.489 15.199  23.596  1.00 67.17  ? 225 ASP A OD2   1 
ATOM   1685 N  N     . SER A 1 207 ? -22.615 14.997  20.832  1.00 41.38  ? 226 SER A N     1 
ATOM   1686 C  CA    . SER A 1 207 ? -22.636 15.386  19.430  1.00 41.02  ? 226 SER A CA    1 
ATOM   1687 C  C     . SER A 1 207 ? -23.749 16.390  19.164  1.00 44.72  ? 226 SER A C     1 
ATOM   1688 O  O     . SER A 1 207 ? -24.770 16.422  19.857  1.00 39.55  ? 226 SER A O     1 
ATOM   1689 C  CB    . SER A 1 207 ? -22.817 14.167  18.526  1.00 41.58  ? 226 SER A CB    1 
ATOM   1690 O  OG    . SER A 1 207 ? -21.591 13.484  18.340  1.00 47.11  ? 226 SER A OG    1 
ATOM   1691 N  N     . THR A 1 208 ? -23.534 17.224  18.149  1.00 41.87  ? 227 THR A N     1 
ATOM   1692 C  CA    . THR A 1 208 ? -24.518 18.210  17.731  1.00 37.25  ? 227 THR A CA    1 
ATOM   1693 C  C     . THR A 1 208 ? -24.538 18.287  16.214  1.00 37.10  ? 227 THR A C     1 
ATOM   1694 O  O     . THR A 1 208 ? -23.558 17.968  15.535  1.00 39.76  ? 227 THR A O     1 
ATOM   1695 C  CB    . THR A 1 208 ? -24.228 19.607  18.299  1.00 42.97  ? 227 THR A CB    1 
ATOM   1696 O  OG1   . THR A 1 208 ? -22.941 20.044  17.851  1.00 43.27  ? 227 THR A OG1   1 
ATOM   1697 C  CG2   . THR A 1 208 ? -24.267 19.606  19.823  1.00 46.27  ? 227 THR A CG2   1 
ATOM   1698 N  N     . LEU A 1 209 ? -25.680 18.716  15.689  1.00 39.79  ? 228 LEU A N     1 
ATOM   1699 C  CA    . LEU A 1 209 ? -25.833 19.059  14.280  1.00 38.51  ? 228 LEU A CA    1 
ATOM   1700 C  C     . LEU A 1 209 ? -26.231 20.528  14.236  1.00 34.88  ? 228 LEU A C     1 
ATOM   1701 O  O     . LEU A 1 209 ? -27.309 20.896  14.715  1.00 32.23  ? 228 LEU A O     1 
ATOM   1702 C  CB    . LEU A 1 209 ? -26.871 18.166  13.599  1.00 33.06  ? 228 LEU A CB    1 
ATOM   1703 C  CG    . LEU A 1 209 ? -27.004 18.360  12.089  1.00 40.30  ? 228 LEU A CG    1 
ATOM   1704 C  CD1   . LEU A 1 209 ? -25.648 18.241  11.411  1.00 43.29  ? 228 LEU A CD1   1 
ATOM   1705 C  CD2   . LEU A 1 209 ? -27.978 17.350  11.520  1.00 46.22  ? 228 LEU A CD2   1 
ATOM   1706 N  N     . GLY A 1 210 ? -25.355 21.364  13.689  1.00 37.75  ? 229 GLY A N     1 
ATOM   1707 C  CA    . GLY A 1 210 ? -25.565 22.795  13.726  1.00 29.84  ? 229 GLY A CA    1 
ATOM   1708 C  C     . GLY A 1 210 ? -26.708 23.247  12.836  1.00 35.35  ? 229 GLY A C     1 
ATOM   1709 O  O     . GLY A 1 210 ? -27.278 22.486  12.051  1.00 37.05  ? 229 GLY A O     1 
ATOM   1710 N  N     . ILE A 1 211 ? -27.042 24.531  12.980  1.00 32.43  ? 230 ILE A N     1 
ATOM   1711 C  CA    . ILE A 1 211 ? -28.096 25.148  12.183  1.00 34.36  ? 230 ILE A CA    1 
ATOM   1712 C  C     . ILE A 1 211 ? -27.644 25.235  10.732  1.00 35.63  ? 230 ILE A C     1 
ATOM   1713 O  O     . ILE A 1 211 ? -26.544 25.716  10.435  1.00 39.43  ? 230 ILE A O     1 
ATOM   1714 C  CB    . ILE A 1 211 ? -28.438 26.540  12.734  1.00 37.56  ? 230 ILE A CB    1 
ATOM   1715 C  CG1   . ILE A 1 211 ? -28.588 26.501  14.255  1.00 34.60  ? 230 ILE A CG1   1 
ATOM   1716 C  CG2   . ILE A 1 211 ? -29.713 27.072  12.091  1.00 36.26  ? 230 ILE A CG2   1 
ATOM   1717 C  CD1   . ILE A 1 211 ? -28.754 27.874  14.876  1.00 38.41  ? 230 ILE A CD1   1 
ATOM   1718 N  N     . HIS A 1 212 ? -28.495 24.781  9.817   1.00 33.34  ? 231 HIS A N     1 
ATOM   1719 C  CA    . HIS A 1 212 ? -28.144 24.822  8.406   1.00 34.10  ? 231 HIS A CA    1 
ATOM   1720 C  C     . HIS A 1 212 ? -29.402 24.691  7.563   1.00 36.70  ? 231 HIS A C     1 
ATOM   1721 O  O     . HIS A 1 212 ? -30.431 24.182  8.015   1.00 34.39  ? 231 HIS A O     1 
ATOM   1722 C  CB    . HIS A 1 212 ? -27.140 23.721  8.045   1.00 29.13  ? 231 HIS A CB    1 
ATOM   1723 C  CG    . HIS A 1 212 ? -27.695 22.335  8.156   1.00 37.30  ? 231 HIS A CG    1 
ATOM   1724 N  ND1   . HIS A 1 212 ? -28.046 21.767  9.363   1.00 38.34  ? 231 HIS A ND1   1 
ATOM   1725 C  CD2   . HIS A 1 212 ? -27.959 21.401  7.211   1.00 35.24  ? 231 HIS A CD2   1 
ATOM   1726 C  CE1   . HIS A 1 212 ? -28.501 20.544  9.156   1.00 38.10  ? 231 HIS A CE1   1 
ATOM   1727 N  NE2   . HIS A 1 212 ? -28.460 20.298  7.859   1.00 44.29  ? 231 HIS A NE2   1 
ATOM   1728 N  N     . VAL A 1 213 ? -29.300 25.172  6.326   1.00 35.64  ? 232 VAL A N     1 
ATOM   1729 C  CA    . VAL A 1 213 ? -30.307 24.955  5.301   1.00 35.84  ? 232 VAL A CA    1 
ATOM   1730 C  C     . VAL A 1 213 ? -29.676 24.124  4.194   1.00 40.91  ? 232 VAL A C     1 
ATOM   1731 O  O     . VAL A 1 213 ? -28.459 24.113  4.003   1.00 39.17  ? 232 VAL A O     1 
ATOM   1732 C  CB    . VAL A 1 213 ? -30.869 26.272  4.725   1.00 41.80  ? 232 VAL A CB    1 
ATOM   1733 C  CG1   . VAL A 1 213 ? -31.598 27.053  5.785   1.00 40.24  ? 232 VAL A CG1   1 
ATOM   1734 C  CG2   . VAL A 1 213 ? -29.749 27.105  4.135   1.00 49.45  ? 232 VAL A CG2   1 
ATOM   1735 N  N     . ASP A 1 214 ? -30.523 23.422  3.457   1.00 45.71  ? 233 ASP A N     1 
ATOM   1736 C  CA    . ASP A 1 214 ? -30.079 22.680  2.288   1.00 48.04  ? 233 ASP A CA    1 
ATOM   1737 C  C     . ASP A 1 214 ? -30.270 23.560  1.062   1.00 49.85  ? 233 ASP A C     1 
ATOM   1738 O  O     . ASP A 1 214 ? -31.390 23.987  0.767   1.00 53.21  ? 233 ASP A O     1 
ATOM   1739 C  CB    . ASP A 1 214 ? -30.847 21.368  2.171   1.00 46.00  ? 233 ASP A CB    1 
ATOM   1740 C  CG    . ASP A 1 214 ? -30.507 20.410  3.295   1.00 50.19  ? 233 ASP A CG    1 
ATOM   1741 O  OD1   . ASP A 1 214 ? -29.319 20.363  3.678   1.00 48.92  ? 233 ASP A OD1   1 
ATOM   1742 O  OD2   . ASP A 1 214 ? -31.415 19.716  3.801   1.00 52.89  ? 233 ASP A OD2   1 
ATOM   1743 N  N     . ARG A 1 215 ? -29.174 23.851  0.366   1.00 55.22  ? 234 ARG A N     1 
ATOM   1744 C  CA    . ARG A 1 215 ? -29.190 24.814  -0.724  1.00 60.45  ? 234 ARG A CA    1 
ATOM   1745 C  C     . ARG A 1 215 ? -29.032 24.189  -2.102  1.00 58.35  ? 234 ARG A C     1 
ATOM   1746 O  O     . ARG A 1 215 ? -28.937 24.929  -3.084  1.00 61.41  ? 234 ARG A O     1 
ATOM   1747 C  CB    . ARG A 1 215 ? -28.091 25.864  -0.513  1.00 61.02  ? 234 ARG A CB    1 
ATOM   1748 C  CG    . ARG A 1 215 ? -28.294 26.742  0.713   1.00 64.61  ? 234 ARG A CG    1 
ATOM   1749 C  CD    . ARG A 1 215 ? -27.385 27.958  0.681   1.00 69.54  ? 234 ARG A CD    1 
ATOM   1750 N  NE    . ARG A 1 215 ? -27.785 28.953  1.672   1.00 68.05  ? 234 ARG A NE    1 
ATOM   1751 C  CZ    . ARG A 1 215 ? -27.229 29.079  2.873   1.00 66.00  ? 234 ARG A CZ    1 
ATOM   1752 N  NH1   . ARG A 1 215 ? -26.239 28.274  3.238   1.00 65.54  ? 234 ARG A NH1   1 
ATOM   1753 N  NH2   . ARG A 1 215 ? -27.662 30.013  3.709   1.00 67.40  ? 234 ARG A NH2   1 
ATOM   1754 N  N     . CYS A 1 216 ? -29.005 22.865  -2.210  1.00 58.72  ? 235 CYS A N     1 
ATOM   1755 C  CA    . CYS A 1 216 ? -28.818 22.244  -3.512  1.00 57.01  ? 235 CYS A CA    1 
ATOM   1756 C  C     . CYS A 1 216 ? -30.082 22.350  -4.357  1.00 60.07  ? 235 CYS A C     1 
ATOM   1757 O  O     . CYS A 1 216 ? -31.207 22.307  -3.851  1.00 62.54  ? 235 CYS A O     1 
ATOM   1758 C  CB    . CYS A 1 216 ? -28.416 20.778  -3.368  1.00 51.27  ? 235 CYS A CB    1 
ATOM   1759 S  SG    . CYS A 1 216 ? -29.363 19.808  -2.180  1.00 61.11  ? 235 CYS A SG    1 
ATOM   1760 N  N     . GLU A 1 217 ? -29.883 22.492  -5.663  1.00 59.23  ? 236 GLU A N     1 
ATOM   1761 C  CA    . GLU A 1 217 ? -30.986 22.544  -6.617  1.00 55.20  ? 236 GLU A CA    1 
ATOM   1762 C  C     . GLU A 1 217 ? -31.453 21.114  -6.853  1.00 57.11  ? 236 GLU A C     1 
ATOM   1763 O  O     . GLU A 1 217 ? -30.799 20.342  -7.556  1.00 62.37  ? 236 GLU A O     1 
ATOM   1764 C  CB    . GLU A 1 217 ? -30.547 23.217  -7.914  1.00 63.43  ? 236 GLU A CB    1 
ATOM   1765 C  CG    . GLU A 1 217 ? -29.885 24.590  -7.738  1.00 75.25  ? 236 GLU A CG    1 
ATOM   1766 C  CD    . GLU A 1 217 ? -28.435 24.508  -7.260  1.00 80.39  ? 236 GLU A CD    1 
ATOM   1767 O  OE1   . GLU A 1 217 ? -27.719 23.565  -7.668  1.00 77.08  ? 236 GLU A OE1   1 
ATOM   1768 O  OE2   . GLU A 1 217 ? -28.016 25.379  -6.466  1.00 76.38  ? 236 GLU A OE2   1 
ATOM   1769 N  N     . LEU A 1 218 ? -32.578 20.748  -6.244  1.00 49.46  ? 237 LEU A N     1 
ATOM   1770 C  CA    . LEU A 1 218 ? -33.152 19.417  -6.382  1.00 47.36  ? 237 LEU A CA    1 
ATOM   1771 C  C     . LEU A 1 218 ? -34.643 19.529  -6.666  1.00 43.62  ? 237 LEU A C     1 
ATOM   1772 O  O     . LEU A 1 218 ? -35.254 20.589  -6.517  1.00 44.04  ? 237 LEU A O     1 
ATOM   1773 C  CB    . LEU A 1 218 ? -32.927 18.565  -5.123  1.00 43.35  ? 237 LEU A CB    1 
ATOM   1774 C  CG    . LEU A 1 218 ? -31.509 18.070  -4.849  1.00 52.35  ? 237 LEU A CG    1 
ATOM   1775 C  CD1   . LEU A 1 218 ? -31.479 17.241  -3.578  1.00 52.07  ? 237 LEU A CD1   1 
ATOM   1776 C  CD2   . LEU A 1 218 ? -30.987 17.266  -6.028  1.00 48.86  ? 237 LEU A CD2   1 
ATOM   1777 N  N     . ASP A 1 219 ? -35.230 18.410  -7.071  1.00 43.43  ? 238 ASP A N     1 
ATOM   1778 C  CA    . ASP A 1 219 ? -36.672 18.323  -7.272  1.00 38.94  ? 238 ASP A CA    1 
ATOM   1779 C  C     . ASP A 1 219 ? -37.346 18.312  -5.908  1.00 36.91  ? 238 ASP A C     1 
ATOM   1780 O  O     . ASP A 1 219 ? -37.382 17.286  -5.228  1.00 40.79  ? 238 ASP A O     1 
ATOM   1781 C  CB    . ASP A 1 219 ? -37.015 17.073  -8.075  1.00 34.03  ? 238 ASP A CB    1 
ATOM   1782 C  CG    . ASP A 1 219 ? -38.511 16.884  -8.267  1.00 37.72  ? 238 ASP A CG    1 
ATOM   1783 O  OD1   . ASP A 1 219 ? -39.297 17.801  -7.942  1.00 34.99  ? 238 ASP A OD1   1 
ATOM   1784 O  OD2   . ASP A 1 219 ? -38.903 15.804  -8.746  1.00 42.00  ? 238 ASP A OD2   1 
ATOM   1785 N  N     . HIS A 1 220 ? -37.900 19.457  -5.507  1.00 37.96  ? 239 HIS A N     1 
ATOM   1786 C  CA    . HIS A 1 220 ? -38.538 19.563  -4.201  1.00 34.41  ? 239 HIS A CA    1 
ATOM   1787 C  C     . HIS A 1 220 ? -39.900 18.884  -4.142  1.00 36.75  ? 239 HIS A C     1 
ATOM   1788 O  O     . HIS A 1 220 ? -40.517 18.878  -3.072  1.00 36.72  ? 239 HIS A O     1 
ATOM   1789 C  CB    . HIS A 1 220 ? -38.669 21.031  -3.800  1.00 33.11  ? 239 HIS A CB    1 
ATOM   1790 C  CG    . HIS A 1 220 ? -37.359 21.748  -3.705  1.00 45.87  ? 239 HIS A CG    1 
ATOM   1791 N  ND1   . HIS A 1 220 ? -36.514 21.618  -2.622  1.00 40.77  ? 239 HIS A ND1   1 
ATOM   1792 C  CD2   . HIS A 1 220 ? -36.744 22.599  -4.561  1.00 42.39  ? 239 HIS A CD2   1 
ATOM   1793 C  CE1   . HIS A 1 220 ? -35.437 22.359  -2.814  1.00 38.72  ? 239 HIS A CE1   1 
ATOM   1794 N  NE2   . HIS A 1 220 ? -35.552 22.965  -3.982  1.00 47.85  ? 239 HIS A NE2   1 
ATOM   1795 N  N     . SER A 1 221 ? -40.392 18.329  -5.251  1.00 32.66  ? 240 SER A N     1 
ATOM   1796 C  CA    . SER A 1 221 ? -41.561 17.463  -5.176  1.00 37.77  ? 240 SER A CA    1 
ATOM   1797 C  C     . SER A 1 221 ? -41.227 16.120  -4.548  1.00 35.40  ? 240 SER A C     1 
ATOM   1798 O  O     . SER A 1 221 ? -42.123 15.468  -4.004  1.00 37.24  ? 240 SER A O     1 
ATOM   1799 C  CB    . SER A 1 221 ? -42.161 17.240  -6.565  1.00 37.36  ? 240 SER A CB    1 
ATOM   1800 O  OG    . SER A 1 221 ? -42.752 18.418  -7.075  1.00 42.24  ? 240 SER A OG    1 
ATOM   1801 N  N     . LYS A 1 222 ? -39.957 15.707  -4.602  1.00 34.71  ? 241 LYS A N     1 
ATOM   1802 C  CA    . LYS A 1 222 ? -39.472 14.451  -4.050  1.00 35.89  ? 241 LYS A CA    1 
ATOM   1803 C  C     . LYS A 1 222 ? -39.263 14.576  -2.543  1.00 37.31  ? 241 LYS A C     1 
ATOM   1804 O  O     . LYS A 1 222 ? -38.833 15.627  -2.061  1.00 37.95  ? 241 LYS A O     1 
ATOM   1805 C  CB    . LYS A 1 222 ? -38.158 14.053  -4.712  1.00 34.67  ? 241 LYS A CB    1 
ATOM   1806 C  CG    . LYS A 1 222 ? -38.288 13.708  -6.177  1.00 38.31  ? 241 LYS A CG    1 
ATOM   1807 C  CD    . LYS A 1 222 ? -39.197 12.514  -6.338  1.00 42.38  ? 241 LYS A CD    1 
ATOM   1808 C  CE    . LYS A 1 222 ? -39.229 12.015  -7.770  1.00 46.93  ? 241 LYS A CE    1 
ATOM   1809 N  NZ    . LYS A 1 222 ? -39.927 10.700  -7.843  1.00 47.47  ? 241 LYS A NZ    1 
ATOM   1810 N  N     . PRO A 1 223 ? -39.548 13.523  -1.785  1.00 37.05  ? 242 PRO A N     1 
ATOM   1811 C  CA    . PRO A 1 223 ? -39.340 13.581  -0.338  1.00 33.95  ? 242 PRO A CA    1 
ATOM   1812 C  C     . PRO A 1 223 ? -37.899 13.295  0.053   1.00 40.07  ? 242 PRO A C     1 
ATOM   1813 O  O     . PRO A 1 223 ? -37.139 12.645  -0.669  1.00 37.35  ? 242 PRO A O     1 
ATOM   1814 C  CB    . PRO A 1 223 ? -40.273 12.487  0.188   1.00 35.17  ? 242 PRO A CB    1 
ATOM   1815 C  CG    . PRO A 1 223 ? -40.284 11.477  -0.910  1.00 39.72  ? 242 PRO A CG    1 
ATOM   1816 C  CD    . PRO A 1 223 ? -40.203 12.269  -2.201  1.00 36.42  ? 242 PRO A CD    1 
ATOM   1817 N  N     . LEU A 1 224 ? -37.532 13.825  1.213   1.00 38.37  ? 243 LEU A N     1 
ATOM   1818 C  CA    . LEU A 1 224 ? -36.318 13.469  1.929   1.00 37.03  ? 243 LEU A CA    1 
ATOM   1819 C  C     . LEU A 1 224 ? -36.742 12.689  3.161   1.00 32.82  ? 243 LEU A C     1 
ATOM   1820 O  O     . LEU A 1 224 ? -37.644 13.121  3.887   1.00 31.00  ? 243 LEU A O     1 
ATOM   1821 C  CB    . LEU A 1 224 ? -35.527 14.720  2.323   1.00 33.89  ? 243 LEU A CB    1 
ATOM   1822 C  CG    . LEU A 1 224 ? -34.288 14.639  3.226   1.00 35.92  ? 243 LEU A CG    1 
ATOM   1823 C  CD1   . LEU A 1 224 ? -33.440 15.877  3.014   1.00 34.62  ? 243 LEU A CD1   1 
ATOM   1824 C  CD2   . LEU A 1 224 ? -34.640 14.520  4.706   1.00 29.52  ? 243 LEU A CD2   1 
ATOM   1825 N  N     . LEU A 1 225 ? -36.099 11.552  3.399   1.00 30.22  ? 244 LEU A N     1 
ATOM   1826 C  CA    . LEU A 1 225 ? -36.463 10.686  4.511   1.00 32.76  ? 244 LEU A CA    1 
ATOM   1827 C  C     . LEU A 1 225 ? -35.355 10.690  5.555   1.00 33.63  ? 244 LEU A C     1 
ATOM   1828 O  O     . LEU A 1 225 ? -34.169 10.675  5.214   1.00 31.15  ? 244 LEU A O     1 
ATOM   1829 C  CB    . LEU A 1 225 ? -36.737 9.256   4.028   1.00 36.48  ? 244 LEU A CB    1 
ATOM   1830 C  CG    . LEU A 1 225 ? -38.001 9.005   3.192   1.00 38.88  ? 244 LEU A CG    1 
ATOM   1831 C  CD1   . LEU A 1 225 ? -37.920 9.640   1.810   1.00 36.63  ? 244 LEU A CD1   1 
ATOM   1832 C  CD2   . LEU A 1 225 ? -38.246 7.514   3.065   1.00 42.45  ? 244 LEU A CD2   1 
ATOM   1833 N  N     . SER A 1 226 ? -35.748 10.715  6.828   1.00 32.74  ? 245 SER A N     1 
ATOM   1834 C  CA    . SER A 1 226 ? -34.797 10.771  7.934   1.00 35.88  ? 245 SER A CA    1 
ATOM   1835 C  C     . SER A 1 226 ? -35.255 9.810   9.026   1.00 32.70  ? 245 SER A C     1 
ATOM   1836 O  O     . SER A 1 226 ? -36.288 10.037  9.662   1.00 32.15  ? 245 SER A O     1 
ATOM   1837 C  CB    . SER A 1 226 ? -34.670 12.196  8.472   1.00 31.82  ? 245 SER A CB    1 
ATOM   1838 O  OG    . SER A 1 226 ? -33.658 12.281  9.457   1.00 40.62  ? 245 SER A OG    1 
ATOM   1839 N  N     . PHE A 1 227 ? -34.481 8.750   9.237   1.00 31.98  ? 246 PHE A N     1 
ATOM   1840 C  CA    . PHE A 1 227 ? -34.726 7.740   10.258  1.00 33.77  ? 246 PHE A CA    1 
ATOM   1841 C  C     . PHE A 1 227 ? -33.770 7.949   11.426  1.00 33.39  ? 246 PHE A C     1 
ATOM   1842 O  O     . PHE A 1 227 ? -32.591 8.251   11.225  1.00 39.97  ? 246 PHE A O     1 
ATOM   1843 C  CB    . PHE A 1 227 ? -34.518 6.322   9.710   1.00 37.66  ? 246 PHE A CB    1 
ATOM   1844 C  CG    . PHE A 1 227 ? -35.297 6.008   8.458   1.00 36.76  ? 246 PHE A CG    1 
ATOM   1845 C  CD1   . PHE A 1 227 ? -34.896 6.502   7.226   1.00 34.24  ? 246 PHE A CD1   1 
ATOM   1846 C  CD2   . PHE A 1 227 ? -36.396 5.169   8.507   1.00 37.48  ? 246 PHE A CD2   1 
ATOM   1847 C  CE1   . PHE A 1 227 ? -35.600 6.195   6.075   1.00 39.70  ? 246 PHE A CE1   1 
ATOM   1848 C  CE2   . PHE A 1 227 ? -37.102 4.856   7.357   1.00 37.70  ? 246 PHE A CE2   1 
ATOM   1849 C  CZ    . PHE A 1 227 ? -36.707 5.371   6.141   1.00 36.04  ? 246 PHE A CZ    1 
ATOM   1850 N  N     . SER A 1 228 ? -34.267 7.749   12.642  1.00 36.58  ? 247 SER A N     1 
ATOM   1851 C  CA    . SER A 1 228 ? -33.452 7.839   13.846  1.00 38.92  ? 247 SER A CA    1 
ATOM   1852 C  C     . SER A 1 228 ? -33.555 6.550   14.652  1.00 36.81  ? 247 SER A C     1 
ATOM   1853 O  O     . SER A 1 228 ? -34.648 6.004   14.828  1.00 35.63  ? 247 SER A O     1 
ATOM   1854 C  CB    . SER A 1 228 ? -33.879 9.024   14.711  1.00 33.26  ? 247 SER A CB    1 
ATOM   1855 O  OG    . SER A 1 228 ? -32.981 9.197   15.793  1.00 47.20  ? 247 SER A OG    1 
ATOM   1856 N  N     . PHE A 1 229 ? -32.412 6.075   15.152  1.00 36.92  ? 248 PHE A N     1 
ATOM   1857 C  CA    . PHE A 1 229 ? -32.340 4.876   15.980  1.00 38.74  ? 248 PHE A CA    1 
ATOM   1858 C  C     . PHE A 1 229 ? -31.449 5.128   17.190  1.00 42.80  ? 248 PHE A C     1 
ATOM   1859 O  O     . PHE A 1 229 ? -30.420 5.803   17.086  1.00 42.20  ? 248 PHE A O     1 
ATOM   1860 C  CB    . PHE A 1 229 ? -31.786 3.679   15.201  1.00 34.97  ? 248 PHE A CB    1 
ATOM   1861 C  CG    . PHE A 1 229 ? -32.579 3.319   13.980  1.00 41.14  ? 248 PHE A CG    1 
ATOM   1862 C  CD1   . PHE A 1 229 ? -33.873 2.837   14.092  1.00 44.17  ? 248 PHE A CD1   1 
ATOM   1863 C  CD2   . PHE A 1 229 ? -32.021 3.437   12.719  1.00 37.99  ? 248 PHE A CD2   1 
ATOM   1864 C  CE1   . PHE A 1 229 ? -34.601 2.496   12.965  1.00 37.86  ? 248 PHE A CE1   1 
ATOM   1865 C  CE2   . PHE A 1 229 ? -32.745 3.100   11.590  1.00 40.84  ? 248 PHE A CE2   1 
ATOM   1866 C  CZ    . PHE A 1 229 ? -34.036 2.629   11.713  1.00 35.76  ? 248 PHE A CZ    1 
ATOM   1867 N  N     . GLY A 1 230 ? -31.836 4.571   18.335  1.00 40.72  ? 249 GLY A N     1 
ATOM   1868 C  CA    . GLY A 1 230 ? -31.006 4.659   19.521  1.00 36.98  ? 249 GLY A CA    1 
ATOM   1869 C  C     . GLY A 1 230 ? -31.510 5.653   20.542  1.00 41.80  ? 249 GLY A C     1 
ATOM   1870 O  O     . GLY A 1 230 ? -32.717 5.742   20.781  1.00 36.94  ? 249 GLY A O     1 
ATOM   1871 N  N     . GLN A 1 231 ? -30.597 6.409   21.153  1.00 40.29  ? 250 GLN A N     1 
ATOM   1872 C  CA    . GLN A 1 231 ? -30.997 7.390   22.149  1.00 37.46  ? 250 GLN A CA    1 
ATOM   1873 C  C     . GLN A 1 231 ? -31.821 8.505   21.503  1.00 42.31  ? 250 GLN A C     1 
ATOM   1874 O  O     . GLN A 1 231 ? -31.714 8.790   20.305  1.00 37.20  ? 250 GLN A O     1 
ATOM   1875 C  CB    . GLN A 1 231 ? -29.771 7.977   22.852  1.00 40.49  ? 250 GLN A CB    1 
ATOM   1876 C  CG    . GLN A 1 231 ? -28.941 6.953   23.618  1.00 42.98  ? 250 GLN A CG    1 
ATOM   1877 C  CD    . GLN A 1 231 ? -29.774 6.134   24.590  1.00 39.87  ? 250 GLN A CD    1 
ATOM   1878 O  OE1   . GLN A 1 231 ? -30.647 6.663   25.284  1.00 34.70  ? 250 GLN A OE1   1 
ATOM   1879 N  NE2   . GLN A 1 231 ? -29.513 4.834   24.637  1.00 40.06  ? 250 GLN A NE2   1 
ATOM   1880 N  N     . SER A 1 232 ? -32.660 9.134   22.321  1.00 39.09  ? 251 SER A N     1 
ATOM   1881 C  CA    . SER A 1 232 ? -33.525 10.198  21.842  1.00 41.34  ? 251 SER A CA    1 
ATOM   1882 C  C     . SER A 1 232 ? -32.719 11.463  21.571  1.00 48.22  ? 251 SER A C     1 
ATOM   1883 O  O     . SER A 1 232 ? -31.582 11.621  22.026  1.00 42.52  ? 251 SER A O     1 
ATOM   1884 C  CB    . SER A 1 232 ? -34.627 10.497  22.859  1.00 38.84  ? 251 SER A CB    1 
ATOM   1885 O  OG    . SER A 1 232 ? -35.405 9.342   23.119  1.00 40.73  ? 251 SER A OG    1 
ATOM   1886 N  N     . ALA A 1 233 ? -33.325 12.376  20.819  1.00 43.68  ? 252 ALA A N     1 
ATOM   1887 C  CA    . ALA A 1 233 ? -32.684 13.655  20.559  1.00 37.68  ? 252 ALA A CA    1 
ATOM   1888 C  C     . ALA A 1 233 ? -33.745 14.741  20.493  1.00 36.49  ? 252 ALA A C     1 
ATOM   1889 O  O     . ALA A 1 233 ? -34.944 14.467  20.441  1.00 41.23  ? 252 ALA A O     1 
ATOM   1890 C  CB    . ALA A 1 233 ? -31.862 13.620  19.268  1.00 42.08  ? 252 ALA A CB    1 
ATOM   1891 N  N     . ILE A 1 234 ? -33.286 15.986  20.497  1.00 35.07  ? 253 ILE A N     1 
ATOM   1892 C  CA    . ILE A 1 234 ? -34.139 17.145  20.280  1.00 39.98  ? 253 ILE A CA    1 
ATOM   1893 C  C     . ILE A 1 234 ? -33.821 17.702  18.901  1.00 41.50  ? 253 ILE A C     1 
ATOM   1894 O  O     . ILE A 1 234 ? -32.647 17.884  18.557  1.00 38.99  ? 253 ILE A O     1 
ATOM   1895 C  CB    . ILE A 1 234 ? -33.942 18.207  21.372  1.00 37.05  ? 253 ILE A CB    1 
ATOM   1896 C  CG1   . ILE A 1 234 ? -34.294 17.626  22.743  1.00 36.99  ? 253 ILE A CG1   1 
ATOM   1897 C  CG2   . ILE A 1 234 ? -34.796 19.422  21.083  1.00 40.15  ? 253 ILE A CG2   1 
ATOM   1898 C  CD1   . ILE A 1 234 ? -34.082 18.594  23.888  1.00 41.53  ? 253 ILE A CD1   1 
ATOM   1899 N  N     . PHE A 1 235 ? -34.863 17.950  18.108  1.00 40.76  ? 254 PHE A N     1 
ATOM   1900 C  CA    . PHE A 1 235 ? -34.751 18.445  16.746  1.00 34.94  ? 254 PHE A CA    1 
ATOM   1901 C  C     . PHE A 1 235 ? -35.423 19.808  16.678  1.00 38.39  ? 254 PHE A C     1 
ATOM   1902 O  O     . PHE A 1 235 ? -36.512 20.001  17.233  1.00 38.47  ? 254 PHE A O     1 
ATOM   1903 C  CB    . PHE A 1 235 ? -35.397 17.451  15.763  1.00 34.86  ? 254 PHE A CB    1 
ATOM   1904 C  CG    . PHE A 1 235 ? -35.428 17.914  14.325  1.00 38.75  ? 254 PHE A CG    1 
ATOM   1905 C  CD1   . PHE A 1 235 ? -34.298 17.837  13.528  1.00 36.48  ? 254 PHE A CD1   1 
ATOM   1906 C  CD2   . PHE A 1 235 ? -36.608 18.375  13.757  1.00 41.19  ? 254 PHE A CD2   1 
ATOM   1907 C  CE1   . PHE A 1 235 ? -34.334 18.241  12.200  1.00 36.89  ? 254 PHE A CE1   1 
ATOM   1908 C  CE2   . PHE A 1 235 ? -36.652 18.775  12.430  1.00 35.84  ? 254 PHE A CE2   1 
ATOM   1909 C  CZ    . PHE A 1 235 ? -35.513 18.709  11.652  1.00 36.11  ? 254 PHE A CZ    1 
ATOM   1910 N  N     . LEU A 1 236 ? -34.756 20.758  16.030  1.00 33.44  ? 255 LEU A N     1 
ATOM   1911 C  CA    . LEU A 1 236 ? -35.254 22.123  15.891  1.00 34.44  ? 255 LEU A CA    1 
ATOM   1912 C  C     . LEU A 1 236 ? -35.570 22.383  14.425  1.00 33.95  ? 255 LEU A C     1 
ATOM   1913 O  O     . LEU A 1 236 ? -34.686 22.265  13.570  1.00 32.37  ? 255 LEU A O     1 
ATOM   1914 C  CB    . LEU A 1 236 ? -34.230 23.143  16.398  1.00 33.62  ? 255 LEU A CB    1 
ATOM   1915 C  CG    . LEU A 1 236 ? -33.875 23.139  17.885  1.00 36.34  ? 255 LEU A CG    1 
ATOM   1916 C  CD1   . LEU A 1 236 ? -32.980 24.322  18.228  1.00 40.05  ? 255 LEU A CD1   1 
ATOM   1917 C  CD2   . LEU A 1 236 ? -35.128 23.166  18.714  1.00 31.19  ? 255 LEU A CD2   1 
ATOM   1918 N  N     . LEU A 1 237 ? -36.821 22.735  14.140  1.00 30.65  ? 256 LEU A N     1 
ATOM   1919 C  CA    . LEU A 1 237 ? -37.256 23.084  12.789  1.00 33.08  ? 256 LEU A CA    1 
ATOM   1920 C  C     . LEU A 1 237 ? -37.580 24.571  12.769  1.00 29.28  ? 256 LEU A C     1 
ATOM   1921 O  O     . LEU A 1 237 ? -38.525 25.015  13.427  1.00 33.69  ? 256 LEU A O     1 
ATOM   1922 C  CB    . LEU A 1 237 ? -38.463 22.252  12.366  1.00 30.77  ? 256 LEU A CB    1 
ATOM   1923 C  CG    . LEU A 1 237 ? -38.934 22.431  10.921  1.00 31.03  ? 256 LEU A CG    1 
ATOM   1924 C  CD1   . LEU A 1 237 ? -37.831 22.050  9.945   1.00 30.00  ? 256 LEU A CD1   1 
ATOM   1925 C  CD2   . LEU A 1 237 ? -40.185 21.605  10.671  1.00 29.16  ? 256 LEU A CD2   1 
ATOM   1926 N  N     . GLY A 1 238 ? -36.801 25.336  12.019  1.00 34.20  ? 257 GLY A N     1 
ATOM   1927 C  CA    . GLY A 1 238 ? -36.918 26.780  11.992  1.00 34.19  ? 257 GLY A CA    1 
ATOM   1928 C  C     . GLY A 1 238 ? -37.614 27.302  10.753  1.00 36.09  ? 257 GLY A C     1 
ATOM   1929 O  O     . GLY A 1 238 ? -38.522 26.668  10.203  1.00 33.87  ? 257 GLY A O     1 
ATOM   1930 N  N     . GLY A 1 239 ? -37.183 28.478  10.307  1.00 36.23  ? 258 GLY A N     1 
ATOM   1931 C  CA    . GLY A 1 239 ? -37.820 29.142  9.190   1.00 32.02  ? 258 GLY A CA    1 
ATOM   1932 C  C     . GLY A 1 239 ? -36.913 29.375  8.001   1.00 34.47  ? 258 GLY A C     1 
ATOM   1933 O  O     . GLY A 1 239 ? -35.790 28.862  7.944   1.00 36.19  ? 258 GLY A O     1 
ATOM   1934 N  N     . LEU A 1 240 ? -37.408 30.149  7.033   1.00 38.41  ? 259 LEU A N     1 
ATOM   1935 C  CA    . LEU A 1 240 ? -36.612 30.474  5.856   1.00 37.15  ? 259 LEU A CA    1 
ATOM   1936 C  C     . LEU A 1 240 ? -35.374 31.276  6.221   1.00 42.81  ? 259 LEU A C     1 
ATOM   1937 O  O     . LEU A 1 240 ? -34.335 31.154  5.562   1.00 41.76  ? 259 LEU A O     1 
ATOM   1938 C  CB    . LEU A 1 240 ? -37.466 31.249  4.857   1.00 37.93  ? 259 LEU A CB    1 
ATOM   1939 C  CG    . LEU A 1 240 ? -38.673 30.498  4.298   1.00 37.45  ? 259 LEU A CG    1 
ATOM   1940 C  CD1   . LEU A 1 240 ? -39.605 31.458  3.586   1.00 39.34  ? 259 LEU A CD1   1 
ATOM   1941 C  CD2   . LEU A 1 240 ? -38.203 29.406  3.357   1.00 29.15  ? 259 LEU A CD2   1 
ATOM   1942 N  N     . LYS A 1 241 ? -35.465 32.103  7.256   1.00 45.52  ? 260 LYS A N     1 
ATOM   1943 C  CA    . LYS A 1 241 ? -34.357 32.927  7.710   1.00 45.72  ? 260 LYS A CA    1 
ATOM   1944 C  C     . LYS A 1 241 ? -33.828 32.388  9.030   1.00 46.57  ? 260 LYS A C     1 
ATOM   1945 O  O     . LYS A 1 241 ? -34.596 31.913  9.874   1.00 41.64  ? 260 LYS A O     1 
ATOM   1946 C  CB    . LYS A 1 241 ? -34.788 34.386  7.863   1.00 52.88  ? 260 LYS A CB    1 
ATOM   1947 C  CG    . LYS A 1 241 ? -34.958 35.105  6.530   1.00 56.64  ? 260 LYS A CG    1 
ATOM   1948 C  CD    . LYS A 1 241 ? -35.788 36.369  6.673   1.00 70.48  ? 260 LYS A CD    1 
ATOM   1949 C  CE    . LYS A 1 241 ? -35.684 37.237  5.430   1.00 76.54  ? 260 LYS A CE    1 
ATOM   1950 N  NZ    . LYS A 1 241 ? -34.328 37.842  5.299   1.00 82.29  ? 260 LYS A NZ    1 
ATOM   1951 N  N     . ARG A 1 242 ? -32.509 32.473  9.198   1.00 50.68  ? 261 ARG A N     1 
ATOM   1952 C  CA    . ARG A 1 242 ? -31.839 31.833  10.323  1.00 49.18  ? 261 ARG A CA    1 
ATOM   1953 C  C     . ARG A 1 242 ? -32.226 32.435  11.668  1.00 50.92  ? 261 ARG A C     1 
ATOM   1954 O  O     . ARG A 1 242 ? -31.995 31.797  12.699  1.00 52.00  ? 261 ARG A O     1 
ATOM   1955 C  CB    . ARG A 1 242 ? -30.325 31.917  10.122  1.00 53.18  ? 261 ARG A CB    1 
ATOM   1956 C  CG    . ARG A 1 242 ? -29.497 30.946  10.942  1.00 54.92  ? 261 ARG A CG    1 
ATOM   1957 C  CD    . ARG A 1 242 ? -28.061 30.991  10.456  1.00 55.72  ? 261 ARG A CD    1 
ATOM   1958 N  NE    . ARG A 1 242 ? -27.117 30.372  11.380  1.00 56.58  ? 261 ARG A NE    1 
ATOM   1959 C  CZ    . ARG A 1 242 ? -26.419 29.274  11.105  1.00 58.69  ? 261 ARG A CZ    1 
ATOM   1960 N  NH1   . ARG A 1 242 ? -25.576 28.780  12.002  1.00 62.13  ? 261 ARG A NH1   1 
ATOM   1961 N  NH2   . ARG A 1 242 ? -26.559 28.675  9.929   1.00 48.89  ? 261 ARG A NH2   1 
ATOM   1962 N  N     . ASP A 1 243 ? -32.819 33.627  11.694  1.00 51.26  ? 262 ASP A N     1 
ATOM   1963 C  CA    . ASP A 1 243 ? -33.111 34.299  12.952  1.00 56.17  ? 262 ASP A CA    1 
ATOM   1964 C  C     . ASP A 1 243 ? -34.560 34.140  13.399  1.00 55.02  ? 262 ASP A C     1 
ATOM   1965 O  O     . ASP A 1 243 ? -34.999 34.866  14.294  1.00 63.50  ? 262 ASP A O     1 
ATOM   1966 C  CB    . ASP A 1 243 ? -32.753 35.786  12.855  1.00 61.55  ? 262 ASP A CB    1 
