data_6L9H
# 
_entry.id   6L9H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.325 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6L9H         
WWPDB D_1300014425 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6L9H 
_pdbx_database_status.recvd_initial_deposition_date   2019-11-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Soman, A.'        1 0000-0003-3522-3661 
'Liew, C.W.'       2 0000-0002-4343-818X 
'Teo, H.L.'        3 ?                   
'Berezhnoy, N.'    4 ?                   
'Korolev, N.'      5 ?                   
'Rhodes, D.'       6 ?                   
'Nordenskiold, L.' 7 0000-0002-3681-209X 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            48 
_citation.language                  ? 
_citation.page_first                5383 
_citation.page_last                 5396 
_citation.title                     'The human telomeric nucleosome displays distinct structural and dynamic properties.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkaa289 
_citation.pdbx_database_id_PubMed   32374876 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Soman, A.'        1 ? 
primary 'Liew, C.W.'       2 ? 
primary 'Teo, H.L.'        3 ? 
primary 'Berezhnoy, N.V.'  4 ? 
primary 'Olieric, V.'      5 ? 
primary 'Korolev, N.'      6 ? 
primary 'Rhodes, D.'       7 ? 
primary 'Nordenskiold, L.' 8 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6L9H 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     106.455 
_cell.length_a_esd                 ? 
_cell.length_b                     109.388 
_cell.length_b_esd                 ? 
_cell.length_c                     176.376 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6L9H 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.1'                             11269.213 2 ? ? ? ? 
2 polymer     man 'Histone H4'                               9990.770  2 ? ? ? ? 
3 polymer     man 'Histone H2A type 1-B/E'                   11508.419 2 ? ? ? ? 
4 polymer     man 'Histone H2B type 1-K'                     10607.174 2 ? ? ? ? 
5 polymer     man 'Human Telomeric DNA (145-MER) - G-strand' 46024.258 1 ? ? ? ? 
6 polymer     man 'Human Telomeric DNA (145-MER) - C-strand' 43478.914 1 ? ? ? ? 
7 non-polymer syn 'MANGANESE (II) ION'                       54.938    4 ? ? ? ? 
8 water       nat water                                      18.015    6 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'Histone H2A' 
4 'Histone H2B' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
;
;RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR
TLYGFGG
;
;KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR
TLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEEL
NKLLGRVTIAQGGVLPNIQAVLLPK
;
;AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEEL
NKLLGRVTIAQGGVLPNIQAVLLPK
;
C,G ? 
4 'polypeptide(L)'        no no 
;RSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA
VSEGTKAVTKYTSAK
;
;RSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA
VSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)
(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)
(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)
(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)
(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)
(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)
(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)(DG)(DT)(DT)(DA)(DG)(DG)
(DG)(DT)(DG)(DA)(DT)
;
;ATCTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGG
GTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTTAGGGTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)
(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)
(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)
(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)
(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)
(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)
(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)(DA)(DA)(DC)(DC)(DC)(DT)
(DA)(DA)(DG)(DA)(DT)
;
;ATCACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCT
AACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAAGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   TYR n 
1 3   ARG n 
1 4   PRO n 
1 5   GLY n 
1 6   THR n 
1 7   VAL n 
1 8   ALA n 
1 9   LEU n 
1 10  ARG n 
1 11  GLU n 
1 12  ILE n 
1 13  ARG n 
1 14  ARG n 
1 15  TYR n 
1 16  GLN n 
1 17  LYS n 
1 18  SER n 
1 19  THR n 
1 20  GLU n 
1 21  LEU n 
1 22  LEU n 
1 23  ILE n 
1 24  ARG n 
1 25  LYS n 
1 26  LEU n 
1 27  PRO n 
1 28  PHE n 
1 29  GLN n 
1 30  ARG n 
1 31  LEU n 
1 32  VAL n 
1 33  ARG n 
1 34  GLU n 
1 35  ILE n 
1 36  ALA n 
1 37  GLN n 
1 38  ASP n 
1 39  PHE n 
1 40  LYS n 
1 41  THR n 
1 42  ASP n 
1 43  LEU n 
1 44  ARG n 
1 45  PHE n 
1 46  GLN n 
1 47  SER n 
1 48  SER n 
1 49  ALA n 
1 50  VAL n 
1 51  MET n 
1 52  ALA n 
1 53  LEU n 
1 54  GLN n 
1 55  GLU n 
1 56  ALA n 
1 57  CYS n 
1 58  GLU n 
1 59  ALA n 
1 60  TYR n 
1 61  LEU n 
1 62  VAL n 
1 63  GLY n 
1 64  LEU n 
1 65  PHE n 
1 66  GLU n 
1 67  ASP n 
1 68  THR n 
1 69  ASN n 
1 70  LEU n 
1 71  CYS n 
1 72  ALA n 
1 73  ILE n 
1 74  HIS n 
1 75  ALA n 
1 76  LYS n 
1 77  ARG n 
1 78  VAL n 
1 79  THR n 
1 80  ILE n 
1 81  MET n 
1 82  PRO n 
1 83  LYS n 
1 84  ASP n 
1 85  ILE n 
1 86  GLN n 
1 87  LEU n 
1 88  ALA n 
1 89  ARG n 
1 90  ARG n 
1 91  ILE n 
1 92  ARG n 
1 93  GLY n 
1 94  GLU n 
1 95  ARG n 
1 96  ALA n 
2 1   LYS n 
2 2   ARG n 
2 3   HIS n 
2 4   ARG n 
2 5   LYS n 
2 6   VAL n 
2 7   LEU n 
2 8   ARG n 
2 9   ASP n 
2 10  ASN n 
2 11  ILE n 
2 12  GLN n 
2 13  GLY n 
2 14  ILE n 
2 15  THR n 
2 16  LYS n 
2 17  PRO n 
2 18  ALA n 
2 19  ILE n 
2 20  ARG n 
2 21  ARG n 
2 22  LEU n 
2 23  ALA n 
2 24  ARG n 
2 25  ARG n 
2 26  GLY n 
2 27  GLY n 
2 28  VAL n 
2 29  LYS n 
2 30  ARG n 
2 31  ILE n 
2 32  SER n 
2 33  GLY n 
2 34  LEU n 
2 35  ILE n 
2 36  TYR n 
2 37  GLU n 
2 38  GLU n 
2 39  THR n 
2 40  ARG n 
2 41  GLY n 
2 42  VAL n 
2 43  LEU n 
2 44  LYS n 
2 45  VAL n 
2 46  PHE n 
2 47  LEU n 
2 48  GLU n 
2 49  ASN n 
2 50  VAL n 
2 51  ILE n 
2 52  ARG n 
2 53  ASP n 
2 54  ALA n 
2 55  VAL n 
2 56  THR n 
2 57  TYR n 
2 58  THR n 
2 59  GLU n 
2 60  HIS n 
2 61  ALA n 
2 62  LYS n 
2 63  ARG n 
2 64  LYS n 
2 65  THR n 
2 66  VAL n 
2 67  THR n 
2 68  ALA n 
2 69  MET n 
2 70  ASP n 
2 71  VAL n 
2 72  VAL n 
2 73  TYR n 
2 74  ALA n 
2 75  LEU n 
2 76  LYS n 
2 77  ARG n 
2 78  GLN n 
2 79  GLY n 
2 80  ARG n 
2 81  THR n 
2 82  LEU n 
2 83  TYR n 
2 84  GLY n 
2 85  PHE n 
2 86  GLY n 
2 87  GLY n 
3 1   ALA n 
3 2   LYS n 
3 3   THR n 
3 4   ARG n 
3 5   SER n 
3 6   SER n 
3 7   ARG n 
3 8   ALA n 
3 9   GLY n 
3 10  LEU n 
3 11  GLN n 
3 12  PHE n 
3 13  PRO n 
3 14  VAL n 
3 15  GLY n 
3 16  ARG n 
3 17  VAL n 
3 18  HIS n 
3 19  ARG n 
3 20  LEU n 
3 21  LEU n 
3 22  ARG n 
3 23  LYS n 
3 24  GLY n 
3 25  ASN n 
3 26  TYR n 
3 27  SER n 
3 28  GLU n 
3 29  ARG n 
3 30  VAL n 
3 31  GLY n 
3 32  ALA n 
3 33  GLY n 
3 34  ALA n 
3 35  PRO n 
3 36  VAL n 
3 37  TYR n 
3 38  LEU n 
3 39  ALA n 
3 40  ALA n 
3 41  VAL n 
3 42  LEU n 
3 43  GLU n 
3 44  TYR n 
3 45  LEU n 
3 46  THR n 
3 47  ALA n 
3 48  GLU n 
3 49  ILE n 
3 50  LEU n 
3 51  GLU n 
3 52  LEU n 
3 53  ALA n 
3 54  GLY n 
3 55  ASN n 
3 56  ALA n 
3 57  ALA n 
3 58  ARG n 
3 59  ASP n 
3 60  ASN n 
3 61  LYS n 
3 62  LYS n 
3 63  THR n 
3 64  ARG n 
3 65  ILE n 
3 66  ILE n 
3 67  PRO n 
3 68  ARG n 
3 69  HIS n 
3 70  LEU n 
3 71  GLN n 
3 72  LEU n 
3 73  ALA n 
3 74  ILE n 
3 75  ARG n 
3 76  ASN n 
3 77  ASP n 
3 78  GLU n 
3 79  GLU n 
3 80  LEU n 
3 81  ASN n 
3 82  LYS n 
3 83  LEU n 
3 84  LEU n 
3 85  GLY n 
3 86  ARG n 
3 87  VAL n 
3 88  THR n 
3 89  ILE n 
3 90  ALA n 
3 91  GLN n 
3 92  GLY n 
3 93  GLY n 
3 94  VAL n 
3 95  LEU n 
3 96  PRO n 
3 97  ASN n 
3 98  ILE n 
3 99  GLN n 
3 100 ALA n 
3 101 VAL n 
3 102 LEU n 
3 103 LEU n 
3 104 PRO n 
3 105 LYS n 
4 1   ARG n 
4 2   SER n 
4 3   ARG n 
4 4   LYS n 
4 5   GLU n 
4 6   SER n 
4 7   TYR n 
4 8   SER n 
4 9   VAL n 
4 10  TYR n 
4 11  VAL n 
4 12  TYR n 
4 13  LYS n 
4 14  VAL n 
4 15  LEU n 
4 16  LYS n 
4 17  GLN n 
4 18  VAL n 
4 19  HIS n 
4 20  PRO n 
4 21  ASP n 
4 22  THR n 
4 23  GLY n 
4 24  ILE n 
4 25  SER n 
4 26  SER n 
4 27  LYS n 
4 28  ALA n 
4 29  MET n 
4 30  GLY n 
4 31  ILE n 
4 32  MET n 
4 33  ASN n 
4 34  SER n 
4 35  PHE n 
4 36  VAL n 
4 37  ASN n 
4 38  ASP n 
4 39  ILE n 
4 40  PHE n 
4 41  GLU n 
4 42  ARG n 
4 43  ILE n 
4 44  ALA n 
4 45  GLY n 
4 46  GLU n 
4 47  ALA n 
4 48  SER n 
4 49  ARG n 
4 50  LEU n 
4 51  ALA n 
4 52  HIS n 
4 53  TYR n 
4 54  ASN n 
4 55  LYS n 
4 56  ARG n 
4 57  SER n 
4 58  THR n 
4 59  ILE n 
4 60  THR n 
4 61  SER n 
4 62  ARG n 
4 63  GLU n 
4 64  ILE n 
4 65  GLN n 
4 66  THR n 
4 67  ALA n 
4 68  VAL n 
4 69  ARG n 
4 70  LEU n 
4 71  LEU n 
4 72  LEU n 
4 73  PRO n 
4 74  GLY n 
4 75  GLU n 
4 76  LEU n 
4 77  ALA n 
4 78  LYS n 
4 79  HIS n 
4 80  ALA n 
4 81  VAL n 
4 82  SER n 
4 83  GLU n 
4 84  GLY n 
4 85  THR n 
4 86  LYS n 
4 87  ALA n 
4 88  VAL n 
4 89  THR n 
4 90  LYS n 
4 91  TYR n 
4 92  THR n 
4 93  SER n 
4 94  ALA n 
4 95  LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DT  n 
5 5   DT  n 
5 6   DA  n 
5 7   DG  n 
5 8   DG  n 
5 9   DG  n 
5 10  DT  n 
5 11  DT  n 
5 12  DA  n 
5 13  DG  n 
5 14  DG  n 
5 15  DG  n 
5 16  DT  n 
5 17  DT  n 
5 18  DA  n 
5 19  DG  n 
5 20  DG  n 
5 21  DG  n 
5 22  DT  n 
5 23  DT  n 
5 24  DA  n 
5 25  DG  n 
5 26  DG  n 
5 27  DG  n 
5 28  DT  n 
5 29  DT  n 
5 30  DA  n 
5 31  DG  n 
5 32  DG  n 
5 33  DG  n 
5 34  DT  n 
5 35  DT  n 
5 36  DA  n 
5 37  DG  n 
5 38  DG  n 
5 39  DG  n 
5 40  DT  n 
5 41  DT  n 
5 42  DA  n 
5 43  DG  n 
5 44  DG  n 
5 45  DG  n 
5 46  DT  n 
5 47  DT  n 
5 48  DA  n 
5 49  DG  n 
5 50  DG  n 
5 51  DG  n 
5 52  DT  n 
5 53  DT  n 
5 54  DA  n 
5 55  DG  n 
5 56  DG  n 
5 57  DG  n 
5 58  DT  n 
5 59  DT  n 
5 60  DA  n 
5 61  DG  n 
5 62  DG  n 
5 63  DG  n 
5 64  DT  n 
5 65  DT  n 
5 66  DA  n 
5 67  DG  n 
5 68  DG  n 
5 69  DG  n 
5 70  DT  n 
5 71  DT  n 
5 72  DA  n 
5 73  DG  n 
5 74  DG  n 
5 75  DG  n 
5 76  DT  n 
5 77  DT  n 
5 78  DA  n 
5 79  DG  n 
5 80  DG  n 
5 81  DG  n 
5 82  DT  n 
5 83  DT  n 
5 84  DA  n 
5 85  DG  n 
5 86  DG  n 
5 87  DG  n 
5 88  DT  n 
5 89  DT  n 
5 90  DA  n 
5 91  DG  n 
5 92  DG  n 
5 93  DG  n 
5 94  DT  n 
5 95  DT  n 
5 96  DA  n 
5 97  DG  n 
5 98  DG  n 
5 99  DG  n 
5 100 DT  n 
5 101 DT  n 
5 102 DA  n 
5 103 DG  n 
5 104 DG  n 
5 105 DG  n 
5 106 DT  n 
5 107 DT  n 
5 108 DA  n 
5 109 DG  n 
5 110 DG  n 
5 111 DG  n 
5 112 DT  n 
5 113 DT  n 
5 114 DA  n 
5 115 DG  n 
5 116 DG  n 
5 117 DG  n 
5 118 DT  n 
5 119 DT  n 
5 120 DA  n 
5 121 DG  n 
5 122 DG  n 
5 123 DG  n 
5 124 DT  n 
5 125 DT  n 
5 126 DA  n 
5 127 DG  n 
5 128 DG  n 
5 129 DG  n 
5 130 DT  n 
5 131 DT  n 
5 132 DA  n 
5 133 DG  n 
5 134 DG  n 
5 135 DG  n 
5 136 DT  n 
5 137 DT  n 
5 138 DA  n 
5 139 DG  n 
5 140 DG  n 
5 141 DG  n 
5 142 DT  n 
5 143 DG  n 
5 144 DA  n 
5 145 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DC  n 
6 6   DC  n 
6 7   DC  n 
6 8   DT  n 
6 9   DA  n 
6 10  DA  n 
6 11  DC  n 
6 12  DC  n 
6 13  DC  n 
6 14  DT  n 
6 15  DA  n 
6 16  DA  n 
6 17  DC  n 
6 18  DC  n 
6 19  DC  n 
6 20  DT  n 
6 21  DA  n 
6 22  DA  n 
6 23  DC  n 
6 24  DC  n 
6 25  DC  n 
6 26  DT  n 
6 27  DA  n 
6 28  DA  n 
6 29  DC  n 
6 30  DC  n 
6 31  DC  n 
6 32  DT  n 
6 33  DA  n 
6 34  DA  n 
6 35  DC  n 
6 36  DC  n 
6 37  DC  n 
6 38  DT  n 
6 39  DA  n 
6 40  DA  n 
6 41  DC  n 
6 42  DC  n 
6 43  DC  n 
6 44  DT  n 
6 45  DA  n 
6 46  DA  n 
6 47  DC  n 
6 48  DC  n 
6 49  DC  n 
6 50  DT  n 
6 51  DA  n 
6 52  DA  n 
6 53  DC  n 
6 54  DC  n 
6 55  DC  n 
6 56  DT  n 
6 57  DA  n 
6 58  DA  n 
6 59  DC  n 
6 60  DC  n 
6 61  DC  n 
6 62  DT  n 
6 63  DA  n 
6 64  DA  n 
6 65  DC  n 
6 66  DC  n 
6 67  DC  n 
6 68  DT  n 
6 69  DA  n 
6 70  DA  n 
6 71  DC  n 
6 72  DC  n 
6 73  DC  n 
6 74  DT  n 
6 75  DA  n 
6 76  DA  n 
6 77  DC  n 
6 78  DC  n 
6 79  DC  n 
6 80  DT  n 
6 81  DA  n 
6 82  DA  n 
6 83  DC  n 
6 84  DC  n 
6 85  DC  n 
6 86  DT  n 
6 87  DA  n 
6 88  DA  n 
6 89  DC  n 
6 90  DC  n 
6 91  DC  n 
6 92  DT  n 
6 93  DA  n 
6 94  DA  n 
6 95  DC  n 
6 96  DC  n 
6 97  DC  n 
6 98  DT  n 
6 99  DA  n 
6 100 DA  n 
6 101 DC  n 
6 102 DC  n 
6 103 DC  n 
6 104 DT  n 
6 105 DA  n 
6 106 DA  n 
6 107 DC  n 
6 108 DC  n 
6 109 DC  n 
6 110 DT  n 
6 111 DA  n 
6 112 DA  n 
6 113 DC  n 
6 114 DC  n 
6 115 DC  n 
6 116 DT  n 
6 117 DA  n 
6 118 DA  n 
6 119 DC  n 
6 120 DC  n 
6 121 DC  n 
6 122 DT  n 
6 123 DA  n 
6 124 DA  n 
6 125 DC  n 
6 126 DC  n 
6 127 DC  n 
6 128 DT  n 
6 129 DA  n 
6 130 DA  n 
6 131 DC  n 
6 132 DC  n 
6 133 DC  n 
6 134 DT  n 
6 135 DA  n 
6 136 DA  n 
6 137 DC  n 
6 138 DC  n 
6 139 DC  n 
6 140 DT  n 
6 141 DA  n 
6 142 DA  n 
6 143 DG  n 
6 144 DA  n 
6 145 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 96  Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 87  Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 105 Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 95  Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 145 Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 145 Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H31_HUMAN   P68431 ? 1 
;RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
;
41 
2 UNP H4_HUMAN    P62805 ? 2 
;KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR
TLYGFGG
;
17 
3 UNP H2A1B_HUMAN P04908 ? 3 
;AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEEL
NKLLGRVTIAQGGVLPNIQAVLLPK
;
15 
4 UNP H2B1K_HUMAN O60814 ? 4 
;RSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA
VSEGTKAVTKYTSAK
;
32 
5 PDB 6L9H        6L9H   ? 5 ? 1  
6 PDB 6L9H        6L9H   ? 6 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6L9H A 1 ? 96  ? P68431 41  ? 136 ? 40  135 
2  2 6L9H B 1 ? 87  ? P62805 17  ? 103 ? 16  102 
3  3 6L9H C 1 ? 105 ? P04908 15  ? 119 ? 14  118 
4  4 6L9H D 1 ? 95  ? O60814 32  ? 126 ? 28  122 
5  1 6L9H E 1 ? 96  ? P68431 41  ? 136 ? 40  135 
6  2 6L9H F 1 ? 87  ? P62805 17  ? 103 ? 16  102 
7  3 6L9H G 1 ? 105 ? P04908 15  ? 119 ? 14  118 
8  4 6L9H H 1 ? 95  ? O60814 32  ? 126 ? 28  122 
9  5 6L9H I 1 ? 145 ? 6L9H   -72 ? 72  ? -72 72  
10 6 6L9H J 1 ? 145 ? 6L9H   -72 ? 72  ? -72 72  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6L9H 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.90 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.56 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Manganase chloride, potassium chloride, potassium cacodylate, MPD and trehalose' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             100 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 2M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-07-17 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            70.560 
_reflns.entry_id                         6L9H 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.518 
_reflns.d_resolution_low                 92.961 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       33289 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             94.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13 
_reflns.pdbx_Rmerge_I_obs                0.114 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.119 
_reflns.pdbx_Rpim_I_all                  0.033 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.518 
_reflns_shell.d_res_low                   2.899 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1665 
_reflns_shell.percent_possible_all        79.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.506 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             13.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             1.567 
_reflns_shell.pdbx_Rpim_I_all             0.426 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.795 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            1.4979 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            -2.9775 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            1.4796 
_refine.B_iso_max                                200.830 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                3.000 
_refine.correlation_coeff_Fo_to_Fc               0.9040 
_refine.correlation_coeff_Fo_to_Fc_free          0.8780 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6L9H 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.6000 
_refine.ls_d_res_low                             46.0000 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     33177 
_refine.ls_number_reflns_R_free                  1620 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    51.8000 
_refine.ls_percent_reflns_R_free                 4.8800 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2384 
_refine.ls_R_factor_R_free                       0.2779 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2363 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3LZ0 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.5340 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        6L9H 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.520 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.6000 
_refine_hist.d_res_low                        46.0000 
_refine_hist.number_atoms_solvent             6 
_refine_hist.number_atoms_total               11931 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       1043 
_refine_hist.pdbx_B_iso_mean_ligand           131.76 
_refine_hist.pdbx_B_iso_mean_solvent          13.82 
_refine_hist.pdbx_number_atoms_protein        5982 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? ?      ? 3703  ? t_dihedral_angle_d        2.000  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_trig_c_planes           ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 1308  ? t_gen_planes              5.000  HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? 12721 ? t_it                      10.000 HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_nbd                     ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_improper_torsion        ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_pseud_angle             ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 1667  ? t_chiral_improper_torsion 5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_sum_occupancies         ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_utility_distance        ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_utility_angle           ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?     ? t_utility_torsion         ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 6884  ? t_ideal_dist_contact      4.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 0.007  ? 12721 ? t_bond_d                  2.000  HARMONIC     
'X-RAY DIFFRACTION' ? 0.760  ? 18420 ? t_angle_deg               2.000  HARMONIC     
'X-RAY DIFFRACTION' ? 2.600  ? ?     ? t_omega_torsion           ?      ?            
'X-RAY DIFFRACTION' ? 24.620 ? ?     ? t_other_torsion           ?      ?            
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.6000 
_refine_ls_shell.d_res_low                        3.0000 
_refine_ls_shell.number_reflns_all                664 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             26 
_refine_ls_shell.number_reflns_R_work             638 
_refine_ls_shell.percent_reflns_obs               6.5100 
_refine_ls_shell.percent_reflns_R_free            3.9200 
_refine_ls_shell.R_factor_all                     0.2649 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2623 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.2650 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   50 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6L9H 
_struct.title                        'The Human Telomeric Nucleosome Displays Distinct Structural and Dynamic Properties' 
_struct.pdbx_descriptor              'Histone H3.1, Histone H4, Histone H2A type 1-B/E, Histone H2B type 1-K/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6L9H 
_struct_keywords.text            'Telomeric DNA, Nucleosome Core Particle, DNA BINDING PROTEIN, DNA BINDING PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 7 ? 
M N N 7 ? 
N N N 7 ? 
O N N 8 ? 
P N N 8 ? 
Q N N 8 ? 
R N N 8 ? 
S N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 5  ? LYS A 17  ? GLY A 44  LYS A 56  1 ? 13 
HELX_P HELX_P2  AA2 ARG A 24 ? LYS A 40  ? ARG A 63  LYS A 79  1 ? 17 
HELX_P HELX_P3  AA3 GLN A 46 ? ALA A 75  ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  AA4 MET A 81 ? ARG A 92  ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  AA5 ASP B 9  ? ILE B 14  ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P6  AA6 THR B 15 ? GLY B 26  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  AA7 LEU B 34 ? ALA B 61  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  AA8 THR B 67 ? GLY B 79  ? THR B 82  GLY B 94  1 ? 13 
HELX_P HELX_P9  AA9 ARG C 4  ? GLY C 9   ? ARG C 17  GLY C 22  1 ? 6  
HELX_P HELX_P10 AB1 PRO C 13 ? GLY C 24  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 AB2 GLY C 33 ? ASP C 59  ? GLY C 46  ASP C 72  1 ? 27 
HELX_P HELX_P12 AB3 ILE C 66 ? ASP C 77  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 AB4 GLU C 78 ? LEU C 84  ? GLU C 91  LEU C 97  1 ? 7  
HELX_P HELX_P14 AB5 GLN C 99 ? LEU C 103 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 AB6 TYR D 7  ? HIS D 19  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 AB7 SER D 25 ? ASN D 54  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 AB8 THR D 60 ? LEU D 72  ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 AB9 PRO D 73 ? ALA D 94  ? PRO D 100 ALA D 121 1 ? 22 
HELX_P HELX_P19 AC1 THR E 6  ? LYS E 17  ? THR E 45  LYS E 56  1 ? 12 
HELX_P HELX_P20 AC2 ARG E 24 ? LYS E 40  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 AC3 GLN E 46 ? ALA E 75  ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 AC4 MET E 81 ? ARG E 92  ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 AC5 ASN F 10 ? ILE F 14  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P24 AC6 THR F 15 ? GLY F 26  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 AC7 LEU F 34 ? ALA F 61  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 AC8 THR F 67 ? GLN F 78  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 AC9 THR G 3  ? GLY G 9   ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 AD1 PRO G 13 ? LYS G 23  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 AD2 GLY G 33 ? ASN G 60  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P30 AD3 ILE G 66 ? ASP G 77  ? ILE G 79  ASP G 90  1 ? 12 
HELX_P HELX_P31 AD4 GLU G 78 ? LEU G 84  ? GLU G 91  LEU G 97  1 ? 7  
HELX_P HELX_P32 AD5 GLN G 99 ? LEU G 103 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 AD6 TYR H 7  ? HIS H 19  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 AD7 SER H 25 ? ASN H 54  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 AD8 THR H 60 ? LEU H 72  ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 AD9 PRO H 73 ? ALA H 94  ? PRO H 100 ALA H 121 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? I DG 80  N7 ? ? ? 1_555 N MN .   MN ? ? I DG 7   I MN 104 1_555 ? ? ? ? ? ? ?               2.210 ? 
metalc2   metalc ? ? I DG 111 N7 ? ? ? 1_555 K MN .   MN ? ? I DG 38  I MN 101 1_555 ? ? ? ? ? ? ?               2.697 ? 
metalc3   metalc ? ? I DG 123 N7 ? ? ? 1_555 M MN .   MN ? ? I DG 50  I MN 103 1_555 ? ? ? ? ? ? ?               2.526 ? 
hydrog1   hydrog ? ? I DT 2   N3 ? ? ? 1_555 J DA 144 N1 ? ? I DT -71 J DA 71  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog2   hydrog ? ? I DC 3   N4 ? ? ? 1_555 J DG 143 O6 ? ? I DC -70 J DG 70  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog3   hydrog ? ? I DT 4   N3 ? ? ? 1_555 J DA 142 N1 ? ? I DT -69 J DA 69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DT 4   O4 ? ? ? 1_555 J DA 142 N6 ? ? I DT -69 J DA 69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DA 6   N1 ? ? ? 1_555 J DT 140 N3 ? ? I DA -67 J DT 67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? I DA 6   N6 ? ? ? 1_555 J DT 140 O4 ? ? I DA -67 J DT 67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DG 7   N1 ? ? ? 1_555 J DC 139 N3 ? ? I DG -66 J DC 66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DG 7   N2 ? ? ? 1_555 J DC 139 O2 ? ? I DG -66 J DC 66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DG 7   O6 ? ? ? 1_555 J DC 139 N4 ? ? I DG -66 J DC 66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DG 8   O6 ? ? ? 1_555 J DC 137 N4 ? ? I DG -65 J DC 64  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog11  hydrog ? ? I DG 8   N2 ? ? ? 1_555 J DC 138 N3 ? ? I DG -65 J DC 65  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog12  hydrog ? ? I DG 9   N2 ? ? ? 1_555 J DC 137 O2 ? ? I DG -64 J DC 64  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog13  hydrog ? ? I DT 10  N3 ? ? ? 1_555 J DA 136 N1 ? ? I DT -63 J DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DT 10  O4 ? ? ? 1_555 J DA 136 N6 ? ? I DT -63 J DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DT 11  N3 ? ? ? 1_555 J DA 135 N1 ? ? I DT -62 J DA 62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DT 11  O4 ? ? ? 1_555 J DA 135 N6 ? ? I DT -62 J DA 62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I DG 13  O6 ? ? ? 1_555 J DC 132 N4 ? ? I DG -60 J DC 59  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog18  hydrog ? ? I DG 13  N2 ? ? ? 1_555 J DC 133 O2 ? ? I DG -60 J DC 60  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog19  hydrog ? ? I DG 14  N2 ? ? ? 1_555 J DC 132 N3 ? ? I DG -59 J DC 59  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog20  hydrog ? ? I DG 15  N1 ? ? ? 1_555 J DC 131 N3 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DG 15  N2 ? ? ? 1_555 J DC 131 O2 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DG 15  O6 ? ? ? 1_555 J DC 131 N4 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DT 16  N3 ? ? ? 1_555 J DA 130 N1 ? ? I DT -57 J DA 57  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog24  hydrog ? ? I DT 17  N3 ? ? ? 1_555 J DA 129 N1 ? ? I DT -56 J DA 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? I DT 17  O4 ? ? ? 1_555 J DA 129 N6 ? ? I DT -56 J DA 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? I DA 18  N1 ? ? ? 1_555 J DT 128 N3 ? ? I DA -55 J DT 55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? I DA 18  N6 ? ? ? 1_555 J DT 128 O4 ? ? I DA -55 J DT 55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DG 19  N2 ? ? ? 1_555 J DC 127 O2 ? ? I DG -54 J DC 54  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog29  hydrog ? ? I DG 20  N2 ? ? ? 1_555 J DC 126 N3 ? ? I DG -53 J DC 53  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog30  hydrog ? ? I DG 21  N1 ? ? ? 1_555 J DA 124 N1 ? ? I DG -52 J DA 51  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog31  hydrog ? ? I DG 21  O6 ? ? ? 1_555 J DA 124 N6 ? ? I DG -52 J DA 51  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog32  hydrog ? ? I DG 21  N1 ? ? ? 1_555 J DC 125 N3 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I DG 21  N2 ? ? ? 1_555 J DC 125 O2 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DG 21  O6 ? ? ? 1_555 J DC 125 N4 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DT 22  O4 ? ? ? 1_555 J DA 123 N6 ? ? I DT -51 J DA 50  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog36  hydrog ? ? I DT 22  N3 ? ? ? 1_555 J DA 124 N1 ? ? I DT -51 J DA 51  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog37  hydrog ? ? I DT 23  N3 ? ? ? 1_555 J DA 123 N1 ? ? I DT -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I DT 23  O4 ? ? ? 1_555 J DA 123 N6 ? ? I DT -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I DA 24  N1 ? ? ? 1_555 J DT 122 N3 ? ? I DA -49 J DT 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? I DA 24  N6 ? ? ? 1_555 J DT 122 O4 ? ? I DA -49 J DT 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? I DG 25  N2 ? ? ? 1_555 J DC 121 O2 ? ? I DG -48 J DC 48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog42  hydrog ? ? I DG 25  N2 ? ? ? 1_555 J DT 122 O2 ? ? I DG -48 J DT 49  1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog43  hydrog ? ? I DG 26  N1 ? ? ? 1_555 J DC 120 N3 ? ? I DG -47 J DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DG 26  N2 ? ? ? 1_555 J DC 120 O2 ? ? I DG -47 J DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I DG 26  O6 ? ? ? 1_555 J DC 120 N4 ? ? I DG -47 J DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DG 27  N2 ? ? ? 1_555 J DC 119 N3 ? ? I DG -46 J DC 46  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog47  hydrog ? ? I DT 28  N3 ? ? ? 1_555 J DA 118 N1 ? ? I DT -45 J DA 45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? I DT 28  O4 ? ? ? 1_555 J DA 118 N6 ? ? I DT -45 J DA 45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DT 29  N3 ? ? ? 1_555 J DA 117 N1 ? ? I DT -44 J DA 44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DT 29  O4 ? ? ? 1_555 J DA 117 N6 ? ? I DT -44 J DA 44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DA 30  N1 ? ? ? 1_555 J DC 115 N4 ? ? I DA -43 J DC 42  1_555 ? ? ? ? ? ? TYPE_26_PAIR    ?     ? 
hydrog52  hydrog ? ? I DA 30  N6 ? ? ? 1_555 J DC 115 N3 ? ? I DA -43 J DC 42  1_555 ? ? ? ? ? ? TYPE_26_PAIR    ?     ? 
hydrog53  hydrog ? ? I DA 30  N1 ? ? ? 1_555 J DT 116 N3 ? ? I DA -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I DA 30  N6 ? ? ? 1_555 J DT 116 O4 ? ? I DA -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DG 31  N1 ? ? ? 1_555 J DC 115 N3 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I DG 31  N2 ? ? ? 1_555 J DC 115 O2 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? I DG 31  O6 ? ? ? 1_555 J DC 115 N4 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DG 32  N1 ? ? ? 1_555 J DC 114 N3 ? ? I DG -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I DG 32  N2 ? ? ? 1_555 J DC 114 O2 ? ? I DG -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DG 32  O6 ? ? ? 1_555 J DC 114 N4 ? ? I DG -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DG 33  N1 ? ? ? 1_555 J DA 112 N1 ? ? I DG -40 J DA 39  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog62  hydrog ? ? I DG 33  O6 ? ? ? 1_555 J DA 112 N6 ? ? I DG -40 J DA 39  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog63  hydrog ? ? I DT 34  N3 ? ? ? 1_555 J DA 112 N1 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I DT 34  O4 ? ? ? 1_555 J DA 112 N6 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DA 36  N1 ? ? ? 1_555 J DT 110 N3 ? ? I DA -37 J DT 37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DA 36  N6 ? ? ? 1_555 J DT 110 O4 ? ? I DA -37 J DT 37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DG 37  N1 ? ? ? 1_555 J DC 109 N3 ? ? I DG -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DG 37  N2 ? ? ? 1_555 J DC 109 O2 ? ? I DG -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? I DG 37  O6 ? ? ? 1_555 J DC 109 N4 ? ? I DG -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I DG 38  N1 ? ? ? 1_555 J DC 108 N3 ? ? I DG -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DG 38  N2 ? ? ? 1_555 J DC 108 O2 ? ? I DG -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DG 38  O6 ? ? ? 1_555 J DC 108 N4 ? ? I DG -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DG 39  N1 ? ? ? 1_555 J DA 106 N1 ? ? I DG -34 J DA 33  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog74  hydrog ? ? I DG 39  O6 ? ? ? 1_555 J DA 106 N6 ? ? I DG -34 J DA 33  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog75  hydrog ? ? I DT 40  N3 ? ? ? 1_555 J DA 106 N1 ? ? I DT -33 J DA 33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DT 40  O4 ? ? ? 1_555 J DA 106 N6 ? ? I DT -33 J DA 33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DT 41  N3 ? ? ? 1_555 J DA 105 N1 ? ? I DT -32 J DA 32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? I DT 41  O4 ? ? ? 1_555 J DA 105 N6 ? ? I DT -32 J DA 32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DA 42  N1 ? ? ? 1_555 J DC 103 N4 ? ? I DA -31 J DC 30  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog80  hydrog ? ? I DG 43  N1 ? ? ? 1_555 J DC 102 N3 ? ? I DG -30 J DC 29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DG 43  N2 ? ? ? 1_555 J DC 102 O2 ? ? I DG -30 J DC 29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DG 43  O6 ? ? ? 1_555 J DC 102 N4 ? ? I DG -30 J DC 29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DG 44  N2 ? ? ? 1_555 J DC 102 O2 ? ? I DG -29 J DC 29  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog84  hydrog ? ? I DG 45  N1 ? ? ? 1_555 J DC 101 N3 ? ? I DG -28 J DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DG 45  N2 ? ? ? 1_555 J DC 101 O2 ? ? I DG -28 J DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DG 45  O6 ? ? ? 1_555 J DC 101 N4 ? ? I DG -28 J DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DT 46  N3 ? ? ? 1_555 J DA 100 N1 ? ? I DT -27 J DA 27  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog88  hydrog ? ? I DT 47  N3 ? ? ? 1_555 J DA 99  N1 ? ? I DT -26 J DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DT 47  O4 ? ? ? 1_555 J DA 99  N6 ? ? I DT -26 J DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DA 48  N1 ? ? ? 1_555 J DT 98  N3 ? ? I DA -25 J DT 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DA 48  N6 ? ? ? 1_555 J DT 98  O4 ? ? I DA -25 J DT 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DG 49  N1 ? ? ? 1_555 J DC 97  N3 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DG 49  N2 ? ? ? 1_555 J DC 97  O2 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DG 49  O6 ? ? ? 1_555 J DC 97  N4 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DG 50  N1 ? ? ? 1_555 J DC 96  N3 ? ? I DG -23 J DC 23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DG 50  N2 ? ? ? 1_555 J DC 96  O2 ? ? I DG -23 J DC 23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DG 50  O6 ? ? ? 1_555 J DC 96  N4 ? ? I DG -23 J DC 23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DG 51  N1 ? ? ? 1_555 J DC 95  N3 ? ? I DG -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DG 51  N2 ? ? ? 1_555 J DC 95  O2 ? ? I DG -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DG 51  O6 ? ? ? 1_555 J DC 95  N4 ? ? I DG -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DT 52  N3 ? ? ? 1_555 J DA 94  N1 ? ? I DT -21 J DA 21  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog102 hydrog ? ? I DT 53  O4 ? ? ? 1_555 J DA 93  N6 ? ? I DT -20 J DA 20  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog103 hydrog ? ? I DT 53  N3 ? ? ? 1_555 J DA 94  N3 ? ? I DT -20 J DA 21  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog104 hydrog ? ? I DA 54  N1 ? ? ? 1_555 J DT 92  N3 ? ? I DA -19 J DT 19  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog105 hydrog ? ? I DG 55  N2 ? ? ? 1_555 J DC 91  O2 ? ? I DG -18 J DC 18  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog106 hydrog ? ? I DG 56  N1 ? ? ? 1_555 J DC 90  N3 ? ? I DG -17 J DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DG 56  N2 ? ? ? 1_555 J DC 90  O2 ? ? I DG -17 J DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DG 56  O6 ? ? ? 1_555 J DC 90  N4 ? ? I DG -17 J DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DG 57  N1 ? ? ? 1_555 J DC 89  N3 ? ? I DG -16 J DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DG 57  N2 ? ? ? 1_555 J DC 89  O2 ? ? I DG -16 J DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DG 57  O6 ? ? ? 1_555 J DC 89  N4 ? ? I DG -16 J DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DT 58  N3 ? ? ? 1_555 J DA 88  N1 ? ? I DT -15 J DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DT 58  O4 ? ? ? 1_555 J DA 88  N6 ? ? I DT -15 J DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DA 60  N1 ? ? ? 1_555 J DT 86  N3 ? ? I DA -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DA 60  N6 ? ? ? 1_555 J DT 86  O4 ? ? I DA -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DG 61  N2 ? ? ? 1_555 J DC 85  N3 ? ? I DG -12 J DC 12  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog117 hydrog ? ? I DG 62  N1 ? ? ? 1_555 J DC 84  N3 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DG 62  N2 ? ? ? 1_555 J DC 84  O2 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DG 62  O6 ? ? ? 1_555 J DC 84  N4 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DG 63  N1 ? ? ? 1_555 J DC 83  N3 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DG 63  N2 ? ? ? 1_555 J DC 83  O2 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DG 63  O6 ? ? ? 1_555 J DC 83  N4 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DT 64  N3 ? ? ? 1_555 J DA 82  N1 ? ? I DT -9  J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DT 64  O4 ? ? ? 1_555 J DA 82  N6 ? ? I DT -9  J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DT 65  N3 ? ? ? 1_555 J DA 81  N1 ? ? I DT -8  J DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I DT 65  O4 ? ? ? 1_555 J DA 81  N6 ? ? I DT -8  J DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I DA 66  N1 ? ? ? 1_555 J DT 80  N3 ? ? I DA -7  J DT 7   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog128 hydrog ? ? I DG 67  N2 ? ? ? 1_555 J DC 79  N3 ? ? I DG -6  J DC 6   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog129 hydrog ? ? I DG 68  N1 ? ? ? 1_555 J DC 78  N3 ? ? I DG -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DG 68  N2 ? ? ? 1_555 J DC 78  O2 ? ? I DG -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DG 68  O6 ? ? ? 1_555 J DC 78  N4 ? ? I DG -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DG 69  N1 ? ? ? 1_555 J DC 77  N3 ? ? I DG -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DG 69  N2 ? ? ? 1_555 J DC 77  O2 ? ? I DG -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DG 69  O6 ? ? ? 1_555 J DC 77  N4 ? ? I DG -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DT 70  N3 ? ? ? 1_555 J DA 76  N1 ? ? I DT -3  J DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DT 70  O4 ? ? ? 1_555 J DA 76  N6 ? ? I DT -3  J DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DA 72  N1 ? ? ? 1_555 J DT 74  N3 ? ? I DA -1  J DT 1   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog138 hydrog ? ? I DG 73  N2 ? ? ? 1_555 J DC 73  O2 ? ? I DG 0   J DC 0   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog139 hydrog ? ? I DG 74  N2 ? ? ? 1_555 J DC 72  N3 ? ? I DG 1   J DC -1  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog140 hydrog ? ? I DG 75  N2 ? ? ? 1_555 J DC 71  N3 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog141 hydrog ? ? I DT 76  N3 ? ? ? 1_555 J DA 70  N1 ? ? I DT 3   J DA -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DT 76  O4 ? ? ? 1_555 J DA 70  N6 ? ? I DT 3   J DA -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DT 77  N3 ? ? ? 1_555 J DA 69  N1 ? ? I DT 4   J DA -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DT 77  O4 ? ? ? 1_555 J DA 69  N6 ? ? I DT 4   J DA -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DA 78  N1 ? ? ? 1_555 J DT 68  N3 ? ? I DA 5   J DT -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DA 78  N6 ? ? ? 1_555 J DT 68  O4 ? ? I DA 5   J DT -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DG 79  N1 ? ? ? 1_555 J DC 67  N3 ? ? I DG 6   J DC -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DG 79  N2 ? ? ? 1_555 J DC 67  O2 ? ? I DG 6   J DC -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DG 79  O6 ? ? ? 1_555 J DC 67  N4 ? ? I DG 6   J DC -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DG 80  O6 ? ? ? 1_555 J DC 65  N4 ? ? I DG 7   J DC -8  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog151 hydrog ? ? I DG 80  N2 ? ? ? 1_555 J DC 66  O2 ? ? I DG 7   J DC -7  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog152 hydrog ? ? I DG 81  N1 ? ? ? 1_555 J DA 64  N1 ? ? I DG 8   J DA -9  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog153 hydrog ? ? I DG 81  O6 ? ? ? 1_555 J DA 64  N6 ? ? I DG 8   J DA -9  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog154 hydrog ? ? I DT 82  N3 ? ? ? 1_555 J DA 64  N1 ? ? I DT 9   J DA -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DT 82  O4 ? ? ? 1_555 J DA 64  N6 ? ? I DT 9   J DA -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DT 83  N3 ? ? ? 1_555 J DA 63  N1 ? ? I DT 10  J DA -10 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog157 hydrog ? ? I DA 84  N1 ? ? ? 1_555 J DT 62  N3 ? ? I DA 11  J DT -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DA 84  N6 ? ? ? 1_555 J DT 62  O4 ? ? I DA 11  J DT -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DG 85  N2 ? ? ? 1_555 J DC 61  N3 ? ? I DG 12  J DC -12 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog160 hydrog ? ? I DG 86  N1 ? ? ? 1_555 J DC 60  N3 ? ? I DG 13  J DC -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DG 86  N2 ? ? ? 1_555 J DC 60  O2 ? ? I DG 13  J DC -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DG 86  O6 ? ? ? 1_555 J DC 60  N4 ? ? I DG 13  J DC -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DG 87  N2 ? ? ? 1_555 J DA 58  N1 ? ? I DG 14  J DA -15 1_555 ? ? ? ? ? ? TYPE_10_PAIR    ?     ? 
hydrog164 hydrog ? ? I DG 87  N3 ? ? ? 1_555 J DA 58  N6 ? ? I DG 14  J DA -15 1_555 ? ? ? ? ? ? TYPE_10_PAIR    ?     ? 
hydrog165 hydrog ? ? I DT 88  O4 ? ? ? 1_555 J DA 58  N6 ? ? I DT 15  J DA -15 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog166 hydrog ? ? I DT 89  N3 ? ? ? 1_555 J DA 57  N1 ? ? I DT 16  J DA -16 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog167 hydrog ? ? I DA 90  N1 ? ? ? 1_555 J DT 56  N3 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DA 90  N6 ? ? ? 1_555 J DT 56  O4 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DG 91  N1 ? ? ? 1_555 J DC 55  N3 ? ? I DG 18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DG 91  N2 ? ? ? 1_555 J DC 55  O2 ? ? I DG 18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DG 91  O6 ? ? ? 1_555 J DC 55  N4 ? ? I DG 18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DG 92  N1 ? ? ? 1_555 J DC 54  N3 ? ? I DG 19  J DC -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DG 92  N2 ? ? ? 1_555 J DC 54  O2 ? ? I DG 19  J DC -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DG 92  O6 ? ? ? 1_555 J DC 54  N4 ? ? I DG 19  J DC -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DG 93  N1 ? ? ? 1_555 J DC 53  N3 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DG 93  N2 ? ? ? 1_555 J DC 53  O2 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DG 93  O6 ? ? ? 1_555 J DC 53  N4 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DT 94  N3 ? ? ? 1_555 J DA 52  N1 ? ? I DT 21  J DA -21 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog179 hydrog ? ? I DT 95  N3 ? ? ? 1_555 J DA 51  N1 ? ? I DT 22  J DA -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DT 95  O4 ? ? ? 1_555 J DA 51  N6 ? ? I DT 22  J DA -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DA 96  N1 ? ? ? 1_555 J DT 50  N3 ? ? I DA 23  J DT -23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DA 96  N6 ? ? ? 1_555 J DT 50  O4 ? ? I DA 23  J DT -23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DG 97  O6 ? ? ? 1_555 J DC 48  N4 ? ? I DG 24  J DC -25 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog184 hydrog ? ? I DG 98  O6 ? ? ? 1_555 J DC 47  N4 ? ? I DG 25  J DC -26 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog185 hydrog ? ? I DG 98  N2 ? ? ? 1_555 J DC 48  N3 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog186 hydrog ? ? I DG 99  N1 ? ? ? 1_555 J DC 47  N3 ? ? I DG 26  J DC -26 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog187 hydrog ? ? I DT 100 N3 ? ? ? 1_555 J DA 46  N1 ? ? I DT 27  J DA -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I DT 100 O4 ? ? ? 1_555 J DA 46  N6 ? ? I DT 27  J DA -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DT 101 N3 ? ? ? 1_555 J DA 45  N1 ? ? I DT 28  J DA -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DT 101 O4 ? ? ? 1_555 J DA 45  N6 ? ? I DT 28  J DA -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DA 102 N1 ? ? ? 1_555 J DT 44  N3 ? ? I DA 29  J DT -29 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog192 hydrog ? ? I DG 103 N1 ? ? ? 1_555 J DC 43  O2 ? ? I DG 30  J DC -30 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog193 hydrog ? ? I DG 104 N2 ? ? ? 1_555 J DC 42  N3 ? ? I DG 31  J DC -31 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog194 hydrog ? ? I DG 105 N1 ? ? ? 1_555 J DA 40  N1 ? ? I DG 32  J DA -33 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog195 hydrog ? ? I DG 105 O6 ? ? ? 1_555 J DA 40  N6 ? ? I DG 32  J DA -33 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog196 hydrog ? ? I DG 105 N1 ? ? ? 1_555 J DC 41  N3 ? ? I DG 32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? I DG 105 N2 ? ? ? 1_555 J DC 41  O2 ? ? I DG 32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DG 105 O6 ? ? ? 1_555 J DC 41  N4 ? ? I DG 32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DT 106 N3 ? ? ? 1_555 J DA 40  N1 ? ? I DT 33  J DA -33 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog200 hydrog ? ? I DT 107 N3 ? ? ? 1_555 J DA 39  N1 ? ? I DT 34  J DA -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I DT 107 O4 ? ? ? 1_555 J DA 39  N6 ? ? I DT 34  J DA -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? I DA 108 N1 ? ? ? 1_555 J DT 38  N3 ? ? I DA 35  J DT -35 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog203 hydrog ? ? I DG 109 N1 ? ? ? 1_555 J DC 37  N3 ? ? I DG 36  J DC -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DG 109 N2 ? ? ? 1_555 J DC 37  O2 ? ? I DG 36  J DC -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I DG 109 O6 ? ? ? 1_555 J DC 37  N4 ? ? I DG 36  J DC -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? I DG 110 N1 ? ? ? 1_555 J DC 36  N3 ? ? I DG 37  J DC -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DG 110 N2 ? ? ? 1_555 J DC 36  O2 ? ? I DG 37  J DC -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I DG 110 O6 ? ? ? 1_555 J DC 36  N4 ? ? I DG 37  J DC -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DG 111 N2 ? ? ? 1_555 J DC 35  O2 ? ? I DG 38  J DC -38 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog210 hydrog ? ? I DT 112 N3 ? ? ? 1_555 J DA 34  N1 ? ? I DT 39  J DA -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? I DT 112 O4 ? ? ? 1_555 J DA 34  N6 ? ? I DT 39  J DA -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DT 113 N3 ? ? ? 1_555 J DA 33  N1 ? ? I DT 40  J DA -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DT 113 O4 ? ? ? 1_555 J DA 33  N6 ? ? I DT 40  J DA -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DA 114 N1 ? ? ? 1_555 J DC 31  N4 ? ? I DA 41  J DC -42 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog215 hydrog ? ? I DA 114 N1 ? ? ? 1_555 J DT 32  N3 ? ? I DA 41  J DT -41 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog216 hydrog ? ? I DG 115 N1 ? ? ? 1_555 J DC 31  N3 ? ? I DG 42  J DC -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DG 115 N2 ? ? ? 1_555 J DC 31  O2 ? ? I DG 42  J DC -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DG 115 O6 ? ? ? 1_555 J DC 31  N4 ? ? I DG 42  J DC -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DG 116 N2 ? ? ? 1_555 J DC 30  O2 ? ? I DG 43  J DC -43 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog220 hydrog ? ? I DG 117 N2 ? ? ? 1_555 J DC 29  N3 ? ? I DG 44  J DC -44 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog221 hydrog ? ? I DT 118 N3 ? ? ? 1_555 J DA 28  N1 ? ? I DT 45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DT 118 O4 ? ? ? 1_555 J DA 28  N6 ? ? I DT 45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I DT 119 N3 ? ? ? 1_555 J DA 27  N1 ? ? I DT 46  J DA -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DT 119 O4 ? ? ? 1_555 J DA 27  N6 ? ? I DT 46  J DA -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DA 120 N1 ? ? ? 1_555 J DT 26  N3 ? ? I DA 47  J DT -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DA 120 N6 ? ? ? 1_555 J DT 26  O4 ? ? I DA 47  J DT -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DG 121 N1 ? ? ? 1_555 J DC 25  N3 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? I DG 121 N2 ? ? ? 1_555 J DC 25  O2 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DG 121 O6 ? ? ? 1_555 J DC 25  N4 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DG 122 N1 ? ? ? 1_555 J DC 24  N3 ? ? I DG 49  J DC -49 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DG 122 N2 ? ? ? 1_555 J DC 24  O2 ? ? I DG 49  J DC -49 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DG 122 O6 ? ? ? 1_555 J DC 24  N4 ? ? I DG 49  J DC -49 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DG 123 N1 ? ? ? 1_555 J DC 23  N3 ? ? I DG 50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DG 123 N2 ? ? ? 1_555 J DC 23  O2 ? ? I DG 50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I DG 123 O6 ? ? ? 1_555 J DC 23  N4 ? ? I DG 50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I DT 124 O4 ? ? ? 1_555 J DA 21  N6 ? ? I DT 51  J DA -52 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog237 hydrog ? ? I DT 124 N3 ? ? ? 1_555 J DA 22  N1 ? ? I DT 51  J DA -51 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog238 hydrog ? ? I DT 125 N3 ? ? ? 1_555 J DA 21  N1 ? ? I DT 52  J DA -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DT 125 O4 ? ? ? 1_555 J DA 21  N6 ? ? I DT 52  J DA -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? I DA 126 N1 ? ? ? 1_555 J DT 20  N3 ? ? I DA 53  J DT -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I DA 126 N6 ? ? ? 1_555 J DT 20  O4 ? ? I DA 53  J DT -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? I DG 127 N1 ? ? ? 1_555 J DC 19  N3 ? ? I DG 54  J DC -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DG 127 N2 ? ? ? 1_555 J DC 19  O2 ? ? I DG 54  J DC -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DG 127 O6 ? ? ? 1_555 J DC 19  N4 ? ? I DG 54  J DC -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DG 128 N2 ? ? ? 1_555 J DC 18  N3 ? ? I DG 55  J DC -55 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog246 hydrog ? ? I DG 129 N1 ? ? ? 1_555 J DC 17  N3 ? ? I DG 56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DG 129 N2 ? ? ? 1_555 J DC 17  O2 ? ? I DG 56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DG 129 O6 ? ? ? 1_555 J DC 17  N4 ? ? I DG 56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DT 130 N3 ? ? ? 1_555 J DA 16  N1 ? ? I DT 57  J DA -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DT 130 O4 ? ? ? 1_555 J DA 16  N6 ? ? I DT 57  J DA -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? I DT 131 N3 ? ? ? 1_555 J DA 15  N1 ? ? I DT 58  J DA -58 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog252 hydrog ? ? I DA 132 N6 ? ? ? 1_555 J DT 14  O2 ? ? I DA 59  J DT -59 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog253 hydrog ? ? I DG 133 O6 ? ? ? 1_555 J DC 12  N4 ? ? I DG 60  J DC -61 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog254 hydrog ? ? I DG 133 N2 ? ? ? 1_555 J DC 13  O2 ? ? I DG 60  J DC -60 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog255 hydrog ? ? I DG 133 N2 ? ? ? 1_555 J DT 14  O2 ? ? I DG 60  J DT -59 1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog256 hydrog ? ? I DG 134 N1 ? ? ? 1_555 J DC 12  N3 ? ? I DG 61  J DC -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? I DG 134 N2 ? ? ? 1_555 J DC 12  O2 ? ? I DG 61  J DC -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? I DG 134 O6 ? ? ? 1_555 J DC 12  N4 ? ? I DG 61  J DC -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? I DG 135 N1 ? ? ? 1_555 J DA 10  N1 ? ? I DG 62  J DA -63 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog260 hydrog ? ? I DG 135 O6 ? ? ? 1_555 J DA 10  N6 ? ? I DG 62  J DA -63 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog261 hydrog ? ? I DT 136 N3 ? ? ? 1_555 J DA 10  N1 ? ? I DT 63  J DA -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? I DT 136 O4 ? ? ? 1_555 J DA 10  N6 ? ? I DT 63  J DA -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? I DT 137 N3 ? ? ? 1_555 J DA 9   N1 ? ? I DT 64  J DA -64 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog264 hydrog ? ? I DA 138 N6 ? ? ? 1_555 J DT 8   O4 ? ? I DA 65  J DT -65 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog265 hydrog ? ? I DG 139 N1 ? ? ? 1_555 J DC 7   N3 ? ? I DG 66  J DC -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? I DG 139 N2 ? ? ? 1_555 J DC 7   O2 ? ? I DG 66  J DC -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I DG 139 O6 ? ? ? 1_555 J DC 7   N4 ? ? I DG 66  J DC -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I DG 141 N1 ? ? ? 1_555 J DC 5   N3 ? ? I DG 68  J DC -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DG 141 N2 ? ? ? 1_555 J DC 5   O2 ? ? I DG 68  J DC -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DG 141 O6 ? ? ? 1_555 J DC 5   N4 ? ? I DG 68  J DC -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DT 142 N3 ? ? ? 1_555 J DA 4   N1 ? ? I DT 69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DT 142 O4 ? ? ? 1_555 J DA 4   N6 ? ? I DT 69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DG 143 N1 ? ? ? 1_555 J DC 3   N3 ? ? I DG 70  J DC -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DG 143 N2 ? ? ? 1_555 J DC 3   O2 ? ? I DG 70  J DC -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DG 143 O6 ? ? ? 1_555 J DC 3   N4 ? ? I DG 70  J DC -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I DA 144 N1 ? ? ? 1_555 J DT 2   N3 ? ? I DA 71  J DT -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DA 144 N6 ? ? ? 1_555 J DT 2   O4 ? ? I DA 71  J DT -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DT 145 N3 ? ? ? 1_555 J DA 1   N1 ? ? I DT 72  J DA -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DT 145 O4 ? ? ? 1_555 J DA 1   N6 ? ? I DT 72  J DA -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 44 ? PHE A 45 ? ARG A 83  PHE A 84  
AA1 2 THR B 65 ? VAL B 66 ? THR B 80  VAL B 81  
AA2 1 THR A 79 ? ILE A 80 ? THR A 118 ILE A 119 
AA2 2 ARG B 30 ? ILE B 31 ? ARG B 45  ILE B 46  
AA3 1 THR B 81 ? TYR B 83 ? THR B 96  TYR B 98  
AA3 2 VAL G 87 ? ILE G 89 ? VAL G 100 ILE G 102 
AA4 1 ARG C 29 ? VAL C 30 ? ARG C 42  VAL C 43  
AA4 2 THR D 58 ? ILE D 59 ? THR D 85  ILE D 86  
AA5 1 ARG C 64 ? ILE C 65 ? ARG C 77  ILE C 78  
AA5 2 GLY D 23 ? ILE D 24 ? GLY D 50  ILE D 51  
AA6 1 VAL C 87 ? ILE C 89 ? VAL C 100 ILE C 102 
AA6 2 THR F 81 ? TYR F 83 ? THR F 96  TYR F 98  
AA7 1 ARG E 44 ? PHE E 45 ? ARG E 83  PHE E 84  
AA7 2 THR F 65 ? VAL F 66 ? THR F 80  VAL F 81  
AA8 1 THR E 79 ? ILE E 80 ? THR E 118 ILE E 119 
AA8 2 ARG F 30 ? ILE F 31 ? ARG F 45  ILE F 46  
AA9 1 ARG G 29 ? VAL G 30 ? ARG G 42  VAL G 43  
AA9 2 THR H 58 ? ILE H 59 ? THR H 85  ILE H 86  
AB1 1 ARG G 64 ? ILE G 65 ? ARG G 77  ILE G 78  
AB1 2 GLY H 23 ? ILE H 24 ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 44 ? N ARG A 83  O VAL B 66 ? O VAL B 81  
AA2 1 2 N ILE A 80 ? N ILE A 119 O ARG B 30 ? O ARG B 45  
AA3 1 2 N TYR B 83 ? N TYR B 98  O THR G 88 ? O THR G 101 
AA4 1 2 N ARG C 29 ? N ARG C 42  O ILE D 59 ? O ILE D 86  
AA5 1 2 N ILE C 65 ? N ILE C 78  O GLY D 23 ? O GLY D 50  
AA6 1 2 N THR C 88 ? N THR C 101 O TYR F 83 ? O TYR F 98  
AA7 1 2 N ARG E 44 ? N ARG E 83  O VAL F 66 ? O VAL F 81  
AA8 1 2 N ILE E 80 ? N ILE E 119 O ARG F 30 ? O ARG F 45  
AA9 1 2 N ARG G 29 ? N ARG G 42  O ILE H 59 ? O ILE H 86  
AB1 1 2 N ILE G 65 ? N ILE G 78  O GLY H 23 ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software I MN 101 ? 1 'binding site for residue MN I 101' 
AC2 Software I MN 102 ? 1 'binding site for residue MN I 102' 
AC3 Software I MN 103 ? 1 'binding site for residue MN I 103' 
AC4 Software I MN 104 ? 2 'binding site for residue MN I 104' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 1 DG I 111 ? DG I 38 . ? 1_555 ? 