ATOM   1967 C  CG    . ASP A 1 243 ? -33.775 36.583  12.073  1.00 69.89  ? 262 ASP A CG    1 
ATOM   1968 O  OD1   . ASP A 1 243 ? -34.299 36.063  11.065  1.00 70.44  ? 262 ASP A OD1   1 
ATOM   1969 O  OD2   . ASP A 1 243 ? -34.059 37.730  12.472  1.00 80.94  ? 262 ASP A OD2   1 
ATOM   1970 N  N     . GLU A 1 244 ? -35.308 33.210  12.814  1.00 49.80  ? 263 GLU A N     1 
ATOM   1971 C  CA    . GLU A 1 244 ? -36.671 32.941  13.253  1.00 47.84  ? 263 GLU A CA    1 
ATOM   1972 C  C     . GLU A 1 244 ? -36.671 31.849  14.317  1.00 47.99  ? 263 GLU A C     1 
ATOM   1973 O  O     . GLU A 1 244 ? -35.929 30.868  14.215  1.00 44.63  ? 263 GLU A O     1 
ATOM   1974 C  CB    . GLU A 1 244 ? -37.549 32.523  12.071  1.00 50.08  ? 263 GLU A CB    1 
ATOM   1975 C  CG    . GLU A 1 244 ? -39.038 32.469  12.383  1.00 50.32  ? 263 GLU A CG    1 
ATOM   1976 C  CD    . GLU A 1 244 ? -39.857 31.902  11.234  1.00 63.21  ? 263 GLU A CD    1 
ATOM   1977 O  OE1   . GLU A 1 244 ? -40.329 30.748  11.348  1.00 59.37  ? 263 GLU A OE1   1 
ATOM   1978 O  OE2   . GLU A 1 244 ? -40.020 32.608  10.214  1.00 61.78  ? 263 GLU A OE2   1 
ATOM   1979 N  N     . ALA A 1 245 ? -37.507 32.025  15.336  1.00 44.03  ? 264 ALA A N     1 
ATOM   1980 C  CA    . ALA A 1 245 ? -37.567 31.083  16.449  1.00 43.97  ? 264 ALA A CA    1 
ATOM   1981 C  C     . ALA A 1 245 ? -38.035 29.713  15.969  1.00 39.14  ? 264 ALA A C     1 
ATOM   1982 O  O     . ALA A 1 245 ? -39.125 29.608  15.385  1.00 38.73  ? 264 ALA A O     1 
ATOM   1983 C  CB    . ALA A 1 245 ? -38.498 31.602  17.544  1.00 36.49  ? 264 ALA A CB    1 
ATOM   1984 N  N     . PRO A 1 246 ? -37.268 28.652  16.196  1.00 40.69  ? 265 PRO A N     1 
ATOM   1985 C  CA    . PRO A 1 246 ? -37.662 27.327  15.715  1.00 36.17  ? 265 PRO A CA    1 
ATOM   1986 C  C     . PRO A 1 246 ? -38.661 26.662  16.653  1.00 39.10  ? 265 PRO A C     1 
ATOM   1987 O  O     . PRO A 1 246 ? -38.948 27.136  17.752  1.00 38.40  ? 265 PRO A O     1 
ATOM   1988 C  CB    . PRO A 1 246 ? -36.338 26.560  15.697  1.00 33.82  ? 265 PRO A CB    1 
ATOM   1989 C  CG    . PRO A 1 246 ? -35.574 27.162  16.835  1.00 37.14  ? 265 PRO A CG    1 
ATOM   1990 C  CD    . PRO A 1 246 ? -35.956 28.626  16.870  1.00 35.37  ? 265 PRO A CD    1 
ATOM   1991 N  N     . THR A 1 247 ? -39.185 25.533  16.188  1.00 35.73  ? 266 THR A N     1 
ATOM   1992 C  CA    . THR A 1 247 ? -40.018 24.652  16.989  1.00 33.89  ? 266 THR A CA    1 
ATOM   1993 C  C     . THR A 1 247 ? -39.210 23.417  17.360  1.00 37.07  ? 266 THR A C     1 
ATOM   1994 O  O     . THR A 1 247 ? -38.506 22.849  16.516  1.00 35.91  ? 266 THR A O     1 
ATOM   1995 C  CB    . THR A 1 247 ? -41.289 24.244  16.233  1.00 38.24  ? 266 THR A CB    1 
ATOM   1996 O  OG1   . THR A 1 247 ? -42.016 25.417  15.841  1.00 38.17  ? 266 THR A OG1   1 
ATOM   1997 C  CG2   . THR A 1 247 ? -42.181 23.384  17.108  1.00 38.97  ? 266 THR A CG2   1 
ATOM   1998 N  N     . ALA A 1 248 ? -39.302 23.020  18.628  1.00 35.89  ? 267 ALA A N     1 
ATOM   1999 C  CA    . ALA A 1 248 ? -38.548 21.899  19.169  1.00 31.16  ? 267 ALA A CA    1 
ATOM   2000 C  C     . ALA A 1 248 ? -39.427 20.659  19.255  1.00 36.46  ? 267 ALA A C     1 
ATOM   2001 O  O     . ALA A 1 248 ? -40.599 20.744  19.629  1.00 36.22  ? 267 ALA A O     1 
ATOM   2002 C  CB    . ALA A 1 248 ? -37.995 22.237  20.554  1.00 35.02  ? 267 ALA A CB    1 
ATOM   2003 N  N     . MET A 1 249 ? -38.850 19.505  18.920  1.00 36.71  ? 268 MET A N     1 
ATOM   2004 C  CA    . MET A 1 249 ? -39.594 18.255  18.963  1.00 35.70  ? 268 MET A CA    1 
ATOM   2005 C  C     . MET A 1 249 ? -38.649 17.110  19.303  1.00 39.40  ? 268 MET A C     1 
ATOM   2006 O  O     . MET A 1 249 ? -37.451 17.169  19.020  1.00 37.70  ? 268 MET A O     1 
ATOM   2007 C  CB    . MET A 1 249 ? -40.298 17.985  17.628  1.00 35.39  ? 268 MET A CB    1 
ATOM   2008 C  CG    . MET A 1 249 ? -39.341 17.709  16.480  1.00 37.44  ? 268 MET A CG    1 
ATOM   2009 S  SD    . MET A 1 249 ? -40.141 17.896  14.876  1.00 40.69  ? 268 MET A SD    1 
ATOM   2010 C  CE    . MET A 1 249 ? -40.659 19.604  14.966  1.00 29.04  ? 268 MET A CE    1 
ATOM   2011 N  N     . PHE A 1 250 ? -39.197 16.059  19.906  1.00 39.82  ? 269 PHE A N     1 
ATOM   2012 C  CA    . PHE A 1 250 ? -38.387 14.895  20.235  1.00 36.41  ? 269 PHE A CA    1 
ATOM   2013 C  C     . PHE A 1 250 ? -38.256 13.965  19.037  1.00 41.24  ? 269 PHE A C     1 
ATOM   2014 O  O     . PHE A 1 250 ? -39.168 13.832  18.218  1.00 40.85  ? 269 PHE A O     1 
ATOM   2015 C  CB    . PHE A 1 250 ? -38.985 14.119  21.409  1.00 39.15  ? 269 PHE A CB    1 
ATOM   2016 C  CG    . PHE A 1 250 ? -38.790 14.783  22.737  1.00 42.27  ? 269 PHE A CG    1 
ATOM   2017 C  CD1   . PHE A 1 250 ? -37.523 14.912  23.281  1.00 43.86  ? 269 PHE A CD1   1 
ATOM   2018 C  CD2   . PHE A 1 250 ? -39.874 15.267  23.451  1.00 38.72  ? 269 PHE A CD2   1 
ATOM   2019 C  CE1   . PHE A 1 250 ? -37.341 15.523  24.509  1.00 45.15  ? 269 PHE A CE1   1 
ATOM   2020 C  CE2   . PHE A 1 250 ? -39.698 15.876  24.677  1.00 39.56  ? 269 PHE A CE2   1 
ATOM   2021 C  CZ    . PHE A 1 250 ? -38.431 16.006  25.207  1.00 39.88  ? 269 PHE A CZ    1 
ATOM   2022 N  N     . MET A 1 251 ? -37.098 13.320  18.946  1.00 38.90  ? 270 MET A N     1 
ATOM   2023 C  CA    . MET A 1 251 ? -36.849 12.229  18.011  1.00 38.83  ? 270 MET A CA    1 
ATOM   2024 C  C     . MET A 1 251 ? -36.560 10.993  18.856  1.00 44.26  ? 270 MET A C     1 
ATOM   2025 O  O     . MET A 1 251 ? -35.479 10.869  19.445  1.00 45.22  ? 270 MET A O     1 
ATOM   2026 C  CB    . MET A 1 251 ? -35.691 12.545  17.069  1.00 45.91  ? 270 MET A CB    1 
ATOM   2027 C  CG    . MET A 1 251 ? -35.951 13.700  16.122  1.00 50.38  ? 270 MET A CG    1 
ATOM   2028 S  SD    . MET A 1 251 ? -34.761 13.750  14.766  1.00 61.70  ? 270 MET A SD    1 
ATOM   2029 C  CE    . MET A 1 251 ? -33.236 14.039  15.658  1.00 44.07  ? 270 MET A CE    1 
ATOM   2030 N  N     . HIS A 1 252 ? -37.539 10.101  18.932  1.00 42.55  ? 271 HIS A N     1 
ATOM   2031 C  CA    . HIS A 1 252 ? -37.383 8.832   19.619  1.00 43.75  ? 271 HIS A CA    1 
ATOM   2032 C  C     . HIS A 1 252 ? -36.953 7.757   18.629  1.00 43.08  ? 271 HIS A C     1 
ATOM   2033 O  O     . HIS A 1 252 ? -37.055 7.926   17.411  1.00 41.98  ? 271 HIS A O     1 
ATOM   2034 C  CB    . HIS A 1 252 ? -38.686 8.434   20.313  1.00 38.37  ? 271 HIS A CB    1 
ATOM   2035 C  CG    . HIS A 1 252 ? -39.156 9.426   21.333  1.00 42.55  ? 271 HIS A CG    1 
ATOM   2036 N  ND1   . HIS A 1 252 ? -38.399 9.784   22.429  1.00 43.44  ? 271 HIS A ND1   1 
ATOM   2037 C  CD2   . HIS A 1 252 ? -40.310 10.129  21.428  1.00 43.56  ? 271 HIS A CD2   1 
ATOM   2038 C  CE1   . HIS A 1 252 ? -39.065 10.666  23.153  1.00 43.21  ? 271 HIS A CE1   1 
ATOM   2039 N  NE2   . HIS A 1 252 ? -40.228 10.893  22.568  1.00 45.85  ? 271 HIS A NE2   1 
ATOM   2040 N  N     . SER A 1 253 ? -36.459 6.645   19.172  1.00 42.86  ? 272 SER A N     1 
ATOM   2041 C  CA    . SER A 1 253 ? -35.966 5.548   18.346  1.00 44.88  ? 272 SER A CA    1 
ATOM   2042 C  C     . SER A 1 253 ? -37.070 5.008   17.440  1.00 40.39  ? 272 SER A C     1 
ATOM   2043 O  O     . SER A 1 253 ? -38.170 4.688   17.898  1.00 38.66  ? 272 SER A O     1 
ATOM   2044 C  CB    . SER A 1 253 ? -35.416 4.433   19.241  1.00 38.36  ? 272 SER A CB    1 
ATOM   2045 O  OG    . SER A 1 253 ? -34.629 3.519   18.497  1.00 39.40  ? 272 SER A OG    1 
ATOM   2046 N  N     . GLY A 1 254 ? -36.774 4.919   16.143  1.00 41.58  ? 273 GLY A N     1 
ATOM   2047 C  CA    . GLY A 1 254 ? -37.729 4.461   15.160  1.00 42.54  ? 273 GLY A CA    1 
ATOM   2048 C  C     . GLY A 1 254 ? -38.524 5.555   14.473  1.00 40.53  ? 273 GLY A C     1 
ATOM   2049 O  O     . GLY A 1 254 ? -39.099 5.304   13.406  1.00 38.73  ? 273 GLY A O     1 
ATOM   2050 N  N     . ASP A 1 255 ? -38.579 6.754   15.049  1.00 35.04  ? 274 ASP A N     1 
ATOM   2051 C  CA    . ASP A 1 255 ? -39.308 7.852   14.426  1.00 32.50  ? 274 ASP A CA    1 
ATOM   2052 C  C     . ASP A 1 255 ? -38.751 8.148   13.038  1.00 32.70  ? 274 ASP A C     1 
ATOM   2053 O  O     . ASP A 1 255 ? -37.560 7.974   12.766  1.00 34.62  ? 274 ASP A O     1 
ATOM   2054 C  CB    . ASP A 1 255 ? -39.236 9.109   15.292  1.00 36.72  ? 274 ASP A CB    1 
ATOM   2055 C  CG    . ASP A 1 255 ? -39.963 8.952   16.620  1.00 37.52  ? 274 ASP A CG    1 
ATOM   2056 O  OD1   . ASP A 1 255 ? -40.672 7.942   16.799  1.00 41.32  ? 274 ASP A OD1   1 
ATOM   2057 O  OD2   . ASP A 1 255 ? -39.821 9.838   17.489  1.00 39.51  ? 274 ASP A OD2   1 
ATOM   2058 N  N     . ILE A 1 256 ? -39.635 8.587   12.149  1.00 38.23  ? 275 ILE A N     1 
ATOM   2059 C  CA    . ILE A 1 256 ? -39.275 8.907   10.774  1.00 32.84  ? 275 ILE A CA    1 
ATOM   2060 C  C     . ILE A 1 256 ? -39.786 10.303  10.455  1.00 31.00  ? 275 ILE A C     1 
ATOM   2061 O  O     . ILE A 1 256 ? -40.899 10.670  10.843  1.00 37.85  ? 275 ILE A O     1 
ATOM   2062 C  CB    . ILE A 1 256 ? -39.848 7.871   9.787   1.00 34.94  ? 275 ILE A CB    1 
ATOM   2063 C  CG1   . ILE A 1 256 ? -39.438 6.459   10.218  1.00 35.66  ? 275 ILE A CG1   1 
ATOM   2064 C  CG2   . ILE A 1 256 ? -39.375 8.165   8.370   1.00 34.87  ? 275 ILE A CG2   1 
ATOM   2065 C  CD1   . ILE A 1 256 ? -39.941 5.362   9.320   1.00 31.85  ? 275 ILE A CD1   1 
ATOM   2066 N  N     . MET A 1 257 ? -38.966 11.090  9.772   1.00 33.03  ? 276 MET A N     1 
ATOM   2067 C  CA    . MET A 1 257 ? -39.366 12.404  9.290   1.00 29.33  ? 276 MET A CA    1 
ATOM   2068 C  C     . MET A 1 257 ? -39.323 12.398  7.771   1.00 30.55  ? 276 MET A C     1 
ATOM   2069 O  O     . MET A 1 257 ? -38.362 11.898  7.176   1.00 34.46  ? 276 MET A O     1 
ATOM   2070 C  CB    . MET A 1 257 ? -38.453 13.501  9.839   1.00 33.77  ? 276 MET A CB    1 
ATOM   2071 C  CG    . MET A 1 257 ? -38.544 13.704  11.347  1.00 44.05  ? 276 MET A CG    1 
ATOM   2072 S  SD    . MET A 1 257 ? -37.499 15.070  11.887  1.00 45.89  ? 276 MET A SD    1 
ATOM   2073 C  CE    . MET A 1 257 ? -37.941 15.194  13.601  1.00 50.73  ? 276 MET A CE    1 
ATOM   2074 N  N     . VAL A 1 258 ? -40.362 12.941  7.146   1.00 32.80  ? 277 VAL A N     1 
ATOM   2075 C  CA    . VAL A 1 258 ? -40.449 13.039  5.695   1.00 26.76  ? 277 VAL A CA    1 
ATOM   2076 C  C     . VAL A 1 258 ? -40.632 14.508  5.356   1.00 33.70  ? 277 VAL A C     1 
ATOM   2077 O  O     . VAL A 1 258 ? -41.607 15.133  5.789   1.00 34.06  ? 277 VAL A O     1 
ATOM   2078 C  CB    . VAL A 1 258 ? -41.600 12.193  5.127   1.00 36.86  ? 277 VAL A CB    1 
ATOM   2079 C  CG1   . VAL A 1 258 ? -41.656 12.313  3.606   1.00 32.86  ? 277 VAL A CG1   1 
ATOM   2080 C  CG2   . VAL A 1 258 ? -41.451 10.733  5.550   1.00 31.72  ? 277 VAL A CG2   1 
ATOM   2081 N  N     . MET A 1 259 ? -39.699 15.063  4.590   1.00 38.25  ? 278 MET A N     1 
ATOM   2082 C  CA    . MET A 1 259 ? -39.694 16.488  4.299   1.00 35.49  ? 278 MET A CA    1 
ATOM   2083 C  C     . MET A 1 259 ? -39.759 16.715  2.797   1.00 37.53  ? 278 MET A C     1 
ATOM   2084 O  O     . MET A 1 259 ? -38.998 16.113  2.036   1.00 34.17  ? 278 MET A O     1 
ATOM   2085 C  CB    . MET A 1 259 ? -38.462 17.153  4.910   1.00 32.39  ? 278 MET A CB    1 
ATOM   2086 C  CG    . MET A 1 259 ? -38.422 16.967  6.422   1.00 40.24  ? 278 MET A CG    1 
ATOM   2087 S  SD    . MET A 1 259 ? -37.482 18.209  7.321   1.00 61.63  ? 278 MET A SD    1 
ATOM   2088 C  CE    . MET A 1 259 ? -36.059 17.239  7.807   1.00 47.83  ? 278 MET A CE    1 
ATOM   2089 N  N     . SER A 1 260 ? -40.682 17.572  2.374   1.00 36.28  ? 279 SER A N     1 
ATOM   2090 C  CA    . SER A 1 260 ? -40.838 17.895  0.967   1.00 32.07  ? 279 SER A CA    1 
ATOM   2091 C  C     . SER A 1 260 ? -41.162 19.373  0.844   1.00 32.31  ? 279 SER A C     1 
ATOM   2092 O  O     . SER A 1 260 ? -41.538 20.030  1.819   1.00 32.63  ? 279 SER A O     1 
ATOM   2093 C  CB    . SER A 1 260 ? -41.929 17.042  0.303   1.00 35.91  ? 279 SER A CB    1 
ATOM   2094 O  OG    . SER A 1 260 ? -43.199 17.291  0.882   1.00 38.94  ? 279 SER A OG    1 
ATOM   2095 N  N     . GLY A 1 261 ? -40.992 19.891  -0.370  1.00 30.78  ? 280 GLY A N     1 
ATOM   2096 C  CA    . GLY A 1 261 ? -41.331 21.263  -0.695  1.00 29.74  ? 280 GLY A CA    1 
ATOM   2097 C  C     . GLY A 1 261 ? -40.870 22.317  0.290   1.00 31.38  ? 280 GLY A C     1 
ATOM   2098 O  O     . GLY A 1 261 ? -39.676 22.424  0.596   1.00 28.58  ? 280 GLY A O     1 
ATOM   2099 N  N     . PHE A 1 262 ? -41.840 23.085  0.800   1.00 29.30  ? 281 PHE A N     1 
ATOM   2100 C  CA    . PHE A 1 262 ? -41.560 24.228  1.666   1.00 31.63  ? 281 PHE A CA    1 
ATOM   2101 C  C     . PHE A 1 262 ? -40.604 23.865  2.798   1.00 30.96  ? 281 PHE A C     1 
ATOM   2102 O  O     . PHE A 1 262 ? -39.583 24.533  3.009   1.00 29.18  ? 281 PHE A O     1 
ATOM   2103 C  CB    . PHE A 1 262 ? -42.878 24.774  2.226   1.00 29.63  ? 281 PHE A CB    1 
ATOM   2104 C  CG    . PHE A 1 262 ? -42.713 25.945  3.152   1.00 29.98  ? 281 PHE A CG    1 
ATOM   2105 C  CD1   . PHE A 1 262 ? -42.711 27.241  2.659   1.00 30.47  ? 281 PHE A CD1   1 
ATOM   2106 C  CD2   . PHE A 1 262 ? -42.572 25.752  4.518   1.00 32.96  ? 281 PHE A CD2   1 
ATOM   2107 C  CE1   . PHE A 1 262 ? -42.563 28.321  3.509   1.00 35.97  ? 281 PHE A CE1   1 
ATOM   2108 C  CE2   . PHE A 1 262 ? -42.416 26.831  5.375   1.00 30.18  ? 281 PHE A CE2   1 
ATOM   2109 C  CZ    . PHE A 1 262 ? -42.414 28.113  4.872   1.00 28.68  ? 281 PHE A CZ    1 
ATOM   2110 N  N     . SER A 1 263 ? -40.911 22.797  3.533   1.00 29.80  ? 282 SER A N     1 
ATOM   2111 C  CA    . SER A 1 263 ? -40.115 22.486  4.713   1.00 33.66  ? 282 SER A CA    1 
ATOM   2112 C  C     . SER A 1 263 ? -38.685 22.086  4.364   1.00 31.89  ? 282 SER A C     1 
ATOM   2113 O  O     . SER A 1 263 ? -37.800 22.225  5.213   1.00 31.82  ? 282 SER A O     1 
ATOM   2114 C  CB    . SER A 1 263 ? -40.794 21.391  5.541   1.00 30.45  ? 282 SER A CB    1 
ATOM   2115 O  OG    . SER A 1 263 ? -40.639 20.119  4.937   1.00 40.70  ? 282 SER A OG    1 
ATOM   2116 N  N     . ARG A 1 264 ? -38.428 21.626  3.133   1.00 35.08  ? 283 ARG A N     1 
ATOM   2117 C  CA    . ARG A 1 264 ? -37.055 21.323  2.733   1.00 29.74  ? 283 ARG A CA    1 
ATOM   2118 C  C     . ARG A 1 264 ? -36.175 22.564  2.700   1.00 34.91  ? 283 ARG A C     1 
ATOM   2119 O  O     . ARG A 1 264 ? -34.946 22.435  2.672   1.00 31.08  ? 283 ARG A O     1 
ATOM   2120 C  CB    . ARG A 1 264 ? -37.029 20.656  1.356   1.00 32.73  ? 283 ARG A CB    1 
ATOM   2121 C  CG    . ARG A 1 264 ? -37.563 19.236  1.326   1.00 33.64  ? 283 ARG A CG    1 
ATOM   2122 C  CD    . ARG A 1 264 ? -36.462 18.221  1.557   1.00 35.77  ? 283 ARG A CD    1 
ATOM   2123 N  NE    . ARG A 1 264 ? -35.511 18.212  0.450   1.00 42.86  ? 283 ARG A NE    1 
ATOM   2124 C  CZ    . ARG A 1 264 ? -35.677 17.512  -0.668  1.00 39.61  ? 283 ARG A CZ    1 
ATOM   2125 N  NH1   . ARG A 1 264 ? -36.759 16.761  -0.828  1.00 45.86  ? 283 ARG A NH1   1 
ATOM   2126 N  NH2   . ARG A 1 264 ? -34.765 17.563  -1.628  1.00 38.25  ? 283 ARG A NH2   1 
ATOM   2127 N  N     . LEU A 1 265 ? -36.769 23.756  2.698   1.00 33.33  ? 284 LEU A N     1 
ATOM   2128 C  CA    . LEU A 1 265 ? -36.021 25.000  2.594   1.00 30.21  ? 284 LEU A CA    1 
ATOM   2129 C  C     . LEU A 1 265 ? -35.679 25.615  3.946   1.00 37.83  ? 284 LEU A C     1 
ATOM   2130 O  O     . LEU A 1 265 ? -35.089 26.701  3.979   1.00 37.32  ? 284 LEU A O     1 
ATOM   2131 C  CB    . LEU A 1 265 ? -36.815 26.023  1.776   1.00 33.92  ? 284 LEU A CB    1 
ATOM   2132 C  CG    . LEU A 1 265 ? -37.190 25.706  0.326   1.00 33.85  ? 284 LEU A CG    1 
ATOM   2133 C  CD1   . LEU A 1 265 ? -38.033 26.836  -0.230  1.00 30.78  ? 284 LEU A CD1   1 
ATOM   2134 C  CD2   . LEU A 1 265 ? -35.951 25.512  -0.520  1.00 36.73  ? 284 LEU A CD2   1 
ATOM   2135 N  N     . LEU A 1 266 ? -36.028 24.964  5.051   1.00 31.59  ? 285 LEU A N     1 
ATOM   2136 C  CA    . LEU A 1 266 ? -36.009 25.597  6.361   1.00 32.22  ? 285 LEU A CA    1 
ATOM   2137 C  C     . LEU A 1 266 ? -34.727 25.287  7.123   1.00 35.05  ? 285 LEU A C     1 
ATOM   2138 O  O     . LEU A 1 266 ? -34.119 24.226  6.958   1.00 36.58  ? 285 LEU A O     1 
ATOM   2139 C  CB    . LEU A 1 266 ? -37.207 25.145  7.195   1.00 33.01  ? 285 LEU A CB    1 
ATOM   2140 C  CG    . LEU A 1 266 ? -38.586 25.384  6.589   1.00 36.14  ? 285 LEU A CG    1 
ATOM   2141 C  CD1   . LEU A 1 266 ? -39.664 24.813  7.498   1.00 25.64  ? 285 LEU A CD1   1 
ATOM   2142 C  CD2   . LEU A 1 266 ? -38.804 26.876  6.342   1.00 30.28  ? 285 LEU A CD2   1 
ATOM   2143 N  N     . ASN A 1 267 ? -34.333 26.227  7.978   1.00 35.70  ? 286 ASN A N     1 
ATOM   2144 C  CA    . ASN A 1 267 ? -33.250 25.974  8.916   1.00 31.44  ? 286 ASN A CA    1 
ATOM   2145 C  C     . ASN A 1 267 ? -33.651 24.877  9.892   1.00 32.07  ? 286 ASN A C     1 
ATOM   2146 O  O     . ASN A 1 267 ? -34.772 24.860  10.409  1.00 31.62  ? 286 ASN A O     1 
ATOM   2147 C  CB    . ASN A 1 267 ? -32.897 27.248  9.683   1.00 29.06  ? 286 ASN A CB    1 
ATOM   2148 C  CG    . ASN A 1 267 ? -32.193 28.272  8.820   1.00 35.27  ? 286 ASN A CG    1 
ATOM   2149 O  OD1   . ASN A 1 267 ? -30.966 28.281  8.730   1.00 34.16  ? 286 ASN A OD1   1 
ATOM   2150 N  ND2   . ASN A 1 267 ? -32.965 29.136  8.169   1.00 36.54  ? 286 ASN A ND2   1 
ATOM   2151 N  N     . HIS A 1 268 ? -32.724 23.957  10.147  1.00 24.68  ? 287 HIS A N     1 
ATOM   2152 C  CA    . HIS A 1 268 ? -32.962 22.896  11.112  1.00 32.71  ? 287 HIS A CA    1 
ATOM   2153 C  C     . HIS A 1 268 ? -31.641 22.500  11.756  1.00 29.17  ? 287 HIS A C     1 
ATOM   2154 O  O     . HIS A 1 268 ? -30.562 22.778  11.226  1.00 30.02  ? 287 HIS A O     1 
ATOM   2155 C  CB    . HIS A 1 268 ? -33.653 21.682  10.467  1.00 30.48  ? 287 HIS A CB    1 
ATOM   2156 C  CG    . HIS A 1 268 ? -32.940 21.141  9.265   1.00 32.46  ? 287 HIS A CG    1 
ATOM   2157 N  ND1   . HIS A 1 268 ? -32.947 21.780  8.044   1.00 31.96  ? 287 HIS A ND1   1 
ATOM   2158 C  CD2   . HIS A 1 268 ? -32.213 20.011  9.094   1.00 37.09  ? 287 HIS A CD2   1 
ATOM   2159 C  CE1   . HIS A 1 268 ? -32.249 21.071  7.174   1.00 37.10  ? 287 HIS A CE1   1 
ATOM   2160 N  NE2   . HIS A 1 268 ? -31.793 19.993  7.785   1.00 37.54  ? 287 HIS A NE2   1 
ATOM   2161 N  N     . ALA A 1 269 ? -31.746 21.849  12.914  1.00 30.93  ? 288 ALA A N     1 
ATOM   2162 C  CA    . ALA A 1 269 ? -30.582 21.494  13.715  1.00 31.07  ? 288 ALA A CA    1 
ATOM   2163 C  C     . ALA A 1 269 ? -30.967 20.415  14.717  1.00 33.54  ? 288 ALA A C     1 
ATOM   2164 O  O     . ALA A 1 269 ? -32.143 20.225  15.035  1.00 32.94  ? 288 ALA A O     1 
ATOM   2165 C  CB    . ALA A 1 269 ? -30.018 22.716  14.446  1.00 29.50  ? 288 ALA A CB    1 
ATOM   2166 N  N     . VAL A 1 270 ? -29.953 19.712  15.215  1.00 31.84  ? 289 VAL A N     1 
ATOM   2167 C  CA    . VAL A 1 270 ? -30.129 18.753  16.304  1.00 33.96  ? 289 VAL A CA    1 
ATOM   2168 C  C     . VAL A 1 270 ? -29.205 19.159  17.448  1.00 37.46  ? 289 VAL A C     1 
ATOM   2169 O  O     . VAL A 1 270 ? -28.032 18.756  17.473  1.00 34.35  ? 289 VAL A O     1 
ATOM   2170 C  CB    . VAL A 1 270 ? -29.847 17.314  15.844  1.00 40.88  ? 289 VAL A CB    1 
ATOM   2171 C  CG1   . VAL A 1 270 ? -30.239 16.331  16.934  1.00 35.33  ? 289 VAL A CG1   1 
ATOM   2172 C  CG2   . VAL A 1 270 ? -30.591 17.008  14.546  1.00 34.08  ? 289 VAL A CG2   1 
ATOM   2173 N  N     . PRO A 1 271 ? -29.682 19.951  18.413  1.00 35.98  ? 290 PRO A N     1 
ATOM   2174 C  CA    . PRO A 1 271 ? -28.769 20.514  19.418  1.00 36.89  ? 290 PRO A CA    1 
ATOM   2175 C  C     . PRO A 1 271 ? -28.310 19.536  20.481  1.00 41.15  ? 290 PRO A C     1 
ATOM   2176 O  O     . PRO A 1 271 ? -27.290 19.806  21.128  1.00 43.02  ? 290 PRO A O     1 
ATOM   2177 C  CB    . PRO A 1 271 ? -29.592 21.645  20.056  1.00 39.14  ? 290 PRO A CB    1 
ATOM   2178 C  CG    . PRO A 1 271 ? -30.813 21.784  19.223  1.00 40.14  ? 290 PRO A CG    1 
ATOM   2179 C  CD    . PRO A 1 271 ? -31.044 20.482  18.553  1.00 37.37  ? 290 PRO A CD    1 
ATOM   2180 N  N     . ARG A 1 272 ? -29.013 18.429  20.703  1.00 42.43  ? 291 ARG A N     1 
ATOM   2181 C  CA    . ARG A 1 272 ? -28.677 17.595  21.847  1.00 41.71  ? 291 ARG A CA    1 
ATOM   2182 C  C     . ARG A 1 272 ? -29.167 16.169  21.649  1.00 41.24  ? 291 ARG A C     1 
ATOM   2183 O  O     . ARG A 1 272 ? -30.299 15.946  21.211  1.00 36.67  ? 291 ARG A O     1 
ATOM   2184 C  CB    . ARG A 1 272 ? -29.273 18.178  23.134  1.00 46.19  ? 291 ARG A CB    1 
ATOM   2185 C  CG    . ARG A 1 272 ? -29.096 17.293  24.354  1.00 48.47  ? 291 ARG A CG    1 
ATOM   2186 C  CD    . ARG A 1 272 ? -29.095 18.114  25.623  1.00 55.18  ? 291 ARG A CD    1 
ATOM   2187 N  NE    . ARG A 1 272 ? -28.815 17.295  26.796  1.00 62.71  ? 291 ARG A NE    1 
ATOM   2188 C  CZ    . ARG A 1 272 ? -27.599 16.896  27.152  1.00 70.35  ? 291 ARG A CZ    1 
ATOM   2189 N  NH1   . ARG A 1 272 ? -26.545 17.234  26.420  1.00 70.83  ? 291 ARG A NH1   1 
ATOM   2190 N  NH2   . ARG A 1 272 ? -27.436 16.149  28.235  1.00 76.74  ? 291 ARG A NH2   1 
ATOM   2191 N  N     . VAL A 1 273 ? -28.303 15.214  21.986  1.00 39.67  ? 292 VAL A N     1 
ATOM   2192 C  CA    . VAL A 1 273 ? -28.681 13.821  22.190  1.00 35.67  ? 292 VAL A CA    1 
ATOM   2193 C  C     . VAL A 1 273 ? -28.911 13.628  23.684  1.00 47.14  ? 292 VAL A C     1 
ATOM   2194 O  O     . VAL A 1 273 ? -28.005 13.859  24.493  1.00 51.52  ? 292 VAL A O     1 
ATOM   2195 C  CB    . VAL A 1 273 ? -27.596 12.862  21.674  1.00 42.05  ? 292 VAL A CB    1 
ATOM   2196 C  CG1   . VAL A 1 273 ? -27.968 11.416  21.983  1.00 42.38  ? 292 VAL A CG1   1 
ATOM   2197 C  CG2   . VAL A 1 273 ? -27.356 13.063  20.185  1.00 36.01  ? 292 VAL A CG2   1 
ATOM   2198 N  N     . LEU A 1 274 ? -30.117 13.210  24.058  1.00 47.38  ? 293 LEU A N     1 
ATOM   2199 C  CA    . LEU A 1 274 ? -30.425 13.057  25.475  1.00 46.71  ? 293 LEU A CA    1 
ATOM   2200 C  C     . LEU A 1 274 ? -29.846 11.751  26.015  1.00 45.94  ? 293 LEU A C     1 
ATOM   2201 O  O     . LEU A 1 274 ? -29.925 10.715  25.350  1.00 47.34  ? 293 LEU A O     1 
ATOM   2202 C  CB    . LEU A 1 274 ? -31.931 13.073  25.699  1.00 39.82  ? 293 LEU A CB    1 
ATOM   2203 C  CG    . LEU A 1 274 ? -32.658 14.348  25.290  1.00 40.62  ? 293 LEU A CG    1 
ATOM   2204 C  CD1   . LEU A 1 274 ? -34.127 14.046  25.076  1.00 46.62  ? 293 LEU A CD1   1 
ATOM   2205 C  CD2   . LEU A 1 274 ? -32.477 15.415  26.350  1.00 48.94  ? 293 LEU A CD2   1 
ATOM   2206 N  N     . PRO A 1 275 ? -29.271 11.769  27.216  1.00 51.35  ? 294 PRO A N     1 
ATOM   2207 C  CA    . PRO A 1 275 ? -28.811 10.517  27.827  1.00 51.23  ? 294 PRO A CA    1 
ATOM   2208 C  C     . PRO A 1 275 ? -29.989 9.645   28.225  1.00 42.17  ? 294 PRO A C     1 
ATOM   2209 O  O     . PRO A 1 275 ? -31.085 10.135  28.506  1.00 44.42  ? 294 PRO A O     1 
ATOM   2210 C  CB    . PRO A 1 275 ? -28.025 10.989  29.055  1.00 40.12  ? 294 PRO A CB    1 
ATOM   2211 C  CG    . PRO A 1 275 ? -28.661 12.287  29.415  1.00 49.30  ? 294 PRO A CG    1 
ATOM   2212 C  CD    . PRO A 1 275 ? -29.056 12.927  28.101  1.00 55.38  ? 294 PRO A CD    1 
ATOM   2213 N  N     . HIS A 1 276 ? -29.759 8.335   28.240  1.00 44.54  ? 295 HIS A N     1 
ATOM   2214 C  CA    . HIS A 1 276 ? -30.844 7.419   28.553  1.00 55.92  ? 295 HIS A CA    1 
ATOM   2215 C  C     . HIS A 1 276 ? -31.315 7.631   29.992  1.00 55.27  ? 295 HIS A C     1 
ATOM   2216 O  O     . HIS A 1 276 ? -30.536 8.046   30.856  1.00 53.53  ? 295 HIS A O     1 
ATOM   2217 C  CB    . HIS A 1 276 ? -30.410 5.966   28.348  1.00 54.29  ? 295 HIS A CB    1 
ATOM   2218 C  CG    . HIS A 1 276 ? -29.447 5.461   29.379  1.00 58.30  ? 295 HIS A CG    1 
ATOM   2219 N  ND1   . HIS A 1 276 ? -29.839 5.089   30.647  1.00 56.33  ? 295 HIS A ND1   1 
ATOM   2220 C  CD2   . HIS A 1 276 ? -28.112 5.245   29.321  1.00 58.52  ? 295 HIS A CD2   1 
ATOM   2221 C  CE1   . HIS A 1 276 ? -28.785 4.680   31.329  1.00 58.48  ? 295 HIS A CE1   1 
ATOM   2222 N  NE2   . HIS A 1 276 ? -27.725 4.763   30.548  1.00 61.94  ? 295 HIS A NE2   1 
ATOM   2223 N  N     . PRO A 1 277 ? -32.591 7.377   30.272  1.00 59.89  ? 296 PRO A N     1 
ATOM   2224 C  CA    . PRO A 1 277 ? -33.071 7.444   31.656  1.00 59.23  ? 296 PRO A CA    1 
ATOM   2225 C  C     . PRO A 1 277 ? -32.434 6.356   32.510  1.00 64.46  ? 296 PRO A C     1 
ATOM   2226 O  O     . PRO A 1 277 ? -31.796 5.422   32.018  1.00 62.14  ? 296 PRO A O     1 
ATOM   2227 C  CB    . PRO A 1 277 ? -34.585 7.240   31.524  1.00 60.43  ? 296 PRO A CB    1 
ATOM   2228 C  CG    . PRO A 1 277 ? -34.899 7.554   30.094  1.00 58.74  ? 296 PRO A CG    1 
ATOM   2229 C  CD    . PRO A 1 277 ? -33.687 7.144   29.316  1.00 59.63  ? 296 PRO A CD    1 
ATOM   2230 N  N     . ASP A 1 278 ? -32.615 6.495   33.821  1.00 73.61  ? 297 ASP A N     1 
ATOM   2231 C  CA    . ASP A 1 278 ? -32.085 5.517   34.763  1.00 68.36  ? 297 ASP A CA    1 
ATOM   2232 C  C     . ASP A 1 278 ? -32.812 4.186   34.620  1.00 66.40  ? 297 ASP A C     1 
ATOM   2233 O  O     . ASP A 1 278 ? -34.040 4.139   34.507  1.00 68.84  ? 297 ASP A O     1 
ATOM   2234 C  CB    . ASP A 1 278 ? -32.219 6.035   36.193  1.00 67.06  ? 297 ASP A CB    1 
ATOM   2235 C  CG    . ASP A 1 278 ? -31.502 7.347   36.401  1.00 70.38  ? 297 ASP A CG    1 
ATOM   2236 O  OD1   . ASP A 1 278 ? -30.359 7.480   35.917  1.00 76.61  ? 297 ASP A OD1   1 
ATOM   2237 O  OD2   . ASP A 1 278 ? -32.084 8.251   37.037  1.00 76.47  ? 297 ASP A OD2   1 
ATOM   2238 N  N     . GLY A 1 279 ? -32.044 3.098   34.624  1.00 65.67  ? 298 GLY A N     1 
ATOM   2239 C  CA    . GLY A 1 279 ? -32.610 1.774   34.472  1.00 69.76  ? 298 GLY A CA    1 
ATOM   2240 C  C     . GLY A 1 279 ? -33.198 1.476   33.112  1.00 72.18  ? 298 GLY A C     1 
ATOM   2241 O  O     . GLY A 1 279 ? -33.752 0.386   32.921  1.00 73.22  ? 298 GLY A O     1 
ATOM   2242 N  N     . GLU A 1 280 ? -33.103 2.402   32.166  1.00 69.59  ? 299 GLU A N     1 
ATOM   2243 C  CA    . GLU A 1 280 ? -33.594 2.221   30.804  1.00 65.44  ? 299 GLU A CA    1 
ATOM   2244 C  C     . GLU A 1 280 ? -32.428 2.468   29.850  1.00 65.18  ? 299 GLU A C     1 
ATOM   2245 O  O     . GLU A 1 280 ? -32.415 3.448   29.100  1.00 67.34  ? 299 GLU A O     1 
ATOM   2246 C  CB    . GLU A 1 280 ? -34.770 3.165   30.523  1.00 70.04  ? 299 GLU A CB    1 
ATOM   2247 C  CG    . GLU A 1 280 ? -35.878 2.558   29.679  1.00 76.42  ? 299 GLU A CG    1 
ATOM   2248 C  CD    . GLU A 1 280 ? -36.948 3.573   29.316  1.00 83.83  ? 299 GLU A CD    1 