2 AC2 1 DG I 69  ? DG I -4 . ? 1_555 ? 
3 AC3 1 DG I 123 ? DG I 50 . ? 1_555 ? 
4 AC4 2 DG I 79  ? DG I 6  . ? 1_555 ? 
5 AC4 2 DG I 80  ? DG I 7  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6L9H 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.009394 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009142 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005670 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ARG A 1 1   ? -5.834  33.924 -82.928 1.00 87.49  ? 40  ARG A N     1 
ATOM   2     C  CA    . ARG A 1 1   ? -4.826  33.126 -82.239 1.00 87.97  ? 40  ARG A CA    1 
ATOM   3     C  C     . ARG A 1 1   ? -3.588  33.938 -81.846 1.00 88.07  ? 40  ARG A C     1 
ATOM   4     O  O     . ARG A 1 1   ? -2.889  34.454 -82.721 1.00 88.29  ? 40  ARG A O     1 
ATOM   5     C  CB    . ARG A 1 1   ? -4.421  31.907 -83.086 1.00 89.54  ? 40  ARG A CB    1 
ATOM   6     C  CG    . ARG A 1 1   ? -3.453  30.990 -82.355 1.00 92.74  ? 40  ARG A CG    1 
ATOM   7     C  CD    . ARG A 1 1   ? -3.444  29.573 -82.885 1.00 96.01  ? 40  ARG A CD    1 
ATOM   8     N  NE    . ARG A 1 1   ? -3.650  28.582 -81.819 1.00 98.99  ? 40  ARG A NE    1 
ATOM   9     C  CZ    . ARG A 1 1   ? -3.109  27.369 -81.807 1.00 101.69 ? 40  ARG A CZ    1 
ATOM   10    N  NH1   . ARG A 1 1   ? -2.308  26.981 -82.793 1.00 101.81 ? 40  ARG A NH1   1 
ATOM   11    N  NH2   . ARG A 1 1   ? -3.368  26.531 -80.810 1.00 101.65 ? 40  ARG A NH2   1 
ATOM   12    N  N     . TYR A 1 2   ? -3.298  34.011 -80.529 1.00 87.59  ? 41  TYR A N     1 
ATOM   13    C  CA    . TYR A 1 2   ? -2.155  34.751 -79.982 1.00 87.52  ? 41  TYR A CA    1 
ATOM   14    C  C     . TYR A 1 2   ? -0.809  34.057 -80.229 1.00 87.59  ? 41  TYR A C     1 
ATOM   15    O  O     . TYR A 1 2   ? -0.723  32.827 -80.177 1.00 87.88  ? 41  TYR A O     1 
ATOM   16    C  CB    . TYR A 1 2   ? -2.329  34.964 -78.472 1.00 87.24  ? 41  TYR A CB    1 
ATOM   17    C  CG    . TYR A 1 2   ? -3.464  35.884 -78.086 1.00 87.52  ? 41  TYR A CG    1 
ATOM   18    C  CD1   . TYR A 1 2   ? -3.340  37.261 -78.205 1.00 88.29  ? 41  TYR A CD1   1 
ATOM   19    C  CD2   . TYR A 1 2   ? -4.633  35.384 -77.532 1.00 88.13  ? 41  TYR A CD2   1 
ATOM   20    C  CE1   . TYR A 1 2   ? -4.374  38.115 -77.830 1.00 89.02  ? 41  TYR A CE1   1 
ATOM   21    C  CE2   . TYR A 1 2   ? -5.669  36.226 -77.143 1.00 88.89  ? 41  TYR A CE2   1 
ATOM   22    C  CZ    . TYR A 1 2   ? -5.542  37.592 -77.302 1.00 89.59  ? 41  TYR A CZ    1 
ATOM   23    O  OH    . TYR A 1 2   ? -6.585  38.411 -76.933 1.00 90.41  ? 41  TYR A OH    1 
ATOM   24    N  N     . ARG A 1 3   ? 0.248   34.855 -80.439 1.00 87.13  ? 42  ARG A N     1 
ATOM   25    C  CA    . ARG A 1 3   ? 1.611   34.359 -80.659 1.00 87.34  ? 42  ARG A CA    1 
ATOM   26    C  C     . ARG A 1 3   ? 2.199   33.712 -79.386 1.00 86.59  ? 42  ARG A C     1 
ATOM   27    O  O     . ARG A 1 3   ? 1.753   34.014 -78.282 1.00 86.72  ? 42  ARG A O     1 
ATOM   28    C  CB    . ARG A 1 3   ? 2.515   35.521 -81.107 1.00 89.53  ? 42  ARG A CB    1 
ATOM   29    C  CG    . ARG A 1 3   ? 2.022   36.262 -82.340 1.00 94.12  ? 42  ARG A CG    1 
ATOM   30    C  CD    . ARG A 1 3   ? 2.992   37.363 -82.746 1.00 98.61  ? 42  ARG A CD    1 
ATOM   31    N  NE    . ARG A 1 3   ? 4.281   36.817 -83.177 1.00 102.96 ? 42  ARG A NE    1 
ATOM   32    C  CZ    . ARG A 1 3   ? 5.384   37.540 -83.361 1.00 106.37 ? 42  ARG A CZ    1 
ATOM   33    N  NH1   . ARG A 1 3   ? 5.371   38.851 -83.144 1.00 106.50 ? 42  ARG A NH1   1 
ATOM   34    N  NH2   . ARG A 1 3   ? 6.509   36.957 -83.757 1.00 106.59 ? 42  ARG A NH2   1 
ATOM   35    N  N     . PRO A 1 4   ? 3.220   32.841 -79.508 1.00 85.54  ? 43  PRO A N     1 
ATOM   36    C  CA    . PRO A 1 4   ? 3.801   32.219 -78.305 1.00 84.49  ? 43  PRO A CA    1 
ATOM   37    C  C     . PRO A 1 4   ? 4.551   33.204 -77.410 1.00 82.68  ? 43  PRO A C     1 
ATOM   38    O  O     . PRO A 1 4   ? 5.608   33.737 -77.771 1.00 82.55  ? 43  PRO A O     1 
ATOM   39    C  CB    . PRO A 1 4   ? 4.735   31.137 -78.865 1.00 85.64  ? 43  PRO A CB    1 
ATOM   40    C  CG    . PRO A 1 4   ? 4.343   30.981 -80.304 1.00 86.54  ? 43  PRO A CG    1 
ATOM   41    C  CD    . PRO A 1 4   ? 3.861   32.336 -80.732 1.00 85.12  ? 43  PRO A CD    1 
ATOM   42    N  N     . GLY A 1 5   ? 3.982   33.414 -76.231 1.00 81.05  ? 44  GLY A N     1 
ATOM   43    C  CA    . GLY A 1 5   ? 4.528   34.306 -75.216 1.00 79.70  ? 44  GLY A CA    1 
ATOM   44    C  C     . GLY A 1 5   ? 3.713   35.561 -74.987 1.00 77.72  ? 44  GLY A C     1 
ATOM   45    O  O     . GLY A 1 5   ? 4.203   36.482 -74.347 1.00 77.79  ? 44  GLY A O     1 
ATOM   46    N  N     . THR A 1 6   ? 2.468   35.611 -75.508 1.00 75.87  ? 45  THR A N     1 
ATOM   47    C  CA    . THR A 1 6   ? 1.557   36.763 -75.427 1.00 74.45  ? 45  THR A CA    1 
ATOM   48    C  C     . THR A 1 6   ? 0.488   36.555 -74.366 1.00 72.13  ? 45  THR A C     1 
ATOM   49    O  O     . THR A 1 6   ? 0.106   37.494 -73.668 1.00 72.03  ? 45  THR A O     1 
ATOM   50    C  CB    . THR A 1 6   ? 0.986   37.054 -76.810 1.00 76.25  ? 45  THR A CB    1 
ATOM   51    O  OG1   . THR A 1 6   ? 2.083   37.381 -77.671 1.00 77.54  ? 45  THR A OG1   1 
ATOM   52    C  CG2   . THR A 1 6   ? -0.058  38.168 -76.796 1.00 76.70  ? 45  THR A CG2   1 
ATOM   53    N  N     . VAL A 1 7   ? 0.008   35.321 -74.245 1.00 70.05  ? 46  VAL A N     1 
ATOM   54    C  CA    . VAL A 1 7   ? -0.889  34.942 -73.163 1.00 68.58  ? 46  VAL A CA    1 
ATOM   55    C  C     . VAL A 1 7   ? -0.002  34.713 -71.899 1.00 66.24  ? 46  VAL A C     1 
ATOM   56    O  O     . VAL A 1 7   ? -0.443  35.017 -70.793 1.00 66.08  ? 46  VAL A O     1 
ATOM   57    C  CB    . VAL A 1 7   ? -1.748  33.698 -73.514 1.00 69.40  ? 46  VAL A CB    1 
ATOM   58    C  CG1   . VAL A 1 7   ? -2.824  33.457 -72.462 1.00 69.96  ? 46  VAL A CG1   1 
ATOM   59    C  CG2   . VAL A 1 7   ? -2.389  33.851 -74.881 1.00 70.04  ? 46  VAL A CG2   1 
ATOM   60    N  N     . ALA A 1 8   ? 1.264   34.230 -72.078 1.00 64.15  ? 47  ALA A N     1 
ATOM   61    C  CA    . ALA A 1 8   ? 2.237   34.006 -71.016 1.00 62.43  ? 47  ALA A CA    1 
ATOM   62    C  C     . ALA A 1 8   ? 2.522   35.321 -70.304 1.00 60.33  ? 47  ALA A C     1 
ATOM   63    O  O     . ALA A 1 8   ? 2.451   35.370 -69.082 1.00 60.30  ? 47  ALA A O     1 
ATOM   64    C  CB    . ALA A 1 8   ? 3.527   33.409 -71.594 1.00 62.59  ? 47  ALA A CB    1 
ATOM   65    N  N     . LEU A 1 9   ? 2.763   36.403 -71.062 1.00 58.49  ? 48  LEU A N     1 
ATOM   66    C  CA    . LEU A 1 9   ? 3.013   37.712 -70.483 1.00 56.65  ? 48  LEU A CA    1 
ATOM   67    C  C     . LEU A 1 9   ? 1.780   38.298 -69.832 1.00 55.49  ? 48  LEU A C     1 
ATOM   68    O  O     . LEU A 1 9   ? 1.902   38.965 -68.822 1.00 55.59  ? 48  LEU A O     1 
ATOM   69    C  CB    . LEU A 1 9   ? 3.602   38.660 -71.514 1.00 56.35  ? 48  LEU A CB    1 
ATOM   70    C  CG    . LEU A 1 9   ? 5.041   38.350 -71.869 1.00 57.96  ? 48  LEU A CG    1 
ATOM   71    C  CD1   . LEU A 1 9   ? 5.506   39.177 -73.019 1.00 58.94  ? 48  LEU A CD1   1 
ATOM   72    C  CD2   . LEU A 1 9   ? 5.956   38.598 -70.702 1.00 58.65  ? 48  LEU A CD2   1 
ATOM   73    N  N     . ARG A 1 10  ? 0.600   38.019 -70.361 1.00 54.79  ? 49  ARG A N     1 
ATOM   74    C  CA    . ARG A 1 10  ? -0.652  38.480 -69.773 1.00 55.23  ? 49  ARG A CA    1 
ATOM   75    C  C     . ARG A 1 10  ? -0.892  37.782 -68.434 1.00 54.06  ? 49  ARG A C     1 
ATOM   76    O  O     . ARG A 1 10  ? -1.324  38.423 -67.480 1.00 53.66  ? 49  ARG A O     1 
ATOM   77    C  CB    . ARG A 1 10  ? -1.822  38.217 -70.740 1.00 58.22  ? 49  ARG A CB    1 
ATOM   78    C  CG    . ARG A 1 10  ? -3.169  38.820 -70.295 1.00 63.70  ? 49  ARG A CG    1 
ATOM   79    C  CD    . ARG A 1 10  ? -4.136  39.082 -71.450 1.00 68.53  ? 49  ARG A CD    1 
ATOM   80    N  NE    . ARG A 1 10  ? -4.663  37.851 -72.045 1.00 73.09  ? 49  ARG A NE    1 
ATOM   81    C  CZ    . ARG A 1 10  ? -4.259  37.347 -73.206 1.00 76.59  ? 49  ARG A CZ    1 
ATOM   82    N  NH1   . ARG A 1 10  ? -3.314  37.963 -73.914 1.00 76.39  ? 49  ARG A NH1   1 
ATOM   83    N  NH2   . ARG A 1 10  ? -4.798  36.226 -73.674 1.00 77.09  ? 49  ARG A NH2   1 
ATOM   84    N  N     . GLU A 1 11  ? -0.597  36.467 -68.375 1.00 53.39  ? 50  GLU A N     1 
ATOM   85    C  CA    . GLU A 1 11  ? -0.730  35.623 -67.188 1.00 52.60  ? 50  GLU A CA    1 
ATOM   86    C  C     . GLU A 1 11  ? 0.178   36.158 -66.057 1.00 51.02  ? 50  GLU A C     1 
ATOM   87    O  O     . GLU A 1 11  ? -0.306  36.375 -64.949 1.00 50.94  ? 50  GLU A O     1 
ATOM   88    C  CB    . GLU A 1 11  ? -0.379  34.153 -67.517 1.00 54.57  ? 50  GLU A CB    1 
ATOM   89    C  CG    . GLU A 1 11  ? -1.489  33.321 -68.140 1.00 58.75  ? 50  GLU A CG    1 
ATOM   90    C  CD    . GLU A 1 11  ? -1.152  31.845 -68.333 1.00 62.99  ? 50  GLU A CD    1 
ATOM   91    O  OE1   . GLU A 1 11  ? -1.002  31.411 -69.500 1.00 62.88  ? 50  GLU A OE1   1 
ATOM   92    O  OE2   . GLU A 1 11  ? -1.036  31.123 -67.315 1.00 64.07  ? 50  GLU A OE2   1 
ATOM   93    N  N     . ILE A 1 12  ? 1.472   36.436 -66.356 1.00 49.31  ? 51  ILE A N     1 
ATOM   94    C  CA    . ILE A 1 12  ? 2.437   36.973 -65.398 1.00 48.16  ? 51  ILE A CA    1 
ATOM   95    C  C     . ILE A 1 12  ? 1.887   38.229 -64.708 1.00 48.33  ? 51  ILE A C     1 
ATOM   96    O  O     . ILE A 1 12  ? 1.823   38.269 -63.485 1.00 48.53  ? 51  ILE A O     1 
ATOM   97    C  CB    . ILE A 1 12  ? 3.785   37.244 -66.097 1.00 47.72  ? 51  ILE A CB    1 
ATOM   98    C  CG1   . ILE A 1 12  ? 4.443   35.952 -66.515 1.00 48.53  ? 51  ILE A CG1   1 
ATOM   99    C  CG2   . ILE A 1 12  ? 4.708   38.048 -65.215 1.00 48.03  ? 51  ILE A CG2   1 
ATOM   100   C  CD1   . ILE A 1 12  ? 5.595   36.158 -67.430 1.00 50.02  ? 51  ILE A CD1   1 
ATOM   101   N  N     . ARG A 1 13  ? 1.407   39.205 -65.490 1.00 47.97  ? 52  ARG A N     1 
ATOM   102   C  CA    . ARG A 1 13  ? 0.842   40.432 -64.936 1.00 48.01  ? 52  ARG A CA    1 
ATOM   103   C  C     . ARG A 1 13  ? -0.434  40.148 -64.155 1.00 47.11  ? 52  ARG A C     1 
ATOM   104   O  O     . ARG A 1 13  ? -0.649  40.736 -63.106 1.00 47.20  ? 52  ARG A O     1 
ATOM   105   C  CB    . ARG A 1 13  ? 0.560   41.455 -66.043 1.00 49.87  ? 52  ARG A CB    1 
ATOM   106   C  CG    . ARG A 1 13  ? 1.719   41.670 -67.007 1.00 53.60  ? 52  ARG A CG    1 
ATOM   107   C  CD    . ARG A 1 13  ? 1.572   42.940 -67.821 1.00 57.58  ? 52  ARG A CD    1 
ATOM   108   N  NE    . ARG A 1 13  ? 2.541   42.937 -68.912 1.00 60.84  ? 52  ARG A NE    1 
ATOM   109   C  CZ    . ARG A 1 13  ? 2.238   42.736 -70.188 1.00 63.36  ? 52  ARG A CZ    1 
ATOM   110   N  NH1   . ARG A 1 13  ? 0.973   42.539 -70.557 1.00 63.50  ? 52  ARG A NH1   1 
ATOM   111   N  NH2   . ARG A 1 13  ? 3.190   42.744 -71.110 1.00 62.83  ? 52  ARG A NH2   1 
ATOM   112   N  N     . ARG A 1 14  ? -1.262  39.233 -64.651 1.00 46.08  ? 53  ARG A N     1 
ATOM   113   C  CA    . ARG A 1 14  ? -2.523  38.871 -64.014 1.00 45.71  ? 53  ARG A CA    1 
ATOM   114   C  C     . ARG A 1 14  ? -2.327  38.341 -62.607 1.00 44.77  ? 53  ARG A C     1 
ATOM   115   O  O     . ARG A 1 14  ? -3.101  38.670 -61.706 1.00 45.00  ? 53  ARG A O     1 
ATOM   116   C  CB    . ARG A 1 14  ? -3.259  37.830 -64.878 1.00 47.09  ? 53  ARG A CB    1 
ATOM   117   C  CG    . ARG A 1 14  ? -4.489  37.209 -64.237 1.00 50.13  ? 53  ARG A CG    1 
ATOM   118   C  CD    . ARG A 1 14  ? -5.032  36.079 -65.082 1.00 53.62  ? 53  ARG A CD    1 
ATOM   119   N  NE    . ARG A 1 14  ? -6.049  35.328 -64.347 1.00 57.25  ? 53  ARG A NE    1 
ATOM   120   C  CZ    . ARG A 1 14  ? -6.771  34.336 -64.860 1.00 59.61  ? 53  ARG A CZ    1 
ATOM   121   N  NH1   . ARG A 1 14  ? -6.606  33.972 -66.129 1.00 59.33  ? 53  ARG A NH1   1 
ATOM   122   N  NH2   . ARG A 1 14  ? -7.668  33.703 -64.112 1.00 59.19  ? 53  ARG A NH2   1 
ATOM   123   N  N     . TYR A 1 15  ? -1.300  37.511 -62.429 1.00 43.67  ? 54  TYR A N     1 
ATOM   124   C  CA    . TYR A 1 15  ? -1.025  36.856 -61.161 1.00 42.96  ? 54  TYR A CA    1 
ATOM   125   C  C     . TYR A 1 15  ? -0.147  37.665 -60.229 1.00 42.30  ? 54  TYR A C     1 
ATOM   126   O  O     . TYR A 1 15  ? -0.432  37.694 -59.030 1.00 42.42  ? 54  TYR A O     1 
ATOM   127   C  CB    . TYR A 1 15  ? -0.461  35.452 -61.398 1.00 42.63  ? 54  TYR A CB    1 
ATOM   128   C  CG    . TYR A 1 15  ? -1.552  34.524 -61.877 1.00 42.64  ? 54  TYR A CG    1 
ATOM   129   C  CD1   . TYR A 1 15  ? -2.679  34.290 -61.101 1.00 43.24  ? 54  TYR A CD1   1 
ATOM   130   C  CD2   . TYR A 1 15  ? -1.509  33.967 -63.145 1.00 43.25  ? 54  TYR A CD2   1 
ATOM   131   C  CE1   . TYR A 1 15  ? -3.710  33.479 -61.551 1.00 44.14  ? 54  TYR A CE1   1 
ATOM   132   C  CE2   . TYR A 1 15  ? -2.547  33.173 -63.619 1.00 44.22  ? 54  TYR A CE2   1 
ATOM   133   C  CZ    . TYR A 1 15  ? -3.644  32.923 -62.815 1.00 45.32  ? 54  TYR A CZ    1 
ATOM   134   O  OH    . TYR A 1 15  ? -4.669  32.117 -63.261 1.00 46.95  ? 54  TYR A OH    1 
ATOM   135   N  N     . GLN A 1 16  ? 0.883   38.370 -60.756 1.00 41.41  ? 55  GLN A N     1 
ATOM   136   C  CA    . GLN A 1 16  ? 1.752   39.202 -59.913 1.00 40.80  ? 55  GLN A CA    1 
ATOM   137   C  C     . GLN A 1 16  ? 0.932   40.287 -59.229 1.00 41.61  ? 55  GLN A C     1 
ATOM   138   O  O     . GLN A 1 16  ? 1.015   40.431 -58.006 1.00 42.47  ? 55  GLN A O     1 
ATOM   139   C  CB    . GLN A 1 16  ? 2.888   39.820 -60.721 1.00 39.92  ? 55  GLN A CB    1 
ATOM   140   C  CG    . GLN A 1 16  ? 3.848   38.792 -61.210 1.00 39.56  ? 55  GLN A CG    1 
ATOM   141   C  CD    . GLN A 1 16  ? 5.092   39.418 -61.736 1.00 42.15  ? 55  GLN A CD    1 
ATOM   142   O  OE1   . GLN A 1 16  ? 5.064   40.407 -62.465 1.00 43.52  ? 55  GLN A OE1   1 
ATOM   143   N  NE2   . GLN A 1 16  ? 6.223   38.855 -61.376 1.00 42.79  ? 55  GLN A NE2   1 
ATOM   144   N  N     . LYS A 1 17  ? 0.022   40.916 -60.018 1.00 40.96  ? 56  LYS A N     1 
ATOM   145   C  CA    . LYS A 1 17  ? -0.921  41.951 -59.629 1.00 41.01  ? 56  LYS A CA    1 
ATOM   146   C  C     . LYS A 1 17  ? -2.027  41.468 -58.671 1.00 40.66  ? 56  LYS A C     1 
ATOM   147   O  O     . LYS A 1 17  ? -2.839  42.286 -58.248 1.00 40.90  ? 56  LYS A O     1 
ATOM   148   C  CB    . LYS A 1 17  ? -1.574  42.538 -60.887 1.00 43.86  ? 56  LYS A CB    1 
ATOM   149   C  CG    . LYS A 1 17  ? -1.463  44.058 -61.028 1.00 50.03  ? 56  LYS A CG    1 
ATOM   150   C  CD    . LYS A 1 17  ? -0.066  44.556 -61.497 1.00 55.34  ? 56  LYS A CD    1 
ATOM   151   C  CE    . LYS A 1 17  ? 0.111   46.046 -61.227 1.00 58.95  ? 56  LYS A CE    1 
ATOM   152   N  NZ    . LYS A 1 17  ? 1.187   46.666 -62.056 1.00 60.74  ? 56  LYS A NZ    1 
ATOM   153   N  N     . SER A 1 18  ? -2.089  40.165 -58.338 1.00 40.04  ? 57  SER A N     1 
ATOM   154   C  CA    . SER A 1 18  ? -3.122  39.631 -57.435 1.00 39.82  ? 57  SER A CA    1 
ATOM   155   C  C     . SER A 1 18  ? -2.517  38.921 -56.198 1.00 39.32  ? 57  SER A C     1 
ATOM   156   O  O     . SER A 1 18  ? -1.285  38.830 -56.081 1.00 39.32  ? 57  SER A O     1 
ATOM   157   C  CB    . SER A 1 18  ? -4.046  38.682 -58.196 1.00 40.89  ? 57  SER A CB    1 
ATOM   158   O  OG    . SER A 1 18  ? -3.341  37.508 -58.567 1.00 42.76  ? 57  SER A OG    1 
ATOM   159   N  N     . THR A 1 19  ? -3.380  38.455 -55.255 1.00 38.62  ? 58  THR A N     1 
ATOM   160   C  CA    . THR A 1 19  ? -2.919  37.767 -54.049 1.00 38.60  ? 58  THR A CA    1 
ATOM   161   C  C     . THR A 1 19  ? -3.574  36.421 -53.765 1.00 38.29  ? 58  THR A C     1 
ATOM   162   O  O     . THR A 1 19  ? -3.140  35.729 -52.841 1.00 38.18  ? 58  THR A O     1 
ATOM   163   C  CB    . THR A 1 19  ? -3.086  38.633 -52.824 1.00 39.71  ? 58  THR A CB    1 
ATOM   164   O  OG1   . THR A 1 19  ? -4.477  38.848 -52.598 1.00 40.83  ? 58  THR A OG1   1 
ATOM   165   C  CG2   . THR A 1 19  ? -2.327  39.912 -52.926 1.00 39.98  ? 58  THR A CG2   1 
ATOM   166   N  N     . GLU A 1 20  ? -4.636  36.065 -54.510 1.00 37.77  ? 59  GLU A N     1 
ATOM   167   C  CA    . GLU A 1 20  ? -5.358  34.801 -54.322 1.00 37.32  ? 59  GLU A CA    1 
ATOM   168   C  C     . GLU A 1 20  ? -4.420  33.593 -54.385 1.00 36.77  ? 59  GLU A C     1 
ATOM   169   O  O     . GLU A 1 20  ? -3.383  33.662 -55.064 1.00 37.19  ? 59  GLU A O     1 
ATOM   170   C  CB    . GLU A 1 20  ? -6.534  34.635 -55.324 1.00 39.33  ? 59  GLU A CB    1 
ATOM   171   C  CG    . GLU A 1 20  ? -6.569  35.566 -56.535 1.00 45.68  ? 59  GLU A CG    1 
ATOM   172   C  CD    . GLU A 1 20  ? -5.798  35.160 -57.784 1.00 52.96  ? 59  GLU A CD    1 
ATOM   173   O  OE1   . GLU A 1 20  ? -5.938  35.837 -58.830 1.00 54.04  ? 59  GLU A OE1   1 
ATOM   174   O  OE2   . GLU A 1 20  ? -5.047  34.165 -57.717 1.00 55.74  ? 59  GLU A OE2   1 
ATOM   175   N  N     . LEU A 1 21  ? -4.762  32.494 -53.673 1.00 35.35  ? 60  LEU A N     1 
ATOM   176   C  CA    . LEU A 1 21  ? -3.907  31.298 -53.736 1.00 33.98  ? 60  LEU A CA    1 
ATOM   177   C  C     . LEU A 1 21  ? -4.019  30.622 -55.118 1.00 32.68  ? 60  LEU A C     1 
ATOM   178   O  O     . LEU A 1 21  ? -5.032  30.755 -55.795 1.00 32.43  ? 60  LEU A O     1 
ATOM   179   C  CB    . LEU A 1 21  ? -4.129  30.340 -52.551 1.00 33.04  ? 60  LEU A CB    1 
ATOM   180   C  CG    . LEU A 1 21  ? -3.686  30.918 -51.192 1.00 32.85  ? 60  LEU A CG    1 
ATOM   181   C  CD1   . LEU A 1 21  ? -4.223  30.133 -50.066 1.00 33.08  ? 60  LEU A CD1   1 
ATOM   182   C  CD2   . LEU A 1 21  ? -2.188  31.018 -51.077 1.00 32.60  ? 60  LEU A CD2   1 
ATOM   183   N  N     . LEU A 1 22  ? -2.942  29.984 -55.565 1.00 31.92  ? 61  LEU A N     1 
ATOM   184   C  CA    . LEU A 1 22  ? -2.842  29.379 -56.893 1.00 31.68  ? 61  LEU A CA    1 
ATOM   185   C  C     . LEU A 1 22  ? -2.930  27.823 -56.920 1.00 31.39  ? 61  LEU A C     1 
ATOM   186   O  O     . LEU A 1 22  ? -2.775  27.204 -57.976 1.00 31.90  ? 61  LEU A O     1 
ATOM   187   C  CB    . LEU A 1 22  ? -1.558  29.887 -57.566 1.00 31.67  ? 61  LEU A CB    1 
ATOM   188   C  CG    . LEU A 1 22  ? -1.452  31.410 -57.587 1.00 32.95  ? 61  LEU A CG    1 
ATOM   189   C  CD1   . LEU A 1 22  ? -0.110  31.874 -58.059 1.00 33.46  ? 61  LEU A CD1   1 
ATOM   190   C  CD2   . LEU A 1 22  ? -2.531  31.998 -58.417 1.00 33.74  ? 61  LEU A CD2   1 
ATOM   191   N  N     . ILE A 1 23  ? -3.181  27.204 -55.765 1.00 30.13  ? 62  ILE A N     1 
ATOM   192   C  CA    . ILE A 1 23  ? -3.368  25.758 -55.641 1.00 29.26  ? 62  ILE A CA    1 
ATOM   193   C  C     . ILE A 1 23  ? -4.744  25.601 -55.009 1.00 28.97  ? 62  ILE A C     1 
ATOM   194   O  O     . ILE A 1 23  ? -5.078  26.381 -54.098 1.00 28.70  ? 62  ILE A O     1 
ATOM   195   C  CB    . ILE A 1 23  ? -2.272  25.116 -54.746 1.00 29.21  ? 62  ILE A CB    1 
ATOM   196   C  CG1   . ILE A 1 23  ? -0.879  25.208 -55.384 1.00 29.31  ? 62  ILE A CG1   1 
ATOM   197   C  CG2   . ILE A 1 23  ? -2.626  23.660 -54.378 1.00 29.58  ? 62  ILE A CG2   1 
ATOM   198   C  CD1   . ILE A 1 23  ? 0.239   24.787 -54.455 1.00 29.73  ? 62  ILE A CD1   1 
ATOM   199   N  N     . ARG A 1 24  ? -5.563  24.640 -55.489 1.00 28.99  ? 63  ARG A N     1 
ATOM   200   C  CA    . ARG A 1 24  ? -6.902  24.495 -54.909 1.00 30.14  ? 63  ARG A CA    1 
ATOM   201   C  C     . ARG A 1 24  ? -6.801  23.952 -53.497 1.00 29.73  ? 63  ARG A C     1 
ATOM   202   O  O     . ARG A 1 24  ? -5.919  23.161 -53.188 1.00 29.55  ? 63  ARG A O     1 
ATOM   203   C  CB    . ARG A 1 24  ? -7.924  23.742 -55.794 1.00 33.30  ? 63  ARG A CB    1 
ATOM   204   C  CG    . ARG A 1 24  ? -8.546  24.573 -56.944 1.00 38.95  ? 63  ARG A CG    1 
ATOM   205   C  CD    . ARG A 1 24  ? -7.633  24.627 -58.175 1.00 45.77  ? 63  ARG A CD    1 
ATOM   206   N  NE    . ARG A 1 24  ? -7.295  23.288 -58.686 1.00 51.92  ? 63  ARG A NE    1 
ATOM   207   C  CZ    . ARG A 1 24  ? -6.118  22.674 -58.514 1.00 55.91  ? 63  ARG A CZ    1 
ATOM   208   N  NH1   . ARG A 1 24  ? -5.140  23.270 -57.838 1.00 54.68  ? 63  ARG A NH1   1 
ATOM   209   N  NH2   . ARG A 1 24  ? -5.927  21.447 -58.985 1.00 57.58  ? 63  ARG A NH2   1 
ATOM   210   N  N     . LYS A 1 25  ? -7.637  24.488 -52.623 1.00 29.93  ? 64  LYS A N     1 
ATOM   211   C  CA    . LYS A 1 25  ? -7.642  24.216 -51.199 1.00 31.06  ? 64  LYS A CA    1 
ATOM   212   C  C     . LYS A 1 25  ? -7.813  22.744 -50.836 1.00 31.23  ? 64  LYS A C     1 
ATOM   213   O  O     . LYS A 1 25  ? -7.170  22.293 -49.888 1.00 32.31  ? 64  LYS A O     1 
ATOM   214   C  CB    . LYS A 1 25  ? -8.699  25.090 -50.488 1.00 33.96  ? 64  LYS A CB    1 
ATOM   215   C  CG    . LYS A 1 25  ? -8.545  26.580 -50.809 1.00 39.44  ? 64  LYS A CG    1 
ATOM   216   C  CD    . LYS A 1 25  ? -9.324  27.457 -49.858 1.00 45.36  ? 64  LYS A CD    1 
ATOM   217   C  CE    . LYS A 1 25  ? -9.096  28.920 -50.163 1.00 50.39  ? 64  LYS A CE    1 
ATOM   218   N  NZ    . LYS A 1 25  ? -9.625  29.808 -49.087 1.00 53.35  ? 64  LYS A NZ    1 
ATOM   219   N  N     . LEU A 1 26  ? -8.662  21.989 -51.569 1.00 29.68  ? 65  LEU A N     1 
ATOM   220   C  CA    . LEU A 1 26  ? -8.883  20.581 -51.244 1.00 28.34  ? 65  LEU A CA    1 
ATOM   221   C  C     . LEU A 1 26  ? -7.746  19.643 -51.692 1.00 25.76  ? 65  LEU A C     1 
ATOM   222   O  O     . LEU A 1 26  ? -7.264  18.900 -50.831 1.00 25.75  ? 65  LEU A O     1 
ATOM   223   C  CB    . LEU A 1 26  ? -10.239 20.070 -51.730 1.00 29.27  ? 65  LEU A CB    1 
ATOM   224   C  CG    . LEU A 1 26  ? -10.575 18.668 -51.240 1.00 31.62  ? 65  LEU A CG    1 
ATOM   225   C  CD1   . LEU A 1 26  ? -10.736 18.623 -49.701 1.00 31.81  ? 65  LEU A CD1   1 
ATOM   226   C  CD2   . LEU A 1 26  ? -11.750 18.072 -52.025 1.00 32.82  ? 65  LEU A CD2   1 
ATOM   227   N  N     . PRO A 1 27  ? -7.234  19.675 -52.952 1.00 23.57  ? 66  PRO A N     1 
ATOM   228   C  CA    . PRO A 1 27  ? -6.103  18.802 -53.298 1.00 23.56  ? 66  PRO A CA    1 
ATOM   229   C  C     . PRO A 1 27  ? -4.926  18.951 -52.328 1.00 25.11  ? 66  PRO A C     1 
ATOM   230   O  O     . PRO A 1 27  ? -4.368  17.935 -51.869 1.00 26.19  ? 66  PRO A O     1 
ATOM   231   C  CB    . PRO A 1 27  ? -5.707  19.267 -54.701 1.00 23.45  ? 66  PRO A CB    1 
ATOM   232   C  CG    . PRO A 1 27  ? -6.881  19.899 -55.246 1.00 23.55  ? 66  PRO A CG    1 
ATOM   233   C  CD    . PRO A 1 27  ? -7.642  20.490 -54.107 1.00 22.32  ? 66  PRO A CD    1 
ATOM   234   N  N     . PHE A 1 28  ? -4.603  20.232 -51.979 1.00 24.70  ? 67  PHE A N     1 
ATOM   235   C  CA    . PHE A 1 28  ? -3.584  20.649 -51.025 1.00 24.53  ? 67  PHE A CA    1 
ATOM   236   C  C     . PHE A 1 28  ? -3.916  20.134 -49.598 1.00 24.89  ? 67  PHE A C     1 
ATOM   237   O  O     . PHE A 1 28  ? -3.023  19.594 -48.957 1.00 25.62  ? 67  PHE A O     1 
ATOM   238   C  CB    . PHE A 1 28  ? -3.385  22.185 -51.049 1.00 23.95  ? 67  PHE A CB    1 
ATOM   239   C  CG    . PHE A 1 28  ? -2.234  22.633 -50.165 1.00 24.34  ? 67  PHE A CG    1 
ATOM   240   C  CD1   . PHE A 1 28  ? -2.437  22.937 -48.822 1.00 25.04  ? 67  PHE A CD1   1 
ATOM   241   C  CD2   . PHE A 1 28  ? -0.945  22.716 -50.665 1.00 24.37  ? 67  PHE A CD2   1 
ATOM   242   C  CE1   . PHE A 1 28  ? -1.367  23.278 -47.996 1.00 24.95  ? 67  PHE A CE1   1 
ATOM   243   C  CE2   . PHE A 1 28  ? 0.114   23.081 -49.840 1.00 24.44  ? 67  PHE A CE2   1 
ATOM   244   C  CZ    . PHE A 1 28  ? -0.103  23.339 -48.509 1.00 24.22  ? 67  PHE A CZ    1 
ATOM   245   N  N     . GLN A 1 29  ? -5.171  20.254 -49.114 1.00 24.38  ? 68  GLN A N     1 
ATOM   246   C  CA    . GLN A 1 29  ? -5.533  19.734 -47.801 1.00 25.23  ? 68  GLN A CA    1 
ATOM   247   C  C     . GLN A 1 29  ? -5.359  18.200 -47.732 1.00 26.34  ? 68  GLN A C     1 
ATOM   248   O  O     . GLN A 1 29  ? -5.067  17.647 -46.655 1.00 27.28  ? 68  GLN A O     1 
ATOM   249   C  CB    . GLN A 1 29  ? -6.965  20.106 -47.428 1.00 27.69  ? 68  GLN A CB    1 
ATOM   250   C  CG    . GLN A 1 29  ? -7.123  20.220 -45.912 1.00 35.15  ? 68  GLN A CG    1 
ATOM   251   C  CD    . GLN A 1 29  ? -8.460  19.760 -45.365 1.00 44.28  ? 68  GLN A CD    1 
ATOM   252   O  OE1   . GLN A 1 29  ? -8.810  18.565 -45.393 1.00 47.45  ? 68  GLN A OE1   1 
ATOM   253   N  NE2   . GLN A 1 29  ? -9.226  20.706 -44.823 1.00 45.71  ? 68  GLN A NE2   1 
ATOM   254   N  N     . ARG A 1 30  ? -5.549  17.503 -48.873 1.00 25.53  ? 69  ARG A N     1 
ATOM   255   C  CA    . ARG A 1 30  ? -5.376  16.050 -48.897 1.00 24.87  ? 69  ARG A CA    1 
ATOM   256   C  C     . ARG A 1 30  ? -3.896  15.750 -48.775 1.00 23.77  ? 69  ARG A C     1 
ATOM   257   O  O     . ARG A 1 30  ? -3.504  14.972 -47.906 1.00 23.40  ? 69  ARG A O     1 
ATOM   258   C  CB    . ARG A 1 30  ? -5.989  15.418 -50.166 1.00 25.59  ? 69  ARG A CB    1 
ATOM   259   C  CG    . ARG A 1 30  ? -7.515  15.252 -50.087 1.00 26.52  ? 69  ARG A CG    1 
ATOM   260   C  CD    . ARG A 1 30  ? -8.041  14.462 -51.252 1.00 27.57  ? 69  ARG A CD    1 
ATOM   261   N  NE    . ARG A 1 30  ? -8.402  15.271 -52.417 1.00 29.55  ? 69  ARG A NE    1 
ATOM   262   C  CZ    . ARG A 1 30  ? -7.675  15.378 -53.529 1.00 31.58  ? 69  ARG A CZ    1 
ATOM   263   N  NH1   . ARG A 1 30  ? -6.450  14.875 -53.581 1.00 31.46  ? 69  ARG A NH1   1 
ATOM   264   N  NH2   . ARG A 1 30  ? -8.133  16.065 -54.567 1.00 31.03  ? 69  ARG A NH2   1 
ATOM   265   N  N     . LEU A 1 31  ? -3.062  16.446 -49.582 1.00 22.65  ? 70  LEU A N     1 
ATOM   266   C  CA    . LEU A 1 31  ? -1.607  16.272 -49.561 1.00 21.40  ? 70  LEU A CA    1 
ATOM   267   C  C     . LEU A 1 31  ? -1.029  16.521 -48.187 1.00 21.04  ? 70  LEU A C     1 
ATOM   268   O  O     . LEU A 1 31  ? -0.178  15.766 -47.736 1.00 20.77  ? 70  LEU A O     1 
ATOM   269   C  CB    . LEU A 1 31  ? -0.926  17.172 -50.597 1.00 20.16  ? 70  LEU A CB    1 
ATOM   270   C  CG    . LEU A 1 31  ? 0.568   17.000 -50.752 1.00 19.58  ? 70  LEU A CG    1 
ATOM   271   C  CD1   . LEU A 1 31  ? 0.926   15.575 -51.061 1.00 19.86  ? 70  LEU A CD1   1 
ATOM   272   C  CD2   . LEU A 1 31  ? 1.072   17.866 -51.853 1.00 19.66  ? 70  LEU A CD2   1 
ATOM   273   N  N     . VAL A 1 32  ? -1.534  17.543 -47.501 1.00 20.75  ? 71  VAL A N     1 
ATOM   274   C  CA    . VAL A 1 32  ? -1.086  17.861 -46.154 1.00 21.33  ? 71  VAL A CA    1 
ATOM   275   C  C     . VAL A 1 32  ? -1.411  16.708 -45.195 1.00 22.38  ? 71  VAL A C     1 
ATOM   276   O  O     . VAL A 1 32  ? -0.513  16.229 -44.500 1.00 22.19  ? 71  VAL A O     1 
ATOM   277   C  CB    . VAL A 1 32  ? -1.638  19.238 -45.684 1.00 21.61  ? 71  VAL A CB    1 
ATOM   278   C  CG1   . VAL A 1 32  ? -1.594  19.390 -44.162 1.00 21.93  ? 71  VAL A CG1   1 
ATOM   279   C  CG2   . VAL A 1 32  ? -0.882  20.380 -46.356 1.00 21.79  ? 71  VAL A CG2   1 
ATOM   280   N  N     . ARG A 1 33  ? -2.666  16.223 -45.209 1.00 23.02  ? 72  ARG A N     1 
ATOM   281   C  CA    . ARG A 1 33  ? -3.083  15.143 -44.317 1.00 24.07  ? 72  ARG A CA    1 
ATOM   282   C  C     . ARG A 1 33  ? -2.375  13.828 -44.624 1.00 23.37  ? 72  ARG A C     1 
ATOM   283   O  O     . ARG A 1 33  ? -2.092  13.063 -43.701 1.00 22.98  ? 72  ARG A O     1 
ATOM   284   C  CB    . ARG A 1 33  ? -4.603  14.965 -44.333 1.00 27.08  ? 72  ARG A CB    1 
ATOM   285   C  CG    . ARG A 1 33  ? -5.375  16.173 -43.823 1.00 32.28  ? 72  ARG A CG    1 
ATOM   286   C  CD    . ARG A 1 33  ? -6.833  15.821 -43.705 1.00 37.46  ? 72  ARG A CD    1 
ATOM   287   N  NE    . ARG A 1 33  ? -7.663  16.964 -43.351 1.00 43.98  ? 72  ARG A NE    1 
ATOM   288   C  CZ    . ARG A 1 33  ? -7.977  17.310 -42.104 1.00 48.45  ? 72  ARG A CZ    1 
ATOM   289   N  NH1   . ARG A 1 33  ? -7.485  16.629 -41.072 1.00 48.43  ? 72  ARG A NH1   1 
ATOM   290   N  NH2   . ARG A 1 33  ? -8.774  18.351 -41.878 1.00 48.85  ? 72  ARG A NH2   1 
ATOM   291   N  N     . GLU A 1 34  ? -2.056  13.587 -45.920 1.00 22.58  ? 73  GLU A N     1 
ATOM   292   C  CA    . GLU A 1 34  ? -1.328  12.402 -46.377 1.00 21.80  ? 73  GLU A CA    1 
ATOM   293   C  C     . GLU A 1 34  ? 0.059   12.437 -45.742 1.00 22.27  ? 73  GLU A C     1 
ATOM   294   O  O     . GLU A 1 34  ? 0.335   11.618 -44.874 1.00 22.87  ? 73  GLU A O     1 
ATOM   295   C  CB    . GLU A 1 34  ? -1.262  12.337 -47.920 1.00 21.66  ? 73  GLU A CB    1 
ATOM   296   C  CG    . GLU A 1 34  ? -0.358  11.240 -48.450 1.00 23.29  ? 73  GLU A CG    1 
ATOM   297   C  CD    . GLU A 1 34  ? -0.055  11.324 -49.935 1.00 29.51  ? 73  GLU A CD    1 
ATOM   298   O  OE1   . GLU A 1 34  ? -0.991  11.621 -50.706 1.00 32.09  ? 73  GLU A OE1   1 
ATOM   299   O  OE2   . GLU A 1 34  ? 1.110   11.100 -50.336 1.00 31.18  ? 73  GLU A OE2   1 
ATOM   300   N  N     . ILE A 1 35  ? 0.877   13.456 -46.076 1.00 22.18  ? 74  ILE A N     1 
ATOM   301   C  CA    . ILE A 1 35  ? 2.222   13.660 -45.539 1.00 22.45  ? 74  ILE A CA    1 
ATOM   302   C  C     . ILE A 1 35  ? 2.239   13.596 -44.007 1.00 23.88  ? 74  ILE A C     1 
ATOM   303   O  O     . ILE A 1 35  ? 3.049   12.873 -43.452 1.00 24.52  ? 74  ILE A O     1 
ATOM   304   C  CB    . ILE A 1 35  ? 2.833   14.986 -46.089 1.00 21.79  ? 74  ILE A CB    1 
ATOM   305   C  CG1   . ILE A 1 35  ? 3.110   14.876 -47.588 1.00 21.97  ? 74  ILE A CG1   1 
ATOM   306   C  CG2   . ILE A 1 35  ? 4.093   15.391 -45.342 1.00 21.71  ? 74  ILE A CG2   1 
ATOM   307   C  CD1   . ILE A 1 35  ? 3.363   16.210 -48.244 1.00 22.66  ? 74  ILE A CD1   1 
ATOM   308   N  N     . ALA A 1 36  ? 1.330   14.301 -43.358 1.00 24.32  ? 75  ALA A N     1 
ATOM   309   C  CA    . ALA A 1 36  ? 1.353   14.375 -41.888 1.00 25.14  ? 75  ALA A CA    1 
ATOM   310   C  C     . ALA A 1 36  ? 0.904   13.077 -41.236 1.00 26.16  ? 75  ALA A C     1 
ATOM   311   O  O     . ALA A 1 36  ? 1.273   12.874 -40.101 1.00 26.60  ? 75  ALA A O     1 
ATOM   312   C  CB    . ALA A 1 36  ? 0.483   15.508 -41.445 1.00 25.26  ? 75  ALA A CB    1 
ATOM   313   N  N     . GLN A 1 37  ? 0.073   12.274 -41.892 1.00 26.41  ? 76  GLN A N     1 
ATOM   314   C  CA    . GLN A 1 37  ? -0.395  11.032 -41.229 1.00 26.81  ? 76  GLN A CA    1 
ATOM   315   C  C     . GLN A 1 37  ? 0.642   9.952  -41.490 1.00 27.29  ? 76  GLN A C     1 
ATOM   316   O  O     . GLN A 1 37  ? 0.937   9.215  -40.568 1.00 26.92  ? 76  GLN A O     1 
ATOM   317   C  CB    . GLN A 1 37  ? -1.793  10.647 -41.712 1.00 27.81  ? 76  GLN A CB    1 
ATOM   318   C  CG    . GLN A 1 37  ? -1.956  9.183  -42.092 1.00 28.18  ? 76  GLN A CG    1 
ATOM   319   C  CD    . GLN A 1 37  ? -2.811  8.975  -43.310 1.00 28.69  ? 76  GLN A CD    1 
ATOM   320   O  OE1   . GLN A 1 37  ? -2.348  8.989  -44.436 1.00 27.84  ? 76  GLN A OE1   1 
ATOM   321   N  NE2   . GLN A 1 37  ? -4.082  8.760  -43.081 1.00 29.40  ? 76  GLN A NE2   1 
ATOM   322   N  N     . ASP A 1 38  ? 1.168   9.887  -42.717 1.00 28.09  ? 77  ASP A N     1 
ATOM   323   C  CA    . ASP A 1 38  ? 2.186   8.865  -43.107 1.00 29.44  ? 77  ASP A CA    1 
ATOM   324   C  C     . ASP A 1 38  ? 3.248   8.908  -41.980 1.00 32.62  ? 77  ASP A C     1 
ATOM   325   O  O     . ASP A 1 38  ? 3.888   7.866  -41.740 1.00 32.60  ? 77  ASP A O     1 
ATOM   326   C  CB    . ASP A 1 38  ? 2.581   8.983  -44.563 1.00 28.30  ? 77  ASP A CB    1 
ATOM   327   C  CG    . ASP A 1 38  ? 1.851   7.999  -45.460 1.00 27.31  ? 77  ASP A CG    1 
ATOM   328   O  OD1   . ASP A 1 38  ? 1.299   7.017  -44.924 1.00 25.72  ? 77  ASP A OD1   1 
ATOM   329   O  OD2   . ASP A 1 38  ? 1.840   8.222  -46.687 1.00 26.40  ? 77  ASP A OD2   1 
ATOM   330   N  N     . PHE A 1 39  ? 3.430   10.089 -41.362 1.00 35.40  ? 78  PHE A N     1 
ATOM   331   C  CA    . PHE A 1 39  ? 4.465   10.468 -40.367 1.00 38.46  ? 78  PHE A CA    1 
ATOM   332   C  C     . PHE A 1 39  ? 4.093   10.346 -38.869 1.00 39.44  ? 78  PHE A C     1 
ATOM   333   O  O     . PHE A 1 39  ? 4.962   10.236 -38.021 1.00 39.21  ? 78  PHE A O     1 
ATOM   334   C  CB    . PHE A 1 39  ? 4.441   11.996 -40.295 1.00 40.10  ? 78  PHE A CB    1 
ATOM   335   C  CG    . PHE A 1 39  ? 5.684   12.730 -40.719 1.00 42.83  ? 78  PHE A CG    1 
ATOM   336   C  CD1   . PHE A 1 39  ? 6.798   12.764 -39.908 1.00 44.54  ? 78  PHE A CD1   1 
ATOM   337   C  CD2   . PHE A 1 39  ? 5.712   13.433 -41.909 1.00 44.49  ? 78  PHE A CD2   1 
ATOM   338   C  CE1   . PHE A 1 39  ? 7.936   13.432 -40.316 1.00 45.82  ? 78  PHE A CE1   1 
ATOM   339   C  CE2   . PHE A 1 39  ? 6.842   14.116 -42.307 1.00 45.74  ? 78  PHE A CE2   1 
ATOM   340   C  CZ    . PHE A 1 39  ? 7.954   14.105 -41.512 1.00 45.83  ? 78  PHE A CZ    1 
ATOM   341   N  N     . LYS A 1 40  ? 2.819   10.552 -38.576 1.00 40.26  ? 79  LYS A N     1 
ATOM   342   C  CA    . LYS A 1 40  ? 2.206   10.443 -37.233 1.00 41.38  ? 79  LYS A CA    1 
ATOM   343   C  C     . LYS A 1 40  ? 0.698   10.346 -37.467 1.00 43.16  ? 79  LYS A C     1 
ATOM   344   O  O     . LYS A 1 40  ? 0.137   11.262 -38.020 1.00 43.66  ? 79  LYS A O     1 
ATOM   345   C  CB    . LYS A 1 40  ? 2.586   11.624 -36.355 1.00 42.47  ? 79  LYS A CB    1 
ATOM   346   C  CG    . LYS A 1 40  ? 2.552   11.318 -34.875 1.00 46.44  ? 79  LYS A CG    1 
ATOM   347   C  CD    . LYS A 1 40  ? 1.162   11.040 -34.396 1.00 51.92  ? 79  LYS A CD    1 
ATOM   348   C  CE    . LYS A 1 40  ? 1.081   10.968 -32.890 1.00 56.81  ? 79  LYS A CE    1 
ATOM   349   N  NZ    . LYS A 1 40  ? 2.428   10.912 -32.279 1.00 59.48  ? 79  LYS A NZ    1 
ATOM   350   N  N     . THR A 1 41  ? 0.096   9.226  -37.107 1.00 44.10  ? 80  THR A N     1 
ATOM   351   C  CA    . THR A 1 41  ? -1.307  8.930  -37.367 1.00 45.52  ? 80  THR A CA    1 
ATOM   352   C  C     . THR A 1 41  ? -2.263  9.518  -36.316 1.00 46.33  ? 80  THR A C     1 
ATOM   353   O  O     . THR A 1 41  ? -1.823  9.979  -35.256 1.00 46.14  ? 80  THR A O     1 
ATOM   354   C  CB    . THR A 1 41  ? -1.474  7.383  -37.529 1.00 47.37  ? 80  THR A CB    1 
ATOM   355   O  OG1   . THR A 1 41  ? -0.829  6.710  -36.440 1.00 48.30  ? 80  THR A OG1   1 
ATOM   356   C  CG2   . THR A 1 41  ? -0.955  6.857  -38.881 1.00 47.75  ? 80  THR A CG2   1 
ATOM   357   N  N     . ASP A 1 42  ? -3.578  9.500  -36.627 1.00 47.09  ? 81  ASP A N     1 
ATOM   358   C  CA    . ASP A 1 42  ? -4.627  10.011 -35.744 1.00 48.55  ? 81  ASP A CA    1 
ATOM   359   C  C     . ASP A 1 42  ? -4.467  11.522 -35.518 1.00 48.22  ? 81  ASP A C     1 
ATOM   360   O  O     . ASP A 1 42  ? -4.662  12.013 -34.408 1.00 48.45  ? 81  ASP A O     1 
ATOM   361   C  CB    . ASP A 1 42  ? -4.644  9.243  -34.406 1.00 52.54  ? 81  ASP A CB    1 
ATOM   362   C  CG    . ASP A 1 42  ? -6.027  8.777  -33.981 1.00 61.41  ? 81  ASP A CG    1 
ATOM   363   O  OD1   . ASP A 1 42  ? -6.999  9.559  -34.155 1.00 63.17  ? 81  ASP A OD1   1 
ATOM   364   O  OD2   . ASP A 1 42  ? -6.142  7.625  -33.471 1.00 64.60  ? 81  ASP A OD2   1 
ATOM   365   N  N     . LEU A 1 43  ? -4.100  12.258 -36.581 1.00 47.25  ? 82  LEU A N     1 
ATOM   366   C  CA    . LEU A 1 43  ? -3.881  13.706 -36.501 1.00 46.07  ? 82  LEU A CA    1 
ATOM   367   C  C     . LEU A 1 43  ? -5.044  14.551 -37.027 1.00 45.73  ? 82  LEU A C     1 
ATOM   368   O  O     . LEU A 1 43  ? -5.659  14.253 -38.053 1.00 45.63  ? 82  LEU A O     1 
ATOM   369   C  CB    . LEU A 1 43  ? -2.581  14.127 -37.230 1.00 45.14  ? 82  LEU A CB    1 
ATOM   370   C  CG    . LEU A 1 43  ? -1.267  14.036 -36.465 1.00 44.75  ? 82  LEU A CG    1 
ATOM   371   C  CD1   . LEU A 1 43  ? -0.139  14.571 -37.303 1.00 44.55  ? 82  LEU A CD1   1 
ATOM   372   C  CD2   . LEU A 1 43  ? -1.334  14.793 -35.163 1.00 44.78  ? 82  LEU A CD2   1 
ATOM   373   N  N     . ARG A 1 44  ? -5.298  15.647 -36.326 1.00 45.38  ? 83  ARG A N     1 
ATOM   374   C  CA    . ARG A 1 44  ? -6.280  16.654 -36.689 1.00 45.04  ? 83  ARG A CA    1 
ATOM   375   C  C     . ARG A 1 44  ? -5.565  17.957 -37.072 1.00 42.35  ? 83  ARG A C     1 
ATOM   376   O  O     . ARG A 1 44  ? -4.501  18.241 -36.565 1.00 41.86  ? 83  ARG A O     1 
ATOM   377   C  CB    . ARG A 1 44  ? -7.266  16.868 -35.539 1.00 48.54  ? 83  ARG A CB    1 
ATOM   378   C  CG    . ARG A 1 44  ? -8.184  15.676 -35.350 1.00 55.58  ? 83  ARG A CG    1 
ATOM   379   C  CD    . ARG A 1 44  ? -9.294  16.013 -34.388 1.00 63.56  ? 83  ARG A CD    1 
ATOM   380   N  NE    . ARG A 1 44  ? -10.584 15.514 -34.867 1.00 71.20  ? 83  ARG A NE    1 
ATOM   381   C  CZ    . ARG A 1 44  ? -11.756 15.875 -34.356 1.00 76.18  ? 83  ARG A CZ    1 
ATOM   382   N  NH1   . ARG A 1 44  ? -11.811 16.724 -33.332 1.00 76.58  ? 83  ARG A NH1   1 
ATOM   383   N  NH2   . ARG A 1 44  ? -12.885 15.389 -34.862 1.00 76.80  ? 83  ARG A NH2   1 
ATOM   384   N  N     . PHE A 1 45  ? -6.117  18.707 -38.006 1.00 40.86  ? 84  PHE A N     1 
ATOM   385   C  CA    . PHE A 1 45  ? -5.526  19.958 -38.470 1.00 39.94  ? 84  PHE A CA    1 
ATOM   386   C  C     . PHE A 1 45  ? -6.475  21.118 -38.315 1.00 39.48  ? 84  PHE A C     1 