ATOM   2249 O  OE1   . GLU A 1 280 ? -36.869 4.155   28.213  1.00 78.70  ? 299 GLU A OE1   1 
ATOM   2250 O  OE2   . GLU A 1 280 ? -37.861 3.800   30.140  1.00 88.00  ? 299 GLU A OE2   1 
ATOM   2251 N  N     . SER A 1 281 ? -31.438 1.575   29.898  1.00 60.40  ? 300 SER A N     1 
ATOM   2252 C  CA    . SER A 1 281 ? -30.222 1.758   29.113  1.00 56.40  ? 300 SER A CA    1 
ATOM   2253 C  C     . SER A 1 281 ? -30.520 1.883   27.623  1.00 63.17  ? 300 SER A C     1 
ATOM   2254 O  O     . SER A 1 281 ? -29.829 2.620   26.910  1.00 55.22  ? 300 SER A O     1 
ATOM   2255 C  CB    . SER A 1 281 ? -29.264 0.595   29.380  1.00 52.99  ? 300 SER A CB    1 
ATOM   2256 O  OG    . SER A 1 281 ? -28.316 0.443   28.339  1.00 66.80  ? 300 SER A OG    1 
ATOM   2257 N  N     . LEU A 1 282 ? -31.540 1.189   27.142  1.00 59.25  ? 301 LEU A N     1 
ATOM   2258 C  CA    . LEU A 1 282 ? -31.959 1.226   25.752  1.00 52.69  ? 301 LEU A CA    1 
ATOM   2259 C  C     . LEU A 1 282 ? -33.454 1.482   25.686  1.00 50.73  ? 301 LEU A C     1 
ATOM   2260 O  O     . LEU A 1 282 ? -34.182 1.210   26.647  1.00 53.74  ? 301 LEU A O     1 
ATOM   2261 C  CB    . LEU A 1 282 ? -31.619 -0.088  25.034  1.00 51.81  ? 301 LEU A CB    1 
ATOM   2262 C  CG    . LEU A 1 282 ? -30.135 -0.310  24.753  1.00 53.26  ? 301 LEU A CG    1 
ATOM   2263 C  CD1   . LEU A 1 282 ? -29.920 -1.655  24.086  1.00 54.48  ? 301 LEU A CD1   1 
ATOM   2264 C  CD2   . LEU A 1 282 ? -29.587 0.818   23.893  1.00 51.14  ? 301 LEU A CD2   1 
ATOM   2265 N  N     . PRO A 1 283 ? -33.943 2.028   24.574  1.00 53.55  ? 302 PRO A N     1 
ATOM   2266 C  CA    . PRO A 1 283 ? -35.387 2.229   24.435  1.00 54.75  ? 302 PRO A CA    1 
ATOM   2267 C  C     . PRO A 1 283 ? -36.116 0.899   24.358  1.00 49.64  ? 302 PRO A C     1 
ATOM   2268 O  O     . PRO A 1 283 ? -35.591 -0.098  23.857  1.00 52.95  ? 302 PRO A O     1 
ATOM   2269 C  CB    . PRO A 1 283 ? -35.517 3.012   23.122  1.00 50.40  ? 302 PRO A CB    1 
ATOM   2270 C  CG    . PRO A 1 283 ? -34.169 3.592   22.880  1.00 49.26  ? 302 PRO A CG    1 
ATOM   2271 C  CD    . PRO A 1 283 ? -33.199 2.604   23.442  1.00 54.89  ? 302 PRO A CD    1 
ATOM   2272 N  N     . HIS A 1 284 ? -37.348 0.899   24.872  1.00 53.23  ? 303 HIS A N     1 
ATOM   2273 C  CA    . HIS A 1 284 ? -38.145 -0.324  24.906  1.00 59.24  ? 303 HIS A CA    1 
ATOM   2274 C  C     . HIS A 1 284 ? -38.340 -0.903  23.508  1.00 63.38  ? 303 HIS A C     1 
ATOM   2275 O  O     . HIS A 1 284 ? -38.346 -2.127  23.331  1.00 63.23  ? 303 HIS A O     1 
ATOM   2276 C  CB    . HIS A 1 284 ? -39.492 -0.039  25.571  1.00 59.59  ? 303 HIS A CB    1 
ATOM   2277 C  CG    . HIS A 1 284 ? -40.404 -1.225  25.633  1.00 74.11  ? 303 HIS A CG    1 
ATOM   2278 N  ND1   . HIS A 1 284 ? -39.951 -2.523  25.544  1.00 76.15  ? 303 HIS A ND1   1 
ATOM   2279 C  CD2   . HIS A 1 284 ? -41.749 -1.305  25.777  1.00 73.96  ? 303 HIS A CD2   1 
ATOM   2280 C  CE1   . HIS A 1 284 ? -40.976 -3.353  25.628  1.00 75.38  ? 303 HIS A CE1   1 
ATOM   2281 N  NE2   . HIS A 1 284 ? -42.078 -2.639  25.770  1.00 78.07  ? 303 HIS A NE2   1 
ATOM   2282 N  N     . SER A 1 285 ? -38.477 -0.041  22.497  1.00 56.66  ? 304 SER A N     1 
ATOM   2283 C  CA    . SER A 1 285 ? -38.740 -0.514  21.143  1.00 51.33  ? 304 SER A CA    1 
ATOM   2284 C  C     . SER A 1 285 ? -37.551 -1.232  20.515  1.00 56.07  ? 304 SER A C     1 
ATOM   2285 O  O     . SER A 1 285 ? -37.702 -1.793  19.424  1.00 60.54  ? 304 SER A O     1 
ATOM   2286 C  CB    . SER A 1 285 ? -39.156 0.656   20.251  1.00 57.61  ? 304 SER A CB    1 
ATOM   2287 O  OG    . SER A 1 285 ? -38.073 1.541   20.022  1.00 57.17  ? 304 SER A OG    1 
ATOM   2288 N  N     . LEU A 1 286 ? -36.386 -1.232  21.163  1.00 54.35  ? 305 LEU A N     1 
ATOM   2289 C  CA    . LEU A 1 286 ? -35.203 -1.902  20.636  1.00 54.40  ? 305 LEU A CA    1 
ATOM   2290 C  C     . LEU A 1 286 ? -34.961 -3.275  21.249  1.00 59.46  ? 305 LEU A C     1 
ATOM   2291 O  O     . LEU A 1 286 ? -34.159 -4.045  20.706  1.00 56.80  ? 305 LEU A O     1 
ATOM   2292 C  CB    . LEU A 1 286 ? -33.959 -1.028  20.850  1.00 54.95  ? 305 LEU A CB    1 
ATOM   2293 C  CG    . LEU A 1 286 ? -33.591 -0.077  19.710  1.00 54.14  ? 305 LEU A CG    1 
ATOM   2294 C  CD1   . LEU A 1 286 ? -32.499 0.889   20.145  1.00 55.65  ? 305 LEU A CD1   1 
ATOM   2295 C  CD2   . LEU A 1 286 ? -33.149 -0.867  18.489  1.00 50.21  ? 305 LEU A CD2   1 
ATOM   2296 N  N     . GLU A 1 287 ? -35.622 -3.600  22.358  1.00 58.89  ? 306 GLU A N     1 
ATOM   2297 C  CA    . GLU A 1 287 ? -35.442 -4.881  23.026  1.00 66.64  ? 306 GLU A CA    1 
ATOM   2298 C  C     . GLU A 1 287 ? -36.578 -5.860  22.764  1.00 66.28  ? 306 GLU A C     1 
ATOM   2299 O  O     . GLU A 1 287 ? -36.467 -7.029  23.148  1.00 65.47  ? 306 GLU A O     1 
ATOM   2300 C  CB    . GLU A 1 287 ? -35.292 -4.666  24.536  1.00 62.70  ? 306 GLU A CB    1 
ATOM   2301 C  CG    . GLU A 1 287 ? -34.074 -3.842  24.919  1.00 60.48  ? 306 GLU A CG    1 
ATOM   2302 C  CD    . GLU A 1 287 ? -34.295 -3.031  26.182  1.00 73.73  ? 306 GLU A CD    1 
ATOM   2303 O  OE1   . GLU A 1 287 ? -35.470 -2.753  26.513  1.00 67.49  ? 306 GLU A OE1   1 
ATOM   2304 O  OE2   . GLU A 1 287 ? -33.297 -2.669  26.843  1.00 77.36  ? 306 GLU A OE2   1 
ATOM   2305 N  N     . THR A 1 288 ? -37.655 -5.414  22.120  1.00 67.56  ? 307 THR A N     1 
ATOM   2306 C  CA    . THR A 1 288 ? -38.794 -6.278  21.861  1.00 61.18  ? 307 THR A CA    1 
ATOM   2307 C  C     . THR A 1 288 ? -38.390 -7.424  20.932  1.00 61.65  ? 307 THR A C     1 
ATOM   2308 O  O     . THR A 1 288 ? -37.462 -7.286  20.130  1.00 61.21  ? 307 THR A O     1 
ATOM   2309 C  CB    . THR A 1 288 ? -39.935 -5.471  21.244  1.00 63.48  ? 307 THR A CB    1 
ATOM   2310 O  OG1   . THR A 1 288 ? -39.439 -4.703  20.140  1.00 67.52  ? 307 THR A OG1   1 
ATOM   2311 C  CG2   . THR A 1 288 ? -40.543 -4.532  22.277  1.00 61.28  ? 307 THR A CG2   1 
ATOM   2312 N  N     . PRO A 1 289 ? -39.056 -8.572  21.031  1.00 65.05  ? 308 PRO A N     1 
ATOM   2313 C  CA    . PRO A 1 289 ? -38.681 -9.717  20.196  1.00 63.02  ? 308 PRO A CA    1 
ATOM   2314 C  C     . PRO A 1 289 ? -39.283 -9.638  18.803  1.00 60.97  ? 308 PRO A C     1 
ATOM   2315 O  O     . PRO A 1 289 ? -40.363 -9.081  18.590  1.00 55.67  ? 308 PRO A O     1 
ATOM   2316 C  CB    . PRO A 1 289 ? -39.255 -10.910 20.968  1.00 59.40  ? 308 PRO A CB    1 
ATOM   2317 C  CG    . PRO A 1 289 ? -40.477 -10.345 21.619  1.00 63.27  ? 308 PRO A CG    1 
ATOM   2318 C  CD    . PRO A 1 289 ? -40.129 -8.915  21.983  1.00 61.44  ? 308 PRO A CD    1 
ATOM   2319 N  N     . LEU A 1 290 ? -38.561 -10.218 17.847  1.00 59.47  ? 309 LEU A N     1 
ATOM   2320 C  CA    . LEU A 1 290 ? -39.055 -10.286 16.483  1.00 65.98  ? 309 LEU A CA    1 
ATOM   2321 C  C     . LEU A 1 290 ? -40.326 -11.132 16.428  1.00 69.10  ? 309 LEU A C     1 
ATOM   2322 O  O     . LEU A 1 290 ? -40.521 -12.025 17.260  1.00 70.78  ? 309 LEU A O     1 
ATOM   2323 C  CB    . LEU A 1 290 ? -37.994 -10.880 15.558  1.00 62.71  ? 309 LEU A CB    1 
ATOM   2324 C  CG    . LEU A 1 290 ? -36.864 -9.953  15.113  1.00 62.89  ? 309 LEU A CG    1 
ATOM   2325 C  CD1   . LEU A 1 290 ? -35.868 -10.709 14.255  1.00 62.43  ? 309 LEU A CD1   1 
ATOM   2326 C  CD2   . LEU A 1 290 ? -37.431 -8.767  14.351  1.00 62.23  ? 309 LEU A CD2   1 
ATOM   2327 N  N     . PRO A 1 291 ? -41.216 -10.862 15.473  1.00 73.04  ? 310 PRO A N     1 
ATOM   2328 C  CA    . PRO A 1 291 ? -42.387 -11.727 15.298  1.00 73.55  ? 310 PRO A CA    1 
ATOM   2329 C  C     . PRO A 1 291 ? -41.967 -13.168 15.044  1.00 73.01  ? 310 PRO A C     1 
ATOM   2330 O  O     . PRO A 1 291 ? -40.890 -13.441 14.509  1.00 66.12  ? 310 PRO A O     1 
ATOM   2331 C  CB    . PRO A 1 291 ? -43.099 -11.124 14.082  1.00 73.33  ? 310 PRO A CB    1 
ATOM   2332 C  CG    . PRO A 1 291 ? -42.681 -9.685  14.085  1.00 73.95  ? 310 PRO A CG    1 
ATOM   2333 C  CD    . PRO A 1 291 ? -41.259 -9.685  14.586  1.00 70.93  ? 310 PRO A CD    1 
ATOM   2334 N  N     . ALA A 1 292 ? -42.836 -14.096 15.451  1.00 81.10  ? 311 ALA A N     1 
ATOM   2335 C  CA    . ALA A 1 292 ? -42.517 -15.515 15.332  1.00 73.14  ? 311 ALA A CA    1 
ATOM   2336 C  C     . ALA A 1 292 ? -42.392 -15.932 13.872  1.00 75.02  ? 311 ALA A C     1 
ATOM   2337 O  O     . ALA A 1 292 ? -41.390 -16.533 13.468  1.00 73.99  ? 311 ALA A O     1 
ATOM   2338 C  CB    . ALA A 1 292 ? -43.582 -16.350 16.043  1.00 76.30  ? 311 ALA A CB    1 
ATOM   2339 N  N     . VAL A 1 293 ? -43.398 -15.619 13.063  1.00 82.56  ? 312 VAL A N     1 
ATOM   2340 C  CA    . VAL A 1 293 ? -43.432 -16.013 11.660  1.00 80.18  ? 312 VAL A CA    1 
ATOM   2341 C  C     . VAL A 1 293 ? -42.944 -14.833 10.831  1.00 79.48  ? 312 VAL A C     1 
ATOM   2342 O  O     . VAL A 1 293 ? -43.601 -13.787 10.769  1.00 79.15  ? 312 VAL A O     1 
ATOM   2343 C  CB    . VAL A 1 293 ? -44.835 -16.456 11.229  1.00 79.15  ? 312 VAL A CB    1 
ATOM   2344 C  CG1   . VAL A 1 293 ? -44.810 -16.952 9.792   1.00 72.87  ? 312 VAL A CG1   1 
ATOM   2345 C  CG2   . VAL A 1 293 ? -45.363 -17.532 12.168  1.00 83.33  ? 312 VAL A CG2   1 
ATOM   2346 N  N     . LEU A 1 294 ? -41.790 -14.999 10.194  1.00 74.29  ? 313 LEU A N     1 
ATOM   2347 C  CA    . LEU A 1 294 ? -41.241 -14.004 9.287   1.00 71.45  ? 313 LEU A CA    1 
ATOM   2348 C  C     . LEU A 1 294 ? -41.539 -14.382 7.842   1.00 74.41  ? 313 LEU A C     1 
ATOM   2349 O  O     . LEU A 1 294 ? -41.478 -15.564 7.487   1.00 74.11  ? 313 LEU A O     1 
ATOM   2350 C  CB    . LEU A 1 294 ? -39.729 -13.880 9.474   1.00 74.15  ? 313 LEU A CB    1 
ATOM   2351 C  CG    . LEU A 1 294 ? -39.191 -12.552 10.011  1.00 71.99  ? 313 LEU A CG    1 
ATOM   2352 C  CD1   . LEU A 1 294 ? -39.955 -12.105 11.247  1.00 63.27  ? 313 LEU A CD1   1 
ATOM   2353 C  CD2   . LEU A 1 294 ? -37.711 -12.688 10.319  1.00 66.94  ? 313 LEU A CD2   1 
ATOM   2354 N  N     . PRO A 1 295 ? -41.887 -13.413 6.996   1.00 74.60  ? 314 PRO A N     1 
ATOM   2355 C  CA    . PRO A 1 295 ? -42.055 -13.716 5.570   1.00 65.10  ? 314 PRO A CA    1 
ATOM   2356 C  C     . PRO A 1 295 ? -40.787 -14.320 4.990   1.00 62.78  ? 314 PRO A C     1 
ATOM   2357 O  O     . PRO A 1 295 ? -39.674 -13.912 5.325   1.00 67.21  ? 314 PRO A O     1 
ATOM   2358 C  CB    . PRO A 1 295 ? -42.362 -12.349 4.950   1.00 64.17  ? 314 PRO A CB    1 
ATOM   2359 C  CG    . PRO A 1 295 ? -42.959 -11.562 6.062   1.00 71.07  ? 314 PRO A CG    1 
ATOM   2360 C  CD    . PRO A 1 295 ? -42.277 -12.030 7.320   1.00 72.99  ? 314 PRO A CD    1 
ATOM   2361 N  N     . SER A 1 296 ? -40.965 -15.315 4.122   1.00 65.81  ? 315 SER A N     1 
ATOM   2362 C  CA    . SER A 1 296 ? -39.825 -15.919 3.444   1.00 62.55  ? 315 SER A CA    1 
ATOM   2363 C  C     . SER A 1 296 ? -39.060 -14.904 2.611   1.00 64.25  ? 315 SER A C     1 
ATOM   2364 O  O     . SER A 1 296 ? -37.890 -15.133 2.286   1.00 64.57  ? 315 SER A O     1 
ATOM   2365 C  CB    . SER A 1 296 ? -40.302 -17.072 2.562   1.00 69.53  ? 315 SER A CB    1 
ATOM   2366 O  OG    . SER A 1 296 ? -41.450 -16.693 1.822   1.00 63.70  ? 315 SER A OG    1 
ATOM   2367 N  N     . ASN A 1 297 ? -39.701 -13.795 2.261   1.00 69.11  ? 316 ASN A N     1 
ATOM   2368 C  CA    . ASN A 1 297 ? -39.098 -12.710 1.506   1.00 65.63  ? 316 ASN A CA    1 
ATOM   2369 C  C     . ASN A 1 297 ? -38.514 -11.623 2.401   1.00 60.16  ? 316 ASN A C     1 
ATOM   2370 O  O     . ASN A 1 297 ? -37.896 -10.686 1.886   1.00 60.99  ? 316 ASN A O     1 
ATOM   2371 C  CB    . ASN A 1 297 ? -40.144 -12.094 0.573   1.00 61.28  ? 316 ASN A CB    1 
ATOM   2372 C  CG    . ASN A 1 297 ? -39.734 -12.150 -0.878  1.00 63.89  ? 316 ASN A CG    1 
ATOM   2373 O  OD1   . ASN A 1 297 ? -38.585 -12.456 -1.197  1.00 67.55  ? 316 ASN A OD1   1 
ATOM   2374 N  ND2   . ASN A 1 297 ? -40.670 -11.844 -1.769  1.00 53.73  ? 316 ASN A ND2   1 
ATOM   2375 N  N     . SER A 1 298 ? -38.695 -11.731 3.716   1.00 62.07  ? 317 SER A N     1 
ATOM   2376 C  CA    . SER A 1 298 ? -38.365 -10.645 4.632   1.00 61.24  ? 317 SER A CA    1 
ATOM   2377 C  C     . SER A 1 298 ? -36.895 -10.258 4.537   1.00 61.66  ? 317 SER A C     1 
ATOM   2378 O  O     . SER A 1 298 ? -36.007 -11.115 4.553   1.00 64.40  ? 317 SER A O     1 
ATOM   2379 C  CB    . SER A 1 298 ? -38.706 -11.048 6.067   1.00 65.08  ? 317 SER A CB    1 
ATOM   2380 O  OG    . SER A 1 298 ? -38.363 -10.027 6.988   1.00 66.31  ? 317 SER A OG    1 
ATOM   2381 N  N     . LEU A 1 299 ? -36.647 -8.951  4.434   1.00 58.63  ? 318 LEU A N     1 
ATOM   2382 C  CA    . LEU A 1 299 ? -35.293 -8.421  4.478   1.00 57.64  ? 318 LEU A CA    1 
ATOM   2383 C  C     . LEU A 1 299 ? -34.790 -8.266  5.906   1.00 57.80  ? 318 LEU A C     1 
ATOM   2384 O  O     . LEU A 1 299 ? -33.574 -8.201  6.120   1.00 60.36  ? 318 LEU A O     1 
ATOM   2385 C  CB    . LEU A 1 299 ? -35.228 -7.072  3.753   1.00 58.12  ? 318 LEU A CB    1 
ATOM   2386 C  CG    . LEU A 1 299 ? -35.609 -7.035  2.268   1.00 62.01  ? 318 LEU A CG    1 
ATOM   2387 C  CD1   . LEU A 1 299 ? -37.119 -6.948  2.057   1.00 58.12  ? 318 LEU A CD1   1 
ATOM   2388 C  CD2   . LEU A 1 299 ? -34.915 -5.884  1.568   1.00 55.78  ? 318 LEU A CD2   1 
ATOM   2389 N  N     . VAL A 1 300 ? -35.695 -8.208  6.876   1.00 53.11  ? 319 VAL A N     1 
ATOM   2390 C  CA    . VAL A 1 300 ? -35.337 -8.185  8.288   1.00 55.50  ? 319 VAL A CA    1 
ATOM   2391 C  C     . VAL A 1 300 ? -35.188 -9.623  8.766   1.00 65.62  ? 319 VAL A C     1 
ATOM   2392 O  O     . VAL A 1 300 ? -36.146 -10.400 8.729   1.00 62.53  ? 319 VAL A O     1 
ATOM   2393 C  CB    . VAL A 1 300 ? -36.394 -7.441  9.115   1.00 51.19  ? 319 VAL A CB    1 
ATOM   2394 C  CG1   . VAL A 1 300 ? -36.181 -7.699  10.600  1.00 56.14  ? 319 VAL A CG1   1 
ATOM   2395 C  CG2   . VAL A 1 300 ? -36.356 -5.953  8.808   1.00 53.30  ? 319 VAL A CG2   1 
ATOM   2396 N  N     . GLU A 1 301 ? -33.985 -9.980  9.210   1.00 67.26  ? 320 GLU A N     1 
ATOM   2397 C  CA    . GLU A 1 301 ? -33.742 -11.302 9.757   1.00 65.52  ? 320 GLU A CA    1 
ATOM   2398 C  C     . GLU A 1 301 ? -32.999 -11.182 11.080  1.00 67.70  ? 320 GLU A C     1 
ATOM   2399 O  O     . GLU A 1 301 ? -32.154 -10.290 11.238  1.00 68.84  ? 320 GLU A O     1 
ATOM   2400 C  CB    . GLU A 1 301 ? -32.932 -12.167 8.782   1.00 64.68  ? 320 GLU A CB    1 
ATOM   2401 C  CG    . GLU A 1 301 ? -33.658 -12.497 7.487   1.00 70.84  ? 320 GLU A CG    1 
ATOM   2402 C  CD    . GLU A 1 301 ? -34.851 -13.419 7.689   1.00 74.55  ? 320 GLU A CD    1 
ATOM   2403 O  OE1   . GLU A 1 301 ? -35.660 -13.552 6.745   1.00 75.10  ? 320 GLU A OE1   1 
ATOM   2404 O  OE2   . GLU A 1 301 ? -34.980 -14.012 8.782   1.00 77.57  ? 320 GLU A OE2   1 
ATOM   2405 N  N     . PRO A 1 302 ? -33.292 -12.054 12.045  1.00 72.40  ? 321 PRO A N     1 
ATOM   2406 C  CA    . PRO A 1 302 ? -32.575 -12.001 13.325  1.00 67.19  ? 321 PRO A CA    1 
ATOM   2407 C  C     . PRO A 1 302 ? -31.085 -12.218 13.119  1.00 61.78  ? 321 PRO A C     1 
ATOM   2408 O  O     . PRO A 1 302 ? -30.663 -13.036 12.300  1.00 69.30  ? 321 PRO A O     1 
ATOM   2409 C  CB    . PRO A 1 302 ? -33.207 -13.137 14.137  1.00 67.71  ? 321 PRO A CB    1 
ATOM   2410 C  CG    . PRO A 1 302 ? -33.819 -14.049 13.117  1.00 67.62  ? 321 PRO A CG    1 
ATOM   2411 C  CD    . PRO A 1 302 ? -34.267 -13.158 11.998  1.00 70.71  ? 321 PRO A CD    1 
ATOM   2412 N  N     . SER A 1 303 ? -30.288 -11.465 13.864  1.00 64.97  ? 322 SER A N     1 
ATOM   2413 C  CA    . SER A 1 303 ? -28.840 -11.483 13.724  1.00 67.48  ? 322 SER A CA    1 
ATOM   2414 C  C     . SER A 1 303 ? -28.203 -12.181 14.922  1.00 58.34  ? 322 SER A C     1 
ATOM   2415 O  O     . SER A 1 303 ? -28.881 -12.596 15.867  1.00 55.34  ? 322 SER A O     1 
ATOM   2416 C  CB    . SER A 1 303 ? -28.306 -10.059 13.558  1.00 70.99  ? 322 SER A CB    1 
ATOM   2417 O  OG    . SER A 1 303 ? -29.106 -9.130  14.271  1.00 73.36  ? 322 SER A OG    1 
ATOM   2418 N  N     . SER A 1 304 ? -26.879 -12.310 14.863  1.00 67.97  ? 323 SER A N     1 
ATOM   2419 C  CA    . SER A 1 304 ? -26.128 -12.979 15.916  1.00 59.42  ? 323 SER A CA    1 
ATOM   2420 C  C     . SER A 1 304 ? -26.354 -12.299 17.260  1.00 63.58  ? 323 SER A C     1 
ATOM   2421 O  O     . SER A 1 304 ? -26.654 -11.105 17.339  1.00 68.02  ? 323 SER A O     1 
ATOM   2422 C  CB    . SER A 1 304 ? -24.635 -12.972 15.588  1.00 60.67  ? 323 SER A CB    1 
ATOM   2423 O  OG    . SER A 1 304 ? -24.395 -13.401 14.260  1.00 65.10  ? 323 SER A OG    1 
ATOM   2424 N  N     . VAL A 1 305 ? -26.210 -13.080 18.332  1.00 67.17  ? 324 VAL A N     1 
ATOM   2425 C  CA    . VAL A 1 305 ? -26.192 -12.482 19.660  1.00 63.87  ? 324 VAL A CA    1 
ATOM   2426 C  C     . VAL A 1 305 ? -24.939 -11.635 19.834  1.00 63.67  ? 324 VAL A C     1 
ATOM   2427 O  O     . VAL A 1 305 ? -24.970 -10.603 20.512  1.00 67.51  ? 324 VAL A O     1 
ATOM   2428 C  CB    . VAL A 1 305 ? -26.302 -13.572 20.742  1.00 66.73  ? 324 VAL A CB    1 
ATOM   2429 C  CG1   . VAL A 1 305 ? -27.673 -14.226 20.693  1.00 62.76  ? 324 VAL A CG1   1 
ATOM   2430 C  CG2   . VAL A 1 305 ? -25.212 -14.616 20.559  1.00 62.06  ? 324 VAL A CG2   1 
ATOM   2431 N  N     . GLU A 1 306 ? -23.828 -12.043 19.216  1.00 62.13  ? 325 GLU A N     1 
ATOM   2432 C  CA    . GLU A 1 306 ? -22.602 -11.251 19.256  1.00 67.54  ? 325 GLU A CA    1 
ATOM   2433 C  C     . GLU A 1 306 ? -22.813 -9.890  18.603  1.00 64.82  ? 325 GLU A C     1 
ATOM   2434 O  O     . GLU A 1 306 ? -22.491 -8.841  19.185  1.00 60.94  ? 325 GLU A O     1 
ATOM   2435 C  CB    . GLU A 1 306 ? -21.478 -12.015 18.549  1.00 65.94  ? 325 GLU A CB    1 
ATOM   2436 C  CG    . GLU A 1 306 ? -20.183 -12.162 19.338  1.00 72.45  ? 325 GLU A CG    1 
ATOM   2437 C  CD    . GLU A 1 306 ? -19.090 -12.847 18.530  1.00 81.26  ? 325 GLU A CD    1 
ATOM   2438 O  OE1   . GLU A 1 306 ? -19.332 -13.163 17.343  1.00 78.13  ? 325 GLU A OE1   1 
ATOM   2439 O  OE2   . GLU A 1 306 ? -17.989 -13.069 19.079  1.00 83.92  ? 325 GLU A OE2   1 
ATOM   2440 N  N     . ASP A 1 307 ? -23.347 -9.897  17.377  1.00 61.90  ? 326 ASP A N     1 
ATOM   2441 C  CA    . ASP A 1 307 ? -23.580 -8.656  16.649  1.00 58.03  ? 326 ASP A CA    1 
ATOM   2442 C  C     . ASP A 1 307 ? -24.515 -7.731  17.418  1.00 54.33  ? 326 ASP A C     1 
ATOM   2443 O  O     . ASP A 1 307 ? -24.243 -6.530  17.544  1.00 54.87  ? 326 ASP A O     1 
ATOM   2444 C  CB    . ASP A 1 307 ? -24.136 -8.968  15.259  1.00 57.91  ? 326 ASP A CB    1 
ATOM   2445 C  CG    . ASP A 1 307 ? -23.105 -9.626  14.353  1.00 65.70  ? 326 ASP A CG    1 
ATOM   2446 O  OD1   . ASP A 1 307 ? -21.929 -9.726  14.764  1.00 62.63  ? 326 ASP A OD1   1 
ATOM   2447 O  OD2   . ASP A 1 307 ? -23.465 -10.037 13.228  1.00 64.07  ? 326 ASP A OD2   1 
ATOM   2448 N  N     . TRP A 1 308 ? -25.611 -8.271  17.958  1.00 51.95  ? 327 TRP A N     1 
ATOM   2449 C  CA    . TRP A 1 308 ? -26.525 -7.408  18.696  1.00 53.50  ? 327 TRP A CA    1 
ATOM   2450 C  C     . TRP A 1 308 ? -25.922 -6.933  20.010  1.00 58.80  ? 327 TRP A C     1 
ATOM   2451 O  O     . TRP A 1 308 ? -26.249 -5.839  20.469  1.00 61.14  ? 327 TRP A O     1 
ATOM   2452 C  CB    . TRP A 1 308 ? -27.857 -8.100  18.971  1.00 48.35  ? 327 TRP A CB    1 
ATOM   2453 C  CG    . TRP A 1 308 ? -28.711 -7.267  19.890  1.00 55.05  ? 327 TRP A CG    1 
ATOM   2454 C  CD1   . TRP A 1 308 ? -29.140 -7.599  21.141  1.00 56.67  ? 327 TRP A CD1   1 
ATOM   2455 C  CD2   . TRP A 1 308 ? -29.186 -5.933  19.646  1.00 57.82  ? 327 TRP A CD2   1 
ATOM   2456 N  NE1   . TRP A 1 308 ? -29.872 -6.567  21.682  1.00 61.68  ? 327 TRP A NE1   1 
ATOM   2457 C  CE2   . TRP A 1 308 ? -29.914 -5.534  20.785  1.00 56.22  ? 327 TRP A CE2   1 
ATOM   2458 C  CE3   . TRP A 1 308 ? -29.079 -5.046  18.569  1.00 55.53  ? 327 TRP A CE3   1 
ATOM   2459 C  CZ2   . TRP A 1 308 ? -30.530 -4.288  20.878  1.00 54.88  ? 327 TRP A CZ2   1 
ATOM   2460 C  CZ3   . TRP A 1 308 ? -29.686 -3.809  18.666  1.00 50.48  ? 327 TRP A CZ3   1 
ATOM   2461 C  CH2   . TRP A 1 308 ? -30.404 -3.442  19.810  1.00 53.95  ? 327 TRP A CH2   1 
ATOM   2462 N  N     . GLN A 1 309 ? -25.055 -7.728  20.640  1.00 61.78  ? 328 GLN A N     1 
ATOM   2463 C  CA    . GLN A 1 309 ? -24.399 -7.252  21.853  1.00 58.41  ? 328 GLN A CA    1 
ATOM   2464 C  C     . GLN A 1 309 ? -23.504 -6.061  21.549  1.00 56.34  ? 328 GLN A C     1 
ATOM   2465 O  O     . GLN A 1 309 ? -23.508 -5.061  22.283  1.00 58.91  ? 328 GLN A O     1 
ATOM   2466 C  CB    . GLN A 1 309 ? -23.605 -8.384  22.502  1.00 62.02  ? 328 GLN A CB    1 
ATOM   2467 C  CG    . GLN A 1 309 ? -24.305 -9.010  23.697  1.00 64.27  ? 328 GLN A CG    1 
ATOM   2468 C  CD    . GLN A 1 309 ? -25.785 -9.239  23.449  1.00 71.21  ? 328 GLN A CD    1 
ATOM   2469 O  OE1   . GLN A 1 309 ? -26.636 -8.649  24.118  1.00 70.30  ? 328 GLN A OE1   1 
ATOM   2470 N  NE2   . GLN A 1 309 ? -26.099 -10.098 22.486  1.00 68.74  ? 328 GLN A NE2   1 
ATOM   2471 N  N     . VAL A 1 310 ? -22.743 -6.145  20.456  1.00 54.40  ? 329 VAL A N     1 
ATOM   2472 C  CA    . VAL A 1 310 ? -21.960 -4.993  20.011  1.00 58.80  ? 329 VAL A CA    1 
ATOM   2473 C  C     . VAL A 1 310 ? -22.873 -3.793  19.769  1.00 58.69  ? 329 VAL A C     1 
ATOM   2474 O  O     . VAL A 1 310 ? -22.622 -2.684  20.265  1.00 57.05  ? 329 VAL A O     1 
ATOM   2475 C  CB    . VAL A 1 310 ? -21.151 -5.348  18.751  1.00 59.61  ? 329 VAL A CB    1 
ATOM   2476 C  CG1   . VAL A 1 310 ? -20.372 -4.136  18.266  1.00 59.17  ? 329 VAL A CG1   1 
ATOM   2477 C  CG2   . VAL A 1 310 ? -20.216 -6.513  19.032  1.00 60.97  ? 329 VAL A CG2   1 
ATOM   2478 N  N     . CYS A 1 311 ? -23.955 -4.006  19.012  1.00 54.61  ? 330 CYS A N     1 
ATOM   2479 C  CA    . CYS A 1 311 ? -24.872 -2.914  18.694  1.00 52.07  ? 330 CYS A CA    1 
ATOM   2480 C  C     . CYS A 1 311 ? -25.450 -2.284  19.955  1.00 51.78  ? 330 CYS A C     1 
ATOM   2481 O  O     . CYS A 1 311 ? -25.550 -1.058  20.051  1.00 53.52  ? 330 CYS A O     1 
ATOM   2482 C  CB    . CYS A 1 311 ? -26.000 -3.413  17.786  1.00 46.08  ? 330 CYS A CB    1 
ATOM   2483 S  SG    . CYS A 1 311 ? -25.494 -3.884  16.109  1.00 50.62  ? 330 CYS A SG    1 
ATOM   2484 N  N     . ALA A 1 312 ? -25.834 -3.105  20.932  1.00 49.89  ? 331 ALA A N     1 
ATOM   2485 C  CA    . ALA A 1 312 ? -26.496 -2.592  22.126  1.00 55.44  ? 331 ALA A CA    1 
ATOM   2486 C  C     . ALA A 1 312 ? -25.528 -1.810  23.002  1.00 53.94  ? 331 ALA A C     1 
ATOM   2487 O  O     . ALA A 1 312 ? -25.871 -0.729  23.505  1.00 59.16  ? 331 ALA A O     1 
ATOM   2488 C  CB    . ALA A 1 312 ? -27.125 -3.742  22.913  1.00 51.87  ? 331 ALA A CB    1 
ATOM   2489 N  N     . THR A 1 313 ? -24.314 -2.333  23.198  1.00 54.85  ? 332 THR A N     1 
ATOM   2490 C  CA    . THR A 1 313 ? -23.332 -1.578  23.967  1.00 61.29  ? 332 THR A CA    1 
ATOM   2491 C  C     . THR A 1 313 ? -23.011 -0.253  23.284  1.00 53.17  ? 332 THR A C     1 
ATOM   2492 O  O     . THR A 1 313 ? -22.856 0.775   23.954  1.00 56.22  ? 332 THR A O     1 
ATOM   2493 C  CB    . THR A 1 313 ? -22.063 -2.407  24.184  1.00 55.54  ? 332 THR A CB    1 
ATOM   2494 O  OG1   . THR A 1 313 ? -21.480 -2.744  22.920  1.00 61.62  ? 332 THR A OG1   1 
ATOM   2495 C  CG2   . THR A 1 313 ? -22.389 -3.683  24.950  1.00 56.08  ? 332 THR A CG2   1 
ATOM   2496 N  N     . TYR A 1 314 ? -22.932 -0.247  21.950  1.00 50.78  ? 333 TYR A N     1 
ATOM   2497 C  CA    . TYR A 1 314 ? -22.695 1.007   21.239  1.00 51.36  ? 333 TYR A CA    1 
ATOM   2498 C  C     . TYR A 1 314 ? -23.853 1.980   21.434  1.00 52.34  ? 333 TYR A C     1 
ATOM   2499 O  O     . TYR A 1 314 ? -23.647 3.140   21.812  1.00 49.77  ? 333 TYR A O     1 
ATOM   2500 C  CB    . TYR A 1 314 ? -22.472 0.734   19.754  1.00 53.49  ? 333 TYR A CB    1 
ATOM   2501 C  CG    . TYR A 1 314 ? -22.283 1.978   18.914  1.00 53.30  ? 333 TYR A CG    1 
ATOM   2502 C  CD1   . TYR A 1 314 ? -21.026 2.547   18.757  1.00 47.69  ? 333 TYR A CD1   1 
ATOM   2503 C  CD2   . TYR A 1 314 ? -23.360 2.578   18.267  1.00 52.59  ? 333 TYR A CD2   1 
ATOM   2504 C  CE1   . TYR A 1 314 ? -20.845 3.680   17.984  1.00 49.81  ? 333 TYR A CE1   1 
ATOM   2505 C  CE2   . TYR A 1 314 ? -23.188 3.710   17.492  1.00 44.69  ? 333 TYR A CE2   1 
ATOM   2506 C  CZ    . TYR A 1 314 ? -21.930 4.256   17.356  1.00 49.70  ? 333 TYR A CZ    1 
ATOM   2507 O  OH    . TYR A 1 314 ? -21.755 5.381   16.588  1.00 47.75  ? 333 TYR A OH    1 
ATOM   2508 N  N     . LEU A 1 315 ? -25.084 1.520   21.188  1.00 49.31  ? 334 LEU A N     1 
ATOM   2509 C  CA    . LEU A 1 315 ? -26.253 2.391   21.244  1.00 46.42  ? 334 LEU A CA    1 
ATOM   2510 C  C     . LEU A 1 315 ? -26.578 2.854   22.653  1.00 47.44  ? 334 LEU A C     1 
ATOM   2511 O  O     . LEU A 1 315 ? -27.400 3.763   22.813  1.00 40.46  ? 334 LEU A O     1 
ATOM   2512 C  CB    . LEU A 1 315 ? -27.484 1.689   20.675  1.00 44.79  ? 334 LEU A CB    1 
ATOM   2513 C  CG    . LEU A 1 315 ? -27.554 1.441   19.173  1.00 46.59  ? 334 LEU A CG    1 
ATOM   2514 C  CD1   . LEU A 1 315 ? -28.914 0.854   18.838  1.00 57.08  ? 334 LEU A CD1   1 
ATOM   2515 C  CD2   . LEU A 1 315 ? -27.309 2.727   18.409  1.00 45.96  ? 334 LEU A CD2   1 
ATOM   2516 N  N     . ARG A 1 316 ? -25.988 2.232   23.676  1.00 49.03  ? 335 ARG A N     1 
ATOM   2517 C  CA    . ARG A 1 316 ? -26.218 2.713   25.034  1.00 49.51  ? 335 ARG A CA    1 
ATOM   2518 C  C     . ARG A 1 316 ? -25.916 4.203   25.162  1.00 44.26  ? 335 ARG A C     1 
ATOM   2519 O  O     . ARG A 1 316 ? -26.544 4.899   25.969  1.00 48.27  ? 335 ARG A O     1 
ATOM   2520 C  CB    . ARG A 1 316 ? -25.379 1.912   26.031  1.00 54.78  ? 335 ARG A CB    1 
ATOM   2521 C  CG    . ARG A 1 316 ? -25.742 2.193   27.480  1.00 61.36  ? 335 ARG A CG    1 
ATOM   2522 C  CD    . ARG A 1 316 ? -24.711 1.651   28.454  1.00 66.66  ? 335 ARG A CD    1 
ATOM   2523 N  NE    . ARG A 1 316 ? -25.008 2.065   29.824  1.00 75.31  ? 335 ARG A NE    1 
ATOM   2524 C  CZ    . ARG A 1 316 ? -24.559 3.185   30.386  1.00 77.21  ? 335 ARG A CZ    1 
ATOM   2525 N  NH1   . ARG A 1 316 ? -23.782 4.013   29.699  1.00 63.95  ? 335 ARG A NH1   1 
ATOM   2526 N  NH2   . ARG A 1 316 ? -24.884 3.475   31.640  1.00 80.40  ? 335 ARG A NH2   1 
ATOM   2527 N  N     . THR A 1 317 ? -24.979 4.719   24.367  1.00 38.10  ? 336 THR A N     1 
ATOM   2528 C  CA    . THR A 1 317 ? -24.604 6.129   24.428  1.00 47.12  ? 336 THR A CA    1 
ATOM   2529 C  C     . THR A 1 317 ? -24.475 6.718   23.028  1.00 47.85  ? 336 THR A C     1 
ATOM   2530 O  O     . THR A 1 317 ? -23.556 7.494   22.748  1.00 49.03  ? 336 THR A O     1 
ATOM   2531 C  CB    . THR A 1 317 ? -23.291 6.324   25.188  1.00 42.81  ? 336 THR A CB    1 