ATOM   387   O  O     . PHE A 1 45  ? -7.543  21.084 -38.935 1.00 39.72  ? 84  PHE A O     1 
ATOM   388   C  CB    . PHE A 1 45  ? -5.223  19.855 -39.956 1.00 39.55  ? 84  PHE A CB    1 
ATOM   389   C  CG    . PHE A 1 45  ? -3.848  19.328 -40.232 1.00 40.29  ? 84  PHE A CG    1 
ATOM   390   C  CD1   . PHE A 1 45  ? -2.730  20.099 -39.970 1.00 41.01  ? 84  PHE A CD1   1 
ATOM   391   C  CD2   . PHE A 1 45  ? -3.667  18.066 -40.764 1.00 40.70  ? 84  PHE A CD2   1 
ATOM   392   C  CE1   . PHE A 1 45  ? -1.462  19.620 -40.240 1.00 41.47  ? 84  PHE A CE1   1 
ATOM   393   C  CE2   . PHE A 1 45  ? -2.401  17.600 -41.047 1.00 41.27  ? 84  PHE A CE2   1 
ATOM   394   C  CZ    . PHE A 1 45  ? -1.306  18.377 -40.772 1.00 41.18  ? 84  PHE A CZ    1 
ATOM   395   N  N     . GLN A 1 46  ? -6.071  22.208 -37.603 1.00 38.40  ? 85  GLN A N     1 
ATOM   396   C  CA    . GLN A 1 46  ? -6.918  23.403 -37.521 1.00 37.48  ? 85  GLN A CA    1 
ATOM   397   C  C     . GLN A 1 46  ? -7.068  23.999 -38.924 1.00 36.78  ? 85  GLN A C     1 
ATOM   398   O  O     . GLN A 1 46  ? -6.107  23.969 -39.694 1.00 36.61  ? 85  GLN A O     1 
ATOM   399   C  CB    . GLN A 1 46  ? -6.310  24.428 -36.568 1.00 38.83  ? 85  GLN A CB    1 
ATOM   400   C  CG    . GLN A 1 46  ? -6.572  24.106 -35.111 1.00 42.59  ? 85  GLN A CG    1 
ATOM   401   C  CD    . GLN A 1 46  ? -6.371  25.313 -34.236 1.00 48.07  ? 85  GLN A CD    1 
ATOM   402   O  OE1   . GLN A 1 46  ? -5.502  26.150 -34.500 1.00 49.94  ? 85  GLN A OE1   1 
ATOM   403   N  NE2   . GLN A 1 46  ? -7.178  25.438 -33.178 1.00 49.20  ? 85  GLN A NE2   1 
ATOM   404   N  N     . SER A 1 47  ? -8.263  24.499 -39.290 1.00 36.53  ? 86  SER A N     1 
ATOM   405   C  CA    . SER A 1 47  ? -8.536  25.069 -40.619 1.00 37.34  ? 86  SER A CA    1 
ATOM   406   C  C     . SER A 1 47  ? -7.436  26.070 -41.040 1.00 38.21  ? 86  SER A C     1 
ATOM   407   O  O     . SER A 1 47  ? -6.893  26.008 -42.157 1.00 38.19  ? 86  SER A O     1 
ATOM   408   C  CB    . SER A 1 47  ? -9.888  25.783 -40.593 1.00 38.94  ? 86  SER A CB    1 
ATOM   409   O  OG    . SER A 1 47  ? -9.863  26.876 -39.682 1.00 41.02  ? 86  SER A OG    1 
ATOM   410   N  N     . SER A 1 48  ? -7.072  26.930 -40.047 1.00 38.18  ? 87  SER A N     1 
ATOM   411   C  CA    . SER A 1 48  ? -6.071  27.988 -40.069 1.00 37.71  ? 87  SER A CA    1 
ATOM   412   C  C     . SER A 1 48  ? -4.673  27.419 -40.258 1.00 36.16  ? 87  SER A C     1 
ATOM   413   O  O     . SER A 1 48  ? -3.924  28.000 -41.027 1.00 36.71  ? 87  SER A O     1 
ATOM   414   C  CB    . SER A 1 48  ? -6.134  28.791 -38.773 1.00 39.49  ? 87  SER A CB    1 
ATOM   415   O  OG    . SER A 1 48  ? -6.140  27.936 -37.639 1.00 42.56  ? 87  SER A OG    1 
ATOM   416   N  N     . ALA A 1 49  ? -4.318  26.306 -39.571 1.00 33.92  ? 88  ALA A N     1 
ATOM   417   C  CA    . ALA A 1 49  ? -3.007  25.651 -39.687 1.00 32.54  ? 88  ALA A CA    1 
ATOM   418   C  C     . ALA A 1 49  ? -2.753  25.185 -41.103 1.00 31.32  ? 88  ALA A C     1 
ATOM   419   O  O     . ALA A 1 49  ? -1.620  25.268 -41.573 1.00 31.28  ? 88  ALA A O     1 
ATOM   420   C  CB    . ALA A 1 49  ? -2.923  24.460 -38.754 1.00 32.30  ? 88  ALA A CB    1 
ATOM   421   N  N     . VAL A 1 50  ? -3.791  24.685 -41.785 1.00 30.30  ? 89  VAL A N     1 
ATOM   422   C  CA    . VAL A 1 50  ? -3.639  24.248 -43.168 1.00 29.96  ? 89  VAL A CA    1 
ATOM   423   C  C     . VAL A 1 50  ? -3.404  25.472 -44.050 1.00 30.27  ? 89  VAL A C     1 
ATOM   424   O  O     . VAL A 1 50  ? -2.496  25.462 -44.881 1.00 30.40  ? 89  VAL A O     1 
ATOM   425   C  CB    . VAL A 1 50  ? -4.832  23.398 -43.656 1.00 29.51  ? 89  VAL A CB    1 
ATOM   426   C  CG1   . VAL A 1 50  ? -4.730  23.100 -45.149 1.00 29.18  ? 89  VAL A CG1   1 
ATOM   427   C  CG2   . VAL A 1 50  ? -4.942  22.114 -42.848 1.00 29.81  ? 89  VAL A CG2   1 
ATOM   428   N  N     . MET A 1 51  ? -4.171  26.545 -43.825 1.00 29.92  ? 90  MET A N     1 
ATOM   429   C  CA    . MET A 1 51  ? -3.998  27.774 -44.584 1.00 30.33  ? 90  MET A CA    1 
ATOM   430   C  C     . MET A 1 51  ? -2.617  28.400 -44.370 1.00 29.00  ? 90  MET A C     1 
ATOM   431   O  O     . MET A 1 51  ? -1.977  28.806 -45.340 1.00 29.01  ? 90  MET A O     1 
ATOM   432   C  CB    . MET A 1 51  ? -5.151  28.743 -44.305 1.00 32.51  ? 90  MET A CB    1 
ATOM   433   C  CG    . MET A 1 51  ? -6.481  28.217 -44.831 1.00 38.23  ? 90  MET A CG    1 
ATOM   434   S  SD    . MET A 1 51  ? -6.441  27.774 -46.612 1.00 50.90  ? 90  MET A SD    1 
ATOM   435   C  CE    . MET A 1 51  ? -6.266  29.407 -47.315 1.00 46.54  ? 90  MET A CE    1 
ATOM   436   N  N     . ALA A 1 52  ? -2.109  28.358 -43.127 1.00 27.57  ? 91  ALA A N     1 
ATOM   437   C  CA    . ALA A 1 52  ? -0.764  28.797 -42.755 1.00 26.46  ? 91  ALA A CA    1 
ATOM   438   C  C     . ALA A 1 52  ? 0.278   27.986 -43.543 1.00 25.47  ? 91  ALA A C     1 
ATOM   439   O  O     . ALA A 1 52  ? 1.281   28.542 -43.984 1.00 25.87  ? 91  ALA A O     1 
ATOM   440   C  CB    . ALA A 1 52  ? -0.552  28.605 -41.267 1.00 26.47  ? 91  ALA A CB    1 
ATOM   441   N  N     . LEU A 1 53  ? 0.023   26.685 -43.750 1.00 23.78  ? 92  LEU A N     1 
ATOM   442   C  CA    . LEU A 1 53  ? 0.898   25.829 -44.525 1.00 22.75  ? 92  LEU A CA    1 
ATOM   443   C  C     . LEU A 1 53  ? 0.830   26.164 -46.009 1.00 21.45  ? 92  LEU A C     1 
ATOM   444   O  O     . LEU A 1 53  ? 1.857   26.139 -46.687 1.00 21.71  ? 92  LEU A O     1 
ATOM   445   C  CB    . LEU A 1 53  ? 0.490   24.373 -44.317 1.00 23.04  ? 92  LEU A CB    1 
ATOM   446   C  CG    . LEU A 1 53  ? 1.297   23.663 -43.285 1.00 24.46  ? 92  LEU A CG    1 
ATOM   447   C  CD1   . LEU A 1 53  ? 0.563   22.496 -42.734 1.00 24.48  ? 92  LEU A CD1   1 
ATOM   448   C  CD2   . LEU A 1 53  ? 2.620   23.280 -43.845 1.00 25.46  ? 92  LEU A CD2   1 
ATOM   449   N  N     . GLN A 1 54  ? -0.380  26.460 -46.521 1.00 19.56  ? 93  GLN A N     1 
ATOM   450   C  CA    . GLN A 1 54  ? -0.572  26.753 -47.928 1.00 18.15  ? 93  GLN A CA    1 
ATOM   451   C  C     . GLN A 1 54  ? 0.052   28.048 -48.330 1.00 17.78  ? 93  GLN A C     1 
ATOM   452   O  O     . GLN A 1 54  ? 0.697   28.115 -49.381 1.00 18.00  ? 93  GLN A O     1 
ATOM   453   C  CB    . GLN A 1 54  ? -2.044  26.729 -48.296 1.00 18.37  ? 93  GLN A CB    1 
ATOM   454   C  CG    . GLN A 1 54  ? -2.233  26.781 -49.799 1.00 19.70  ? 93  GLN A CG    1 
ATOM   455   C  CD    . GLN A 1 54  ? -3.638  26.465 -50.224 1.00 22.36  ? 93  GLN A CD    1 
ATOM   456   O  OE1   . GLN A 1 54  ? -4.599  26.506 -49.437 1.00 23.61  ? 93  GLN A OE1   1 
ATOM   457   N  NE2   . GLN A 1 54  ? -3.782  26.159 -51.496 1.00 21.98  ? 93  GLN A NE2   1 
ATOM   458   N  N     . GLU A 1 55  ? -0.096  29.083 -47.480 1.00 16.86  ? 94  GLU A N     1 
ATOM   459   C  CA    . GLU A 1 55  ? 0.483   30.391 -47.730 1.00 16.80  ? 94  GLU A CA    1 
ATOM   460   C  C     . GLU A 1 55  ? 2.001   30.282 -47.816 1.00 17.29  ? 94  GLU A C     1 
ATOM   461   O  O     . GLU A 1 55  ? 2.598   30.709 -48.806 1.00 17.22  ? 94  GLU A O     1 
ATOM   462   C  CB    . GLU A 1 55  ? 0.079   31.362 -46.624 1.00 18.34  ? 94  GLU A CB    1 
ATOM   463   C  CG    . GLU A 1 55  ? -1.377  31.756 -46.676 1.00 22.23  ? 94  GLU A CG    1 
ATOM   464   C  CD    . GLU A 1 55  ? -1.754  32.810 -47.697 1.00 27.05  ? 94  GLU A CD    1 
ATOM   465   O  OE1   . GLU A 1 55  ? -2.948  33.187 -47.703 1.00 28.71  ? 94  GLU A OE1   1 
ATOM   466   O  OE2   . GLU A 1 55  ? -0.874  33.293 -48.451 1.00 26.77  ? 94  GLU A OE2   1 
ATOM   467   N  N     . ALA A 1 56  ? 2.593   29.599 -46.820 1.00 17.64  ? 95  ALA A N     1 
ATOM   468   C  CA    . ALA A 1 56  ? 4.019   29.344 -46.679 1.00 18.20  ? 95  ALA A CA    1 
ATOM   469   C  C     . ALA A 1 56  ? 4.606   28.675 -47.924 1.00 19.04  ? 95  ALA A C     1 
ATOM   470   O  O     . ALA A 1 56  ? 5.695   29.054 -48.376 1.00 19.06  ? 95  ALA A O     1 
ATOM   471   C  CB    . ALA A 1 56  ? 4.253   28.464 -45.452 1.00 17.91  ? 95  ALA A CB    1 
ATOM   472   N  N     . CYS A 1 57  ? 3.868   27.690 -48.474 1.00 19.69  ? 96  CYS A N     1 
ATOM   473   C  CA    . CYS A 1 57  ? 4.261   26.868 -49.612 1.00 20.75  ? 96  CYS A CA    1 
ATOM   474   C  C     . CYS A 1 57  ? 4.305   27.648 -50.869 1.00 20.86  ? 96  CYS A C     1 
ATOM   475   O  O     . CYS A 1 57  ? 5.284   27.570 -51.619 1.00 20.60  ? 96  CYS A O     1 
ATOM   476   C  CB    . CYS A 1 57  ? 3.340   25.662 -49.749 1.00 22.02  ? 96  CYS A CB    1 
ATOM   477   S  SG    . CYS A 1 57  ? 3.850   24.241 -48.761 1.00 29.75  ? 96  CYS A SG    1 
ATOM   478   N  N     . GLU A 1 58  ? 3.227   28.388 -51.120 1.00 20.97  ? 97  GLU A N     1 
ATOM   479   C  CA    . GLU A 1 58  ? 3.115   29.155 -52.336 1.00 21.86  ? 97  GLU A CA    1 
ATOM   480   C  C     . GLU A 1 58  ? 4.132   30.293 -52.327 1.00 21.28  ? 97  GLU A C     1 
ATOM   481   O  O     . GLU A 1 58  ? 4.940   30.402 -53.254 1.00 21.57  ? 97  GLU A O     1 
ATOM   482   C  CB    . GLU A 1 58  ? 1.684   29.638 -52.512 1.00 25.47  ? 97  GLU A CB    1 
ATOM   483   C  CG    . GLU A 1 58  ? 0.729   28.469 -52.539 1.00 33.81  ? 97  GLU A CG    1 
ATOM   484   C  CD    . GLU A 1 58  ? -0.598  28.765 -53.196 1.00 45.13  ? 97  GLU A CD    1 
ATOM   485   O  OE1   . GLU A 1 58  ? -0.653  29.725 -54.001 1.00 46.78  ? 97  GLU A OE1   1 
ATOM   486   O  OE2   . GLU A 1 58  ? -1.585  28.044 -52.910 1.00 48.49  ? 97  GLU A OE2   1 
ATOM   487   N  N     . ALA A 1 59  ? 4.216   31.032 -51.208 1.00 19.75  ? 98  ALA A N     1 
ATOM   488   C  CA    . ALA A 1 59  ? 5.174   32.108 -51.071 1.00 19.09  ? 98  ALA A CA    1 
ATOM   489   C  C     . ALA A 1 59  ? 6.605   31.617 -51.310 1.00 19.88  ? 98  ALA A C     1 
ATOM   490   O  O     . ALA A 1 59  ? 7.377   32.301 -51.982 1.00 21.14  ? 98  ALA A O     1 
ATOM   491   C  CB    . ALA A 1 59  ? 5.045   32.733 -49.701 1.00 18.41  ? 98  ALA A CB    1 
ATOM   492   N  N     . TYR A 1 60  ? 6.916   30.406 -50.828 1.00 19.28  ? 99  TYR A N     1 
ATOM   493   C  CA    . TYR A 1 60  ? 8.219   29.776 -51.008 1.00 19.56  ? 99  TYR A CA    1 
ATOM   494   C  C     . TYR A 1 60  ? 8.461   29.483 -52.480 1.00 19.45  ? 99  TYR A C     1 
ATOM   495   O  O     . TYR A 1 60  ? 9.537   29.817 -52.978 1.00 19.57  ? 99  TYR A O     1 
ATOM   496   C  CB    . TYR A 1 60  ? 8.343   28.464 -50.171 1.00 19.37  ? 99  TYR A CB    1 
ATOM   497   C  CG    . TYR A 1 60  ? 9.468   27.551 -50.624 1.00 20.00  ? 99  TYR A CG    1 
ATOM   498   C  CD1   . TYR A 1 60  ? 10.795  27.937 -50.502 1.00 20.99  ? 99  TYR A CD1   1 
ATOM   499   C  CD2   . TYR A 1 60  ? 9.201   26.319 -51.205 1.00 20.94  ? 99  TYR A CD2   1 
ATOM   500   C  CE1   . TYR A 1 60  ? 11.829  27.117 -50.944 1.00 21.92  ? 99  TYR A CE1   1 
ATOM   501   C  CE2   . TYR A 1 60  ? 10.227  25.489 -51.647 1.00 21.61  ? 99  TYR A CE2   1 
ATOM   502   C  CZ    . TYR A 1 60  ? 11.540  25.901 -51.534 1.00 22.66  ? 99  TYR A CZ    1 
ATOM   503   O  OH    . TYR A 1 60  ? 12.563  25.108 -51.993 1.00 24.39  ? 99  TYR A OH    1 
ATOM   504   N  N     . LEU A 1 61  ? 7.488   28.797 -53.140 1.00 18.70  ? 100 LEU A N     1 
ATOM   505   C  CA    . LEU A 1 61  ? 7.562   28.341 -54.524 1.00 18.43  ? 100 LEU A CA    1 
ATOM   506   C  C     . LEU A 1 61  ? 7.643   29.456 -55.510 1.00 19.65  ? 100 LEU A C     1 
ATOM   507   O  O     . LEU A 1 61  ? 8.387   29.346 -56.476 1.00 20.17  ? 100 LEU A O     1 
ATOM   508   C  CB    . LEU A 1 61  ? 6.402   27.418 -54.854 1.00 17.93  ? 100 LEU A CB    1 
ATOM   509   C  CG    . LEU A 1 61  ? 6.501   25.992 -54.290 1.00 18.16  ? 100 LEU A CG    1 
ATOM   510   C  CD1   . LEU A 1 61  ? 5.284   25.228 -54.620 1.00 18.67  ? 100 LEU A CD1   1 
ATOM   511   C  CD2   . LEU A 1 61  ? 7.721   25.254 -54.836 1.00 17.80  ? 100 LEU A CD2   1 
ATOM   512   N  N     . VAL A 1 62  ? 6.935   30.559 -55.247 1.00 19.85  ? 101 VAL A N     1 
ATOM   513   C  CA    . VAL A 1 62  ? 6.977   31.750 -56.087 1.00 20.11  ? 101 VAL A CA    1 
ATOM   514   C  C     . VAL A 1 62  ? 8.367   32.387 -55.994 1.00 22.17  ? 101 VAL A C     1 
ATOM   515   O  O     . VAL A 1 62  ? 8.949   32.750 -57.013 1.00 23.13  ? 101 VAL A O     1 
ATOM   516   C  CB    . VAL A 1 62  ? 5.882   32.741 -55.695 1.00 19.46  ? 101 VAL A CB    1 
ATOM   517   C  CG1   . VAL A 1 62  ? 6.042   34.029 -56.472 1.00 19.84  ? 101 VAL A CG1   1 
ATOM   518   C  CG2   . VAL A 1 62  ? 4.502   32.155 -55.930 1.00 19.31  ? 101 VAL A CG2   1 
ATOM   519   N  N     . GLY A 1 63  ? 8.912   32.464 -54.786 1.00 22.74  ? 102 GLY A N     1 
ATOM   520   C  CA    . GLY A 1 63  ? 10.264  32.957 -54.566 1.00 23.89  ? 102 GLY A CA    1 
ATOM   521   C  C     . GLY A 1 63  ? 11.303  32.050 -55.201 1.00 25.07  ? 102 GLY A C     1 
ATOM   522   O  O     . GLY A 1 63  ? 12.325  32.519 -55.699 1.00 24.85  ? 102 GLY A O     1 
ATOM   523   N  N     . LEU A 1 64  ? 11.049  30.736 -55.190 1.00 26.16  ? 103 LEU A N     1 
ATOM   524   C  CA    . LEU A 1 64  ? 11.925  29.762 -55.823 1.00 27.21  ? 103 LEU A CA    1 
ATOM   525   C  C     . LEU A 1 64  ? 11.859  29.943 -57.328 1.00 28.40  ? 103 LEU A C     1 
ATOM   526   O  O     . LEU A 1 64  ? 12.898  29.849 -57.978 1.00 29.27  ? 103 LEU A O     1 
ATOM   527   C  CB    . LEU A 1 64  ? 11.543  28.337 -55.446 1.00 27.35  ? 103 LEU A CB    1 
ATOM   528   C  CG    . LEU A 1 64  ? 12.455  27.232 -56.007 1.00 29.27  ? 103 LEU A CG    1 
ATOM   529   C  CD1   . LEU A 1 64  ? 13.917  27.434 -55.608 1.00 29.97  ? 103 LEU A CD1   1 
ATOM   530   C  CD2   . LEU A 1 64  ? 11.993  25.869 -55.558 1.00 29.82  ? 103 LEU A CD2   1 
ATOM   531   N  N     . PHE A 1 65  ? 10.664  30.251 -57.885 1.00 28.25  ? 104 PHE A N     1 
ATOM   532   C  CA    . PHE A 1 65  ? 10.522  30.505 -59.307 1.00 28.87  ? 104 PHE A CA    1 
ATOM   533   C  C     . PHE A 1 65  ? 11.299  31.738 -59.703 1.00 30.38  ? 104 PHE A C     1 
ATOM   534   O  O     . PHE A 1 65  ? 12.054  31.683 -60.670 1.00 31.11  ? 104 PHE A O     1 
ATOM   535   C  CB    . PHE A 1 65  ? 9.058   30.573 -59.730 1.00 28.60  ? 104 PHE A CB    1 
ATOM   536   C  CG    . PHE A 1 65  ? 8.501   29.184 -59.917 1.00 29.84  ? 104 PHE A CG    1 
ATOM   537   C  CD1   . PHE A 1 65  ? 9.246   28.195 -60.554 1.00 30.52  ? 104 PHE A CD1   1 
ATOM   538   C  CD2   . PHE A 1 65  ? 7.247   28.847 -59.427 1.00 30.60  ? 104 PHE A CD2   1 
ATOM   539   C  CE1   . PHE A 1 65  ? 8.744   26.912 -60.699 1.00 30.72  ? 104 PHE A CE1   1 
ATOM   540   C  CE2   . PHE A 1 65  ? 6.746   27.561 -59.581 1.00 30.72  ? 104 PHE A CE2   1 
ATOM   541   C  CZ    . PHE A 1 65  ? 7.493   26.607 -60.223 1.00 30.42  ? 104 PHE A CZ    1 
ATOM   542   N  N     . GLU A 1 66  ? 11.242  32.805 -58.879 1.00 30.08  ? 105 GLU A N     1 
ATOM   543   C  CA    . GLU A 1 66  ? 12.006  34.030 -59.088 1.00 30.35  ? 105 GLU A CA    1 
ATOM   544   C  C     . GLU A 1 66  ? 13.505  33.734 -59.296 1.00 30.52  ? 105 GLU A C     1 
ATOM   545   O  O     . GLU A 1 66  ? 14.055  34.096 -60.328 1.00 30.51  ? 105 GLU A O     1 
ATOM   546   C  CB    . GLU A 1 66  ? 11.795  35.010 -57.911 1.00 32.06  ? 105 GLU A CB    1 
ATOM   547   C  CG    . GLU A 1 66  ? 10.411  35.631 -57.881 1.00 35.44  ? 105 GLU A CG    1 
ATOM   548   C  CD    . GLU A 1 66  ? 10.108  36.476 -56.660 1.00 38.94  ? 105 GLU A CD    1 
ATOM   549   O  OE1   . GLU A 1 66  ? 11.070  36.887 -55.975 1.00 39.66  ? 105 GLU A OE1   1 
ATOM   550   O  OE2   . GLU A 1 66  ? 8.912   36.727 -56.385 1.00 40.31  ? 105 GLU A OE2   1 
ATOM   551   N  N     . ASP A 1 67  ? 14.122  32.996 -58.368 1.00 30.66  ? 106 ASP A N     1 
ATOM   552   C  CA    . ASP A 1 67  ? 15.532  32.663 -58.472 1.00 31.64  ? 106 ASP A CA    1 
ATOM   553   C  C     . ASP A 1 67  ? 15.785  31.726 -59.630 1.00 32.91  ? 106 ASP A C     1 
ATOM   554   O  O     . ASP A 1 67  ? 16.805  31.853 -60.297 1.00 33.20  ? 106 ASP A O     1 
ATOM   555   C  CB    . ASP A 1 67  ? 16.055  32.046 -57.168 1.00 33.46  ? 106 ASP A CB    1 
ATOM   556   C  CG    . ASP A 1 67  ? 15.852  32.880 -55.920 1.00 38.79  ? 106 ASP A CG    1 
ATOM   557   O  OD1   . ASP A 1 67  ? 15.896  34.128 -56.018 1.00 40.73  ? 106 ASP A OD1   1 
ATOM   558   O  OD2   . ASP A 1 67  ? 15.658  32.293 -54.850 1.00 40.68  ? 106 ASP A OD2   1 
ATOM   559   N  N     . THR A 1 68  ? 14.868  30.788 -59.881 1.00 33.68  ? 107 THR A N     1 
ATOM   560   C  CA    . THR A 1 68  ? 15.006  29.822 -60.965 1.00 35.11  ? 107 THR A CA    1 
ATOM   561   C  C     . THR A 1 68  ? 15.065  30.531 -62.312 1.00 36.06  ? 107 THR A C     1 
ATOM   562   O  O     . THR A 1 68  ? 15.916  30.213 -63.149 1.00 36.22  ? 107 THR A O     1 
ATOM   563   C  CB    . THR A 1 68  ? 13.842  28.825 -60.929 1.00 37.04  ? 107 THR A CB    1 
ATOM   564   O  OG1   . THR A 1 68  ? 13.784  28.243 -59.635 1.00 38.86  ? 107 THR A OG1   1 
ATOM   565   C  CG2   . THR A 1 68  ? 13.985  27.729 -61.953 1.00 37.27  ? 107 THR A CG2   1 
ATOM   566   N  N     . ASN A 1 69  ? 14.185  31.530 -62.493 1.00 36.12  ? 108 ASN A N     1 
ATOM   567   C  CA    . ASN A 1 69  ? 14.071  32.322 -63.709 1.00 36.30  ? 108 ASN A CA    1 
ATOM   568   C  C     . ASN A 1 69  ? 15.357  33.103 -63.939 1.00 36.07  ? 108 ASN A C     1 
ATOM   569   O  O     . ASN A 1 69  ? 15.840  33.132 -65.056 1.00 35.76  ? 108 ASN A O     1 
ATOM   570   C  CB    . ASN A 1 69  ? 12.847  33.227 -63.624 1.00 37.63  ? 108 ASN A CB    1 
ATOM   571   C  CG    . ASN A 1 69  ? 12.259  33.638 -64.950 1.00 41.06  ? 108 ASN A CG    1 
ATOM   572   O  OD1   . ASN A 1 69  ? 11.731  32.832 -65.726 1.00 41.38  ? 108 ASN A OD1   1 
ATOM   573   N  ND2   . ASN A 1 69  ? 12.298  34.933 -65.212 1.00 42.78  ? 108 ASN A ND2   1 
ATOM   574   N  N     . LEU A 1 70  ? 15.956  33.645 -62.873 1.00 36.24  ? 109 LEU A N     1 
ATOM   575   C  CA    . LEU A 1 70  ? 17.230  34.348 -62.924 1.00 37.24  ? 109 LEU A CA    1 
ATOM   576   C  C     . LEU A 1 70  ? 18.366  33.416 -63.371 1.00 38.70  ? 109 LEU A C     1 
ATOM   577   O  O     . LEU A 1 70  ? 19.339  33.872 -63.959 1.00 38.95  ? 109 LEU A O     1 
ATOM   578   C  CB    . LEU A 1 70  ? 17.564  34.926 -61.537 1.00 37.30  ? 109 LEU A CB    1 
ATOM   579   C  CG    . LEU A 1 70  ? 17.053  36.323 -61.122 1.00 38.50  ? 109 LEU A CG    1 
ATOM   580   C  CD1   . LEU A 1 70  ? 17.975  37.453 -61.601 1.00 38.72  ? 109 LEU A CD1   1 
ATOM   581   C  CD2   . LEU A 1 70  ? 15.586  36.590 -61.426 1.00 39.12  ? 109 LEU A CD2   1 
ATOM   582   N  N     . CYS A 1 71  ? 18.251  32.120 -63.082 1.00 39.86  ? 110 CYS A N     1 
ATOM   583   C  CA    . CYS A 1 71  ? 19.224  31.113 -63.490 1.00 42.03  ? 110 CYS A CA    1 
ATOM   584   C  C     . CYS A 1 71  ? 19.038  30.758 -64.977 1.00 43.62  ? 110 CYS A C     1 
ATOM   585   O  O     . CYS A 1 71  ? 20.022  30.538 -65.688 1.00 43.54  ? 110 CYS A O     1 
ATOM   586   C  CB    . CYS A 1 71  ? 19.112  29.874 -62.608 1.00 42.96  ? 110 CYS A CB    1 
ATOM   587   S  SG    . CYS A 1 71  ? 19.362  30.207 -60.855 1.00 46.25  ? 110 CYS A SG    1 
ATOM   588   N  N     . ALA A 1 72  ? 17.781  30.712 -65.460 1.00 44.45  ? 111 ALA A N     1 
ATOM   589   C  CA    . ALA A 1 72  ? 17.511  30.453 -66.867 1.00 45.10  ? 111 ALA A CA    1 
ATOM   590   C  C     . ALA A 1 72  ? 18.050  31.674 -67.668 1.00 46.32  ? 111 ALA A C     1 
ATOM   591   O  O     . ALA A 1 72  ? 18.874  31.499 -68.563 1.00 47.00  ? 111 ALA A O     1 
ATOM   592   C  CB    . ALA A 1 72  ? 16.013  30.259 -67.084 1.00 44.76  ? 111 ALA A CB    1 
ATOM   593   N  N     . ILE A 1 73  ? 17.723  32.901 -67.237 1.00 46.41  ? 112 ILE A N     1 
ATOM   594   C  CA    . ILE A 1 73  ? 18.219  34.101 -67.896 1.00 47.02  ? 112 ILE A CA    1 
ATOM   595   C  C     . ILE A 1 73  ? 19.746  34.170 -67.853 1.00 47.94  ? 112 ILE A C     1 
ATOM   596   O  O     . ILE A 1 73  ? 20.354  34.661 -68.799 1.00 47.92  ? 112 ILE A O     1 
ATOM   597   C  CB    . ILE A 1 73  ? 17.553  35.351 -67.287 1.00 47.70  ? 112 ILE A CB    1 
ATOM   598   C  CG1   . ILE A 1 73  ? 16.027  35.252 -67.388 1.00 48.71  ? 112 ILE A CG1   1 
ATOM   599   C  CG2   . ILE A 1 73  ? 18.051  36.629 -67.940 1.00 48.21  ? 112 ILE A CG2   1 
ATOM   600   C  CD1   . ILE A 1 73  ? 15.274  36.345 -66.643 1.00 50.17  ? 112 ILE A CD1   1 
ATOM   601   N  N     . HIS A 1 74  ? 20.370  33.647 -66.789 1.00 48.68  ? 113 HIS A N     1 
ATOM   602   C  CA    . HIS A 1 74  ? 21.823  33.658 -66.672 1.00 50.20  ? 113 HIS A CA    1 
ATOM   603   C  C     . HIS A 1 74  ? 22.476  32.825 -67.768 1.00 52.26  ? 113 HIS A C     1 
ATOM   604   O  O     . HIS A 1 74  ? 23.528  33.209 -68.293 1.00 52.44  ? 113 HIS A O     1 
ATOM   605   C  CB    . HIS A 1 74  ? 22.272  33.152 -65.301 1.00 50.63  ? 113 HIS A CB    1 
ATOM   606   C  CG    . HIS A 1 74  ? 23.750  33.242 -65.120 1.00 52.46  ? 113 HIS A CG    1 
ATOM   607   N  ND1   . HIS A 1 74  ? 24.361  34.436 -64.798 1.00 54.36  ? 113 HIS A ND1   1 
ATOM   608   C  CD2   . HIS A 1 74  ? 24.702  32.298 -65.293 1.00 53.51  ? 113 HIS A CD2   1 
ATOM   609   C  CE1   . HIS A 1 74  ? 25.658  34.176 -64.750 1.00 54.86  ? 113 HIS A CE1   1 
ATOM   610   N  NE2   . HIS A 1 74  ? 25.909  32.903 -65.041 1.00 54.74  ? 113 HIS A NE2   1 
ATOM   611   N  N     . ALA A 1 75  ? 21.855  31.669 -68.098 1.00 53.45  ? 114 ALA A N     1 
ATOM   612   C  CA    . ALA A 1 75  ? 22.341  30.753 -69.137 1.00 54.54  ? 114 ALA A CA    1 
ATOM   613   C  C     . ALA A 1 75  ? 21.637  31.012 -70.472 1.00 55.36  ? 114 ALA A C     1 
ATOM   614   O  O     . ALA A 1 75  ? 21.320  30.078 -71.198 1.00 55.41  ? 114 ALA A O     1 
ATOM   615   C  CB    . ALA A 1 75  ? 22.159  29.301 -68.704 1.00 54.70  ? 114 ALA A CB    1 
ATOM   616   N  N     . LYS A 1 76  ? 21.387  32.299 -70.777 1.00 56.11  ? 115 LYS A N     1 
ATOM   617   C  CA    . LYS A 1 76  ? 20.804  32.802 -72.022 1.00 57.18  ? 115 LYS A CA    1 
ATOM   618   C  C     . LYS A 1 76  ? 19.491  32.115 -72.417 1.00 57.62  ? 115 LYS A C     1 
ATOM   619   O  O     . LYS A 1 76  ? 19.263  31.867 -73.599 1.00 58.18  ? 115 LYS A O     1 
ATOM   620   C  CB    . LYS A 1 76  ? 21.833  32.740 -73.182 1.00 59.47  ? 115 LYS A CB    1 
ATOM   621   C  CG    . LYS A 1 76  ? 23.285  33.140 -72.844 1.00 63.60  ? 115 LYS A CG    1 
ATOM   622   C  CD    . LYS A 1 76  ? 24.222  31.921 -72.511 1.00 67.73  ? 115 LYS A CD    1 
ATOM   623   C  CE    . LYS A 1 76  ? 24.308  30.810 -73.552 1.00 70.69  ? 115 LYS A CE    1 
ATOM   624   N  NZ    . LYS A 1 76  ? 24.948  29.567 -73.016 1.00 72.10  ? 115 LYS A NZ    1 
ATOM   625   N  N     . ARG A 1 77  ? 18.631  31.800 -71.445 1.00 57.28  ? 116 ARG A N     1 
ATOM   626   C  CA    . ARG A 1 77  ? 17.358  31.131 -71.735 1.00 57.54  ? 116 ARG A CA    1 
ATOM   627   C  C     . ARG A 1 77  ? 16.156  31.915 -71.229 1.00 58.27  ? 116 ARG A C     1 
ATOM   628   O  O     . ARG A 1 77  ? 16.307  32.872 -70.483 1.00 58.41  ? 116 ARG A O     1 
ATOM   629   C  CB    . ARG A 1 77  ? 17.341  29.691 -71.190 1.00 57.93  ? 116 ARG A CB    1 
ATOM   630   C  CG    . ARG A 1 77  ? 18.242  28.756 -71.956 1.00 59.80  ? 116 ARG A CG    1 
ATOM   631   C  CD    . ARG A 1 77  ? 18.154  27.341 -71.425 1.00 61.94  ? 116 ARG A CD    1 
ATOM   632   N  NE    . ARG A 1 77  ? 19.003  27.132 -70.252 1.00 62.94  ? 116 ARG A NE    1 
ATOM   633   C  CZ    . ARG A 1 77  ? 18.546  26.962 -69.016 1.00 63.23  ? 116 ARG A CZ    1 
ATOM   634   N  NH1   . ARG A 1 77  ? 17.237  26.984 -68.774 1.00 61.72  ? 116 ARG A NH1   1 
ATOM   635   N  NH2   . ARG A 1 77  ? 19.391  26.778 -68.011 1.00 62.60  ? 116 ARG A NH2   1 
ATOM   636   N  N     . VAL A 1 78  ? 14.967  31.529 -71.673 1.00 58.84  ? 117 VAL A N     1 
ATOM   637   C  CA    . VAL A 1 78  ? 13.696  32.139 -71.279 1.00 60.12  ? 117 VAL A CA    1 
ATOM   638   C  C     . VAL A 1 78  ? 12.798  31.115 -70.538 1.00 60.49  ? 117 VAL A C     1 
ATOM   639   O  O     . VAL A 1 78  ? 11.896  31.510 -69.781 1.00 60.58  ? 117 VAL A O     1 
ATOM   640   C  CB    . VAL A 1 78  ? 12.985  32.746 -72.520 1.00 61.63  ? 117 VAL A CB    1 
ATOM   641   C  CG1   . VAL A 1 78  ? 11.550  33.168 -72.204 1.00 62.57  ? 117 VAL A CG1   1 
ATOM   642   C  CG2   . VAL A 1 78  ? 13.786  33.908 -73.105 1.00 62.08  ? 117 VAL A CG2   1 
ATOM   643   N  N     . THR A 1 79  ? 13.065  29.798 -70.750 1.00 60.34  ? 118 THR A N     1 
ATOM   644   C  CA    . THR A 1 79  ? 12.351  28.700 -70.117 1.00 60.70  ? 118 THR A CA    1 
ATOM   645   C  C     . THR A 1 79  ? 13.164  28.054 -68.971 1.00 60.50  ? 118 THR A C     1 
ATOM   646   O  O     . THR A 1 79  ? 14.355  27.718 -69.117 1.00 60.55  ? 118 THR A O     1 
ATOM   647   C  CB    . THR A 1 79  ? 11.850  27.677 -71.149 1.00 62.44  ? 118 THR A CB    1 
ATOM   648   O  OG1   . THR A 1 79  ? 11.307  26.517 -70.476 1.00 63.31  ? 118 THR A OG1   1 
ATOM   649   C  CG2   . THR A 1 79  ? 12.926  27.296 -72.171 1.00 63.10  ? 118 THR A CG2   1 
ATOM   650   N  N     . ILE A 1 80  ? 12.473  27.892 -67.823 1.00 59.85  ? 119 ILE A N     1 
ATOM   651   C  CA    . ILE A 1 80  ? 12.997  27.314 -66.593 1.00 59.39  ? 119 ILE A CA    1 
ATOM   652   C  C     . ILE A 1 80  ? 13.132  25.797 -66.746 1.00 59.54  ? 119 ILE A C     1 
ATOM   653   O  O     . ILE A 1 80  ? 12.234  25.126 -67.254 1.00 59.81  ? 119 ILE A O     1 
ATOM   654   C  CB    . ILE A 1 80  ? 12.114  27.727 -65.386 1.00 59.29  ? 119 ILE A CB    1 
ATOM   655   C  CG1   . ILE A 1 80  ? 10.641  27.354 -65.615 1.00 59.81  ? 119 ILE A CG1   1 
ATOM   656   C  CG2   . ILE A 1 80  ? 12.250  29.217 -65.117 1.00 59.61  ? 119 ILE A CG2   1 
ATOM   657   C  CD1   . ILE A 1 80  ? 9.793   27.453 -64.405 1.00 60.73  ? 119 ILE A CD1   1 
ATOM   658   N  N     . MET A 1 81  ? 14.287  25.273 -66.371 1.00 58.94  ? 120 MET A N     1 
ATOM   659   C  CA    . MET A 1 81  ? 14.593  23.854 -66.494 1.00 58.78  ? 120 MET A CA    1 
ATOM   660   C  C     . MET A 1 81  ? 14.970  23.285 -65.134 1.00 57.99  ? 120 MET A C     1 
ATOM   661   O  O     . MET A 1 81  ? 15.409  24.044 -64.279 1.00 58.18  ? 120 MET A O     1 
ATOM   662   C  CB    . MET A 1 81  ? 15.781  23.682 -67.456 1.00 59.92  ? 120 MET A CB    1 
ATOM   663   C  CG    . MET A 1 81  ? 15.418  23.855 -68.909 1.00 62.54  ? 120 MET A CG    1 
ATOM   664   S  SD    . MET A 1 81  ? 16.891  23.656 -69.932 1.00 67.81  ? 120 MET A SD    1 
ATOM   665   C  CE    . MET A 1 81  ? 16.143  23.653 -71.540 1.00 67.95  ? 120 MET A CE    1 
ATOM   666   N  N     . PRO A 1 82  ? 14.867  21.959 -64.900 1.00 57.02  ? 121 PRO A N     1 
ATOM   667   C  CA    . PRO A 1 82  ? 15.268  21.416 -63.593 1.00 56.11  ? 121 PRO A CA    1 
ATOM   668   C  C     . PRO A 1 82  ? 16.677  21.824 -63.135 1.00 54.52  ? 121 PRO A C     1 
ATOM   669   O  O     . PRO A 1 82  ? 16.858  22.105 -61.955 1.00 54.64  ? 121 PRO A O     1 
ATOM   670   C  CB    . PRO A 1 82  ? 15.127  19.903 -63.791 1.00 57.02  ? 121 PRO A CB    1 
ATOM   671   C  CG    . PRO A 1 82  ? 14.062  19.773 -64.811 1.00 57.64  ? 121 PRO A CG    1 
ATOM   672   C  CD    . PRO A 1 82  ? 14.350  20.890 -65.777 1.00 56.43  ? 121 PRO A CD    1 
ATOM   673   N  N     . LYS A 1 83  ? 17.642  21.950 -64.061 1.00 52.84  ? 122 LYS A N     1 
ATOM   674   C  CA    . LYS A 1 83  ? 18.997  22.369 -63.697 1.00 51.78  ? 122 LYS A CA    1 
ATOM   675   C  C     . LYS A 1 83  ? 19.068  23.806 -63.132 1.00 49.57  ? 122 LYS A C     1 
ATOM   676   O  O     . LYS A 1 83  ? 20.039  24.154 -62.462 1.00 49.89  ? 122 LYS A O     1 
ATOM   677   C  CB    . LYS A 1 83  ? 19.975  22.169 -64.865 1.00 54.67  ? 122 LYS A CB    1 
ATOM   678   C  CG    . LYS A 1 83  ? 19.604  22.890 -66.167 1.00 59.72  ? 122 LYS A CG    1 
ATOM   679   C  CD    . LYS A 1 83  ? 20.607  22.508 -67.256 1.00 64.47  ? 122 LYS A CD    1 
ATOM   680   C  CE    . LYS A 1 83  ? 20.714  23.523 -68.364 1.00 68.04  ? 122 LYS A CE    1 
ATOM   681   N  NZ    . LYS A 1 83  ? 22.019  23.417 -69.081 1.00 70.18  ? 122 LYS A NZ    1 
ATOM   682   N  N     . ASP A 1 84  ? 18.034  24.619 -63.373 1.00 47.24  ? 123 ASP A N     1 
ATOM   683   C  CA    . ASP A 1 84  ? 17.929  25.970 -62.842 1.00 45.79  ? 123 ASP A CA    1 
ATOM   684   C  C     . ASP A 1 84  ? 17.353  25.881 -61.430 1.00 44.19  ? 123 ASP A C     1 
ATOM   685   O  O     . ASP A 1 84  ? 17.888  26.523 -60.532 1.00 44.72  ? 123 ASP A O     1 
ATOM   686   C  CB    . ASP A 1 84  ? 17.032  26.856 -63.721 1.00 46.86  ? 123 ASP A CB    1 
ATOM   687   C  CG    . ASP A 1 84  ? 17.470  26.963 -65.163 1.00 50.28  ? 123 ASP A CG    1 
ATOM   688   O  OD1   . ASP A 1 84  ? 18.693  27.074 -65.403 1.00 50.73  ? 123 ASP A OD1   1 
ATOM   689   O  OD2   . ASP A 1 84  ? 16.585  26.956 -66.056 1.00 51.74  ? 123 ASP A OD2   1 
ATOM   690   N  N     . ILE A 1 85  ? 16.300  25.053 -61.209 1.00 41.97  ? 124 ILE A N     1 
ATOM   691   C  CA    . ILE A 1 85  ? 15.721  24.853 -59.872 1.00 40.37  ? 124 ILE A CA    1 
ATOM   692   C  C     . ILE A 1 85  ? 16.795  24.312 -58.923 1.00 39.66  ? 124 ILE A C     1 
ATOM   693   O  O     . ILE A 1 85  ? 16.916  24.771 -57.788 1.00 39.88  ? 124 ILE A O     1 
ATOM   694   C  CB    . ILE A 1 85  ? 14.497  23.902 -59.886 1.00 39.96  ? 124 ILE A CB    1 
ATOM   695   C  CG1   . ILE A 1 85  ? 13.360  24.444 -60.769 1.00 40.32  ? 124 ILE A CG1   1 
ATOM   696   C  CG2   . ILE A 1 85  ? 14.021  23.627 -58.456 1.00 40.33  ? 124 ILE A CG2   1 
ATOM   697   C  CD1   . ILE A 1 85  ? 11.949  23.769 -60.605 1.00 41.01  ? 124 ILE A CD1   1 
ATOM   698   N  N     . GLN A 1 86  ? 17.602  23.366 -59.418 1.00 38.75  ? 125 GLN A N     1 
ATOM   699   C  CA    . GLN A 1 86  ? 18.695  22.742 -58.677 1.00 38.14  ? 125 GLN A CA    1 
ATOM   700   C  C     . GLN A 1 86  ? 19.774  23.745 -58.331 1.00 36.66  ? 125 GLN A C     1 
ATOM   701   O  O     . GLN A 1 86  ? 20.252  23.738 -57.199 1.00 36.95  ? 125 GLN A O     1 
ATOM   702   C  CB    . GLN A 1 86  ? 19.299  21.580 -59.479 1.00 40.22  ? 125 GLN A CB    1 
ATOM   703   C  CG    . GLN A 1 86  ? 18.415  20.333 -59.547 1.00 43.55  ? 125 GLN A CG    1 
ATOM   704   C  CD    . GLN A 1 86  ? 18.776  19.475 -60.739 1.00 47.03  ? 125 GLN A CD    1 
ATOM   705   O  OE1   . GLN A 1 86  ? 19.934  19.429 -61.189 1.00 48.15  ? 125 GLN A OE1   1 
ATOM   706   N  NE2   . GLN A 1 86  ? 17.782  18.780 -61.279 1.00 47.03  ? 125 GLN A NE2   1 
ATOM   707   N  N     . LEU A 1 87  ? 20.160  24.606 -59.287 1.00 35.02  ? 126 LEU A N     1 
ATOM   708   C  CA    . LEU A 1 87  ? 21.181  25.606 -59.020 1.00 34.22  ? 126 LEU A CA    1 
ATOM   709   C  C     . LEU A 1 87  ? 20.661  26.620 -57.993 1.00 35.09  ? 126 LEU A C     1 
ATOM   710   O  O     . LEU A 1 87  ? 21.395  26.998 -57.063 1.00 36.28  ? 126 LEU A O     1 
ATOM   711   C  CB    . LEU A 1 87  ? 21.616  26.307 -60.306 1.00 33.18  ? 126 LEU A CB    1 
ATOM   712   C  CG    . LEU A 1 87  ? 22.705  27.360 -60.131 1.00 33.02  ? 126 LEU A CG    1 
ATOM   713   C  CD1   . LEU A 1 87  ? 24.005  26.759 -59.660 1.00 32.26  ? 126 LEU A CD1   1 
ATOM   714   C  CD2   . LEU A 1 87  ? 22.903  28.131 -61.391 1.00 34.04  ? 126 LEU A CD2   1 
ATOM   715   N  N     . ALA A 1 88  ? 19.384  27.029 -58.123 1.00 33.95  ? 127 ALA A N     1 
ATOM   716   C  CA    . ALA A 1 88  ? 18.802  27.970 -57.174 1.00 33.43  ? 127 ALA A CA    1 
ATOM   717   C  C     . ALA A 1 88  ? 18.785  27.389 -55.753 1.00 33.40  ? 127 ALA A C     1 
ATOM   718   O  O     . ALA A 1 88  ? 19.210  28.068 -54.833 1.00 33.78  ? 127 ALA A O     1 
ATOM   719   C  CB    . ALA A 1 88  ? 17.405  28.360 -57.607 1.00 33.33  ? 127 ALA A CB    1 
ATOM   720   N  N     . ARG A 1 89  ? 18.380  26.123 -55.583 1.00 32.82  ? 128 ARG A N     1 
ATOM   721   C  CA    . ARG A 1 89  ? 18.351  25.494 -54.271 1.00 32.67  ? 128 ARG A CA    1 
ATOM   722   C  C     . ARG A 1 89  ? 19.731  25.227 -53.730 1.00 33.80  ? 128 ARG A C     1 
ATOM   723   O  O     . ARG A 1 89  ? 19.887  25.276 -52.518 1.00 34.08  ? 128 ARG A O     1 
ATOM   724   C  CB    . ARG A 1 89  ? 17.524  24.214 -54.295 1.00 32.29  ? 128 ARG A CB    1 
ATOM   725   C  CG    . ARG A 1 89  ? 16.089  24.463 -54.687 1.00 33.80  ? 128 ARG A CG    1 
ATOM   726   C  CD    . ARG A 1 89  ? 15.236  23.225 -54.591 1.00 36.26  ? 128 ARG A CD    1 
ATOM   727   N  NE    . ARG A 1 89  ? 15.111  22.776 -53.210 1.00 37.83  ? 128 ARG A NE    1 
ATOM   728   C  CZ    . ARG A 1 89  ? 15.597  21.634 -52.734 1.00 37.80  ? 128 ARG A CZ    1 
ATOM   729   N  NH1   . ARG A 1 89  ? 16.305  20.828 -53.516 1.00 35.93  ? 128 ARG A NH1   1 
ATOM   730   N  NH2   . ARG A 1 89  ? 15.407  21.307 -51.463 1.00 37.43  ? 128 ARG A NH2   1 
ATOM   731   N  N     . ARG A 1 90  ? 20.744  24.985 -54.612 1.00 34.46  ? 129 ARG A N     1 
ATOM   732   C  CA    . ARG A 1 90  ? 22.154  24.727 -54.247 1.00 35.32  ? 129 ARG A CA    1 
ATOM   733   C  C     . ARG A 1 90  ? 22.771  25.961 -53.596 1.00 35.13  ? 129 ARG A C     1 
ATOM   734   O  O     . ARG A 1 90  ? 23.404  25.866 -52.537 1.00 34.67  ? 129 ARG A O     1 
ATOM   735   C  CB    . ARG A 1 90  ? 22.988  24.356 -55.491 1.00 37.97  ? 129 ARG A CB    1 
ATOM   736   C  CG    . ARG A 1 90  ? 23.768  23.050 -55.374 1.00 44.70  ? 129 ARG A CG    1 
ATOM   737   C  CD    . ARG A 1 90  ? 25.300  23.209 -55.356 1.00 50.85  ? 129 ARG A CD    1 
ATOM   738   N  NE    . ARG A 1 90  ? 26.000  22.125 -56.079 1.00 55.72  ? 129 ARG A NE    1 
ATOM   739   C  CZ    . ARG A 1 90  ? 27.268  21.766 -55.855 1.00 58.25  ? 129 ARG A CZ    1 
ATOM   740   N  NH1   . ARG A 1 90  ? 27.836  20.815 -56.587 1.00 56.89  ? 129 ARG A NH1   1 
ATOM   741   N  NH2   . ARG A 1 90  ? 27.980  22.373 -54.906 1.00 58.94  ? 129 ARG A NH2   1 
ATOM   742   N  N     . ILE A 1 91  ? 22.582  27.122 -54.247 1.00 35.31  ? 130 ILE A N     1 
ATOM   743   C  CA    . ILE A 1 91  ? 23.106  28.404 -53.786 1.00 36.37  ? 130 ILE A CA    1 
ATOM   744   C  C     . ILE A 1 91  ? 22.318  28.942 -52.580 1.00 37.27  ? 130 ILE A C     1 
ATOM   745   O  O     . ILE A 1 91  ? 22.908  29.550 -51.687 1.00 37.49  ? 130 ILE A O     1 
ATOM   746   C  CB    . ILE A 1 91  ? 23.191  29.400 -54.963 1.00 36.67  ? 130 ILE A CB    1 
ATOM   747   C  CG1   . ILE A 1 91  ? 24.093  28.826 -56.059 1.00 37.68  ? 130 ILE A CG1   1 
ATOM   748   C  CG2   . ILE A 1 91  ? 23.676  30.761 -54.497 1.00 36.78  ? 130 ILE A CG2   1 
ATOM   749   C  CD1   . ILE A 1 91  ? 24.135  29.607 -57.288 1.00 38.98  ? 130 ILE A CD1   1 
ATOM   750   N  N     . ARG A 1 92  ? 20.999  28.649 -52.525 1.00 37.32  ? 131 ARG A N     1 
ATOM   751   C  CA    . ARG A 1 92  ? 20.113  28.999 -51.409 1.00 37.63  ? 131 ARG A CA    1 
ATOM   752   C  C     . ARG A 1 92  ? 20.479  28.218 -50.097 1.00 38.91  ? 131 ARG A C     1 
ATOM   753   O  O     . ARG A 1 92  ? 19.991  28.558 -49.015 1.00 39.05  ? 131 ARG A O     1 
ATOM   754   C  CB    . ARG A 1 92  ? 18.653  28.682 -51.788 1.00 37.53  ? 131 ARG A CB    1 
ATOM   755   C  CG    . ARG A 1 92  ? 17.821  29.833 -52.353 1.00 36.88  ? 131 ARG A CG    1 
ATOM   756   C  CD    . ARG A 1 92  ? 16.564  29.266 -52.998 1.00 36.89  ? 131 ARG A CD    1 
ATOM   757   N  NE    . ARG A 1 92  ? 15.433  30.200 -53.025 1.00 36.11  ? 131 ARG A NE    1 
ATOM   758   C  CZ    . ARG A 1 92  ? 14.246  29.949 -52.481 1.00 36.85  ? 131 ARG A CZ    1 
ATOM   759   N  NH1   . ARG A 1 92  ? 14.030  28.811 -51.836 1.00 37.85  ? 131 ARG A NH1   1 
ATOM   760   N  NH2   . ARG A 1 92  ? 13.270  30.839 -52.565 1.00 35.24  ? 131 ARG A NH2   1 
ATOM   761   N  N     . GLY A 1 93  ? 21.300  27.176 -50.205 1.00 39.66  ? 132 GLY A N     1 
ATOM   762   C  CA    . GLY A 1 93  ? 21.701  26.388 -49.048 1.00 40.99  ? 132 GLY A CA    1 
ATOM   763   C  C     . GLY A 1 93  ? 20.661  25.363 -48.652 1.00 42.19  ? 132 GLY A C     1 
ATOM   764   O  O     . GLY A 1 93  ? 20.412  25.135 -47.467 1.00 42.40  ? 132 GLY A O     1 
ATOM   765   N  N     . GLU A 1 94  ? 20.023  24.764 -49.652 1.00 42.79  ? 133 GLU A N     1 
ATOM   766   C  CA    . GLU A 1 94  ? 19.010  23.724 -49.465 1.00 43.64  ? 133 GLU A CA    1 
ATOM   767   C  C     . GLU A 1 94  ? 19.565  22.360 -49.915 1.00 45.45  ? 133 GLU A C     1 
ATOM   768   O  O     . GLU A 1 94  ? 19.172  21.336 -49.344 1.00 45.61  ? 133 GLU A O     1 
ATOM   769   C  CB    . GLU A 1 94  ? 17.718  24.080 -50.242 1.00 43.85  ? 133 GLU A CB    1 
ATOM   770   C  CG    . GLU A 1 94  ? 17.179  25.466 -49.926 1.00 43.56  ? 133 GLU A CG    1 
ATOM   771   C  CD    . GLU A 1 94  ? 15.872  25.843 -50.591 1.00 42.10  ? 133 GLU A CD    1 
ATOM   772   O  OE1   . GLU A 1 94  ? 15.348  25.025 -51.378 1.00 39.14  ? 133 GLU A OE1   1 
ATOM   773   O  OE2   . GLU A 1 94  ? 15.376  26.963 -50.332 1.00 43.65  ? 133 GLU A OE2   1 
ATOM   774   N  N     . ARG A 1 95  ? 20.523  22.371 -50.907 1.00 46.68  ? 134 ARG A N     1 
ATOM   775   C  CA    . ARG A 1 95  ? 21.257  21.274 -51.562 1.00 48.28  ? 134 ARG A CA    1 
ATOM   776   C  C     . ARG A 1 95  ? 20.398  19.998 -51.782 1.00 49.65  ? 134 ARG A C     1 
ATOM   777   O  O     . ARG A 1 95  ? 19.500  19.660 -50.996 1.00 50.18  ? 134 ARG A O     1 
ATOM   778   C  CB    . ARG A 1 95  ? 22.587  20.961 -50.820 1.00 49.80  ? 134 ARG A CB    1 
ATOM   779   C  CG    . ARG A 1 95  ? 23.646  20.170 -51.623 1.00 52.22  ? 134 ARG A CG    1 
ATOM   780   C  CD    . ARG A 1 95  ? 24.573  21.084 -52.413 1.00 55.06  ? 134 ARG A CD    1 
ATOM   781   N  NE    . ARG A 1 95  ? 25.964  21.088 -51.937 1.00 57.63  ? 134 ARG A NE    1 
ATOM   782   C  CZ    . ARG A 1 95  ? 26.648  22.188 -51.611 1.00 59.21  ? 134 ARG A CZ    1 
ATOM   783   N  NH1   . ARG A 1 95  ? 26.074  23.385 -51.687 1.00 59.25  ? 134 ARG A NH1   1 
ATOM   784   N  NH2   . ARG A 1 95  ? 27.909  22.097 -51.198 1.00 57.88  ? 134 ARG A NH2   1 
ATOM   785   N  N     . LYS B 2 1   ? -17.523 6.984  -37.099 1.00 79.09  ? 16  LYS B N     1 
ATOM   786   C  CA    . LYS B 2 1   ? -17.731 5.988  -36.013 1.00 79.52  ? 16  LYS B CA    1 
ATOM   787   C  C     . LYS B 2 1   ? -17.065 4.665  -36.408 1.00 79.70  ? 16  LYS B C     1 
ATOM   788   O  O     . LYS B 2 1   ? -16.930 3.787  -35.532 1.00 80.02  ? 16  LYS B O     1 
ATOM   789   C  CB    . LYS B 2 1   ? -19.227 5.792  -35.748 1.00 81.12  ? 16  LYS B CB    1 
ATOM   790   C  CG    . LYS B 2 1   ? -20.042 5.305  -36.938 1.00 84.20  ? 16  LYS B CG    1 
ATOM   791   C  CD    . LYS B 2 1   ? -20.855 4.063  -36.640 1.00 87.20  ? 16  LYS B CD    1 
ATOM   792   C  CE    . LYS B 2 1   ? -21.695 3.608  -37.815 1.00 89.74  ? 16  LYS B CE    1 
ATOM   793   N  NZ    . LYS B 2 1   ? -22.470 4.726  -38.401 1.00 91.29  ? 16  LYS B NZ    1 
ATOM   794   N  N     . ARG B 2 2   ? -16.670 4.538  -37.679 1.00 78.98  ? 17  ARG B N     1 
ATOM   795   C  CA    . ARG B 2 2   ? -16.013 3.303  -38.183 1.00 78.42  ? 17  ARG B CA    1 
ATOM   796   C  C     . ARG B 2 2   ? -14.526 3.161  -38.529 1.00 77.06  ? 17  ARG B C     1 
ATOM   797   O  O     . ARG B 2 2   ? -13.779 2.593  -37.707 1.00 77.17  ? 17  ARG B O     1 
ATOM   798   C  CB    . ARG B 2 2   ? -16.698 2.820  -39.466 1.00 80.16  ? 17  ARG B CB    1 
ATOM   799   C  CG    . ARG B 2 2   ? -17.305 3.936  -40.304 1.00 83.71  ? 17  ARG B CG    1 
ATOM   800   C  CD    . ARG B 2 2   ? -18.475 3.457  -41.142 1.00 87.21  ? 17  ARG B CD    1 
ATOM   801   N  NE    . ARG B 2 2   ? -19.411 4.528  -41.451 1.00 90.24  ? 17  ARG B NE    1 
ATOM   802   C  CZ    . ARG B 2 2   ? -19.058 5.746  -41.847 1.00 92.35  ? 17  ARG B CZ    1 
ATOM   803   N  NH1   . ARG B 2 2   ? -19.984 6.653  -42.105 1.00 91.83  ? 17  ARG B NH1   1 
ATOM   804   N  NH2   . ARG B 2 2   ? -17.780 6.051  -41.984 1.00 92.12  ? 17  ARG B NH2   1 
ATOM   805   N  N     . HIS B 2 3   ? -14.123 3.663  -39.700 1.00 75.70  ? 18  HIS B N     1 
ATOM   806   C  CA    . HIS B 2 3   ? -12.706 3.930  -40.065 1.00 74.60  ? 18  HIS B CA    1 
ATOM   807   C  C     . HIS B 2 3   ? -12.643 5.019  -41.143 1.00 71.75  ? 18  HIS B C     1 
ATOM   808   O  O     . HIS B 2 3   ? -13.714 5.439  -41.623 1.00 72.04  ? 18  HIS B O     1 
ATOM   809   C  CB    . HIS B 2 3   ? -12.014 2.634  -40.510 1.00 76.53  ? 18  HIS B CB    1 
ATOM   810   C  CG    . HIS B 2 3   ? -12.224 2.303  -41.950 1.00 80.40  ? 18  HIS B CG    1 
ATOM   811   N  ND1   . HIS B 2 3   ? -13.396 2.607  -42.614 1.00 82.76  ? 18  HIS B ND1   1 
ATOM   812   C  CD2   . HIS B 2 3   ? -11.422 1.699  -42.853 1.00 82.02  ? 18  HIS B CD2   1 
ATOM   813   C  CE1   . HIS B 2 3   ? -13.308 2.204  -43.866 1.00 83.59  ? 18  HIS B CE1   1 
ATOM   814   N  NE2   . HIS B 2 3   ? -12.105 1.644  -44.038 1.00 83.52  ? 18  HIS B NE2   1 
ATOM   815   N  N     . ARG B 2 4   ? -11.428 5.449  -41.499 1.00 68.91  ? 19  ARG B N     1 
ATOM   816   C  CA    . ARG B 2 4   ? -11.225 6.497  -42.528 1.00 66.91  ? 19  ARG B CA    1 
ATOM   817   C  C     . ARG B 2 4   ? -10.991 5.880  -43.906 1.00 63.21  ? 19  ARG B C     1 
ATOM   818   O  O     . ARG B 2 4   ? -11.257 4.693  -44.039 1.00 63.82  ? 19  ARG B O     1 
ATOM   819   C  CB    . ARG B 2 4   ? -9.936  7.209  -42.124 1.00 69.57  ? 19  ARG B CB    1 
ATOM   820   C  CG    . ARG B 2 4   ? -9.660  7.178  -40.626 1.00 74.53  ? 19  ARG B CG    1 
ATOM   821   C  CD    . ARG B 2 4   ? -8.245  6.818  -40.235 1.00 79.50  ? 19  ARG B CD    1 
ATOM   822   N  NE    . ARG B 2 4   ? -8.007  6.925  -38.803 1.00 84.26  ? 19  ARG B NE    1 
ATOM   823   C  CZ    . ARG B 2 4   ? -7.062  6.257  -38.155 1.00 87.71  ? 19  ARG B CZ    1 
ATOM   824   N  NH1   . ARG B 2 4   ? -6.902  6.411  -36.852 1.00 87.38  ? 19  ARG B NH1   1 
ATOM   825   N  NH2   . ARG B 2 4   ? -6.276  5.428  -38.814 1.00 88.27  ? 19  ARG B NH2   1 
ATOM   826   N  N     . LYS B 2 5   ? -10.539 6.673  -44.888 1.00 59.14  ? 20  LYS B N     1 
ATOM   827   C  CA    . LYS B 2 5   ? -10.215 6.157  -46.226 1.00 55.60  ? 20  LYS B CA    1 
ATOM   828   C  C     . LYS B 2 5   ? -8.702  6.271  -46.455 1.00 51.54  ? 20  LYS B C     1 
ATOM   829   O  O     . LYS B 2 5   ? -8.039  7.073  -45.793 1.00 51.32  ? 20  LYS B O     1 
ATOM   830   C  CB    . LYS B 2 5   ? -10.995 6.908  -47.314 1.00 57.40  ? 20  LYS B CB    1 
ATOM   831   C  CG    . LYS B 2 5   ? -10.522 6.680  -48.763 1.00 60.55  ? 20  LYS B CG    1 
ATOM   832   C  CD    . LYS B 2 5   ? -11.043 5.393  -49.394 1.00 63.45  ? 20  LYS B CD    1 
ATOM   833   C  CE    . LYS B 2 5   ? -11.274 5.570  -50.875 1.00 65.86  ? 20  LYS B CE    1 
ATOM   834   N  NZ    . LYS B 2 5   ? -10.169 6.316  -51.521 1.00 67.38  ? 20  LYS B NZ    1 
ATOM   835   N  N     . VAL B 2 6   ? -8.145  5.458  -47.366 1.00 48.34  ? 21  VAL B N     1 
ATOM   836   C  CA    . VAL B 2 6   ? -6.705  5.484  -47.631 1.00 45.64  ? 21  VAL B CA    1 
ATOM   837   C  C     . VAL B 2 6   ? -6.263  6.748  -48.390 1.00 42.33  ? 21  VAL B C     1 
ATOM   838   O  O     . VAL B 2 6   ? -6.915  7.164  -49.348 1.00 42.36  ? 21  VAL B O     1 
ATOM   839   C  CB    . VAL B 2 6   ? -6.187  4.190  -48.309 1.00 45.98  ? 21  VAL B CB    1 
ATOM   840   C  CG1   . VAL B 2 6   ? -6.598  4.129  -49.774 1.00 46.87  ? 21  VAL B CG1   1 
ATOM   841   C  CG2   . VAL B 2 6   ? -4.676  4.069  -48.174 1.00 45.93  ? 21  VAL B CG2   1 
ATOM   842   N  N     . LEU B 2 7   ? -5.164  7.374  -47.921 1.00 39.17  ? 22  LEU B N     1 
ATOM   843   C  CA    . LEU B 2 7   ? -4.593  8.553  -48.550 1.00 36.56  ? 22  LEU B CA    1 
ATOM   844   C  C     . LEU B 2 7   ? -3.358  8.169  -49.364 1.00 34.12  ? 22  LEU B C     1 
ATOM   845   O  O     . LEU B 2 7   ? -2.417  7.587  -48.811 1.00 34.17  ? 22  LEU B O     1 
ATOM   846   C  CB    . LEU B 2 7   ? -4.317  9.628  -47.502 1.00 36.19  ? 22  LEU B CB    1 
ATOM   847   C  CG    . LEU B 2 7   ? -5.550  10.497 -47.242 1.00 36.72  ? 22  LEU B CG    1 
ATOM   848   C  CD1   . LEU B 2 7   ? -5.519  11.171 -45.884 1.00 37.11  ? 22  LEU B CD1   1 
ATOM   849   C  CD2   . LEU B 2 7   ? -5.789  11.454 -48.368 1.00 36.62  ? 22  LEU B CD2   1 
ATOM   850   N  N     . ARG B 2 8   ? -3.393  8.442  -50.689 1.00 31.87  ? 23  ARG B N     1 
ATOM   851   C  CA    . ARG B 2 8   ? -2.345  8.041  -51.631 1.00 30.79  ? 23  ARG B CA    1 
ATOM   852   C  C     . ARG B 2 8   ? -2.188  8.987  -52.811 1.00 29.99  ? 23  ARG B C     1 
ATOM   853   O  O     . ARG B 2 8   ? -3.200  9.388  -53.361 1.00 30.00  ? 23  ARG B O     1 
ATOM   854   C  CB    . ARG B 2 8   ? -2.795  6.727  -52.287 1.00 31.76  ? 23  ARG B CB    1 
ATOM   855   C  CG    . ARG B 2 8   ? -2.292  5.442  -51.685 1.00 32.65  ? 23  ARG B CG    1 
ATOM   856   C  CD    . ARG B 2 8   ? -3.245  4.335  -52.047 1.00 32.99  ? 23  ARG B CD    1 
ATOM   857   N  NE    . ARG B 2 8   ? -3.057  3.857  -53.416 1.00 32.60  ? 23  ARG B NE    1 
ATOM   858   C  CZ    . ARG B 2 8   ? -4.052  3.542  -54.245 1.00 31.88  ? 23  ARG B CZ    1 
ATOM   859   N  NH1   . ARG B 2 8   ? -5.321  3.719  -53.875 1.00 30.95  ? 23  ARG B NH1   1 
ATOM   860   N  NH2   . ARG B 2 8   ? -3.787  3.088  -55.464 1.00 29.04  ? 23  ARG B NH2   1 
ATOM   861   N  N     . ASP B 2 9   ? -0.948  9.205  -53.303 1.00 29.50  ? 24  ASP B N     1 
ATOM   862   C  CA    . ASP B 2 9   ? -0.616  9.979  -54.518 1.00 29.92  ? 24  ASP B CA    1 
ATOM   863   C  C     . ASP B 2 9   ? -1.187  11.417 -54.621 1.00 30.53  ? 24  ASP B C     1 
ATOM   864   O  O     . ASP B 2 9   ? -1.348  11.916 -55.752 1.00 31.34  ? 24  ASP B O     1 
ATOM   865   C  CB    . ASP B 2 9   ? -1.045  9.187  -55.771 1.00 31.36  ? 24  ASP B CB    1 
ATOM   866   C  CG    . ASP B 2 9   ? -0.216  9.418  -57.030 1.00 36.43  ? 24  ASP B CG    1 
ATOM   867   O  OD1   . ASP B 2 9   ? 1.017   9.587  -56.908 1.00 37.78  ? 24  ASP B OD1   1 
ATOM   868   O  OD2   . ASP B 2 9   ? -0.803  9.400  -58.145 1.00 38.25  ? 24  ASP B OD2   1 
ATOM   869   N  N     . ASN B 2 10  ? -1.449  12.110 -53.483 1.00 29.54  ? 25  ASN B N     1 
ATOM   870   C  CA    . ASN B 2 10  ? -2.060  13.439 -53.550 1.00 29.04  ? 25  ASN B CA    1 
ATOM   871   C  C     . ASN B 2 10  ? -1.100  14.563 -54.036 1.00 29.29  ? 25  ASN B C     1 
ATOM   872   O  O     . ASN B 2 10  ? -1.559  15.684 -54.330 1.00 29.64  ? 25  ASN B O     1 
ATOM   873   C  CB    . ASN B 2 10  ? -2.761  13.790 -52.259 1.00 29.40  ? 25  ASN B CB    1 
ATOM   874   C  CG    . ASN B 2 10  ? -3.943  12.883 -52.079 1.00 32.10  ? 25  ASN B CG    1 
ATOM   875   O  OD1   . ASN B 2 10  ? -4.854  12.838 -52.912 1.00 33.26  ? 25  ASN B OD1   1 
ATOM   876   N  ND2   . ASN B 2 10  ? -3.940  12.091 -51.022 1.00 32.70  ? 25  ASN B ND2   1 
ATOM   877   N  N     . ILE B 2 11  ? 0.191   14.237 -54.244 1.00 28.60  ? 26  ILE B N     1 
ATOM   878   C  CA    . ILE B 2 11  ? 1.123   15.190 -54.835 1.00 28.51  ? 26  ILE B CA    1 
ATOM   879   C  C     . ILE B 2 11  ? 0.715   15.490 -56.299 1.00 29.72  ? 26  ILE B C     1 
ATOM   880   O  O     . ILE B 2 11  ? 1.060   16.549 -56.826 1.00 30.28  ? 26  ILE B O     1 
ATOM   881   C  CB    . ILE B 2 11  ? 2.587   14.736 -54.674 1.00 28.22  ? 26  ILE B CB    1 
ATOM   882   C  CG1   . ILE B 2 11  ? 3.605   15.790 -55.143 1.00 28.44  ? 26  ILE B CG1   1 
ATOM   883   C  CG2   . ILE B 2 11  ? 2.805   13.431 -55.374 1.00 29.19  ? 26  ILE B CG2   1 
ATOM   884   C  CD1   . ILE B 2 11  ? 3.643   17.048 -54.365 1.00 29.21  ? 26  ILE B CD1   1 
ATOM   885   N  N     . GLN B 2 12  ? -0.076  14.608 -56.937 1.00 30.17  ? 27  GLN B N     1 
ATOM   886   C  CA    . GLN B 2 12  ? -0.576  14.878 -58.277 1.00 31.29  ? 27  GLN B CA    1 
ATOM   887   C  C     . GLN B 2 12  ? -1.745  15.913 -58.272 1.00 31.83  ? 27  GLN B C     1 
ATOM   888   O  O     . GLN B 2 12  ? -2.036  16.492 -59.336 1.00 32.18  ? 27  GLN B O     1 
ATOM   889   C  CB    . GLN B 2 12  ? -0.903  13.573 -59.000 1.00 32.99  ? 27  GLN B CB    1 
ATOM   890   C  CG    . GLN B 2 12  ? 0.341   12.685 -59.103 1.00 36.30  ? 27  GLN B CG    1 
ATOM   891   C  CD    . GLN B 2 12  ? 1.438   13.306 -59.962 1.00 40.85  ? 27  GLN B CD    1 
ATOM   892   O  OE1   . GLN B 2 12  ? 1.180   13.839 -61.048 1.00 42.90  ? 27  GLN B OE1   1 
ATOM   893   N  NE2   . GLN B 2 12  ? 2.689   13.252 -59.501 1.00 40.64  ? 27  GLN B NE2   1 
ATOM   894   N  N     . GLY B 2 13  ? -2.327  16.176 -57.077 1.00 31.43  ? 28  GLY B N     1 
ATOM   895   C  CA    . GLY B 2 13  ? -3.358  17.186 -56.824 1.00 31.90  ? 28  GLY B CA    1 
ATOM   896   C  C     . GLY B 2 13  ? -2.861  18.620 -57.057 1.00 32.11  ? 28  GLY B C     1 
ATOM   897   O  O     . GLY B 2 13  ? -3.643  19.546 -57.294 1.00 31.85  ? 28  GLY B O     1 
ATOM   898   N  N     . ILE B 2 14  ? -1.529  18.797 -56.986 1.00 31.67  ? 29  ILE B N     1 
ATOM   899   C  CA    . ILE B 2 14  ? -0.774  19.987 -57.294 1.00 31.17  ? 29  ILE B CA    1 
ATOM   900   C  C     . ILE B 2 14  ? -0.562  19.775 -58.783 1.00 32.00  ? 29  ILE B C     1 
ATOM   901   O  O     . ILE B 2 14  ? 0.458   19.225 -59.205 1.00 32.21  ? 29  ILE B O     1 
ATOM   902   C  CB    . ILE B 2 14  ? 0.569   19.961 -56.524 1.00 30.80  ? 29  ILE B CB    1 
ATOM   903   C  CG1   . ILE B 2 14  ? 0.375   19.697 -55.003 1.00 30.92  ? 29  ILE B CG1   1 
ATOM   904   C  CG2   . ILE B 2 14  ? 1.408   21.214 -56.794 1.00 31.49  ? 29  ILE B CG2   1 
ATOM   905   C  CD1   . ILE B 2 14  ? -0.893  20.295 -54.277 1.00 31.79  ? 29  ILE B CD1   1 
ATOM   906   N  N     . THR B 2 15  ? -1.614  20.097 -59.554 1.00 32.43  ? 30  THR B N     1 
ATOM   907   C  CA    . THR B 2 15  ? -1.780  19.954 -61.006 1.00 33.19  ? 30  THR B CA    1 
ATOM   908   C  C     . THR B 2 15  ? -0.751  20.737 -61.869 1.00 34.87  ? 30  THR B C     1 
ATOM   909   O  O     . THR B 2 15  ? 0.014   21.538 -61.334 1.00 35.12  ? 30  THR B O     1 
ATOM   910   C  CB    . THR B 2 15  ? -3.235  20.371 -61.335 1.00 33.25  ? 30  THR B CB    1 
ATOM   911   O  OG1   . THR B 2 15  ? -3.497  21.674 -60.814 1.00 33.48  ? 30  THR B OG1   1 
ATOM   912   C  CG2   . THR B 2 15  ? -4.244  19.426 -60.735 1.00 33.72  ? 30  THR B CG2   1 
ATOM   913   N  N     . LYS B 2 16  ? -0.730  20.518 -63.201 1.00 35.69  ? 31  LYS B N     1 
ATOM   914   C  CA    . LYS B 2 16  ? 0.122   21.332 -64.089 1.00 37.30  ? 31  LYS B CA    1 
ATOM   915   C  C     . LYS B 2 16  ? -0.394  22.797 -64.177 1.00 38.25  ? 31  LYS B C     1 
ATOM   916   O  O     . LYS B 2 16  ? 0.431   23.716 -64.180 1.00 38.52  ? 31  LYS B O     1 
ATOM   917   C  CB    . LYS B 2 16  ? 0.268   20.699 -65.487 1.00 39.85  ? 31  LYS B CB    1 
ATOM   918   C  CG    . LYS B 2 16  ? 0.887   21.592 -66.562 1.00 43.89  ? 31  LYS B CG    1 
ATOM   919   C  CD    . LYS B 2 16  ? 1.203   20.796 -67.819 1.00 49.11  ? 31  LYS B CD    1 
ATOM   920   C  CE    . LYS B 2 16  ? 1.273   21.667 -69.053 1.00 53.41  ? 31  LYS B CE    1 
ATOM   921   N  NZ    . LYS B 2 16  ? 1.669   20.896 -70.268 1.00 55.70  ? 31  LYS B NZ    1 
ATOM   922   N  N     . PRO B 2 17  ? -1.731  23.062 -64.211 1.00 38.69  ? 32  PRO B N     1 
ATOM   923   C  CA    . PRO B 2 17  ? -2.190  24.462 -64.236 1.00 38.93  ? 32  PRO B CA    1 
ATOM   924   C  C     . PRO B 2 17  ? -1.916  25.225 -62.931 1.00 38.61  ? 32  PRO B C     1 
ATOM   925   O  O     . PRO B 2 17  ? -1.654  26.432 -62.994 1.00 38.69  ? 32  PRO B O     1 
ATOM   926   C  CB    . PRO B 2 17  ? -3.702  24.343 -64.515 1.00 39.81  ? 32  PRO B CB    1 
ATOM   927   C  CG    . PRO B 2 17  ? -4.081  23.028 -64.002 1.00 40.13  ? 32  PRO B CG    1 
ATOM   928   C  CD    . PRO B 2 17  ? -2.878  22.127 -64.216 1.00 38.37  ? 32  PRO B CD    1 
ATOM   929   N  N     . ALA B 2 18  ? -1.970  24.535 -61.764 1.00 37.69  ? 33  ALA B N     1 
ATOM   930   C  CA    . ALA B 2 18  ? -1.687  25.149 -60.467 1.00 37.39  ? 33  ALA B CA    1 
ATOM   931   C  C     . ALA B 2 18  ? -0.214  25.545 -60.377 1.00 37.27  ? 33  ALA B C     1 
ATOM   932   O  O     . ALA B 2 18  ? 0.094   26.578 -59.787 1.00 37.74  ? 33  ALA B O     1 
ATOM   933   C  CB    . ALA B 2 18  ? -2.044  24.198 -59.341 1.00 37.40  ? 33  ALA B CB    1 
ATOM   934   N  N     . ILE B 2 19  ? 0.689   24.738 -60.976 1.00 36.84  ? 34  ILE B N     1 
ATOM   935   C  CA    . ILE B 2 19  ? 2.133   24.989 -61.026 1.00 37.21  ? 34  ILE B CA    1 
ATOM   936   C  C     . ILE B 2 19  ? 2.439   26.138 -61.977 1.00 37.48  ? 34  ILE B C     1 
ATOM   937   O  O     . ILE B 2 19  ? 3.299   26.958 -61.683 1.00 37.75  ? 34  ILE B O     1 
ATOM   938   C  CB    . ILE B 2 19  ? 2.921   23.682 -61.349 1.00 37.95  ? 34  ILE B CB    1 
ATOM   939   C  CG1   . ILE B 2 19  ? 2.878   22.716 -60.146 1.00 39.33  ? 34  ILE B CG1   1 
ATOM   940   C  CG2   . ILE B 2 19  ? 4.370   23.957 -61.762 1.00 38.14  ? 34  ILE B CG2   1 
ATOM   941   C  CD1   . ILE B 2 19  ? 3.370   21.334 -60.426 1.00 41.20  ? 34  ILE B CD1   1 
ATOM   942   N  N     . ARG B 2 20  ? 1.696   26.237 -63.078 1.00 37.55  ? 35  ARG B N     1 
ATOM   943   C  CA    . ARG B 2 20  ? 1.839   27.318 -64.042 1.00 38.26  ? 35  ARG B CA    1 
ATOM   944   C  C     . ARG B 2 20  ? 1.559   28.675 -63.400 1.00 37.02  ? 35  ARG B C     1 
ATOM   945   O  O     . ARG B 2 20  ? 2.321   29.617 -63.615 1.00 36.66  ? 35  ARG B O     1 
ATOM   946   C  CB    . ARG B 2 20  ? 0.875   27.103 -65.226 1.00 41.69  ? 35  ARG B CB    1 
ATOM   947   C  CG    . ARG B 2 20  ? 1.426   26.173 -66.298 1.00 47.63  ? 35  ARG B CG    1 
ATOM   948   C  CD    . ARG B 2 20  ? 0.653   26.292 -67.600 1.00 52.53  ? 35  ARG B CD    1 
ATOM   949   N  NE    . ARG B 2 20  ? 1.421   25.737 -68.719 1.00 56.25  ? 35  ARG B NE    1 
ATOM   950   C  CZ    . ARG B 2 20  ? 2.211   26.453 -69.514 1.00 58.22  ? 35  ARG B CZ    1 
ATOM   951   N  NH1   . ARG B 2 20  ? 2.879   25.866 -70.500 1.00 56.64  ? 35  ARG B NH1   1 
ATOM   952   N  NH2   . ARG B 2 20  ? 2.338   27.762 -69.331 1.00 58.79  ? 35  ARG B NH2   1 
ATOM   953   N  N     . ARG B 2 21  ? 0.490   28.766 -62.593 1.00 36.17  ? 36  ARG B N     1 
ATOM   954   C  CA    . ARG B 2 21  ? 0.109   30.016 -61.948 1.00 35.91  ? 36  ARG B CA    1 
ATOM   955   C  C     . ARG B 2 21  ? 1.211   30.519 -61.020 1.00 36.34  ? 36  ARG B C     1 
ATOM   956   O  O     . ARG B 2 21  ? 1.536   31.706 -61.032 1.00 36.38  ? 36  ARG B O     1 
ATOM   957   C  CB    . ARG B 2 21  ? -1.206  29.862 -61.180 1.00 36.48  ? 36  ARG B CB    1 
ATOM   958   C  CG    . ARG B 2 21  ? -2.335  29.373 -62.038 1.00 39.73  ? 36  ARG B CG    1 
ATOM   959   C  CD    . ARG B 2 21  ? -3.680  29.639 -61.401 1.00 44.07  ? 36  ARG B CD    1 
ATOM   960   N  NE    . ARG B 2 21  ? -4.087  28.671 -60.376 1.00 47.82  ? 36  ARG B NE    1 
ATOM   961   C  CZ    . ARG B 2 21  ? -4.741  27.538 -60.626 1.00 49.18  ? 36  ARG B CZ    1 
ATOM   962   N  NH1   . ARG B 2 21  ? -4.995  27.172 -61.876 1.00 49.31  ? 36  ARG B NH1   1 
ATOM   963   N  NH2   . ARG B 2 21  ? -5.111  26.744 -59.628 1.00 47.68  ? 36  ARG B NH2   1 
ATOM   964   N  N     . LEU B 2 22  ? 1.810   29.612 -60.235 1.00 36.35  ? 37  LEU B N     1 
ATOM   965   C  CA    . LEU B 2 22  ? 2.896   29.974 -59.337 1.00 36.48  ? 37  LEU B CA    1 
ATOM   966   C  C     . LEU B 2 22  ? 4.123   30.461 -60.123 1.00 37.40  ? 37  LEU B C     1 
ATOM   967   O  O     . LEU B 2 22  ? 4.812   31.363 -59.660 1.00 38.00  ? 37  LEU B O     1 
ATOM   968   C  CB    . LEU B 2 22  ? 3.242   28.809 -58.413 1.00 35.98  ? 37  LEU B CB    1 
ATOM   969   C  CG    . LEU B 2 22  ? 2.130   28.412 -57.443 1.00 36.83  ? 37  LEU B CG    1 
ATOM   970   C  CD1   . LEU B 2 22  ? 2.326   26.978 -56.931 1.00 37.06  ? 37  LEU B CD1   1 
ATOM   971   C  CD2   . LEU B 2 22  ? 2.029   29.387 -56.282 1.00 36.92  ? 37  LEU B CD2   1 
ATOM   972   N  N     . ALA B 2 23  ? 4.362   29.921 -61.331 1.00 37.25  ? 38  ALA B N     1 
ATOM   973   C  CA    . ALA B 2 23  ? 5.478   30.360 -62.159 1.00 37.53  ? 38  ALA B CA    1 
ATOM   974   C  C     . ALA B 2 23  ? 5.219   31.773 -62.677 1.00 38.51  ? 38  ALA B C     1 
ATOM   975   O  O     . ALA B 2 23  ? 6.131   32.602 -62.665 1.00 38.79  ? 38  ALA B O     1 
ATOM   976   C  CB    . ALA B 2 23  ? 5.690   29.397 -63.314 1.00 37.18  ? 38  ALA B CB    1 
ATOM   977   N  N     . ARG B 2 24  ? 3.957   32.073 -63.066 1.00 38.44  ? 39  ARG B N     1 
ATOM   978   C  CA    . ARG B 2 24  ? 3.558   33.395 -63.564 1.00 37.99  ? 39  ARG B CA    1 
ATOM   979   C  C     . ARG B 2 24  ? 3.754   34.466 -62.498 1.00 37.67  ? 39  ARG B C     1 
ATOM   980   O  O     . ARG B 2 24  ? 4.352   35.504 -62.786 1.00 37.99  ? 39  ARG B O     1 
ATOM   981   C  CB    . ARG B 2 24  ? 2.103   33.389 -64.070 1.00 38.60  ? 39  ARG B CB    1 
ATOM   982   C  CG    . ARG B 2 24  ? 1.829   32.395 -65.193 1.00 40.98  ? 39  ARG B CG    1 
ATOM   983   C  CD    . ARG B 2 24  ? 2.796   32.481 -66.364 1.00 43.71  ? 39  ARG B CD    1 
ATOM   984   N  NE    . ARG B 2 24  ? 2.251   31.799 -67.538 1.00 47.70  ? 39  ARG B NE    1 
ATOM   985   C  CZ    . ARG B 2 24  ? 2.986   31.317 -68.536 1.00 51.71  ? 39  ARG B CZ    1 
ATOM   986   N  NH1   . ARG B 2 24  ? 4.309   31.403 -68.499 1.00 52.82  ? 39  ARG B NH1   1 
ATOM   987   N  NH2   . ARG B 2 24  ? 2.401   30.727 -69.572 1.00 51.70  ? 39  ARG B NH2   1 
ATOM   988   N  N     . ARG B 2 25  ? 3.334   34.196 -61.254 1.00 36.61  ? 40  ARG B N     1 
ATOM   989   C  CA    . ARG B 2 25  ? 3.549   35.136 -60.157 1.00 35.97  ? 40  ARG B CA    1 
ATOM   990   C  C     . ARG B 2 25  ? 5.057   35.363 -59.925 1.00 37.84  ? 40  ARG B C     1 
ATOM   991   O  O     . ARG B 2 25  ? 5.493   36.484 -59.678 1.00 38.38  ? 40  ARG B O     1 
ATOM   992   C  CB    . ARG B 2 25  ? 2.871   34.636 -58.887 1.00 34.18  ? 40  ARG B CB    1 
ATOM   993   C  CG    . ARG B 2 25  ? 2.798   35.694 -57.833 1.00 31.71  ? 40  ARG B CG    1 
ATOM   994   C  CD    . ARG B 2 25  ? 1.762   35.369 -56.810 1.00 31.41  ? 40  ARG B CD    1 
ATOM   995   N  NE    . ARG B 2 25  ? 0.412   35.517 -57.342 1.00 32.47  ? 40  ARG B NE    1 
ATOM   996   C  CZ    . ARG B 2 25  ? -0.698  35.245 -56.664 1.00 34.45  ? 40  ARG B CZ    1 
ATOM   997   N  NH1   . ARG B 2 25  ? -0.633  34.836 -55.408 1.00 34.26  ? 40  ARG B NH1   1 
ATOM   998   N  NH2   . ARG B 2 25  ? -1.885  35.417 -57.226 1.00 34.71  ? 40  ARG B NH2   1 
ATOM   999   N  N     . GLY B 2 26  ? 5.851   34.316 -60.090 1.00 38.81  ? 41  GLY B N     1 
ATOM   1000  C  CA    . GLY B 2 26  ? 7.302   34.405 -59.985 1.00 40.37  ? 41  GLY B CA    1 
ATOM   1001  C  C     . GLY B 2 26  ? 7.983   35.044 -61.184 1.00 42.22  ? 41  GLY B C     1 
ATOM   1002  O  O     . GLY B 2 26  ? 9.208   35.170 -61.207 1.00 42.46  ? 41  GLY B O     1 
ATOM   1003  N  N     . GLY B 2 27  ? 7.202   35.444 -62.183 1.00 43.57  ? 42  GLY B N     1 
ATOM   1004  C  CA    . GLY B 2 27  ? 7.701   36.097 -63.386 1.00 45.68  ? 42  GLY B CA    1 
ATOM   1005  C  C     . GLY B 2 27  ? 8.354   35.148 -64.362 1.00 47.76  ? 42  GLY B C     1 
ATOM   1006  O  O     . GLY B 2 27  ? 9.446   35.423 -64.860 1.00 47.71  ? 42  GLY B O     1 
ATOM   1007  N  N     . VAL B 2 28  ? 7.692   34.022 -64.643 1.00 49.44  ? 43  VAL B N     1 
ATOM   1008  C  CA    . VAL B 2 28  ? 8.238   33.016 -65.553 1.00 51.39  ? 43  VAL B CA    1 
ATOM   1009  C  C     . VAL B 2 28  ? 7.472   32.989 -66.885 1.00 52.56  ? 43  VAL B C     1 
ATOM   1010  O  O     . VAL B 2 28  ? 6.245   32.853 -66.886 1.00 51.97  ? 43  VAL B O     1 
ATOM   1011  C  CB    . VAL B 2 28  ? 8.287   31.619 -64.884 1.00 52.38  ? 43  VAL B CB    1 
ATOM   1012  C  CG1   . VAL B 2 28  ? 8.744   30.565 -65.869 1.00 53.24  ? 43  VAL B CG1   1 
ATOM   1013  C  CG2   . VAL B 2 28  ? 9.183   31.622 -63.650 1.00 52.84  ? 43  VAL B CG2   1 
ATOM   1014  N  N     . LYS B 2 29  ? 8.202   33.123 -68.012 1.00 53.85  ? 44  LYS B N     1 
ATOM   1015  C  CA    . LYS B 2 29  ? 7.588   33.138 -69.334 1.00 55.79  ? 44  LYS B CA    1 
ATOM   1016  C  C     . LYS B 2 29  ? 7.436   31.735 -69.916 1.00 57.07  ? 44  LYS B C     1 
ATOM   1017  O  O     . LYS B 2 29  ? 6.327   31.343 -70.293 1.00 57.29  ? 44  LYS B O     1 
ATOM   1018  C  CB    . LYS B 2 29  ? 8.385   34.041 -70.295 1.00 58.74  ? 44  LYS B CB    1 
ATOM   1019  C  CG    . LYS B 2 29  ? 7.611   34.434 -71.559 1.00 64.15  ? 44  LYS B CG    1 
ATOM   1020  C  CD    . LYS B 2 29  ? 8.541   35.085 -72.598 1.00 69.24  ? 44  LYS B CD    1 
ATOM   1021  C  CE    . LYS B 2 29  ? 7.820   35.791 -73.718 1.00 73.50  ? 44  LYS B CE    1 
ATOM   1022  N  NZ    . LYS B 2 29  ? 8.780   36.547 -74.573 1.00 75.80  ? 44  LYS B NZ    1 
ATOM   1023  N  N     . ARG B 2 30  ? 8.541   30.980 -69.999 1.00 57.69  ? 45  ARG B N     1 
ATOM   1024  C  CA    . ARG B 2 30  ? 8.482   29.636 -70.548 1.00 58.54  ? 45  ARG B CA    1 
ATOM   1025  C  C     . ARG B 2 30  ? 8.689   28.590 -69.444 1.00 58.25  ? 45  ARG B C     1 
ATOM   1026  O  O     . ARG B 2 30  ? 9.589   28.725 -68.623 1.00 58.50  ? 45  ARG B O     1 
ATOM   1027  C  CB    . ARG B 2 30  ? 9.470   29.478 -71.724 1.00 61.11  ? 45  ARG B CB    1 
ATOM   1028  C  CG    . ARG B 2 30  ? 8.957   28.505 -72.789 1.00 65.86  ? 45  ARG B CG    1 
ATOM   1029  C  CD    . ARG B 2 30  ? 9.544   28.718 -74.160 1.00 70.32  ? 45  ARG B CD    1 
ATOM   1030  N  NE    . ARG B 2 30  ? 8.825   27.913 -75.155 1.00 74.50  ? 45  ARG B NE    1 
ATOM   1031  C  CZ    . ARG B 2 30  ? 7.921   28.405 -76.005 1.00 77.96  ? 45  ARG B CZ    1 
ATOM   1032  N  NH1   . ARG B 2 30  ? 7.643   29.706 -76.014 1.00 77.72  ? 45  ARG B NH1   1 
ATOM   1033  N  NH2   . ARG B 2 30  ? 7.300   27.602 -76.863 1.00 77.94  ? 45  ARG B NH2   1 
ATOM   1034  N  N     . ILE B 2 31  ? 7.834   27.566 -69.401 1.00 57.40  ? 46  ILE B N     1 
ATOM   1035  C  CA    . ILE B 2 31  ? 7.922   26.531 -68.381 1.00 56.85  ? 46  ILE B CA    1 
ATOM   1036  C  C     . ILE B 2 31  ? 8.164   25.156 -69.005 1.00 56.65  ? 46  ILE B C     1 
ATOM   1037  O  O     . ILE B 2 31  ? 7.228   24.575 -69.564 1.00 57.07  ? 46  ILE B O     1 
ATOM   1038  C  CB    . ILE B 2 31  ? 6.622   26.500 -67.538 1.00 57.15  ? 46  ILE B CB    1 
ATOM   1039  C  CG1   . ILE B 2 31  ? 6.219   27.885 -67.021 1.00 57.63  ? 46  ILE B CG1   1 
ATOM   1040  C  CG2   . ILE B 2 31  ? 6.750   25.512 -66.395 1.00 57.87  ? 46  ILE B CG2   1 
ATOM   1041  C  CD1   . ILE B 2 31  ? 4.807   27.925 -66.507 1.00 58.50  ? 46  ILE B CD1   1 
ATOM   1042  N  N     . SER B 2 32  ? 9.381   24.592 -68.851 1.00 55.67  ? 47  SER B N     1 
ATOM   1043  C  CA    . SER B 2 32  ? 9.680   23.245 -69.356 1.00 55.26  ? 47  SER B CA    1 
ATOM   1044  C  C     . SER B 2 32  ? 8.665   22.181 -68.828 1.00 54.66  ? 47  SER B C     1 
ATOM   1045  O  O     . SER B 2 32  ? 8.001   22.394 -67.817 1.00 54.94  ? 47  SER B O     1 
ATOM   1046  C  CB    . SER B 2 32  ? 11.118  22.854 -69.011 1.00 56.37  ? 47  SER B CB    1 
ATOM   1047  O  OG    . SER B 2 32  ? 11.462  21.545 -69.434 1.00 58.92  ? 47  SER B OG    1 
ATOM   1048  N  N     . GLY B 2 33  ? 8.512   21.085 -69.551 1.00 53.76  ? 48  GLY B N     1 
ATOM   1049  C  CA    . GLY B 2 33  ? 7.600   20.014 -69.154 1.00 53.04  ? 48  GLY B CA    1 
ATOM   1050  C  C     . GLY B 2 33  ? 8.134   19.192 -67.999 1.00 51.54  ? 48  GLY B C     1 
ATOM   1051  O  O     . GLY B 2 33  ? 7.362   18.624 -67.226 1.00 52.06  ? 48  GLY B O     1 
ATOM   1052  N  N     . LEU B 2 34  ? 9.460   19.105 -67.883 1.00 49.58  ? 49  LEU B N     1 
ATOM   1053  C  CA    . LEU B 2 34  ? 10.102  18.373 -66.800 1.00 48.55  ? 49  LEU B CA    1 
ATOM   1054  C  C     . LEU B 2 34  ? 9.912   19.085 -65.446 1.00 46.91  ? 49  LEU B C     1 
ATOM   1055  O  O     . LEU B 2 34  ? 9.912   18.439 -64.400 1.00 47.00  ? 49  LEU B O     1 
ATOM   1056  C  CB    . LEU B 2 34  ? 11.596  18.240 -67.099 1.00 49.06  ? 49  LEU B CB    1 
ATOM   1057  C  CG    . LEU B 2 34  ? 11.984  17.696 -68.463 1.00 50.32  ? 49  LEU B CG    1 
ATOM   1058  C  CD1   . LEU B 2 34  ? 13.492  17.783 -68.662 1.00 50.91  ? 49  LEU B CD1   1 
ATOM   1059  C  CD2   . LEU B 2 34  ? 11.474  16.279 -68.641 1.00 50.63  ? 49  LEU B CD2   1 
ATOM   1060  N  N     . ILE B 2 35  ? 9.778   20.418 -65.476 1.00 45.39  ? 50  ILE B N     1 
ATOM   1061  C  CA    . ILE B 2 35  ? 9.560   21.283 -64.326 1.00 44.52  ? 50  ILE B CA    1 
ATOM   1062  C  C     . ILE B 2 35  ? 8.415   20.784 -63.453 1.00 43.47  ? 50  ILE B C     1 
ATOM   1063  O  O     . ILE B 2 35  ? 8.625   20.585 -62.274 1.00 43.92  ? 50  ILE B O     1 
ATOM   1064  C  CB    . ILE B 2 35  ? 9.323   22.750 -64.805 1.00 44.87  ? 50  ILE B CB    1 
ATOM   1065  C  CG1   . ILE B 2 35  ? 10.628  23.405 -65.273 1.00 46.21  ? 50  ILE B CG1   1 
ATOM   1066  C  CG2   . ILE B 2 35  ? 8.577   23.626 -63.789 1.00 44.87  ? 50  ILE B CG2   1 
ATOM   1067  C  CD1   . ILE B 2 35  ? 11.610  23.617 -64.241 1.00 47.81  ? 50  ILE B CD1   1 
ATOM   1068  N  N     . TYR B 2 36  ? 7.234   20.524 -64.021 1.00 42.00  ? 51  TYR B N     1 
ATOM   1069  C  CA    . TYR B 2 36  ? 6.054   20.117 -63.257 1.00 41.44  ? 51  TYR B CA    1 
ATOM   1070  C  C     . TYR B 2 36  ? 6.325   18.977 -62.253 1.00 39.77  ? 51  TYR B C     1 
ATOM   1071  O  O     . TYR B 2 36  ? 5.792   19.033 -61.149 1.00 39.86  ? 51  TYR B O     1 
ATOM   1072  C  CB    . TYR B 2 36  ? 4.867   19.796 -64.190 1.00 42.29  ? 51  TYR B CB    1 
ATOM   1073  C  CG    . TYR B 2 36  ? 4.621   20.873 -65.226 1.00 43.96  ? 51  TYR B CG    1 
ATOM   1074  C  CD1   . TYR B 2 36  ? 4.086   22.102 -64.866 1.00 45.49  ? 51  TYR B CD1   1 
ATOM   1075  C  CD2   . TYR B 2 36  ? 4.995   20.691 -66.548 1.00 45.18  ? 51  TYR B CD2   1 
ATOM   1076  C  CE1   . TYR B 2 36  ? 3.926   23.121 -65.795 1.00 46.82  ? 51  TYR B CE1   1 
ATOM   1077  C  CE2   . TYR B 2 36  ? 4.818   21.693 -67.493 1.00 46.70  ? 51  TYR B CE2   1 
ATOM   1078  C  CZ    . TYR B 2 36  ? 4.283   22.911 -67.114 1.00 48.13  ? 51  TYR B CZ    1 
ATOM   1079  O  OH    . TYR B 2 36  ? 4.118   23.913 -68.047 1.00 50.35  ? 51  TYR B OH    1 
ATOM   1080  N  N     . GLU B 2 37  ? 7.185   17.984 -62.590 1.00 38.04  ? 52  GLU B N     1 
ATOM   1081  C  CA    . GLU B 2 37  ? 7.529   16.929 -61.618 1.00 36.63  ? 52  GLU B CA    1 
ATOM   1082  C  C     . GLU B 2 37  ? 8.588   17.456 -60.624 1.00 33.76  ? 52  GLU B C     1 
ATOM   1083  O  O     . GLU B 2 37  ? 8.410   17.287 -59.424 1.00 33.53  ? 52  GLU B O     1 
ATOM   1084  C  CB    . GLU B 2 37  ? 8.007   15.605 -62.282 1.00 39.86  ? 52  GLU B CB    1 
ATOM   1085  C  CG    . GLU B 2 37  ? 6.915   14.626 -62.717 1.00 46.37  ? 52  GLU B CG    1 
ATOM   1086  C  CD    . GLU B 2 37  ? 6.008   14.032 -61.646 1.00 53.69  ? 52  GLU B CD    1 
ATOM   1087  O  OE1   . GLU B 2 37  ? 6.505   13.758 -60.527 1.00 55.23  ? 52  GLU B OE1   1 
ATOM   1088  O  OE2   . GLU B 2 37  ? 4.801   13.826 -61.932 1.00 54.80  ? 52  GLU B OE2   1 
ATOM   1089  N  N     . GLU B 2 38  ? 9.655   18.138 -61.108 1.00 31.51  ? 53  GLU B N     1 
ATOM   1090  C  CA    . GLU B 2 38  ? 10.703  18.680 -60.234 1.00 29.66  ? 53  GLU B CA    1 
ATOM   1091  C  C     . GLU B 2 38  ? 10.135  19.597 -59.146 1.00 27.91  ? 53  GLU B C     1 
ATOM   1092  O  O     . GLU B 2 38  ? 10.560  19.523 -58.004 1.00 27.47  ? 53  GLU B O     1 
ATOM   1093  C  CB    . GLU B 2 38  ? 11.797  19.377 -61.047 1.00 30.59  ? 53  GLU B CB    1 
ATOM   1094  C  CG    . GLU B 2 38  ? 12.949  19.862 -60.198 1.00 33.86  ? 53  GLU B CG    1 
ATOM   1095  C  CD    . GLU B 2 38  ? 14.135  18.932 -60.016 1.00 39.27  ? 53  GLU B CD    1 
ATOM   1096  O  OE1   . GLU B 2 38  ? 14.080  17.784 -60.507 1.00 40.30  ? 53  GLU B OE1   1 
ATOM   1097  O  OE2   . GLU B 2 38  ? 15.135  19.361 -59.391 1.00 41.55  ? 53  GLU B OE2   1 
ATOM   1098  N  N     . THR B 2 39  ? 9.117   20.389 -59.484 1.00 26.98  ? 54  THR B N     1 
ATOM   1099  C  CA    . THR B 2 39  ? 8.418   21.274 -58.554 1.00 26.51  ? 54  THR B CA    1 
ATOM   1100  C  C     . THR B 2 39  ? 7.665   20.443 -57.538 1.00 25.76  ? 54  THR B C     1 
ATOM   1101  O  O     . THR B 2 39  ? 7.721   20.761 -56.361 1.00 25.81  ? 54  THR B O     1 
ATOM   1102  C  CB    . THR B 2 39  ? 7.432   22.192 -59.304 1.00 28.17  ? 54  THR B CB    1 
ATOM   1103  O  OG1   . THR B 2 39  ? 8.119   22.857 -60.354 1.00 29.57  ? 54  THR B OG1   1 
ATOM   1104  C  CG2   . THR B 2 39  ? 6.804   23.238 -58.403 1.00 28.71  ? 54  THR B CG2   1 
ATOM   1105  N  N     . ARG B 2 40  ? 6.965   19.377 -57.980 1.00 25.00  ? 55  ARG B N     1 
ATOM   1106  C  CA    . ARG B 2 40  ? 6.234   18.458 -57.094 1.00 24.69  ? 55  ARG B CA    1 
ATOM   1107  C  C     . ARG B 2 40  ? 7.179   17.802 -56.085 1.00 23.87  ? 55  ARG B C     1 
ATOM   1108  O  O     . ARG B 2 40  ? 6.803   17.592 -54.935 1.00 24.28  ? 55  ARG B O     1 
ATOM   1109  C  CB    . ARG B 2 40  ? 5.504   17.367 -57.898 1.00 25.90  ? 55  ARG B CB    1 
ATOM   1110  C  CG    . ARG B 2 40  ? 4.130   17.773 -58.368 1.00 29.44  ? 55  ARG B CG    1 
ATOM   1111  C  CD    . ARG B 2 40  ? 3.489   16.672 -59.147 1.00 33.44  ? 55  ARG B CD    1 
ATOM   1112  N  NE    . ARG B 2 40  ? 2.445   17.173 -60.034 1.00 39.02  ? 55  ARG B NE    1 
ATOM   1113  C  CZ    . ARG B 2 40  ? 2.534   17.185 -61.364 1.00 44.66  ? 55  ARG B CZ    1 
ATOM   1114  N  NH1   . ARG B 2 40  ? 3.621   16.712 -61.971 1.00 44.35  ? 55  ARG B NH1   1 
ATOM   1115  N  NH2   . ARG B 2 40  ? 1.532   17.652 -62.099 1.00 46.76  ? 55  ARG B NH2   1 
ATOM   1116  N  N     . GLY B 2 41  ? 8.395   17.489 -56.526 1.00 22.34  ? 56  GLY B N     1 
ATOM   1117  C  CA    . GLY B 2 41  ? 9.401   16.903 -55.660 1.00 21.18  ? 56  GLY B CA    1 
ATOM   1118  C  C     . GLY B 2 41  ? 9.822   17.874 -54.588 1.00 20.09  ? 56  GLY B C     1 
ATOM   1119  O  O     . GLY B 2 41  ? 9.728   17.558 -53.402 1.00 20.17  ? 56  GLY B O     1 
ATOM   1120  N  N     . VAL B 2 42  ? 10.206  19.096 -55.015 1.00 18.98  ? 57  VAL B N     1 
ATOM   1121  C  CA    . VAL B 2 42  ? 10.654  20.187 -54.164 1.00 18.20  ? 57  VAL B CA    1 
ATOM   1122  C  C     . VAL B 2 42  ? 9.571   20.665 -53.195 1.00 18.96  ? 57  VAL B C     1 
ATOM   1123  O  O     . VAL B 2 42  ? 9.892   20.950 -52.041 1.00 19.55  ? 57  VAL B O     1 
ATOM   1124  C  CB    . VAL B 2 42  ? 11.230  21.301 -55.026 1.00 18.09  ? 57  VAL B CB    1 
ATOM   1125  C  CG1   . VAL B 2 42  ? 11.476  22.560 -54.224 1.00 18.62  ? 57  VAL B CG1   1 
ATOM   1126  C  CG2   . VAL B 2 42  ? 12.520  20.834 -55.665 1.00 18.44  ? 57  VAL B CG2   1 
ATOM   1127  N  N     . LEU B 2 43  ? 8.293   20.696 -53.621 1.00 18.90  ? 58  LEU B N     1 
ATOM   1128  C  CA    . LEU B 2 43  ? 7.173   21.069 -52.743 1.00 18.98  ? 58  LEU B CA    1 
ATOM   1129  C  C     . LEU B 2 43  ? 7.009   20.007 -51.651 1.00 19.20  ? 58  LEU B C     1 
ATOM   1130  O  O     . LEU B 2 43  ? 6.786   20.350 -50.484 1.00 19.24  ? 58  LEU B O     1 
ATOM   1131  C  CB    . LEU B 2 43  ? 5.860   21.201 -53.541 1.00 18.71  ? 58  LEU B CB    1 
ATOM   1132  C  CG    . LEU B 2 43  ? 4.552   21.286 -52.727 1.00 19.43  ? 58  LEU B CG    1 
ATOM   1133  C  CD1   . LEU B 2 43  ? 4.484   22.542 -51.900 1.00 19.75  ? 58  LEU B CD1   1 
ATOM   1134  C  CD2   . LEU B 2 43  ? 3.368   21.245 -53.615 1.00 19.84  ? 58  LEU B CD2   1 
ATOM   1135  N  N     . LYS B 2 44  ? 7.127   18.721 -52.036 1.00 19.02  ? 59  LYS B N     1 
ATOM   1136  C  CA    . LYS B 2 44  ? 6.988   17.599 -51.097 1.00 19.30  ? 59  LYS B CA    1 
ATOM   1137  C  C     . LYS B 2 44  ? 8.041   17.671 -50.003 1.00 18.60  ? 59  LYS B C     1 
ATOM   1138  O  O     . LYS B 2 44  ? 7.734   17.439 -48.838 1.00 18.16  ? 59  LYS B O     1 
ATOM   1139  C  CB    . LYS B 2 44  ? 7.031   16.236 -51.812 1.00 21.34  ? 59  LYS B CB    1 
ATOM   1140  C  CG    . LYS B 2 44  ? 6.403   15.131 -50.952 1.00 26.11  ? 59  LYS B CG    1 
ATOM   1141  C  CD    . LYS B 2 44  ? 6.263   13.794 -51.657 1.00 30.79  ? 59  LYS B CD    1 
ATOM   1142  C  CE    . LYS B 2 44  ? 5.540   12.764 -50.793 1.00 34.91  ? 59  LYS B CE    1 
ATOM   1143  N  NZ    . LYS B 2 44  ? 4.794   11.736 -51.592 1.00 36.63  ? 59  LYS B NZ    1 
ATOM   1144  N  N     . VAL B 2 45  ? 9.274   18.052 -50.372 1.00 17.91  ? 60  VAL B N     1 
ATOM   1145  C  CA    . VAL B 2 45  ? 10.363  18.177 -49.413 1.00 17.01  ? 60  VAL B CA    1 
ATOM   1146  C  C     . VAL B 2 45  ? 10.052  19.302 -48.461 1.00 15.70  ? 60  VAL B C     1 
ATOM   1147  O  O     . VAL B 2 45  ? 10.069  19.094 -47.254 1.00 15.73  ? 60  VAL B O     1 
ATOM   1148  C  CB    . VAL B 2 45  ? 11.729  18.383 -50.098 1.00 17.58  ? 60  VAL B CB    1 
ATOM   1149  C  CG1   . VAL B 2 45  ? 12.831  18.558 -49.065 1.00 18.51  ? 60  VAL B CG1   1 
ATOM   1150  C  CG2   . VAL B 2 45  ? 12.045  17.235 -51.043 1.00 17.60  ? 60  VAL B CG2   1 
ATOM   1151  N  N     . PHE B 2 46  ? 9.640   20.452 -48.990 1.00 14.74  ? 61  PHE B N     1 
ATOM   1152  C  CA    . PHE B 2 46  ? 9.303   21.607 -48.167 1.00 14.93  ? 61  PHE B CA    1 
ATOM   1153  C  C     . PHE B 2 46  ? 8.200   21.280 -47.168 1.00 15.48  ? 61  PHE B C     1 
ATOM   1154  O  O     . PHE B 2 46  ? 8.344   21.537 -45.973 1.00 15.89  ? 61  PHE B O     1 
ATOM   1155  C  CB    . PHE B 2 46  ? 8.925   22.803 -49.046 1.00 14.52  ? 61  PHE B CB    1 
ATOM   1156  C  CG    . PHE B 2 46  ? 8.569   24.067 -48.284 1.00 14.82  ? 61  PHE B CG    1 
ATOM   1157  C  CD1   . PHE B 2 46  ? 7.289   24.267 -47.789 1.00 15.12  ? 61  PHE B CD1   1 
ATOM   1158  C  CD2   . PHE B 2 46  ? 9.498   25.072 -48.105 1.00 15.56  ? 61  PHE B CD2   1 
ATOM   1159  C  CE1   . PHE B 2 46  ? 6.967   25.423 -47.088 1.00 15.46  ? 61  PHE B CE1   1 
ATOM   1160  C  CE2   . PHE B 2 46  ? 9.162   26.241 -47.427 1.00 16.00  ? 61  PHE B CE2   1 
ATOM   1161  C  CZ    . PHE B 2 46  ? 7.901   26.407 -46.919 1.00 15.40  ? 61  PHE B CZ    1 
ATOM   1162  N  N     . LEU B 2 47  ? 7.135   20.658 -47.648 1.00 15.38  ? 62  LEU B N     1 
ATOM   1163  C  CA    . LEU B 2 47  ? 6.013   20.301 -46.805 1.00 15.86  ? 62  LEU B CA    1 
ATOM   1164  C  C     . LEU B 2 47  ? 6.414   19.301 -45.738 1.00 16.80  ? 62  LEU B C     1 
ATOM   1165  O  O     . LEU B 2 47  ? 5.994   19.424 -44.591 1.00 16.53  ? 62  LEU B O     1 
ATOM   1166  C  CB    . LEU B 2 47  ? 4.905   19.728 -47.666 1.00 15.52  ? 62  LEU B CB    1 