ATOM   2532 O  OG1   . THR A 1 317 ? -22.244 5.620   24.512  1.00 39.68  ? 336 THR A OG1   1 
ATOM   2533 C  CG2   . THR A 1 317 ? -23.399 5.818   26.621  1.00 43.39  ? 336 THR A CG2   1 
ATOM   2534 N  N     . ALA A 1 318 ? -25.389 6.372   22.124  1.00 47.07  ? 337 ALA A N     1 
ATOM   2535 C  CA    . ALA A 1 318 ? -25.250 6.839   20.752  1.00 45.62  ? 337 ALA A CA    1 
ATOM   2536 C  C     . ALA A 1 318 ? -26.613 6.987   20.094  1.00 46.41  ? 337 ALA A C     1 
ATOM   2537 O  O     . ALA A 1 318 ? -27.620 6.443   20.558  1.00 44.53  ? 337 ALA A O     1 
ATOM   2538 C  CB    . ALA A 1 318 ? -24.367 5.895   19.929  1.00 38.68  ? 337 ALA A CB    1 
ATOM   2539 N  N     . ARG A 1 319 ? -26.624 7.750   19.003  1.00 39.23  ? 338 ARG A N     1 
ATOM   2540 C  CA    . ARG A 1 319 ? -27.778 7.859   18.120  1.00 37.68  ? 338 ARG A CA    1 
ATOM   2541 C  C     . ARG A 1 319 ? -27.310 7.708   16.682  1.00 40.04  ? 338 ARG A C     1 
ATOM   2542 O  O     . ARG A 1 319 ? -26.241 8.204   16.313  1.00 35.99  ? 338 ARG A O     1 
ATOM   2543 C  CB    . ARG A 1 319 ? -28.520 9.198   18.290  1.00 38.64  ? 338 ARG A CB    1 
ATOM   2544 C  CG    . ARG A 1 319 ? -29.861 9.243   17.558  1.00 39.50  ? 338 ARG A CG    1 
ATOM   2545 C  CD    . ARG A 1 319 ? -30.577 10.575  17.727  1.00 29.76  ? 338 ARG A CD    1 
ATOM   2546 N  NE    . ARG A 1 319 ? -29.977 11.629  16.912  1.00 38.02  ? 338 ARG A NE    1 
ATOM   2547 C  CZ    . ARG A 1 319 ? -30.325 11.899  15.656  1.00 38.85  ? 338 ARG A CZ    1 
ATOM   2548 N  NH1   . ARG A 1 319 ? -29.720 12.874  14.996  1.00 34.82  ? 338 ARG A NH1   1 
ATOM   2549 N  NH2   . ARG A 1 319 ? -31.277 11.194  15.056  1.00 36.86  ? 338 ARG A NH2   1 
ATOM   2550 N  N     . VAL A 1 320 ? -28.100 7.008   15.873  1.00 35.41  ? 339 VAL A N     1 
ATOM   2551 C  CA    . VAL A 1 320 ? -27.797 6.802   14.464  1.00 34.84  ? 339 VAL A CA    1 
ATOM   2552 C  C     . VAL A 1 320 ? -28.907 7.435   13.640  1.00 37.95  ? 339 VAL A C     1 
ATOM   2553 O  O     . VAL A 1 320 ? -30.088 7.327   13.988  1.00 33.40  ? 339 VAL A O     1 
ATOM   2554 C  CB    . VAL A 1 320 ? -27.647 5.306   14.123  1.00 37.01  ? 339 VAL A CB    1 
ATOM   2555 C  CG1   . VAL A 1 320 ? -27.266 5.128   12.663  1.00 34.94  ? 339 VAL A CG1   1 
ATOM   2556 C  CG2   . VAL A 1 320 ? -26.613 4.661   15.032  1.00 40.70  ? 339 VAL A CG2   1 
ATOM   2557 N  N     . ASN A 1 321 ? -28.527 8.102   12.554  1.00 36.18  ? 340 ASN A N     1 
ATOM   2558 C  CA    . ASN A 1 321 ? -29.482 8.747   11.669  1.00 35.57  ? 340 ASN A CA    1 
ATOM   2559 C  C     . ASN A 1 321 ? -29.221 8.322   10.232  1.00 33.67  ? 340 ASN A C     1 
ATOM   2560 O  O     . ASN A 1 321 ? -28.067 8.229   9.802   1.00 33.77  ? 340 ASN A O     1 
ATOM   2561 C  CB    . ASN A 1 321 ? -29.402 10.273  11.792  1.00 28.95  ? 340 ASN A CB    1 
ATOM   2562 C  CG    . ASN A 1 321 ? -30.669 10.954  11.327  1.00 38.18  ? 340 ASN A CG    1 
ATOM   2563 O  OD1   . ASN A 1 321 ? -31.636 11.070  12.081  1.00 35.62  ? 340 ASN A OD1   1 
ATOM   2564 N  ND2   . ASN A 1 321 ? -30.675 11.405  10.075  1.00 31.88  ? 340 ASN A ND2   1 
ATOM   2565 N  N     . MET A 1 322 ? -30.301 8.067   9.497   1.00 35.11  ? 341 MET A N     1 
ATOM   2566 C  CA    . MET A 1 322 ? -30.251 7.760   8.072   1.00 34.13  ? 341 MET A CA    1 
ATOM   2567 C  C     . MET A 1 322 ? -31.012 8.835   7.312   1.00 34.21  ? 341 MET A C     1 
ATOM   2568 O  O     . MET A 1 322 ? -32.156 9.146   7.654   1.00 35.76  ? 341 MET A O     1 
ATOM   2569 C  CB    . MET A 1 322 ? -30.863 6.385   7.766   1.00 30.54  ? 341 MET A CB    1 
ATOM   2570 C  CG    . MET A 1 322 ? -30.404 5.245   8.670   1.00 37.33  ? 341 MET A CG    1 
ATOM   2571 S  SD    . MET A 1 322 ? -30.876 3.627   8.009   1.00 47.90  ? 341 MET A SD    1 
ATOM   2572 C  CE    . MET A 1 322 ? -32.663 3.716   8.094   1.00 41.37  ? 341 MET A CE    1 
ATOM   2573 N  N     . THR A 1 323 ? -30.390 9.395   6.282   1.00 34.21  ? 342 THR A N     1 
ATOM   2574 C  CA    . THR A 1 323 ? -31.011 10.407  5.439   1.00 34.11  ? 342 THR A CA    1 
ATOM   2575 C  C     . THR A 1 323 ? -30.970 9.920   4.001   1.00 34.59  ? 342 THR A C     1 
ATOM   2576 O  O     . THR A 1 323 ? -29.914 9.504   3.518   1.00 34.38  ? 342 THR A O     1 
ATOM   2577 C  CB    . THR A 1 323 ? -30.295 11.757  5.562   1.00 36.71  ? 342 THR A CB    1 
ATOM   2578 O  OG1   . THR A 1 323 ? -30.381 12.227  6.914   1.00 36.58  ? 342 THR A OG1   1 
ATOM   2579 C  CG2   . THR A 1 323 ? -30.927 12.778  4.640   1.00 32.64  ? 342 THR A CG2   1 
ATOM   2580 N  N     . VAL A 1 324 ? -32.114 9.978   3.325   1.00 33.92  ? 343 VAL A N     1 
ATOM   2581 C  CA    . VAL A 1 324 ? -32.288 9.389   2.004   1.00 35.94  ? 343 VAL A CA    1 
ATOM   2582 C  C     . VAL A 1 324 ? -32.941 10.411  1.082   1.00 32.86  ? 343 VAL A C     1 
ATOM   2583 O  O     . VAL A 1 324 ? -33.965 11.008  1.436   1.00 33.87  ? 343 VAL A O     1 
ATOM   2584 C  CB    . VAL A 1 324 ? -33.133 8.102   2.072   1.00 41.83  ? 343 VAL A CB    1 
ATOM   2585 C  CG1   . VAL A 1 324 ? -33.476 7.617   0.682   1.00 35.39  ? 343 VAL A CG1   1 
ATOM   2586 C  CG2   . VAL A 1 324 ? -32.390 7.023   2.852   1.00 43.53  ? 343 VAL A CG2   1 
ATOM   2587 N  N     . ARG A 1 325 ? -32.350 10.594  -0.104  1.00 36.31  ? 344 ARG A N     1 
ATOM   2588 C  CA    . ARG A 1 325 ? -32.814 11.525  -1.122  1.00 35.27  ? 344 ARG A CA    1 
ATOM   2589 C  C     . ARG A 1 325 ? -32.841 10.841  -2.483  1.00 39.68  ? 344 ARG A C     1 
ATOM   2590 O  O     . ARG A 1 325 ? -32.094 9.889   -2.740  1.00 40.55  ? 344 ARG A O     1 
ATOM   2591 C  CB    . ARG A 1 325 ? -31.900 12.758  -1.250  1.00 34.42  ? 344 ARG A CB    1 
ATOM   2592 C  CG    . ARG A 1 325 ? -31.842 13.720  -0.080  1.00 36.00  ? 344 ARG A CG    1 
ATOM   2593 C  CD    . ARG A 1 325 ? -30.812 14.814  -0.407  1.00 36.82  ? 344 ARG A CD    1 
ATOM   2594 N  NE    . ARG A 1 325 ? -30.910 15.998  0.446   1.00 37.33  ? 344 ARG A NE    1 
ATOM   2595 C  CZ    . ARG A 1 325 ? -30.284 16.136  1.612   1.00 45.09  ? 344 ARG A CZ    1 
ATOM   2596 N  NH1   . ARG A 1 325 ? -30.429 17.254  2.313   1.00 41.16  ? 344 ARG A NH1   1 
ATOM   2597 N  NH2   . ARG A 1 325 ? -29.519 15.157  2.082   1.00 32.30  ? 344 ARG A NH2   1 
ATOM   2598 N  N     . GLN A 1 326 ? -33.690 11.363  -3.364  1.00 36.14  ? 345 GLN A N     1 
ATOM   2599 C  CA    . GLN A 1 326 ? -33.642 11.060  -4.789  1.00 41.63  ? 345 GLN A CA    1 
ATOM   2600 C  C     . GLN A 1 326 ? -33.040 12.262  -5.508  1.00 40.10  ? 345 GLN A C     1 
ATOM   2601 O  O     . GLN A 1 326 ? -33.534 13.385  -5.367  1.00 41.66  ? 345 GLN A O     1 
ATOM   2602 C  CB    . GLN A 1 326 ? -35.034 10.744  -5.337  1.00 42.53  ? 345 GLN A CB    1 
ATOM   2603 C  CG    . GLN A 1 326 ? -35.069 10.516  -6.844  1.00 44.20  ? 345 GLN A CG    1 
ATOM   2604 C  CD    . GLN A 1 326 ? -36.399 9.960   -7.335  1.00 43.97  ? 345 GLN A CD    1 
ATOM   2605 O  OE1   . GLN A 1 326 ? -37.234 9.514   -6.547  1.00 40.24  ? 345 GLN A OE1   1 
ATOM   2606 N  NE2   . GLN A 1 326 ? -36.598 9.985   -8.648  1.00 49.14  ? 345 GLN A NE2   1 
ATOM   2607 N  N     . VAL A 1 327 ? -31.976 12.033  -6.269  1.00 41.14  ? 346 VAL A N     1 
ATOM   2608 C  CA    . VAL A 1 327 ? -31.267 13.128  -6.916  1.00 55.19  ? 346 VAL A CA    1 
ATOM   2609 C  C     . VAL A 1 327 ? -31.423 13.130  -8.432  1.00 53.16  ? 346 VAL A C     1 
ATOM   2610 O  O     . VAL A 1 327 ? -31.149 14.164  -9.060  1.00 58.59  ? 346 VAL A O     1 
ATOM   2611 C  CB    . VAL A 1 327 ? -29.773 13.129  -6.534  1.00 49.95  ? 346 VAL A CB    1 
ATOM   2612 C  CG1   . VAL A 1 327 ? -29.616 13.364  -5.040  1.00 46.97  ? 346 VAL A CG1   1 
ATOM   2613 C  CG2   . VAL A 1 327 ? -29.112 11.823  -6.950  1.00 54.45  ? 346 VAL A CG2   1 
ATOM   2614 N  N     . LEU A 1 328 ? -31.859 12.029  -9.036  1.00 53.36  ? 347 LEU A N     1 
ATOM   2615 C  CA    . LEU A 1 328 ? -32.046 11.941  -10.477 1.00 57.68  ? 347 LEU A CA    1 
ATOM   2616 C  C     . LEU A 1 328 ? -33.528 11.861  -10.815 1.00 53.27  ? 347 LEU A C     1 
ATOM   2617 O  O     . LEU A 1 328 ? -34.295 11.173  -10.134 1.00 55.76  ? 347 LEU A O     1 
ATOM   2618 C  CB    . LEU A 1 328 ? -31.323 10.721  -11.052 1.00 63.49  ? 347 LEU A CB    1 
ATOM   2619 C  CG    . LEU A 1 328 ? -29.811 10.861  -11.233 1.00 73.50  ? 347 LEU A CG    1 
ATOM   2620 C  CD1   . LEU A 1 328 ? -29.185 9.519   -11.582 1.00 70.97  ? 347 LEU A CD1   1 
ATOM   2621 C  CD2   . LEU A 1 328 ? -29.508 11.895  -12.306 1.00 69.67  ? 347 LEU A CD2   1 
ATOM   2622 N  N     . ALA A 1 329 ? -33.920 12.561  -11.876 1.00 54.27  ? 348 ALA A N     1 
ATOM   2623 C  CA    . ALA A 1 329 ? -35.294 12.494  -12.346 1.00 60.25  ? 348 ALA A CA    1 
ATOM   2624 C  C     . ALA A 1 329 ? -35.642 11.071  -12.761 1.00 61.52  ? 348 ALA A C     1 
ATOM   2625 O  O     . ALA A 1 329 ? -34.772 10.270  -13.113 1.00 66.48  ? 348 ALA A O     1 
ATOM   2626 C  CB    . ALA A 1 329 ? -35.509 13.448  -13.522 1.00 59.10  ? 348 ALA A CB    1 
ATOM   2627 N  N     . THR A 1 330 ? -36.933 10.761  -12.712 1.00 64.80  ? 349 THR A N     1 
ATOM   2628 C  CA    . THR A 1 330 ? -37.399 9.425   -13.055 1.00 73.42  ? 349 THR A CA    1 
ATOM   2629 C  C     . THR A 1 330 ? -37.037 9.089   -14.497 1.00 75.48  ? 349 THR A C     1 
ATOM   2630 O  O     . THR A 1 330 ? -37.465 9.771   -15.434 1.00 76.27  ? 349 THR A O     1 
ATOM   2631 C  CB    . THR A 1 330 ? -38.907 9.329   -12.836 1.00 74.99  ? 349 THR A CB    1 
ATOM   2632 O  OG1   . THR A 1 330 ? -39.185 9.411   -11.431 1.00 75.75  ? 349 THR A OG1   1 
ATOM   2633 C  CG2   . THR A 1 330 ? -39.449 8.017   -13.385 1.00 72.57  ? 349 THR A CG2   1 
ATOM   2634 N  N     . GLY A 1 331 ? -36.224 8.048   -14.665 1.00 71.04  ? 350 GLY A N     1 
ATOM   2635 C  CA    . GLY A 1 331 ? -35.829 7.588   -15.980 1.00 75.54  ? 350 GLY A CA    1 
ATOM   2636 C  C     . GLY A 1 331 ? -34.444 8.049   -16.380 1.00 87.02  ? 350 GLY A C     1 
ATOM   2637 O  O     . GLY A 1 331 ? -33.607 7.243   -16.797 1.00 92.94  ? 350 GLY A O     1 
ATOM   2638 N  N     . GLN A 1 332 ? -34.191 9.348   -16.257 1.00 85.36  ? 351 GLN A N     1 
ATOM   2639 C  CA    . GLN A 1 332 ? -32.908 9.896   -16.670 1.00 85.99  ? 351 GLN A CA    1 
ATOM   2640 C  C     . GLN A 1 332 ? -31.797 9.409   -15.746 1.00 89.45  ? 351 GLN A C     1 
ATOM   2641 O  O     . GLN A 1 332 ? -31.970 9.326   -14.527 1.00 87.85  ? 351 GLN A O     1 
ATOM   2642 C  CB    . GLN A 1 332 ? -32.959 11.423  -16.677 1.00 89.24  ? 351 GLN A CB    1 
ATOM   2643 C  CG    . GLN A 1 332 ? -34.069 12.013  -17.536 1.00 87.61  ? 351 GLN A CG    1 
ATOM   2644 C  CD    . GLN A 1 332 ? -33.874 13.498  -17.790 1.00 99.44  ? 351 GLN A CD    1 
ATOM   2645 O  OE1   . GLN A 1 332 ? -34.152 14.331  -16.926 1.00 95.87  ? 351 GLN A OE1   1 
ATOM   2646 N  NE2   . GLN A 1 332 ? -33.383 13.835  -18.978 1.00 93.29  ? 351 GLN A NE2   1 
ATOM   2647 N  N     . ASP A 1 333 ? -30.655 9.067   -16.337 1.00 91.68  ? 352 ASP A N     1 
ATOM   2648 C  CA    . ASP A 1 333 ? -29.466 8.697   -15.589 1.00 91.95  ? 352 ASP A CA    1 
ATOM   2649 C  C     . ASP A 1 333 ? -28.565 9.927   -15.451 1.00 91.39  ? 352 ASP A C     1 
ATOM   2650 O  O     . ASP A 1 333 ? -29.037 11.068  -15.526 1.00 92.35  ? 352 ASP A O     1 
ATOM   2651 C  CB    . ASP A 1 333 ? -28.766 7.514   -16.274 1.00 96.56  ? 352 ASP A CB    1 
ATOM   2652 C  CG    . ASP A 1 333 ? -28.957 6.202   -15.523 1.00 96.81  ? 352 ASP A CG    1 
ATOM   2653 O  OD1   . ASP A 1 333 ? -30.018 5.562   -15.690 1.00 94.94  ? 352 ASP A OD1   1 
ATOM   2654 O  OD2   . ASP A 1 333 ? -28.044 5.808   -14.765 1.00 90.59  ? 352 ASP A OD2   1 
ATOM   2655 N  N     . PHE A 1 334 ? -27.267 9.710   -15.258 1.00 88.14  ? 353 PHE A N     1 
ATOM   2656 C  CA    . PHE A 1 334 ? -26.323 10.801  -15.012 1.00 90.97  ? 353 PHE A CA    1 
ATOM   2657 C  C     . PHE A 1 334 ? -25.310 10.907  -16.144 1.00 98.45  ? 353 PHE A C     1 
ATOM   2658 O  O     . PHE A 1 334 ? -24.299 10.182  -16.147 1.00 95.40  ? 353 PHE A O     1 
ATOM   2659 C  CB    . PHE A 1 334 ? -25.611 10.605  -13.674 1.00 88.35  ? 353 PHE A CB    1 
ATOM   2660 C  CG    . PHE A 1 334 ? -25.780 11.759  -12.729 1.00 83.37  ? 353 PHE A CG    1 
ATOM   2661 C  CD1   . PHE A 1 334 ? -25.656 13.063  -13.181 1.00 84.06  ? 353 PHE A CD1   1 
ATOM   2662 C  CD2   . PHE A 1 334 ? -26.082 11.544  -11.395 1.00 75.45  ? 353 PHE A CD2   1 
ATOM   2663 C  CE1   . PHE A 1 334 ? -25.817 14.131  -12.318 1.00 77.00  ? 353 PHE A CE1   1 
ATOM   2664 C  CE2   . PHE A 1 334 ? -26.247 12.607  -10.526 1.00 76.13  ? 353 PHE A CE2   1 
ATOM   2665 C  CZ    . PHE A 1 334 ? -26.115 13.902  -10.988 1.00 73.65  ? 353 PHE A CZ    1 
ATOM   2666 N  N     . PRO A 1 335 ? -25.531 11.795  -17.127 1.00 100.98 ? 354 PRO A N     1 
ATOM   2667 C  CA    . PRO A 1 335 ? -24.580 12.058  -18.208 1.00 97.82  ? 354 PRO A CA    1 
ATOM   2668 C  C     . PRO A 1 335 ? -23.731 13.301  -17.947 1.00 96.80  ? 354 PRO A C     1 
ATOM   2669 O  O     . PRO A 1 335 ? -24.024 14.042  -17.007 1.00 97.30  ? 354 PRO A O     1 
ATOM   2670 C  CB    . PRO A 1 335 ? -25.491 12.260  -19.423 1.00 98.21  ? 354 PRO A CB    1 
ATOM   2671 C  CG    . PRO A 1 335 ? -26.847 12.684  -18.840 1.00 95.60  ? 354 PRO A CG    1 
ATOM   2672 C  CD    . PRO A 1 335 ? -26.791 12.528  -17.336 1.00 95.02  ? 354 PRO A CD    1 
ATOM   2673 O  "O5'" . DG  B 2 1   ? -22.184 38.917  -6.582  1.00 81.31  ? 1   DG  B "O5'" 1 
ATOM   2674 C  "C5'" . DG  B 2 1   ? -20.806 38.553  -6.578  1.00 81.33  ? 1   DG  B "C5'" 1 
ATOM   2675 C  "C4'" . DG  B 2 1   ? -19.953 39.686  -6.039  1.00 75.41  ? 1   DG  B "C4'" 1 
ATOM   2676 O  "O4'" . DG  B 2 1   ? -20.727 40.453  -5.082  1.00 79.43  ? 1   DG  B "O4'" 1 
ATOM   2677 C  "C3'" . DG  B 2 1   ? -18.717 39.248  -5.271  1.00 77.72  ? 1   DG  B "C3'" 1 
ATOM   2678 O  "O3'" . DG  B 2 1   ? -17.764 40.304  -5.268  1.00 82.00  ? 1   DG  B "O3'" 1 
ATOM   2679 C  "C2'" . DG  B 2 1   ? -19.296 39.026  -3.881  1.00 71.95  ? 1   DG  B "C2'" 1 
ATOM   2680 C  "C1'" . DG  B 2 1   ? -20.219 40.232  -3.776  1.00 76.52  ? 1   DG  B "C1'" 1 
ATOM   2681 N  N9    . DG  B 2 1   ? -21.344 40.046  -2.865  1.00 63.41  ? 1   DG  B N9    1 
ATOM   2682 C  C8    . DG  B 2 1   ? -22.298 39.058  -2.912  1.00 61.84  ? 1   DG  B C8    1 
ATOM   2683 N  N7    . DG  B 2 1   ? -23.195 39.159  -1.969  1.00 65.13  ? 1   DG  B N7    1 
ATOM   2684 C  C5    . DG  B 2 1   ? -22.813 40.289  -1.256  1.00 57.76  ? 1   DG  B C5    1 
ATOM   2685 C  C6    . DG  B 2 1   ? -23.405 40.896  -0.123  1.00 61.83  ? 1   DG  B C6    1 
ATOM   2686 O  O6    . DG  B 2 1   ? -24.421 40.542  0.497   1.00 65.61  ? 1   DG  B O6    1 
ATOM   2687 N  N1    . DG  B 2 1   ? -22.699 42.028  0.283   1.00 58.74  ? 1   DG  B N1    1 
ATOM   2688 C  C2    . DG  B 2 1   ? -21.565 42.510  -0.330  1.00 63.41  ? 1   DG  B C2    1 
ATOM   2689 N  N2    . DG  B 2 1   ? -21.021 43.615  0.205   1.00 61.31  ? 1   DG  B N2    1 
ATOM   2690 N  N3    . DG  B 2 1   ? -21.002 41.950  -1.393  1.00 62.93  ? 1   DG  B N3    1 
ATOM   2691 C  C4    . DG  B 2 1   ? -21.678 40.847  -1.799  1.00 58.48  ? 1   DG  B C4    1 
ATOM   2692 P  P     . DC  B 2 2   ? -16.242 40.033  -4.828  1.00 83.54  ? 2   DC  B P     1 
ATOM   2693 O  OP1   . DC  B 2 2   ? -15.408 40.158  -6.044  1.00 81.81  ? 2   DC  B OP1   1 
ATOM   2694 O  OP2   . DC  B 2 2   ? -16.195 38.788  -4.029  1.00 84.73  ? 2   DC  B OP2   1 
ATOM   2695 O  "O5'" . DC  B 2 2   ? -15.906 41.265  -3.865  1.00 77.21  ? 2   DC  B "O5'" 1 
ATOM   2696 C  "C5'" . DC  B 2 2   ? -16.845 41.664  -2.874  1.00 75.35  ? 2   DC  B "C5'" 1 
ATOM   2697 C  "C4'" . DC  B 2 2   ? -16.171 42.492  -1.798  1.00 73.90  ? 2   DC  B "C4'" 1 
ATOM   2698 O  "O4'" . DC  B 2 2   ? -17.067 42.640  -0.675  1.00 78.91  ? 2   DC  B "O4'" 1 
ATOM   2699 C  "C3'" . DC  B 2 2   ? -14.936 41.864  -1.193  1.00 77.73  ? 2   DC  B "C3'" 1 
ATOM   2700 O  "O3'" . DC  B 2 2   ? -14.181 42.866  -0.523  1.00 81.69  ? 2   DC  B "O3'" 1 
ATOM   2701 C  "C2'" . DC  B 2 2   ? -15.554 40.876  -0.208  1.00 71.38  ? 2   DC  B "C2'" 1 
ATOM   2702 C  "C1'" . DC  B 2 2   ? -16.752 41.671  0.317   1.00 67.70  ? 2   DC  B "C1'" 1 
ATOM   2703 N  N1    . DC  B 2 2   ? -17.970 40.849  0.547   1.00 61.60  ? 2   DC  B N1    1 
ATOM   2704 C  C2    . DC  B 2 2   ? -18.841 41.185  1.591   1.00 63.84  ? 2   DC  B C2    1 
ATOM   2705 O  O2    . DC  B 2 2   ? -18.566 42.151  2.317   1.00 60.26  ? 2   DC  B O2    1 
ATOM   2706 N  N3    . DC  B 2 2   ? -19.958 40.436  1.782   1.00 58.99  ? 2   DC  B N3    1 
ATOM   2707 C  C4    . DC  B 2 2   ? -20.214 39.402  0.977   1.00 59.98  ? 2   DC  B C4    1 
ATOM   2708 N  N4    . DC  B 2 2   ? -21.326 38.692  1.203   1.00 60.85  ? 2   DC  B N4    1 
ATOM   2709 C  C5    . DC  B 2 2   ? -19.342 39.051  -0.096  1.00 60.46  ? 2   DC  B C5    1 
ATOM   2710 C  C6    . DC  B 2 2   ? -18.245 39.796  -0.274  1.00 62.90  ? 2   DC  B C6    1 
ATOM   2711 P  P     . DT  B 2 3   ? -12.776 42.503  0.164   1.00 82.16  ? 3   DT  B P     1 
ATOM   2712 O  OP1   . DT  B 2 3   ? -11.893 43.680  0.003   1.00 83.90  ? 3   DT  B OP1   1 
ATOM   2713 O  OP2   . DT  B 2 3   ? -12.347 41.185  -0.362  1.00 72.17  ? 3   DT  B OP2   1 
ATOM   2714 O  "O5'" . DT  B 2 3   ? -13.144 42.350  1.714   1.00 76.86  ? 3   DT  B "O5'" 1 
ATOM   2715 C  "C5'" . DT  B 2 3   ? -13.808 43.416  2.391   1.00 75.13  ? 3   DT  B "C5'" 1 
ATOM   2716 C  "C4'" . DT  B 2 3   ? -14.109 43.050  3.836   1.00 76.34  ? 3   DT  B "C4'" 1 
ATOM   2717 O  "O4'" . DT  B 2 3   ? -15.336 42.273  3.908   1.00 78.16  ? 3   DT  B "O4'" 1 
ATOM   2718 C  "C3'" . DT  B 2 3   ? -13.041 42.214  4.539   1.00 79.45  ? 3   DT  B "C3'" 1 
ATOM   2719 O  "O3'" . DT  B 2 3   ? -12.895 42.663  5.880   1.00 87.32  ? 3   DT  B "O3'" 1 
ATOM   2720 C  "C2'" . DT  B 2 3   ? -13.624 40.801  4.485   1.00 72.64  ? 3   DT  B "C2'" 1 
ATOM   2721 C  "C1'" . DT  B 2 3   ? -15.104 41.095  4.656   1.00 70.76  ? 3   DT  B "C1'" 1 
ATOM   2722 N  N1    . DT  B 2 3   ? -16.009 40.021  4.134   1.00 63.26  ? 3   DT  B N1    1 
ATOM   2723 C  C2    . DT  B 2 3   ? -17.236 39.837  4.726   1.00 63.29  ? 3   DT  B C2    1 
ATOM   2724 O  O2    . DT  B 2 3   ? -17.627 40.502  5.671   1.00 68.31  ? 3   DT  B O2    1 
ATOM   2725 N  N3    . DT  B 2 3   ? -17.994 38.837  4.176   1.00 53.78  ? 3   DT  B N3    1 
ATOM   2726 C  C4    . DT  B 2 3   ? -17.658 38.021  3.112   1.00 57.76  ? 3   DT  B C4    1 
ATOM   2727 O  O4    . DT  B 2 3   ? -18.411 37.149  2.687   1.00 55.87  ? 3   DT  B O4    1 
ATOM   2728 C  C5    . DT  B 2 3   ? -16.359 38.269  2.531   1.00 56.99  ? 3   DT  B C5    1 
ATOM   2729 C  C7    . DT  B 2 3   ? -15.886 37.446  1.370   1.00 52.27  ? 3   DT  B C7    1 
ATOM   2730 C  C6    . DT  B 2 3   ? -15.605 39.246  3.063   1.00 60.84  ? 3   DT  B C6    1 
ATOM   2731 P  P     . DG  B 2 4   ? -11.477 42.550  6.627   1.00 89.95  ? 4   DG  B P     1 
ATOM   2732 O  OP1   . DG  B 2 4   ? -10.872 43.902  6.640   1.00 86.91  ? 4   DG  B OP1   1 
ATOM   2733 O  OP2   . DG  B 2 4   ? -10.747 41.410  6.024   1.00 81.88  ? 4   DG  B OP2   1 
ATOM   2734 O  "O5'" . DG  B 2 4   ? -11.869 42.151  8.127   1.00 87.03  ? 4   DG  B "O5'" 1 
ATOM   2735 C  "C5'" . DG  B 2 4   ? -12.644 43.043  8.918   1.00 79.80  ? 4   DG  B "C5'" 1 
ATOM   2736 C  "C4'" . DG  B 2 4   ? -13.700 42.290  9.703   1.00 77.80  ? 4   DG  B "C4'" 1 
ATOM   2737 O  "O4'" . DG  B 2 4   ? -14.448 41.425  8.807   1.00 82.73  ? 4   DG  B "O4'" 1 
ATOM   2738 C  "C3'" . DG  B 2 4   ? -13.161 41.387  10.816  1.00 76.33  ? 4   DG  B "C3'" 1 
ATOM   2739 O  "O3'" . DG  B 2 4   ? -13.914 41.590  12.003  1.00 79.41  ? 4   DG  B "O3'" 1 
ATOM   2740 C  "C2'" . DG  B 2 4   ? -13.356 39.976  10.257  1.00 76.74  ? 4   DG  B "C2'" 1 
ATOM   2741 C  "C1'" . DG  B 2 4   ? -14.597 40.162  9.406   1.00 76.53  ? 4   DG  B "C1'" 1 
ATOM   2742 N  N9    . DG  B 2 4   ? -14.741 39.156  8.356   1.00 67.69  ? 4   DG  B N9    1 
ATOM   2743 C  C8    . DG  B 2 4   ? -13.813 38.814  7.403   1.00 65.32  ? 4   DG  B C8    1 
ATOM   2744 N  N7    . DG  B 2 4   ? -14.221 37.875  6.593   1.00 58.93  ? 4   DG  B N7    1 
ATOM   2745 C  C5    . DG  B 2 4   ? -15.503 37.575  7.038   1.00 59.59  ? 4   DG  B C5    1 
ATOM   2746 C  C6    . DG  B 2 4   ? -16.441 36.636  6.550   1.00 53.82  ? 4   DG  B C6    1 
ATOM   2747 O  O6    . DG  B 2 4   ? -16.321 35.856  5.594   1.00 55.84  ? 4   DG  B O6    1 
ATOM   2748 N  N1    . DG  B 2 4   ? -17.619 36.653  7.291   1.00 53.84  ? 4   DG  B N1    1 
ATOM   2749 C  C2    . DG  B 2 4   ? -17.861 37.476  8.368   1.00 59.67  ? 4   DG  B C2    1 
ATOM   2750 N  N2    . DG  B 2 4   ? -19.059 37.351  8.959   1.00 55.59  ? 4   DG  B N2    1 
ATOM   2751 N  N3    . DG  B 2 4   ? -16.990 38.361  8.834   1.00 64.90  ? 4   DG  B N3    1 
ATOM   2752 C  C4    . DG  B 2 4   ? -15.837 38.356  8.123   1.00 62.55  ? 4   DG  B C4    1 
ATOM   2753 P  P     . DA  B 2 5   ? -13.509 40.841  13.367  1.00 84.70  ? 5   DA  B P     1 
ATOM   2754 O  OP1   . DA  B 2 5   ? -13.547 41.850  14.449  1.00 82.96  ? 5   DA  B OP1   1 
ATOM   2755 O  OP2   . DA  B 2 5   ? -12.267 40.071  13.133  1.00 77.50  ? 5   DA  B OP2   1 
ATOM   2756 O  "O5'" . DA  B 2 5   ? -14.711 39.814  13.606  1.00 72.69  ? 5   DA  B "O5'" 1 
ATOM   2757 C  "C5'" . DA  B 2 5   ? -15.992 40.308  13.967  1.00 68.74  ? 5   DA  B "C5'" 1 
ATOM   2758 C  "C4'" . DA  B 2 5   ? -17.019 39.190  14.005  1.00 70.75  ? 5   DA  B "C4'" 1 
ATOM   2759 O  "O4'" . DA  B 2 5   ? -17.013 38.477  12.741  1.00 71.24  ? 5   DA  B "O4'" 1 
ATOM   2760 C  "C3'" . DA  B 2 5   ? -16.796 38.137  15.087  1.00 70.44  ? 5   DA  B "C3'" 1 
ATOM   2761 O  "O3'" . DA  B 2 5   ? -18.045 37.769  15.647  1.00 78.80  ? 5   DA  B "O3'" 1 
ATOM   2762 C  "C2'" . DA  B 2 5   ? -16.157 36.980  14.317  1.00 67.57  ? 5   DA  B "C2'" 1 
ATOM   2763 C  "C1'" . DA  B 2 5   ? -16.861 37.094  12.976  1.00 65.07  ? 5   DA  B "C1'" 1 
ATOM   2764 N  N9    . DA  B 2 5   ? -16.114 36.523  11.859  1.00 56.98  ? 5   DA  B N9    1 
ATOM   2765 C  C8    . DA  B 2 5   ? -14.863 36.876  11.438  1.00 61.25  ? 5   DA  B C8    1 
ATOM   2766 N  N7    . DA  B 2 5   ? -14.447 36.203  10.391  1.00 58.98  ? 5   DA  B N7    1 
ATOM   2767 C  C5    . DA  B 2 5   ? -15.503 35.358  10.097  1.00 53.42  ? 5   DA  B C5    1 
ATOM   2768 C  C6    . DA  B 2 5   ? -15.693 34.388  9.094   1.00 57.70  ? 5   DA  B C6    1 
ATOM   2769 N  N6    . DA  B 2 5   ? -14.774 34.100  8.162   1.00 55.75  ? 5   DA  B N6    1 
ATOM   2770 N  N1    . DA  B 2 5   ? -16.866 33.719  9.085   1.00 56.01  ? 5   DA  B N1    1 
ATOM   2771 C  C2    . DA  B 2 5   ? -17.782 34.011  10.017  1.00 52.21  ? 5   DA  B C2    1 
ATOM   2772 N  N3    . DA  B 2 5   ? -17.717 34.899  11.006  1.00 57.03  ? 5   DA  B N3    1 
ATOM   2773 C  C4    . DA  B 2 5   ? -16.542 35.545  10.990  1.00 54.99  ? 5   DA  B C4    1 
ATOM   2774 P  P     . DG  B 2 6   ? -18.117 36.760  16.893  1.00 81.89  ? 6   DG  B P     1 
ATOM   2775 O  OP1   . DG  B 2 6   ? -19.222 37.214  17.768  1.00 73.09  ? 6   DG  B OP1   1 
ATOM   2776 O  OP2   . DG  B 2 6   ? -16.750 36.611  17.440  1.00 67.38  ? 6   DG  B OP2   1 
ATOM   2777 O  "O5'" . DG  B 2 6   ? -18.542 35.374  16.225  1.00 72.47  ? 6   DG  B "O5'" 1 
ATOM   2778 C  "C5'" . DG  B 2 6   ? -19.749 35.292  15.479  1.00 69.22  ? 6   DG  B "C5'" 1 
ATOM   2779 C  "C4'" . DG  B 2 6   ? -19.990 33.874  14.996  1.00 69.60  ? 6   DG  B "C4'" 1 
ATOM   2780 O  "O4'" . DG  B 2 6   ? -19.171 33.608  13.825  1.00 64.79  ? 6   DG  B "O4'" 1 
ATOM   2781 C  "C3'" . DG  B 2 6   ? -19.642 32.782  16.009  1.00 73.10  ? 6   DG  B "C3'" 1 
ATOM   2782 O  "O3'" . DG  B 2 6   ? -20.616 31.730  15.938  1.00 81.93  ? 6   DG  B "O3'" 1 
ATOM   2783 C  "C2'" . DG  B 2 6   ? -18.267 32.315  15.531  1.00 67.17  ? 6   DG  B "C2'" 1 
ATOM   2784 C  "C1'" . DG  B 2 6   ? -18.448 32.415  14.027  1.00 62.60  ? 6   DG  B "C1'" 1 
ATOM   2785 N  N9    . DG  B 2 6   ? -17.196 32.495  13.276  1.00 57.93  ? 6   DG  B N9    1 
ATOM   2786 C  C8    . DG  B 2 6   ? -16.137 33.337  13.515  1.00 57.49  ? 6   DG  B C8    1 
ATOM   2787 N  N7    . DG  B 2 6   ? -15.152 33.185  12.671  1.00 56.59  ? 6   DG  B N7    1 
ATOM   2788 C  C5    . DG  B 2 6   ? -15.588 32.179  11.816  1.00 50.61  ? 6   DG  B C5    1 
ATOM   2789 C  C6    . DG  B 2 6   ? -14.947 31.589  10.698  1.00 54.77  ? 6   DG  B C6    1 
ATOM   2790 O  O6    . DG  B 2 6   ? -13.827 31.845  10.228  1.00 56.54  ? 6   DG  B O6    1 
ATOM   2791 N  N1    . DG  B 2 6   ? -15.739 30.605  10.110  1.00 54.19  ? 6   DG  B N1    1 
ATOM   2792 C  C2    . DG  B 2 6   ? -16.991 30.240  10.545  1.00 50.41  ? 6   DG  B C2    1 
ATOM   2793 N  N2    . DG  B 2 6   ? -17.602 29.271  9.850   1.00 46.05  ? 6   DG  B N2    1 
ATOM   2794 N  N3    . DG  B 2 6   ? -17.603 30.786  11.590  1.00 53.68  ? 6   DG  B N3    1 
ATOM   2795 C  C4    . DG  B 2 6   ? -16.844 31.743  12.176  1.00 49.99  ? 6   DG  B C4    1 
ATOM   2796 P  P     . DT  B 2 7   ? -21.031 30.910  17.258  1.00 86.69  ? 7   DT  B P     1 
ATOM   2797 O  OP1   . DT  B 2 7   ? -22.509 30.929  17.360  1.00 81.12  ? 7   DT  B OP1   1 
ATOM   2798 O  OP2   . DT  B 2 7   ? -20.193 31.400  18.376  1.00 75.37  ? 7   DT  B OP2   1 
ATOM   2799 O  "O5'" . DT  B 2 7   ? -20.579 29.415  16.931  1.00 78.64  ? 7   DT  B "O5'" 1 
ATOM   2800 C  "C5'" . DT  B 2 7   ? -19.630 29.187  15.917  1.00 73.69  ? 7   DT  B "C5'" 1 
ATOM   2801 C  "C4'" . DT  B 2 7   ? -20.050 28.043  15.026  1.00 70.76  ? 7   DT  B "C4'" 1 
ATOM   2802 O  "O4'" . DT  B 2 7   ? -19.250 28.073  13.821  1.00 66.20  ? 7   DT  B "O4'" 1 
ATOM   2803 C  "C3'" . DT  B 2 7   ? -19.788 26.678  15.616  1.00 72.24  ? 7   DT  B "C3'" 1 
ATOM   2804 O  "O3'" . DT  B 2 7   ? -20.573 25.698  14.955  1.00 75.94  ? 7   DT  B "O3'" 1 
ATOM   2805 C  "C2'" . DT  B 2 7   ? -18.305 26.501  15.319  1.00 67.38  ? 7   DT  B "C2'" 1 
ATOM   2806 C  "C1'" . DT  B 2 7   ? -18.184 27.145  13.937  1.00 61.47  ? 7   DT  B "C1'" 1 
ATOM   2807 N  N1    . DT  B 2 7   ? -16.897 27.870  13.732  1.00 56.44  ? 7   DT  B N1    1 
ATOM   2808 C  C2    . DT  B 2 7   ? -16.111 27.555  12.649  1.00 51.73  ? 7   DT  B C2    1 
ATOM   2809 O  O2    . DT  B 2 7   ? -16.413 26.706  11.831  1.00 56.45  ? 7   DT  B O2    1 
ATOM   2810 N  N3    . DT  B 2 7   ? -14.950 28.274  12.556  1.00 46.70  ? 7   DT  B N3    1 
ATOM   2811 C  C4    . DT  B 2 7   ? -14.507 29.258  13.423  1.00 53.41  ? 7   DT  B C4    1 
ATOM   2812 O  O4    . DT  B 2 7   ? -13.447 29.854  13.255  1.00 55.72  ? 7   DT  B O4    1 
ATOM   2813 C  C5    . DT  B 2 7   ? -15.378 29.536  14.538  1.00 52.68  ? 7   DT  B C5    1 
ATOM   2814 C  C7    . DT  B 2 7   ? -15.004 30.582  15.544  1.00 53.29  ? 7   DT  B C7    1 
ATOM   2815 C  C6    . DT  B 2 7   ? -16.515 28.836  14.638  1.00 55.41  ? 7   DT  B C6    1 
ATOM   2816 P  P     . DG  B 2 8   ? -20.582 24.186  15.497  1.00 71.94  ? 8   DG  B P     1 
ATOM   2817 O  OP1   . DG  B 2 8   ? -21.901 23.604  15.165  1.00 71.77  ? 8   DG  B OP1   1 
ATOM   2818 O  OP2   . DG  B 2 8   ? -20.101 24.198  16.896  1.00 73.80  ? 8   DG  B OP2   1 
ATOM   2819 O  "O5'" . DG  B 2 8   ? -19.505 23.445  14.583  1.00 63.45  ? 8   DG  B "O5'" 1 
ATOM   2820 C  "C5'" . DG  B 2 8   ? -19.920 22.859  13.362  1.00 66.54  ? 8   DG  B "C5'" 1 
ATOM   2821 C  "C4'" . DG  B 2 8   ? -18.753 22.694  12.412  1.00 60.80  ? 8   DG  B "C4'" 1 
ATOM   2822 O  "O4'" . DG  B 2 8   ? -17.773 23.738  12.645  1.00 65.41  ? 8   DG  B "O4'" 1 
ATOM   2823 C  "C3'" . DG  B 2 8   ? -17.991 21.370  12.532  1.00 58.33  ? 8   DG  B "C3'" 1 
ATOM   2824 O  "O3'" . DG  B 2 8   ? -17.805 20.817  11.235  1.00 55.41  ? 8   DG  B "O3'" 1 
ATOM   2825 C  "C2'" . DG  B 2 8   ? -16.654 21.792  13.153  1.00 52.50  ? 8   DG  B "C2'" 1 
ATOM   2826 C  "C1'" . DG  B 2 8   ? -16.498 23.163  12.539  1.00 57.25  ? 8   DG  B "C1'" 1 
ATOM   2827 N  N9    . DG  B 2 8   ? -15.528 24.031  13.199  1.00 53.14  ? 8   DG  B N9    1 
ATOM   2828 C  C8    . DG  B 2 8   ? -15.697 24.740  14.362  1.00 52.44  ? 8   DG  B C8    1 
ATOM   2829 N  N7    . DG  B 2 8   ? -14.656 25.455  14.691  1.00 49.35  ? 8   DG  B N7    1 
ATOM   2830 C  C5    . DG  B 2 8   ? -13.742 25.207  13.674  1.00 53.23  ? 8   DG  B C5    1 
ATOM   2831 C  C6    . DG  B 2 8   ? -12.431 25.701  13.485  1.00 50.54  ? 8   DG  B C6    1 
ATOM   2832 O  O6    . DG  B 2 8   ? -11.794 26.484  14.205  1.00 53.91  ? 8   DG  B O6    1 
ATOM   2833 N  N1    . DG  B 2 8   ? -11.854 25.195  12.323  1.00 48.61  ? 8   DG  B N1    1 
ATOM   2834 C  C2    . DG  B 2 8   ? -12.467 24.320  11.454  1.00 48.35  ? 8   DG  B C2    1 
ATOM   2835 N  N2    . DG  B 2 8   ? -11.753 23.939  10.381  1.00 43.71  ? 8   DG  B N2    1 
ATOM   2836 N  N3    . DG  B 2 8   ? -13.692 23.853  11.621  1.00 49.43  ? 8   DG  B N3    1 
ATOM   2837 C  C4    . DG  B 2 8   ? -14.267 24.336  12.748  1.00 48.62  ? 8   DG  B C4    1 
ATOM   2838 P  P     . DC  B 2 9   ? -18.550 19.457  10.818  1.00 65.56  ? 9   DC  B P     1 
ATOM   2839 O  OP1   . DC  B 2 9   ? -19.576 19.154  11.839  1.00 66.44  ? 9   DC  B OP1   1 
ATOM   2840 O  OP2   . DC  B 2 9   ? -17.518 18.446  10.505  1.00 77.39  ? 9   DC  B OP2   1 
ATOM   2841 O  "O5'" . DC  B 2 9   ? -19.268 19.828  9.443   1.00 60.47  ? 9   DC  B "O5'" 1 
ATOM   2842 C  "C5'" . DC  B 2 9   ? -20.332 20.767  9.418   1.00 55.64  ? 9   DC  B "C5'" 1 
ATOM   2843 C  "C4'" . DC  B 2 9   ? -21.170 20.572  8.171   1.00 53.23  ? 9   DC  B "C4'" 1 
ATOM   2844 O  "O4'" . DC  B 2 9   ? -20.631 21.363  7.097   1.00 49.94  ? 9   DC  B "O4'" 1 
ATOM   2845 C  "C3'" . DC  B 2 9   ? -21.190 19.139  7.643   1.00 54.07  ? 9   DC  B "C3'" 1 
ATOM   2846 O  "O3'" . DC  B 2 9   ? -22.401 18.506  8.011   1.00 53.06  ? 9   DC  B "O3'" 1 
ATOM   2847 C  "C2'" . DC  B 2 9   ? -21.068 19.279  6.113   1.00 47.08  ? 9   DC  B "C2'" 1 
ATOM   2848 C  "C1'" . DC  B 2 9   ? -21.042 20.790  5.887   1.00 51.23  ? 9   DC  B "C1'" 1 
ATOM   2849 N  N1    . DC  B 2 9   ? -20.099 21.215  4.811   1.00 54.02  ? 9   DC  B N1    1 
ATOM   2850 C  C2    . DC  B 2 9   ? -20.295 22.437  4.165   1.00 49.08  ? 9   DC  B C2    1 
ATOM   2851 O  O2    . DC  B 2 9   ? -21.247 23.149  4.503   1.00 49.26  ? 9   DC  B O2    1 
ATOM   2852 N  N3    . DC  B 2 9   ? -19.430 22.810  3.188   1.00 54.91  ? 9   DC  B N3    1 
ATOM   2853 C  C4    . DC  B 2 9   ? -18.412 22.014  2.853   1.00 52.09  ? 9   DC  B C4    1 
ATOM   2854 N  N4    . DC  B 2 9   ? -17.587 22.427  1.884   1.00 51.21  ? 9   DC  B N4    1 
ATOM   2855 C  C5    . DC  B 2 9   ? -18.194 20.762  3.499   1.00 50.24  ? 9   DC  B C5    1 
ATOM   2856 C  C6    . DC  B 2 9   ? -19.055 20.404  4.462   1.00 56.39  ? 9   DC  B C6    1 
ATOM   2857 P  P     . DC  B 2 10  ? -22.421 16.941  8.359   1.00 52.16  ? 10  DC  B P     1 
ATOM   2858 O  OP1   . DC  B 2 10  ? -23.841 16.522  8.353   1.00 59.17  ? 10  DC  B OP1   1 
ATOM   2859 O  OP2   . DC  B 2 10  ? -21.584 16.736  9.561   1.00 57.43  ? 10  DC  B OP2   1 
ATOM   2860 O  "O5'" . DC  B 2 10  ? -21.673 16.257  7.122   1.00 45.93  ? 10  DC  B "O5'" 1 
ATOM   2861 C  "C5'" . DC  B 2 10  ? -20.766 15.193  7.344   1.00 43.88  ? 10  DC  B "C5'" 1 
ATOM   2862 C  "C4'" . DC  B 2 10  ? -20.560 14.385  6.075   1.00 43.22  ? 10  DC  B "C4'" 1 
ATOM   2863 O  "O4'" . DC  B 2 10  ? -21.844 13.951  5.570   1.00 44.89  ? 10  DC  B "O4'" 1 
ATOM   2864 C  "C3'" . DC  B 2 10  ? -19.925 15.140  4.921   1.00 52.05  ? 10  DC  B "C3'" 1 
ATOM   2865 O  "O3'" . DC  B 2 10  ? -18.506 15.093  5.031   1.00 56.12  ? 10  DC  B "O3'" 1 
ATOM   2866 C  "C2'" . DC  B 2 10  ? -20.414 14.341  3.718   1.00 52.61  ? 10  DC  B "C2'" 1 
ATOM   2867 C  "C1'" . DC  B 2 10  ? -21.825 13.938  4.152   1.00 46.82  ? 10  DC  B "C1'" 1 
ATOM   2868 N  N1    . DC  B 2 10  ? -22.891 14.860  3.654   1.00 45.88  ? 10  DC  B N1    1 
ATOM   2869 C  C2    . DC  B 2 10  ? -23.271 14.820  2.308   1.00 43.29  ? 10  DC  B C2    1 
ATOM   2870 O  O2    . DC  B 2 10  ? -22.716 14.019  1.547   1.00 47.78  ? 10  DC  B O2    1 
ATOM   2871 N  N3    . DC  B 2 10  ? -24.239 15.664  1.873   1.00 46.40  ? 10  DC  B N3    1 
ATOM   2872 C  C4    . DC  B 2 10  ? -24.816 16.514  2.724   1.00 48.47  ? 10  DC  B C4    1 
ATOM   2873 N  N4    . DC  B 2 10  ? -25.766 17.327  2.249   1.00 51.06  ? 10  DC  B N4    1 
ATOM   2874 C  C5    . DC  B 2 10  ? -24.444 16.570  4.100   1.00 47.49  ? 10  DC  B C5    1 
ATOM   2875 C  C6    . DC  B 2 10  ? -23.488 15.734  4.518   1.00 49.31  ? 10  DC  B C6    1 
ATOM   2876 P  P     . DC  B 2 11  ? -17.590 16.166  4.259   1.00 51.97  ? 11  DC  B P     1 
ATOM   2877 O  OP1   . DC  B 2 11  ? -18.135 16.374  2.899   1.00 60.33  ? 11  DC  B OP1   1 
ATOM   2878 O  OP2   . DC  B 2 11  ? -16.190 15.724  4.423   1.00 66.08  ? 11  DC  B OP2   1 
ATOM   2879 O  "O5'" . DC  B 2 11  ? -17.808 17.517  5.079   1.00 56.15  ? 11  DC  B "O5'" 1 
ATOM   2880 C  "C5'" . DC  B 2 11  ? -17.348 17.611  6.417   1.00 59.32  ? 11  DC  B "C5'" 1 
ATOM   2881 C  "C4'" . DC  B 2 11  ? -15.934 18.162  6.466   1.00 60.78  ? 11  DC  B "C4'" 1 
ATOM   2882 O  "O4'" . DC  B 2 11  ? -15.955 19.550  6.085   1.00 57.22  ? 11  DC  B "O4'" 1 
ATOM   2883 C  "C3'" . DC  B 2 11  ? -15.291 18.113  7.844   1.00 62.45  ? 11  DC  B "C3'" 1 
ATOM   2884 O  "O3'" . DC  B 2 11  ? -14.469 16.963  7.936   1.00 71.62  ? 11  DC  B "O3'" 1 
ATOM   2885 C  "C2'" . DC  B 2 11  ? -14.455 19.394  7.934   1.00 61.34  ? 11  DC  B "C2'" 1 
ATOM   2886 C  "C1'" . DC  B 2 11  ? -14.950 20.260  6.774   1.00 59.80  ? 11  DC  B "C1'" 1 
ATOM   2887 N  N1    . DC  B 2 11  ? -15.488 21.595  7.205   1.00 52.52  ? 11  DC  B N1    1 
ATOM   2888 C  C2    . DC  B 2 11  ? -16.849 21.752  7.537   1.00 56.58  ? 11  DC  B C2    1 
ATOM   2889 O  O2    . DC  B 2 11  ? -17.611 20.784  7.478   1.00 67.49  ? 11  DC  B O2    1 
ATOM   2890 N  N3    . DC  B 2 11  ? -17.294 22.973  7.919   1.00 52.01  ? 11  DC  B N3    1 
ATOM   2891 C  C4    . DC  B 2 11  ? -16.454 24.001  7.977   1.00 51.41  ? 11  DC  B C4    1 
ATOM   2892 N  N4    . DC  B 2 11  ? -16.943 25.188  8.361   1.00 48.18  ? 11  DC  B N4    1 
ATOM   2893 C  C5    . DC  B 2 11  ? -15.073 23.860  7.650   1.00 48.64  ? 11  DC  B C5    1 
ATOM   2894 C  C6    . DC  B 2 11  ? -14.639 22.657  7.271   1.00 48.56  ? 11  DC  B C6    1 
ATOM   2895 P  P     . DG  B 2 12  ? -14.723 15.881  9.095   1.00 76.01  ? 12  DG  B P     1 
ATOM   2896 O  OP1   . DG  B 2 12  ? -14.028 14.641  8.680   1.00 69.13  ? 12  DG  B OP1   1 
ATOM   2897 O  OP2   . DG  B 2 12  ? -16.171 15.851  9.403   1.00 70.21  ? 12  DG  B OP2   1 
ATOM   2898 O  "O5'" . DG  B 2 12  ? -13.989 16.509  10.366  1.00 65.10  ? 12  DG  B "O5'" 1 
ATOM   2899 C  "C5'" . DG  B 2 12  ? -12.590 16.335  10.528  1.00 70.83  ? 12  DG  B "C5'" 1 
ATOM   2900 C  "C4'" . DG  B 2 12  ? -11.824 17.503  9.938   1.00 67.91  ? 12  DG  B "C4'" 1 
ATOM   2901 O  "O4'" . DG  B 2 12  ? -12.319 18.730  10.500  1.00 63.71  ? 12  DG  B "O4'" 1 
ATOM   2902 C  "C3'" . DG  B 2 12  ? -10.341 17.504  10.266  1.00 69.21  ? 12  DG  B "C3'" 1 
ATOM   2903 O  "O3'" . DG  B 2 12  ? -9.628  16.767  9.285   1.00 75.10  ? 12  DG  B "O3'" 1 
ATOM   2904 C  "C2'" . DG  B 2 12  ? -9.965  18.991  10.239  1.00 61.82  ? 12  DG  B "C2'" 1 
ATOM   2905 C  "C1'" . DG  B 2 12  ? -11.307 19.713  10.428  1.00 61.21  ? 12  DG  B "C1'" 1 
ATOM   2906 N  N9    . DG  B 2 12  ? -11.389 20.560  11.623  1.00 54.11  ? 12  DG  B N9    1 
ATOM   2907 C  C8    . DG  B 2 12  ? -12.444 20.640  12.497  1.00 47.75  ? 12  DG  B C8    1 
ATOM   2908 N  N7    . DG  B 2 12  ? -12.257 21.495  13.464  1.00 50.63  ? 12  DG  B N7    1 
ATOM   2909 C  C5    . DG  B 2 12  ? -10.999 22.024  13.215  1.00 46.89  ? 12  DG  B C5    1 
ATOM   2910 C  C6    . DG  B 2 12  ? -10.265 23.000  13.932  1.00 49.73  ? 12  DG  B C6    1 
ATOM   2911 O  O6    . DG  B 2 12  ? -10.593 23.610  14.961  1.00 45.79  ? 12  DG  B O6    1 
ATOM   2912 N  N1    . DG  B 2 12  ? -9.030  23.249  13.341  1.00 52.32  ? 12  DG  B N1    1 
ATOM   2913 C  C2    . DG  B 2 12  ? -8.566  22.637  12.203  1.00 52.36  ? 12  DG  B C2    1 
ATOM   2914 N  N2    . DG  B 2 12  ? -7.349  23.010  11.782  1.00 55.68  ? 12  DG  B N2    1 
ATOM   2915 N  N3    . DG  B 2 12  ? -9.244  21.723  11.521  1.00 52.06  ? 12  DG  B N3    1 
ATOM   2916 C  C4    . DG  B 2 12  ? -10.449 21.465  12.083  1.00 48.55  ? 12  DG  B C4    1 
ATOM   2917 P  P     . DC  B 2 13  ? -8.373  15.867  9.725   1.00 77.96  ? 13  DC  B P     1 
ATOM   2918 O  OP1   . DC  B 2 13  ? -7.914  15.092  8.549   1.00 80.46  ? 13  DC  B OP1   1 
ATOM   2919 O  OP2   . DC  B 2 13  ? -8.755  15.184  10.981  1.00 71.24  ? 13  DC  B OP2   1 
ATOM   2920 O  "O5'" . DC  B 2 13  ? -7.251  16.937  10.100  1.00 71.34  ? 13  DC  B "O5'" 1 
ATOM   2921 C  "C5'" . DC  B 2 13  ? -6.774  17.840  9.122   1.00 65.49  ? 13  DC  B "C5'" 1 
ATOM   2922 C  "C4'" . DC  B 2 13  ? -5.441  18.419  9.547   1.00 70.71  ? 13  DC  B "C4'" 1 
ATOM   2923 O  "O4'" . DC  B 2 13  ? -5.654  19.520  10.468  1.00 68.38  ? 13  DC  B "O4'" 1 
ATOM   2924 C  "C3'" . DC  B 2 13  ? -4.525  17.442  10.272  1.00 75.09  ? 13  DC  B "C3'" 1 
ATOM   2925 O  "O3'" . DC  B 2 13  ? -3.182  17.692  9.903   1.00 78.36  ? 13  DC  B "O3'" 1 
ATOM   2926 C  "C2'" . DC  B 2 13  ? -4.780  17.760  11.747  1.00 69.27  ? 13  DC  B "C2'" 1 
ATOM   2927 C  "C1'" . DC  B 2 13  ? -4.993  19.261  11.691  1.00 64.01  ? 13  DC  B "C1'" 1 
ATOM   2928 N  N1    . DC  B 2 13  ? -5.839  19.798  12.785  1.00 58.62  ? 13  DC  B N1    1 
ATOM   2929 C  C2    . DC  B 2 13  ? -5.338  20.807  13.605  1.00 57.41  ? 13  DC  B C2    1 
ATOM   2930 O  O2    . DC  B 2 13  ? -4.185  21.215  13.418  1.00 63.91  ? 13  DC  B O2    1 
ATOM   2931 N  N3    . DC  B 2 13  ? -6.125  21.308  14.589  1.00 49.81  ? 13  DC  B N3    1 
ATOM   2932 C  C4    . DC  B 2 13  ? -7.361  20.841  14.756  1.00 52.52  ? 13  DC  B C4    1 
ATOM   2933 N  N4    . DC  B 2 13  ? -8.100  21.366  15.739  1.00 52.80  ? 13  DC  B N4    1 
ATOM   2934 C  C5    . DC  B 2 13  ? -7.894  19.814  13.922  1.00 49.40  ? 13  DC  B C5    1 
ATOM   2935 C  C6    . DC  B 2 13  ? -7.107  19.329  12.957  1.00 56.73  ? 13  DC  B C6    1 
ATOM   2936 P  P     . DG  B 2 14  ? -2.080  16.530  10.022  1.00 100.11 ? 14  DG  B P     1 
ATOM   2937 O  OP1   . DG  B 2 14  ? -1.551  16.269  8.662   1.00 86.15  ? 14  DG  B OP1   1 
ATOM   2938 O  OP2   . DG  B 2 14  ? -2.661  15.429  10.829  1.00 83.27  ? 14  DG  B OP2   1 
ATOM   2939 O  "O5'" . DG  B 2 14  ? -0.933  17.212  10.889  1.00 85.82  ? 14  DG  B "O5'" 1 
ATOM   2940 C  "C5'" . DG  B 2 14  ? -1.268  18.238  11.799  1.00 76.87  ? 14  DG  B "C5'" 1 
ATOM   2941 C  "C4'" . DG  B 2 14  ? -0.050  18.670  12.576  1.00 81.66  ? 14  DG  B "C4'" 1 
ATOM   2942 O  "O4'" . DG  B 2 14  ? -0.462  19.467  13.705  1.00 83.06  ? 14  DG  B "O4'" 1 
ATOM   2943 C  "C3'" . DG  B 2 14  ? 0.751   17.535  13.175  1.00 85.40  ? 14  DG  B "C3'" 1 
ATOM   2944 O  "O3'" . DG  B 2 14  ? 2.094   17.958  13.370  1.00 88.45  ? 14  DG  B "O3'" 1 
ATOM   2945 C  "C2'" . DG  B 2 14  ? 0.022   17.277  14.498  1.00 79.51  ? 14  DG  B "C2'" 1 
ATOM   2946 C  "C1'" . DG  B 2 14  ? -0.539  18.656  14.861  1.00 74.17  ? 14  DG  B "C1'" 1 
ATOM   2947 N  N9    . DG  B 2 14  ? -1.931  18.626  15.302  1.00 67.08  ? 14  DG  B N9    1 
ATOM   2948 C  C8    . DG  B 2 14  ? -2.924  17.772  14.878  1.00 65.47  ? 14  DG  B C8    1 
ATOM   2949 N  N7    . DG  B 2 14  ? -4.077  17.992  15.450  1.00 58.46  ? 14  DG  B N7    1 
ATOM   2950 C  C5    . DG  B 2 14  ? -3.833  19.062  16.304  1.00 52.84  ? 14  DG  B C5    1 
ATOM   2951 C  C6    . DG  B 2 14  ? -4.705  19.744  17.187  1.00 57.77  ? 14  DG  B C6    1 
ATOM   2952 O  O6    . DG  B 2 14  ? -5.908  19.529  17.400  1.00 59.75  ? 14  DG  B O6    1 
ATOM   2953 N  N1    . DG  B 2 14  ? -4.051  20.771  17.865  1.00 56.95  ? 14  DG  B N1    1 
ATOM   2954 C  C2    . DG  B 2 14  ? -2.722  21.093  17.710  1.00 56.89  ? 14  DG  B C2    1 
ATOM   2955 N  N2    . DG  B 2 14  ? -2.265  22.112  18.449  1.00 57.22  ? 14  DG  B N2    1 
ATOM   2956 N  N3    . DG  B 2 14  ? -1.898  20.462  16.888  1.00 58.96  ? 14  DG  B N3    1 
ATOM   2957 C  C4    . DG  B 2 14  ? -2.519  19.463  16.220  1.00 60.92  ? 14  DG  B C4    1 
ATOM   2958 P  P     . DT  B 2 15  ? 3.137   17.057  14.197  1.00 97.04  ? 15  DT  B P     1 
ATOM   2959 O  OP1   . DT  B 2 15  ? 4.477   17.301  13.617  1.00 97.81  ? 15  DT  B OP1   1 
ATOM   2960 O  OP2   . DT  B 2 15  ? 2.625   15.669  14.280  1.00 89.50  ? 15  DT  B OP2   1 
ATOM   2961 O  "O5'" . DT  B 2 15  ? 3.100   17.716  15.651  1.00 91.55  ? 15  DT  B "O5'" 1 
ATOM   2962 C  "C5'" . DT  B 2 15  ? 3.046   19.136  15.774  1.00 84.99  ? 15  DT  B "C5'" 1 
ATOM   2963 C  "C4'" . DT  B 2 15  ? 3.062   19.555  17.230  1.00 84.65  ? 15  DT  B "C4'" 1 
ATOM   2964 O  "O4'" . DT  B 2 15  ? 1.700   19.662  17.727  1.00 77.61  ? 15  DT  B "O4'" 1 
ATOM   2965 C  "C3'" . DT  B 2 15  ? 3.781   18.589  18.168  1.00 86.78  ? 15  DT  B "C3'" 1 
ATOM   2966 O  "O3'" . DT  B 2 15  ? 4.495   19.328  19.142  1.00 91.56  ? 15  DT  B "O3'" 1 
ATOM   2967 C  "C2'" . DT  B 2 15  ? 2.629   17.804  18.794  1.00 78.22  ? 15  DT  B "C2'" 1 
ATOM   2968 C  "C1'" . DT  B 2 15  ? 1.565   18.884  18.897  1.00 74.91  ? 15  DT  B "C1'" 1 
ATOM   2969 N  N1    . DT  B 2 15  ? 0.170   18.360  18.951  1.00 66.57  ? 15  DT  B N1    1 
ATOM   2970 C  C2    . DT  B 2 15  ? -0.737  18.954  19.798  1.00 63.27  ? 15  DT  B C2    1 
ATOM   2971 O  O2    . DT  B 2 15  ? -0.457  19.892  20.525  1.00 65.12  ? 15  DT  B O2    1 
ATOM   2972 N  N3    . DT  B 2 15  ? -1.993  18.408  19.765  1.00 61.38  ? 15  DT  B N3    1 
ATOM   2973 C  C4    . DT  B 2 15  ? -2.423  17.349  18.986  1.00 63.48  ? 15  DT  B C4    1 
ATOM   2974 O  O4    . DT  B 2 15  ? -3.575  16.928  19.028  1.00 64.47  ? 15  DT  B O4    1 
ATOM   2975 C  C5    . DT  B 2 15  ? -1.423  16.772  18.118  1.00 61.15  ? 15  DT  B C5    1 
ATOM   2976 C  C7    . DT  B 2 15  ? -1.773  15.617  17.228  1.00 56.23  ? 15  DT  B C7    1 
ATOM   2977 C  C6    . DT  B 2 15  ? -0.189  17.300  18.141  1.00 65.06  ? 15  DT  B C6    1 
ATOM   2978 P  P     . DG  B 2 16  ? 5.821   18.728  19.823  1.00 94.94  ? 16  DG  B P     1 
ATOM   2979 O  OP1   . DG  B 2 16  ? 6.988   19.310  19.125  1.00 95.00  ? 16  DG  B OP1   1 
ATOM   2980 O  OP2   . DG  B 2 16  ? 5.681   17.255  19.906  1.00 89.18  ? 16  DG  B OP2   1 
ATOM   2981 O  "O5'" . DG  B 2 16  ? 5.756   19.316  21.306  1.00 87.92  ? 16  DG  B "O5'" 1 
ATOM   2982 C  "C5'" . DG  B 2 16  ? 5.198   20.609  21.529  1.00 83.33  ? 16  DG  B "C5'" 1 
ATOM   2983 C  "C4'" . DG  B 2 16  ? 4.449   20.654  22.849  1.00 83.24  ? 16  DG  B "C4'" 1 
ATOM   2984 O  "O4'" . DG  B 2 16  ? 3.099   20.142  22.672  1.00 84.13  ? 16  DG  B "O4'" 1 
ATOM   2985 C  "C3'" . DG  B 2 16  ? 5.073   19.823  23.968  1.00 86.73  ? 16  DG  B "C3'" 1 
ATOM   2986 O  "O3'" . DG  B 2 16  ? 5.014   20.550  25.188  1.00 90.60  ? 16  DG  B "O3'" 1 
ATOM   2987 C  "C2'" . DG  B 2 16  ? 4.189   18.574  24.006  1.00 80.42  ? 16  DG  B "C2'" 1 
ATOM   2988 C  "C1'" . DG  B 2 16  ? 2.835   19.161  23.652  1.00 77.94  ? 16  DG  B "C1'" 1 
ATOM   2989 N  N9    . DG  B 2 16  ? 1.895   18.194  23.089  1.00 70.08  ? 16  DG  B N9    1 
ATOM   2990 C  C8    . DG  B 2 16  ? 2.160   17.238  22.138  1.00 70.17  ? 16  DG  B C8    1 
ATOM   2991 N  N7    . DG  B 2 16  ? 1.117   16.521  21.816  1.00 66.79  ? 16  DG  B N7    1 
ATOM   2992 C  C5    . DG  B 2 16  ? 0.094   17.035  22.605  1.00 61.96  ? 16  DG  B C5    1 
ATOM   2993 C  C6    . DG  B 2 16  ? -1.269  16.657  22.692  1.00 60.99  ? 16  DG  B C6    1 
ATOM   2994 O  O6    . DG  B 2 16  ? -1.861  15.763  22.068  1.00 60.75  ? 16  DG  B O6    1 
ATOM   2995 N  N1    . DG  B 2 16  ? -1.962  17.437  23.616  1.00 56.79  ? 16  DG  B N1    1 
ATOM   2996 C  C2    . DG  B 2 16  ? -1.407  18.453  24.361  1.00 61.14  ? 16  DG  B C2    1 
ATOM   2997 N  N2    . DG  B 2 16  ? -2.233  19.093  25.202  1.00 61.52  ? 16  DG  B N2    1 
ATOM   2998 N  N3    . DG  B 2 16  ? -0.132  18.816  24.288  1.00 65.85  ? 16  DG  B N3    1 
ATOM   2999 C  C4    . DG  B 2 16  ? 0.556   18.067  23.392  1.00 65.88  ? 16  DG  B C4    1 
ATOM   3000 P  P     . DC  B 2 17  ? 6.038   20.219  26.379  1.00 95.30  ? 17  DC  B P     1 
ATOM   3001 O  OP1   . DC  B 2 17  ? 6.851   21.433  26.619  1.00 95.90  ? 17  DC  B OP1   1 
ATOM   3002 O  OP2   . DC  B 2 17  ? 6.711   18.938  26.057  1.00 92.66  ? 17  DC  B OP2   1 
ATOM   3003 O  "O5'" . DC  B 2 17  ? 5.078   19.977  27.633  1.00 89.77  ? 17  DC  B "O5'" 1 
ATOM   3004 C  "C5'" . DC  B 2 17  ? 3.913   19.188  27.473  1.00 85.52  ? 17  DC  B "C5'" 1 
ATOM   3005 C  "C4'" . DC  B 2 17  ? 2.752   19.765  28.257  1.00 83.38  ? 17  DC  B "C4'" 1 
ATOM   3006 O  "O4'" . DC  B 2 17  ? 1.509   19.358  27.636  1.00 77.47  ? 17  DC  B "O4'" 1 
ATOM   3007 C  "C3'" . DC  B 2 17  ? 2.636   19.252  29.673  1.00 83.97  ? 17  DC  B "C3'" 1 
ATOM   3008 O  "O3'" . DC  B 2 17  ? 1.791   20.115  30.416  1.00 88.43  ? 17  DC  B "O3'" 1 
ATOM   3009 C  "C2'" . DC  B 2 17  ? 1.979   17.895  29.435  1.00 81.06  ? 17  DC  B "C2'" 1 
ATOM   3010 C  "C1'" . DC  B 2 17  ? 0.973   18.242  28.336  1.00 77.22  ? 17  DC  B "C1'" 1 
ATOM   3011 N  N1    . DC  B 2 17  ? 0.733   17.153  27.337  1.00 70.22  ? 17  DC  B N1    1 
ATOM   3012 C  C2    . DC  B 2 17  ? -0.571  16.688  27.116  1.00 65.09  ? 17  DC  B C2    1 
ATOM   3013 O  O2    . DC  B 2 17  ? -1.504  17.167  27.777  1.00 59.92  ? 17  DC  B O2    1 
ATOM   3014 N  N3    . DC  B 2 17  ? -0.774  15.715  26.190  1.00 62.23  ? 17  DC  B N3    1 
ATOM   3015 C  C4    . DC  B 2 17  ? 0.260   15.222  25.500  1.00 64.94  ? 17  DC  B C4    1 
ATOM   3016 N  N4    . DC  B 2 17  ? 0.011   14.266  24.597  1.00 63.24  ? 17  DC  B N4    1 
ATOM   3017 C  C5    . DC  B 2 17  ? 1.592   15.691  25.705  1.00 67.21  ? 17  DC  B C5    1 
ATOM   3018 C  C6    . DC  B 2 17  ? 1.779   16.649  26.620  1.00 66.89  ? 17  DC  B C6    1 
ATOM   3019 P  P     . DT  B 2 18  ? 1.801   20.073  32.021  1.00 95.80  ? 18  DT  B P     1 
ATOM   3020 O  OP1   . DT  B 2 18  ? 1.253   21.360  32.508  1.00 88.87  ? 18  DT  B OP1   1 
ATOM   3021 O  OP2   . DT  B 2 18  ? 3.152   19.636  32.439  1.00 86.00  ? 18  DT  B OP2   1 
ATOM   3022 O  "O5'" . DT  B 2 18  ? 0.770   18.903  32.378  1.00 85.24  ? 18  DT  B "O5'" 1 
ATOM   3023 C  "C5'" . DT  B 2 18  ? -0.576  18.964  31.904  1.00 84.70  ? 18  DT  B "C5'" 1 
ATOM   3024 C  "C4'" . DT  B 2 18  ? -1.403  17.821  32.471  1.00 79.71  ? 18  DT  B "C4'" 1 
ATOM   3025 O  "O4'" . DT  B 2 18  ? -1.510  16.753  31.490  1.00 81.22  ? 18  DT  B "O4'" 1 
ATOM   3026 C  "C3'" . DT  B 2 18  ? -0.831  17.175  33.727  1.00 80.81  ? 18  DT  B "C3'" 1 
ATOM   3027 O  "O3'" . DT  B 2 18  ? -1.889  16.768  34.582  1.00 84.64  ? 18  DT  B "O3'" 1 
ATOM   3028 C  "C2'" . DT  B 2 18  ? -0.069  15.976  33.167  1.00 75.09  ? 18  DT  B "C2'" 1 
ATOM   3029 C  "C1'" . DT  B 2 18  ? -0.975  15.555  32.022  1.00 71.40  ? 18  DT  B "C1'" 1 
ATOM   3030 N  N1    . DT  B 2 18  ? -0.270  14.835  30.919  1.00 66.45  ? 18  DT  B N1    1 
ATOM   3031 C  C2    . DT  B 2 18  ? -1.012  14.122  30.010  1.00 63.58  ? 18  DT  B C2    1 
ATOM   3032 O  O2    . DT  B 2 18  ? -2.227  14.045  30.060  1.00 63.90  ? 18  DT  B O2    1 
ATOM   3033 N  N3    . DT  B 2 18  ? -0.279  13.497  29.034  1.00 61.51  ? 18  DT  B N3    1 
ATOM   3034 C  C4    . DT  B 2 18  ? 1.096   13.517  28.879  1.00 65.27  ? 18  DT  B C4    1 
ATOM   3035 O  O4    . DT  B 2 18  ? 1.665   12.922  27.966  1.00 62.26  ? 18  DT  B O4    1 
ATOM   3036 C  C5    . DT  B 2 18  ? 1.816   14.286  29.868  1.00 67.23  ? 18  DT  B C5    1 
ATOM   3037 C  C7    . DT  B 2 18  ? 3.311   14.381  29.804  1.00 73.22  ? 18  DT  B C7    1 
ATOM   3038 C  C6    . DT  B 2 18  ? 1.106   14.899  30.830  1.00 66.25  ? 18  DT  B C6    1 
ATOM   3039 P  P     . DG  B 2 19  ? -2.293  17.668  35.850  1.00 94.27  ? 19  DG  B P     1 
ATOM   3040 O  OP1   . DG  B 2 19  ? -2.603  19.029  35.351  1.00 90.09  ? 19  DG  B OP1   1 
ATOM   3041 O  OP2   . DG  B 2 19  ? -1.253  17.473  36.885  1.00 74.57  ? 19  DG  B OP2   1 
ATOM   3042 O  "O5'" . DG  B 2 19  ? -3.640  16.990  36.382  1.00 82.65  ? 19  DG  B "O5'" 1 
ATOM   3043 C  "C5'" . DG  B 2 19  ? -4.570  16.440  35.457  1.00 76.79  ? 19  DG  B "C5'" 1 
ATOM   3044 C  "C4'" . DG  B 2 19  ? -4.738  14.946  35.681  1.00 74.99  ? 19  DG  B "C4'" 1 
ATOM   3045 O  "O4'" . DG  B 2 19  ? -3.854  14.207  34.791  1.00 75.03  ? 19  DG  B "O4'" 1 
ATOM   3046 C  "C3'" . DG  B 2 19  ? -4.404  14.456  37.091  1.00 73.59  ? 19  DG  B "C3'" 1 
ATOM   3047 O  "O3'" . DG  B 2 19  ? -5.287  13.410  37.442  1.00 74.21  ? 19  DG  B "O3'" 1 
ATOM   3048 C  "C2'" . DG  B 2 19  ? -2.986  13.922  36.917  1.00 71.31  ? 19  DG  B "C2'" 1 
ATOM   3049 C  "C1'" . DG  B 2 19  ? -3.126  13.276  35.554  1.00 64.58  ? 19  DG  B "C1'" 1 
ATOM   3050 N  N9    . DG  B 2 19  ? -1.862  12.998  34.887  1.00 60.67  ? 19  DG  B N9    1 
ATOM   3051 C  C8    . DG  B 2 19  ? -0.609  13.403  35.276  1.00 62.99  ? 19  DG  B C8    1 
ATOM   3052 N  N7    . DG  B 2 19  ? 0.340   12.995  34.476  1.00 64.34  ? 19  DG  B N7    1 
ATOM   3053 C  C5    . DG  B 2 19  ? -0.328  12.267  33.498  1.00 59.37  ? 19  DG  B C5    1 
ATOM   3054 C  C6    . DG  B 2 19  ? 0.175   11.584  32.365  1.00 58.00  ? 19  DG  B C6    1 
ATOM   3055 O  O6    . DG  B 2 19  ? 1.352   11.482  31.990  1.00 60.32  ? 19  DG  B O6    1 
ATOM   3056 N  N1    . DG  B 2 19  ? -0.843  10.974  31.635  1.00 57.83  ? 19  DG  B N1    1 
ATOM   3057 C  C2    . DG  B 2 19  ? -2.180  11.022  31.960  1.00 59.98  ? 19  DG  B C2    1 
ATOM   3058 N  N2    . DG  B 2 19  ? -3.017  10.373  31.136  1.00 54.03  ? 19  DG  B N2    1 
ATOM   3059 N  N3    . DG  B 2 19  ? -2.665  11.661  33.018  1.00 58.33  ? 19  DG  B N3    1 
ATOM   3060 C  C4    . DG  B 2 19  ? -1.684  12.257  33.740  1.00 60.80  ? 19  DG  B C4    1 
ATOM   3061 P  P     . DG  B 2 20  ? -6.587  13.701  38.336  1.00 91.13  ? 20  DG  B P     1 
ATOM   3062 O  OP1   . DG  B 2 20  ? -7.396  14.712  37.619  1.00 87.80  ? 20  DG  B OP1   1 
ATOM   3063 O  OP2   . DG  B 2 20  ? -6.143  13.966  39.723  1.00 83.81  ? 20  DG  B OP2   1 
ATOM   3064 O  "O5'" . DG  B 2 20  ? -7.371  12.304  38.323  1.00 80.12  ? 20  DG  B "O5'" 1 
ATOM   3065 C  "C5'" . DG  B 2 20  ? -8.252  11.997  37.249  1.00 72.85  ? 20  DG  B "C5'" 1 
ATOM   3066 C  "C4'" . DG  B 2 20  ? -7.868  10.689  36.572  1.00 70.84  ? 20  DG  B "C4'" 1 
ATOM   3067 O  "O4'" . DG  B 2 20  ? -6.497  10.747  36.123  1.00 71.57  ? 20  DG  B "O4'" 1 
ATOM   3068 C  "C3'" . DG  B 2 20  ? -7.981  9.433   37.443  1.00 70.43  ? 20  DG  B "C3'" 1 
ATOM   3069 O  "O3'" . DG  B 2 20  ? -8.919  8.538   36.853  1.00 72.45  ? 20  DG  B "O3'" 1 
ATOM   3070 C  "C2'" . DG  B 2 20  ? -6.554  8.851   37.459  1.00 67.15  ? 20  DG  B "C2'" 1 
ATOM   3071 C  "C1'" . DG  B 2 20  ? -5.940  9.462   36.212  1.00 59.92  ? 20  DG  B "C1'" 1 
ATOM   3072 N  N9    . DG  B 2 20  ? -4.487  9.605   36.265  1.00 53.44  ? 20  DG  B N9    1 
ATOM   3073 C  C8    . DG  B 2 20  ? -3.758  10.311  37.190  1.00 56.23  ? 20  DG  B C8    1 
ATOM   3074 N  N7    . DG  B 2 20  ? -2.472  10.281  36.972  1.00 54.92  ? 20  DG  B N7    1 
ATOM   3075 C  C5    . DG  B 2 20  ? -2.338  9.512   35.823  1.00 49.90  ? 20  DG  B C5    1 
ATOM   3076 C  C6    . DG  B 2 20  ? -1.176  9.134   35.107  1.00 53.01  ? 20  DG  B C6    1 
ATOM   3077 O  O6    . DG  B 2 20  ? 0.006   9.413   35.357  1.00 55.60  ? 20  DG  B O6    1 
ATOM   3078 N  N1    . DG  B 2 20  ? -1.485  8.349   33.998  1.00 53.30  ? 20  DG  B N1    1 
ATOM   3079 C  C2    . DG  B 2 20  ? -2.755  7.980   33.624  1.00 52.91  ? 20  DG  B C2    1 
ATOM   3080 N  N2    . DG  B 2 20  ? -2.852  7.222   32.523  1.00 51.09  ? 20  DG  B N2    1 
ATOM   3081 N  N3    . DG  B 2 20  ? -3.855  8.328   34.285  1.00 50.96  ? 20  DG  B N3    1 
ATOM   3082 C  C4    . DG  B 2 20  ? -3.571  9.091   35.371  1.00 53.09  ? 20  DG  B C4    1 
ATOM   3083 P  P     . DA  B 2 21  ? -9.179  7.078   37.474  1.00 75.67  ? 21  DA  B P     1 
ATOM   3084 O  OP1   . DA  B 2 21  ? -10.607 6.760   37.249  1.00 74.38  ? 21  DA  B OP1   1 
ATOM   3085 O  OP2   . DA  B 2 21  ? -8.624  7.024   38.844  1.00 78.52  ? 21  DA  B OP2   1 
ATOM   3086 O  "O5'" . DA  B 2 21  ? -8.319  6.119   36.534  1.00 63.74  ? 21  DA  B "O5'" 1 
ATOM   3087 C  "C5'" . DA  B 2 21  ? -8.579  6.100   35.145  1.00 58.33  ? 21  DA  B "C5'" 1 
ATOM   3088 C  "C4'" . DA  B 2 21  ? -7.626  5.168   34.428  1.00 55.58  ? 21  DA  B "C4'" 1 
ATOM   3089 O  "O4'" . DA  B 2 21  ? -6.271  5.670   34.545  1.00 56.05  ? 21  DA  B "O4'" 1 
ATOM   3090 C  "C3'" . DA  B 2 21  ? -7.603  3.738   34.954  1.00 60.34  ? 21  DA  B "C3'" 1 
ATOM   3091 O  "O3'" . DA  B 2 21  ? -7.571  2.839   33.860  1.00 57.06  ? 21  DA  B "O3'" 1 
ATOM   3092 C  "C2'" . DA  B 2 21  ? -6.313  3.684   35.780  1.00 54.85  ? 21  DA  B "C2'" 1 
ATOM   3093 C  "C1'" . DA  B 2 21  ? -5.420  4.654   35.021  1.00 54.22  ? 21  DA  B "C1'" 1 
ATOM   3094 N  N9    . DA  B 2 21  ? -4.391  5.286   35.844  1.00 51.46  ? 21  DA  B N9    1 
ATOM   3095 C  C8    . DA  B 2 21  ? -4.583  6.030   36.976  1.00 51.77  ? 21  DA  B C8    1 