ATOM   1167  C  CG    . LEU B 2 47  ? 3.875   20.707 -48.024 1.00 16.31  ? 62  LEU B CG    1 
ATOM   1168  C  CD1   . LEU B 2 47  ? 3.111   20.270 -49.242 1.00 15.92  ? 62  LEU B CD1   1 
ATOM   1169  C  CD2   . LEU B 2 47  ? 2.985   20.945 -46.860 1.00 17.43  ? 62  LEU B CD2   1 
ATOM   1170  N  N     . GLU B 2 48  ? 7.278   18.329 -46.088 1.00 17.43  ? 63  GLU B N     1 
ATOM   1171  C  CA    . GLU B 2 48  ? 7.712   17.316 -45.135 1.00 18.21  ? 63  GLU B CA    1 
ATOM   1172  C  C     . GLU B 2 48  ? 8.434   17.991 -43.987 1.00 18.84  ? 63  GLU B C     1 
ATOM   1173  O  O     . GLU B 2 48  ? 7.993   17.861 -42.860 1.00 19.53  ? 63  GLU B O     1 
ATOM   1174  C  CB    . GLU B 2 48  ? 8.607   16.259 -45.804 1.00 20.26  ? 63  GLU B CB    1 
ATOM   1175  C  CG    . GLU B 2 48  ? 7.857   15.202 -46.602 1.00 23.19  ? 63  GLU B CG    1 
ATOM   1176  C  CD    . GLU B 2 48  ? 8.683   14.381 -47.587 1.00 25.85  ? 63  GLU B CD    1 
ATOM   1177  O  OE1   . GLU B 2 48  ? 9.878   14.712 -47.788 1.00 26.85  ? 63  GLU B OE1   1 
ATOM   1178  O  OE2   . GLU B 2 48  ? 8.128   13.417 -48.170 1.00 24.84  ? 63  GLU B OE2   1 
ATOM   1179  N  N     . ASN B 2 49  ? 9.394   18.861 -44.306 1.00 18.46  ? 64  ASN B N     1 
ATOM   1180  C  CA    . ASN B 2 49  ? 10.220  19.557 -43.331 1.00 19.05  ? 64  ASN B CA    1 
ATOM   1181  C  C     . ASN B 2 49  ? 9.417   20.447 -42.402 1.00 19.48  ? 64  ASN B C     1 
ATOM   1182  O  O     . ASN B 2 49  ? 9.629   20.408 -41.194 1.00 19.34  ? 64  ASN B O     1 
ATOM   1183  C  CB    . ASN B 2 49  ? 11.357  20.310 -44.032 1.00 20.47  ? 64  ASN B CB    1 
ATOM   1184  C  CG    . ASN B 2 49  ? 12.326  19.398 -44.798 1.00 23.66  ? 64  ASN B CG    1 
ATOM   1185  O  OD1   . ASN B 2 49  ? 12.961  19.799 -45.782 1.00 23.55  ? 64  ASN B OD1   1 
ATOM   1186  N  ND2   . ASN B 2 49  ? 12.463  18.130 -44.390 1.00 25.27  ? 64  ASN B ND2   1 
ATOM   1187  N  N     . VAL B 2 50  ? 8.447   21.183 -42.945 1.00 19.93  ? 65  VAL B N     1 
ATOM   1188  C  CA    . VAL B 2 50  ? 7.583   22.032 -42.129 1.00 20.96  ? 65  VAL B CA    1 
ATOM   1189  C  C     . VAL B 2 50  ? 6.629   21.204 -41.240 1.00 22.40  ? 65  VAL B C     1 
ATOM   1190  O  O     . VAL B 2 50  ? 6.608   21.412 -40.026 1.00 23.62  ? 65  VAL B O     1 
ATOM   1191  C  CB    . VAL B 2 50  ? 6.818   23.079 -42.967 1.00 21.36  ? 65  VAL B CB    1 
ATOM   1192  C  CG1   . VAL B 2 50  ? 5.834   23.862 -42.105 1.00 21.43  ? 65  VAL B CG1   1 
ATOM   1193  C  CG2   . VAL B 2 50  ? 7.794   24.022 -43.665 1.00 22.25  ? 65  VAL B CG2   1 
ATOM   1194  N  N     . ILE B 2 51  ? 5.865   20.258 -41.829 1.00 21.61  ? 66  ILE B N     1 
ATOM   1195  C  CA    . ILE B 2 51  ? 4.927   19.440 -41.084 1.00 21.49  ? 66  ILE B CA    1 
ATOM   1196  C  C     . ILE B 2 51  ? 5.622   18.593 -40.031 1.00 22.58  ? 66  ILE B C     1 
ATOM   1197  O  O     . ILE B 2 51  ? 5.122   18.499 -38.928 1.00 23.49  ? 66  ILE B O     1 
ATOM   1198  C  CB    . ILE B 2 51  ? 4.035   18.604 -42.012 1.00 20.97  ? 66  ILE B CB    1 
ATOM   1199  C  CG1   . ILE B 2 51  ? 3.255   19.519 -42.952 1.00 21.13  ? 66  ILE B CG1   1 
ATOM   1200  C  CG2   . ILE B 2 51  ? 3.095   17.701 -41.207 1.00 20.87  ? 66  ILE B CG2   1 
ATOM   1201  C  CD1   . ILE B 2 51  ? 2.566   18.823 -44.030 1.00 22.14  ? 66  ILE B CD1   1 
ATOM   1202  N  N     . ARG B 2 52  ? 6.814   18.079 -40.304 1.00 22.33  ? 67  ARG B N     1 
ATOM   1203  C  CA    . ARG B 2 52  ? 7.580   17.303 -39.320 1.00 22.64  ? 67  ARG B CA    1 
ATOM   1204  C  C     . ARG B 2 52  ? 7.810   18.090 -38.028 1.00 21.98  ? 67  ARG B C     1 
ATOM   1205  O  O     . ARG B 2 52  ? 7.588   17.560 -36.944 1.00 22.15  ? 67  ARG B O     1 
ATOM   1206  C  CB    . ARG B 2 52  ? 8.928   16.878 -39.906 1.00 24.82  ? 67  ARG B CB    1 
ATOM   1207  C  CG    . ARG B 2 52  ? 9.815   16.098 -38.956 1.00 29.65  ? 67  ARG B CG    1 
ATOM   1208  C  CD    . ARG B 2 52  ? 11.196  15.880 -39.557 1.00 35.65  ? 67  ARG B CD    1 
ATOM   1209  N  NE    . ARG B 2 52  ? 11.141  15.139 -40.823 1.00 41.07  ? 67  ARG B NE    1 
ATOM   1210  C  CZ    . ARG B 2 52  ? 11.568  15.613 -41.993 1.00 44.23  ? 67  ARG B CZ    1 
ATOM   1211  N  NH1   . ARG B 2 52  ? 12.121  16.821 -42.065 1.00 42.67  ? 67  ARG B NH1   1 
ATOM   1212  N  NH2   . ARG B 2 52  ? 11.460  14.872 -43.098 1.00 44.96  ? 67  ARG B NH2   1 
ATOM   1213  N  N     . ASP B 2 53  ? 8.221   19.356 -38.148 1.00 21.11  ? 68  ASP B N     1 
ATOM   1214  C  CA    . ASP B 2 53  ? 8.465   20.191 -36.980 1.00 20.94  ? 68  ASP B CA    1 
ATOM   1215  C  C     . ASP B 2 53  ? 7.141   20.627 -36.349 1.00 21.24  ? 68  ASP B C     1 
ATOM   1216  O  O     . ASP B 2 53  ? 6.998   20.559 -35.134 1.00 21.33  ? 68  ASP B O     1 
ATOM   1217  C  CB    . ASP B 2 53  ? 9.334   21.403 -37.335 1.00 21.29  ? 68  ASP B CB    1 
ATOM   1218  C  CG    . ASP B 2 53  ? 10.745  21.085 -37.793 1.00 23.15  ? 68  ASP B CG    1 
ATOM   1219  O  OD1   . ASP B 2 53  ? 11.216  19.955 -37.533 1.00 22.20  ? 68  ASP B OD1   1 
ATOM   1220  O  OD2   . ASP B 2 53  ? 11.392  21.983 -38.396 1.00 25.06  ? 68  ASP B OD2   1 
ATOM   1221  N  N     . ALA B 2 54  ? 6.138   20.962 -37.167 1.00 21.20  ? 69  ALA B N     1 
ATOM   1222  C  CA    . ALA B 2 54  ? 4.815   21.360 -36.680 1.00 21.76  ? 69  ALA B CA    1 
ATOM   1223  C  C     . ALA B 2 54  ? 4.201   20.274 -35.822 1.00 21.84  ? 69  ALA B C     1 
ATOM   1224  O  O     . ALA B 2 54  ? 3.679   20.551 -34.748 1.00 21.91  ? 69  ALA B O     1 
ATOM   1225  C  CB    . ALA B 2 54  ? 3.887   21.677 -37.855 1.00 22.27  ? 69  ALA B CB    1 
ATOM   1226  N  N     . VAL B 2 55  ? 4.337   19.027 -36.264 1.00 21.80  ? 70  VAL B N     1 
ATOM   1227  C  CA    . VAL B 2 55  ? 3.820   17.867 -35.586 1.00 21.97  ? 70  VAL B CA    1 
ATOM   1228  C  C     . VAL B 2 55  ? 4.653   17.604 -34.353 1.00 23.02  ? 70  VAL B C     1 
ATOM   1229  O  O     . VAL B 2 55  ? 4.067   17.377 -33.313 1.00 23.36  ? 70  VAL B O     1 
ATOM   1230  C  CB    . VAL B 2 55  ? 3.737   16.694 -36.562 1.00 22.02  ? 70  VAL B CB    1 
ATOM   1231  C  CG1   . VAL B 2 55  ? 3.534   15.380 -35.837 1.00 22.62  ? 70  VAL B CG1   1 
ATOM   1232  C  CG2   . VAL B 2 55  ? 2.617   16.931 -37.562 1.00 22.26  ? 70  VAL B CG2   1 
ATOM   1233  N  N     . THR B 2 56  ? 5.987   17.774 -34.410 1.00 23.40  ? 71  THR B N     1 
ATOM   1234  C  CA    . THR B 2 56  ? 6.869   17.664 -33.240 1.00 24.06  ? 71  THR B CA    1 
ATOM   1235  C  C     . THR B 2 56  ? 6.432   18.670 -32.145 1.00 25.15  ? 71  THR B C     1 
ATOM   1236  O  O     . THR B 2 56  ? 6.543   18.363 -30.962 1.00 25.97  ? 71  THR B O     1 
ATOM   1237  C  CB    . THR B 2 56  ? 8.320   17.916 -33.648 1.00 24.87  ? 71  THR B CB    1 
ATOM   1238  O  OG1   . THR B 2 56  ? 8.650   17.121 -34.785 1.00 25.71  ? 71  THR B OG1   1 
ATOM   1239  C  CG2   . THR B 2 56  ? 9.300   17.643 -32.532 1.00 25.01  ? 71  THR B CG2   1 
ATOM   1240  N  N     . TYR B 2 57  ? 5.896   19.840 -32.536 1.00 25.03  ? 72  TYR B N     1 
ATOM   1241  C  CA    . TYR B 2 57  ? 5.385   20.831 -31.583 1.00 25.98  ? 72  TYR B CA    1 
ATOM   1242  C  C     . TYR B 2 57  ? 4.073   20.346 -30.974 1.00 28.31  ? 72  TYR B C     1 
ATOM   1243  O  O     . TYR B 2 57  ? 3.889   20.434 -29.756 1.00 28.82  ? 72  TYR B O     1 
ATOM   1244  C  CB    . TYR B 2 57  ? 5.173   22.213 -32.248 1.00 24.82  ? 72  TYR B CB    1 
ATOM   1245  C  CG    . TYR B 2 57  ? 6.427   23.049 -32.299 1.00 23.81  ? 72  TYR B CG    1 
ATOM   1246  C  CD1   . TYR B 2 57  ? 7.089   23.408 -31.139 1.00 24.05  ? 72  TYR B CD1   1 
ATOM   1247  C  CD2   . TYR B 2 57  ? 6.952   23.478 -33.507 1.00 23.79  ? 72  TYR B CD2   1 
ATOM   1248  C  CE1   . TYR B 2 57  ? 8.258   24.147 -31.178 1.00 24.60  ? 72  TYR B CE1   1 
ATOM   1249  C  CE2   . TYR B 2 57  ? 8.132   24.201 -33.560 1.00 24.21  ? 72  TYR B CE2   1 
ATOM   1250  C  CZ    . TYR B 2 57  ? 8.779   24.538 -32.390 1.00 25.15  ? 72  TYR B CZ    1 
ATOM   1251  O  OH    . TYR B 2 57  ? 9.945   25.252 -32.401 1.00 26.78  ? 72  TYR B OH    1 
ATOM   1252  N  N     . THR B 2 58  ? 3.175   19.823 -31.831 1.00 29.35  ? 73  THR B N     1 
ATOM   1253  C  CA    . THR B 2 58  ? 1.874   19.274 -31.476 1.00 30.77  ? 73  THR B CA    1 
ATOM   1254  C  C     . THR B 2 58  ? 2.072   18.132 -30.474 1.00 32.44  ? 73  THR B C     1 
ATOM   1255  O  O     . THR B 2 58  ? 1.485   18.161 -29.401 1.00 32.81  ? 73  THR B O     1 
ATOM   1256  C  CB    . THR B 2 58  ? 1.153   18.823 -32.756 1.00 31.65  ? 73  THR B CB    1 
ATOM   1257  O  OG1   . THR B 2 58  ? 1.121   19.917 -33.658 1.00 32.75  ? 73  THR B OG1   1 
ATOM   1258  C  CG2   . THR B 2 58  ? -0.253  18.349 -32.505 1.00 31.80  ? 73  THR B CG2   1 
ATOM   1259  N  N     . GLU B 2 59  ? 2.967   17.190 -30.777 1.00 33.27  ? 74  GLU B N     1 
ATOM   1260  C  CA    . GLU B 2 59  ? 3.277   16.069 -29.910 1.00 34.94  ? 74  GLU B CA    1 
ATOM   1261  C  C     . GLU B 2 59  ? 3.835   16.540 -28.579 1.00 36.27  ? 74  GLU B C     1 
ATOM   1262  O  O     . GLU B 2 59  ? 3.469   15.980 -27.546 1.00 36.73  ? 74  GLU B O     1 
ATOM   1263  C  CB    . GLU B 2 59  ? 4.260   15.094 -30.577 1.00 37.63  ? 74  GLU B CB    1 
ATOM   1264  C  CG    . GLU B 2 59  ? 3.667   14.275 -31.704 1.00 43.42  ? 74  GLU B CG    1 
ATOM   1265  C  CD    . GLU B 2 59  ? 4.522   13.082 -32.101 1.00 52.26  ? 74  GLU B CD    1 
ATOM   1266  O  OE1   . GLU B 2 59  ? 5.505   13.280 -32.852 1.00 53.66  ? 74  GLU B OE1   1 
ATOM   1267  O  OE2   . GLU B 2 59  ? 4.215   11.948 -31.662 1.00 55.25  ? 74  GLU B OE2   1 
ATOM   1268  N  N     . HIS B 2 60  ? 4.703   17.559 -28.584 1.00 37.03  ? 75  HIS B N     1 
ATOM   1269  C  CA    . HIS B 2 60  ? 5.240   18.083 -27.327 1.00 38.49  ? 75  HIS B CA    1 
ATOM   1270  C  C     . HIS B 2 60  ? 4.129   18.713 -26.492 1.00 40.60  ? 75  HIS B C     1 
ATOM   1271  O  O     . HIS B 2 60  ? 4.103   18.544 -25.273 1.00 40.96  ? 75  HIS B O     1 
ATOM   1272  C  CB    . HIS B 2 60  ? 6.366   19.089 -27.539 1.00 38.28  ? 75  HIS B CB    1 
ATOM   1273  C  CG    . HIS B 2 60  ? 6.981   19.497 -26.249 1.00 39.57  ? 75  HIS B CG    1 
ATOM   1274  N  ND1   . HIS B 2 60  ? 6.564   20.629 -25.584 1.00 41.40  ? 75  HIS B ND1   1 
ATOM   1275  C  CD2   . HIS B 2 60  ? 7.897   18.855 -25.490 1.00 40.74  ? 75  HIS B CD2   1 
ATOM   1276  C  CE1   . HIS B 2 60  ? 7.287   20.686 -24.479 1.00 41.98  ? 75  HIS B CE1   1 
ATOM   1277  N  NE2   . HIS B 2 60  ? 8.120   19.647 -24.389 1.00 42.15  ? 75  HIS B NE2   1 
ATOM   1278  N  N     . ALA B 2 61  ? 3.192   19.415 -27.148 1.00 41.40  ? 76  ALA B N     1 
ATOM   1279  C  CA    . ALA B 2 61  ? 2.047   20.024 -26.475 1.00 42.39  ? 76  ALA B CA    1 
ATOM   1280  C  C     . ALA B 2 61  ? 1.002   19.007 -25.975 1.00 43.57  ? 76  ALA B C     1 
ATOM   1281  O  O     . ALA B 2 61  ? -0.014  19.417 -25.410 1.00 44.12  ? 76  ALA B O     1 
ATOM   1282  C  CB    . ALA B 2 61  ? 1.381   21.004 -27.411 1.00 42.56  ? 76  ALA B CB    1 
ATOM   1283  N  N     . LYS B 2 62  ? 1.245   17.696 -26.202 1.00 43.65  ? 77  LYS B N     1 
ATOM   1284  C  CA    . LYS B 2 62  ? 0.365   16.593 -25.858 1.00 44.37  ? 77  LYS B CA    1 
ATOM   1285  C  C     . LYS B 2 62  ? -0.981  16.706 -26.578 1.00 44.55  ? 77  LYS B C     1 
ATOM   1286  O  O     . LYS B 2 62  ? -1.994  16.266 -26.048 1.00 45.13  ? 77  LYS B O     1 
ATOM   1287  C  CB    . LYS B 2 62  ? 0.226   16.427 -24.332 1.00 46.49  ? 77  LYS B CB    1 
ATOM   1288  C  CG    . LYS B 2 62  ? 1.385   15.646 -23.714 1.00 50.84  ? 77  LYS B CG    1 
ATOM   1289  C  CD    . LYS B 2 62  ? 1.545   15.956 -22.219 1.00 55.43  ? 77  LYS B CD    1 
ATOM   1290  C  CE    . LYS B 2 62  ? 2.718   15.230 -21.577 1.00 58.82  ? 77  LYS B CE    1 
ATOM   1291  N  NZ    . LYS B 2 62  ? 3.350   16.027 -20.471 1.00 60.46  ? 77  LYS B NZ    1 
ATOM   1292  N  N     . ARG B 2 63  ? -0.986  17.249 -27.802 1.00 43.90  ? 78  ARG B N     1 
ATOM   1293  C  CA    . ARG B 2 63  ? -2.208  17.411 -28.563 1.00 44.21  ? 78  ARG B CA    1 
ATOM   1294  C  C     . ARG B 2 63  ? -2.296  16.497 -29.785 1.00 44.96  ? 78  ARG B C     1 
ATOM   1295  O  O     . ARG B 2 63  ? -1.282  16.012 -30.281 1.00 44.88  ? 78  ARG B O     1 
ATOM   1296  C  CB    . ARG B 2 63  ? -2.341  18.859 -29.009 1.00 45.10  ? 78  ARG B CB    1 
ATOM   1297  C  CG    . ARG B 2 63  ? -2.345  19.840 -27.860 1.00 47.71  ? 78  ARG B CG    1 
ATOM   1298  C  CD    . ARG B 2 63  ? -2.808  21.207 -28.322 1.00 49.53  ? 78  ARG B CD    1 
ATOM   1299  N  NE    . ARG B 2 63  ? -1.695  22.144 -28.468 1.00 50.76  ? 78  ARG B NE    1 
ATOM   1300  C  CZ    . ARG B 2 63  ? -1.026  22.349 -29.595 1.00 51.45  ? 78  ARG B CZ    1 
ATOM   1301  N  NH1   . ARG B 2 63  ? -1.328  21.661 -30.688 1.00 50.37  ? 78  ARG B NH1   1 
ATOM   1302  N  NH2   . ARG B 2 63  ? -0.035  23.227 -29.634 1.00 51.47  ? 78  ARG B NH2   1 
ATOM   1303  N  N     . LYS B 2 64  ? -3.530  16.252 -30.256 1.00 45.39  ? 79  LYS B N     1 
ATOM   1304  C  CA    . LYS B 2 64  ? -3.836  15.476 -31.473 1.00 45.84  ? 79  LYS B CA    1 
ATOM   1305  C  C     . LYS B 2 64  ? -4.126  16.420 -32.658 1.00 44.94  ? 79  LYS B C     1 
ATOM   1306  O  O     . LYS B 2 64  ? -4.110  15.970 -33.795 1.00 45.15  ? 79  LYS B O     1 
ATOM   1307  C  CB    . LYS B 2 64  ? -5.058  14.558 -31.264 1.00 48.73  ? 79  LYS B CB    1 
ATOM   1308  C  CG    . LYS B 2 64  ? -4.733  13.135 -30.829 1.00 53.99  ? 79  LYS B CG    1 
ATOM   1309  C  CD    . LYS B 2 64  ? -5.830  12.166 -31.310 1.00 59.69  ? 79  LYS B CD    1 
ATOM   1310  C  CE    . LYS B 2 64  ? -5.542  10.710 -30.987 1.00 64.79  ? 79  LYS B CE    1 
ATOM   1311  N  NZ    . LYS B 2 64  ? -4.420  10.139 -31.798 1.00 67.50  ? 79  LYS B NZ    1 
ATOM   1312  N  N     . THR B 2 65  ? -4.434  17.705 -32.383 1.00 43.75  ? 80  THR B N     1 
ATOM   1313  C  CA    . THR B 2 65  ? -4.733  18.720 -33.386 1.00 42.98  ? 80  THR B CA    1 
ATOM   1314  C  C     . THR B 2 65  ? -3.556  19.700 -33.564 1.00 40.58  ? 80  THR B C     1 
ATOM   1315  O  O     . THR B 2 65  ? -3.154  20.376 -32.615 1.00 40.21  ? 80  THR B O     1 
ATOM   1316  C  CB    . THR B 2 65  ? -6.006  19.491 -33.019 1.00 45.07  ? 80  THR B CB    1 
ATOM   1317  O  OG1   . THR B 2 65  ? -7.012  18.593 -32.525 1.00 46.88  ? 80  THR B OG1   1 
ATOM   1318  C  CG2   . THR B 2 65  ? -6.518  20.336 -34.181 1.00 45.25  ? 80  THR B CG2   1 
ATOM   1319  N  N     . VAL B 2 66  ? -3.009  19.741 -34.789 1.00 38.53  ? 81  VAL B N     1 
ATOM   1320  C  CA    . VAL B 2 66  ? -1.921  20.594 -35.232 1.00 36.77  ? 81  VAL B CA    1 
ATOM   1321  C  C     . VAL B 2 66  ? -2.534  21.977 -35.394 1.00 35.18  ? 81  VAL B C     1 
ATOM   1322  O  O     . VAL B 2 66  ? -3.390  22.165 -36.266 1.00 35.36  ? 81  VAL B O     1 
ATOM   1323  C  CB    . VAL B 2 66  ? -1.334  20.050 -36.561 1.00 36.94  ? 81  VAL B CB    1 
ATOM   1324  C  CG1   . VAL B 2 66  ? -0.283  20.992 -37.132 1.00 37.37  ? 81  VAL B CG1   1 
ATOM   1325  C  CG2   . VAL B 2 66  ? -0.746  18.660 -36.356 1.00 37.16  ? 81  VAL B CG2   1 
ATOM   1326  N  N     . THR B 2 67  ? -2.168  22.922 -34.498 1.00 33.11  ? 82  THR B N     1 
ATOM   1327  C  CA    . THR B 2 67  ? -2.748  24.257 -34.520 1.00 31.74  ? 82  THR B CA    1 
ATOM   1328  C  C     . THR B 2 67  ? -2.021  25.180 -35.519 1.00 30.32  ? 82  THR B C     1 
ATOM   1329  O  O     . THR B 2 67  ? -0.989  24.813 -36.069 1.00 29.78  ? 82  THR B O     1 
ATOM   1330  C  CB    . THR B 2 67  ? -2.843  24.833 -33.083 1.00 32.40  ? 82  THR B CB    1 
ATOM   1331  O  OG1   . THR B 2 67  ? -1.549  25.098 -32.562 1.00 33.30  ? 82  THR B OG1   1 
ATOM   1332  C  CG2   . THR B 2 67  ? -3.600  23.940 -32.144 1.00 32.54  ? 82  THR B CG2   1 
ATOM   1333  N  N     . ALA B 2 68  ? -2.595  26.358 -35.790 1.00 29.70  ? 83  ALA B N     1 
ATOM   1334  C  CA    . ALA B 2 68  ? -1.990  27.367 -36.653 1.00 29.23  ? 83  ALA B CA    1 
ATOM   1335  C  C     . ALA B 2 68  ? -0.643  27.813 -36.076 1.00 28.65  ? 83  ALA B C     1 
ATOM   1336  O  O     . ALA B 2 68  ? 0.294   28.042 -36.833 1.00 28.68  ? 83  ALA B O     1 
ATOM   1337  C  CB    . ALA B 2 68  ? -2.913  28.555 -36.760 1.00 29.10  ? 83  ALA B CB    1 
ATOM   1338  N  N     . MET B 2 69  ? -0.540  27.886 -34.732 1.00 27.88  ? 84  MET B N     1 
ATOM   1339  C  CA    . MET B 2 69  ? 0.688   28.239 -34.035 1.00 27.33  ? 84  MET B CA    1 
ATOM   1340  C  C     . MET B 2 69  ? 1.782   27.244 -34.234 1.00 25.44  ? 84  MET B C     1 
ATOM   1341  O  O     . MET B 2 69  ? 2.898   27.644 -34.472 1.00 25.16  ? 84  MET B O     1 
ATOM   1342  C  CB    . MET B 2 69  ? 0.448   28.493 -32.546 1.00 29.06  ? 84  MET B CB    1 
ATOM   1343  C  CG    . MET B 2 69  ? -0.195  29.829 -32.292 1.00 33.47  ? 84  MET B CG    1 
ATOM   1344  S  SD    . MET B 2 69  ? 0.763   31.216 -32.977 1.00 41.03  ? 84  MET B SD    1 
ATOM   1345  C  CE    . MET B 2 69  ? 1.394   31.905 -31.465 1.00 43.52  ? 84  MET B CE    1 
ATOM   1346  N  N     . ASP B 2 70  ? 1.467   25.960 -34.245 1.00 24.19  ? 85  ASP B N     1 
ATOM   1347  C  CA    . ASP B 2 70  ? 2.461   24.917 -34.493 1.00 23.50  ? 85  ASP B CA    1 
ATOM   1348  C  C     . ASP B 2 70  ? 3.059   25.070 -35.879 1.00 21.45  ? 85  ASP B C     1 
ATOM   1349  O  O     . ASP B 2 70  ? 4.270   25.002 -36.011 1.00 21.34  ? 85  ASP B O     1 
ATOM   1350  C  CB    . ASP B 2 70  ? 1.838   23.528 -34.304 1.00 26.20  ? 85  ASP B CB    1 
ATOM   1351  C  CG    . ASP B 2 70  ? 1.256   23.301 -32.920 1.00 32.14  ? 85  ASP B CG    1 
ATOM   1352  O  OD1   . ASP B 2 70  ? 1.516   24.145 -32.007 1.00 32.58  ? 85  ASP B OD1   1 
ATOM   1353  O  OD2   . ASP B 2 70  ? 0.540   22.291 -32.741 1.00 35.24  ? 85  ASP B OD2   1 
ATOM   1354  N  N     . VAL B 2 71  ? 2.226   25.363 -36.884 1.00 19.91  ? 86  VAL B N     1 
ATOM   1355  C  CA    . VAL B 2 71  ? 2.701   25.609 -38.245 1.00 19.25  ? 86  VAL B CA    1 
ATOM   1356  C  C     . VAL B 2 71  ? 3.524   26.889 -38.309 1.00 19.46  ? 86  VAL B C     1 
ATOM   1357  O  O     . VAL B 2 71  ? 4.503   26.948 -39.049 1.00 19.55  ? 86  VAL B O     1 
ATOM   1358  C  CB    . VAL B 2 71  ? 1.557   25.583 -39.274 1.00 19.31  ? 86  VAL B CB    1 
ATOM   1359  C  CG1   . VAL B 2 71  ? 1.994   26.137 -40.613 1.00 19.06  ? 86  VAL B CG1   1 
ATOM   1360  C  CG2   . VAL B 2 71  ? 1.048   24.163 -39.443 1.00 20.34  ? 86  VAL B CG2   1 
ATOM   1361  N  N     . VAL B 2 72  ? 3.154   27.899 -37.512 1.00 19.44  ? 87  VAL B N     1 
ATOM   1362  C  CA    . VAL B 2 72  ? 3.878   29.156 -37.441 1.00 19.65  ? 87  VAL B CA    1 
ATOM   1363  C  C     . VAL B 2 72  ? 5.249   28.953 -36.781 1.00 20.11  ? 87  VAL B C     1 
ATOM   1364  O  O     . VAL B 2 72  ? 6.248   29.399 -37.331 1.00 21.11  ? 87  VAL B O     1 
ATOM   1365  C  CB    . VAL B 2 72  ? 3.033   30.243 -36.753 1.00 20.07  ? 87  VAL B CB    1 
ATOM   1366  C  CG1   . VAL B 2 72  ? 3.897   31.402 -36.272 1.00 21.00  ? 87  VAL B CG1   1 
ATOM   1367  C  CG2   . VAL B 2 72  ? 1.937   30.744 -37.683 1.00 20.42  ? 87  VAL B CG2   1 
ATOM   1368  N  N     . TYR B 2 73  ? 5.311   28.265 -35.638 1.00 19.37  ? 88  TYR B N     1 
ATOM   1369  C  CA    . TYR B 2 73  ? 6.572   28.027 -34.951 1.00 19.53  ? 88  TYR B CA    1 
ATOM   1370  C  C     . TYR B 2 73  ? 7.507   27.201 -35.815 1.00 19.36  ? 88  TYR B C     1 
ATOM   1371  O  O     . TYR B 2 73  ? 8.720   27.444 -35.808 1.00 19.89  ? 88  TYR B O     1 
ATOM   1372  C  CB    . TYR B 2 73  ? 6.348   27.303 -33.637 1.00 20.34  ? 88  TYR B CB    1 
ATOM   1373  C  CG    . TYR B 2 73  ? 5.567   28.069 -32.607 1.00 22.86  ? 88  TYR B CG    1 
ATOM   1374  C  CD1   . TYR B 2 73  ? 5.639   29.453 -32.537 1.00 25.11  ? 88  TYR B CD1   1 
ATOM   1375  C  CD2   . TYR B 2 73  ? 4.747   27.414 -31.705 1.00 24.85  ? 88  TYR B CD2   1 
ATOM   1376  C  CE1   . TYR B 2 73  ? 4.910   30.166 -31.591 1.00 26.77  ? 88  TYR B CE1   1 
ATOM   1377  C  CE2   . TYR B 2 73  ? 4.012   28.113 -30.756 1.00 26.75  ? 88  TYR B CE2   1 
ATOM   1378  C  CZ    . TYR B 2 73  ? 4.098   29.491 -30.697 1.00 28.50  ? 88  TYR B CZ    1 
ATOM   1379  O  OH    . TYR B 2 73  ? 3.406   30.167 -29.716 1.00 31.34  ? 88  TYR B OH    1 
ATOM   1380  N  N     . ALA B 2 74  ? 6.938   26.209 -36.554 1.00 18.16  ? 89  ALA B N     1 
ATOM   1381  C  CA    . ALA B 2 74  ? 7.672   25.358 -37.465 1.00 17.63  ? 89  ALA B CA    1 
ATOM   1382  C  C     . ALA B 2 74  ? 8.257   26.194 -38.557 1.00 18.31  ? 89  ALA B C     1 
ATOM   1383  O  O     . ALA B 2 74  ? 9.415   26.006 -38.847 1.00 19.07  ? 89  ALA B O     1 
ATOM   1384  C  CB    . ALA B 2 74  ? 6.765   24.298 -38.066 1.00 17.44  ? 89  ALA B CB    1 
ATOM   1385  N  N     . LEU B 2 75  ? 7.506   27.155 -39.125 1.00 18.15  ? 90  LEU B N     1 
ATOM   1386  C  CA    . LEU B 2 75  ? 8.013   28.010 -40.183 1.00 18.68  ? 90  LEU B CA    1 
ATOM   1387  C  C     . LEU B 2 75  ? 9.146   28.891 -39.680 1.00 21.93  ? 90  LEU B C     1 
ATOM   1388  O  O     . LEU B 2 75  ? 10.191  28.914 -40.321 1.00 22.92  ? 90  LEU B O     1 
ATOM   1389  C  CB    . LEU B 2 75  ? 6.891   28.837 -40.803 1.00 16.91  ? 90  LEU B CB    1 
ATOM   1390  C  CG    . LEU B 2 75  ? 6.045   28.097 -41.800 1.00 15.62  ? 90  LEU B CG    1 
ATOM   1391  C  CD1   . LEU B 2 75  ? 4.719   28.778 -42.012 1.00 14.64  ? 90  LEU B CD1   1 
ATOM   1392  C  CD2   . LEU B 2 75  ? 6.814   27.844 -43.079 1.00 15.80  ? 90  LEU B CD2   1 
ATOM   1393  N  N     . LYS B 2 76  ? 9.009   29.527 -38.494 1.00 23.44  ? 91  LYS B N     1 
ATOM   1394  C  CA    . LYS B 2 76  ? 10.085  30.336 -37.918 1.00 25.49  ? 91  LYS B CA    1 
ATOM   1395  C  C     . LYS B 2 76  ? 11.368  29.496 -37.736 1.00 27.52  ? 91  LYS B C     1 
ATOM   1396  O  O     . LYS B 2 76  ? 12.451  29.996 -38.040 1.00 28.59  ? 91  LYS B O     1 
ATOM   1397  C  CB    . LYS B 2 76  ? 9.662   31.017 -36.604 1.00 27.71  ? 91  LYS B CB    1 
ATOM   1398  C  CG    . LYS B 2 76  ? 10.529  32.229 -36.231 1.00 33.62  ? 91  LYS B CG    1 
ATOM   1399  C  CD    . LYS B 2 76  ? 9.825   33.226 -35.261 1.00 40.35  ? 91  LYS B CD    1 
ATOM   1400  C  CE    . LYS B 2 76  ? 10.287  33.146 -33.808 1.00 45.95  ? 91  LYS B CE    1 
ATOM   1401  N  NZ    . LYS B 2 76  ? 9.193   32.806 -32.819 1.00 48.61  ? 91  LYS B NZ    1 
ATOM   1402  N  N     . ARG B 2 77  ? 11.241  28.210 -37.339 1.00 27.89  ? 92  ARG B N     1 
ATOM   1403  C  CA    . ARG B 2 77  ? 12.383  27.310 -37.185 1.00 29.12  ? 92  ARG B CA    1 
ATOM   1404  C  C     . ARG B 2 77  ? 13.079  27.119 -38.537 1.00 29.81  ? 92  ARG B C     1 
ATOM   1405  O  O     . ARG B 2 77  ? 14.303  27.169 -38.612 1.00 30.33  ? 92  ARG B O     1 
ATOM   1406  C  CB    . ARG B 2 77  ? 11.937  25.944 -36.629 1.00 30.81  ? 92  ARG B CB    1 
ATOM   1407  C  CG    . ARG B 2 77  ? 12.238  25.756 -35.155 1.00 34.76  ? 92  ARG B CG    1 
ATOM   1408  C  CD    . ARG B 2 77  ? 12.823  24.396 -34.843 1.00 38.27  ? 92  ARG B CD    1 
ATOM   1409  N  NE    . ARG B 2 77  ? 14.189  24.273 -35.346 1.00 43.55  ? 92  ARG B NE    1 
ATOM   1410  C  CZ    . ARG B 2 77  ? 14.543  23.526 -36.395 1.00 48.48  ? 92  ARG B CZ    1 
ATOM   1411  N  NH1   . ARG B 2 77  ? 13.635  22.806 -37.045 1.00 49.35  ? 92  ARG B NH1   1 
ATOM   1412  N  NH2   . ARG B 2 77  ? 15.811  23.482 -36.790 1.00 48.52  ? 92  ARG B NH2   1 
ATOM   1413  N  N     . GLN B 2 78  ? 12.291  26.924 -39.607 1.00 29.42  ? 93  GLN B N     1 
ATOM   1414  C  CA    . GLN B 2 78  ? 12.799  26.754 -40.972 1.00 29.01  ? 93  GLN B CA    1 
ATOM   1415  C  C     . GLN B 2 78  ? 13.320  28.059 -41.585 1.00 28.24  ? 93  GLN B C     1 
ATOM   1416  O  O     . GLN B 2 78  ? 13.821  28.032 -42.706 1.00 29.07  ? 93  GLN B O     1 
ATOM   1417  C  CB    . GLN B 2 78  ? 11.694  26.222 -41.908 1.00 30.77  ? 93  GLN B CB    1 
ATOM   1418  C  CG    . GLN B 2 78  ? 11.085  24.893 -41.524 1.00 34.79  ? 93  GLN B CG    1 
ATOM   1419  C  CD    . GLN B 2 78  ? 12.114  23.801 -41.481 1.00 42.09  ? 93  GLN B CD    1 
ATOM   1420  O  OE1   . GLN B 2 78  ? 12.810  23.532 -42.472 1.00 45.10  ? 93  GLN B OE1   1 
ATOM   1421  N  NE2   . GLN B 2 78  ? 12.235  23.140 -40.329 1.00 42.59  ? 93  GLN B NE2   1 
ATOM   1422  N  N     . GLY B 2 79  ? 13.155  29.183 -40.898 1.00 26.63  ? 94  GLY B N     1 
ATOM   1423  C  CA    . GLY B 2 79  ? 13.547  30.484 -41.413 1.00 25.81  ? 94  GLY B CA    1 
ATOM   1424  C  C     . GLY B 2 79  ? 12.604  30.948 -42.498 1.00 24.75  ? 94  GLY B C     1 
ATOM   1425  O  O     . GLY B 2 79  ? 13.027  31.613 -43.443 1.00 25.72  ? 94  GLY B O     1 
ATOM   1426  N  N     . ARG B 2 80  ? 11.332  30.609 -42.358 1.00 23.09  ? 95  ARG B N     1 
ATOM   1427  C  CA    . ARG B 2 80  ? 10.337  31.063 -43.350 1.00 22.93  ? 95  ARG B CA    1 
ATOM   1428  C  C     . ARG B 2 80  ? 9.247   31.483 -42.381 1.00 23.25  ? 95  ARG B C     1 
ATOM   1429  O  O     . ARG B 2 80  ? 8.179   30.897 -42.463 1.00 23.88  ? 95  ARG B O     1 
ATOM   1430  C  CB    . ARG B 2 80  ? 9.771   29.921 -44.189 1.00 23.93  ? 95  ARG B CB    1 
ATOM   1431  C  CG    . ARG B 2 80  ? 10.802  28.905 -44.639 1.00 25.75  ? 95  ARG B CG    1 
ATOM   1432  C  CD    . ARG B 2 80  ? 11.366  29.152 -46.009 1.00 26.87  ? 95  ARG B CD    1 
ATOM   1433  N  NE    . ARG B 2 80  ? 10.569  30.019 -46.831 1.00 27.94  ? 95  ARG B NE    1 
ATOM   1434  C  CZ    . ARG B 2 80  ? 11.122  30.797 -47.722 1.00 30.09  ? 95  ARG B CZ    1 
ATOM   1435  N  NH1   . ARG B 2 80  ? 12.429  30.779 -47.836 1.00 30.88  ? 95  ARG B NH1   1 
ATOM   1436  N  NH2   . ARG B 2 80  ? 10.400  31.581 -48.488 1.00 28.83  ? 95  ARG B NH2   1 
ATOM   1437  N  N     . THR B 2 81  ? 9.561   32.475 -41.544 1.00 22.05  ? 96  THR B N     1 
ATOM   1438  C  CA    . THR B 2 81  ? 8.715   33.286 -40.629 1.00 20.87  ? 96  THR B CA    1 
ATOM   1439  C  C     . THR B 2 81  ? 7.445   33.754 -41.327 1.00 19.36  ? 96  THR B C     1 
ATOM   1440  O  O     . THR B 2 81  ? 7.561   34.490 -42.284 1.00 19.17  ? 96  THR B O     1 
ATOM   1441  C  CB    . THR B 2 81  ? 9.502   34.518 -40.182 1.00 22.49  ? 96  THR B CB    1 
ATOM   1442  O  OG1   . THR B 2 81  ? 10.771  34.066 -39.731 1.00 23.32  ? 96  THR B OG1   1 
ATOM   1443  C  CG2   . THR B 2 81  ? 8.845   35.306 -39.077 1.00 22.91  ? 96  THR B CG2   1 
ATOM   1444  N  N     . LEU B 2 82  ? 6.276   33.381 -40.817 1.00 18.09  ? 97  LEU B N     1 
ATOM   1445  C  CA    . LEU B 2 82  ? 5.033   33.781 -41.510 1.00 17.27  ? 97  LEU B CA    1 
ATOM   1446  C  C     . LEU B 2 82  ? 4.217   34.723 -40.651 1.00 17.56  ? 97  LEU B C     1 
ATOM   1447  O  O     . LEU B 2 82  ? 3.974   34.425 -39.493 1.00 17.25  ? 97  LEU B O     1 
ATOM   1448  C  CB    . LEU B 2 82  ? 4.189   32.567 -41.895 1.00 16.62  ? 97  LEU B CB    1 
ATOM   1449  C  CG    . LEU B 2 82  ? 2.962   32.880 -42.741 1.00 16.70  ? 97  LEU B CG    1 
ATOM   1450  C  CD1   . LEU B 2 82  ? 3.282   32.877 -44.212 1.00 16.58  ? 97  LEU B CD1   1 
ATOM   1451  C  CD2   . LEU B 2 82  ? 1.832   31.931 -42.455 1.00 17.22  ? 97  LEU B CD2   1 
ATOM   1452  N  N     . TYR B 2 83  ? 3.807   35.808 -41.287 1.00 18.00  ? 98  TYR B N     1 
ATOM   1453  C  CA    . TYR B 2 83  ? 2.974   36.850 -40.721 1.00 18.48  ? 98  TYR B CA    1 
ATOM   1454  C  C     . TYR B 2 83  ? 1.489   36.624 -41.045 1.00 19.21  ? 98  TYR B C     1 
ATOM   1455  O  O     . TYR B 2 83  ? 1.128   36.397 -42.206 1.00 18.01  ? 98  TYR B O     1 
ATOM   1456  C  CB    . TYR B 2 83  ? 3.404   38.215 -41.301 1.00 18.00  ? 98  TYR B CB    1 
ATOM   1457  C  CG    . TYR B 2 83  ? 4.535   38.899 -40.577 1.00 18.16  ? 98  TYR B CG    1 
ATOM   1458  C  CD1   . TYR B 2 83  ? 5.339   38.206 -39.688 1.00 19.04  ? 98  TYR B CD1   1 
ATOM   1459  C  CD2   . TYR B 2 83  ? 4.850   40.220 -40.839 1.00 18.81  ? 98  TYR B CD2   1 
ATOM   1460  C  CE1   . TYR B 2 83  ? 6.398   38.822 -39.038 1.00 20.00  ? 98  TYR B CE1   1 
ATOM   1461  C  CE2   . TYR B 2 83  ? 5.908   40.847 -40.198 1.00 19.83  ? 98  TYR B CE2   1 
ATOM   1462  C  CZ    . TYR B 2 83  ? 6.678   40.145 -39.290 1.00 20.81  ? 98  TYR B CZ    1 
ATOM   1463  O  OH    . TYR B 2 83  ? 7.723   40.748 -38.630 1.00 22.48  ? 98  TYR B OH    1 
ATOM   1464  N  N     . GLY B 2 84  ? 0.649   36.754 -40.020 1.00 20.80  ? 99  GLY B N     1 
ATOM   1465  C  CA    . GLY B 2 84  ? -0.791  36.750 -40.193 1.00 23.13  ? 99  GLY B CA    1 
ATOM   1466  C  C     . GLY B 2 84  ? -1.604  35.655 -39.553 1.00 25.78  ? 99  GLY B C     1 
ATOM   1467  O  O     . GLY B 2 84  ? -2.835  35.764 -39.534 1.00 26.90  ? 99  GLY B O     1 
ATOM   1468  N  N     . PHE B 2 85  ? -0.959  34.583 -39.076 1.00 26.33  ? 100 PHE B N     1 
ATOM   1469  C  CA    . PHE B 2 85  ? -1.713  33.479 -38.494 1.00 27.63  ? 100 PHE B CA    1 
ATOM   1470  C  C     . PHE B 2 85  ? -1.527  33.357 -36.990 1.00 30.36  ? 100 PHE B C     1 
ATOM   1471  O  O     . PHE B 2 85  ? -1.659  32.257 -36.433 1.00 31.05  ? 100 PHE B O     1 
ATOM   1472  C  CB    . PHE B 2 85  ? -1.358  32.166 -39.204 1.00 26.66  ? 100 PHE B CB    1 
ATOM   1473  C  CG    . PHE B 2 85  ? -1.892  32.108 -40.609 1.00 26.47  ? 100 PHE B CG    1 
ATOM   1474  C  CD1   . PHE B 2 85  ? -1.175  32.643 -41.661 1.00 26.82  ? 100 PHE B CD1   1 
ATOM   1475  C  CD2   . PHE B 2 85  ? -3.133  31.555 -40.875 1.00 27.14  ? 100 PHE B CD2   1 
ATOM   1476  C  CE1   . PHE B 2 85  ? -1.656  32.569 -42.963 1.00 27.42  ? 100 PHE B CE1   1 
ATOM   1477  C  CE2   . PHE B 2 85  ? -3.634  31.513 -42.179 1.00 27.64  ? 100 PHE B CE2   1 
ATOM   1478  C  CZ    . PHE B 2 85  ? -2.889  32.015 -43.216 1.00 27.27  ? 100 PHE B CZ    1 
ATOM   1479  N  N     . GLY B 2 86  ? -1.262  34.474 -36.333 1.00 31.48  ? 101 GLY B N     1 
ATOM   1480  C  CA    . GLY B 2 86  ? -0.966  34.487 -34.907 1.00 33.70  ? 101 GLY B CA    1 
ATOM   1481  C  C     . GLY B 2 86  ? 0.534   34.600 -34.675 1.00 36.28  ? 101 GLY B C     1 
ATOM   1482  O  O     . GLY B 2 86  ? 1.328   34.566 -35.639 1.00 36.83  ? 101 GLY B O     1 
ATOM   1483  N  N     . GLY B 2 87  ? 0.925   34.750 -33.401 1.00 37.49  ? 102 GLY B N     1 
ATOM   1484  C  CA    . GLY B 2 87  ? 2.341   34.904 -33.016 1.00 39.14  ? 102 GLY B CA    1 
ATOM   1485  C  C     . GLY B 2 87  ? 2.858   36.291 -33.449 1.00 40.75  ? 102 GLY B C     1 
ATOM   1486  O  O     . GLY B 2 87  ? 2.053   37.251 -33.360 1.00 41.38  ? 102 GLY B O     1 
ATOM   1487  O  OXT   . GLY B 2 87  ? 4.033   36.412 -33.902 1.00 42.75  ? 102 GLY B OXT   1 
ATOM   1488  N  N     . THR C 3 3   ? 29.231  12.667 -7.385  1.00 75.50  ? 16  THR C N     1 
ATOM   1489  C  CA    . THR C 3 3   ? 28.941  13.583 -8.484  1.00 76.09  ? 16  THR C CA    1 
ATOM   1490  C  C     . THR C 3 3   ? 27.690  13.127 -9.235  1.00 76.24  ? 16  THR C C     1 
ATOM   1491  O  O     . THR C 3 3   ? 27.469  11.923 -9.372  1.00 76.61  ? 16  THR C O     1 
ATOM   1492  C  CB    . THR C 3 3   ? 30.147  13.702 -9.448  1.00 77.62  ? 16  THR C CB    1 
ATOM   1493  O  OG1   . THR C 3 3   ? 30.568  12.402 -9.867  1.00 78.47  ? 16  THR C OG1   1 
ATOM   1494  C  CG2   . THR C 3 3   ? 31.317  14.443 -8.840  1.00 78.32  ? 16  THR C CG2   1 
ATOM   1495  N  N     . ARG C 3 4   ? 26.880  14.083 -9.734  1.00 75.61  ? 17  ARG C N     1 
ATOM   1496  C  CA    . ARG C 3 4   ? 25.670  13.770 -10.507 1.00 75.14  ? 17  ARG C CA    1 
ATOM   1497  C  C     . ARG C 3 4   ? 26.006  13.111 -11.848 1.00 74.28  ? 17  ARG C C     1 
ATOM   1498  O  O     . ARG C 3 4   ? 25.197  12.338 -12.358 1.00 74.03  ? 17  ARG C O     1 
ATOM   1499  C  CB    . ARG C 3 4   ? 24.823  15.029 -10.737 1.00 76.44  ? 17  ARG C CB    1 
ATOM   1500  C  CG    . ARG C 3 4   ? 24.430  15.755 -9.457  1.00 78.97  ? 17  ARG C CG    1 
ATOM   1501  C  CD    . ARG C 3 4   ? 23.248  16.681 -9.695  1.00 81.17  ? 17  ARG C CD    1 
ATOM   1502  N  NE    . ARG C 3 4   ? 23.629  18.093 -9.810  1.00 82.17  ? 17  ARG C NE    1 
ATOM   1503  C  CZ    . ARG C 3 4   ? 22.799  19.063 -10.193 1.00 82.48  ? 17  ARG C CZ    1 
ATOM   1504  N  NH1   . ARG C 3 4   ? 21.541  18.780 -10.516 1.00 81.24  ? 17  ARG C NH1   1 
ATOM   1505  N  NH2   . ARG C 3 4   ? 23.223  20.318 -10.263 1.00 81.93  ? 17  ARG C NH2   1 
ATOM   1506  N  N     . SER C 3 5   ? 27.199  13.406 -12.408 1.00 73.85  ? 18  SER C N     1 
ATOM   1507  C  CA    . SER C 3 5   ? 27.681  12.833 -13.662 1.00 74.13  ? 18  SER C CA    1 
ATOM   1508  C  C     . SER C 3 5   ? 27.943  11.342 -13.493 1.00 74.09  ? 18  SER C C     1 
ATOM   1509  O  O     . SER C 3 5   ? 27.600  10.560 -14.375 1.00 74.10  ? 18  SER C O     1 
ATOM   1510  C  CB    . SER C 3 5   ? 28.955  13.534 -14.119 1.00 75.47  ? 18  SER C CB    1 
ATOM   1511  O  OG    . SER C 3 5   ? 28.706  14.901 -14.395 1.00 77.70  ? 18  SER C OG    1 
ATOM   1512  N  N     . SER C 3 6   ? 28.524  10.940 -12.350 1.00 73.74  ? 19  SER C N     1 
ATOM   1513  C  CA    . SER C 3 6   ? 28.796  9.526  -12.064 1.00 73.35  ? 19  SER C CA    1 
ATOM   1514  C  C     . SER C 3 6   ? 27.492  8.760  -11.924 1.00 72.54  ? 19  SER C C     1 
ATOM   1515  O  O     . SER C 3 6   ? 27.384  7.660  -12.461 1.00 72.62  ? 19  SER C O     1 
ATOM   1516  C  CB    . SER C 3 6   ? 29.638  9.373  -10.801 1.00 74.73  ? 19  SER C CB    1 
ATOM   1517  O  OG    . SER C 3 6   ? 28.931  9.784  -9.642  1.00 77.00  ? 19  SER C OG    1 
ATOM   1518  N  N     . ARG C 3 7   ? 26.484  9.372  -11.260 1.00 71.80  ? 20  ARG C N     1 
ATOM   1519  C  CA    . ARG C 3 7   ? 25.133  8.824  -11.070 1.00 71.89  ? 20  ARG C CA    1 
ATOM   1520  C  C     . ARG C 3 7   ? 24.407  8.544  -12.420 1.00 71.09  ? 20  ARG C C     1 
ATOM   1521  O  O     . ARG C 3 7   ? 23.507  7.701  -12.482 1.00 70.73  ? 20  ARG C O     1 
ATOM   1522  C  CB    . ARG C 3 7   ? 24.282  9.792  -10.219 1.00 73.81  ? 20  ARG C CB    1 
ATOM   1523  C  CG    . ARG C 3 7   ? 24.198  9.453  -8.733  1.00 77.83  ? 20  ARG C CG    1 
ATOM   1524  C  CD    . ARG C 3 7   ? 25.376  9.978  -7.933  1.00 82.19  ? 20  ARG C CD    1 
ATOM   1525  N  NE    . ARG C 3 7   ? 26.197  8.895  -7.383  1.00 86.33  ? 20  ARG C NE    1 
ATOM   1526  C  CZ    . ARG C 3 7   ? 27.310  9.076  -6.675  1.00 88.91  ? 20  ARG C CZ    1 
ATOM   1527  N  NH1   . ARG C 3 7   ? 27.757  10.305 -6.428  1.00 88.88  ? 20  ARG C NH1   1 
ATOM   1528  N  NH2   . ARG C 3 7   ? 27.992  8.031  -6.219  1.00 88.41  ? 20  ARG C NH2   1 
ATOM   1529  N  N     . ALA C 3 8   ? 24.813  9.258  -13.490 1.00 70.31  ? 21  ALA C N     1 
ATOM   1530  C  CA    . ALA C 3 8   ? 24.248  9.135  -14.830 1.00 69.76  ? 21  ALA C CA    1 
ATOM   1531  C  C     . ALA C 3 8   ? 25.158  8.426  -15.857 1.00 68.87  ? 21  ALA C C     1 
ATOM   1532  O  O     . ALA C 3 8   ? 24.720  8.155  -16.977 1.00 68.90  ? 21  ALA C O     1 
ATOM   1533  C  CB    . ALA C 3 8   ? 23.864  10.506 -15.340 1.00 69.96  ? 21  ALA C CB    1 
ATOM   1534  N  N     . GLY C 3 9   ? 26.398  8.135  -15.478 1.00 67.88  ? 22  GLY C N     1 
ATOM   1535  C  CA    . GLY C 3 9   ? 27.352  7.457  -16.351 1.00 67.44  ? 22  GLY C CA    1 
ATOM   1536  C  C     . GLY C 3 9   ? 27.950  8.373  -17.397 1.00 66.35  ? 22  GLY C C     1 
ATOM   1537  O  O     . GLY C 3 9   ? 28.269  7.949  -18.512 1.00 66.35  ? 22  GLY C O     1 
ATOM   1538  N  N     . LEU C 3 10  ? 28.127  9.635  -17.031 1.00 65.47  ? 23  LEU C N     1 
ATOM   1539  C  CA    . LEU C 3 10  ? 28.620  10.640 -17.943 1.00 64.95  ? 23  LEU C CA    1 
ATOM   1540  C  C     . LEU C 3 10  ? 29.968  11.201 -17.551 1.00 64.84  ? 23  LEU C C     1 
ATOM   1541  O  O     . LEU C 3 10  ? 30.337  11.215 -16.380 1.00 64.63  ? 23  LEU C O     1 
ATOM   1542  C  CB    . LEU C 3 10  ? 27.596  11.790 -18.020 1.00 64.81  ? 23  LEU C CB    1 
ATOM   1543  C  CG    . LEU C 3 10  ? 26.191  11.401 -18.438 1.00 65.45  ? 23  LEU C CG    1 
ATOM   1544  C  CD1   . LEU C 3 10  ? 25.219  12.496 -18.145 1.00 65.72  ? 23  LEU C CD1   1 
ATOM   1545  C  CD2   . LEU C 3 10  ? 26.146  11.031 -19.889 1.00 65.79  ? 23  LEU C CD2   1 
ATOM   1546  N  N     . GLN C 3 11  ? 30.690  11.684 -18.559 1.00 64.75  ? 24  GLN C N     1 
ATOM   1547  C  CA    . GLN C 3 11  ? 31.953  12.406 -18.454 1.00 64.86  ? 24  GLN C CA    1 
ATOM   1548  C  C     . GLN C 3 11  ? 31.637  13.907 -18.371 1.00 64.15  ? 24  GLN C C     1 
ATOM   1549  O  O     . GLN C 3 11  ? 32.257  14.608 -17.582 1.00 64.56  ? 24  GLN C O     1 
ATOM   1550  C  CB    . GLN C 3 11  ? 32.858  12.133 -19.670 1.00 66.44  ? 24  GLN C CB    1 
ATOM   1551  C  CG    . GLN C 3 11  ? 33.040  10.662 -19.977 1.00 69.95  ? 24  GLN C CG    1 
ATOM   1552  C  CD    . GLN C 3 11  ? 33.671  9.889  -18.848 1.00 74.47  ? 24  GLN C CD    1 
ATOM   1553  O  OE1   . GLN C 3 11  ? 34.405  10.426 -18.007 1.00 75.51  ? 24  GLN C OE1   1 
ATOM   1554  N  NE2   . GLN C 3 11  ? 33.410  8.593  -18.821 1.00 75.72  ? 24  GLN C NE2   1 
ATOM   1555  N  N     . PHE C 3 12  ? 30.655  14.384 -19.163 1.00 62.92  ? 25  PHE C N     1 
ATOM   1556  C  CA    . PHE C 3 12  ? 30.227  15.775 -19.187 1.00 61.94  ? 25  PHE C CA    1 
ATOM   1557  C  C     . PHE C 3 12  ? 29.624  16.190 -17.838 1.00 61.16  ? 25  PHE C C     1 
ATOM   1558  O  O     . PHE C 3 12  ? 29.044  15.363 -17.121 1.00 61.34  ? 25  PHE C O     1 
ATOM   1559  C  CB    . PHE C 3 12  ? 29.289  16.034 -20.375 1.00 61.54  ? 25  PHE C CB    1 
ATOM   1560  C  CG    . PHE C 3 12  ? 30.060  16.430 -21.613 1.00 61.67  ? 25  PHE C CG    1 
ATOM   1561  C  CD1   . PHE C 3 12  ? 31.138  15.682 -22.050 1.00 62.10  ? 25  PHE C CD1   1 
ATOM   1562  C  CD2   . PHE C 3 12  ? 29.723  17.561 -22.324 1.00 62.21  ? 25  PHE C CD2   1 
ATOM   1563  C  CE1   . PHE C 3 12  ? 31.848  16.047 -23.186 1.00 62.36  ? 25  PHE C CE1   1 
ATOM   1564  C  CE2   . PHE C 3 12  ? 30.447  17.929 -23.454 1.00 62.56  ? 25  PHE C CE2   1 
ATOM   1565  C  CZ    . PHE C 3 12  ? 31.507  17.171 -23.872 1.00 62.02  ? 25  PHE C CZ    1 
ATOM   1566  N  N     . PRO C 3 13  ? 29.844  17.454 -17.436 1.00 59.89  ? 26  PRO C N     1 
ATOM   1567  C  CA    . PRO C 3 13  ? 29.415  17.882 -16.100 1.00 59.14  ? 26  PRO C CA    1 
ATOM   1568  C  C     . PRO C 3 13  ? 27.937  18.165 -15.927 1.00 58.24  ? 26  PRO C C     1 
ATOM   1569  O  O     . PRO C 3 13  ? 27.479  19.227 -16.308 1.00 58.33  ? 26  PRO C O     1 
ATOM   1570  C  CB    . PRO C 3 13  ? 30.244  19.137 -15.874 1.00 59.94  ? 26  PRO C CB    1 
ATOM   1571  C  CG    . PRO C 3 13  ? 30.409  19.707 -17.244 1.00 60.42  ? 26  PRO C CG    1 
ATOM   1572  C  CD    . PRO C 3 13  ? 30.567  18.528 -18.144 1.00 58.99  ? 26  PRO C CD    1 
ATOM   1573  N  N     . VAL C 3 14  ? 27.205  17.251 -15.293 1.00 57.56  ? 27  VAL C N     1 
ATOM   1574  C  CA    . VAL C 3 14  ? 25.775  17.433 -15.050 1.00 57.57  ? 27  VAL C CA    1 
ATOM   1575  C  C     . VAL C 3 14  ? 25.497  18.624 -14.134 1.00 57.31  ? 27  VAL C C     1 
ATOM   1576  O  O     . VAL C 3 14  ? 24.522  19.350 -14.343 1.00 57.94  ? 27  VAL C O     1 
ATOM   1577  C  CB    . VAL C 3 14  ? 25.099  16.130 -14.554 1.00 58.61  ? 27  VAL C CB    1 
ATOM   1578  C  CG1   . VAL C 3 14  ? 23.709  16.395 -13.972 1.00 59.19  ? 27  VAL C CG1   1 
ATOM   1579  C  CG2   . VAL C 3 14  ? 25.022  15.104 -15.682 1.00 59.23  ? 27  VAL C CG2   1 
ATOM   1580  N  N     . GLY C 3 15  ? 26.367  18.841 -13.164 1.00 56.31  ? 28  GLY C N     1 
ATOM   1581  C  CA    . GLY C 3 15  ? 26.210  19.947 -12.234 1.00 55.88  ? 28  GLY C CA    1 
ATOM   1582  C  C     . GLY C 3 15  ? 26.382  21.302 -12.876 1.00 55.02  ? 28  GLY C C     1 
ATOM   1583  O  O     . GLY C 3 15  ? 25.602  22.220 -12.599 1.00 55.18  ? 28  GLY C O     1 
ATOM   1584  N  N     . ARG C 3 16  ? 27.404  21.429 -13.743 1.00 54.03  ? 29  ARG C N     1 
ATOM   1585  C  CA    . ARG C 3 16  ? 27.718  22.679 -14.439 1.00 53.51  ? 29  ARG C CA    1 
ATOM   1586  C  C     . ARG C 3 16  ? 26.618  23.076 -15.411 1.00 53.90  ? 29  ARG C C     1 
ATOM   1587  O  O     . ARG C 3 16  ? 26.167  24.215 -15.392 1.00 53.60  ? 29  ARG C O     1 
ATOM   1588  C  CB    . ARG C 3 16  ? 29.074  22.567 -15.134 1.00 53.51  ? 29  ARG C CB    1 
ATOM   1589  C  CG    . ARG C 3 16  ? 29.414  23.716 -16.046 1.00 54.92  ? 29  ARG C CG    1 
ATOM   1590  C  CD    . ARG C 3 16  ? 30.764  23.513 -16.686 1.00 56.72  ? 29  ARG C CD    1 
ATOM   1591  N  NE    . ARG C 3 16  ? 31.835  23.690 -15.708 1.00 57.83  ? 29  ARG C NE    1 
ATOM   1592  C  CZ    . ARG C 3 16  ? 33.124  23.780 -16.009 1.00 58.50  ? 29  ARG C CZ    1 
ATOM   1593  N  NH1   . ARG C 3 16  ? 34.024  23.923 -15.047 1.00 58.31  ? 29  ARG C NH1   1 
ATOM   1594  N  NH2   . ARG C 3 16  ? 33.527  23.697 -17.275 1.00 57.06  ? 29  ARG C NH2   1 
ATOM   1595  N  N     . VAL C 3 17  ? 26.144  22.118 -16.217 1.00 54.52  ? 30  VAL C N     1 
ATOM   1596  C  CA    . VAL C 3 17  ? 25.067  22.316 -17.187 1.00 55.24  ? 30  VAL C CA    1 
ATOM   1597  C  C     . VAL C 3 17  ? 23.808  22.811 -16.488 1.00 56.33  ? 30  VAL C C     1 
ATOM   1598  O  O     . VAL C 3 17  ? 23.178  23.744 -16.976 1.00 56.45  ? 30  VAL C O     1 
ATOM   1599  C  CB    . VAL C 3 17  ? 24.818  21.025 -18.010 1.00 55.53  ? 30  VAL C CB    1 
ATOM   1600  C  CG1   . VAL C 3 17  ? 23.555  21.134 -18.846 1.00 56.05  ? 30  VAL C CG1   1 
ATOM   1601  C  CG2   . VAL C 3 17  ? 26.016  20.710 -18.896 1.00 55.80  ? 30  VAL C CG2   1 
ATOM   1602  N  N     . HIS C 3 18  ? 23.492  22.255 -15.305 1.00 56.86  ? 31  HIS C N     1 
ATOM   1603  C  CA    . HIS C 3 18  ? 22.318  22.673 -14.532 1.00 57.81  ? 31  HIS C CA    1 
ATOM   1604  C  C     . HIS C 3 18  ? 22.431  24.131 -14.092 1.00 57.57  ? 31  HIS C C     1 
ATOM   1605  O  O     . HIS C 3 18  ? 21.431  24.846 -14.077 1.00 57.84  ? 31  HIS C O     1 
ATOM   1606  C  CB    . HIS C 3 18  ? 22.105  21.778 -13.297 1.00 59.38  ? 31  HIS C CB    1 
ATOM   1607  C  CG    . HIS C 3 18  ? 20.879  22.140 -12.516 1.00 62.82  ? 31  HIS C CG    1 
ATOM   1608  N  ND1   . HIS C 3 18  ? 19.604  21.908 -13.017 1.00 65.03  ? 31  HIS C ND1   1 
ATOM   1609  C  CD2   . HIS C 3 18  ? 20.770  22.739 -11.306 1.00 64.26  ? 31  HIS C CD2   1 
ATOM   1610  C  CE1   . HIS C 3 18  ? 18.768  22.349 -12.089 1.00 65.72  ? 31  HIS C CE1   1 
ATOM   1611  N  NE2   . HIS C 3 18  ? 19.421  22.866 -11.044 1.00 65.54  ? 31  HIS C NE2   1 
ATOM   1612  N  N     . ARG C 3 19  ? 23.641  24.569 -13.736 1.00 56.85  ? 32  ARG C N     1 
ATOM   1613  C  CA    . ARG C 3 19  ? 23.900  25.935 -13.297 1.00 56.56  ? 32  ARG C CA    1 
ATOM   1614  C  C     . ARG C 3 19  ? 23.801  26.910 -14.471 1.00 56.15  ? 32  ARG C C     1 
ATOM   1615  O  O     . ARG C 3 19  ? 23.235  27.994 -14.304 1.00 56.36  ? 32  ARG C O     1 
ATOM   1616  C  CB    . ARG C 3 19  ? 25.279  26.004 -12.627 1.00 57.71  ? 32  ARG C CB    1 
ATOM   1617  C  CG    . ARG C 3 19  ? 25.680  27.373 -12.081 1.00 59.86  ? 32  ARG C CG    1 
ATOM   1618  C  CD    . ARG C 3 19  ? 26.837  27.993 -12.852 1.00 61.71  ? 32  ARG C CD    1 
ATOM   1619  N  NE    . ARG C 3 19  ? 27.908  27.039 -13.151 1.00 63.15  ? 32  ARG C NE    1 
ATOM   1620  C  CZ    . ARG C 3 19  ? 29.048  27.357 -13.755 1.00 65.16  ? 32  ARG C CZ    1 
ATOM   1621  N  NH1   . ARG C 3 19  ? 29.294  28.612 -14.107 1.00 64.83  ? 32  ARG C NH1   1 
ATOM   1622  N  NH2   . ARG C 3 19  ? 29.961  26.427 -13.990 1.00 65.57  ? 32  ARG C NH2   1 
ATOM   1623  N  N     . LEU C 3 20  ? 24.326  26.515 -15.661 1.00 55.11  ? 33  LEU C N     1 
ATOM   1624  C  CA    . LEU C 3 20  ? 24.276  27.331 -16.879 1.00 54.50  ? 33  LEU C CA    1 
ATOM   1625  C  C     . LEU C 3 20  ? 22.856  27.507 -17.409 1.00 54.89  ? 33  LEU C C     1 
ATOM   1626  O  O     . LEU C 3 20  ? 22.570  28.514 -18.049 1.00 55.07  ? 33  LEU C O     1 
ATOM   1627  C  CB    . LEU C 3 20  ? 25.139  26.724 -17.977 1.00 53.98  ? 33  LEU C CB    1 
ATOM   1628  C  CG    . LEU C 3 20  ? 26.610  26.618 -17.698 1.00 54.88  ? 33  LEU C CG    1 
ATOM   1629  C  CD1   . LEU C 3 20  ? 27.307  25.876 -18.817 1.00 55.16  ? 33  LEU C CD1   1 
ATOM   1630  C  CD2   . LEU C 3 20  ? 27.222  27.982 -17.509 1.00 55.66  ? 33  LEU C CD2   1 
ATOM   1631  N  N     . LEU C 3 21  ? 21.978  26.531 -17.172 1.00 55.12  ? 34  LEU C N     1 
ATOM   1632  C  CA    . LEU C 3 21  ? 20.595  26.612 -17.617 1.00 55.96  ? 34  LEU C CA    1 
ATOM   1633  C  C     . LEU C 3 21  ? 19.817  27.658 -16.830 1.00 57.47  ? 34  LEU C C     1 
ATOM   1634  O  O     . LEU C 3 21  ? 19.003  28.358 -17.419 1.00 57.95  ? 34  LEU C O     1 
ATOM   1635  C  CB    . LEU C 3 21  ? 19.913  25.249 -17.489 1.00 55.85  ? 34  LEU C CB    1 
ATOM   1636  C  CG    . LEU C 3 21  ? 20.304  24.225 -18.529 1.00 57.00  ? 34  LEU C CG    1 
ATOM   1637  C  CD1   . LEU C 3 21  ? 19.964  22.830 -18.063 1.00 57.42  ? 34  LEU C CD1   1 
ATOM   1638  C  CD2   . LEU C 3 21  ? 19.663  24.530 -19.860 1.00 57.67  ? 34  LEU C CD2   1 
ATOM   1639  N  N     . ARG C 3 22  ? 20.026  27.765 -15.503 1.00 58.23  ? 35  ARG C N     1 
ATOM   1640  C  CA    . ARG C 3 22  ? 19.297  28.775 -14.709 1.00 59.23  ? 35  ARG C CA    1 
ATOM   1641  C  C     . ARG C 3 22  ? 19.917  30.161 -14.843 1.00 58.93  ? 35  ARG C C     1 
ATOM   1642  O  O     . ARG C 3 22  ? 19.192  31.155 -14.881 1.00 59.16  ? 35  ARG C O     1 
ATOM   1643  C  CB    . ARG C 3 22  ? 19.111  28.360 -13.234 1.00 61.86  ? 35  ARG C CB    1 
ATOM   1644  C  CG    . ARG C 3 22  ? 20.236  27.506 -12.651 1.00 66.70  ? 35  ARG C CG    1 
ATOM   1645  C  CD    . ARG C 3 22  ? 19.789  26.815 -11.377 1.00 71.68  ? 35  ARG C CD    1 
ATOM   1646  N  NE    . ARG C 3 22  ? 20.809  25.914 -10.833 1.00 76.31  ? 35  ARG C NE    1 
ATOM   1647  C  CZ    . ARG C 3 22  ? 21.729  26.269 -9.940  1.00 79.17  ? 35  ARG C CZ    1 
ATOM   1648  N  NH1   . ARG C 3 22  ? 21.784  27.520 -9.493  1.00 78.52  ? 35  ARG C NH1   1 
ATOM   1649  N  NH2   . ARG C 3 22  ? 22.612  25.381 -9.497  1.00 79.63  ? 35  ARG C NH2   1 
ATOM   1650  N  N     . LYS C 3 23  ? 21.256  30.219 -14.967 1.00 58.45  ? 36  LYS C N     1 
ATOM   1651  C  CA    . LYS C 3 23  ? 22.023  31.462 -15.139 1.00 58.59  ? 36  LYS C CA    1 
ATOM   1652  C  C     . LYS C 3 23  ? 21.831  32.089 -16.540 1.00 57.87  ? 36  LYS C C     1 
ATOM   1653  O  O     . LYS C 3 23  ? 21.844  33.319 -16.690 1.00 58.30  ? 36  LYS C O     1 
ATOM   1654  C  CB    . LYS C 3 23  ? 23.526  31.202 -14.864 1.00 60.85  ? 36  LYS C CB    1 
ATOM   1655  C  CG    . LYS C 3 23  ? 24.476  32.366 -15.197 1.00 65.30  ? 36  LYS C CG    1 
ATOM   1656  C  CD    . LYS C 3 23  ? 25.408  32.030 -16.370 1.00 69.82  ? 36  LYS C CD    1 
ATOM   1657  C  CE    . LYS C 3 23  ? 26.868  31.915 -15.973 1.00 73.01  ? 36  LYS C CE    1 
ATOM   1658  N  NZ    . LYS C 3 23  ? 27.117  30.846 -14.966 1.00 74.16  ? 36  LYS C NZ    1 
ATOM   1659  N  N     . GLY C 3 24  ? 21.648  31.239 -17.542 1.00 56.37  ? 37  GLY C N     1 
ATOM   1660  C  CA    . GLY C 3 24  ? 21.508  31.660 -18.926 1.00 55.35  ? 37  GLY C CA    1 
ATOM   1661  C  C     . GLY C 3 24  ? 20.175  32.257 -19.318 1.00 54.01  ? 37  GLY C C     1 
ATOM   1662  O  O     . GLY C 3 24  ? 19.987  32.603 -20.483 1.00 53.50  ? 37  GLY C O     1 
ATOM   1663  N  N     . ASN C 3 25  ? 19.245  32.380 -18.361 1.00 53.66  ? 38  ASN C N     1 
ATOM   1664  C  CA    . ASN C 3 25  ? 17.918  32.969 -18.580 1.00 54.20  ? 38  ASN C CA    1 
ATOM   1665  C  C     . ASN C 3 25  ? 17.062  32.221 -19.624 1.00 53.19  ? 38  ASN C C     1 
ATOM   1666  O  O     . ASN C 3 25  ? 16.496  32.846 -20.540 1.00 53.04  ? 38  ASN C O     1 
ATOM   1667  C  CB    . ASN C 3 25  ? 18.006  34.473 -18.924 1.00 56.69  ? 38  ASN C CB    1 
ATOM   1668  C  CG    . ASN C 3 25  ? 18.695  35.325 -17.885 1.00 61.29  ? 38  ASN C CG    1 
ATOM   1669  O  OD1   . ASN C 3 25  ? 18.518  35.151 -16.671 1.00 63.54  ? 38  ASN C OD1   1 
ATOM   1670  N  ND2   . ASN C 3 25  ? 19.507  36.270 -18.345 1.00 61.67  ? 38  ASN C ND2   1 
ATOM   1671  N  N     . TYR C 3 26  ? 16.966  30.887 -19.485 1.00 51.96  ? 39  TYR C N     1 
ATOM   1672  C  CA    . TYR C 3 26  ? 16.158  30.104 -20.405 1.00 51.17  ? 39  TYR C CA    1 
ATOM   1673  C  C     . TYR C 3 26  ? 14.741  29.890 -19.856 1.00 52.89  ? 39  TYR C C     1 
ATOM   1674  O  O     . TYR C 3 26  ? 13.776  29.872 -20.621 1.00 53.01  ? 39  TYR C O     1 
ATOM   1675  C  CB    . TYR C 3 26  ? 16.858  28.800 -20.757 1.00 49.44  ? 39  TYR C CB    1 
ATOM   1676  C  CG    . TYR C 3 26  ? 18.218  29.007 -21.370 1.00 48.04  ? 39  TYR C CG    1 
ATOM   1677  C  CD1   . TYR C 3 26  ? 18.354  29.440 -22.676 1.00 48.03  ? 39  TYR C CD1   1 
ATOM   1678  C  CD2   . TYR C 3 26  ? 19.371  28.746 -20.650 1.00 48.33  ? 39  TYR C CD2   1 
ATOM   1679  C  CE1   . TYR C 3 26  ? 19.607  29.633 -23.244 1.00 48.52  ? 39  TYR C CE1   1 
ATOM   1680  C  CE2   . TYR C 3 26  ? 20.628  28.921 -21.209 1.00 48.76  ? 39  TYR C CE2   1 
ATOM   1681  C  CZ    . TYR C 3 26  ? 20.744  29.372 -22.505 1.00 49.11  ? 39  TYR C CZ    1 
ATOM   1682  O  OH    . TYR C 3 26  ? 21.994  29.530 -23.048 1.00 49.76  ? 39  TYR C OH    1 
ATOM   1683  N  N     . SER C 3 27  ? 14.607  29.770 -18.531 1.00 54.04  ? 40  SER C N     1 
ATOM   1684  C  CA    . SER C 3 27  ? 13.308  29.607 -17.882 1.00 55.66  ? 40  SER C CA    1 
ATOM   1685  C  C     . SER C 3 27  ? 13.406  29.887 -16.379 1.00 56.92  ? 40  SER C C     1 
ATOM   1686  O  O     . SER C 3 27  ? 14.511  29.946 -15.820 1.00 56.91  ? 40  SER C O     1 
ATOM   1687  C  CB    . SER C 3 27  ? 12.754  28.202 -18.116 1.00 57.32  ? 40  SER C CB    1 
ATOM   1688  O  OG    . SER C 3 27  ? 13.457  27.227 -17.357 1.00 59.68  ? 40  SER C OG    1 
ATOM   1689  N  N     . GLU C 3 28  ? 12.239  30.031 -15.726 1.00 57.81  ? 41  GLU C N     1 
ATOM   1690  C  CA    . GLU C 3 28  ? 12.153  30.253 -14.295 1.00 59.46  ? 41  GLU C CA    1 
ATOM   1691  C  C     . GLU C 3 28  ? 12.798  29.063 -13.536 1.00 60.91  ? 41  GLU C C     1 
ATOM   1692  O  O     . GLU C 3 28  ? 13.737  29.279 -12.767 1.00 61.61  ? 41  GLU C O     1 
ATOM   1693  C  CB    . GLU C 3 28  ? 10.680  30.468 -13.890 1.00 62.13  ? 41  GLU C CB    1 
ATOM   1694  C  CG    . GLU C 3 28  ? 10.472  31.371 -12.680 1.00 67.96  ? 41  GLU C CG    1 
ATOM   1695  C  CD    . GLU C 3 28  ? 9.777   30.721 -11.493 1.00 75.78  ? 41  GLU C CD    1 
ATOM   1696  O  OE1   . GLU C 3 28  ? 8.524   30.666 -11.486 1.00 77.47  ? 41  GLU C OE1   1 
ATOM   1697  O  OE2   . GLU C 3 28  ? 10.491  30.256 -10.574 1.00 77.87  ? 41  GLU C OE2   1 
ATOM   1698  N  N     . ARG C 3 29  ? 12.363  27.808 -13.812 1.00 61.15  ? 42  ARG C N     1 
ATOM   1699  C  CA    . ARG C 3 29  ? 12.917  26.606 -13.160 1.00 61.79  ? 42  ARG C CA    1 
ATOM   1700  C  C     . ARG C 3 29  ? 13.553  25.573 -14.140 1.00 60.80  ? 42  ARG C C     1 
ATOM   1701  O  O     . ARG C 3 29  ? 13.192  25.506 -15.307 1.00 60.67  ? 42  ARG C O     1 
ATOM   1702  C  CB    . ARG C 3 29  ? 11.854  25.907 -12.296 1.00 64.69  ? 42  ARG C CB    1 
ATOM   1703  C  CG    . ARG C 3 29  ? 10.949  26.838 -11.484 1.00 70.24  ? 42  ARG C CG    1 
ATOM   1704  C  CD    . ARG C 3 29  ? 9.595   26.185 -11.209 1.00 75.67  ? 42  ARG C CD    1 
ATOM   1705  N  NE    . ARG C 3 29  ? 9.479   25.641 -9.859  1.00 80.66  ? 42  ARG C NE    1 
ATOM   1706  C  CZ    . ARG C 3 29  ? 8.778   24.548 -9.550  1.00 84.95  ? 42  ARG C CZ    1 
ATOM   1707  N  NH1   . ARG C 3 29  ? 8.153   23.858 -10.499 1.00 85.36  ? 42  ARG C NH1   1 
ATOM   1708  N  NH2   . ARG C 3 29  ? 8.714   24.128 -8.294  1.00 85.71  ? 42  ARG C NH2   1 
ATOM   1709  N  N     . VAL C 3 30  ? 14.499  24.770 -13.646 1.00 59.87  ? 43  VAL C N     1 
ATOM   1710  C  CA    . VAL C 3 30  ? 15.190  23.749 -14.427 1.00 59.41  ? 43  VAL C CA    1 
ATOM   1711  C  C     . VAL C 3 30  ? 14.970  22.375 -13.786 1.00 59.35  ? 43  VAL C C     1 
ATOM   1712  O  O     . VAL C 3 30  ? 15.410  22.130 -12.662 1.00 59.67  ? 43  VAL C O     1 
ATOM   1713  C  CB    . VAL C 3 30  ? 16.702  24.060 -14.534 1.00 59.69  ? 43  VAL C CB    1 
ATOM   1714  C  CG1   . VAL C 3 30  ? 17.455  22.932 -15.237 1.00 60.04  ? 43  VAL C CG1   1 
ATOM   1715  C  CG2   . VAL C 3 30  ? 16.940  25.393 -15.224 1.00 60.12  ? 43  VAL C CG2   1 
ATOM   1716  N  N     . GLY C 3 31  ? 14.309  21.489 -14.513 1.00 58.72  ? 44  GLY C N     1 
ATOM   1717  C  CA    . GLY C 3 31  ? 14.041  20.126 -14.072 1.00 58.55  ? 44  GLY C CA    1 
ATOM   1718  C  C     . GLY C 3 31  ? 15.278  19.344 -13.667 1.00 57.76  ? 44  GLY C C     1 
ATOM   1719  O  O     . GLY C 3 31  ? 16.400  19.703 -14.041 1.00 57.76  ? 44  GLY C O     1 
ATOM   1720  N  N     . ALA C 3 32  ? 15.084  18.294 -12.861 1.00 56.73  ? 45  ALA C N     1 
ATOM   1721  C  CA    . ALA C 3 32  ? 16.182  17.489 -12.333 1.00 56.10  ? 45  ALA C CA    1 
ATOM   1722  C  C     . ALA C 3 32  ? 16.913  16.665 -13.396 1.00 54.88  ? 45  ALA C C     1 
ATOM   1723  O  O     . ALA C 3 32  ? 18.125  16.449 -13.294 1.00 54.59  ? 45  ALA C O     1 
ATOM   1724  C  CB    . ALA C 3 32  ? 15.667  16.584 -11.228 1.00 56.31  ? 45  ALA C CB    1 
ATOM   1725  N  N     . GLY C 3 33  ? 16.161  16.223 -14.397 1.00 53.95  ? 46  GLY C N     1 
ATOM   1726  C  CA    . GLY C 3 33  ? 16.677  15.409 -15.484 1.00 53.44  ? 46  GLY C CA    1 
ATOM   1727  C  C     . GLY C 3 33  ? 17.103  16.179 -16.712 1.00 52.73  ? 46  GLY C C     1 
ATOM   1728  O  O     . GLY C 3 33  ? 17.777  15.610 -17.576 1.00 53.27  ? 46  GLY C O     1 
ATOM   1729  N  N     . ALA C 3 34  ? 16.711  17.461 -16.816 1.00 51.29  ? 47  ALA C N     1 
ATOM   1730  C  CA    . ALA C 3 34  ? 17.118  18.265 -17.959 1.00 50.67  ? 47  ALA C CA    1 
ATOM   1731  C  C     . ALA C 3 34  ? 18.653  18.414 -18.095 1.00 49.76  ? 47  ALA C C     1 
ATOM   1732  O  O     . ALA C 3 34  ? 19.150  18.129 -19.187 1.00 50.03  ? 47  ALA C O     1 
ATOM   1733  C  CB    . ALA C 3 34  ? 16.427  19.617 -17.959 1.00 50.97  ? 47  ALA C CB    1 
ATOM   1734  N  N     . PRO C 3 35  ? 19.449  18.775 -17.047 1.00 48.45  ? 48  PRO C N     1 
ATOM   1735  C  CA    . PRO C 3 35  ? 20.910  18.876 -17.250 1.00 47.77  ? 48  PRO C CA    1 
ATOM   1736  C  C     . PRO C 3 35  ? 21.582  17.552 -17.546 1.00 47.45  ? 48  PRO C C     1 
ATOM   1737  O  O     . PRO C 3 35  ? 22.636  17.533 -18.167 1.00 47.67  ? 48  PRO C O     1 
ATOM   1738  C  CB    . PRO C 3 35  ? 21.419  19.423 -15.921 1.00 48.21  ? 48  PRO C CB    1 
ATOM   1739  C  CG    . PRO C 3 35  ? 20.387  19.061 -14.948 1.00 48.76  ? 48  PRO C CG    1 
ATOM   1740  C  CD    . PRO C 3 35  ? 19.089  19.155 -15.668 1.00 47.51  ? 48  PRO C CD    1 
ATOM   1741  N  N     . VAL C 3 36  ? 20.980  16.457 -17.067 1.00 46.70  ? 49  VAL C N     1 
ATOM   1742  C  CA    . VAL C 3 36  ? 21.442  15.091 -17.240 1.00 46.38  ? 49  VAL C CA    1 
ATOM   1743  C  C     . VAL C 3 36  ? 21.252  14.694 -18.712 1.00 46.05  ? 49  VAL C C     1 
ATOM   1744  O  O     . VAL C 3 36  ? 22.199  14.237 -19.358 1.00 46.61  ? 49  VAL C O     1 
ATOM   1745  C  CB    . VAL C 3 36  ? 20.650  14.166 -16.289 1.00 46.63  ? 49  VAL C CB    1 
ATOM   1746  C  CG1   . VAL C 3 36  ? 21.076  12.721 -16.451 1.00 47.17  ? 49  VAL C CG1   1 
ATOM   1747  C  CG2   . VAL C 3 36  ? 20.780  14.622 -14.847 1.00 46.79  ? 49  VAL C CG2   1 
ATOM   1748  N  N     . TYR C 3 37  ? 20.042  14.927 -19.255 1.00 44.72  ? 50  TYR C N     1 
ATOM   1749  C  CA    . TYR C 3 37  ? 19.712  14.631 -20.640 1.00 44.11  ? 50  TYR C CA    1 
ATOM   1750  C  C     . TYR C 3 37  ? 20.611  15.460 -21.553 1.00 43.54  ? 50  TYR C C     1 
ATOM   1751  O  O     . TYR C 3 37  ? 21.206  14.911 -22.477 1.00 43.62  ? 50  TYR C O     1 
ATOM   1752  C  CB    . TYR C 3 37  ? 18.235  14.977 -20.901 1.00 44.02  ? 50  TYR C CB    1 
ATOM   1753  C  CG    . TYR C 3 37  ? 17.651  14.311 -22.123 1.00 44.48  ? 50  TYR C CG    1 
ATOM   1754  C  CD1   . TYR C 3 37  ? 18.125  14.601 -23.391 1.00 45.10  ? 50  TYR C CD1   1 
ATOM   1755  C  CD2   . TYR C 3 37  ? 16.586  13.434 -22.014 1.00 45.53  ? 50  TYR C CD2   1 
ATOM   1756  C  CE1   . TYR C 3 37  ? 17.600  13.985 -24.515 1.00 46.18  ? 50  TYR C CE1   1 
ATOM   1757  C  CE2   . TYR C 3 37  ? 16.053  12.806 -23.131 1.00 46.46  ? 50  TYR C CE2   1 
ATOM   1758  C  CZ    . TYR C 3 37  ? 16.559  13.088 -24.384 1.00 47.24  ? 50  TYR C CZ    1 
ATOM   1759  O  OH    . TYR C 3 37  ? 16.022  12.487 -25.497 1.00 48.53  ? 50  TYR C OH    1 
ATOM   1760  N  N     . LEU C 3 38  ? 20.746  16.769 -21.248 1.00 42.61  ? 51  LEU C N     1 
ATOM   1761  C  CA    . LEU C 3 38  ? 21.555  17.702 -22.025 1.00 42.14  ? 51  LEU C CA    1 
ATOM   1762  C  C     . LEU C 3 38  ? 23.038  17.373 -21.990 1.00 42.03  ? 51  LEU C C     1 
ATOM   1763  O  O     . LEU C 3 38  ? 23.625  17.262 -23.066 1.00 42.19  ? 51  LEU C O     1 
ATOM   1764  C  CB    . LEU C 3 38  ? 21.294  19.152 -21.599 1.00 41.87  ? 51  LEU C CB    1 
ATOM   1765  C  CG    . LEU C 3 38  ? 21.987  20.278 -22.392 1.00 42.42  ? 51  LEU C CG    1 
ATOM   1766  C  CD1   . LEU C 3 38  ? 21.771  20.142 -23.892 1.00 42.71  ? 51  LEU C CD1   1 
ATOM   1767  C  CD2   . LEU C 3 38  ? 21.474  21.614 -21.933 1.00 42.78  ? 51  LEU C CD2   1 
ATOM   1768  N  N     . ALA C 3 39  ? 23.641  17.145 -20.792 1.00 41.49  ? 52  ALA C N     1 
ATOM   1769  C  CA    . ALA C 3 39  ? 25.062  16.781 -20.706 1.00 41.57  ? 52  ALA C CA    1 
ATOM   1770  C  C     . ALA C 3 39  ? 25.376  15.530 -21.532 1.00 41.94  ? 52  ALA C C     1 
ATOM   1771  O  O     . ALA C 3 39  ? 26.444  15.441 -22.141 1.00 41.96  ? 52  ALA C O     1 
ATOM   1772  C  CB    . ALA C 3 39  ? 25.468  16.563 -19.267 1.00 41.52  ? 52  ALA C CB    1 
ATOM   1773  N  N     . ALA C 3 40  ? 24.395  14.601 -21.601 1.00 41.99  ? 53  ALA C N     1 
ATOM   1774  C  CA    . ALA C 3 40  ? 24.451  13.352 -22.363 1.00 42.36  ? 53  ALA C CA    1 
ATOM   1775  C  C     . ALA C 3 40  ? 24.401  13.587 -23.880 1.00 42.50  ? 53  ALA C C     1 
ATOM   1776  O  O     . ALA C 3 40  ? 25.135  12.927 -24.621 1.00 42.91  ? 53  ALA C O     1 
ATOM   1777  C  CB    . ALA C 3 40  ? 23.310  12.437 -21.939 1.00 42.22  ? 53  ALA C CB    1 
ATOM   1778  N  N     . VAL C 3 41  ? 23.515  14.498 -24.336 1.00 41.64  ? 54  VAL C N     1 
ATOM   1779  C  CA    . VAL C 3 41  ? 23.381  14.856 -25.748 1.00 41.31  ? 54  VAL C CA    1 
ATOM   1780  C  C     . VAL C 3 41  ? 24.647  15.566 -26.212 1.00 40.91  ? 54  VAL C C     1 
ATOM   1781  O  O     . VAL C 3 41  ? 25.099  15.330 -27.325 1.00 40.92  ? 54  VAL C O     1 
ATOM   1782  C  CB    . VAL C 3 41  ? 22.118  15.713 -26.011 1.00 42.30  ? 54  VAL C CB    1 
ATOM   1783  C  CG1   . VAL C 3 41  ? 22.104  16.275 -27.428 1.00 43.09  ? 54  VAL C CG1   1 
ATOM   1784  C  CG2   . VAL C 3 41  ? 20.853  14.910 -25.751 1.00 42.68  ? 54  VAL C CG2   1 
ATOM   1785  N  N     . LEU C 3 42  ? 25.226  16.424 -25.360 1.00 40.57  ? 55  LEU C N     1 
ATOM   1786  C  CA    . LEU C 3 42  ? 26.453  17.138 -25.679 1.00 40.68  ? 55  LEU C CA    1 
ATOM   1787  C  C     . LEU C 3 42  ? 27.614  16.165 -25.723 1.00 41.73  ? 55  LEU C C     1 
ATOM   1788  O  O     . LEU C 3 42  ? 28.410  16.212 -26.661 1.00 41.86  ? 55  LEU C O     1 
ATOM   1789  C  CB    . LEU C 3 42  ? 26.705  18.244 -24.655 1.00 40.34  ? 55  LEU C CB    1 
ATOM   1790  C  CG    . LEU C 3 42  ? 25.721  19.404 -24.728 1.00 41.23  ? 55  LEU C CG    1 
ATOM   1791  C  CD1   . LEU C 3 42  ? 25.819  20.288 -23.519 1.00 41.53  ? 55  LEU C CD1   1 
ATOM   1792  C  CD2   . LEU C 3 42  ? 25.932  20.202 -25.978 1.00 41.62  ? 55  LEU C CD2   1 
ATOM   1793  N  N     . GLU C 3 43  ? 27.677  15.237 -24.743 1.00 42.30  ? 56  GLU C N     1 
ATOM   1794  C  CA    . GLU C 3 43  ? 28.723  14.224 -24.675 1.00 43.24  ? 56  GLU C CA    1 
ATOM   1795  C  C     . GLU C 3 43  ? 28.652  13.291 -25.882 1.00 44.18  ? 56  GLU C C     1 
ATOM   1796  O  O     . GLU C 3 43  ? 29.689  12.952 -26.458 1.00 44.07  ? 56  GLU C O     1 
ATOM   1797  C  CB    . GLU C 3 43  ? 28.629  13.419 -23.373 1.00 45.29  ? 56  GLU C CB    1 
ATOM   1798  C  CG    . GLU C 3 43  ? 29.732  12.375 -23.262 1.00 49.26  ? 56  GLU C CG    1 
ATOM   1799  C  CD    . GLU C 3 43  ? 29.737  11.536 -22.004 1.00 53.58  ? 56  GLU C CD    1 
ATOM   1800  O  OE1   . GLU C 3 43  ? 29.360  12.082 -20.942 1.00 53.93  ? 56  GLU C OE1   1 
ATOM   1801  O  OE2   . GLU C 3 43  ? 30.130  10.347 -22.070 1.00 55.08  ? 56  GLU C OE2   1 
ATOM   1802  N  N     . TYR C 3 44  ? 27.430  12.890 -26.282 1.00 44.85  ? 57  TYR C N     1 
ATOM   1803  C  CA    . TYR C 3 44  ? 27.248  12.033 -27.452 1.00 45.94  ? 57  TYR C CA    1 
ATOM   1804  C  C     . TYR C 3 44  ? 27.782  12.725 -28.708 1.00 46.57  ? 57  TYR C C     1 
ATOM   1805  O  O     . TYR C 3 44  ? 28.544  12.115 -29.454 1.00 46.90  ? 57  TYR C O     1 
ATOM   1806  C  CB    . TYR C 3 44  ? 25.772  11.616 -27.649 1.00 46.28  ? 57  TYR C CB    1 
ATOM   1807  C  CG    . TYR C 3 44  ? 25.471  11.110 -29.048 1.00 47.69  ? 57  TYR C CG    1 
ATOM   1808  C  CD1   . TYR C 3 44  ? 26.006  9.914  -29.505 1.00 48.72  ? 57  TYR C CD1   1 
ATOM   1809  C  CD2   . TYR C 3 44  ? 24.719  11.868 -29.937 1.00 49.03  ? 57  TYR C CD2   1 
ATOM   1810  C  CE1   . TYR C 3 44  ? 25.786  9.473  -30.804 1.00 49.87  ? 57  TYR C CE1   1 
ATOM   1811  C  CE2   . TYR C 3 44  ? 24.488  11.434 -31.239 1.00 50.25  ? 57  TYR C CE2   1 
ATOM   1812  C  CZ    . TYR C 3 44  ? 25.025  10.235 -31.671 1.00 51.11  ? 57  TYR C CZ    1 
ATOM   1813  O  OH    . TYR C 3 44  ? 24.784  9.783  -32.951 1.00 52.63  ? 57  TYR C OH    1 
ATOM   1814  N  N     . LEU C 3 45  ? 27.370  13.977 -28.942 1.00 46.55  ? 58  LEU C N     1 
ATOM   1815  C  CA    . LEU C 3 45  ? 27.778  14.713 -30.126 1.00 47.11  ? 58  LEU C CA    1 
ATOM   1816  C  C     . LEU C 3 45  ? 29.271  14.947 -30.164 1.00 48.27  ? 58  LEU C C     1 
ATOM   1817  O  O     . LEU C 3 45  ? 29.863  14.856 -31.240 1.00 48.55  ? 58  LEU C O     1 
ATOM   1818  C  CB    . LEU C 3 45  ? 26.998  16.022 -30.266 1.00 46.90  ? 58  LEU C CB    1 
ATOM   1819  C  CG    . LEU C 3 45  ? 25.511  15.864 -30.543 1.00 47.66  ? 58  LEU C CG    1 
ATOM   1820  C  CD1   . LEU C 3 45  ? 24.803  17.201 -30.493 1.00 47.67  ? 58  LEU C CD1   1 
ATOM   1821  C  CD2   . LEU C 3 45  ? 25.269  15.159 -31.866 1.00 48.23  ? 58  LEU C CD2   1 
ATOM   1822  N  N     . THR C 3 46  ? 29.892  15.189 -28.998 1.00 48.74  ? 59  THR C N     1 
ATOM   1823  C  CA    . THR C 3 46  ? 31.337  15.366 -28.892 1.00 49.69  ? 59  THR C CA    1 
ATOM   1824  C  C     . THR C 3 46  ? 32.039  14.068 -29.290 1.00 50.72  ? 59  THR C C     1 
ATOM   1825  O  O     . THR C 3 46  ? 32.975  14.093 -30.078 1.00 50.83  ? 59  THR C O     1 
ATOM   1826  C  CB    . THR C 3 46  ? 31.687  15.785 -27.468 1.00 51.00  ? 59  THR C CB    1 
ATOM   1827  O  OG1   . THR C 3 46  ? 31.277  17.130 -27.307 1.00 52.20  ? 59  THR C OG1   1 
ATOM   1828  C  CG2   . THR C 3 46  ? 33.160  15.687 -27.171 1.00 51.35  ? 59  THR C CG2   1 
ATOM   1829  N  N     . ALA C 3 47  ? 31.548  12.934 -28.783 1.00 51.11  ? 60  ALA C N     1 
ATOM   1830  C  CA    . ALA C 3 47  ? 32.108  11.630 -29.084 1.00 52.07  ? 60  ALA C CA    1 
ATOM   1831  C  C     . ALA C 3 47  ? 31.954  11.299 -30.569 1.00 53.26  ? 60  ALA C C     1 
ATOM   1832  O  O     . ALA C 3 47  ? 32.894  10.820 -31.198 1.00 53.53  ? 60  ALA C O     1 
ATOM   1833  C  CB    . ALA C 3 47  ? 31.432  10.573 -28.227 1.00 52.01  ? 60  ALA C CB    1 
ATOM   1834  N  N     . GLU C 3 48  ? 30.793  11.610 -31.137 1.00 53.75  ? 61  GLU C N     1 
ATOM   1835  C  CA    . GLU C 3 48  ? 30.484  11.381 -32.534 1.00 54.67  ? 61  GLU C CA    1 
ATOM   1836  C  C     . GLU C 3 48  ? 31.472  12.156 -33.432 1.00 55.59  ? 61  GLU C C     1 
ATOM   1837  O  O     . GLU C 3 48  ? 31.993  11.602 -34.402 1.00 55.58  ? 61  GLU C O     1 
ATOM   1838  C  CB    . GLU C 3 48  ? 29.033  11.803 -32.774 1.00 56.61  ? 61  GLU C CB    1 
ATOM   1839  C  CG    . GLU C 3 48  ? 28.421  11.290 -34.062 1.00 61.30  ? 61  GLU C CG    1 
ATOM   1840  C  CD    . GLU C 3 48  ? 28.504  9.794  -34.275 1.00 66.66  ? 61  GLU C CD    1 
ATOM   1841  O  OE1   . GLU C 3 48  ? 27.869  9.036  -33.506 1.00 67.03  ? 61  GLU C OE1   1 
ATOM   1842  O  OE2   . GLU C 3 48  ? 29.204  9.385  -35.229 1.00 68.85  ? 61  GLU C OE2   1 
ATOM   1843  N  N     . ILE C 3 49  ? 31.789  13.406 -33.063 1.00 56.35  ? 62  ILE C N     1 
ATOM   1844  C  CA    . ILE C 3 49  ? 32.756  14.222 -33.811 1.00 57.47  ? 62  ILE C CA    1 
ATOM   1845  C  C     . ILE C 3 49  ? 34.183  13.689 -33.639 1.00 58.48  ? 62  ILE C C     1 
ATOM   1846  O  O     . ILE C 3 49  ? 34.832  13.379 -34.639 1.00 58.82  ? 62  ILE C O     1 
ATOM   1847  C  CB    . ILE C 3 49  ? 32.645  15.740 -33.475 1.00 58.02  ? 62  ILE C CB    1 
ATOM   1848  C  CG1   . ILE C 3 49  ? 31.318  16.309 -34.011 1.00 58.82  ? 62  ILE C CG1   1 
ATOM   1849  C  CG2   . ILE C 3 49  ? 33.871  16.536 -33.991 1.00 58.41  ? 62  ILE C CG2   1 
ATOM   1850  C  CD1   . ILE C 3 49  ? 31.206  17.798 -33.977 1.00 60.04  ? 62  ILE C CD1   1 
ATOM   1851  N  N     . LEU C 3 50  ? 34.652  13.555 -32.369 1.00 58.43  ? 63  LEU C N     1 
ATOM   1852  C  CA    . LEU C 3 50  ? 35.982  13.057 -32.001 1.00 58.72  ? 63  LEU C CA    1 
ATOM   1853  C  C     . LEU C 3 50  ? 36.300  11.750 -32.696 1.00 59.76  ? 63  LEU C C     1 
ATOM   1854  O  O     . LEU C 3 50  ? 37.435  11.549 -33.119 1.00 59.82  ? 63  LEU C O     1 
ATOM   1855  C  CB    . LEU C 3 50  ? 36.097  12.881 -30.484 1.00 58.19  ? 63  LEU C CB    1 
ATOM   1856  C  CG    . LEU C 3 50  ? 36.169  14.174 -29.687 1.00 58.72  ? 63  LEU C CG    1 
ATOM   1857  C  CD1   . LEU C 3 50  ? 36.041  13.915 -28.217 1.00 59.15  ? 63  LEU C CD1   1 
ATOM   1858  C  CD2   . LEU C 3 50  ? 37.434  14.888 -29.948 1.00 58.95  ? 63  LEU C CD2   1 
ATOM   1859  N  N     . GLU C 3 51  ? 35.285  10.886 -32.863 1.00 60.52  ? 64  GLU C N     1 
ATOM   1860  C  CA    . GLU C 3 51  ? 35.430  9.611  -33.543 1.00 61.99  ? 64  GLU C CA    1 
ATOM   1861  C  C     . GLU C 3 51  ? 35.885  9.821  -34.982 1.00 63.13  ? 64  GLU C C     1 
ATOM   1862  O  O     . GLU C 3 51  ? 36.973  9.390  -35.344 1.00 63.59  ? 64  GLU C O     1 
ATOM   1863  C  CB    . GLU C 3 51  ? 34.116  8.797  -33.468 1.00 64.78  ? 64  GLU C CB    1 
ATOM   1864  C  CG    . GLU C 3 51  ? 34.057  7.556  -34.353 1.00 70.27  ? 64  GLU C CG    1 
ATOM   1865  C  CD    . GLU C 3 51  ? 34.753  6.310  -33.843 1.00 76.96  ? 64  GLU C CD    1 
ATOM   1866  O  OE1   . GLU C 3 51  ? 35.373  5.610  -34.676 1.00 78.81  ? 64  GLU C OE1   1 
ATOM   1867  O  OE2   . GLU C 3 51  ? 34.670  6.023  -32.626 1.00 78.39  ? 64  GLU C OE2   1 
ATOM   1868  N  N     . LEU C 3 52  ? 35.105  10.544 -35.772 1.00 63.53  ? 65  LEU C N     1 
ATOM   1869  C  CA    . LEU C 3 52  ? 35.420  10.768 -37.176 1.00 64.54  ? 65  LEU C CA    1 
ATOM   1870  C  C     . LEU C 3 52  ? 36.675  11.631 -37.390 1.00 65.14  ? 65  LEU C C     1 
ATOM   1871  O  O     . LEU C 3 52  ? 37.337  11.515 -38.422 1.00 64.83  ? 65  LEU C O     1 
ATOM   1872  C  CB    . LEU C 3 52  ? 34.193  11.357 -37.879 1.00 65.06  ? 65  LEU C CB    1 
ATOM   1873  C  CG    . LEU C 3 52  ? 32.882  10.610 -37.633 1.00 66.55  ? 65  LEU C CG    1 
ATOM   1874  C  CD1   . LEU C 3 52  ? 31.699  11.410 -38.101 1.00 67.23  ? 65  LEU C CD1   1 
ATOM   1875  C  CD2   . LEU C 3 52  ? 32.905  9.279  -38.300 1.00 67.12  ? 65  LEU C CD2   1 
ATOM   1876  N  N     . ALA C 3 53  ? 37.004  12.482 -36.411 1.00 66.03  ? 66  ALA C N     1 
ATOM   1877  C  CA    . ALA C 3 53  ? 38.173  13.348 -36.484 1.00 67.68  ? 66  ALA C CA    1 
ATOM   1878  C  C     . ALA C 3 53  ? 39.432  12.541 -36.212 1.00 69.40  ? 66  ALA C C     1 
ATOM   1879  O  O     . ALA C 3 53  ? 40.400  12.682 -36.951 1.00 70.02  ? 66  ALA C O     1 
ATOM   1880  C  CB    . ALA C 3 53  ? 38.053  14.499 -35.496 1.00 67.90  ? 66  ALA C CB    1 
ATOM   1881  N  N     . GLY C 3 54  ? 39.399  11.645 -35.224 1.00 69.93  ? 67  GLY C N     1 
ATOM   1882  C  CA    . GLY C 3 54  ? 40.537  10.781 -34.925 1.00 71.09  ? 67  GLY C CA    1 
ATOM   1883  C  C     . GLY C 3 54  ? 40.885  9.892  -36.104 1.00 72.37  ? 67  GLY C C     1 
ATOM   1884  O  O     . GLY C 3 54  ? 42.062  9.697  -36.419 1.00 72.55  ? 67  GLY C O     1 
ATOM   1885  N  N     . ASN C 3 55  ? 39.844  9.405  -36.805 1.00 73.10  ? 68  ASN C N     1 
ATOM   1886  C  CA    . ASN C 3 55  ? 39.975  8.585  -38.005 1.00 74.31  ? 68  ASN C CA    1 
ATOM   1887  C  C     . ASN C 3 55  ? 40.554  9.375  -39.178 1.00 75.60  ? 68  ASN C C     1 
ATOM   1888  O  O     . ASN C 3 55  ? 41.234  8.796  -40.011 1.00 75.79  ? 68  ASN C O     1 
ATOM   1889  C  CB    . ASN C 3 55  ? 38.639  7.948  -38.385 1.00 75.26  ? 68  ASN C CB    1 
ATOM   1890  C  CG    . ASN C 3 55  ? 38.360  6.679  -37.625 1.00 78.19  ? 68  ASN C CG    1 
ATOM   1891  O  OD1   . ASN C 3 55  ? 39.263  5.868  -37.361 1.00 79.57  ? 68  ASN C OD1   1 
ATOM   1892  N  ND2   . ASN C 3 55  ? 37.102  6.474  -37.264 1.00 78.44  ? 68  ASN C ND2   1 
ATOM   1893  N  N     . ALA C 3 56  ? 40.306  10.688 -39.240 1.00 76.43  ? 69  ALA C N     1 
ATOM   1894  C  CA    . ALA C 3 56  ? 40.857  11.544 -40.283 1.00 77.75  ? 69  ALA C CA    1 
ATOM   1895  C  C     . ALA C 3 56  ? 42.364  11.749 -40.043 1.00 79.24  ? 69  ALA C C     1 
ATOM   1896  O  O     . ALA C 3 56  ? 43.138  11.741 -40.998 1.00 79.35  ? 69  ALA C O     1 
ATOM   1897  C  CB    . ALA C 3 56  ? 40.132  12.880 -40.303 1.00 77.88  ? 69  ALA C CB    1 
ATOM   1898  N  N     . ALA C 3 57  ? 42.781  11.891 -38.769 1.00 80.10  ? 70  ALA C N     1 
ATOM   1899  C  CA    . ALA C 3 57  ? 44.196  12.015 -38.398 1.00 81.66  ? 70  ALA C CA    1 
ATOM   1900  C  C     . ALA C 3 57  ? 44.928  10.667 -38.600 1.00 83.38  ? 70  ALA C C     1 
ATOM   1901  O  O     . ALA C 3 57  ? 46.111  10.644 -38.939 1.00 83.25  ? 70  ALA C O     1 
ATOM   1902  C  CB    . ALA C 3 57  ? 44.321  12.469 -36.953 1.00 81.67  ? 70  ALA C CB    1 
ATOM   1903  N  N     . ARG C 3 58  ? 44.210  9.548  -38.398 1.00 84.86  ? 71  ARG C N     1 
ATOM   1904  C  CA    . ARG C 3 58  ? 44.700  8.188  -38.618 1.00 86.75  ? 71  ARG C CA    1 
ATOM   1905  C  C     . ARG C 3 58  ? 45.095  8.007  -40.112 1.00 88.16  ? 71  ARG C C     1 
ATOM   1906  O  O     . ARG C 3 58  ? 46.002  7.237  -40.414 1.00 88.56  ? 71  ARG C O     1 
ATOM   1907  C  CB    . ARG C 3 58  ? 43.608  7.158  -38.212 1.00 88.48  ? 71  ARG C CB    1 
ATOM   1908  C  CG    . ARG C 3 58  ? 44.035  6.058  -37.213 1.00 91.87  ? 71  ARG C CG    1 
ATOM   1909  C  CD    . ARG C 3 58  ? 43.731  6.383  -35.744 1.00 95.13  ? 71  ARG C CD    1 
ATOM   1910  N  NE    . ARG C 3 58  ? 43.056  5.283  -35.041 1.00 97.65  ? 71  ARG C NE    1 
ATOM   1911  C  CZ    . ARG C 3 58  ? 43.143  5.057  -33.729 1.00 99.26  ? 71  ARG C CZ    1 
ATOM   1912  N  NH1   . ARG C 3 58  ? 42.485  4.045  -33.179 1.00 98.69  ? 71  ARG C NH1   1 
ATOM   1913  N  NH2   . ARG C 3 58  ? 43.894  5.838  -32.962 1.00 98.85  ? 71  ARG C NH2   1 
ATOM   1914  N  N     . ASP C 3 59  ? 44.420  8.720  -41.000 1.00 88.82  ? 72  ASP C N     1 
ATOM   1915  C  CA    . ASP C 3 59  ? 44.687  8.528  -42.445 1.00 90.12  ? 72  ASP C CA    1 
ATOM   1916  C  C     . ASP C 3 59  ? 45.634  9.612  -42.947 1.00 90.72  ? 72  ASP C C     1 
ATOM   1917  O  O     . ASP C 3 59  ? 45.886  9.657  -44.155 1.00 91.00  ? 72  ASP C O     1 
ATOM   1918  C  CB    . ASP C 3 59  ? 43.375  8.482  -43.225 1.00 92.72  ? 72  ASP C CB    1 
ATOM   1919  C  CG    . ASP C 3 59  ? 42.204  8.175  -42.317 1.00 98.68  ? 72  ASP C CG    1 
ATOM   1920  O  OD1   . ASP C 3 59  ? 42.321  7.220  -41.540 1.00 99.71  ? 72  ASP C OD1   1 
ATOM   1921  O  OD2   . ASP C 3 59  ? 41.209  8.912  -42.369 1.00 101.22 ? 72  ASP C OD2   1 
ATOM   1922  N  N     . ASN C 3 60  ? 46.111  10.479 -42.061 1.00 90.81  ? 73  ASN C N     1 
ATOM   1923  C  CA    . ASN C 3 60  ? 47.047  11.532 -42.533 1.00 91.38  ? 73  ASN C CA    1 
ATOM   1924  C  C     . ASN C 3 60  ? 48.347  11.419 -41.744 1.00 90.89  ? 73  ASN C C     1 
ATOM   1925  O  O     . ASN C 3 60  ? 49.052  12.417 -41.607 1.00 90.80  ? 73  ASN C O     1 
ATOM   1926  C  CB    . ASN C 3 60  ? 46.386  12.906 -42.603 1.00 93.57  ? 73  ASN C CB    1 
ATOM   1927  C  CG    . ASN C 3 60  ? 45.257  12.915 -43.610 1.00 97.92  ? 73  ASN C CG    1 
ATOM   1928  O  OD1   . ASN C 3 60  ? 45.471  12.603 -44.778 1.00 99.59  ? 73  ASN C OD1   1 
ATOM   1929  N  ND2   . ASN C 3 60  ? 44.049  13.206 -43.160 1.00 98.60  ? 73  ASN C ND2   1 
ATOM   1930  N  N     . LYS C 3 61  ? 48.597  10.212 -41.240 1.00 90.33  ? 74  LYS C N     1 
ATOM   1931  C  CA    . LYS C 3 61  ? 49.833  9.828  -40.514 1.00 90.12  ? 74  LYS C CA    1 
ATOM   1932  C  C     . LYS C 3 61  ? 50.031  10.668 -39.250 1.00 89.05  ? 74  LYS C C     1 
ATOM   1933  O  O     . LYS C 3 61  ? 51.171  10.715 -38.767 1.00 89.18  ? 74  LYS C O     1 
ATOM   1934  C  CB    . LYS C 3 61  ? 51.017  9.872  -41.483 1.00 92.12  ? 74  LYS C CB    1 
ATOM   1935  C  CG    . LYS C 3 61  ? 50.824  9.038  -42.745 1.00 95.72  ? 74  LYS C CG    1 
ATOM   1936  C  CD    . LYS C 3 61  ? 50.925  9.808  -44.045 1.00 99.06  ? 74  LYS C CD    1 
ATOM   1937  C  CE    . LYS C 3 61  ? 50.861  8.915  -45.266 1.00 101.68 ? 74  LYS C CE    1 
ATOM   1938  N  NZ    . LYS C 3 61  ? 52.161  8.256  -45.542 1.00 103.16 ? 74  LYS C NZ    1 
ATOM   1939  N  N     . LYS C 3 62  ? 48.973  11.284 -38.721 1.00 87.65  ? 75  LYS C N     1 
ATOM   1940  C  CA    . LYS C 3 62  ? 49.173  12.051 -37.491 1.00 86.63  ? 75  LYS C CA    1 
ATOM   1941  C  C     . LYS C 3 62  ? 48.490  11.394 -36.283 1.00 85.49  ? 75  LYS C C     1 
ATOM   1942  O  O     . LYS C 3 62  ? 47.613  10.542 -36.445 1.00 85.41  ? 75  LYS C O     1 
ATOM   1943  C  CB    . LYS C 3 62  ? 48.666  13.497 -37.661 1.00 87.97  ? 75  LYS C CB    1 
ATOM   1944  C  CG    . LYS C 3 62  ? 49.173  14.183 -38.919 1.00 91.36  ? 75  LYS C CG    1 
ATOM   1945  C  CD    . LYS C 3 62  ? 49.529  15.641 -38.681 1.00 95.36  ? 75  LYS C CD    1 
ATOM   1946  C  CE    . LYS C 3 62  ? 50.189  16.245 -39.898 1.00 98.82  ? 75  LYS C CE    1 
ATOM   1947  N  NZ    . LYS C 3 62  ? 50.584  17.660 -39.677 1.00 100.85 ? 75  LYS C NZ    1 