ATOM   3096 N  N7    . DA  B 2 21  ? -3.472  6.497   37.496  1.00 52.71  ? 21  DA  B N7    1 
ATOM   3097 C  C5    . DA  B 2 21  ? -2.483  6.038   36.639  1.00 45.21  ? 21  DA  B C5    1 
ATOM   3098 C  C6    . DA  B 2 21  ? -1.083  6.192   36.636  1.00 44.90  ? 21  DA  B C6    1 
ATOM   3099 N  N6    . DA  B 2 21  ? -0.418  6.884   37.565  1.00 47.28  ? 21  DA  B N6    1 
ATOM   3100 N  N1    . DA  B 2 21  ? -0.390  5.605   35.639  1.00 48.07  ? 21  DA  B N1    1 
ATOM   3101 C  C2    . DA  B 2 21  ? -1.058  4.915   34.710  1.00 50.97  ? 21  DA  B C2    1 
ATOM   3102 N  N3    . DA  B 2 21  ? -2.371  4.700   34.608  1.00 52.36  ? 21  DA  B N3    1 
ATOM   3103 C  C4    . DA  B 2 21  ? -3.032  5.294   35.614  1.00 45.50  ? 21  DA  B C4    1 
ATOM   3104 P  P     . DT  B 2 22  ? -7.674  1.258   34.104  1.00 60.44  ? 22  DT  B P     1 
ATOM   3105 O  OP1   . DT  B 2 22  ? -8.417  0.678   32.963  1.00 72.66  ? 22  DT  B OP1   1 
ATOM   3106 O  OP2   . DT  B 2 22  ? -8.164  1.048   35.484  1.00 61.55  ? 22  DT  B OP2   1 
ATOM   3107 O  "O5'" . DT  B 2 22  ? -6.158  0.772   34.000  1.00 55.99  ? 22  DT  B "O5'" 1 
ATOM   3108 C  "C5'" . DT  B 2 22  ? -5.390  1.135   32.868  1.00 56.25  ? 22  DT  B "C5'" 1 
ATOM   3109 C  "C4'" . DT  B 2 22  ? -3.956  0.663   33.008  1.00 55.58  ? 22  DT  B "C4'" 1 
ATOM   3110 O  "O4'" . DT  B 2 22  ? -3.229  1.549   33.893  1.00 57.13  ? 22  DT  B "O4'" 1 
ATOM   3111 C  "C3'" . DT  B 2 22  ? -3.783  -0.749  33.572  1.00 58.18  ? 22  DT  B "C3'" 1 
ATOM   3112 O  "O3'" . DT  B 2 22  ? -2.954  -1.499  32.693  1.00 61.65  ? 22  DT  B "O3'" 1 
ATOM   3113 C  "C2'" . DT  B 2 22  ? -3.119  -0.523  34.942  1.00 52.22  ? 22  DT  B "C2'" 1 
ATOM   3114 C  "C1'" . DT  B 2 22  ? -2.384  0.788   34.719  1.00 51.48  ? 22  DT  B "C1'" 1 
ATOM   3115 N  N1    . DT  B 2 22  ? -2.128  1.587   35.962  1.00 49.63  ? 22  DT  B N1    1 
ATOM   3116 C  C2    . DT  B 2 22  ? -0.836  1.948   36.278  1.00 47.99  ? 22  DT  B C2    1 
ATOM   3117 O  O2    . DT  B 2 22  ? 0.130   1.623   35.611  1.00 50.65  ? 22  DT  B O2    1 
ATOM   3118 N  N3    . DT  B 2 22  ? -0.712  2.701   37.416  1.00 41.95  ? 22  DT  B N3    1 
ATOM   3119 C  C4    . DT  B 2 22  ? -1.730  3.127   38.249  1.00 49.88  ? 22  DT  B C4    1 
ATOM   3120 O  O4    . DT  B 2 22  ? -1.519  3.804   39.253  1.00 49.36  ? 22  DT  B O4    1 
ATOM   3121 C  C5    . DT  B 2 22  ? -3.060  2.722   37.856  1.00 46.72  ? 22  DT  B C5    1 
ATOM   3122 C  C7    . DT  B 2 22  ? -4.245  3.124   38.684  1.00 41.25  ? 22  DT  B C7    1 
ATOM   3123 C  C6    . DT  B 2 22  ? -3.193  1.986   36.742  1.00 47.48  ? 22  DT  B C6    1 
ATOM   3124 P  P     . DC  B 2 23  ? -2.773  -3.081  32.884  1.00 61.28  ? 23  DC  B P     1 
ATOM   3125 O  OP1   . DC  B 2 23  ? -2.681  -3.687  31.538  1.00 67.99  ? 23  DC  B OP1   1 
ATOM   3126 O  OP2   . DC  B 2 23  ? -3.829  -3.548  33.810  1.00 65.79  ? 23  DC  B OP2   1 
ATOM   3127 O  "O5'" . DC  B 2 23  ? -1.343  -3.198  33.599  1.00 64.60  ? 23  DC  B "O5'" 1 
ATOM   3128 C  "C5'" . DC  B 2 23  ? -0.249  -2.425  33.098  1.00 58.42  ? 23  DC  B "C5'" 1 
ATOM   3129 C  "C4'" . DC  B 2 23  ? 1.039   -2.699  33.863  1.00 55.76  ? 23  DC  B "C4'" 1 
ATOM   3130 O  "O4'" . DC  B 2 23  ? 1.174   -1.768  34.965  1.00 57.13  ? 23  DC  B "O4'" 1 
ATOM   3131 C  "C3'" . DC  B 2 23  ? 1.174   -4.089  34.468  1.00 58.29  ? 23  DC  B "C3'" 1 
ATOM   3132 O  "O3'" . DC  B 2 23  ? 2.525   -4.506  34.361  1.00 53.61  ? 23  DC  B "O3'" 1 
ATOM   3133 C  "C2'" . DC  B 2 23  ? 0.765   -3.864  35.927  1.00 53.41  ? 23  DC  B "C2'" 1 
ATOM   3134 C  "C1'" . DC  B 2 23  ? 1.319   -2.472  36.185  1.00 49.75  ? 23  DC  B "C1'" 1 
ATOM   3135 N  N1    . DC  B 2 23  ? 0.586   -1.698  37.219  1.00 46.17  ? 23  DC  B N1    1 
ATOM   3136 C  C2    . DC  B 2 23  ? 1.300   -0.898  38.113  1.00 48.72  ? 23  DC  B C2    1 
ATOM   3137 O  O2    . DC  B 2 23  ? 2.535   -0.882  38.048  1.00 48.81  ? 23  DC  B O2    1 
ATOM   3138 N  N3    . DC  B 2 23  ? 0.617   -0.169  39.034  1.00 44.27  ? 23  DC  B N3    1 
ATOM   3139 C  C4    . DC  B 2 23  ? -0.717  -0.216  39.066  1.00 44.62  ? 23  DC  B C4    1 
ATOM   3140 N  N4    . DC  B 2 23  ? -1.347  0.516   39.990  1.00 44.35  ? 23  DC  B N4    1 
ATOM   3141 C  C5    . DC  B 2 23  ? -1.462  -1.018  38.152  1.00 43.67  ? 23  DC  B C5    1 
ATOM   3142 C  C6    . DC  B 2 23  ? -0.776  -1.730  37.251  1.00 44.62  ? 23  DC  B C6    1 
ATOM   3143 P  P     . DC  B 2 24  ? 2.892   -6.066  34.324  1.00 63.09  ? 24  DC  B P     1 
ATOM   3144 O  OP1   . DC  B 2 24  ? 3.940   -6.251  33.294  1.00 58.48  ? 24  DC  B OP1   1 
ATOM   3145 O  OP2   . DC  B 2 24  ? 1.625   -6.827  34.238  1.00 57.47  ? 24  DC  B OP2   1 
ATOM   3146 O  "O5'" . DC  B 2 24  ? 3.557   -6.323  35.756  1.00 61.63  ? 24  DC  B "O5'" 1 
ATOM   3147 C  "C5'" . DC  B 2 24  ? 4.844   -5.785  36.035  1.00 54.07  ? 24  DC  B "C5'" 1 
ATOM   3148 C  "C4'" . DC  B 2 24  ? 5.101   -5.719  37.529  1.00 52.85  ? 24  DC  B "C4'" 1 
ATOM   3149 O  "O4'" . DC  B 2 24  ? 4.305   -4.676  38.117  1.00 49.58  ? 24  DC  B "O4'" 1 
ATOM   3150 C  "C3'" . DC  B 2 24  ? 4.748   -6.986  38.308  1.00 53.53  ? 24  DC  B "C3'" 1 
ATOM   3151 O  "O3'" . DC  B 2 24  ? 5.933   -7.695  38.641  1.00 62.51  ? 24  DC  B "O3'" 1 
ATOM   3152 C  "C2'" . DC  B 2 24  ? 4.016   -6.476  39.566  1.00 47.72  ? 24  DC  B "C2'" 1 
ATOM   3153 C  "C1'" . DC  B 2 24  ? 4.181   -4.962  39.479  1.00 46.81  ? 24  DC  B "C1'" 1 
ATOM   3154 N  N1    . DC  B 2 24  ? 3.028   -4.202  40.021  1.00 45.24  ? 24  DC  B N1    1 
ATOM   3155 C  C2    . DC  B 2 24  ? 3.250   -3.203  40.973  1.00 45.09  ? 24  DC  B C2    1 
ATOM   3156 O  O2    . DC  B 2 24  ? 4.406   -2.970  41.342  1.00 46.25  ? 24  DC  B O2    1 
ATOM   3157 N  N3    . DC  B 2 24  ? 2.190   -2.517  41.465  1.00 47.60  ? 24  DC  B N3    1 
ATOM   3158 C  C4    . DC  B 2 24  ? 0.956   -2.797  41.038  1.00 45.33  ? 24  DC  B C4    1 
ATOM   3159 N  N4    . DC  B 2 24  ? -0.058  -2.091  41.554  1.00 43.03  ? 24  DC  B N4    1 
ATOM   3160 C  C5    . DC  B 2 24  ? 0.709   -3.813  40.067  1.00 39.63  ? 24  DC  B C5    1 
ATOM   3161 C  C6    . DC  B 2 24  ? 1.765   -4.485  39.591  1.00 43.85  ? 24  DC  B C6    1 
ATOM   3162 O  "O5'" . DG  C 3 1   ? 2.329   4.332   50.283  1.00 68.16  ? 1   DG  C "O5'" 1 
ATOM   3163 C  "C5'" . DG  C 3 1   ? 2.698   3.120   49.641  1.00 56.53  ? 1   DG  C "C5'" 1 
ATOM   3164 C  "C4'" . DG  C 3 1   ? 4.171   3.116   49.283  1.00 53.21  ? 1   DG  C "C4'" 1 
ATOM   3165 O  "O4'" . DG  C 3 1   ? 4.394   2.156   48.231  1.00 59.87  ? 1   DG  C "O4'" 1 
ATOM   3166 C  "C3'" . DG  C 3 1   ? 4.689   4.408   48.693  1.00 53.41  ? 1   DG  C "C3'" 1 
ATOM   3167 O  "O3'" . DG  C 3 1   ? 6.115   4.400   48.725  1.00 60.56  ? 1   DG  C "O3'" 1 
ATOM   3168 C  "C2'" . DG  C 3 1   ? 4.162   4.312   47.264  1.00 52.64  ? 1   DG  C "C2'" 1 
ATOM   3169 C  "C1'" . DG  C 3 1   ? 4.290   2.810   46.975  1.00 54.87  ? 1   DG  C "C1'" 1 
ATOM   3170 N  N9    . DG  C 3 1   ? 3.141   2.247   46.274  1.00 48.04  ? 1   DG  C N9    1 
ATOM   3171 C  C8    . DG  C 3 1   ? 1.824   2.609   46.421  1.00 45.46  ? 1   DG  C C8    1 
ATOM   3172 N  N7    . DG  C 3 1   ? 1.009   1.921   45.670  1.00 47.43  ? 1   DG  C N7    1 
ATOM   3173 C  C5    . DG  C 3 1   ? 1.840   1.042   44.983  1.00 49.59  ? 1   DG  C C5    1 
ATOM   3174 C  C6    . DG  C 3 1   ? 1.527   0.048   44.024  1.00 46.98  ? 1   DG  C C6    1 
ATOM   3175 O  O6    . DG  C 3 1   ? 0.414   -0.267  43.576  1.00 50.46  ? 1   DG  C O6    1 
ATOM   3176 N  N1    . DG  C 3 1   ? 2.666   -0.614  43.579  1.00 43.14  ? 1   DG  C N1    1 
ATOM   3177 C  C2    . DG  C 3 1   ? 3.943   -0.355  44.005  1.00 44.90  ? 1   DG  C C2    1 
ATOM   3178 N  N2    . DG  C 3 1   ? 4.913   -1.100  43.457  1.00 42.17  ? 1   DG  C N2    1 
ATOM   3179 N  N3    . DG  C 3 1   ? 4.252   0.573   44.902  1.00 48.56  ? 1   DG  C N3    1 
ATOM   3180 C  C4    . DG  C 3 1   ? 3.155   1.229   45.347  1.00 45.59  ? 1   DG  C C4    1 
ATOM   3181 P  P     . DG  C 3 2   ? 6.957   5.657   48.185  1.00 65.04  ? 2   DG  C P     1 
ATOM   3182 O  OP1   . DG  C 3 2   ? 8.296   5.596   48.817  1.00 67.51  ? 2   DG  C OP1   1 
ATOM   3183 O  OP2   . DG  C 3 2   ? 6.113   6.863   48.344  1.00 55.41  ? 2   DG  C OP2   1 
ATOM   3184 O  "O5'" . DG  C 3 2   ? 7.130   5.355   46.626  1.00 57.21  ? 2   DG  C "O5'" 1 
ATOM   3185 C  "C5'" . DG  C 3 2   ? 7.680   4.113   46.207  1.00 57.03  ? 2   DG  C "C5'" 1 
ATOM   3186 C  "C4'" . DG  C 3 2   ? 7.615   3.968   44.695  1.00 68.17  ? 2   DG  C "C4'" 1 
ATOM   3187 O  "O4'" . DG  C 3 2   ? 6.336   3.406   44.296  1.00 65.72  ? 2   DG  C "O4'" 1 
ATOM   3188 C  "C3'" . DG  C 3 2   ? 7.774   5.271   43.900  1.00 68.16  ? 2   DG  C "C3'" 1 
ATOM   3189 O  "O3'" . DG  C 3 2   ? 8.716   5.066   42.871  1.00 73.49  ? 2   DG  C "O3'" 1 
ATOM   3190 C  "C2'" . DG  C 3 2   ? 6.371   5.513   43.330  1.00 61.31  ? 2   DG  C "C2'" 1 
ATOM   3191 C  "C1'" . DG  C 3 2   ? 5.882   4.088   43.149  1.00 61.22  ? 2   DG  C "C1'" 1 
ATOM   3192 N  N9    . DG  C 3 2   ? 4.427   3.952   43.072  1.00 52.55  ? 2   DG  C N9    1 
ATOM   3193 C  C8    . DG  C 3 2   ? 3.486   4.668   43.774  1.00 47.97  ? 2   DG  C C8    1 
ATOM   3194 N  N7    . DG  C 3 2   ? 2.259   4.317   43.504  1.00 44.62  ? 2   DG  C N7    1 
ATOM   3195 C  C5    . DG  C 3 2   ? 2.394   3.299   42.567  1.00 44.19  ? 2   DG  C C5    1 
ATOM   3196 C  C6    . DG  C 3 2   ? 1.405   2.531   41.902  1.00 45.23  ? 2   DG  C C6    1 
ATOM   3197 O  O6    . DG  C 3 2   ? 0.165   2.593   42.023  1.00 50.88  ? 2   DG  C O6    1 
ATOM   3198 N  N1    . DG  C 3 2   ? 1.976   1.604   41.029  1.00 43.89  ? 2   DG  C N1    1 
ATOM   3199 C  C2    . DG  C 3 2   ? 3.328   1.443   40.826  1.00 45.04  ? 2   DG  C C2    1 
ATOM   3200 N  N2    . DG  C 3 2   ? 3.691   0.500   39.944  1.00 47.56  ? 2   DG  C N2    1 
ATOM   3201 N  N3    . DG  C 3 2   ? 4.260   2.157   41.442  1.00 46.94  ? 2   DG  C N3    1 
ATOM   3202 C  C4    . DG  C 3 2   ? 3.722   3.063   42.292  1.00 44.86  ? 2   DG  C C4    1 
ATOM   3203 P  P     . DA  C 3 3   ? 9.496   6.300   42.204  1.00 83.20  ? 3   DA  C P     1 
ATOM   3204 O  OP1   . DA  C 3 3   ? 10.810  6.396   42.878  1.00 83.58  ? 3   DA  C OP1   1 
ATOM   3205 O  OP2   . DA  C 3 3   ? 8.600   7.479   42.170  1.00 67.76  ? 3   DA  C OP2   1 
ATOM   3206 O  "O5'" . DA  C 3 3   ? 9.727   5.796   40.707  1.00 75.43  ? 3   DA  C "O5'" 1 
ATOM   3207 C  "C5'" . DA  C 3 3   ? 10.080  4.437   40.482  1.00 70.58  ? 3   DA  C "C5'" 1 
ATOM   3208 C  "C4'" . DA  C 3 3   ? 9.463   3.918   39.197  1.00 71.79  ? 3   DA  C "C4'" 1 
ATOM   3209 O  "O4'" . DA  C 3 3   ? 8.047   3.651   39.393  1.00 67.42  ? 3   DA  C "O4'" 1 
ATOM   3210 C  "C3'" . DA  C 3 3   ? 9.557   4.874   38.007  1.00 68.98  ? 3   DA  C "C3'" 1 
ATOM   3211 O  "O3'" . DA  C 3 3   ? 9.991   4.167   36.864  1.00 65.04  ? 3   DA  C "O3'" 1 
ATOM   3212 C  "C2'" . DA  C 3 3   ? 8.125   5.380   37.843  1.00 67.61  ? 3   DA  C "C2'" 1 
ATOM   3213 C  "C1'" . DA  C 3 3   ? 7.328   4.174   38.301  1.00 64.41  ? 3   DA  C "C1'" 1 
ATOM   3214 N  N9    . DA  C 3 3   ? 5.979   4.504   38.744  1.00 56.84  ? 3   DA  C N9    1 
ATOM   3215 C  C8    . DA  C 3 3   ? 5.618   5.471   39.642  1.00 54.49  ? 3   DA  C C8    1 
ATOM   3216 N  N7    . DA  C 3 3   ? 4.324   5.545   39.847  1.00 50.54  ? 3   DA  C N7    1 
ATOM   3217 C  C5    . DA  C 3 3   ? 3.801   4.559   39.024  1.00 49.44  ? 3   DA  C C5    1 
ATOM   3218 C  C6    . DA  C 3 3   ? 2.483   4.125   38.783  1.00 46.56  ? 3   DA  C C6    1 
ATOM   3219 N  N6    . DA  C 3 3   ? 1.413   4.662   39.376  1.00 42.40  ? 3   DA  C N6    1 
ATOM   3220 N  N1    . DA  C 3 3   ? 2.308   3.116   37.902  1.00 50.04  ? 3   DA  C N1    1 
ATOM   3221 C  C2    . DA  C 3 3   ? 3.383   2.581   37.309  1.00 48.76  ? 3   DA  C C2    1 
ATOM   3222 N  N3    . DA  C 3 3   ? 4.667   2.903   37.457  1.00 51.92  ? 3   DA  C N3    1 
ATOM   3223 C  C4    . DA  C 3 3   ? 4.808   3.909   38.337  1.00 52.06  ? 3   DA  C C4    1 
ATOM   3224 P  P     . DT  C 3 4   ? 10.229  4.944   35.481  1.00 70.38  ? 4   DT  C P     1 
ATOM   3225 O  OP1   . DT  C 3 4   ? 11.367  4.281   34.804  1.00 67.49  ? 4   DT  C OP1   1 
ATOM   3226 O  OP2   . DT  C 3 4   ? 10.276  6.397   35.762  1.00 66.46  ? 4   DT  C OP2   1 
ATOM   3227 O  "O5'" . DT  C 3 4   ? 8.889   4.655   34.666  1.00 73.06  ? 4   DT  C "O5'" 1 
ATOM   3228 C  "C5'" . DT  C 3 4   ? 8.378   3.334   34.609  1.00 70.04  ? 4   DT  C "C5'" 1 
ATOM   3229 C  "C4'" . DT  C 3 4   ? 7.137   3.278   33.744  1.00 67.84  ? 4   DT  C "C4'" 1 
ATOM   3230 O  "O4'" . DT  C 3 4   ? 5.979   3.629   34.534  1.00 67.76  ? 4   DT  C "O4'" 1 
ATOM   3231 C  "C3'" . DT  C 3 4   ? 7.150   4.224   32.542  1.00 69.85  ? 4   DT  C "C3'" 1 
ATOM   3232 O  "O3'" . DT  C 3 4   ? 6.922   3.474   31.354  1.00 77.86  ? 4   DT  C "O3'" 1 
ATOM   3233 C  "C2'" . DT  C 3 4   ? 6.021   5.224   32.833  1.00 62.43  ? 4   DT  C "C2'" 1 
ATOM   3234 C  "C1'" . DT  C 3 4   ? 5.120   4.436   33.771  1.00 64.37  ? 4   DT  C "C1'" 1 
ATOM   3235 N  N1    . DT  C 3 4   ? 4.340   5.284   34.712  1.00 56.92  ? 4   DT  C N1    1 
ATOM   3236 C  C2    . DT  C 3 4   ? 2.985   5.086   34.825  1.00 57.56  ? 4   DT  C C2    1 
ATOM   3237 O  O2    . DT  C 3 4   ? 2.377   4.252   34.177  1.00 57.38  ? 4   DT  C O2    1 
ATOM   3238 N  N3    . DT  C 3 4   ? 2.360   5.906   35.725  1.00 51.18  ? 4   DT  C N3    1 
ATOM   3239 C  C4    . DT  C 3 4   ? 2.941   6.879   36.512  1.00 49.08  ? 4   DT  C C4    1 
ATOM   3240 O  O4    . DT  C 3 4   ? 2.290   7.564   37.296  1.00 54.23  ? 4   DT  C O4    1 
ATOM   3241 C  C5    . DT  C 3 4   ? 4.366   7.033   36.349  1.00 54.74  ? 4   DT  C C5    1 
ATOM   3242 C  C7    . DT  C 3 4   ? 5.109   8.061   37.151  1.00 52.81  ? 4   DT  C C7    1 
ATOM   3243 C  C6    . DT  C 3 4   ? 4.991   6.234   35.469  1.00 54.79  ? 4   DT  C C6    1 
ATOM   3244 P  P     . DC  C 3 5   ? 6.715   4.204   29.938  1.00 83.98  ? 5   DC  C P     1 
ATOM   3245 O  OP1   . DC  C 3 5   ? 7.210   3.263   28.908  1.00 78.22  ? 5   DC  C OP1   1 
ATOM   3246 O  OP2   . DC  C 3 5   ? 7.275   5.576   30.006  1.00 71.67  ? 5   DC  C OP2   1 
ATOM   3247 O  "O5'" . DC  C 3 5   ? 5.125   4.299   29.813  1.00 69.72  ? 5   DC  C "O5'" 1 
ATOM   3248 C  "C5'" . DC  C 3 5   ? 4.324   3.240   30.327  1.00 68.19  ? 5   DC  C "C5'" 1 
ATOM   3249 C  "C4'" . DC  C 3 5   ? 2.879   3.367   29.879  1.00 70.47  ? 5   DC  C "C4'" 1 
ATOM   3250 O  "O4'" . DC  C 3 5   ? 2.116   4.124   30.854  1.00 67.31  ? 5   DC  C "O4'" 1 
ATOM   3251 C  "C3'" . DC  C 3 5   ? 2.664   4.076   28.553  1.00 66.46  ? 5   DC  C "C3'" 1 
ATOM   3252 O  "O3'" . DC  C 3 5   ? 1.504   3.543   27.948  1.00 73.52  ? 5   DC  C "O3'" 1 
ATOM   3253 C  "C2'" . DC  C 3 5   ? 2.446   5.523   28.996  1.00 69.12  ? 5   DC  C "C2'" 1 
ATOM   3254 C  "C1'" . DC  C 3 5   ? 1.631   5.322   30.267  1.00 64.56  ? 5   DC  C "C1'" 1 
ATOM   3255 N  N1    . DC  C 3 5   ? 1.782   6.399   31.281  1.00 59.08  ? 5   DC  C N1    1 
ATOM   3256 C  C2    . DC  C 3 5   ? 0.665   6.814   32.019  1.00 61.00  ? 5   DC  C C2    1 
ATOM   3257 O  O2    . DC  C 3 5   ? -0.439  6.302   31.785  1.00 59.60  ? 5   DC  C O2    1 
ATOM   3258 N  N3    . DC  C 3 5   ? 0.822   7.774   32.964  1.00 56.72  ? 5   DC  C N3    1 
ATOM   3259 C  C4    . DC  C 3 5   ? 2.027   8.299   33.187  1.00 56.75  ? 5   DC  C C4    1 
ATOM   3260 N  N4    . DC  C 3 5   ? 2.131   9.242   34.130  1.00 56.75  ? 5   DC  C N4    1 
ATOM   3261 C  C5    . DC  C 3 5   ? 3.179   7.881   32.455  1.00 55.89  ? 5   DC  C C5    1 
ATOM   3262 C  C6    . DC  C 3 5   ? 3.012   6.934   31.525  1.00 58.17  ? 5   DC  C C6    1 
ATOM   3263 P  P     . DC  C 3 6   ? 1.413   3.361   26.357  1.00 85.01  ? 6   DC  C P     1 
ATOM   3264 O  OP1   . DC  C 3 6   ? 1.271   1.913   26.089  1.00 71.18  ? 6   DC  C OP1   1 
ATOM   3265 O  OP2   . DC  C 3 6   ? 2.513   4.131   25.728  1.00 75.41  ? 6   DC  C OP2   1 
ATOM   3266 O  "O5'" . DC  C 3 6   ? 0.040   4.088   25.999  1.00 75.58  ? 6   DC  C "O5'" 1 
ATOM   3267 C  "C5'" . DC  C 3 6   ? -1.042  4.022   26.913  1.00 69.29  ? 6   DC  C "C5'" 1 
ATOM   3268 C  "C4'" . DC  C 3 6   ? -1.886  5.278   26.830  1.00 69.26  ? 6   DC  C "C4'" 1 
ATOM   3269 O  "O4'" . DC  C 3 6   ? -1.410  6.258   27.793  1.00 71.92  ? 6   DC  C "O4'" 1 
ATOM   3270 C  "C3'" . DC  C 3 6   ? -1.864  5.974   25.470  1.00 69.39  ? 6   DC  C "C3'" 1 
ATOM   3271 O  "O3'" . DC  C 3 6   ? -3.165  6.409   25.143  1.00 69.41  ? 6   DC  C "O3'" 1 
ATOM   3272 C  "C2'" . DC  C 3 6   ? -0.927  7.157   25.702  1.00 64.98  ? 6   DC  C "C2'" 1 
ATOM   3273 C  "C1'" . DC  C 3 6   ? -1.245  7.498   27.147  1.00 67.17  ? 6   DC  C "C1'" 1 
ATOM   3274 N  N1    . DC  C 3 6   ? -0.164  8.254   27.835  1.00 62.02  ? 6   DC  C N1    1 
ATOM   3275 C  C2    . DC  C 3 6   ? -0.458  8.983   28.995  1.00 61.75  ? 6   DC  C C2    1 
ATOM   3276 O  O2    . DC  C 3 6   ? -1.616  8.981   29.432  1.00 59.97  ? 6   DC  C O2    1 
ATOM   3277 N  N3    . DC  C 3 6   ? 0.539   9.669   29.609  1.00 61.04  ? 6   DC  C N3    1 
ATOM   3278 C  C4    . DC  C 3 6   ? 1.776   9.644   29.102  1.00 63.67  ? 6   DC  C C4    1 
ATOM   3279 N  N4    . DC  C 3 6   ? 2.729   10.335  29.739  1.00 61.97  ? 6   DC  C N4    1 
ATOM   3280 C  C5    . DC  C 3 6   ? 2.091   8.909   27.920  1.00 64.17  ? 6   DC  C C5    1 
ATOM   3281 C  C6    . DC  C 3 6   ? 1.101   8.238   27.324  1.00 61.59  ? 6   DC  C C6    1 
ATOM   3282 P  P     . DA  C 3 7   ? -4.110  5.517   24.201  1.00 66.38  ? 7   DA  C P     1 
ATOM   3283 O  OP1   . DA  C 3 7   ? -3.900  4.090   24.535  1.00 64.73  ? 7   DA  C OP1   1 
ATOM   3284 O  OP2   . DA  C 3 7   ? -3.900  5.974   22.810  1.00 67.49  ? 7   DA  C OP2   1 
ATOM   3285 O  "O5'" . DA  C 3 7   ? -5.578  5.944   24.662  1.00 58.55  ? 7   DA  C "O5'" 1 
ATOM   3286 C  "C5'" . DA  C 3 7   ? -5.895  5.969   26.045  1.00 62.34  ? 7   DA  C "C5'" 1 
ATOM   3287 C  "C4'" . DA  C 3 7   ? -6.983  6.987   26.352  1.00 65.84  ? 7   DA  C "C4'" 1 
ATOM   3288 O  "O4'" . DA  C 3 7   ? -6.396  8.186   26.908  1.00 64.47  ? 7   DA  C "O4'" 1 
ATOM   3289 C  "C3'" . DA  C 3 7   ? -7.806  7.460   25.167  1.00 61.29  ? 7   DA  C "C3'" 1 
ATOM   3290 O  "O3'" . DA  C 3 7   ? -9.102  7.834   25.625  1.00 68.66  ? 7   DA  C "O3'" 1 
ATOM   3291 C  "C2'" . DA  C 3 7   ? -7.006  8.662   24.659  1.00 64.44  ? 7   DA  C "C2'" 1 
ATOM   3292 C  "C1'" . DA  C 3 7   ? -6.358  9.212   25.932  1.00 67.43  ? 7   DA  C "C1'" 1 
ATOM   3293 N  N9    . DA  C 3 7   ? -4.962  9.599   25.753  1.00 63.83  ? 7   DA  C N9    1 
ATOM   3294 C  C8    . DA  C 3 7   ? -4.099  9.150   24.792  1.00 57.69  ? 7   DA  C C8    1 
ATOM   3295 N  N7    . DA  C 3 7   ? -2.895  9.658   24.886  1.00 60.13  ? 7   DA  C N7    1 
ATOM   3296 C  C5    . DA  C 3 7   ? -2.973  10.496  25.986  1.00 56.67  ? 7   DA  C C5    1 
ATOM   3297 C  C6    . DA  C 3 7   ? -2.025  11.331  26.615  1.00 60.29  ? 7   DA  C C6    1 
ATOM   3298 N  N6    . DA  C 3 7   ? -0.761  11.457  26.196  1.00 56.43  ? 7   DA  C N6    1 
ATOM   3299 N  N1    . DA  C 3 7   ? -2.430  12.034  27.696  1.00 58.99  ? 7   DA  C N1    1 
ATOM   3300 C  C2    . DA  C 3 7   ? -3.697  11.905  28.113  1.00 58.99  ? 7   DA  C C2    1 
ATOM   3301 N  N3    . DA  C 3 7   ? -4.674  11.153  27.604  1.00 57.97  ? 7   DA  C N3    1 
ATOM   3302 C  C4    . DA  C 3 7   ? -4.240  10.468  26.533  1.00 55.79  ? 7   DA  C C4    1 
ATOM   3303 P  P     . DG  C 3 8   ? -10.097 8.694   24.702  1.00 71.97  ? 8   DG  C P     1 
ATOM   3304 O  OP1   . DG  C 3 8   ? -11.471 8.321   25.102  1.00 72.78  ? 8   DG  C OP1   1 
ATOM   3305 O  OP2   . DG  C 3 8   ? -9.680  8.590   23.287  1.00 65.69  ? 8   DG  C OP2   1 
ATOM   3306 O  "O5'" . DG  C 3 8   ? -9.839  10.191  25.178  1.00 67.55  ? 8   DG  C "O5'" 1 
ATOM   3307 C  "C5'" . DG  C 3 8   ? -10.017 10.532  26.543  1.00 67.52  ? 8   DG  C "C5'" 1 
ATOM   3308 C  "C4'" . DG  C 3 8   ? -9.654  11.983  26.781  1.00 66.07  ? 8   DG  C "C4'" 1 
ATOM   3309 O  "O4'" . DG  C 3 8   ? -8.222  12.164  26.608  1.00 67.90  ? 8   DG  C "O4'" 1 
ATOM   3310 C  "C3'" . DG  C 3 8   ? -10.321 12.977  25.829  1.00 72.23  ? 8   DG  C "C3'" 1 
ATOM   3311 O  "O3'" . DG  C 3 8   ? -10.676 14.136  26.550  1.00 82.35  ? 8   DG  C "O3'" 1 
ATOM   3312 C  "C2'" . DG  C 3 8   ? -9.217  13.269  24.815  1.00 69.22  ? 8   DG  C "C2'" 1 
ATOM   3313 C  "C1'" . DG  C 3 8   ? -7.992  13.225  25.710  1.00 66.70  ? 8   DG  C "C1'" 1 
ATOM   3314 N  N9    . DG  C 3 8   ? -6.743  12.977  24.992  1.00 59.47  ? 8   DG  C N9    1 
ATOM   3315 C  C8    . DG  C 3 8   ? -6.551  12.141  23.916  1.00 59.37  ? 8   DG  C C8    1 
ATOM   3316 N  N7    . DG  C 3 8   ? -5.317  12.126  23.483  1.00 56.50  ? 8   DG  C N7    1 
ATOM   3317 C  C5    . DG  C 3 8   ? -4.651  13.008  24.328  1.00 59.45  ? 8   DG  C C5    1 
ATOM   3318 C  C6    . DG  C 3 8   ? -3.290  13.399  24.351  1.00 57.01  ? 8   DG  C C6    1 
ATOM   3319 O  O6    . DG  C 3 8   ? -2.372  13.032  23.604  1.00 59.50  ? 8   DG  C O6    1 
ATOM   3320 N  N1    . DG  C 3 8   ? -3.036  14.314  25.370  1.00 57.20  ? 8   DG  C N1    1 
ATOM   3321 C  C2    . DG  C 3 8   ? -3.977  14.789  26.256  1.00 60.34  ? 8   DG  C C2    1 
ATOM   3322 N  N2    . DG  C 3 8   ? -3.545  15.669  27.174  1.00 59.46  ? 8   DG  C N2    1 
ATOM   3323 N  N3    . DG  C 3 8   ? -5.252  14.428  26.246  1.00 57.01  ? 8   DG  C N3    1 
ATOM   3324 C  C4    . DG  C 3 8   ? -5.516  13.538  25.261  1.00 58.01  ? 8   DG  C C4    1 
ATOM   3325 P  P     . DC  C 3 9   ? -11.790 15.147  25.988  1.00 84.23  ? 9   DC  C P     1 
ATOM   3326 O  OP1   . DC  C 3 9   ? -13.093 14.793  26.598  1.00 79.71  ? 9   DC  C OP1   1 
ATOM   3327 O  OP2   . DC  C 3 9   ? -11.641 15.220  24.517  1.00 79.92  ? 9   DC  C OP2   1 
ATOM   3328 O  "O5'" . DC  C 3 9   ? -11.330 16.541  26.597  1.00 80.24  ? 9   DC  C "O5'" 1 
ATOM   3329 C  "C5'" . DC  C 3 9   ? -10.561 16.555  27.789  1.00 78.68  ? 9   DC  C "C5'" 1 
ATOM   3330 C  "C4'" . DC  C 3 9   ? -9.500  17.629  27.718  1.00 76.54  ? 9   DC  C "C4'" 1 
ATOM   3331 O  "O4'" . DC  C 3 9   ? -8.309  17.108  27.074  1.00 71.04  ? 9   DC  C "O4'" 1 
ATOM   3332 C  "C3'" . DC  C 3 9   ? -9.911  18.867  26.924  1.00 76.02  ? 9   DC  C "C3'" 1 
ATOM   3333 O  "O3'" . DC  C 3 9   ? -9.703  20.021  27.710  1.00 81.35  ? 9   DC  C "O3'" 1 
ATOM   3334 C  "C2'" . DC  C 3 9   ? -8.996  18.838  25.695  1.00 71.41  ? 9   DC  C "C2'" 1 
ATOM   3335 C  "C1'" . DC  C 3 9   ? -7.784  18.096  26.226  1.00 68.98  ? 9   DC  C "C1'" 1 
ATOM   3336 N  N1    . DC  C 3 9   ? -6.973  17.427  25.162  1.00 64.21  ? 9   DC  C N1    1 
ATOM   3337 C  C2    . DC  C 3 9   ? -5.633  17.792  24.974  1.00 60.19  ? 9   DC  C C2    1 
ATOM   3338 O  O2    . DC  C 3 9   ? -5.138  18.670  25.692  1.00 63.56  ? 9   DC  C O2    1 
ATOM   3339 N  N3    . DC  C 3 9   ? -4.913  17.170  24.006  1.00 56.40  ? 9   DC  C N3    1 
ATOM   3340 C  C4    . DC  C 3 9   ? -5.483  16.230  23.250  1.00 54.65  ? 9   DC  C C4    1 
ATOM   3341 N  N4    . DC  C 3 9   ? -4.734  15.645  22.309  1.00 57.31  ? 9   DC  C N4    1 
ATOM   3342 C  C5    . DC  C 3 9   ? -6.844  15.848  23.425  1.00 56.82  ? 9   DC  C C5    1 
ATOM   3343 C  C6    . DC  C 3 9   ? -7.543  16.464  24.384  1.00 63.19  ? 9   DC  C C6    1 
ATOM   3344 P  P     . DA  C 3 10  ? -10.447 21.395  27.344  1.00 90.38  ? 10  DA  C P     1 
ATOM   3345 O  OP1   . DA  C 3 10  ? -11.336 21.748  28.475  1.00 87.60  ? 10  DA  C OP1   1 
ATOM   3346 O  OP2   . DA  C 3 10  ? -11.005 21.267  25.978  1.00 77.27  ? 10  DA  C OP2   1 
ATOM   3347 O  "O5'" . DA  C 3 10  ? -9.249  22.445  27.289  1.00 80.03  ? 10  DA  C "O5'" 1 
ATOM   3348 C  "C5'" . DA  C 3 10  ? -8.019  22.133  27.921  1.00 74.74  ? 10  DA  C "C5'" 1 
ATOM   3349 C  "C4'" . DA  C 3 10  ? -6.890  22.928  27.302  1.00 77.38  ? 10  DA  C "C4'" 1 
ATOM   3350 O  "O4'" . DA  C 3 10  ? -6.144  22.093  26.379  1.00 70.83  ? 10  DA  C "O4'" 1 
ATOM   3351 C  "C3'" . DA  C 3 10  ? -7.331  24.152  26.513  1.00 78.83  ? 10  DA  C "C3'" 1 
ATOM   3352 O  "O3'" . DA  C 3 10  ? -6.455  25.230  26.794  1.00 82.65  ? 10  DA  C "O3'" 1 
ATOM   3353 C  "C2'" . DA  C 3 10  ? -7.237  23.691  25.052  1.00 70.59  ? 10  DA  C "C2'" 1 
ATOM   3354 C  "C1'" . DA  C 3 10  ? -6.079  22.706  25.107  1.00 66.56  ? 10  DA  C "C1'" 1 
ATOM   3355 N  N9    . DA  C 3 10  ? -6.154  21.644  24.107  1.00 57.96  ? 10  DA  C N9    1 
ATOM   3356 C  C8    . DA  C 3 10  ? -7.233  20.856  23.828  1.00 61.71  ? 10  DA  C C8    1 
ATOM   3357 N  N7    . DA  C 3 10  ? -7.010  19.956  22.901  1.00 57.40  ? 10  DA  C N7    1 
ATOM   3358 C  C5    . DA  C 3 10  ? -5.686  20.159  22.553  1.00 53.97  ? 10  DA  C C5    1 
ATOM   3359 C  C6    . DA  C 3 10  ? -4.844  19.528  21.617  1.00 54.02  ? 10  DA  C C6    1 
ATOM   3360 N  N6    . DA  C 3 10  ? -5.238  18.518  20.837  1.00 54.26  ? 10  DA  C N6    1 
ATOM   3361 N  N1    . DA  C 3 10  ? -3.575  19.976  21.515  1.00 57.71  ? 10  DA  C N1    1 
ATOM   3362 C  C2    . DA  C 3 10  ? -3.184  20.988  22.299  1.00 56.30  ? 10  DA  C C2    1 
ATOM   3363 N  N3    . DA  C 3 10  ? -3.885  21.660  23.214  1.00 58.09  ? 10  DA  C N3    1 
ATOM   3364 C  C4    . DA  C 3 10  ? -5.139  21.192  23.292  1.00 56.13  ? 10  DA  C C4    1 
ATOM   3365 P  P     . DC  C 3 11  ? -6.775  26.708  26.256  1.00 89.61  ? 11  DC  C P     1 
ATOM   3366 O  OP1   . DC  C 3 11  ? -6.367  27.665  27.311  1.00 76.02  ? 11  DC  C OP1   1 
ATOM   3367 O  OP2   . DC  C 3 11  ? -8.164  26.725  25.741  1.00 81.84  ? 11  DC  C OP2   1 
ATOM   3368 O  "O5'" . DC  C 3 11  ? -5.763  26.865  25.034  1.00 76.61  ? 11  DC  C "O5'" 1 
ATOM   3369 C  "C5'" . DC  C 3 11  ? -4.514  26.180  25.062  1.00 77.00  ? 11  DC  C "C5'" 1 
ATOM   3370 C  "C4'" . DC  C 3 11  ? -3.806  26.326  23.733  1.00 77.91  ? 11  DC  C "C4'" 1 
ATOM   3371 O  "O4'" . DC  C 3 11  ? -3.914  25.087  22.975  1.00 70.80  ? 11  DC  C "O4'" 1 
ATOM   3372 C  "C3'" . DC  C 3 11  ? -4.382  27.423  22.839  1.00 78.13  ? 11  DC  C "C3'" 1 
ATOM   3373 O  "O3'" . DC  C 3 11  ? -3.333  28.155  22.232  1.00 81.11  ? 11  DC  C "O3'" 1 
ATOM   3374 C  "C2'" . DC  C 3 11  ? -5.193  26.638  21.810  1.00 75.14  ? 11  DC  C "C2'" 1 
ATOM   3375 C  "C1'" . DC  C 3 11  ? -4.348  25.384  21.670  1.00 67.83  ? 11  DC  C "C1'" 1 
ATOM   3376 N  N1    . DC  C 3 11  ? -5.099  24.207  21.125  1.00 62.05  ? 11  DC  C N1    1 
ATOM   3377 C  C2    . DC  C 3 11  ? -4.504  23.397  20.149  1.00 59.27  ? 11  DC  C C2    1 
ATOM   3378 O  O2    . DC  C 3 11  ? -3.360  23.662  19.759  1.00 61.14  ? 11  DC  C O2    1 
ATOM   3379 N  N3    . DC  C 3 11  ? -5.196  22.340  19.661  1.00 54.58  ? 11  DC  C N3    1 
ATOM   3380 C  C4    . DC  C 3 11  ? -6.427  22.087  20.103  1.00 55.83  ? 11  DC  C C4    1 
ATOM   3381 N  N4    . DC  C 3 11  ? -7.071  21.031  19.592  1.00 51.70  ? 11  DC  C N4    1 
ATOM   3382 C  C5    . DC  C 3 11  ? -7.053  22.902  21.095  1.00 56.97  ? 11  DC  C C5    1 
ATOM   3383 C  C6    . DC  C 3 11  ? -6.360  23.942  21.572  1.00 57.16  ? 11  DC  C C6    1 
ATOM   3384 P  P     . DG  C 3 12  ? -3.509  29.726  21.941  1.00 87.97  ? 12  DG  C P     1 
ATOM   3385 O  OP1   . DG  C 3 12  ? -2.751  30.468  22.973  1.00 86.06  ? 12  DG  C OP1   1 
ATOM   3386 O  OP2   . DG  C 3 12  ? -4.952  29.993  21.748  1.00 84.29  ? 12  DG  C OP2   1 
ATOM   3387 O  "O5'" . DG  C 3 12  ? -2.792  29.925  20.532  1.00 78.55  ? 12  DG  C "O5'" 1 
ATOM   3388 C  "C5'" . DG  C 3 12  ? -1.600  29.220  20.247  1.00 70.02  ? 12  DG  C "C5'" 1 
ATOM   3389 C  "C4'" . DG  C 3 12  ? -1.633  28.679  18.834  1.00 73.43  ? 12  DG  C "C4'" 1 
ATOM   3390 O  "O4'" . DG  C 3 12  ? -2.478  27.503  18.780  1.00 77.89  ? 12  DG  C "O4'" 1 
ATOM   3391 C  "C3'" . DG  C 3 12  ? -2.191  29.650  17.786  1.00 69.34  ? 12  DG  C "C3'" 1 
ATOM   3392 O  "O3'" . DG  C 3 12  ? -1.294  29.733  16.693  1.00 70.10  ? 12  DG  C "O3'" 1 
ATOM   3393 C  "C2'" . DG  C 3 12  ? -3.523  29.015  17.375  1.00 69.46  ? 12  DG  C "C2'" 1 
ATOM   3394 C  "C1'" . DG  C 3 12  ? -3.227  27.545  17.594  1.00 69.80  ? 12  DG  C "C1'" 1 
ATOM   3395 N  N9    . DG  C 3 12  ? -4.420  26.723  17.759  1.00 64.61  ? 12  DG  C N9    1 
ATOM   3396 C  C8    . DG  C 3 12  ? -5.487  26.964  18.590  1.00 64.89  ? 12  DG  C C8    1 
ATOM   3397 N  N7    . DG  C 3 12  ? -6.413  26.045  18.527  1.00 56.07  ? 12  DG  C N7    1 
ATOM   3398 C  C5    . DG  C 3 12  ? -5.927  25.140  17.592  1.00 52.68  ? 12  DG  C C5    1 
ATOM   3399 C  C6    . DG  C 3 12  ? -6.496  23.944  17.106  1.00 52.64  ? 12  DG  C C6    1 
ATOM   3400 O  O6    . DG  C 3 12  ? -7.579  23.426  17.419  1.00 57.02  ? 12  DG  C O6    1 
ATOM   3401 N  N1    . DG  C 3 12  ? -5.675  23.330  16.159  1.00 56.56  ? 12  DG  C N1    1 
ATOM   3402 C  C2    . DG  C 3 12  ? -4.457  23.818  15.741  1.00 60.02  ? 12  DG  C C2    1 
ATOM   3403 N  N2    . DG  C 3 12  ? -3.805  23.090  14.823  1.00 58.12  ? 12  DG  C N2    1 
ATOM   3404 N  N3    . DG  C 3 12  ? -3.915  24.939  16.191  1.00 58.10  ? 12  DG  C N3    1 
ATOM   3405 C  C4    . DG  C 3 12  ? -4.703  25.545  17.110  1.00 56.68  ? 12  DG  C C4    1 
ATOM   3406 P  P     . DC  C 3 13  ? -1.554  30.784  15.507  1.00 82.87  ? 13  DC  C P     1 
ATOM   3407 O  OP1   . DC  C 3 13  ? -0.243  31.353  15.127  1.00 80.67  ? 13  DC  C OP1   1 
ATOM   3408 O  OP2   . DC  C 3 13  ? -2.661  31.680  15.916  1.00 75.79  ? 13  DC  C OP2   1 
ATOM   3409 O  "O5'" . DC  C 3 13  ? -2.070  29.871  14.303  1.00 74.68  ? 13  DC  C "O5'" 1 
ATOM   3410 C  "C5'" . DC  C 3 13  ? -1.326  28.719  13.929  1.00 71.83  ? 13  DC  C "C5'" 1 
ATOM   3411 C  "C4'" . DC  C 3 13  ? -2.126  27.846  12.982  1.00 71.12  ? 13  DC  C "C4'" 1 
ATOM   3412 O  "O4'" . DC  C 3 13  ? -3.151  27.136  13.720  1.00 67.88  ? 13  DC  C "O4'" 1 
ATOM   3413 C  "C3'" . DC  C 3 13  ? -2.854  28.609  11.866  1.00 66.06  ? 13  DC  C "C3'" 1 
ATOM   3414 O  "O3'" . DC  C 3 13  ? -2.401  28.169  10.586  1.00 72.69  ? 13  DC  C "O3'" 1 
ATOM   3415 C  "C2'" . DC  C 3 13  ? -4.331  28.273  12.087  1.00 63.78  ? 13  DC  C "C2'" 1 
ATOM   3416 C  "C1'" . DC  C 3 13  ? -4.259  26.978  12.879  1.00 62.74  ? 13  DC  C "C1'" 1 
ATOM   3417 N  N1    . DC  C 3 13  ? -5.477  26.734  13.706  1.00 57.49  ? 13  DC  C N1    1 
ATOM   3418 C  C2    . DC  C 3 13  ? -6.275  25.611  13.451  1.00 54.28  ? 13  DC  C C2    1 
ATOM   3419 O  O2    . DC  C 3 13  ? -5.938  24.821  12.561  1.00 59.02  ? 13  DC  C O2    1 
ATOM   3420 N  N3    . DC  C 3 13  ? -7.392  25.416  14.195  1.00 48.50  ? 13  DC  C N3    1 
ATOM   3421 C  C4    . DC  C 3 13  ? -7.721  26.292  15.145  1.00 53.78  ? 13  DC  C C4    1 
ATOM   3422 N  N4    . DC  C 3 13  ? -8.829  26.057  15.857  1.00 53.59  ? 13  DC  C N4    1 
ATOM   3423 C  C5    . DC  C 3 13  ? -6.926  27.445  15.412  1.00 56.14  ? 13  DC  C C5    1 
ATOM   3424 C  C6    . DC  C 3 13  ? -5.828  27.626  14.673  1.00 56.91  ? 13  DC  C C6    1 
ATOM   3425 P  P     . DC  C 3 14  ? -2.939  28.873  9.241   1.00 70.14  ? 14  DC  C P     1 
ATOM   3426 O  OP1   . DC  C 3 14  ? -1.789  28.974  8.317   1.00 71.02  ? 14  DC  C OP1   1 
ATOM   3427 O  OP2   . DC  C 3 14  ? -3.700  30.090  9.604   1.00 59.24  ? 14  DC  C OP2   1 
ATOM   3428 O  "O5'" . DC  C 3 14  ? -3.981  27.816  8.647   1.00 60.30  ? 14  DC  C "O5'" 1 
ATOM   3429 C  "C5'" . DC  C 3 14  ? -3.549  26.503  8.322   1.00 56.97  ? 14  DC  C "C5'" 1 
ATOM   3430 C  "C4'" . DC  C 3 14  ? -4.718  25.646  7.868   1.00 60.81  ? 14  DC  C "C4'" 1 
ATOM   3431 O  "O4'" . DC  C 3 14  ? -5.657  25.480  8.962   1.00 64.41  ? 14  DC  C "O4'" 1 
ATOM   3432 C  "C3'" . DC  C 3 14  ? -5.525  26.210  6.697   1.00 53.30  ? 14  DC  C "C3'" 1 
ATOM   3433 O  "O3'" . DC  C 3 14  ? -5.859  25.159  5.805   1.00 51.77  ? 14  DC  C "O3'" 1 
ATOM   3434 C  "C2'" . DC  C 3 14  ? -6.763  26.796  7.374   1.00 51.57  ? 14  DC  C "C2'" 1 
ATOM   3435 C  "C1'" . DC  C 3 14  ? -6.953  25.844  8.544   1.00 53.55  ? 14  DC  C "C1'" 1 
ATOM   3436 N  N1    . DC  C 3 14  ? -7.658  26.458  9.702   1.00 51.00  ? 14  DC  C N1    1 
ATOM   3437 C  C2    . DC  C 3 14  ? -8.833  25.875  10.185  1.00 46.75  ? 14  DC  C C2    1 
ATOM   3438 O  O2    . DC  C 3 14  ? -9.272  24.858  9.634   1.00 48.78  ? 14  DC  C O2    1 
ATOM   3439 N  N3    . DC  C 3 14  ? -9.460  26.445  11.244  1.00 45.12  ? 14  DC  C N3    1 
ATOM   3440 C  C4    . DC  C 3 14  ? -8.954  27.543  11.808  1.00 48.54  ? 14  DC  C C4    1 
ATOM   3441 N  N4    . DC  C 3 14  ? -9.606  28.069  12.849  1.00 44.99  ? 14  DC  C N4    1 
ATOM   3442 C  C5    . DC  C 3 14  ? -7.756  28.150  11.329  1.00 47.67  ? 14  DC  C C5    1 
ATOM   3443 C  C6    . DC  C 3 14  ? -7.147  27.579  10.284  1.00 48.78  ? 14  DC  C C6    1 
ATOM   3444 P  P     . DA  C 3 15  ? -6.792  25.430  4.527   1.00 51.23  ? 15  DA  C P     1 
ATOM   3445 O  OP1   . DA  C 3 15  ? -6.447  24.402  3.519   1.00 43.80  ? 15  DA  C OP1   1 
ATOM   3446 O  OP2   . DA  C 3 15  ? -6.704  26.863  4.183   1.00 53.52  ? 15  DA  C OP2   1 
ATOM   3447 O  "O5'" . DA  C 3 15  ? -8.274  25.126  5.060   1.00 53.78  ? 15  DA  C "O5'" 1 
ATOM   3448 C  "C5'" . DA  C 3 15  ? -8.589  23.827  5.564   1.00 49.00  ? 15  DA  C "C5'" 1 
ATOM   3449 C  "C4'" . DA  C 3 15  ? -10.087 23.553  5.521   1.00 45.20  ? 15  DA  C "C4'" 1 
ATOM   3450 O  "O4'" . DA  C 3 15  ? -10.735 24.110  6.691   1.00 50.29  ? 15  DA  C "O4'" 1 
ATOM   3451 C  "C3'" . DA  C 3 15  ? -10.832 24.117  4.321   1.00 44.22  ? 15  DA  C "C3'" 1 
ATOM   3452 O  "O3'" . DA  C 3 15  ? -11.848 23.208  3.949   1.00 47.46  ? 15  DA  C "O3'" 1 
ATOM   3453 C  "C2'" . DA  C 3 15  ? -11.409 25.432  4.853   1.00 42.20  ? 15  DA  C "C2'" 1 
ATOM   3454 C  "C1'" . DA  C 3 15  ? -11.669 25.106  6.321   1.00 43.39  ? 15  DA  C "C1'" 1 
ATOM   3455 N  N9    . DA  C 3 15  ? -11.467 26.235  7.222   1.00 43.78  ? 15  DA  C N9    1 
ATOM   3456 C  C8    . DA  C 3 15  ? -10.419 27.111  7.217   1.00 43.98  ? 15  DA  C C8    1 
ATOM   3457 N  N7    . DA  C 3 15  ? -10.482 28.016  8.164   1.00 47.70  ? 15  DA  C N7    1 
ATOM   3458 C  C5    . DA  C 3 15  ? -11.646 27.706  8.847   1.00 40.32  ? 15  DA  C C5    1 
ATOM   3459 C  C6    . DA  C 3 15  ? -12.278 28.290  9.964   1.00 44.97  ? 15  DA  C C6    1 
ATOM   3460 N  N6    . DA  C 3 15  ? -11.795 29.356  10.610  1.00 48.37  ? 15  DA  C N6    1 
ATOM   3461 N  N1    . DA  C 3 15  ? -13.430 27.734  10.392  1.00 51.39  ? 15  DA  C N1    1 
ATOM   3462 C  C2    . DA  C 3 15  ? -13.910 26.669  9.742   1.00 44.28  ? 15  DA  C C2    1 
ATOM   3463 N  N3    . DA  C 3 15  ? -13.404 26.035  8.687   1.00 45.18  ? 15  DA  C N3    1 
ATOM   3464 C  C4    . DA  C 3 15  ? -12.262 26.607  8.284   1.00 44.56  ? 15  DA  C C4    1 
ATOM   3465 P  P     . DC  C 3 16  ? -12.591 23.338  2.533   1.00 52.36  ? 16  DC  C P     1 
ATOM   3466 O  OP1   . DC  C 3 16  ? -13.021 21.976  2.150   1.00 48.95  ? 16  DC  C OP1   1 
ATOM   3467 O  OP2   . DC  C 3 16  ? -11.757 24.143  1.612   1.00 58.71  ? 16  DC  C OP2   1 
ATOM   3468 O  "O5'" . DC  C 3 16  ? -13.884 24.197  2.883   1.00 52.64  ? 16  DC  C "O5'" 1 
ATOM   3469 C  "C5'" . DC  C 3 16  ? -14.831 23.675  3.780   1.00 45.47  ? 16  DC  C "C5'" 1 
ATOM   3470 C  "C4'" . DC  C 3 16  ? -15.693 24.773  4.364   1.00 45.42  ? 16  DC  C "C4'" 1 
ATOM   3471 O  "O4'" . DC  C 3 16  ? -14.908 25.642  5.190   1.00 43.89  ? 16  DC  C "O4'" 1 
ATOM   3472 C  "C3'" . DC  C 3 16  ? -16.368 25.704  3.355   1.00 45.36  ? 16  DC  C "C3'" 1 
ATOM   3473 O  "O3'" . DC  C 3 16  ? -17.715 25.278  3.157   1.00 55.82  ? 16  DC  C "O3'" 1 
ATOM   3474 C  "C2'" . DC  C 3 16  ? -16.293 27.093  4.030   1.00 47.48  ? 16  DC  C "C2'" 1 
ATOM   3475 C  "C1'" . DC  C 3 16  ? -15.691 26.779  5.396   1.00 46.08  ? 16  DC  C "C1'" 1 
ATOM   3476 N  N1    . DC  C 3 16  ? -14.850 27.869  5.962   1.00 45.20  ? 16  DC  C N1    1 
ATOM   3477 C  C2    . DC  C 3 16  ? -15.220 28.456  7.174   1.00 46.04  ? 16  DC  C C2    1 
ATOM   3478 O  O2    . DC  C 3 16  ? -16.233 28.047  7.754   1.00 52.47  ? 16  DC  C O2    1 
ATOM   3479 N  N3    . DC  C 3 16  ? -14.457 29.452  7.685   1.00 45.81  ? 16  DC  C N3    1 
ATOM   3480 C  C4    . DC  C 3 16  ? -13.371 29.862  7.030   1.00 45.10  ? 16  DC  C C4    1 
ATOM   3481 N  N4    . DC  C 3 16  ? -12.649 30.847  7.574   1.00 44.59  ? 16  DC  C N4    1 
ATOM   3482 C  C5    . DC  C 3 16  ? -12.977 29.280  5.789   1.00 40.11  ? 16  DC  C C5    1 
ATOM   3483 C  C6    . DC  C 3 16  ? -13.739 28.297  5.293   1.00 44.31  ? 16  DC  C C6    1 
ATOM   3484 P  P     . DT  C 3 17  ? -18.829 26.265  2.546   1.00 48.34  ? 17  DT  C P     1 
ATOM   3485 O  OP1   . DT  C 3 17  ? -19.862 25.379  1.966   1.00 54.83  ? 17  DT  C OP1   1 
ATOM   3486 O  OP2   . DT  C 3 17  ? -18.185 27.279  1.679   1.00 60.00  ? 17  DT  C OP2   1 
ATOM   3487 O  "O5'" . DT  C 3 17  ? -19.452 26.991  3.828   1.00 45.77  ? 17  DT  C "O5'" 1 
ATOM   3488 C  "C5'" . DT  C 3 17  ? -19.977 26.206  4.889   1.00 48.42  ? 17  DT  C "C5'" 1 
ATOM   3489 C  "C4'" . DT  C 3 17  ? -20.584 27.081  5.971   1.00 49.50  ? 17  DT  C "C4'" 1 
ATOM   3490 O  "O4'" . DT  C 3 17  ? -19.566 27.950  6.527   1.00 52.03  ? 17  DT  C "O4'" 1 
ATOM   3491 C  "C3'" . DT  C 3 17  ? -21.719 27.996  5.512   1.00 52.40  ? 17  DT  C "C3'" 1 
ATOM   3492 O  "O3'" . DT  C 3 17  ? -22.731 28.021  6.509   1.00 59.48  ? 17  DT  C "O3'" 1 
ATOM   3493 C  "C2'" . DT  C 3 17  ? -21.033 29.354  5.373   1.00 49.49  ? 17  DT  C "C2'" 1 
ATOM   3494 C  "C1'" . DT  C 3 17  ? -20.022 29.286  6.504   1.00 55.08  ? 17  DT  C "C1'" 1 
ATOM   3495 N  N1    . DT  C 3 17  ? -18.833 30.183  6.332   1.00 52.97  ? 17  DT  C N1    1 
ATOM   3496 C  C2    . DT  C 3 17  ? -18.556 31.114  7.303   1.00 52.44  ? 17  DT  C C2    1 
ATOM   3497 O  O2    . DT  C 3 17  ? -19.242 31.262  8.297   1.00 55.56  ? 17  DT  C O2    1 
ATOM   3498 N  N3    . DT  C 3 17  ? -17.441 31.876  7.067   1.00 53.46  ? 17  DT  C N3    1 
ATOM   3499 C  C4    . DT  C 3 17  ? -16.592 31.798  5.980   1.00 50.90  ? 17  DT  C C4    1 
ATOM   3500 O  O4    . DT  C 3 17  ? -15.616 32.530  5.857   1.00 54.05  ? 17  DT  C O4    1 
ATOM   3501 C  C5    . DT  C 3 17  ? -16.934 30.798  4.998   1.00 51.82  ? 17  DT  C C5    1 
ATOM   3502 C  C7    . DT  C 3 17  ? -16.083 30.626  3.775   1.00 49.10  ? 17  DT  C C7    1 
ATOM   3503 C  C6    . DT  C 3 17  ? -18.025 30.043  5.218   1.00 46.71  ? 17  DT  C C6    1 
ATOM   3504 P  P     . DC  C 3 18  ? -24.118 28.787  6.249   1.00 53.29  ? 18  DC  C P     1 
ATOM   3505 O  OP1   . DC  C 3 18  ? -25.171 28.022  6.948   1.00 65.72  ? 18  DC  C OP1   1 
ATOM   3506 O  OP2   . DC  C 3 18  ? -24.233 29.044  4.793   1.00 53.65  ? 18  DC  C OP2   1 
ATOM   3507 O  "O5'" . DC  C 3 18  ? -23.940 30.164  7.035   1.00 56.93  ? 18  DC  C "O5'" 1 
ATOM   3508 C  "C5'" . DC  C 3 18  ? -23.822 30.133  8.450   1.00 62.75  ? 18  DC  C "C5'" 1 
ATOM   3509 C  "C4'" . DC  C 3 18  ? -23.679 31.528  9.036   1.00 65.44  ? 18  DC  C "C4'" 1 
ATOM   3510 O  "O4'" . DC  C 3 18  ? -22.401 32.109  8.656   1.00 63.74  ? 18  DC  C "O4'" 1 
ATOM   3511 C  "C3'" . DC  C 3 18  ? -24.739 32.541  8.612   1.00 67.96  ? 18  DC  C "C3'" 1 
ATOM   3512 O  "O3'" . DC  C 3 18  ? -25.025 33.373  9.724   1.00 73.95  ? 18  DC  C "O3'" 1 
ATOM   3513 C  "C2'" . DC  C 3 18  ? -24.025 33.318  7.504   1.00 64.41  ? 18  DC  C "C2'" 1 
ATOM   3514 C  "C1'" . DC  C 3 18  ? -22.620 33.382  8.082   1.00 62.22  ? 18  DC  C "C1'" 1 
ATOM   3515 N  N1    . DC  C 3 18  ? -21.535 33.626  7.086   1.00 57.79  ? 18  DC  C N1    1 
ATOM   3516 C  C2    . DC  C 3 18  ? -20.550 34.582  7.364   1.00 56.24  ? 18  DC  C C2    1 
ATOM   3517 O  O2    . DC  C 3 18  ? -20.618 35.231  8.417   1.00 58.03  ? 18  DC  C O2    1 
ATOM   3518 N  N3    . DC  C 3 18  ? -19.553 34.775  6.468   1.00 50.58  ? 18  DC  C N3    1 
ATOM   3519 C  C4    . DC  C 3 18  ? -19.514 34.055  5.348   1.00 55.88  ? 18  DC  C C4    1 
ATOM   3520 N  N4    . DC  C 3 18  ? -18.511 34.283  4.493   1.00 53.25  ? 18  DC  C N4    1 
ATOM   3521 C  C5    . DC  C 3 18  ? -20.503 33.069  5.051   1.00 47.51  ? 18  DC  C C5    1 
ATOM   3522 C  C6    . DC  C 3 18  ? -21.482 32.886  5.942   1.00 50.16  ? 18  DC  C C6    1 
ATOM   3523 P  P     . DA  C 3 19  ? -26.419 34.159  9.836   1.00 74.76  ? 19  DA  C P     1 
ATOM   3524 O  OP1   . DA  C 3 19  ? -27.014 33.789  11.142  1.00 79.29  ? 19  DA  C OP1   1 
ATOM   3525 O  OP2   . DA  C 3 19  ? -27.165 33.988  8.568   1.00 71.64  ? 19  DA  C OP2   1 
ATOM   3526 O  "O5'" . DA  C 3 19  ? -25.972 35.682  9.947   1.00 78.20  ? 19  DA  C "O5'" 1 
ATOM   3527 C  "C5'" . DA  C 3 19  ? -25.084 36.081  10.984  1.00 82.65  ? 19  DA  C "C5'" 1 
ATOM   3528 C  "C4'" . DA  C 3 19  ? -24.608 37.504  10.765  1.00 88.38  ? 19  DA  C "C4'" 1 
ATOM   3529 O  "O4'" . DA  C 3 19  ? -23.572 37.517  9.747   1.00 79.75  ? 19  DA  C "O4'" 1 
ATOM   3530 C  "C3'" . DA  C 3 19  ? -25.683 38.471  10.278  1.00 87.59  ? 19  DA  C "C3'" 1 
ATOM   3531 O  "O3'" . DA  C 3 19  ? -25.431 39.763  10.794  1.00 95.00  ? 19  DA  C "O3'" 1 
ATOM   3532 C  "C2'" . DA  C 3 19  ? -25.507 38.433  8.765   1.00 78.18  ? 19  DA  C "C2'" 1 
ATOM   3533 C  "C1'" . DA  C 3 19  ? -23.997 38.285  8.639   1.00 76.35  ? 19  DA  C "C1'" 1 
ATOM   3534 N  N9    . DA  C 3 19  ? -23.588 37.603  7.417   1.00 72.25  ? 19  DA  C N9    1 
ATOM   3535 C  C8    . DA  C 3 19  ? -24.273 36.622  6.750   1.00 69.62  ? 19  DA  C C8    1 
ATOM   3536 N  N7    . DA  C 3 19  ? -23.665 36.193  5.669   1.00 63.47  ? 19  DA  C N7    1 
ATOM   3537 C  C5    . DA  C 3 19  ? -22.501 36.947  5.624   1.00 61.65  ? 19  DA  C C5    1 
ATOM   3538 C  C6    . DA  C 3 19  ? -21.423 36.972  4.720   1.00 56.46  ? 19  DA  C C6    1 
ATOM   3539 N  N6    . DA  C 3 19  ? -21.348 36.180  3.643   1.00 57.14  ? 19  DA  C N6    1 
ATOM   3540 N  N1    . DA  C 3 19  ? -20.421 37.846  4.966   1.00 62.79  ? 19  DA  C N1    1 
ATOM   3541 C  C2    . DA  C 3 19  ? -20.502 38.636  6.047   1.00 62.40  ? 19  DA  C C2    1 
ATOM   3542 N  N3    . DA  C 3 19  ? -21.463 38.700  6.967   1.00 59.82  ? 19  DA  C N3    1 
ATOM   3543 C  C4    . DA  C 3 19  ? -22.441 37.822  6.694   1.00 61.09  ? 19  DA  C C4    1 
ATOM   3544 P  P     . DG  C 3 20  ? -26.602 40.861  10.838  1.00 107.75 ? 20  DG  C P     1 
ATOM   3545 O  OP1   . DG  C 3 20  ? -27.528 40.479  11.931  1.00 102.85 ? 20  DG  C OP1   1 
ATOM   3546 O  OP2   . DG  C 3 20  ? -27.112 41.038  9.458   1.00 93.19  ? 20  DG  C OP2   1 
ATOM   3547 O  "O5'" . DG  C 3 20  ? -25.838 42.200  11.257  1.00 99.13  ? 20  DG  C "O5'" 1 
ATOM   3548 C  "C5'" . DG  C 3 20  ? -24.415 42.221  11.280  1.00 88.57  ? 20  DG  C "C5'" 1 
ATOM   3549 C  "C4'" . DG  C 3 20  ? -23.871 43.074  10.148  1.00 82.32  ? 20  DG  C "C4'" 1 
ATOM   3550 O  "O4'" . DG  C 3 20  ? -23.479 42.230  9.037   1.00 76.72  ? 20  DG  C "O4'" 1 
ATOM   3551 C  "C3'" . DG  C 3 20  ? -24.853 44.103  9.579   1.00 85.52  ? 20  DG  C "C3'" 1 
ATOM   3552 O  "O3'" . DG  C 3 20  ? -24.275 45.399  9.642   1.00 90.68  ? 20  DG  C "O3'" 1 
ATOM   3553 C  "C2'" . DG  C 3 20  ? -25.072 43.643  8.130   1.00 78.23  ? 20  DG  C "C2'" 1 
ATOM   3554 C  "C1'" . DG  C 3 20  ? -23.780 42.901  7.844   1.00 73.37  ? 20  DG  C "C1'" 1 
ATOM   3555 N  N9    . DG  C 3 20  ? -23.887 41.921  6.766   1.00 68.58  ? 20  DG  C N9    1 
ATOM   3556 C  C8    . DG  C 3 20  ? -24.897 41.012  6.565   1.00 68.44  ? 20  DG  C C8    1 
ATOM   3557 N  N7    . DG  C 3 20  ? -24.718 40.260  5.512   1.00 65.56  ? 20  DG  C N7    1 
ATOM   3558 C  C5    . DG  C 3 20  ? -23.513 40.700  4.980   1.00 60.76  ? 20  DG  C C5    1 
ATOM   3559 C  C6    . DG  C 3 20  ? -22.804 40.260  3.835   1.00 60.24  ? 20  DG  C C6    1 
ATOM   3560 O  O6    . DG  C 3 20  ? -23.112 39.364  3.036   1.00 59.44  ? 20  DG  C O6    1 
ATOM   3561 N  N1    . DG  C 3 20  ? -21.624 40.976  3.654   1.00 58.78  ? 20  DG  C N1    1 
ATOM   3562 C  C2    . DG  C 3 20  ? -21.185 41.987  4.478   1.00 61.19  ? 20  DG  C C2    1 
ATOM   3563 N  N2    . DG  C 3 20  ? -20.019 42.562  4.146   1.00 64.05  ? 20  DG  C N2    1 
ATOM   3564 N  N3    . DG  C 3 20  ? -21.839 42.406  5.552   1.00 59.49  ? 20  DG  C N3    1 
ATOM   3565 C  C4    . DG  C 3 20  ? -22.990 41.722  5.741   1.00 62.15  ? 20  DG  C C4    1 
ATOM   3566 P  P     . DC  C 3 21  ? -25.132 46.700  9.247   1.00 91.46  ? 21  DC  C P     1 
ATOM   3567 O  OP1   . DC  C 3 21  ? -24.904 47.704  10.307  1.00 84.52  ? 21  DC  C OP1   1 
ATOM   3568 O  OP2   . DC  C 3 21  ? -26.516 46.278  8.928   1.00 89.16  ? 21  DC  C OP2   1 
ATOM   3569 O  "O5'" . DC  C 3 21  ? -24.432 47.206  7.900   1.00 84.72  ? 21  DC  C "O5'" 1 
ATOM   3570 C  "C5'" . DC  C 3 21  ? -23.039 47.496  7.902   1.00 81.74  ? 21  DC  C "C5'" 1 
ATOM   3571 C  "C4'" . DC  C 3 21  ? -22.425 47.263  6.532   1.00 81.57  ? 21  DC  C "C4'" 1 
ATOM   3572 O  "O4'" . DC  C 3 21  ? -22.841 45.982  6.014   1.00 77.87  ? 21  DC  C "O4'" 1 
ATOM   3573 C  "C3'" . DC  C 3 21  ? -22.809 48.286  5.455   1.00 82.73  ? 21  DC  C "C3'" 1 
ATOM   3574 O  "O3'" . DC  C 3 21  ? -21.682 49.090  5.128   1.00 93.58  ? 21  DC  C "O3'" 1 
ATOM   3575 C  "C2'" . DC  C 3 21  ? -23.260 47.432  4.255   1.00 76.17  ? 21  DC  C "C2'" 1 
ATOM   3576 C  "C1'" . DC  C 3 21  ? -22.739 46.049  4.620   1.00 71.93  ? 21  DC  C "C1'" 1 
ATOM   3577 N  N1    . DC  C 3 21  ? -23.520 44.932  4.019   1.00 66.26  ? 21  DC  C N1    1 
ATOM   3578 C  C2    . DC  C 3 21  ? -23.062 44.329  2.842   1.00 64.47  ? 21  DC  C C2    1 
ATOM   3579 O  O2    . DC  C 3 21  ? -22.015 44.737  2.325   1.00 66.51  ? 21  DC  C O2    1 
ATOM   3580 N  N3    . DC  C 3 21  ? -23.780 43.312  2.301   1.00 58.18  ? 21  DC  C N3    1 
ATOM   3581 C  C4    . DC  C 3 21  ? -24.904 42.902  2.890   1.00 62.27  ? 21  DC  C C4    1 
ATOM   3582 N  N4    . DC  C 3 21  ? -25.576 41.896  2.320   1.00 62.32  ? 21  DC  C N4    1 
ATOM   3583 C  C5    . DC  C 3 21  ? -25.386 43.505  4.090   1.00 63.51  ? 21  DC  C C5    1 
ATOM   3584 C  C6    . DC  C 3 21  ? -24.670 44.507  4.614   1.00 66.16  ? 21  DC  C C6    1 
HETATM 3585 CL CL    . CL  D 4 .   ? -32.516 18.847  0.189   1.00 42.16  ? 401 CL  A CL    1 
HETATM 3586 CL CL    . CL  E 4 .   ? -44.918 22.564  0.000   0.50 36.74  ? 402 CL  A CL    1 
HETATM 3587 C  C1    . SIN F 5 .   ? -27.933 16.276  7.789   1.00 57.44  ? 403 SIN A C1    1 
HETATM 3588 O  O1    . SIN F 5 .   ? -27.291 17.252  7.338   1.00 51.76  ? 403 SIN A O1    1 
HETATM 3589 O  O2    . SIN F 5 .   ? -27.380 15.154  7.824   1.00 57.34  ? 403 SIN A O2    1 
HETATM 3590 C  C2    . SIN F 5 .   ? -29.349 16.443  8.289   1.00 50.39  ? 403 SIN A C2    1 
HETATM 3591 C  C3    . SIN F 5 .   ? -30.336 16.311  7.140   1.00 49.71  ? 403 SIN A C3    1 
HETATM 3592 C  C4    . SIN F 5 .   ? -30.015 17.372  6.123   1.00 54.56  ? 403 SIN A C4    1 
HETATM 3593 O  O3    . SIN F 5 .   ? -29.458 17.062  5.049   1.00 54.92  ? 403 SIN A O3    1 
HETATM 3594 O  O4    . SIN F 5 .   ? -30.295 18.571  6.347   1.00 55.74  ? 403 SIN A O4    1 
HETATM 3595 C  CA    . XL3 G 6 .   ? -26.322 17.079  0.955   1.00 48.92  ? 101 XL3 B CA    1 
HETATM 3596 C  CB    . XL3 G 6 .   ? -27.510 17.898  0.502   1.00 48.69  ? 101 XL3 B CB    1 
HETATM 3597 C  CC    . XL3 G 6 .   ? -27.057 19.285  0.068   1.00 48.89  ? 101 XL3 B CC    1 
HETATM 3598 S  SG    . XL3 G 6 .   ? -28.499 20.269  -0.401  1.00 60.71  ? 101 XL3 B SG    1 
HETATM 3599 O  O     . HOH H 7 .   ? -22.309 -12.939 13.231  1.00 64.05  ? 501 HOH A O     1 
HETATM 3600 O  O     . HOH H 7 .   ? -32.262 -9.131  15.713  1.00 59.32  ? 502 HOH A O     1 
HETATM 3601 O  O     . HOH H 7 .   ? -41.710 10.751  18.821  1.00 46.25  ? 503 HOH A O     1 
HETATM 3602 O  O     . HOH H 7 .   ? -41.430 10.329  -5.883  1.00 48.41  ? 504 HOH A O     1 
HETATM 3603 O  O     . HOH H 7 .   ? -25.947 14.817  26.029  1.00 52.87  ? 505 HOH A O     1 
HETATM 3604 O  O     . HOH H 7 .   ? -52.401 5.167   9.337   1.00 51.62  ? 506 HOH A O     1 
HETATM 3605 O  O     . HOH H 7 .   ? -19.369 6.165   16.252  1.00 45.74  ? 507 HOH A O     1 
HETATM 3606 O  O     . HOH H 7 .   ? -42.704 -17.990 0.024   1.00 51.67  ? 508 HOH A O     1 
HETATM 3607 O  O     . HOH H 7 .   ? -27.056 7.197   26.951  1.00 47.97  ? 509 HOH A O     1 
HETATM 3608 O  O     . HOH H 7 .   ? -40.075 28.511  13.009  1.00 40.07  ? 510 HOH A O     1 
HETATM 3609 O  O     . HOH H 7 .   ? -34.217 11.744  11.917  1.00 41.36  ? 511 HOH A O     1 
HETATM 3610 O  O     . HOH H 7 .   ? -32.048 8.860   25.234  1.00 45.31  ? 512 HOH A O     1 
HETATM 3611 O  O     . HOH H 7 .   ? -28.431 10.988  8.538   1.00 36.95  ? 513 HOH A O     1 
HETATM 3612 O  O     . HOH H 7 .   ? -38.923 25.666  22.235  1.00 45.77  ? 514 HOH A O     1 
HETATM 3613 O  O     . HOH H 7 .   ? -41.522 13.395  19.284  1.00 42.89  ? 515 HOH A O     1 
HETATM 3614 O  O     . HOH H 7 .   ? -22.955 3.360   -1.396  1.00 53.60  ? 516 HOH A O     1 
HETATM 3615 O  O     . HOH H 7 .   ? -35.231 13.465  -2.288  1.00 36.46  ? 517 HOH A O     1 
HETATM 3616 O  O     . HOH H 7 .   ? -43.619 15.915  3.202   1.00 40.02  ? 518 HOH A O     1 
HETATM 3617 O  O     . HOH H 7 .   ? -45.014 0.859   16.087  1.00 45.38  ? 519 HOH A O     1 
HETATM 3618 O  O     . HOH H 7 .   ? -46.446 19.840  8.453   1.00 37.85  ? 520 HOH A O     1 
HETATM 3619 O  O     . HOH H 7 .   ? -45.729 29.128  7.228   1.00 37.87  ? 521 HOH A O     1 
HETATM 3620 O  O     . HOH H 7 .   ? -50.087 -1.594  4.952   1.00 51.17  ? 522 HOH A O     1 
HETATM 3621 O  O     . HOH H 7 .   ? -32.966 23.077  4.491   1.00 38.17  ? 523 HOH A O     1 
HETATM 3622 O  O     . HOH H 7 .   ? -25.769 16.266  22.449  1.00 45.26  ? 524 HOH A O     1 
HETATM 3623 O  O     . HOH H 7 .   ? -35.071 7.067   21.729  1.00 45.02  ? 525 HOH A O     1 
HETATM 3624 O  O     . HOH H 7 .   ? -40.898 24.260  20.842  1.00 41.60  ? 526 HOH A O     1 
HETATM 3625 O  O     . HOH H 7 .   ? -33.910 8.895   18.304  1.00 36.53  ? 527 HOH A O     1 
HETATM 3626 O  O     . HOH H 7 .   ? -14.315 -1.026  15.979  1.00 55.68  ? 528 HOH A O     1 
HETATM 3627 O  O     . HOH H 7 .   ? -37.847 33.012  8.184   1.00 47.43  ? 529 HOH A O     1 
HETATM 3628 O  O     . HOH H 7 .   ? -30.507 30.756  25.104  1.00 47.54  ? 530 HOH A O     1 
HETATM 3629 O  O     . HOH H 7 .   ? -39.857 31.249  7.509   1.00 43.31  ? 531 HOH A O     1 
HETATM 3630 O  O     . HOH H 7 .   ? -28.693 13.671  11.342  1.00 42.26  ? 532 HOH A O     1 
HETATM 3631 O  O     . HOH H 7 .   ? -35.272 29.941  11.713  1.00 36.85  ? 533 HOH A O     1 
HETATM 3632 O  O     . HOH H 7 .   ? -45.507 18.334  -6.926  1.00 48.93  ? 534 HOH A O     1 
HETATM 3633 O  O     . HOH H 7 .   ? -44.754 16.297  -3.870  1.00 45.82  ? 535 HOH A O     1 
HETATM 3634 O  O     . HOH H 7 .   ? -28.704 12.688  1.146   1.00 38.92  ? 536 HOH A O     1 
HETATM 3635 O  O     . HOH H 7 .   ? -53.699 7.836   8.359   1.00 56.09  ? 537 HOH A O     1 
HETATM 3636 O  O     . HOH H 7 .   ? -49.174 8.983   18.110  1.00 52.44  ? 538 HOH A O     1 
HETATM 3637 O  O     . HOH H 7 .   ? -34.077 29.051  2.871   1.00 41.88  ? 539 HOH A O     1 
HETATM 3638 O  O     . HOH H 7 .   ? -38.161 -2.313  16.723  1.00 51.18  ? 540 HOH A O     1 
HETATM 3639 O  O     . HOH H 7 .   ? -27.343 16.268  18.572  1.00 38.61  ? 541 HOH A O     1 
HETATM 3640 O  O     . HOH H 7 .   ? -34.304 -2.096  -3.905  1.00 50.06  ? 542 HOH A O     1 
HETATM 3641 O  O     . HOH H 7 .   ? -40.777 -0.798  17.297  1.00 52.14  ? 543 HOH A O     1 
HETATM 3642 O  O     . HOH H 7 .   ? -35.607 20.919  6.477   1.00 43.50  ? 544 HOH A O     1 
HETATM 3643 O  O     . HOH H 7 .   ? -42.547 9.652   25.220  1.00 58.15  ? 545 HOH A O     1 
HETATM 3644 O  O     . HOH H 7 .   ? -27.674 17.901  -8.380  1.00 51.79  ? 546 HOH A O     1 
HETATM 3645 O  O     . HOH H 7 .   ? -21.208 4.724   21.678  1.00 48.36  ? 547 HOH A O     1 
HETATM 3646 O  O     . HOH H 7 .   ? -30.139 33.051  14.561  1.00 50.60  ? 548 HOH A O     1 
HETATM 3647 O  O     . HOH H 7 .   ? -30.300 9.807   38.808  1.00 61.50  ? 549 HOH A O     1 
HETATM 3648 O  O     . HOH H 7 .   ? -12.979 12.028  10.905  1.00 57.76  ? 550 HOH A O     1 
HETATM 3649 O  O     . HOH H 7 .   ? -46.164 16.625  2.616   1.00 38.24  ? 551 HOH A O     1 
HETATM 3650 O  O     . HOH H 7 .   ? -37.715 6.146   22.618  1.00 45.96  ? 552 HOH A O     1 
HETATM 3651 O  O     . HOH H 7 .   ? -27.802 34.957  24.321  1.00 52.55  ? 553 HOH A O     1 
HETATM 3652 O  O     . HOH H 7 .   ? -49.480 19.757  7.838   1.00 50.70  ? 554 HOH A O     1 
HETATM 3653 O  O     . HOH I 7 .   ? -11.942 26.492  16.554  1.00 54.02  ? 201 HOH B O     1 
HETATM 3654 O  O     . HOH I 7 .   ? -2.543  4.704   41.231  1.00 46.22  ? 202 HOH B O     1 
HETATM 3655 O  O     . HOH I 7 .   ? -4.038  -0.469  40.563  1.00 46.92  ? 203 HOH B O     1 
HETATM 3656 O  O     . HOH I 7 .   ? -15.683 13.376  11.399  1.00 52.34  ? 204 HOH B O     1 
HETATM 3657 O  O     . HOH J 7 .   ? -27.495 32.467  6.841   1.00 58.94  ? 101 HOH C O     1 
HETATM 3658 O  O     . HOH J 7 .   ? 2.888   7.047   40.974  1.00 60.50  ? 102 HOH C O     1 
HETATM 3659 O  O     . HOH J 7 .   ? 6.675   1.034   30.222  1.00 70.22  ? 103 HOH C O     1 
HETATM 3660 O  O     . HOH J 7 .   ? -15.036 20.911  0.782   1.00 55.79  ? 104 HOH C O     1 