ATOM   1948  N  N     . THR C 3 63  ? 48.905  11.780 -35.067 1.00 84.45  ? 76  THR C N     1 
ATOM   1949  C  CA    . THR C 3 63  ? 48.280  11.268 -33.852 1.00 83.95  ? 76  THR C CA    1 
ATOM   1950  C  C     . THR C 3 63  ? 47.368  12.344 -33.283 1.00 83.19  ? 76  THR C C     1 
ATOM   1951  O  O     . THR C 3 63  ? 46.260  12.024 -32.863 1.00 83.40  ? 76  THR C O     1 
ATOM   1952  C  CB    . THR C 3 63  ? 49.299  10.768 -32.814 1.00 85.10  ? 76  THR C CB    1 
ATOM   1953  O  OG1   . THR C 3 63  ? 50.154  11.838 -32.405 1.00 85.91  ? 76  THR C OG1   1 
ATOM   1954  C  CG2   . THR C 3 63  ? 50.108  9.578  -33.305 1.00 85.50  ? 76  THR C CG2   1 
ATOM   1955  N  N     . ARG C 3 64  ? 47.822  13.621 -33.268 1.00 82.10  ? 77  ARG C N     1 
ATOM   1956  C  CA    . ARG C 3 64  ? 47.002  14.735 -32.764 1.00 81.27  ? 77  ARG C CA    1 
ATOM   1957  C  C     . ARG C 3 64  ? 46.078  15.327 -33.818 1.00 78.99  ? 77  ARG C C     1 
ATOM   1958  O  O     . ARG C 3 64  ? 46.484  15.590 -34.954 1.00 79.09  ? 77  ARG C O     1 
ATOM   1959  C  CB    . ARG C 3 64  ? 47.824  15.850 -32.090 1.00 83.63  ? 77  ARG C CB    1 
ATOM   1960  C  CG    . ARG C 3 64  ? 48.388  15.443 -30.726 1.00 88.61  ? 77  ARG C CG    1 
ATOM   1961  C  CD    . ARG C 3 64  ? 49.885  15.210 -30.777 1.00 93.69  ? 77  ARG C CD    1 
ATOM   1962  N  NE    . ARG C 3 64  ? 50.618  16.426 -31.137 1.00 98.71  ? 77  ARG C NE    1 
ATOM   1963  C  CZ    . ARG C 3 64  ? 51.549  16.998 -30.381 1.00 102.57 ? 77  ARG C CZ    1 
ATOM   1964  N  NH1   . ARG C 3 64  ? 51.864  16.482 -29.197 1.00 103.15 ? 77  ARG C NH1   1 
ATOM   1965  N  NH2   . ARG C 3 64  ? 52.153  18.105 -30.790 1.00 102.66 ? 77  ARG C NH2   1 
ATOM   1966  N  N     . ILE C 3 65  ? 44.818  15.521 -33.416 1.00 76.68  ? 78  ILE C N     1 
ATOM   1967  C  CA    . ILE C 3 65  ? 43.744  16.080 -34.213 1.00 74.64  ? 78  ILE C CA    1 
ATOM   1968  C  C     . ILE C 3 65  ? 43.916  17.588 -34.248 1.00 72.32  ? 78  ILE C C     1 
ATOM   1969  O  O     . ILE C 3 65  ? 43.972  18.235 -33.206 1.00 72.59  ? 78  ILE C O     1 
ATOM   1970  C  CB    . ILE C 3 65  ? 42.378  15.698 -33.576 1.00 74.95  ? 78  ILE C CB    1 
ATOM   1971  C  CG1   . ILE C 3 65  ? 42.082  14.204 -33.726 1.00 75.59  ? 78  ILE C CG1   1 
ATOM   1972  C  CG2   . ILE C 3 65  ? 41.235  16.542 -34.133 1.00 75.49  ? 78  ILE C CG2   1 
ATOM   1973  C  CD1   . ILE C 3 65  ? 40.975  13.730 -32.836 1.00 76.79  ? 78  ILE C CD1   1 
ATOM   1974  N  N     . ILE C 3 66  ? 44.025  18.138 -35.444 1.00 69.70  ? 79  ILE C N     1 
ATOM   1975  C  CA    . ILE C 3 66  ? 44.100  19.576 -35.648 1.00 67.59  ? 79  ILE C CA    1 
ATOM   1976  C  C     . ILE C 3 66  ? 42.744  20.010 -36.246 1.00 65.18  ? 79  ILE C C     1 
ATOM   1977  O  O     . ILE C 3 66  ? 41.950  19.153 -36.673 1.00 65.28  ? 79  ILE C O     1 
ATOM   1978  C  CB    . ILE C 3 66  ? 45.284  19.919 -36.591 1.00 67.91  ? 79  ILE C CB    1 
ATOM   1979  C  CG1   . ILE C 3 66  ? 45.076  19.303 -37.992 1.00 68.51  ? 79  ILE C CG1   1 
ATOM   1980  C  CG2   . ILE C 3 66  ? 46.619  19.528 -35.958 1.00 68.37  ? 79  ILE C CG2   1 
ATOM   1981  C  CD1   . ILE C 3 66  ? 46.116  19.602 -39.010 1.00 69.64  ? 79  ILE C CD1   1 
ATOM   1982  N  N     . PRO C 3 67  ? 42.456  21.324 -36.320 1.00 62.65  ? 80  PRO C N     1 
ATOM   1983  C  CA    . PRO C 3 67  ? 41.182  21.750 -36.910 1.00 61.21  ? 80  PRO C CA    1 
ATOM   1984  C  C     . PRO C 3 67  ? 40.929  21.224 -38.329 1.00 59.63  ? 80  PRO C C     1 
ATOM   1985  O  O     . PRO C 3 67  ? 39.768  21.090 -38.705 1.00 59.95  ? 80  PRO C O     1 
ATOM   1986  C  CB    . PRO C 3 67  ? 41.250  23.277 -36.834 1.00 62.01  ? 80  PRO C CB    1 
ATOM   1987  C  CG    . PRO C 3 67  ? 42.212  23.557 -35.741 1.00 62.59  ? 80  PRO C CG    1 
ATOM   1988  C  CD    . PRO C 3 67  ? 43.237  22.481 -35.847 1.00 61.50  ? 80  PRO C CD    1 
ATOM   1989  N  N     . ARG C 3 68  ? 41.981  20.854 -39.092 1.00 57.88  ? 81  ARG C N     1 
ATOM   1990  C  CA    . ARG C 3 68  ? 41.785  20.286 -40.428 1.00 56.76  ? 81  ARG C CA    1 
ATOM   1991  C  C     . ARG C 3 68  ? 41.069  18.956 -40.319 1.00 56.59  ? 81  ARG C C     1 
ATOM   1992  O  O     . ARG C 3 68  ? 40.175  18.686 -41.103 1.00 56.96  ? 81  ARG C O     1 
ATOM   1993  C  CB    . ARG C 3 68  ? 43.109  20.071 -41.166 1.00 56.55  ? 81  ARG C CB    1 
ATOM   1994  C  CG    . ARG C 3 68  ? 43.012  20.223 -42.689 1.00 56.93  ? 81  ARG C CG    1 
ATOM   1995  C  CD    . ARG C 3 68  ? 41.945  19.375 -43.349 1.00 57.36  ? 81  ARG C CD    1 
ATOM   1996  N  NE    . ARG C 3 68  ? 42.088  19.227 -44.788 1.00 58.20  ? 81  ARG C NE    1 
ATOM   1997  C  CZ    . ARG C 3 68  ? 41.617  20.087 -45.693 1.00 58.70  ? 81  ARG C CZ    1 
ATOM   1998  N  NH1   . ARG C 3 68  ? 40.956  21.169 -45.308 1.00 56.83  ? 81  ARG C NH1   1 
ATOM   1999  N  NH2   . ARG C 3 68  ? 41.780  19.856 -46.991 1.00 58.72  ? 81  ARG C NH2   1 
ATOM   2000  N  N     . HIS C 3 69  ? 41.439  18.137 -39.338 1.00 56.12  ? 82  HIS C N     1 
ATOM   2001  C  CA    . HIS C 3 69  ? 40.827  16.827 -39.121 1.00 55.89  ? 82  HIS C CA    1 
ATOM   2002  C  C     . HIS C 3 69  ? 39.354  16.977 -38.722 1.00 54.01  ? 82  HIS C C     1 
ATOM   2003  O  O     . HIS C 3 69  ? 38.509  16.229 -39.214 1.00 54.07  ? 82  HIS C O     1 
ATOM   2004  C  CB    . HIS C 3 69  ? 41.640  16.033 -38.090 1.00 57.86  ? 82  HIS C CB    1 
ATOM   2005  C  CG    . HIS C 3 69  ? 43.107  15.955 -38.429 1.00 61.63  ? 82  HIS C CG    1 
ATOM   2006  N  ND1   . HIS C 3 69  ? 44.080  15.916 -37.439 1.00 63.73  ? 82  HIS C ND1   1 
ATOM   2007  C  CD2   . HIS C 3 69  ? 43.716  15.922 -39.641 1.00 62.98  ? 82  HIS C CD2   1 
ATOM   2008  C  CE1   . HIS C 3 69  ? 45.236  15.838 -38.080 1.00 64.27  ? 82  HIS C CE1   1 
ATOM   2009  N  NE2   . HIS C 3 69  ? 45.068  15.859 -39.406 1.00 64.10  ? 82  HIS C NE2   1 
ATOM   2010  N  N     . LEU C 3 70  ? 39.044  18.004 -37.910 1.00 52.03  ? 83  LEU C N     1 
ATOM   2011  C  CA    . LEU C 3 70  ? 37.683  18.312 -37.517 1.00 50.62  ? 83  LEU C CA    1 
ATOM   2012  C  C     . LEU C 3 70  ? 36.861  18.703 -38.730 1.00 50.16  ? 83  LEU C C     1 
ATOM   2013  O  O     . LEU C 3 70  ? 35.781  18.162 -38.907 1.00 50.67  ? 83  LEU C O     1 
ATOM   2014  C  CB    . LEU C 3 70  ? 37.665  19.420 -36.465 1.00 50.03  ? 83  LEU C CB    1 
ATOM   2015  C  CG    . LEU C 3 70  ? 38.156  18.975 -35.111 1.00 50.63  ? 83  LEU C CG    1 
ATOM   2016  C  CD1   . LEU C 3 70  ? 38.421  20.132 -34.223 1.00 50.71  ? 83  LEU C CD1   1 
ATOM   2017  C  CD2   . LEU C 3 70  ? 37.191  18.022 -34.475 1.00 51.13  ? 83  LEU C CD2   1 
ATOM   2018  N  N     . GLN C 3 71  ? 37.388  19.564 -39.606 1.00 49.41  ? 84  GLN C N     1 
ATOM   2019  C  CA    . GLN C 3 71  ? 36.661  19.972 -40.806 1.00 49.77  ? 84  GLN C CA    1 
ATOM   2020  C  C     . GLN C 3 71  ? 36.419  18.792 -41.728 1.00 50.58  ? 84  GLN C C     1 
ATOM   2021  O  O     . GLN C 3 71  ? 35.297  18.586 -42.185 1.00 51.30  ? 84  GLN C O     1 
ATOM   2022  C  CB    . GLN C 3 71  ? 37.373  21.110 -41.543 1.00 50.64  ? 84  GLN C CB    1 
ATOM   2023  C  CG    . GLN C 3 71  ? 36.726  21.497 -42.875 1.00 52.63  ? 84  GLN C CG    1 
ATOM   2024  C  CD    . GLN C 3 71  ? 35.618  22.523 -42.766 1.00 55.92  ? 84  GLN C CD    1 
ATOM   2025  O  OE1   . GLN C 3 71  ? 35.383  23.141 -41.719 1.00 57.30  ? 84  GLN C OE1   1 
ATOM   2026  N  NE2   . GLN C 3 71  ? 34.965  22.788 -43.885 1.00 56.13  ? 84  GLN C NE2   1 
ATOM   2027  N  N     . LEU C 3 72  ? 37.433  17.967 -41.938 1.00 50.47  ? 85  LEU C N     1 
ATOM   2028  C  CA    . LEU C 3 72  ? 37.304  16.786 -42.783 1.00 51.00  ? 85  LEU C CA    1 
ATOM   2029  C  C     . LEU C 3 72  ? 36.232  15.846 -42.268 1.00 50.61  ? 85  LEU C C     1 
ATOM   2030  O  O     . LEU C 3 72  ? 35.432  15.347 -43.054 1.00 50.98  ? 85  LEU C O     1 
ATOM   2031  C  CB    . LEU C 3 72  ? 38.640  16.057 -42.872 1.00 51.90  ? 85  LEU C CB    1 
ATOM   2032  C  CG    . LEU C 3 72  ? 39.714  16.791 -43.649 1.00 54.22  ? 85  LEU C CG    1 
ATOM   2033  C  CD1   . LEU C 3 72  ? 41.017  16.012 -43.629 1.00 55.00  ? 85  LEU C CD1   1 
ATOM   2034  C  CD2   . LEU C 3 72  ? 39.261  17.082 -45.079 1.00 55.09  ? 85  LEU C CD2   1 
ATOM   2035  N  N     . ALA C 3 73  ? 36.161  15.680 -40.941 1.00 49.76  ? 86  ALA C N     1 
ATOM   2036  C  CA    . ALA C 3 73  ? 35.154  14.829 -40.324 1.00 49.65  ? 86  ALA C CA    1 
ATOM   2037  C  C     . ALA C 3 73  ? 33.747  15.400 -40.534 1.00 49.06  ? 86  ALA C C     1 
ATOM   2038  O  O     . ALA C 3 73  ? 32.847  14.655 -40.938 1.00 49.61  ? 86  ALA C O     1 
ATOM   2039  C  CB    . ALA C 3 73  ? 35.447  14.663 -38.837 1.00 49.90  ? 86  ALA C CB    1 
ATOM   2040  N  N     . ILE C 3 74  ? 33.574  16.722 -40.309 1.00 47.48  ? 87  ILE C N     1 
ATOM   2041  C  CA    . ILE C 3 74  ? 32.286  17.388 -40.429 1.00 46.66  ? 87  ILE C CA    1 
ATOM   2042  C  C     . ILE C 3 74  ? 31.742  17.348 -41.843 1.00 45.86  ? 87  ILE C C     1 
ATOM   2043  O  O     . ILE C 3 74  ? 30.632  16.864 -42.044 1.00 46.20  ? 87  ILE C O     1 
ATOM   2044  C  CB    . ILE C 3 74  ? 32.304  18.844 -39.870 1.00 47.00  ? 87  ILE C CB    1 
ATOM   2045  C  CG1   . ILE C 3 74  ? 32.859  18.933 -38.443 1.00 47.80  ? 87  ILE C CG1   1 
ATOM   2046  C  CG2   . ILE C 3 74  ? 30.925  19.470 -39.952 1.00 47.55  ? 87  ILE C CG2   1 
ATOM   2047  C  CD1   . ILE C 3 74  ? 32.168  18.079 -37.459 1.00 49.11  ? 87  ILE C CD1   1 
ATOM   2048  N  N     . ARG C 3 75  ? 32.517  17.844 -42.822 1.00 45.06  ? 88  ARG C N     1 
ATOM   2049  C  CA    . ARG C 3 75  ? 32.090  17.952 -44.214 1.00 44.83  ? 88  ARG C CA    1 
ATOM   2050  C  C     . ARG C 3 75  ? 31.979  16.639 -44.951 1.00 45.62  ? 88  ARG C C     1 
ATOM   2051  O  O     . ARG C 3 75  ? 31.317  16.591 -45.989 1.00 45.65  ? 88  ARG C O     1 
ATOM   2052  C  CB    . ARG C 3 75  ? 32.984  18.912 -44.985 1.00 45.65  ? 88  ARG C CB    1 
ATOM   2053  C  CG    . ARG C 3 75  ? 33.268  20.207 -44.248 1.00 48.22  ? 88  ARG C CG    1 
ATOM   2054  C  CD    . ARG C 3 75  ? 32.008  20.996 -43.971 1.00 51.31  ? 88  ARG C CD    1 
ATOM   2055  N  NE    . ARG C 3 75  ? 32.025  21.655 -42.663 1.00 53.12  ? 88  ARG C NE    1 
ATOM   2056  C  CZ    . ARG C 3 75  ? 31.038  22.417 -42.202 1.00 54.44  ? 88  ARG C CZ    1 
ATOM   2057  N  NH1   . ARG C 3 75  ? 29.941  22.604 -42.923 1.00 53.55  ? 88  ARG C NH1   1 
ATOM   2058  N  NH2   . ARG C 3 75  ? 31.134  22.986 -41.009 1.00 54.50  ? 88  ARG C NH2   1 
ATOM   2059  N  N     . ASN C 3 76  ? 32.605  15.572 -44.432 1.00 45.83  ? 89  ASN C N     1 
ATOM   2060  C  CA    . ASN C 3 76  ? 32.478  14.260 -45.050 1.00 46.73  ? 89  ASN C CA    1 
ATOM   2061  C  C     . ASN C 3 76  ? 31.223  13.520 -44.564 1.00 46.73  ? 89  ASN C C     1 
ATOM   2062  O  O     . ASN C 3 76  ? 30.698  12.673 -45.289 1.00 46.65  ? 89  ASN C O     1 
ATOM   2063  C  CB    . ASN C 3 76  ? 33.748  13.454 -44.912 1.00 48.84  ? 89  ASN C CB    1 
ATOM   2064  C  CG    . ASN C 3 76  ? 34.729  13.827 -46.003 1.00 54.13  ? 89  ASN C CG    1 
ATOM   2065  O  OD1   . ASN C 3 76  ? 34.368  13.904 -47.194 1.00 55.35  ? 89  ASN C OD1   1 
ATOM   2066  N  ND2   . ASN C 3 76  ? 35.984  14.083 -45.625 1.00 55.97  ? 89  ASN C ND2   1 
ATOM   2067  N  N     . ASP C 3 77  ? 30.702  13.881 -43.375 1.00 46.70  ? 90  ASP C N     1 
ATOM   2068  C  CA    . ASP C 3 77  ? 29.439  13.340 -42.883 1.00 47.04  ? 90  ASP C CA    1 
ATOM   2069  C  C     . ASP C 3 77  ? 28.299  14.135 -43.557 1.00 46.71  ? 90  ASP C C     1 
ATOM   2070  O  O     . ASP C 3 77  ? 28.509  15.244 -44.063 1.00 46.49  ? 90  ASP C O     1 
ATOM   2071  C  CB    . ASP C 3 77  ? 29.342  13.465 -41.342 1.00 49.31  ? 90  ASP C CB    1 
ATOM   2072  C  CG    . ASP C 3 77  ? 28.316  12.546 -40.689 1.00 55.96  ? 90  ASP C CG    1 
ATOM   2073  O  OD1   . ASP C 3 77  ? 27.587  11.838 -41.428 1.00 57.34  ? 90  ASP C OD1   1 
ATOM   2074  O  OD2   . ASP C 3 77  ? 28.247  12.525 -39.440 1.00 58.84  ? 90  ASP C OD2   1 
ATOM   2075  N  N     . GLU C 3 78  ? 27.103  13.554 -43.596 1.00 46.45  ? 91  GLU C N     1 
ATOM   2076  C  CA    . GLU C 3 78  ? 25.946  14.240 -44.158 1.00 46.54  ? 91  GLU C CA    1 
ATOM   2077  C  C     . GLU C 3 78  ? 25.225  14.992 -43.049 1.00 45.52  ? 91  GLU C C     1 
ATOM   2078  O  O     . GLU C 3 78  ? 24.838  16.132 -43.235 1.00 45.72  ? 91  GLU C O     1 
ATOM   2079  C  CB    . GLU C 3 78  ? 25.004  13.250 -44.849 1.00 49.72  ? 91  GLU C CB    1 
ATOM   2080  C  CG    . GLU C 3 78  ? 23.935  13.942 -45.678 1.00 55.81  ? 91  GLU C CG    1 
ATOM   2081  C  CD    . GLU C 3 78  ? 23.091  13.032 -46.552 1.00 63.61  ? 91  GLU C CD    1 
ATOM   2082  O  OE1   . GLU C 3 78  ? 22.461  12.091 -46.010 1.00 65.56  ? 91  GLU C OE1   1 
ATOM   2083  O  OE2   . GLU C 3 78  ? 23.048  13.272 -47.782 1.00 65.46  ? 91  GLU C OE2   1 
ATOM   2084  N  N     . GLU C 3 79  ? 25.085  14.372 -41.883 1.00 44.72  ? 92  GLU C N     1 
ATOM   2085  C  CA    . GLU C 3 79  ? 24.394  14.949 -40.739 1.00 44.48  ? 92  GLU C CA    1 
ATOM   2086  C  C     . GLU C 3 79  ? 25.205  15.979 -40.017 1.00 44.45  ? 92  GLU C C     1 
ATOM   2087  O  O     . GLU C 3 79  ? 24.652  17.006 -39.648 1.00 45.33  ? 92  GLU C O     1 
ATOM   2088  C  CB    . GLU C 3 79  ? 23.921  13.863 -39.776 1.00 46.16  ? 92  GLU C CB    1 
ATOM   2089  C  CG    . GLU C 3 79  ? 23.231  12.736 -40.510 1.00 49.26  ? 92  GLU C CG    1 
ATOM   2090  C  CD    . GLU C 3 79  ? 22.216  12.031 -39.658 1.00 54.59  ? 92  GLU C CD    1 
ATOM   2091  O  OE1   . GLU C 3 79  ? 22.630  11.326 -38.709 1.00 56.85  ? 92  GLU C OE1   1 
ATOM   2092  O  OE2   . GLU C 3 79  ? 21.004  12.185 -39.930 1.00 55.61  ? 92  GLU C OE2   1 
ATOM   2093  N  N     . LEU C 3 80  ? 26.504  15.738 -39.809 1.00 43.65  ? 93  LEU C N     1 
ATOM   2094  C  CA    . LEU C 3 80  ? 27.359  16.740 -39.159 1.00 43.34  ? 93  LEU C CA    1 
ATOM   2095  C  C     . LEU C 3 80  ? 27.481  17.974 -40.055 1.00 42.29  ? 93  LEU C C     1 
ATOM   2096  O  O     . LEU C 3 80  ? 27.428  19.095 -39.556 1.00 42.05  ? 93  LEU C O     1 
ATOM   2097  C  CB    . LEU C 3 80  ? 28.746  16.177 -38.790 1.00 43.66  ? 93  LEU C CB    1 
ATOM   2098  C  CG    . LEU C 3 80  ? 28.791  15.203 -37.601 1.00 44.58  ? 93  LEU C CG    1 
ATOM   2099  C  CD1   . LEU C 3 80  ? 30.178  14.703 -37.382 1.00 44.87  ? 93  LEU C CD1   1 
ATOM   2100  C  CD2   . LEU C 3 80  ? 28.296  15.855 -36.330 1.00 45.21  ? 93  LEU C CD2   1 
ATOM   2101  N  N     . ASN C 3 81  ? 27.550  17.772 -41.380 1.00 41.58  ? 94  ASN C N     1 
ATOM   2102  C  CA    . ASN C 3 81  ? 27.589  18.884 -42.307 1.00 41.58  ? 94  ASN C CA    1 
ATOM   2103  C  C     . ASN C 3 81  ? 26.288  19.689 -42.230 1.00 41.77  ? 94  ASN C C     1 
ATOM   2104  O  O     . ASN C 3 81  ? 26.347  20.910 -42.216 1.00 42.33  ? 94  ASN C O     1 
ATOM   2105  C  CB    . ASN C 3 81  ? 27.820  18.406 -43.713 1.00 42.46  ? 94  ASN C CB    1 
ATOM   2106  C  CG    . ASN C 3 81  ? 27.932  19.550 -44.672 1.00 46.14  ? 94  ASN C CG    1 
ATOM   2107  O  OD1   . ASN C 3 81  ? 28.553  20.578 -44.379 1.00 47.35  ? 94  ASN C OD1   1 
ATOM   2108  N  ND2   . ASN C 3 81  ? 27.300  19.413 -45.823 1.00 47.38  ? 94  ASN C ND2   1 
ATOM   2109  N  N     . LYS C 3 82  ? 25.122  19.028 -42.174 1.00 41.07  ? 95  LYS C N     1 
ATOM   2110  C  CA    . LYS C 3 82  ? 23.839  19.737 -42.099 1.00 40.58  ? 95  LYS C CA    1 
ATOM   2111  C  C     . LYS C 3 82  ? 23.698  20.457 -40.774 1.00 39.31  ? 95  LYS C C     1 
ATOM   2112  O  O     . LYS C 3 82  ? 23.206  21.573 -40.757 1.00 39.48  ? 95  LYS C O     1 
ATOM   2113  C  CB    . LYS C 3 82  ? 22.670  18.762 -42.298 1.00 42.94  ? 95  LYS C CB    1 
ATOM   2114  C  CG    . LYS C 3 82  ? 21.281  19.396 -42.278 1.00 48.24  ? 95  LYS C CG    1 
ATOM   2115  C  CD    . LYS C 3 82  ? 20.143  18.314 -42.351 1.00 54.30  ? 95  LYS C CD    1 
ATOM   2116  C  CE    . LYS C 3 82  ? 20.095  17.469 -43.636 1.00 58.95  ? 95  LYS C CE    1 
ATOM   2117  N  NZ    . LYS C 3 82  ? 19.689  16.026 -43.423 1.00 60.79  ? 95  LYS C NZ    1 
ATOM   2118  N  N     . LEU C 3 83  ? 24.149  19.831 -39.667 1.00 37.97  ? 96  LEU C N     1 
ATOM   2119  C  CA    . LEU C 3 83  ? 24.064  20.406 -38.325 1.00 37.05  ? 96  LEU C CA    1 
ATOM   2120  C  C     . LEU C 3 83  ? 24.970  21.617 -38.207 1.00 36.54  ? 96  LEU C C     1 
ATOM   2121  O  O     . LEU C 3 83  ? 24.575  22.633 -37.633 1.00 37.18  ? 96  LEU C O     1 
ATOM   2122  C  CB    . LEU C 3 83  ? 24.421  19.351 -37.272 1.00 36.84  ? 96  LEU C CB    1 
ATOM   2123  C  CG    . LEU C 3 83  ? 24.543  19.830 -35.824 1.00 37.75  ? 96  LEU C CG    1 
ATOM   2124  C  CD1   . LEU C 3 83  ? 23.240  20.370 -35.306 1.00 37.94  ? 96  LEU C CD1   1 
ATOM   2125  C  CD2   . LEU C 3 83  ? 25.020  18.715 -34.936 1.00 38.62  ? 96  LEU C CD2   1 
ATOM   2126  N  N     . LEU C 3 84  ? 26.169  21.533 -38.787 1.00 35.18  ? 97  LEU C N     1 
ATOM   2127  C  CA    . LEU C 3 84  ? 27.123  22.636 -38.754 1.00 33.98  ? 97  LEU C CA    1 
ATOM   2128  C  C     . LEU C 3 84  ? 27.231  23.270 -40.145 1.00 33.96  ? 97  LEU C C     1 
ATOM   2129  O  O     . LEU C 3 84  ? 28.322  23.566 -40.609 1.00 34.20  ? 97  LEU C O     1 
ATOM   2130  C  CB    . LEU C 3 84  ? 28.478  22.131 -38.252 1.00 32.69  ? 97  LEU C CB    1 
ATOM   2131  C  CG    . LEU C 3 84  ? 28.392  21.438 -36.908 1.00 32.21  ? 97  LEU C CG    1 
ATOM   2132  C  CD1   . LEU C 3 84  ? 29.544  20.547 -36.678 1.00 32.32  ? 97  LEU C CD1   1 
ATOM   2133  C  CD2   . LEU C 3 84  ? 28.181  22.420 -35.803 1.00 32.14  ? 97  LEU C CD2   1 
ATOM   2134  N  N     . GLY C 3 85  ? 26.089  23.459 -40.795 1.00 33.49  ? 98  GLY C N     1 
ATOM   2135  C  CA    . GLY C 3 85  ? 26.013  24.020 -42.130 1.00 33.79  ? 98  GLY C CA    1 
ATOM   2136  C  C     . GLY C 3 85  ? 26.323  25.492 -42.172 1.00 34.49  ? 98  GLY C C     1 
ATOM   2137  O  O     . GLY C 3 85  ? 27.000  25.934 -43.094 1.00 34.83  ? 98  GLY C O     1 
ATOM   2138  N  N     . ARG C 3 86  ? 25.829  26.269 -41.201 1.00 35.07  ? 99  ARG C N     1 
ATOM   2139  C  CA    . ARG C 3 86  ? 26.072  27.715 -41.192 1.00 36.77  ? 99  ARG C CA    1 
ATOM   2140  C  C     . ARG C 3 86  ? 27.129  28.105 -40.162 1.00 38.70  ? 99  ARG C C     1 
ATOM   2141  O  O     . ARG C 3 86  ? 27.043  29.181 -39.562 1.00 38.80  ? 99  ARG C O     1 
ATOM   2142  C  CB    . ARG C 3 86  ? 24.775  28.491 -40.971 1.00 37.75  ? 99  ARG C CB    1 
ATOM   2143  C  CG    . ARG C 3 86  ? 23.640  28.035 -41.886 1.00 41.10  ? 99  ARG C CG    1 
ATOM   2144  C  CD    . ARG C 3 86  ? 23.110  29.114 -42.822 1.00 44.59  ? 99  ARG C CD    1 
ATOM   2145  N  NE    . ARG C 3 86  ? 23.939  29.288 -44.014 1.00 47.76  ? 99  ARG C NE    1 
ATOM   2146  C  CZ    . ARG C 3 86  ? 24.679  30.363 -44.265 1.00 50.92  ? 99  ARG C CZ    1 
ATOM   2147  N  NH1   . ARG C 3 86  ? 24.687  31.390 -43.416 1.00 49.43  ? 99  ARG C NH1   1 
ATOM   2148  N  NH2   . ARG C 3 86  ? 25.401  30.432 -45.377 1.00 52.41  ? 99  ARG C NH2   1 
ATOM   2149  N  N     . VAL C 3 87  ? 28.147  27.223 -39.985 1.00 39.61  ? 100 VAL C N     1 
ATOM   2150  C  CA    . VAL C 3 87  ? 29.278  27.342 -39.063 1.00 40.27  ? 100 VAL C CA    1 
ATOM   2151  C  C     . VAL C 3 87  ? 30.601  27.295 -39.858 1.00 41.64  ? 100 VAL C C     1 
ATOM   2152  O  O     . VAL C 3 87  ? 30.700  26.595 -40.871 1.00 42.09  ? 100 VAL C O     1 
ATOM   2153  C  CB    . VAL C 3 87  ? 29.214  26.189 -38.041 1.00 40.62  ? 100 VAL C CB    1 
ATOM   2154  C  CG1   . VAL C 3 87  ? 30.512  26.053 -37.293 1.00 41.37  ? 100 VAL C CG1   1 
ATOM   2155  C  CG2   . VAL C 3 87  ? 28.070  26.376 -37.068 1.00 41.14  ? 100 VAL C CG2   1 
ATOM   2156  N  N     . THR C 3 88  ? 31.620  28.012 -39.384 1.00 42.25  ? 101 THR C N     1 
ATOM   2157  C  CA    . THR C 3 88  ? 32.939  28.017 -40.025 1.00 43.43  ? 101 THR C CA    1 
ATOM   2158  C  C     . THR C 3 88  ? 34.008  27.568 -39.021 1.00 44.98  ? 101 THR C C     1 
ATOM   2159  O  O     . THR C 3 88  ? 34.195  28.224 -38.004 1.00 45.24  ? 101 THR C O     1 
ATOM   2160  C  CB    . THR C 3 88  ? 33.284  29.357 -40.760 1.00 43.95  ? 101 THR C CB    1 
ATOM   2161  O  OG1   . THR C 3 88  ? 32.449  30.443 -40.333 1.00 45.22  ? 101 THR C OG1   1 
ATOM   2162  C  CG2   . THR C 3 88  ? 33.167  29.227 -42.279 1.00 43.82  ? 101 THR C CG2   1 
ATOM   2163  N  N     . ILE C 3 89  ? 34.685  26.438 -39.289 1.00 46.00  ? 102 ILE C N     1 
ATOM   2164  C  CA    . ILE C 3 89  ? 35.767  25.949 -38.428 1.00 47.50  ? 102 ILE C CA    1 
ATOM   2165  C  C     . ILE C 3 89  ? 37.053  26.710 -38.789 1.00 49.13  ? 102 ILE C C     1 
ATOM   2166  O  O     . ILE C 3 89  ? 37.515  26.633 -39.936 1.00 49.32  ? 102 ILE C O     1 
ATOM   2167  C  CB    . ILE C 3 89  ? 35.928  24.397 -38.519 1.00 47.96  ? 102 ILE C CB    1 
ATOM   2168  C  CG1   . ILE C 3 89  ? 34.847  23.688 -37.694 1.00 48.76  ? 102 ILE C CG1   1 
ATOM   2169  C  CG2   . ILE C 3 89  ? 37.315  23.928 -38.072 1.00 48.53  ? 102 ILE C CG2   1 
ATOM   2170  C  CD1   . ILE C 3 89  ? 33.849  23.071 -38.504 1.00 49.96  ? 102 ILE C CD1   1 
ATOM   2171  N  N     . ALA C 3 90  ? 37.585  27.503 -37.840 1.00 50.09  ? 103 ALA C N     1 
ATOM   2172  C  CA    . ALA C 3 90  ? 38.805  28.261 -38.099 1.00 51.83  ? 103 ALA C CA    1 
ATOM   2173  C  C     . ALA C 3 90  ? 39.993  27.318 -38.331 1.00 54.16  ? 103 ALA C C     1 
ATOM   2174  O  O     . ALA C 3 90  ? 40.189  26.355 -37.575 1.00 54.53  ? 103 ALA C O     1 
ATOM   2175  C  CB    . ALA C 3 90  ? 39.096  29.203 -36.957 1.00 51.78  ? 103 ALA C CB    1 
ATOM   2176  N  N     . GLN C 3 91  ? 40.754  27.584 -39.411 1.00 55.08  ? 104 GLN C N     1 
ATOM   2177  C  CA    . GLN C 3 91  ? 41.888  26.772 -39.847 1.00 56.08  ? 104 GLN C CA    1 
ATOM   2178  C  C     . GLN C 3 91  ? 41.444  25.401 -40.369 1.00 56.51  ? 104 GLN C C     1 
ATOM   2179  O  O     . GLN C 3 91  ? 42.203  24.434 -40.294 1.00 57.15  ? 104 GLN C O     1 
ATOM   2180  C  CB    . GLN C 3 91  ? 42.970  26.659 -38.752 1.00 58.27  ? 104 GLN C CB    1 
ATOM   2181  C  CG    . GLN C 3 91  ? 44.047  27.738 -38.827 1.00 63.23  ? 104 GLN C CG    1 
ATOM   2182  C  CD    . GLN C 3 91  ? 44.766  27.762 -40.165 1.00 69.37  ? 104 GLN C CD    1 
ATOM   2183  O  OE1   . GLN C 3 91  ? 44.498  28.620 -41.029 1.00 71.02  ? 104 GLN C OE1   1 
ATOM   2184  N  NE2   . GLN C 3 91  ? 45.701  26.822 -40.367 1.00 70.05  ? 104 GLN C NE2   1 
ATOM   2185  N  N     . GLY C 3 92  ? 40.243  25.331 -40.930 1.00 56.21  ? 105 GLY C N     1 
ATOM   2186  C  CA    . GLY C 3 92  ? 39.706  24.077 -41.420 1.00 56.75  ? 105 GLY C CA    1 
ATOM   2187  C  C     . GLY C 3 92  ? 39.955  23.780 -42.879 1.00 57.19  ? 105 GLY C C     1 
ATOM   2188  O  O     . GLY C 3 92  ? 39.983  22.612 -43.259 1.00 57.47  ? 105 GLY C O     1 
ATOM   2189  N  N     . GLY C 3 93  ? 40.084  24.816 -43.702 1.00 57.19  ? 106 GLY C N     1 
ATOM   2190  C  CA    . GLY C 3 93  ? 40.273  24.638 -45.140 1.00 57.95  ? 106 GLY C CA    1 
ATOM   2191  C  C     . GLY C 3 93  ? 39.033  24.094 -45.824 1.00 58.70  ? 106 GLY C C     1 
ATOM   2192  O  O     . GLY C 3 93  ? 37.965  24.072 -45.209 1.00 58.93  ? 106 GLY C O     1 
ATOM   2193  N  N     . VAL C 3 94  ? 39.137  23.643 -47.092 1.00 59.06  ? 107 VAL C N     1 
ATOM   2194  C  CA    . VAL C 3 94  ? 37.962  23.085 -47.785 1.00 60.12  ? 107 VAL C CA    1 
ATOM   2195  C  C     . VAL C 3 94  ? 38.124  21.595 -48.128 1.00 61.03  ? 107 VAL C C     1 
ATOM   2196  O  O     . VAL C 3 94  ? 39.236  21.065 -48.054 1.00 61.53  ? 107 VAL C O     1 
ATOM   2197  C  CB    . VAL C 3 94  ? 37.535  23.907 -49.031 1.00 61.13  ? 107 VAL C CB    1 
ATOM   2198  C  CG1   . VAL C 3 94  ? 37.529  25.397 -48.742 1.00 61.71  ? 107 VAL C CG1   1 
ATOM   2199  C  CG2   . VAL C 3 94  ? 38.401  23.577 -50.239 1.00 61.70  ? 107 VAL C CG2   1 
ATOM   2200  N  N     . LEU C 3 95  ? 37.019  20.903 -48.472 1.00 61.31  ? 108 LEU C N     1 
ATOM   2201  C  CA    . LEU C 3 95  ? 37.121  19.515 -48.911 1.00 62.19  ? 108 LEU C CA    1 
ATOM   2202  C  C     . LEU C 3 95  ? 37.650  19.593 -50.340 1.00 64.24  ? 108 LEU C C     1 
ATOM   2203  O  O     . LEU C 3 95  ? 37.198  20.437 -51.130 1.00 64.52  ? 108 LEU C O     1 
ATOM   2204  C  CB    . LEU C 3 95  ? 35.746  18.819 -48.968 1.00 61.69  ? 108 LEU C CB    1 
ATOM   2205  C  CG    . LEU C 3 95  ? 35.148  18.201 -47.733 1.00 62.55  ? 108 LEU C CG    1 
ATOM   2206  C  CD1   . LEU C 3 95  ? 33.974  17.346 -48.123 1.00 63.09  ? 108 LEU C CD1   1 
ATOM   2207  C  CD2   . LEU C 3 95  ? 36.158  17.373 -46.957 1.00 63.09  ? 108 LEU C CD2   1 
ATOM   2208  N  N     . PRO C 3 96  ? 38.578  18.706 -50.705 1.00 65.44  ? 109 PRO C N     1 
ATOM   2209  C  CA    . PRO C 3 96  ? 39.083  18.714 -52.078 1.00 66.37  ? 109 PRO C CA    1 
ATOM   2210  C  C     . PRO C 3 96  ? 38.016  18.205 -53.052 1.00 67.54  ? 109 PRO C C     1 
ATOM   2211  O  O     . PRO C 3 96  ? 37.596  17.057 -52.969 1.00 67.61  ? 109 PRO C O     1 
ATOM   2212  C  CB    . PRO C 3 96  ? 40.303  17.787 -52.009 1.00 66.96  ? 109 PRO C CB    1 
ATOM   2213  C  CG    . PRO C 3 96  ? 40.554  17.547 -50.518 1.00 67.11  ? 109 PRO C CG    1 
ATOM   2214  C  CD    . PRO C 3 96  ? 39.211  17.649 -49.901 1.00 65.20  ? 109 PRO C CD    1 
ATOM   2215  N  N     . ASN C 3 97  ? 37.548  19.080 -53.938 1.00 68.30  ? 110 ASN C N     1 
ATOM   2216  C  CA    . ASN C 3 97  ? 36.563  18.753 -54.956 1.00 69.71  ? 110 ASN C CA    1 
ATOM   2217  C  C     . ASN C 3 97  ? 36.777  19.697 -56.143 1.00 70.82  ? 110 ASN C C     1 
ATOM   2218  O  O     . ASN C 3 97  ? 36.818  20.916 -55.969 1.00 71.02  ? 110 ASN C O     1 
ATOM   2219  C  CB    . ASN C 3 97  ? 35.129  18.819 -54.396 1.00 71.43  ? 110 ASN C CB    1 
ATOM   2220  C  CG    . ASN C 3 97  ? 34.014  19.002 -55.421 1.00 75.69  ? 110 ASN C CG    1 
ATOM   2221  O  OD1   . ASN C 3 97  ? 33.486  18.051 -56.022 1.00 77.10  ? 110 ASN C OD1   1 
ATOM   2222  N  ND2   . ASN C 3 97  ? 33.631  20.254 -55.639 1.00 76.43  ? 110 ASN C ND2   1 
ATOM   2223  N  N     . ILE C 3 98  ? 36.957  19.124 -57.341 1.00 71.36  ? 111 ILE C N     1 
ATOM   2224  C  CA    . ILE C 3 98  ? 37.160  19.850 -58.603 1.00 72.06  ? 111 ILE C CA    1 
ATOM   2225  C  C     . ILE C 3 98  ? 36.040  19.404 -59.524 1.00 73.04  ? 111 ILE C C     1 
ATOM   2226  O  O     . ILE C 3 98  ? 35.893  18.200 -59.752 1.00 73.11  ? 111 ILE C O     1 
ATOM   2227  C  CB    . ILE C 3 98  ? 38.552  19.542 -59.239 1.00 72.07  ? 111 ILE C CB    1 
ATOM   2228  C  CG1   . ILE C 3 98  ? 39.721  20.023 -58.351 1.00 72.48  ? 111 ILE C CG1   1 
ATOM   2229  C  CG2   . ILE C 3 98  ? 38.647  20.121 -60.648 1.00 72.39  ? 111 ILE C CG2   1 
ATOM   2230  C  CD1   . ILE C 3 98  ? 40.398  18.952 -57.459 1.00 73.24  ? 111 ILE C CD1   1 
ATOM   2231  N  N     . GLN C 3 99  ? 35.228  20.340 -60.025 1.00 73.76  ? 112 GLN C N     1 
ATOM   2232  C  CA    . GLN C 3 99  ? 34.109  19.983 -60.899 1.00 75.22  ? 112 GLN C CA    1 
ATOM   2233  C  C     . GLN C 3 99  ? 34.573  19.226 -62.153 1.00 76.19  ? 112 GLN C C     1 
ATOM   2234  O  O     . GLN C 3 99  ? 35.625  19.551 -62.706 1.00 76.36  ? 112 GLN C O     1 
ATOM   2235  C  CB    . GLN C 3 99  ? 33.260  21.213 -61.240 1.00 77.01  ? 112 GLN C CB    1 
ATOM   2236  C  CG    . GLN C 3 99  ? 32.524  21.769 -60.030 1.00 80.74  ? 112 GLN C CG    1 
ATOM   2237  C  CD    . GLN C 3 99  ? 31.111  21.249 -59.946 1.00 85.26  ? 112 GLN C CD    1 
ATOM   2238  O  OE1   . GLN C 3 99  ? 30.423  21.088 -60.967 1.00 86.71  ? 112 GLN C OE1   1 
ATOM   2239  N  NE2   . GLN C 3 99  ? 30.644  20.989 -58.722 1.00 85.65  ? 112 GLN C NE2   1 
ATOM   2240  N  N     . ALA C 3 100 ? 33.826  18.173 -62.548 1.00 76.45  ? 113 ALA C N     1 
ATOM   2241  C  CA    . ALA C 3 100 ? 34.155  17.309 -63.683 1.00 76.96  ? 113 ALA C CA    1 
ATOM   2242  C  C     . ALA C 3 100 ? 34.348  18.052 -64.992 1.00 77.54  ? 113 ALA C C     1 
ATOM   2243  O  O     . ALA C 3 100 ? 35.133  17.608 -65.823 1.00 77.81  ? 113 ALA C O     1 
ATOM   2244  C  CB    . ALA C 3 100 ? 33.103  16.227 -63.848 1.00 77.16  ? 113 ALA C CB    1 
ATOM   2245  N  N     . VAL C 3 101 ? 33.648  19.175 -65.181 1.00 77.67  ? 114 VAL C N     1 
ATOM   2246  C  CA    . VAL C 3 101 ? 33.771  19.977 -66.398 1.00 78.42  ? 114 VAL C CA    1 
ATOM   2247  C  C     . VAL C 3 101 ? 35.154  20.654 -66.469 1.00 79.59  ? 114 VAL C C     1 
ATOM   2248  O  O     . VAL C 3 101 ? 35.711  20.812 -67.555 1.00 79.77  ? 114 VAL C O     1 
ATOM   2249  C  CB    . VAL C 3 101 ? 32.609  20.986 -66.556 1.00 79.10  ? 114 VAL C CB    1 
ATOM   2250  C  CG1   . VAL C 3 101 ? 32.587  21.574 -67.961 1.00 79.64  ? 114 VAL C CG1   1 
ATOM   2251  C  CG2   . VAL C 3 101 ? 31.259  20.342 -66.224 1.00 79.58  ? 114 VAL C CG2   1 
ATOM   2252  N  N     . LEU C 3 102 ? 35.740  20.991 -65.308 1.00 80.23  ? 115 LEU C N     1 
ATOM   2253  C  CA    . LEU C 3 102 ? 37.074  21.591 -65.223 1.00 81.43  ? 115 LEU C CA    1 
ATOM   2254  C  C     . LEU C 3 102 ? 38.220  20.566 -65.352 1.00 82.34  ? 115 LEU C C     1 
ATOM   2255  O  O     . LEU C 3 102 ? 39.380  20.957 -65.308 1.00 82.27  ? 115 LEU C O     1 
ATOM   2256  C  CB    . LEU C 3 102 ? 37.240  22.364 -63.910 1.00 81.87  ? 115 LEU C CB    1 
ATOM   2257  C  CG    . LEU C 3 102 ? 36.128  23.346 -63.533 1.00 83.61  ? 115 LEU C CG    1 
ATOM   2258  C  CD1   . LEU C 3 102 ? 36.436  24.013 -62.220 1.00 84.32  ? 115 LEU C CD1   1 
ATOM   2259  C  CD2   . LEU C 3 102 ? 35.939  24.403 -64.598 1.00 84.18  ? 115 LEU C CD2   1 
ATOM   2260  N  N     . LEU C 3 103 ? 37.909  19.267 -65.493 1.00 83.13  ? 116 LEU C N     1 
ATOM   2261  C  CA    . LEU C 3 103 ? 38.919  18.220 -65.652 1.00 84.36  ? 116 LEU C CA    1 
ATOM   2262  C  C     . LEU C 3 103 ? 39.442  18.183 -67.101 1.00 85.87  ? 116 LEU C C     1 
ATOM   2263  O  O     . LEU C 3 103 ? 38.680  18.463 -68.031 1.00 85.96  ? 116 LEU C O     1 
ATOM   2264  C  CB    . LEU C 3 103 ? 38.347  16.852 -65.234 1.00 84.48  ? 116 LEU C CB    1 
ATOM   2265  C  CG    . LEU C 3 103 ? 38.055  16.689 -63.742 1.00 85.75  ? 116 LEU C CG    1 
ATOM   2266  C  CD1   . LEU C 3 103 ? 37.418  15.343 -63.458 1.00 86.25  ? 116 LEU C CD1   1 
ATOM   2267  C  CD2   . LEU C 3 103 ? 39.316  16.870 -62.907 1.00 86.31  ? 116 LEU C CD2   1 
ATOM   2268  N  N     . PRO C 3 104 ? 40.741  17.863 -67.310 1.00 86.71  ? 117 PRO C N     1 
ATOM   2269  C  CA    . PRO C 3 104 ? 41.305  17.885 -68.673 1.00 87.50  ? 117 PRO C CA    1 
ATOM   2270  C  C     . PRO C 3 104 ? 40.620  16.979 -69.698 1.00 88.55  ? 117 PRO C C     1 
ATOM   2271  O  O     . PRO C 3 104 ? 40.116  15.911 -69.347 1.00 88.91  ? 117 PRO C O     1 
ATOM   2272  C  CB    . PRO C 3 104 ? 42.776  17.493 -68.458 1.00 88.06  ? 117 PRO C CB    1 
ATOM   2273  C  CG    . PRO C 3 104 ? 42.819  16.817 -67.126 1.00 88.20  ? 117 PRO C CG    1 
ATOM   2274  C  CD    . PRO C 3 104 ? 41.773  17.528 -66.313 1.00 86.45  ? 117 PRO C CD    1 
ATOM   2275  N  N     . LYS C 3 105 ? 40.599  17.421 -70.973 1.00 88.80  ? 118 LYS C N     1 
ATOM   2276  C  CA    . LYS C 3 105 ? 39.963  16.685 -72.067 1.00 89.53  ? 118 LYS C CA    1 
ATOM   2277  C  C     . LYS C 3 105 ? 40.759  15.455 -72.492 1.00 89.63  ? 118 LYS C C     1 
ATOM   2278  O  O     . LYS C 3 105 ? 40.225  14.344 -72.503 1.00 89.65  ? 118 LYS C O     1 
ATOM   2279  C  CB    . LYS C 3 105 ? 39.692  17.615 -73.270 1.00 91.83  ? 118 LYS C CB    1 
ATOM   2280  C  CG    . LYS C 3 105 ? 38.978  16.920 -74.426 1.00 96.55  ? 118 LYS C CG    1 
ATOM   2281  C  CD    . LYS C 3 105 ? 38.428  17.902 -75.458 1.00 101.07 ? 118 LYS C CD    1 
ATOM   2282  C  CE    . LYS C 3 105 ? 37.131  18.551 -75.020 1.00 104.82 ? 118 LYS C CE    1 
ATOM   2283  N  NZ    . LYS C 3 105 ? 36.536  19.385 -76.093 1.00 107.10 ? 118 LYS C NZ    1 
ATOM   2284  N  N     . ARG D 4 1   ? 43.250  38.605 -11.770 1.00 92.14  ? 28  ARG D N     1 
ATOM   2285  C  CA    . ARG D 4 1   ? 42.654  38.079 -12.998 1.00 92.42  ? 28  ARG D CA    1 
ATOM   2286  C  C     . ARG D 4 1   ? 41.241  37.456 -12.743 1.00 91.79  ? 28  ARG D C     1 
ATOM   2287  O  O     . ARG D 4 1   ? 40.671  37.651 -11.670 1.00 91.91  ? 28  ARG D O     1 
ATOM   2288  C  CB    . ARG D 4 1   ? 43.633  37.121 -13.727 1.00 94.23  ? 28  ARG D CB    1 
ATOM   2289  C  CG    . ARG D 4 1   ? 44.418  37.814 -14.845 1.00 97.87  ? 28  ARG D CG    1 
ATOM   2290  C  CD    . ARG D 4 1   ? 44.550  36.995 -16.128 1.00 101.64 ? 28  ARG D CD    1 
ATOM   2291  N  NE    . ARG D 4 1   ? 45.681  36.068 -16.086 1.00 104.78 ? 28  ARG D NE    1 
ATOM   2292  C  CZ    . ARG D 4 1   ? 46.072  35.308 -17.106 1.00 106.77 ? 28  ARG D CZ    1 
ATOM   2293  N  NH1   . ARG D 4 1   ? 45.419  35.347 -18.263 1.00 106.50 ? 28  ARG D NH1   1 
ATOM   2294  N  NH2   . ARG D 4 1   ? 47.125  34.508 -16.980 1.00 106.34 ? 28  ARG D NH2   1 
ATOM   2295  N  N     . SER D 4 2   ? 40.665  36.768 -13.749 1.00 90.81  ? 29  SER D N     1 
ATOM   2296  C  CA    . SER D 4 2   ? 39.342  36.154 -13.706 1.00 90.20  ? 29  SER D CA    1 
ATOM   2297  C  C     . SER D 4 2   ? 39.408  34.675 -14.134 1.00 88.96  ? 29  SER D C     1 
ATOM   2298  O  O     . SER D 4 2   ? 40.271  34.298 -14.937 1.00 88.99  ? 29  SER D O     1 
ATOM   2299  C  CB    . SER D 4 2   ? 38.388  36.914 -14.626 1.00 91.63  ? 29  SER D CB    1 
ATOM   2300  O  OG    . SER D 4 2   ? 38.776  36.789 -15.986 1.00 93.99  ? 29  SER D OG    1 
ATOM   2301  N  N     . ARG D 4 3   ? 38.481  33.840 -13.606 1.00 87.57  ? 30  ARG D N     1 
ATOM   2302  C  CA    . ARG D 4 3   ? 38.426  32.412 -13.935 1.00 86.46  ? 30  ARG D CA    1 
ATOM   2303  C  C     . ARG D 4 3   ? 37.808  32.205 -15.322 1.00 84.51  ? 30  ARG D C     1 
ATOM   2304  O  O     . ARG D 4 3   ? 36.854  32.894 -15.697 1.00 84.53  ? 30  ARG D O     1 
ATOM   2305  C  CB    . ARG D 4 3   ? 37.636  31.629 -12.872 1.00 87.97  ? 30  ARG D CB    1 
ATOM   2306  C  CG    . ARG D 4 3   ? 37.901  30.119 -12.870 1.00 91.26  ? 30  ARG D CG    1 
ATOM   2307  C  CD    . ARG D 4 3   ? 37.297  29.446 -11.656 1.00 94.99  ? 30  ARG D CD    1 
ATOM   2308  N  NE    . ARG D 4 3   ? 38.283  29.282 -10.586 1.00 98.79  ? 30  ARG D NE    1 
ATOM   2309  C  CZ    . ARG D 4 3   ? 38.829  28.118 -10.241 1.00 101.57 ? 30  ARG D CZ    1 
ATOM   2310  N  NH1   . ARG D 4 3   ? 38.493  27.004 -10.879 1.00 101.23 ? 30  ARG D NH1   1 
ATOM   2311  N  NH2   . ARG D 4 3   ? 39.720  28.061 -9.258  1.00 101.83 ? 30  ARG D NH2   1 
ATOM   2312  N  N     . LYS D 4 4   ? 38.375  31.282 -16.102 1.00 82.59  ? 31  LYS D N     1 
ATOM   2313  C  CA    . LYS D 4 4   ? 37.875  30.998 -17.443 1.00 81.14  ? 31  LYS D CA    1 
ATOM   2314  C  C     . LYS D 4 4   ? 37.357  29.563 -17.552 1.00 79.03  ? 31  LYS D C     1 
ATOM   2315  O  O     . LYS D 4 4   ? 38.137  28.614 -17.494 1.00 79.22  ? 31  LYS D O     1 
ATOM   2316  C  CB    . LYS D 4 4   ? 38.960  31.268 -18.501 1.00 82.85  ? 31  LYS D CB    1 
ATOM   2317  C  CG    . LYS D 4 4   ? 39.456  32.701 -18.480 1.00 86.50  ? 31  LYS D CG    1 
ATOM   2318  C  CD    . LYS D 4 4   ? 40.055  33.127 -19.796 1.00 90.74  ? 31  LYS D CD    1 
ATOM   2319  C  CE    . LYS D 4 4   ? 40.217  34.626 -19.863 1.00 94.72  ? 31  LYS D CE    1 
ATOM   2320  N  NZ    . LYS D 4 4   ? 40.596  35.212 -18.541 1.00 96.99  ? 31  LYS D NZ    1 
ATOM   2321  N  N     . GLU D 4 5   ? 36.031  29.401 -17.695 1.00 77.02  ? 32  GLU D N     1 
ATOM   2322  C  CA    . GLU D 4 5   ? 35.391  28.085 -17.828 1.00 75.40  ? 32  GLU D CA    1 
ATOM   2323  C  C     . GLU D 4 5   ? 35.805  27.377 -19.123 1.00 73.63  ? 32  GLU D C     1 
ATOM   2324  O  O     . GLU D 4 5   ? 36.202  28.045 -20.080 1.00 74.05  ? 32  GLU D O     1 
ATOM   2325  C  CB    . GLU D 4 5   ? 33.874  28.257 -17.810 1.00 76.85  ? 32  GLU D CB    1 
ATOM   2326  C  CG    . GLU D 4 5   ? 33.362  28.758 -16.482 1.00 79.71  ? 32  GLU D CG    1 
ATOM   2327  C  CD    . GLU D 4 5   ? 32.474  27.731 -15.823 1.00 83.14  ? 32  GLU D CD    1 
ATOM   2328  O  OE1   . GLU D 4 5   ? 31.398  27.447 -16.392 1.00 83.55  ? 32  GLU D OE1   1 
ATOM   2329  O  OE2   . GLU D 4 5   ? 32.852  27.198 -14.755 1.00 84.29  ? 32  GLU D OE2   1 
ATOM   2330  N  N     . SER D 4 6   ? 35.686  26.038 -19.174 1.00 71.43  ? 33  SER D N     1 
ATOM   2331  C  CA    . SER D 4 6   ? 36.075  25.283 -20.371 1.00 69.88  ? 33  SER D CA    1 
ATOM   2332  C  C     . SER D 4 6   ? 35.564  23.847 -20.310 1.00 67.78  ? 33  SER D C     1 
ATOM   2333  O  O     . SER D 4 6   ? 35.495  23.261 -19.235 1.00 67.81  ? 33  SER D O     1 
ATOM   2334  C  CB    . SER D 4 6   ? 37.599  25.267 -20.508 1.00 71.16  ? 33  SER D CB    1 
ATOM   2335  O  OG    . SER D 4 6   ? 38.052  25.075 -21.838 1.00 73.22  ? 33  SER D OG    1 
ATOM   2336  N  N     . TYR D 4 7   ? 35.224  23.272 -21.463 1.00 66.06  ? 34  TYR D N     1 
ATOM   2337  C  CA    . TYR D 4 7   ? 34.818  21.870 -21.534 1.00 64.94  ? 34  TYR D CA    1 