HETATM 3661 O  O     . HOH J 7 .   ? -9.925  28.091  17.327  1.00 59.26  ? 105 HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   20  20  GLU ALA A . n 
A 1 2   ASP 2   21  21  ASP ASP A . n 
A 1 3   ALA 3   22  22  ALA ALA A . n 
A 1 4   PHE 4   23  23  PHE PHE A . n 
A 1 5   ARG 5   24  24  ARG ARG A . n 
A 1 6   LYS 6   25  25  LYS LYS A . n 
A 1 7   LEU 7   26  26  LEU LEU A . n 
A 1 8   PHE 8   27  27  PHE PHE A . n 
A 1 9   ARG 9   28  28  ARG ARG A . n 
A 1 10  PHE 10  29  29  PHE PHE A . n 
A 1 11  TYR 11  30  30  TYR TYR A . n 
A 1 12  ARG 12  31  31  ARG ARG A . n 
A 1 13  GLN 13  32  32  GLN GLN A . n 
A 1 14  SER 14  33  33  SER SER A . n 
A 1 15  ARG 15  34  34  ARG ARG A . n 
A 1 16  PRO 16  35  35  PRO PRO A . n 
A 1 17  GLY 17  36  36  GLY GLY A . n 
A 1 18  THR 18  37  37  THR THR A . n 
A 1 19  ALA 19  38  38  ALA ALA A . n 
A 1 20  ASP 20  39  39  ASP ASP A . n 
A 1 21  LEU 21  40  40  LEU LEU A . n 
A 1 22  GLY 22  41  41  GLY GLY A . n 
A 1 23  ALA 23  42  42  ALA ALA A . n 
A 1 24  VAL 24  43  43  VAL VAL A . n 
A 1 25  ILE 25  44  44  ILE ILE A . n 
A 1 26  ASP 26  45  45  ASP ASP A . n 
A 1 27  PHE 27  46  46  PHE PHE A . n 
A 1 28  SER 28  47  47  SER SER A . n 
A 1 29  GLU 29  48  48  GLU GLU A . n 
A 1 30  ALA 30  49  49  ALA ALA A . n 
A 1 31  HIS 31  50  50  HIS HIS A . n 
A 1 32  LEU 32  51  51  LEU LEU A . n 
A 1 33  ALA 33  52  52  ALA ALA A . n 
A 1 34  ARG 34  53  53  ARG ARG A . n 
A 1 35  SER 35  54  54  SER ALA A . n 
A 1 36  PRO 36  55  55  PRO PRO A . n 
A 1 37  LYS 37  56  56  LYS LYS A . n 
A 1 38  PRO 38  57  57  PRO PRO A . n 
A 1 39  GLY 39  58  58  GLY GLY A . n 
A 1 40  VAL 40  59  59  VAL VAL A . n 
A 1 41  PRO 41  60  60  PRO PRO A . n 
A 1 42  GLN 42  61  61  GLN GLN A . n 
A 1 43  VAL 43  62  62  VAL VAL A . n 
A 1 44  VAL 44  63  63  VAL VAL A . n 
A 1 45  ARG 45  64  64  ARG ARG A . n 
A 1 46  PHE 46  65  65  PHE PHE A . n 
A 1 47  PRO 47  66  66  PRO PRO A . n 
A 1 48  LEU 48  67  67  LEU LEU A . n 
A 1 49  ASN 49  68  68  ASN ASN A . n 
A 1 50  VAL 50  69  69  VAL VAL A . n 
A 1 51  SER 51  70  70  SER SER A . n 
A 1 52  SER 52  71  71  SER SER A . n 
A 1 53  VAL 53  72  72  VAL VAL A . n 
A 1 54  THR 54  73  73  THR THR A . n 
A 1 55  GLU 55  74  74  GLU GLU A . n 
A 1 56  ARG 56  75  75  ARG ARG A . n 
A 1 57  ASP 57  76  76  ASP ASP A . n 
A 1 58  ALA 58  77  77  ALA ALA A . n 
A 1 59  GLU 59  78  78  GLU GLU A . n 
A 1 60  ARG 60  79  79  ARG ARG A . n 
A 1 61  VAL 61  80  80  VAL VAL A . n 
A 1 62  GLY 62  81  81  GLY GLY A . n 
A 1 63  LEU 63  82  82  LEU LEU A . n 
A 1 64  GLU 64  83  83  GLU GLU A . n 
A 1 65  PRO 65  84  84  PRO PRO A . n 
A 1 66  VAL 66  85  85  VAL VAL A . n 
A 1 67  SER 67  86  86  SER SER A . n 
A 1 68  LYS 68  87  87  LYS LYS A . n 
A 1 69  TRP 69  88  88  TRP TRP A . n 
A 1 70  ARG 70  89  89  ARG ARG A . n 
A 1 71  ALA 71  90  90  ALA ALA A . n 
A 1 72  TYR 72  91  91  TYR TYR A . n 
A 1 73  GLY 73  92  92  GLY GLY A . n 
A 1 74  LEU 74  93  93  LEU LEU A . n 
A 1 75  GLU 75  94  94  GLU GLU A . n 
A 1 76  GLY 76  95  95  GLY GLY A . n 
A 1 77  TYR 77  96  96  TYR TYR A . n 
A 1 78  PRO 78  97  97  PRO PRO A . n 
A 1 79  GLY 79  98  98  GLY GLY A . n 
A 1 80  PHE 80  99  99  PHE PHE A . n 
A 1 81  ILE 81  100 100 ILE ILE A . n 
A 1 82  PHE 82  101 101 PHE PHE A . n 
A 1 83  ILE 83  102 102 ILE ILE A . n 
A 1 84  PRO 84  103 103 PRO PRO A . n 
A 1 85  ASN 85  104 104 ASN ASN A . n 
A 1 86  PRO 86  105 105 PRO PRO A . n 
A 1 87  PHE 87  106 106 PHE PHE A . n 
A 1 88  LEU 88  107 107 LEU LEU A . n 
A 1 89  PRO 89  108 108 PRO PRO A . n 
A 1 90  GLY 90  109 109 GLY GLY A . n 
A 1 91  CYS 91  110 110 CYS CYS A . n 
A 1 92  GLN 92  111 111 GLN GLN A . n 
A 1 93  ARG 93  112 112 ARG ARG A . n 
A 1 94  HIS 94  113 113 HIS HIS A . n 
A 1 95  TRP 95  114 114 TRP TRP A . n 
A 1 96  VAL 96  115 115 VAL VAL A . n 
A 1 97  LYS 97  116 116 LYS LYS A . n 
A 1 98  GLN 98  117 117 GLN GLN A . n 
A 1 99  CYS 99  118 118 CYS CYS A . n 
A 1 100 LEU 100 119 119 LEU LEU A . n 
A 1 101 LYS 101 120 120 LYS LYS A . n 
A 1 102 LEU 102 121 121 LEU LEU A . n 
A 1 103 TYR 103 122 122 TYR TYR A . n 
A 1 104 SER 104 123 123 SER SER A . n 
A 1 105 GLN 105 124 124 GLN GLN A . n 
A 1 106 LYS 106 125 125 LYS LYS A . n 
A 1 107 PRO 107 126 126 PRO PRO A . n 
A 1 108 ASN 108 127 127 ASN ASN A . n 
A 1 109 VAL 109 128 128 VAL VAL A . n 
A 1 110 SER 110 129 129 SER SER A . n 
A 1 111 ASN 111 130 130 ASN ASN A . n 
A 1 112 LEU 112 131 131 LEU LEU A . n 
A 1 113 ASP 113 132 132 ASP ASP A . n 
A 1 114 LYS 114 133 133 LYS LYS A . n 
A 1 115 HIS 115 134 134 HIS HIS A . n 
A 1 116 MET 116 135 135 MET MET A . n 
A 1 117 THR 117 136 136 THR THR A . n 
A 1 118 LYS 118 137 137 LYS LYS A . n 
A 1 119 GLU 119 138 138 GLU GLU A . n 
A 1 120 GLU 120 139 139 GLU GLU A . n 
A 1 121 THR 121 140 140 THR THR A . n 
A 1 122 GLN 122 141 141 GLN GLN A . n 
A 1 123 GLY 123 142 142 GLY GLY A . n 
A 1 124 LEU 124 143 143 LEU LEU A . n 
A 1 125 TRP 125 144 144 TRP TRP A . n 
A 1 126 GLU 126 145 145 GLU GLU A . n 
A 1 127 GLN 127 146 146 GLN GLN A . n 
A 1 128 SER 128 147 147 SER SER A . n 
A 1 129 LYS 129 148 148 LYS LYS A . n 
A 1 130 GLU 130 149 149 GLU GLU A . n 
A 1 131 VAL 131 150 150 VAL VAL A . n 
A 1 132 LEU 132 151 151 LEU LEU A . n 
A 1 133 ARG 133 152 152 ARG ARG A . n 
A 1 134 SER 134 153 153 SER SER A . n 
A 1 135 LYS 135 154 154 LYS LYS A . n 
A 1 136 GLU 136 155 155 GLU GLU A . n 
A 1 137 VAL 137 156 156 VAL VAL A . n 
A 1 138 THR 138 157 157 THR THR A . n 
A 1 139 LYS 139 158 158 LYS LYS A . n 
A 1 140 ARG 140 159 159 ARG ARG A . n 
A 1 141 ARG 141 160 160 ARG ARG A . n 
A 1 142 PRO 142 161 161 PRO PRO A . n 
A 1 143 ARG 143 162 162 ARG ARG A . n 
A 1 144 SER 144 163 163 SER SER A . n 
A 1 145 LEU 145 164 164 LEU LEU A . n 
A 1 146 LEU 146 165 165 LEU LEU A . n 
A 1 147 GLU 147 166 166 GLU GLU A . n 
A 1 148 ARG 148 167 167 ARG ARG A . n 
A 1 149 LEU 149 168 168 LEU LEU A . n 
A 1 150 ARG 150 169 169 ARG ARG A . n 
A 1 151 TRP 151 170 170 TRP TRP A . n 
A 1 152 VAL 152 171 171 VAL VAL A . n 
A 1 153 THR 153 172 172 THR THR A . n 
A 1 154 LEU 154 173 173 LEU LEU A . n 
A 1 155 GLY 155 174 174 GLY GLY A . n 
A 1 156 TYR 156 175 175 TYR TYR A . n 
A 1 157 HIS 157 176 176 HIS HIS A . n 
A 1 158 TYR 158 177 177 TYR TYR A . n 
A 1 159 ASN 159 178 178 ASN ASN A . n 
A 1 160 TRP 160 179 179 TRP TRP A . n 
A 1 161 ASP 161 180 180 ASP ASP A . n 
A 1 162 SER 162 181 181 SER SER A . n 
A 1 163 LYS 163 182 182 LYS LYS A . n 
A 1 164 LYS 164 183 183 LYS LYS A . n 
A 1 165 TYR 165 184 184 TYR TYR A . n 
A 1 166 SER 166 185 185 SER SER A . n 
A 1 167 ALA 167 186 186 ALA ALA A . n 
A 1 168 ASP 168 187 187 ASP ASP A . n 
A 1 169 HIS 169 188 188 HIS HIS A . n 
A 1 170 TYR 170 189 189 TYR TYR A . n 
A 1 171 THR 171 190 190 THR THR A . n 
A 1 172 PRO 172 191 191 PRO PRO A . n 
A 1 173 PHE 173 192 192 PHE PHE A . n 
A 1 174 PRO 174 193 193 PRO PRO A . n 
A 1 175 SER 175 194 194 SER SER A . n 
A 1 176 ASP 176 195 195 ASP ASP A . n 
A 1 177 LEU 177 196 196 LEU LEU A . n 
A 1 178 ALA 178 197 197 ALA ALA A . n 
A 1 179 PHE 179 198 198 PHE PHE A . n 
A 1 180 LEU 180 199 199 LEU LEU A . n 
A 1 181 SER 181 200 200 SER SER A . n 
A 1 182 GLU 182 201 201 GLU GLU A . n 
A 1 183 GLN 183 202 202 GLN GLN A . n 
A 1 184 VAL 184 203 203 VAL VAL A . n 
A 1 185 ALA 185 204 204 ALA ALA A . n 
A 1 186 THR 186 205 205 THR THR A . n 
A 1 187 ALA 187 206 206 ALA ALA A . n 
A 1 188 CYS 188 207 207 CYS CYS A . n 
A 1 189 GLY 189 208 208 GLY GLY A . n 
A 1 190 PHE 190 209 209 PHE PHE A . n 
A 1 191 GLN 191 210 210 GLN GLN A . n 
A 1 192 GLY 192 211 211 GLY GLY A . n 
A 1 193 PHE 193 212 212 PHE PHE A . n 
A 1 194 GLN 194 213 213 GLN GLN A . n 
A 1 195 ALA 195 214 214 ALA ALA A . n 
A 1 196 GLU 196 215 215 GLU GLU A . n 
A 1 197 ALA 197 216 216 ALA ALA A . n 
A 1 198 GLY 198 217 217 GLY GLY A . n 
A 1 199 ILE 199 218 218 ILE ILE A . n 
A 1 200 LEU 200 219 219 LEU LEU A . n 
A 1 201 ASN 201 220 220 ASN ASN A . n 
A 1 202 TYR 202 221 221 TYR TYR A . n 
A 1 203 TYR 203 222 222 TYR TYR A . n 
A 1 204 ARG 204 223 223 ARG ARG A . n 
A 1 205 LEU 205 224 224 LEU LEU A . n 
A 1 206 ASP 206 225 225 ASP ASP A . n 
A 1 207 SER 207 226 226 SER SER A . n 
A 1 208 THR 208 227 227 THR THR A . n 
A 1 209 LEU 209 228 228 LEU LEU A . n 
A 1 210 GLY 210 229 229 GLY GLY A . n 
A 1 211 ILE 211 230 230 ILE ILE A . n 
A 1 212 HIS 212 231 231 HIS HIS A . n 
A 1 213 VAL 213 232 232 VAL VAL A . n 
A 1 214 ASP 214 233 233 ASP ASP A . n 
A 1 215 ARG 215 234 234 ARG ARG A . n 
A 1 216 CYS 216 235 235 CYS CYS A . n 
A 1 217 GLU 217 236 236 GLU GLU A . n 
A 1 218 LEU 218 237 237 LEU LEU A . n 
A 1 219 ASP 219 238 238 ASP ASP A . n 
A 1 220 HIS 220 239 239 HIS HIS A . n 
A 1 221 SER 221 240 240 SER SER A . n 
A 1 222 LYS 222 241 241 LYS LYS A . n 
A 1 223 PRO 223 242 242 PRO PRO A . n 
A 1 224 LEU 224 243 243 LEU LEU A . n 
A 1 225 LEU 225 244 244 LEU LEU A . n 
A 1 226 SER 226 245 245 SER SER A . n 
A 1 227 PHE 227 246 246 PHE PHE A . n 
A 1 228 SER 228 247 247 SER SER A . n 
A 1 229 PHE 229 248 248 PHE PHE A . n 
A 1 230 GLY 230 249 249 GLY GLY A . n 
A 1 231 GLN 231 250 250 GLN GLN A . n 
A 1 232 SER 232 251 251 SER SER A . n 
A 1 233 ALA 233 252 252 ALA ALA A . n 
A 1 234 ILE 234 253 253 ILE ILE A . n 
A 1 235 PHE 235 254 254 PHE PHE A . n 
A 1 236 LEU 236 255 255 LEU LEU A . n 
A 1 237 LEU 237 256 256 LEU LEU A . n 
A 1 238 GLY 238 257 257 GLY GLY A . n 
A 1 239 GLY 239 258 258 GLY GLY A . n 
A 1 240 LEU 240 259 259 LEU LEU A . n 
A 1 241 LYS 241 260 260 LYS LYS A . n 
A 1 242 ARG 242 261 261 ARG ARG A . n 
A 1 243 ASP 243 262 262 ASP ASP A . n 
A 1 244 GLU 244 263 263 GLU GLU A . n 
A 1 245 ALA 245 264 264 ALA ALA A . n 
A 1 246 PRO 246 265 265 PRO PRO A . n 
A 1 247 THR 247 266 266 THR THR A . n 
A 1 248 ALA 248 267 267 ALA ALA A . n 
A 1 249 MET 249 268 268 MET MET A . n 
A 1 250 PHE 250 269 269 PHE PHE A . n 
A 1 251 MET 251 270 270 MET MET A . n 
A 1 252 HIS 252 271 271 HIS HIS A . n 
A 1 253 SER 253 272 272 SER SER A . n 
A 1 254 GLY 254 273 273 GLY GLY A . n 
A 1 255 ASP 255 274 274 ASP ASP A . n 
A 1 256 ILE 256 275 275 ILE ILE A . n 
A 1 257 MET 257 276 276 MET MET A . n 
A 1 258 VAL 258 277 277 VAL VAL A . n 
A 1 259 MET 259 278 278 MET MET A . n 
A 1 260 SER 260 279 279 SER SER A . n 
A 1 261 GLY 261 280 280 GLY GLY A . n 
A 1 262 PHE 262 281 281 PHE PHE A . n 
A 1 263 SER 263 282 282 SER SER A . n 
A 1 264 ARG 264 283 283 ARG ARG A . n 
A 1 265 LEU 265 284 284 LEU LEU A . n 
A 1 266 LEU 266 285 285 LEU LEU A . n 
A 1 267 ASN 267 286 286 ASN ASN A . n 
A 1 268 HIS 268 287 287 HIS HIS A . n 
A 1 269 ALA 269 288 288 ALA ALA A . n 
A 1 270 VAL 270 289 289 VAL VAL A . n 
A 1 271 PRO 271 290 290 PRO PRO A . n 
A 1 272 ARG 272 291 291 ARG ARG A . n 
A 1 273 VAL 273 292 292 VAL VAL A . n 
A 1 274 LEU 274 293 293 LEU LEU A . n 
A 1 275 PRO 275 294 294 PRO PRO A . n 
A 1 276 HIS 276 295 295 HIS HIS A . n 
A 1 277 PRO 277 296 296 PRO PRO A . n 
A 1 278 ASP 278 297 297 ASP ASP A . n 
A 1 279 GLY 279 298 298 GLY GLY A . n 
A 1 280 GLU 280 299 299 GLU GLU A . n 
A 1 281 SER 281 300 300 SER SER A . n 
A 1 282 LEU 282 301 301 LEU LEU A . n 
A 1 283 PRO 283 302 302 PRO PRO A . n 
A 1 284 HIS 284 303 303 HIS HIS A . n 
A 1 285 SER 285 304 304 SER SER A . n 
A 1 286 LEU 286 305 305 LEU LEU A . n 
A 1 287 GLU 287 306 306 GLU GLU A . n 
A 1 288 THR 288 307 307 THR THR A . n 
A 1 289 PRO 289 308 308 PRO PRO A . n 
A 1 290 LEU 290 309 309 LEU LEU A . n 
A 1 291 PRO 291 310 310 PRO PRO A . n 
A 1 292 ALA 292 311 311 ALA ALA A . n 
A 1 293 VAL 293 312 312 VAL VAL A . n 
A 1 294 LEU 294 313 313 LEU LEU A . n 
A 1 295 PRO 295 314 314 PRO PRO A . n 
A 1 296 SER 296 315 315 SER SER A . n 
A 1 297 ASN 297 316 316 ASN ASN A . n 
A 1 298 SER 298 317 317 SER SER A . n 
A 1 299 LEU 299 318 318 LEU LEU A . n 
A 1 300 VAL 300 319 319 VAL VAL A . n 
A 1 301 GLU 301 320 320 GLU GLU A . n 
A 1 302 PRO 302 321 321 PRO PRO A . n 
A 1 303 SER 303 322 322 SER SER A . n 
A 1 304 SER 304 323 323 SER SER A . n 
A 1 305 VAL 305 324 324 VAL VAL A . n 
A 1 306 GLU 306 325 325 GLU GLU A . n 
A 1 307 ASP 307 326 326 ASP ASP A . n 
A 1 308 TRP 308 327 327 TRP TRP A . n 
A 1 309 GLN 309 328 328 GLN GLN A . n 
A 1 310 VAL 310 329 329 VAL VAL A . n 
A 1 311 CYS 311 330 330 CYS CYS A . n 
A 1 312 ALA 312 331 331 ALA ALA A . n 
A 1 313 THR 313 332 332 THR THR A . n 
A 1 314 TYR 314 333 333 TYR TYR A . n 
A 1 315 LEU 315 334 334 LEU LEU A . n 
A 1 316 ARG 316 335 335 ARG ARG A . n 
A 1 317 THR 317 336 336 THR THR A . n 
A 1 318 ALA 318 337 337 ALA ALA A . n 
A 1 319 ARG 319 338 338 ARG ARG A . n 
A 1 320 VAL 320 339 339 VAL VAL A . n 
A 1 321 ASN 321 340 340 ASN ASN A . n 
A 1 322 MET 322 341 341 MET MET A . n 
A 1 323 THR 323 342 342 THR THR A . n 
A 1 324 VAL 324 343 343 VAL VAL A . n 
A 1 325 ARG 325 344 344 ARG ARG A . n 
A 1 326 GLN 326 345 345 GLN GLN A . n 
A 1 327 VAL 327 346 346 VAL VAL A . n 
A 1 328 LEU 328 347 347 LEU LEU A . n 
A 1 329 ALA 329 348 348 ALA ALA A . n 
A 1 330 THR 330 349 349 THR THR A . n 
A 1 331 GLY 331 350 350 GLY GLY A . n 
A 1 332 GLN 332 351 351 GLN GLN A . n 
A 1 333 ASP 333 352 352 ASP ASP A . n 
A 1 334 PHE 334 353 353 PHE PHE A . n 
A 1 335 PRO 335 354 354 PRO PRO A . n 
A 1 336 LEU 336 355 ?   ?   ?   A . n 
B 2 1   DG  1   1   1   DG  DG  B . n 
B 2 2   DC  2   2   2   DC  DC  B . n 
B 2 3   DT  3   3   3   DT  DT  B . n 
B 2 4   DG  4   4   4   DG  DG  B . n 
B 2 5   DA  5   5   5   DA  DA  B . n 
B 2 6   DG  6   6   6   DG  DG  B . n 
B 2 7   DT  7   7   7   DT  DT  B . n 
B 2 8   DG  8   8   8   DG  DG  B . n 
B 2 9   DC  9   9   9   DC  DC  B . n 
B 2 10  DC  10  10  10  DC  DC  B . n 
B 2 11  DC  11  11  11  DC  DC  B . n 
B 2 12  DG  12  12  12  DG  DG  B . n 
B 2 13  DC  13  13  13  DC  DC  B . n 
B 2 14  DG  14  14  14  DG  DG  B . n 
B 2 15  DT  15  15  15  DT  DT  B . n 
B 2 16  DG  16  16  16  DG  DG  B . n 
B 2 17  DC  17  17  17  DC  DC  B . n 
B 2 18  DT  18  18  18  DT  DT  B . n 
B 2 19  DG  19  19  19  DG  DG  B . n 
B 2 20  DG  20  20  20  DG  DG  B . n 
B 2 21  DA  21  21  21  DA  DA  B . n 
B 2 22  DT  22  22  22  DT  DT  B . n 
B 2 23  DC  23  23  23  DC  DC  B . n 
B 2 24  DC  24  24  24  DC  DC  B . n 
C 3 1   DG  1   1   1   DG  DG  C . n 
C 3 2   DG  2   2   2   DG  DG  C . n 
C 3 3   DA  3   3   3   DA  DA  C . n 
C 3 4   DT  4   4   4   DT  DT  C . n 
C 3 5   DC  5   5   5   DC  DC  C . n 
C 3 6   DC  6   6   6   DC  DC  C . n 
C 3 7   DA  7   7   7   DA  DA  C . n 
C 3 8   DG  8   8   8   DG  DG  C . n 
C 3 9   DC  9   9   9   DC  DC  C . n 
C 3 10  DA  10  10  10  DA  DA  C . n 
C 3 11  DC  11  11  11  DC  DC  C . n 
C 3 12  DG  12  12  12  DG  DG  C . n 
C 3 13  DC  13  13  13  DC  DC  C . n 
C 3 14  DC  14  14  14  DC  DC  C . n 
C 3 15  DA  15  15  15  DA  DA  C . n 
C 3 16  DC  16  16  16  DC  DC  C . n 
C 3 17  DT  17  17  17  DT  DT  C . n 
C 3 18  DC  18  18  18  DC  DC  C . n 
C 3 19  DA  19  19  19  DA  DA  C . n 
C 3 20  DG  20  20  20  DG  DG  C . n 
C 3 21  DC  21  21  21  DC  DC  C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CL  1  401 1  CL  CL  A . 
E 4 CL  1  402 2  CL  CL  A . 
F 5 SIN 1  403 1  SIN SIN A . 
G 6 XL3 1  101 1  XL3 XL3 B . 
H 7 HOH 1  501 41 HOH HOH A . 
H 7 HOH 2  502 52 HOH HOH A . 
H 7 HOH 3  503 30 HOH HOH A . 
H 7 HOH 4  504 37 HOH HOH A . 
H 7 HOH 5  505 58 HOH HOH A . 
H 7 HOH 6  506 32 HOH HOH A . 
H 7 HOH 7  507 4  HOH HOH A . 
H 7 HOH 8  508 51 HOH HOH A . 
H 7 HOH 9  509 46 HOH HOH A . 
H 7 HOH 10 510 5  HOH HOH A . 
H 7 HOH 11 511 17 HOH HOH A . 
H 7 HOH 12 512 10 HOH HOH A . 
H 7 HOH 13 513 2  HOH HOH A . 
H 7 HOH 14 514 56 HOH HOH A . 
H 7 HOH 15 515 31 HOH HOH A . 
H 7 HOH 16 516 12 HOH HOH A . 
H 7 HOH 17 517 7  HOH HOH A . 
H 7 HOH 18 518 40 HOH HOH A . 
H 7 HOH 19 519 15 HOH HOH A . 
H 7 HOH 20 520 6  HOH HOH A . 
H 7 HOH 21 521 9  HOH HOH A . 
H 7 HOH 22 522 24 HOH HOH A . 
H 7 HOH 23 523 3  HOH HOH A . 
H 7 HOH 24 524 29 HOH HOH A . 
H 7 HOH 25 525 59 HOH HOH A . 
H 7 HOH 26 526 25 HOH HOH A . 
H 7 HOH 27 527 11 HOH HOH A . 
H 7 HOH 28 528 19 HOH HOH A . 
H 7 HOH 29 529 20 HOH HOH A . 
H 7 HOH 30 530 16 HOH HOH A . 
H 7 HOH 31 531 27 HOH HOH A . 
H 7 HOH 32 532 63 HOH HOH A . 
H 7 HOH 33 533 1  HOH HOH A . 
H 7 HOH 34 534 44 HOH HOH A . 
H 7 HOH 35 535 18 HOH HOH A . 
H 7 HOH 36 536 14 HOH HOH A . 
H 7 HOH 37 537 33 HOH HOH A . 
H 7 HOH 38 538 53 HOH HOH A . 
H 7 HOH 39 539 26 HOH HOH A . 
H 7 HOH 40 540 28 HOH HOH A . 
H 7 HOH 41 541 13 HOH HOH A . 
H 7 HOH 42 542 35 HOH HOH A . 
H 7 HOH 43 543 39 HOH HOH A . 
H 7 HOH 44 544 42 HOH HOH A . 
H 7 HOH 45 545 49 HOH HOH A . 
H 7 HOH 46 546 34 HOH HOH A . 
H 7 HOH 47 547 23 HOH HOH A . 
H 7 HOH 48 548 8  HOH HOH A . 
H 7 HOH 49 549 62 HOH HOH A . 
H 7 HOH 50 550 54 HOH HOH A . 
H 7 HOH 51 551 38 HOH HOH A . 
H 7 HOH 52 552 61 HOH HOH A . 
H 7 HOH 53 553 47 HOH HOH A . 
H 7 HOH 54 554 50 HOH HOH A . 
I 7 HOH 1  201 55 HOH HOH B . 
I 7 HOH 2  202 21 HOH HOH B . 
I 7 HOH 3  203 36 HOH HOH B . 
I 7 HOH 4  204 57 HOH HOH B . 
J 7 HOH 1  101 45 HOH HOH C . 
J 7 HOH 2  102 48 HOH HOH C . 
J 7 HOH 3  103 60 HOH HOH C . 
J 7 HOH 4  104 43 HOH HOH C . 
J 7 HOH 5  105 22 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4980  ? 
1 MORE         -39   ? 
1 'SSA (A^2)'  21850 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    CL 
_pdbx_struct_special_symmetry.auth_seq_id     402 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   CL 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-04-08 
2 'Structure model' 1 1 2020-06-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Source and taxonomy' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            entity_src_gen 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_entity_src_gen.gene_src_common_name'           
2 2 'Structure model' '_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id' 
3 2 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? DENZO       ? ? ? .    1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .    2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .    3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .    5 
# 
_pdbx_entry_details.entry_id                 6KSF 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NZ 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    LYS 
_pdbx_validate_symm_contact.auth_seq_id_1     25 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O6 
_pdbx_validate_symm_contact.auth_asym_id_2    C 
_pdbx_validate_symm_contact.auth_comp_id_2    DG 
_pdbx_validate_symm_contact.auth_seq_id_2     2 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   5_455 
_pdbx_validate_symm_contact.dist              1.30 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C A LYS 56 ? ? N A PRO 57 ? ? CA A PRO 57 ? ? 146.92 127.00 19.92  2.40 Y 
2 1 C A LYS 56 ? ? N A PRO 57 ? ? CD A PRO 57 ? ? 103.26 120.60 -17.34 2.20 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 35  ? ? -42.59  100.62  
2 1 LEU A 51  ? ? 70.10   -15.77  
3 1 PRO A 55  ? ? -86.04  31.70   
4 1 LYS A 56  ? ? -150.43 -139.10 
5 1 ASN A 104 ? ? -21.64  95.01   
6 1 LYS A 137 ? ? -69.09  13.41   
7 1 GLU A 138 ? ? -57.60  -90.51  
8 1 GLU A 155 ? ? -78.01  26.07   
9 1 ASP A 352 ? ? -96.06  -155.71 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLU 20 ? CG  ? A GLU 1  CG  
2 1 Y 1 A GLU 20 ? CD  ? A GLU 1  CD  
3 1 Y 1 A GLU 20 ? OE1 ? A GLU 1  OE1 
4 1 Y 1 A GLU 20 ? OE2 ? A GLU 1  OE2 
5 1 Y 1 A SER 54 ? OG  ? A SER 35 OG  
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     LEU 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      355 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    LEU 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     336 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6KSF 'double helix'        
6KSF 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 21 1_555 -0.134 -0.434 0.336  5.019   -4.270  -2.700 1  B_DG1:DC21_C  B 1  ? C 21 ? 19 1 
1 B DC 2  1_555 C DG 20 1_555 -0.076 -0.409 0.092  1.969   -4.444  1.691  2  B_DC2:DG20_C  B 2  ? C 20 ? 19 1 
1 B DT 3  1_555 C DA 19 1_555 -0.797 -0.173 -0.106 5.112   -4.385  9.585  3  B_DT3:DA19_C  B 3  ? C 19 ? 20 1 
1 B DG 4  1_555 C DC 18 1_555 -0.291 -0.213 0.248  6.884   -11.193 1.025  4  B_DG4:DC18_C  B 4  ? C 18 ? 19 1 
1 B DA 5  1_555 C DT 17 1_555 -0.017 -0.193 0.205  0.052   -11.763 -1.608 5  B_DA5:DT17_C  B 5  ? C 17 ? 20 1 
1 B DG 6  1_555 C DC 16 1_555 -0.525 -0.088 -0.092 -6.302  -8.121  2.184  6  B_DG6:DC16_C  B 6  ? C 16 ? 19 1 
1 B DT 7  1_555 C DA 15 1_555 -0.106 -0.175 0.169  2.249   -6.421  7.617  7  B_DT7:DA15_C  B 7  ? C 15 ? 20 1 
1 B DG 8  1_555 C DC 14 1_555 -0.059 -0.110 0.363  -9.392  -13.470 0.227  8  B_DG8:DC14_C  B 8  ? C 14 ? 19 1 
1 B DG 12 1_555 C DC 13 1_555 -0.223 -0.069 -0.110 -13.931 -4.555  7.299  9  B_DG12:DC13_C B 12 ? C 13 ? 19 1 
1 B DC 13 1_555 C DG 12 1_555 -0.408 -0.347 0.116  -12.737 3.909   2.550  10 B_DC13:DG12_C B 13 ? C 12 ? 19 1 
1 B DG 14 1_555 C DC 11 1_555 -0.005 -0.285 -0.059 1.363   8.473   5.959  11 B_DG14:DC11_C B 14 ? C 11 ? 19 1 
1 B DT 15 1_555 C DA 10 1_555 0.418  -0.235 0.159  2.121   -0.065  -0.896 12 B_DT15:DA10_C B 15 ? C 10 ? 20 1 
1 B DG 16 1_555 C DC 9  1_555 0.215  -0.040 0.392  3.575   -4.202  -3.472 13 B_DG16:DC9_C  B 16 ? C 9  ? 19 1 
1 B DC 17 1_555 C DG 8  1_555 -0.618 -0.201 -0.037 1.270   -6.712  1.824  14 B_DC17:DG8_C  B 17 ? C 8  ? 19 1 
1 B DT 18 1_555 C DA 7  1_555 0.728  -0.106 -0.036 7.954   -8.677  7.098  15 B_DT18:DA7_C  B 18 ? C 7  ? 20 1 
1 B DG 19 1_555 C DC 6  1_555 -0.869 -0.429 -0.092 0.649   -6.426  2.224  16 B_DG19:DC6_C  B 19 ? C 6  ? 19 1 
1 B DG 20 1_555 C DC 5  1_555 -0.505 -0.580 0.041  2.988   -11.038 -4.226 17 B_DG20:DC5_C  B 20 ? C 5  ? 19 1 
1 B DA 21 1_555 C DT 4  1_555 -0.174 -0.261 -0.102 -2.026  -13.413 -2.618 18 B_DA21:DT4_C  B 21 ? C 4  ? 20 1 
1 B DT 22 1_555 C DA 3  1_555 0.488  -0.036 -0.055 -6.800  -13.562 -4.086 19 B_DT22:DA3_C  B 22 ? C 3  ? 20 1 
1 B DC 23 1_555 C DG 2  1_555 -0.171 0.088  -0.007 -6.560  -3.844  7.086  20 B_DC23:DG2_C  B 23 ? C 2  ? 19 1 
1 B DC 24 1_555 C DG 1  1_555 0.158  -0.181 -0.213 -0.138  -0.433  -2.922 21 B_DC24:DG1_C  B 24 ? C 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 21 1_555 B DC 2  1_555 C DG 20 1_555 -0.477 -0.579 3.327 1.468  2.685  36.685 -1.285 0.956  3.257 4.256  
-2.327 36.808 1  BB_DG1DC2:DG20DC21_CC   B 1  ? C 21 ? B 2  ? C 20 ? 
1 B DC 2  1_555 C DG 20 1_555 B DT 3  1_555 C DA 19 1_555 0.650  0.260  3.279 2.869  2.970  27.731 -0.176 -0.652 3.337 6.153  
-5.944 28.030 2  BB_DC2DT3:DA19DG20_CC   B 2  ? C 20 ? B 3  ? C 19 ? 
1 B DT 3  1_555 C DA 19 1_555 B DG 4  1_555 C DC 18 1_555 -0.279 1.082  3.380 -1.226 2.896  40.391 1.225  0.259  3.453 4.187  
1.773  40.508 3  BB_DT3DG4:DC18DA19_CC   B 3  ? C 19 ? B 4  ? C 18 ? 
1 B DG 4  1_555 C DC 18 1_555 B DA 5  1_555 C DT 17 1_555 -0.268 -0.322 3.427 -0.901 0.301  41.270 -0.491 0.278  3.430 0.427  
1.278  41.280 4  BB_DG4DA5:DT17DC18_CC   B 4  ? C 18 ? B 5  ? C 17 ? 
1 B DA 5  1_555 C DT 17 1_555 B DG 6  1_555 C DC 16 1_555 0.177  -0.823 3.402 -0.217 0.249  33.701 -1.462 -0.342 3.395 0.430  
0.374  33.702 5  BB_DA5DG6:DC16DT17_CC   B 5  ? C 17 ? B 6  ? C 16 ? 
1 B DG 6  1_555 C DC 16 1_555 B DT 7  1_555 C DA 15 1_555 -0.318 -0.464 3.090 -1.753 2.000  31.249 -1.214 0.277  3.068 3.705  
3.247  31.359 6  BB_DG6DT7:DA15DC16_CC   B 6  ? C 16 ? B 7  ? C 15 ? 
1 B DT 7  1_555 C DA 15 1_555 B DG 8  1_555 C DC 14 1_555 -0.117 -0.455 3.496 -1.853 -2.002 37.708 -0.426 -0.076 3.516 -3.092 
2.862  37.803 7  BB_DT7DG8:DC14DA15_CC   B 7  ? C 15 ? B 8  ? C 14 ? 
1 B DG 8  1_555 C DC 14 1_555 B DG 12 1_555 C DC 13 1_555 -0.413 -0.659 3.339 2.255  3.154  45.240 -1.136 0.737  3.265 4.091  
-2.925 45.398 8  BB_DG8DG12:DC13DC14_CC  B 8  ? C 14 ? B 12 ? C 13 ? 
1 B DG 12 1_555 C DC 13 1_555 B DC 13 1_555 C DG 12 1_555 -1.038 -1.466 3.214 0.546  5.822  34.494 -3.269 1.806  2.919 9.732  
-0.912 34.971 9  BB_DG12DC13:DG12DC13_CC B 12 ? C 13 ? B 13 ? C 12 ? 
1 B DC 13 1_555 C DG 12 1_555 B DG 14 1_555 C DC 11 1_555 -0.171 0.368  3.094 1.711  5.590  35.391 -0.167 0.512  3.103 9.117  
-2.791 35.856 10 BB_DC13DG14:DC11DG12_CC B 13 ? C 12 ? B 14 ? C 11 ? 
1 B DG 14 1_555 C DC 11 1_555 B DT 15 1_555 C DA 10 1_555 -0.521 -0.494 3.337 -0.232 3.008  29.099 -1.638 0.980  3.274 5.966  
0.459  29.252 11 BB_DG14DT15:DA10DC11_CC B 14 ? C 11 ? B 15 ? C 10 ? 
1 B DT 15 1_555 C DA 10 1_555 B DG 16 1_555 C DC 9  1_555 -0.104 0.229  3.279 0.153  2.440  35.546 0.017  0.193  3.287 3.991  
-0.250 35.628 12 BB_DT15DG16:DC9DA10_CC  B 15 ? C 10 ? B 16 ? C 9  ? 
1 B DG 16 1_555 C DC 9  1_555 B DC 17 1_555 C DG 8  1_555 0.400  -0.535 3.262 5.339  2.130  31.944 -1.333 0.224  3.243 3.831  
-9.604 32.443 13 BB_DG16DC17:DG8DC9_CC   B 16 ? C 9  ? B 17 ? C 8  ? 
1 B DC 17 1_555 C DG 8  1_555 B DT 18 1_555 C DA 7  1_555 0.112  0.619  3.244 3.758  4.095  35.278 0.414  0.364  3.287 6.705  
-6.154 35.699 14 BB_DC17DT18:DA7DG8_CC   B 17 ? C 8  ? B 18 ? C 7  ? 
1 B DT 18 1_555 C DA 7  1_555 B DG 19 1_555 C DC 6  1_555 0.562  2.610  3.562 2.785  -0.466 34.655 4.445  -0.477 3.561 -0.781 
-4.665 34.766 15 BB_DT18DG19:DC6DA7_CC   B 18 ? C 7  ? B 19 ? C 6  ? 
1 B DG 19 1_555 C DC 6  1_555 B DG 20 1_555 C DC 5  1_555 -0.856 1.475  3.358 -5.218 0.565  37.374 2.205  0.616  3.463 0.876  
8.094  37.728 16 BB_DG19DG20:DC5DC6_CC   B 19 ? C 6  ? B 20 ? C 5  ? 
1 B DG 20 1_555 C DC 5  1_555 B DA 21 1_555 C DT 4  1_555 -0.035 -0.305 3.377 -0.714 0.919  39.650 -0.560 -0.034 3.369 1.355  
1.052  39.667 17 BB_DG20DA21:DT4DC5_CC   B 20 ? C 5  ? B 21 ? C 4  ? 
1 B DA 21 1_555 C DT 4  1_555 B DT 22 1_555 C DA 3  1_555 -0.251 -0.883 3.411 -2.011 0.892  36.324 -1.543 0.110  3.398 1.430  
3.222  36.388 18 BB_DA21DT22:DA3DT4_CC   B 21 ? C 4  ? B 22 ? C 3  ? 
1 B DT 22 1_555 C DA 3  1_555 B DC 23 1_555 C DG 2  1_555 0.704  -0.038 3.221 0.149  4.227  33.949 -0.721 -1.174 3.196 7.205  
-0.254 34.204 19 BB_DT22DC23:DG2DA3_CC   B 22 ? C 3  ? B 23 ? C 2  ? 
1 B DC 23 1_555 C DG 2  1_555 B DC 24 1_555 C DG 1  1_555 -0.912 -0.119 3.150 1.752  8.564  26.547 -2.183 2.287  2.905 18.039 
-3.690 27.924 20 BB_DC23DC24:DG1DG2_CC   B 23 ? C 2  ? B 24 ? C 1  ? 
# 
_pdbx_audit_support.funding_organization   'National Natural Science Foundation of China' 
_pdbx_audit_support.country                China 
_pdbx_audit_support.grant_number           31725014 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        XL3 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   XL3 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CHLORIDE ION'  CL  
5 'SUCCINIC ACID' SIN 
6 propane-1-thiol XL3 
7 water           HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#