ATOM   2338  C  C     . TYR D 4 7   ? 36.019  20.980 -21.933 1.00 64.47  ? 34  TYR D C     1 
ATOM   2339  O  O     . TYR D 4 7   ? 35.798  19.871 -22.414 1.00 64.67  ? 34  TYR D O     1 
ATOM   2340  C  CB    . TYR D 4 7   ? 33.715  21.671 -22.587 1.00 64.35  ? 34  TYR D CB    1 
ATOM   2341  C  CG    . TYR D 4 7   ? 32.379  22.274 -22.235 1.00 64.44  ? 34  TYR D CG    1 
ATOM   2342  C  CD1   . TYR D 4 7   ? 31.442  21.558 -21.506 1.00 65.12  ? 34  TYR D CD1   1 
ATOM   2343  C  CD2   . TYR D 4 7   ? 32.031  23.539 -22.671 1.00 65.10  ? 34  TYR D CD2   1 
ATOM   2344  C  CE1   . TYR D 4 7   ? 30.211  22.109 -21.175 1.00 65.87  ? 34  TYR D CE1   1 
ATOM   2345  C  CE2   . TYR D 4 7   ? 30.804  24.099 -22.351 1.00 65.88  ? 34  TYR D CE2   1 
ATOM   2346  C  CZ    . TYR D 4 7   ? 29.897  23.382 -21.601 1.00 66.74  ? 34  TYR D CZ    1 
ATOM   2347  O  OH    . TYR D 4 7   ? 28.692  23.947 -21.284 1.00 68.46  ? 34  TYR D OH    1 
ATOM   2348  N  N     . SER D 4 8   ? 37.273  21.456 -21.758 1.00 63.56  ? 35  SER D N     1 
ATOM   2349  C  CA    . SER D 4 8   ? 38.491  20.763 -22.182 1.00 63.07  ? 35  SER D CA    1 
ATOM   2350  C  C     . SER D 4 8   ? 38.774  19.467 -21.444 1.00 63.11  ? 35  SER D C     1 
ATOM   2351  O  O     . SER D 4 8   ? 39.282  18.508 -22.027 1.00 62.74  ? 35  SER D O     1 
ATOM   2352  C  CB    . SER D 4 8   ? 39.689  21.701 -22.089 1.00 63.58  ? 35  SER D CB    1 
ATOM   2353  O  OG    . SER D 4 8   ? 39.407  23.001 -22.585 1.00 64.70  ? 35  SER D OG    1 
ATOM   2354  N  N     . VAL D 4 9   ? 38.463  19.455 -20.147 1.00 63.28  ? 36  VAL D N     1 
ATOM   2355  C  CA    . VAL D 4 9   ? 38.655  18.305 -19.270 1.00 63.83  ? 36  VAL D CA    1 
ATOM   2356  C  C     . VAL D 4 9   ? 37.820  17.130 -19.784 1.00 63.99  ? 36  VAL D C     1 
ATOM   2357  O  O     . VAL D 4 9   ? 38.328  16.013 -19.915 1.00 64.16  ? 36  VAL D O     1 
ATOM   2358  C  CB    . VAL D 4 9   ? 38.269  18.691 -17.816 1.00 64.51  ? 36  VAL D CB    1 
ATOM   2359  C  CG1   . VAL D 4 9   ? 38.508  17.536 -16.855 1.00 65.12  ? 36  VAL D CG1   1 
ATOM   2360  C  CG2   . VAL D 4 9   ? 39.021  19.940 -17.357 1.00 64.85  ? 36  VAL D CG2   1 
ATOM   2361  N  N     . TYR D 4 10  ? 36.566  17.421 -20.155 1.00 63.90  ? 37  TYR D N     1 
ATOM   2362  C  CA    . TYR D 4 10  ? 35.587  16.458 -20.654 1.00 64.56  ? 37  TYR D CA    1 
ATOM   2363  C  C     . TYR D 4 10  ? 35.834  16.070 -22.102 1.00 65.38  ? 37  TYR D C     1 
ATOM   2364  O  O     . TYR D 4 10  ? 35.631  14.909 -22.446 1.00 65.64  ? 37  TYR D O     1 
ATOM   2365  C  CB    . TYR D 4 10  ? 34.147  16.956 -20.470 1.00 64.39  ? 37  TYR D CB    1 
ATOM   2366  C  CG    . TYR D 4 10  ? 33.970  17.782 -19.226 1.00 65.06  ? 37  TYR D CG    1 
ATOM   2367  C  CD1   . TYR D 4 10  ? 33.945  17.189 -17.979 1.00 65.98  ? 37  TYR D CD1   1 
ATOM   2368  C  CD2   . TYR D 4 10  ? 34.004  19.164 -19.282 1.00 66.03  ? 37  TYR D CD2   1 
ATOM   2369  C  CE1   . TYR D 4 10  ? 33.832  17.944 -16.822 1.00 66.96  ? 37  TYR D CE1   1 
ATOM   2370  C  CE2   . TYR D 4 10  ? 33.915  19.936 -18.133 1.00 66.92  ? 37  TYR D CE2   1 
ATOM   2371  C  CZ    . TYR D 4 10  ? 33.829  19.322 -16.900 1.00 67.72  ? 37  TYR D CZ    1 
ATOM   2372  O  OH    . TYR D 4 10  ? 33.698  20.074 -15.757 1.00 68.86  ? 37  TYR D OH    1 
ATOM   2373  N  N     . VAL D 4 11  ? 36.271  17.012 -22.956 1.00 65.38  ? 38  VAL D N     1 
ATOM   2374  C  CA    . VAL D 4 11  ? 36.584  16.681 -24.353 1.00 65.73  ? 38  VAL D CA    1 
ATOM   2375  C  C     . VAL D 4 11  ? 37.781  15.696 -24.390 1.00 66.48  ? 38  VAL D C     1 
ATOM   2376  O  O     . VAL D 4 11  ? 37.781  14.774 -25.203 1.00 66.52  ? 38  VAL D O     1 
ATOM   2377  C  CB    . VAL D 4 11  ? 36.779  17.938 -25.244 1.00 66.08  ? 38  VAL D CB    1 
ATOM   2378  C  CG1   . VAL D 4 11  ? 37.431  17.594 -26.579 1.00 66.65  ? 38  VAL D CG1   1 
ATOM   2379  C  CG2   . VAL D 4 11  ? 35.460  18.655 -25.472 1.00 66.11  ? 38  VAL D CG2   1 
ATOM   2380  N  N     . TYR D 4 12  ? 38.746  15.841 -23.438 1.00 66.79  ? 39  TYR D N     1 
ATOM   2381  C  CA    . TYR D 4 12  ? 39.912  14.958 -23.269 1.00 67.40  ? 39  TYR D CA    1 
ATOM   2382  C  C     . TYR D 4 12  ? 39.445  13.553 -22.827 1.00 66.14  ? 39  TYR D C     1 
ATOM   2383  O  O     . TYR D 4 12  ? 39.779  12.570 -23.492 1.00 66.10  ? 39  TYR D O     1 
ATOM   2384  C  CB    . TYR D 4 12  ? 40.889  15.543 -22.223 1.00 68.61  ? 39  TYR D CB    1 
ATOM   2385  C  CG    . TYR D 4 12  ? 42.168  16.129 -22.788 1.00 70.99  ? 39  TYR D CG    1 
ATOM   2386  C  CD1   . TYR D 4 12  ? 43.142  15.312 -23.352 1.00 72.33  ? 39  TYR D CD1   1 
ATOM   2387  C  CD2   . TYR D 4 12  ? 42.447  17.487 -22.668 1.00 72.66  ? 39  TYR D CD2   1 
ATOM   2388  C  CE1   . TYR D 4 12  ? 44.339  15.840 -23.835 1.00 73.86  ? 39  TYR D CE1   1 
ATOM   2389  C  CE2   . TYR D 4 12  ? 43.639  18.028 -23.150 1.00 74.08  ? 39  TYR D CE2   1 
ATOM   2390  C  CZ    . TYR D 4 12  ? 44.587  17.202 -23.733 1.00 75.21  ? 39  TYR D CZ    1 
ATOM   2391  O  OH    . TYR D 4 12  ? 45.774  17.733 -24.211 1.00 77.01  ? 39  TYR D OH    1 
ATOM   2392  N  N     . LYS D 4 13  ? 38.630  13.472 -21.742 1.00 64.91  ? 40  LYS D N     1 
ATOM   2393  C  CA    . LYS D 4 13  ? 38.059  12.232 -21.208 1.00 64.27  ? 40  LYS D CA    1 
ATOM   2394  C  C     . LYS D 4 13  ? 37.343  11.442 -22.310 1.00 63.69  ? 40  LYS D C     1 
ATOM   2395  O  O     . LYS D 4 13  ? 37.621  10.261 -22.497 1.00 63.98  ? 40  LYS D O     1 
ATOM   2396  C  CB    . LYS D 4 13  ? 37.054  12.540 -20.084 1.00 65.62  ? 40  LYS D CB    1 
ATOM   2397  C  CG    . LYS D 4 13  ? 37.657  12.817 -18.726 1.00 68.99  ? 40  LYS D CG    1 
ATOM   2398  C  CD    . LYS D 4 13  ? 36.536  12.980 -17.705 1.00 72.88  ? 40  LYS D CD    1 
ATOM   2399  C  CE    . LYS D 4 13  ? 37.033  12.990 -16.283 1.00 76.45  ? 40  LYS D CE    1 
ATOM   2400  N  NZ    . LYS D 4 13  ? 37.928  14.146 -16.008 1.00 78.39  ? 40  LYS D NZ    1 
ATOM   2401  N  N     . VAL D 4 14  ? 36.438  12.110 -23.048 1.00 62.90  ? 41  VAL D N     1 
ATOM   2402  C  CA    . VAL D 4 14  ? 35.665  11.532 -24.140 1.00 62.44  ? 41  VAL D CA    1 
ATOM   2403  C  C     . VAL D 4 14  ? 36.581  11.143 -25.310 1.00 62.36  ? 41  VAL D C     1 
ATOM   2404  O  O     . VAL D 4 14  ? 36.379  10.088 -25.907 1.00 62.56  ? 41  VAL D O     1 
ATOM   2405  C  CB    . VAL D 4 14  ? 34.481  12.452 -24.544 1.00 62.59  ? 41  VAL D CB    1 
ATOM   2406  C  CG1   . VAL D 4 14  ? 33.767  11.934 -25.780 1.00 62.87  ? 41  VAL D CG1   1 
ATOM   2407  C  CG2   . VAL D 4 14  ? 33.497  12.603 -23.387 1.00 62.96  ? 41  VAL D CG2   1 
ATOM   2408  N  N     . LEU D 4 15  ? 37.653  11.918 -25.566 1.00 62.01  ? 42  LEU D N     1 
ATOM   2409  C  CA    . LEU D 4 15  ? 38.605  11.575 -26.623 1.00 62.48  ? 42  LEU D CA    1 
ATOM   2410  C  C     . LEU D 4 15  ? 39.292  10.263 -26.274 1.00 64.49  ? 42  LEU D C     1 
ATOM   2411  O  O     . LEU D 4 15  ? 39.361  9.368  -27.118 1.00 64.88  ? 42  LEU D O     1 
ATOM   2412  C  CB    . LEU D 4 15  ? 39.639  12.687 -26.869 1.00 61.52  ? 42  LEU D CB    1 
ATOM   2413  C  CG    . LEU D 4 15  ? 40.723  12.379 -27.912 1.00 61.46  ? 42  LEU D CG    1 
ATOM   2414  C  CD1   . LEU D 4 15  ? 40.129  12.033 -29.257 1.00 61.58  ? 42  LEU D CD1   1 
ATOM   2415  C  CD2   . LEU D 4 15  ? 41.678  13.527 -28.061 1.00 61.61  ? 42  LEU D CD2   1 
ATOM   2416  N  N     . LYS D 4 16  ? 39.695  10.106 -24.997 1.00 65.46  ? 43  LYS D N     1 
ATOM   2417  C  CA    . LYS D 4 16  ? 40.330  8.884  -24.496 1.00 66.62  ? 43  LYS D CA    1 
ATOM   2418  C  C     . LYS D 4 16  ? 39.459  7.653  -24.757 1.00 67.21  ? 43  LYS D C     1 
ATOM   2419  O  O     . LYS D 4 16  ? 39.988  6.618  -25.128 1.00 67.58  ? 43  LYS D O     1 
ATOM   2420  C  CB    . LYS D 4 16  ? 40.687  9.021  -22.999 1.00 68.91  ? 43  LYS D CB    1 
ATOM   2421  C  CG    . LYS D 4 16  ? 41.730  10.118 -22.718 1.00 73.30  ? 43  LYS D CG    1 
ATOM   2422  C  CD    . LYS D 4 16  ? 41.933  10.384 -21.212 1.00 77.59  ? 43  LYS D CD    1 
ATOM   2423  C  CE    . LYS D 4 16  ? 42.964  11.461 -20.927 1.00 80.75  ? 43  LYS D CE    1 
ATOM   2424  N  NZ    . LYS D 4 16  ? 43.465  11.400 -19.522 1.00 82.54  ? 43  LYS D NZ    1 
ATOM   2425  N  N     . GLN D 4 17  ? 38.129  7.788  -24.646 1.00 67.30  ? 44  GLN D N     1 
ATOM   2426  C  CA    . GLN D 4 17  ? 37.181  6.706  -24.898 1.00 67.96  ? 44  GLN D CA    1 
ATOM   2427  C  C     . GLN D 4 17  ? 37.143  6.250  -26.355 1.00 68.21  ? 44  GLN D C     1 
ATOM   2428  O  O     . GLN D 4 17  ? 37.120  5.051  -26.599 1.00 68.33  ? 44  GLN D O     1 
ATOM   2429  C  CB    . GLN D 4 17  ? 35.770  7.111  -24.457 1.00 70.04  ? 44  GLN D CB    1 
ATOM   2430  C  CG    . GLN D 4 17  ? 35.408  6.665  -23.053 1.00 74.90  ? 44  GLN D CG    1 
ATOM   2431  C  CD    . GLN D 4 17  ? 34.187  7.387  -22.520 1.00 80.88  ? 44  GLN D CD    1 
ATOM   2432  O  OE1   . GLN D 4 17  ? 33.175  6.774  -22.134 1.00 82.85  ? 44  GLN D OE1   1 
ATOM   2433  N  NE2   . GLN D 4 17  ? 34.260  8.711  -22.483 1.00 81.65  ? 44  GLN D NE2   1 
ATOM   2434  N  N     . VAL D 4 18  ? 37.105  7.182  -27.318 1.00 68.36  ? 45  VAL D N     1 
ATOM   2435  C  CA    . VAL D 4 18  ? 37.009  6.805  -28.731 1.00 68.95  ? 45  VAL D CA    1 
ATOM   2436  C  C     . VAL D 4 18  ? 38.354  6.442  -29.334 1.00 69.47  ? 45  VAL D C     1 
ATOM   2437  O  O     . VAL D 4 18  ? 38.439  5.488  -30.103 1.00 69.60  ? 45  VAL D O     1 
ATOM   2438  C  CB    . VAL D 4 18  ? 36.259  7.843  -29.612 1.00 69.50  ? 45  VAL D CB    1 
ATOM   2439  C  CG1   . VAL D 4 18  ? 34.749  7.651  -29.532 1.00 69.99  ? 45  VAL D CG1   1 
ATOM   2440  C  CG2   . VAL D 4 18  ? 36.651  9.273  -29.263 1.00 69.84  ? 45  VAL D CG2   1 
ATOM   2441  N  N     . HIS D 4 19  ? 39.392  7.216  -29.026 1.00 69.71  ? 46  HIS D N     1 
ATOM   2442  C  CA    . HIS D 4 19  ? 40.722  6.984  -29.576 1.00 70.56  ? 46  HIS D CA    1 
ATOM   2443  C  C     . HIS D 4 19  ? 41.763  7.228  -28.495 1.00 71.21  ? 46  HIS D C     1 
ATOM   2444  O  O     . HIS D 4 19  ? 42.260  8.346  -28.372 1.00 71.43  ? 46  HIS D O     1 
ATOM   2445  C  CB    . HIS D 4 19  ? 40.987  7.912  -30.789 1.00 71.42  ? 46  HIS D CB    1 
ATOM   2446  C  CG    . HIS D 4 19  ? 40.192  7.572  -32.018 1.00 73.69  ? 46  HIS D CG    1 
ATOM   2447  N  ND1   . HIS D 4 19  ? 38.991  8.193  -32.295 1.00 75.35  ? 46  HIS D ND1   1 
ATOM   2448  C  CD2   . HIS D 4 19  ? 40.453  6.678  -33.000 1.00 74.93  ? 46  HIS D CD2   1 
ATOM   2449  C  CE1   . HIS D 4 19  ? 38.556  7.652  -33.421 1.00 75.76  ? 46  HIS D CE1   1 
ATOM   2450  N  NE2   . HIS D 4 19  ? 39.400  6.739  -33.885 1.00 75.80  ? 46  HIS D NE2   1 
ATOM   2451  N  N     . PRO D 4 20  ? 42.091  6.214  -27.675 1.00 71.35  ? 47  PRO D N     1 
ATOM   2452  C  CA    . PRO D 4 20  ? 43.123  6.422  -26.642 1.00 71.59  ? 47  PRO D CA    1 
ATOM   2453  C  C     . PRO D 4 20  ? 44.511  6.627  -27.245 1.00 72.15  ? 47  PRO D C     1 
ATOM   2454  O  O     . PRO D 4 20  ? 45.353  7.289  -26.636 1.00 72.01  ? 47  PRO D O     1 
ATOM   2455  C  CB    . PRO D 4 20  ? 43.044  5.161  -25.773 1.00 72.16  ? 47  PRO D CB    1 
ATOM   2456  C  CG    . PRO D 4 20  ? 41.926  4.335  -26.329 1.00 72.50  ? 47  PRO D CG    1 
ATOM   2457  C  CD    . PRO D 4 20  ? 41.618  4.822  -27.704 1.00 70.89  ? 47  PRO D CD    1 
ATOM   2458  N  N     . ASP D 4 21  ? 44.733  6.090  -28.464 1.00 72.58  ? 48  ASP D N     1 
ATOM   2459  C  CA    . ASP D 4 21  ? 45.970  6.244  -29.219 1.00 73.57  ? 48  ASP D CA    1 
ATOM   2460  C  C     . ASP D 4 21  ? 45.842  7.433  -30.225 1.00 73.41  ? 48  ASP D C     1 
ATOM   2461  O  O     . ASP D 4 21  ? 46.282  7.345  -31.385 1.00 73.60  ? 48  ASP D O     1 
ATOM   2462  C  CB    . ASP D 4 21  ? 46.352  4.908  -29.907 1.00 76.29  ? 48  ASP D CB    1 
ATOM   2463  C  CG    . ASP D 4 21  ? 47.250  3.992  -29.065 1.00 81.98  ? 48  ASP D CG    1 
ATOM   2464  O  OD1   . ASP D 4 21  ? 47.240  4.126  -27.814 1.00 82.82  ? 48  ASP D OD1   1 
ATOM   2465  O  OD2   . ASP D 4 21  ? 47.963  3.141  -29.659 1.00 84.24  ? 48  ASP D OD2   1 
ATOM   2466  N  N     . THR D 4 22  ? 45.228  8.567  -29.745 1.00 72.63  ? 49  THR D N     1 
ATOM   2467  C  CA    . THR D 4 22  ? 44.970  9.815  -30.497 1.00 72.13  ? 49  THR D CA    1 
ATOM   2468  C  C     . THR D 4 22  ? 44.925  11.056 -29.528 1.00 71.04  ? 49  THR D C     1 
ATOM   2469  O  O     . THR D 4 22  ? 44.490  10.925 -28.381 1.00 70.91  ? 49  THR D O     1 
ATOM   2470  C  CB    . THR D 4 22  ? 43.703  9.629  -31.386 1.00 73.81  ? 49  THR D CB    1 
ATOM   2471  O  OG1   . THR D 4 22  ? 43.948  8.653  -32.405 1.00 74.88  ? 49  THR D OG1   1 
ATOM   2472  C  CG2   . THR D 4 22  ? 43.250  10.905 -32.054 1.00 74.51  ? 49  THR D CG2   1 
ATOM   2473  N  N     . GLY D 4 23  ? 45.413  12.218 -29.986 1.00 70.20  ? 50  GLY D N     1 
ATOM   2474  C  CA    . GLY D 4 23  ? 45.471  13.450 -29.194 1.00 70.06  ? 50  GLY D CA    1 
ATOM   2475  C  C     . GLY D 4 23  ? 44.728  14.640 -29.787 1.00 69.74  ? 50  GLY D C     1 
ATOM   2476  O  O     . GLY D 4 23  ? 44.004  14.478 -30.766 1.00 70.13  ? 50  GLY D O     1 
ATOM   2477  N  N     . ILE D 4 24  ? 44.885  15.855 -29.215 1.00 68.89  ? 51  ILE D N     1 
ATOM   2478  C  CA    . ILE D 4 24  ? 44.164  17.036 -29.711 1.00 68.55  ? 51  ILE D CA    1 
ATOM   2479  C  C     . ILE D 4 24  ? 44.966  18.355 -29.596 1.00 68.81  ? 51  ILE D C     1 
ATOM   2480  O  O     . ILE D 4 24  ? 45.467  18.677 -28.517 1.00 69.44  ? 51  ILE D O     1 
ATOM   2481  C  CB    . ILE D 4 24  ? 42.782  17.136 -28.999 1.00 68.57  ? 51  ILE D CB    1 
ATOM   2482  C  CG1   . ILE D 4 24  ? 41.870  18.182 -29.663 1.00 69.27  ? 51  ILE D CG1   1 
ATOM   2483  C  CG2   . ILE D 4 24  ? 42.922  17.361 -27.486 1.00 68.85  ? 51  ILE D CG2   1 
ATOM   2484  C  CD1   . ILE D 4 24  ? 40.473  18.322 -29.028 1.00 70.36  ? 51  ILE D CD1   1 
ATOM   2485  N  N     . SER D 4 25  ? 45.059  19.140 -30.698 1.00 68.11  ? 52  SER D N     1 
ATOM   2486  C  CA    . SER D 4 25  ? 45.776  20.435 -30.721 1.00 67.87  ? 52  SER D CA    1 
ATOM   2487  C  C     . SER D 4 25  ? 45.066  21.544 -29.908 1.00 67.66  ? 52  SER D C     1 
ATOM   2488  O  O     . SER D 4 25  ? 43.887  21.403 -29.598 1.00 67.83  ? 52  SER D O     1 
ATOM   2489  C  CB    . SER D 4 25  ? 46.064  20.879 -32.159 1.00 68.91  ? 52  SER D CB    1 
ATOM   2490  O  OG    . SER D 4 25  ? 45.086  21.731 -32.733 1.00 70.96  ? 52  SER D OG    1 
ATOM   2491  N  N     . SER D 4 26  ? 45.775  22.626 -29.540 1.00 67.28  ? 53  SER D N     1 
ATOM   2492  C  CA    . SER D 4 26  ? 45.162  23.713 -28.752 1.00 67.47  ? 53  SER D CA    1 
ATOM   2493  C  C     . SER D 4 26  ? 44.075  24.422 -29.545 1.00 66.83  ? 53  SER D C     1 
ATOM   2494  O  O     . SER D 4 26  ? 43.045  24.804 -28.984 1.00 67.19  ? 53  SER D O     1 
ATOM   2495  C  CB    . SER D 4 26  ? 46.201  24.739 -28.308 1.00 69.12  ? 53  SER D CB    1 
ATOM   2496  O  OG    . SER D 4 26  ? 45.600  25.751 -27.510 1.00 71.41  ? 53  SER D OG    1 
ATOM   2497  N  N     . LYS D 4 27  ? 44.313  24.609 -30.848 1.00 65.70  ? 54  LYS D N     1 
ATOM   2498  C  CA    . LYS D 4 27  ? 43.344  25.226 -31.748 1.00 64.89  ? 54  LYS D CA    1 
ATOM   2499  C  C     . LYS D 4 27  ? 42.132  24.292 -31.925 1.00 63.31  ? 54  LYS D C     1 
ATOM   2500  O  O     . LYS D 4 27  ? 41.005  24.742 -31.762 1.00 63.49  ? 54  LYS D O     1 
ATOM   2501  C  CB    . LYS D 4 27  ? 43.977  25.647 -33.101 1.00 67.46  ? 54  LYS D CB    1 
ATOM   2502  C  CG    . LYS D 4 27  ? 45.349  25.017 -33.434 1.00 72.84  ? 54  LYS D CG    1 
ATOM   2503  C  CD    . LYS D 4 27  ? 45.737  25.128 -34.923 1.00 77.80  ? 54  LYS D CD    1 
ATOM   2504  C  CE    . LYS D 4 27  ? 46.869  24.190 -35.306 1.00 81.22  ? 54  LYS D CE    1 
ATOM   2505  N  NZ    . LYS D 4 27  ? 46.535  22.750 -35.100 1.00 82.61  ? 54  LYS D NZ    1 
ATOM   2506  N  N     . ALA D 4 28  ? 42.363  22.983 -32.150 1.00 61.33  ? 55  ALA D N     1 
ATOM   2507  C  CA    . ALA D 4 28  ? 41.265  22.030 -32.293 1.00 59.82  ? 55  ALA D CA    1 
ATOM   2508  C  C     . ALA D 4 28  ? 40.438  21.920 -31.024 1.00 58.14  ? 55  ALA D C     1 
ATOM   2509  O  O     . ALA D 4 28  ? 39.228  21.780 -31.115 1.00 58.07  ? 55  ALA D O     1 
ATOM   2510  C  CB    . ALA D 4 28  ? 41.779  20.675 -32.713 1.00 59.85  ? 55  ALA D CB    1 
ATOM   2511  N  N     . MET D 4 29  ? 41.060  22.058 -29.850 1.00 56.92  ? 56  MET D N     1 
ATOM   2512  C  CA    . MET D 4 29  ? 40.323  22.066 -28.586 1.00 56.56  ? 56  MET D CA    1 
ATOM   2513  C  C     . MET D 4 29  ? 39.423  23.313 -28.495 1.00 55.31  ? 56  MET D C     1 
ATOM   2514  O  O     . MET D 4 29  ? 38.322  23.247 -27.953 1.00 55.61  ? 56  MET D O     1 
ATOM   2515  C  CB    . MET D 4 29  ? 41.279  22.013 -27.396 1.00 58.23  ? 56  MET D CB    1 
ATOM   2516  C  CG    . MET D 4 29  ? 40.580  22.055 -26.051 1.00 62.51  ? 56  MET D CG    1 
ATOM   2517  S  SD    . MET D 4 29  ? 39.544  20.604 -25.756 1.00 72.72  ? 56  MET D SD    1 
ATOM   2518  C  CE    . MET D 4 29  ? 37.980  21.344 -25.658 1.00 76.04  ? 56  MET D CE    1 
ATOM   2519  N  N     . GLY D 4 30  ? 39.878  24.429 -29.058 1.00 53.55  ? 57  GLY D N     1 
ATOM   2520  C  CA    . GLY D 4 30  ? 39.092  25.649 -29.142 1.00 52.04  ? 57  GLY D CA    1 
ATOM   2521  C  C     . GLY D 4 30  ? 37.884  25.432 -30.032 1.00 50.01  ? 57  GLY D C     1 
ATOM   2522  O  O     . GLY D 4 30  ? 36.769  25.763 -29.636 1.00 50.05  ? 57  GLY D O     1 
ATOM   2523  N  N     . ILE D 4 31  ? 38.079  24.783 -31.206 1.00 48.08  ? 58  ILE D N     1 
ATOM   2524  C  CA    . ILE D 4 31  ? 36.987  24.435 -32.118 1.00 46.72  ? 58  ILE D CA    1 
ATOM   2525  C  C     . ILE D 4 31  ? 35.987  23.522 -31.399 1.00 45.75  ? 58  ILE D C     1 
ATOM   2526  O  O     . ILE D 4 31  ? 34.790  23.744 -31.518 1.00 46.07  ? 58  ILE D O     1 
ATOM   2527  C  CB    . ILE D 4 31  ? 37.471  23.889 -33.504 1.00 46.59  ? 58  ILE D CB    1 
ATOM   2528  C  CG1   . ILE D 4 31  ? 37.810  25.046 -34.465 1.00 47.93  ? 58  ILE D CG1   1 
ATOM   2529  C  CG2   . ILE D 4 31  ? 36.415  23.029 -34.184 1.00 46.45  ? 58  ILE D CG2   1 
ATOM   2530  C  CD1   . ILE D 4 31  ? 39.109  25.715 -34.303 1.00 49.26  ? 58  ILE D CD1   1 
ATOM   2531  N  N     . MET D 4 32  ? 36.463  22.564 -30.596 1.00 44.91  ? 59  MET D N     1 
ATOM   2532  C  CA    . MET D 4 32  ? 35.566  21.685 -29.849 1.00 44.98  ? 59  MET D CA    1 
ATOM   2533  C  C     . MET D 4 32  ? 34.816  22.434 -28.761 1.00 46.10  ? 59  MET D C     1 
ATOM   2534  O  O     . MET D 4 32  ? 33.656  22.139 -28.519 1.00 46.24  ? 59  MET D O     1 
ATOM   2535  C  CB    . MET D 4 32  ? 36.302  20.485 -29.264 1.00 44.86  ? 59  MET D CB    1 
ATOM   2536  C  CG    . MET D 4 32  ? 36.791  19.510 -30.300 1.00 45.65  ? 59  MET D CG    1 
ATOM   2537  S  SD    . MET D 4 32  ? 35.517  18.752 -31.338 1.00 44.74  ? 59  MET D SD    1 
ATOM   2538  C  CE    . MET D 4 32  ? 34.448  18.066 -30.102 1.00 42.07  ? 59  MET D CE    1 
ATOM   2539  N  N     . ASN D 4 33  ? 35.445  23.417 -28.139 1.00 46.92  ? 60  ASN D N     1 
ATOM   2540  C  CA    . ASN D 4 33  ? 34.801  24.223 -27.112 1.00 48.51  ? 60  ASN D CA    1 
ATOM   2541  C  C     . ASN D 4 33  ? 33.726  25.138 -27.684 1.00 47.94  ? 60  ASN D C     1 
ATOM   2542  O  O     . ASN D 4 33  ? 32.689  25.351 -27.051 1.00 48.44  ? 60  ASN D O     1 
ATOM   2543  C  CB    . ASN D 4 33  ? 35.832  25.040 -26.385 1.00 51.96  ? 60  ASN D CB    1 
ATOM   2544  C  CG    . ASN D 4 33  ? 35.987  24.544 -24.997 1.00 58.64  ? 60  ASN D CG    1 
ATOM   2545  O  OD1   . ASN D 4 33  ? 34.990  24.223 -24.319 1.00 60.39  ? 60  ASN D OD1   1 
ATOM   2546  N  ND2   . ASN D 4 33  ? 37.242  24.455 -24.557 1.00 60.65  ? 60  ASN D ND2   1 
ATOM   2547  N  N     . SER D 4 34  ? 33.990  25.691 -28.876 1.00 46.42  ? 61  SER D N     1 
ATOM   2548  C  CA    . SER D 4 34  ? 33.035  26.523 -29.584 1.00 45.13  ? 61  SER D CA    1 
ATOM   2549  C  C     . SER D 4 34  ? 31.826  25.658 -30.025 1.00 43.95  ? 61  SER D C     1 
ATOM   2550  O  O     . SER D 4 34  ? 30.676  26.110 -29.947 1.00 44.21  ? 61  SER D O     1 
ATOM   2551  C  CB    . SER D 4 34  ? 33.714  27.191 -30.772 1.00 45.74  ? 61  SER D CB    1 
ATOM   2552  O  OG    . SER D 4 34  ? 34.746  28.065 -30.335 1.00 47.06  ? 61  SER D OG    1 
ATOM   2553  N  N     . PHE D 4 35  ? 32.086  24.399 -30.417 1.00 42.31  ? 62  PHE D N     1 
ATOM   2554  C  CA    . PHE D 4 35  ? 31.054  23.473 -30.827 1.00 41.27  ? 62  PHE D CA    1 
ATOM   2555  C  C     . PHE D 4 35  ? 30.132  23.145 -29.680 1.00 40.80  ? 62  PHE D C     1 
ATOM   2556  O  O     . PHE D 4 35  ? 28.927  23.163 -29.869 1.00 41.30  ? 62  PHE D O     1 
ATOM   2557  C  CB    . PHE D 4 35  ? 31.666  22.207 -31.442 1.00 40.82  ? 62  PHE D CB    1 
ATOM   2558  C  CG    . PHE D 4 35  ? 30.665  21.108 -31.666 1.00 41.68  ? 62  PHE D CG    1 
ATOM   2559  C  CD1   . PHE D 4 35  ? 29.743  21.193 -32.689 1.00 42.70  ? 62  PHE D CD1   1 
ATOM   2560  C  CD2   . PHE D 4 35  ? 30.601  20.023 -30.812 1.00 42.62  ? 62  PHE D CD2   1 
ATOM   2561  C  CE1   . PHE D 4 35  ? 28.809  20.192 -32.882 1.00 43.54  ? 62  PHE D CE1   1 
ATOM   2562  C  CE2   . PHE D 4 35  ? 29.657  19.037 -30.992 1.00 43.47  ? 62  PHE D CE2   1 
ATOM   2563  C  CZ    . PHE D 4 35  ? 28.763  19.127 -32.023 1.00 43.44  ? 62  PHE D CZ    1 
ATOM   2564  N  N     . VAL D 4 36  ? 30.677  22.836 -28.504 1.00 39.88  ? 63  VAL D N     1 
ATOM   2565  C  CA    . VAL D 4 36  ? 29.866  22.483 -27.346 1.00 39.58  ? 63  VAL D CA    1 
ATOM   2566  C  C     . VAL D 4 36  ? 29.032  23.659 -26.895 1.00 39.39  ? 63  VAL D C     1 
ATOM   2567  O  O     . VAL D 4 36  ? 27.860  23.491 -26.582 1.00 39.55  ? 63  VAL D O     1 
ATOM   2568  C  CB    . VAL D 4 36  ? 30.735  21.954 -26.194 1.00 40.26  ? 63  VAL D CB    1 
ATOM   2569  C  CG1   . VAL D 4 36  ? 29.893  21.643 -24.967 1.00 40.91  ? 63  VAL D CG1   1 
ATOM   2570  C  CG2   . VAL D 4 36  ? 31.504  20.720 -26.624 1.00 40.52  ? 63  VAL D CG2   1 
ATOM   2571  N  N     . ASN D 4 37  ? 29.619  24.854 -26.887 1.00 39.01  ? 64  ASN D N     1 
ATOM   2572  C  CA    . ASN D 4 37  ? 28.912  26.055 -26.467 1.00 39.21  ? 64  ASN D CA    1 
ATOM   2573  C  C     . ASN D 4 37  ? 27.790  26.438 -27.413 1.00 38.46  ? 64  ASN D C     1 
ATOM   2574  O  O     . ASN D 4 37  ? 26.726  26.880 -26.960 1.00 39.13  ? 64  ASN D O     1 
ATOM   2575  C  CB    . ASN D 4 37  ? 29.879  27.213 -26.287 1.00 41.13  ? 64  ASN D CB    1 
ATOM   2576  C  CG    . ASN D 4 37  ? 30.592  27.125 -24.978 1.00 46.15  ? 64  ASN D CG    1 
ATOM   2577  O  OD1   . ASN D 4 37  ? 29.970  26.928 -23.929 1.00 48.54  ? 64  ASN D OD1   1 
ATOM   2578  N  ND2   . ASN D 4 37  ? 31.913  27.240 -25.008 1.00 47.12  ? 64  ASN D ND2   1 
ATOM   2579  N  N     . ASP D 4 38  ? 28.014  26.263 -28.717 1.00 36.73  ? 65  ASP D N     1 
ATOM   2580  C  CA    . ASP D 4 38  ? 26.995  26.590 -29.701 1.00 35.52  ? 65  ASP D CA    1 
ATOM   2581  C  C     . ASP D 4 38  ? 25.797  25.654 -29.554 1.00 33.80  ? 65  ASP D C     1 
ATOM   2582  O  O     . ASP D 4 38  ? 24.667  26.119 -29.462 1.00 33.29  ? 65  ASP D O     1 
ATOM   2583  C  CB    . ASP D 4 38  ? 27.593  26.514 -31.109 1.00 37.04  ? 65  ASP D CB    1 
ATOM   2584  C  CG    . ASP D 4 38  ? 26.582  26.656 -32.229 1.00 39.68  ? 65  ASP D CG    1 
ATOM   2585  O  OD1   . ASP D 4 38  ? 25.523  27.286 -32.002 1.00 39.89  ? 65  ASP D OD1   1 
ATOM   2586  O  OD2   . ASP D 4 38  ? 26.855  26.155 -33.328 1.00 40.94  ? 65  ASP D OD2   1 
ATOM   2587  N  N     . ILE D 4 39  ? 26.053  24.339 -29.532 1.00 32.77  ? 66  ILE D N     1 
ATOM   2588  C  CA    . ILE D 4 39  ? 25.009  23.332 -29.407 1.00 31.97  ? 66  ILE D CA    1 
ATOM   2589  C  C     . ILE D 4 39  ? 24.323  23.429 -28.061 1.00 31.90  ? 66  ILE D C     1 
ATOM   2590  O  O     . ILE D 4 39  ? 23.108  23.261 -27.999 1.00 32.14  ? 66  ILE D O     1 
ATOM   2591  C  CB    . ILE D 4 39  ? 25.531  21.925 -29.708 1.00 31.92  ? 66  ILE D CB    1 
ATOM   2592  C  CG1   . ILE D 4 39  ? 26.283  21.880 -31.037 1.00 32.41  ? 66  ILE D CG1   1 
ATOM   2593  C  CG2   . ILE D 4 39  ? 24.413  20.901 -29.666 1.00 32.68  ? 66  ILE D CG2   1 
ATOM   2594  C  CD1   . ILE D 4 39  ? 25.509  22.204 -32.224 1.00 33.74  ? 66  ILE D CD1   1 
ATOM   2595  N  N     . PHE D 4 40  ? 25.047  23.827 -26.991 1.00 31.73  ? 67  PHE D N     1 
ATOM   2596  C  CA    . PHE D 4 40  ? 24.424  24.017 -25.683 1.00 32.45  ? 67  PHE D CA    1 
ATOM   2597  C  C     . PHE D 4 40  ? 23.325  25.082 -25.800 1.00 32.78  ? 67  PHE D C     1 
ATOM   2598  O  O     . PHE D 4 40  ? 22.166  24.805 -25.499 1.00 33.24  ? 67  PHE D O     1 
ATOM   2599  C  CB    . PHE D 4 40  ? 25.449  24.386 -24.571 1.00 32.79  ? 67  PHE D CB    1 
ATOM   2600  C  CG    . PHE D 4 40  ? 24.764  24.833 -23.295 1.00 34.28  ? 67  PHE D CG    1 
ATOM   2601  C  CD1   . PHE D 4 40  ? 24.198  23.907 -22.427 1.00 35.44  ? 67  PHE D CD1   1 
ATOM   2602  C  CD2   . PHE D 4 40  ? 24.567  26.172 -23.031 1.00 35.26  ? 67  PHE D CD2   1 
ATOM   2603  C  CE1   . PHE D 4 40  ? 23.497  24.322 -21.293 1.00 36.07  ? 67  PHE D CE1   1 
ATOM   2604  C  CE2   . PHE D 4 40  ? 23.825  26.577 -21.928 1.00 36.13  ? 67  PHE D CE2   1 
ATOM   2605  C  CZ    . PHE D 4 40  ? 23.303  25.650 -21.062 1.00 35.88  ? 67  PHE D CZ    1 
ATOM   2606  N  N     . GLU D 4 41  ? 23.691  26.249 -26.362 1.00 32.05  ? 68  GLU D N     1 
ATOM   2607  C  CA    . GLU D 4 41  ? 22.773  27.357 -26.538 1.00 31.78  ? 68  GLU D CA    1 
ATOM   2608  C  C     . GLU D 4 41  ? 21.640  26.978 -27.453 1.00 30.10  ? 68  GLU D C     1 
ATOM   2609  O  O     . GLU D 4 41  ? 20.498  27.321 -27.164 1.00 30.78  ? 68  GLU D O     1 
ATOM   2610  C  CB    . GLU D 4 41  ? 23.495  28.588 -27.088 1.00 35.66  ? 68  GLU D CB    1 
ATOM   2611  C  CG    . GLU D 4 41  ? 23.278  29.820 -26.236 1.00 45.41  ? 68  GLU D CG    1 
ATOM   2612  C  CD    . GLU D 4 41  ? 24.480  30.264 -25.411 1.00 58.89  ? 68  GLU D CD    1 
ATOM   2613  O  OE1   . GLU D 4 41  ? 25.633  30.108 -25.885 1.00 61.65  ? 68  GLU D OE1   1 
ATOM   2614  O  OE2   . GLU D 4 41  ? 24.262  30.789 -24.292 1.00 63.10  ? 68  GLU D OE2   1 
ATOM   2615  N  N     . ARG D 4 42  ? 21.938  26.250 -28.546 1.00 27.61  ? 69  ARG D N     1 
ATOM   2616  C  CA    . ARG D 4 42  ? 20.938  25.869 -29.535 1.00 25.75  ? 69  ARG D CA    1 
ATOM   2617  C  C     . ARG D 4 42  ? 19.813  25.077 -28.903 1.00 25.73  ? 69  ARG D C     1 
ATOM   2618  O  O     . ARG D 4 42  ? 18.638  25.414 -29.080 1.00 25.84  ? 69  ARG D O     1 
ATOM   2619  C  CB    . ARG D 4 42  ? 21.582  25.070 -30.658 1.00 24.72  ? 69  ARG D CB    1 
ATOM   2620  C  CG    . ARG D 4 42  ? 22.316  25.904 -31.651 1.00 24.93  ? 69  ARG D CG    1 
ATOM   2621  C  CD    . ARG D 4 42  ? 22.479  25.099 -32.895 1.00 25.76  ? 69  ARG D CD    1 
ATOM   2622  N  NE    . ARG D 4 42  ? 23.726  25.402 -33.584 1.00 27.26  ? 69  ARG D NE    1 
ATOM   2623  C  CZ    . ARG D 4 42  ? 24.074  24.871 -34.750 1.00 30.01  ? 69  ARG D CZ    1 
ATOM   2624  N  NH1   . ARG D 4 42  ? 23.280  23.990 -35.352 1.00 29.78  ? 69  ARG D NH1   1 
ATOM   2625  N  NH2   . ARG D 4 42  ? 25.214  25.218 -35.329 1.00 30.73  ? 69  ARG D NH2   1 
ATOM   2626  N  N     . ILE D 4 43  ? 20.185  24.072 -28.095 1.00 25.48  ? 70  ILE D N     1 
ATOM   2627  C  CA    . ILE D 4 43  ? 19.223  23.207 -27.438 1.00 25.70  ? 70  ILE D CA    1 
ATOM   2628  C  C     . ILE D 4 43  ? 18.514  23.949 -26.320 1.00 26.53  ? 70  ILE D C     1 
ATOM   2629  O  O     . ILE D 4 43  ? 17.280  23.999 -26.315 1.00 27.02  ? 70  ILE D O     1 
ATOM   2630  C  CB    . ILE D 4 43  ? 19.865  21.858 -26.995 1.00 25.61  ? 70  ILE D CB    1 
ATOM   2631  C  CG1   . ILE D 4 43  ? 20.521  21.148 -28.187 1.00 26.05  ? 70  ILE D CG1   1 
ATOM   2632  C  CG2   . ILE D 4 43  ? 18.838  20.939 -26.308 1.00 26.04  ? 70  ILE D CG2   1 
ATOM   2633  C  CD1   . ILE D 4 43  ? 21.265  19.933 -27.831 1.00 27.76  ? 70  ILE D CD1   1 
ATOM   2634  N  N     . ALA D 4 44  ? 19.286  24.595 -25.422 1.00 26.32  ? 71  ALA D N     1 
ATOM   2635  C  CA    . ALA D 4 44  ? 18.732  25.328 -24.284 1.00 26.37  ? 71  ALA D CA    1 
ATOM   2636  C  C     . ALA D 4 44  ? 17.727  26.382 -24.706 1.00 27.05  ? 71  ALA D C     1 
ATOM   2637  O  O     . ALA D 4 44  ? 16.671  26.488 -24.088 1.00 27.88  ? 71  ALA D O     1 
ATOM   2638  C  CB    . ALA D 4 44  ? 19.845  25.946 -23.449 1.00 26.06  ? 71  ALA D CB    1 
ATOM   2639  N  N     . GLY D 4 45  ? 18.035  27.109 -25.775 1.00 26.48  ? 72  GLY D N     1 
ATOM   2640  C  CA    . GLY D 4 45  ? 17.171  28.158 -26.292 1.00 26.35  ? 72  GLY D CA    1 
ATOM   2641  C  C     . GLY D 4 45  ? 15.888  27.608 -26.863 1.00 26.39  ? 72  GLY D C     1 
ATOM   2642  O  O     . GLY D 4 45  ? 14.816  28.152 -26.609 1.00 26.12  ? 72  GLY D O     1 
ATOM   2643  N  N     . GLU D 4 46  ? 15.980  26.505 -27.610 1.00 26.64  ? 73  GLU D N     1 
ATOM   2644  C  CA    . GLU D 4 46  ? 14.800  25.878 -28.199 1.00 27.84  ? 73  GLU D CA    1 
ATOM   2645  C  C     . GLU D 4 46  ? 13.877  25.317 -27.105 1.00 29.12  ? 73  GLU D C     1 
ATOM   2646  O  O     . GLU D 4 46  ? 12.654  25.404 -27.212 1.00 29.78  ? 73  GLU D O     1 
ATOM   2647  C  CB    . GLU D 4 46  ? 15.224  24.772 -29.183 1.00 29.94  ? 73  GLU D CB    1 
ATOM   2648  C  CG    . GLU D 4 46  ? 14.063  24.117 -29.917 1.00 33.62  ? 73  GLU D CG    1 
ATOM   2649  C  CD    . GLU D 4 46  ? 13.210  25.053 -30.751 1.00 37.48  ? 73  GLU D CD    1 
ATOM   2650  O  OE1   . GLU D 4 46  ? 12.027  25.256 -30.390 1.00 36.74  ? 73  GLU D OE1   1 
ATOM   2651  O  OE2   . GLU D 4 46  ? 13.722  25.579 -31.766 1.00 39.49  ? 73  GLU D OE2   1 
ATOM   2652  N  N     . ALA D 4 47  ? 14.470  24.761 -26.044 1.00 29.09  ? 74  ALA D N     1 
ATOM   2653  C  CA    . ALA D 4 47  ? 13.732  24.247 -24.904 1.00 29.50  ? 74  ALA D CA    1 
ATOM   2654  C  C     . ALA D 4 47  ? 13.095  25.398 -24.112 1.00 30.02  ? 74  ALA D C     1 
ATOM   2655  O  O     . ALA D 4 47  ? 12.006  25.242 -23.572 1.00 30.28  ? 74  ALA D O     1 
ATOM   2656  C  CB    . ALA D 4 47  ? 14.669  23.456 -24.016 1.00 29.79  ? 74  ALA D CB    1 
ATOM   2657  N  N     . SER D 4 48  ? 13.773  26.543 -24.041 1.00 30.20  ? 75  SER D N     1 
ATOM   2658  C  CA    . SER D 4 48  ? 13.272  27.751 -23.385 1.00 31.18  ? 75  SER D CA    1 
ATOM   2659  C  C     . SER D 4 48  ? 11.988  28.246 -24.072 1.00 31.93  ? 75  SER D C     1 
ATOM   2660  O  O     . SER D 4 48  ? 11.086  28.768 -23.411 1.00 31.96  ? 75  SER D O     1 
ATOM   2661  C  CB    . SER D 4 48  ? 14.335  28.849 -23.443 1.00 32.36  ? 75  SER D CB    1 
ATOM   2662  O  OG    . SER D 4 48  ? 13.838  30.125 -23.073 1.00 34.16  ? 75  SER D OG    1 
ATOM   2663  N  N     . ARG D 4 49  ? 11.938  28.107 -25.404 1.00 32.09  ? 76  ARG D N     1 
ATOM   2664  C  CA    . ARG D 4 49  ? 10.823  28.512 -26.234 1.00 32.34  ? 76  ARG D CA    1 
ATOM   2665  C  C     . ARG D 4 49  ? 9.689   27.528 -26.068 1.00 32.59  ? 76  ARG D C     1 
ATOM   2666  O  O     . ARG D 4 49  ? 8.572   27.962 -25.879 1.00 32.48  ? 76  ARG D O     1 
ATOM   2667  C  CB    . ARG D 4 49  ? 11.267  28.554 -27.691 1.00 33.46  ? 76  ARG D CB    1 
ATOM   2668  C  CG    . ARG D 4 49  ? 11.063  29.881 -28.333 1.00 35.73  ? 76  ARG D CG    1 
ATOM   2669  C  CD    . ARG D 4 49  ? 11.838  29.916 -29.608 1.00 39.21  ? 76  ARG D CD    1 
ATOM   2670  N  NE    . ARG D 4 49  ? 13.246  30.197 -29.346 1.00 43.85  ? 76  ARG D NE    1 
ATOM   2671  C  CZ    . ARG D 4 49  ? 14.255  29.555 -29.919 1.00 48.83  ? 76  ARG D CZ    1 
ATOM   2672  N  NH1   . ARG D 4 49  ? 14.021  28.561 -30.774 1.00 51.10  ? 76  ARG D NH1   1 
ATOM   2673  N  NH2   . ARG D 4 49  ? 15.509  29.888 -29.633 1.00 48.43  ? 76  ARG D NH2   1 
ATOM   2674  N  N     . LEU D 4 50  ? 9.968   26.212 -26.101 1.00 32.72  ? 77  LEU D N     1 
ATOM   2675  C  CA    . LEU D 4 50  ? 8.975   25.142 -25.917 1.00 33.18  ? 77  LEU D CA    1 
ATOM   2676  C  C     . LEU D 4 50  ? 8.218   25.319 -24.591 1.00 34.50  ? 77  LEU D C     1 
ATOM   2677  O  O     . LEU D 4 50  ? 6.983   25.312 -24.563 1.00 34.15  ? 77  LEU D O     1 
ATOM   2678  C  CB    . LEU D 4 50  ? 9.688   23.783 -25.914 1.00 32.49  ? 77  LEU D CB    1 
ATOM   2679  C  CG    . LEU D 4 50  ? 10.068  23.262 -27.259 1.00 33.36  ? 77  LEU D CG    1 
ATOM   2680  C  CD1   . LEU D 4 50  ? 11.016  22.108 -27.136 1.00 33.80  ? 77  LEU D CD1   1 
ATOM   2681  C  CD2   . LEU D 4 50  ? 8.855   22.842 -28.000 1.00 33.97  ? 77  LEU D CD2   1 
ATOM   2682  N  N     . ALA D 4 51  ? 8.974   25.540 -23.490 1.00 35.70  ? 78  ALA D N     1 
ATOM   2683  C  CA    . ALA D 4 51  ? 8.428   25.739 -22.160 1.00 37.49  ? 78  ALA D CA    1 
ATOM   2684  C  C     . ALA D 4 51  ? 7.488   26.931 -22.176 1.00 40.62  ? 78  ALA D C     1 
ATOM   2685  O  O     . ALA D 4 51  ? 6.340   26.795 -21.773 1.00 41.25  ? 78  ALA D O     1 
ATOM   2686  C  CB    . ALA D 4 51  ? 9.560   25.935 -21.153 1.00 37.15  ? 78  ALA D CB    1 
ATOM   2687  N  N     . HIS D 4 52  ? 7.928   28.030 -22.799 1.00 42.40  ? 79  HIS D N     1 
ATOM   2688  C  CA    . HIS D 4 52  ? 7.181   29.246 -22.964 1.00 44.32  ? 79  HIS D CA    1 
ATOM   2689  C  C     . HIS D 4 52  ? 5.910   29.076 -23.796 1.00 44.82  ? 79  HIS D C     1 
ATOM   2690  O  O     . HIS D 4 52  ? 4.848   29.502 -23.352 1.00 45.04  ? 79  HIS D O     1 
ATOM   2691  C  CB    . HIS D 4 52  ? 8.082   30.299 -23.579 1.00 46.81  ? 79  HIS D CB    1 
ATOM   2692  C  CG    . HIS D 4 52  ? 7.729   31.647 -23.095 1.00 51.70  ? 79  HIS D CG    1 
ATOM   2693  N  ND1   . HIS D 4 52  ? 8.249   32.135 -21.911 1.00 54.39  ? 79  HIS D ND1   1 
ATOM   2694  C  CD2   . HIS D 4 52  ? 6.834   32.532 -23.594 1.00 53.59  ? 79  HIS D CD2   1 
ATOM   2695  C  CE1   . HIS D 4 52  ? 7.682   33.319 -21.744 1.00 55.52  ? 79  HIS D CE1   1 
ATOM   2696  N  NE2   . HIS D 4 52  ? 6.829   33.607 -22.738 1.00 55.35  ? 79  HIS D NE2   1 
ATOM   2697  N  N     . TYR D 4 53  ? 5.994   28.430 -24.972 1.00 44.95  ? 80  TYR D N     1 
ATOM   2698  C  CA    . TYR D 4 53  ? 4.844   28.204 -25.850 1.00 46.03  ? 80  TYR D CA    1 
ATOM   2699  C  C     . TYR D 4 53  ? 3.728   27.481 -25.122 1.00 47.24  ? 80  TYR D C     1 
ATOM   2700  O  O     . TYR D 4 53  ? 2.553   27.783 -25.343 1.00 47.73  ? 80  TYR D O     1 
ATOM   2701  C  CB    . TYR D 4 53  ? 5.221   27.328 -27.053 1.00 46.09  ? 80  TYR D CB    1 
ATOM   2702  C  CG    . TYR D 4 53  ? 6.192   27.927 -28.037 1.00 46.95  ? 80  TYR D CG    1 
ATOM   2703  C  CD1   . TYR D 4 53  ? 6.346   29.300 -28.146 1.00 47.62  ? 80  TYR D CD1   1 
ATOM   2704  C  CD2   . TYR D 4 53  ? 6.977   27.118 -28.845 1.00 47.94  ? 80  TYR D CD2   1 
ATOM   2705  C  CE1   . TYR D 4 53  ? 7.236   29.853 -29.055 1.00 48.50  ? 80  TYR D CE1   1 
ATOM   2706  C  CE2   . TYR D 4 53  ? 7.859   27.660 -29.770 1.00 48.78  ? 80  TYR D CE2   1 
ATOM   2707  C  CZ    . TYR D 4 53  ? 7.981   29.030 -29.877 1.00 49.59  ? 80  TYR D CZ    1 
ATOM   2708  O  OH    . TYR D 4 53  ? 8.854   29.566 -30.790 1.00 51.36  ? 80  TYR D OH    1 
ATOM   2709  N  N     . ASN D 4 54  ? 4.097   26.505 -24.268 1.00 47.32  ? 81  ASN D N     1 
ATOM   2710  C  CA    . ASN D 4 54  ? 3.118   25.705 -23.558 1.00 47.73  ? 81  ASN D CA    1 
ATOM   2711  C  C     . ASN D 4 54  ? 2.844   26.221 -22.141 1.00 47.86  ? 81  ASN D C     1 
ATOM   2712  O  O     . ASN D 4 54  ? 2.516   25.437 -21.251 1.00 48.32  ? 81  ASN D O     1 
ATOM   2713  C  CB    . ASN D 4 54  ? 3.530   24.223 -23.582 1.00 49.01  ? 81  ASN D CB    1 
ATOM   2714  C  CG    . ASN D 4 54  ? 3.865   23.703 -24.974 1.00 51.50  ? 81  ASN D CG    1 
ATOM   2715  O  OD1   . ASN D 4 54  ? 3.043   23.722 -25.906 1.00 52.15  ? 81  ASN D OD1   1 
ATOM   2716  N  ND2   . ASN D 4 54  ? 5.088   23.232 -25.151 1.00 52.00  ? 81  ASN D ND2   1 
ATOM   2717  N  N     . LYS D 4 55  ? 2.969   27.544 -21.939 1.00 47.55  ? 82  LYS D N     1 
ATOM   2718  C  CA    . LYS D 4 55  ? 2.732   28.236 -20.673 1.00 48.01  ? 82  LYS D CA    1 
ATOM   2719  C  C     . LYS D 4 55  ? 3.300   27.505 -19.447 1.00 49.06  ? 82  LYS D C     1 
ATOM   2720  O  O     . LYS D 4 55  ? 2.658   27.461 -18.404 1.00 49.52  ? 82  LYS D O     1 
ATOM   2721  C  CB    . LYS D 4 55  ? 1.232   28.526 -20.495 1.00 48.83  ? 82  LYS D CB    1 
ATOM   2722  C  CG    . LYS D 4 55  ? 0.615   29.397 -21.582 1.00 50.77  ? 82  LYS D CG    1 
ATOM   2723  C  CD    . LYS D 4 55  ? -0.899  29.253 -21.584 1.00 53.32  ? 82  LYS D CD    1 
ATOM   2724  C  CE    . LYS D 4 55  ? -1.575  30.208 -22.518 1.00 55.80  ? 82  LYS D CE    1 
ATOM   2725  N  NZ    . LYS D 4 55  ? -2.200  31.332 -21.771 1.00 57.22  ? 82  LYS D NZ    1 
ATOM   2726  N  N     . ARG D 4 56  ? 4.483   26.908 -19.581 1.00 49.36  ? 83  ARG D N     1 
ATOM   2727  C  CA    . ARG D 4 56  ? 5.118   26.187 -18.488 1.00 50.26  ? 83  ARG D CA    1 
ATOM   2728  C  C     . ARG D 4 56  ? 6.311   26.958 -17.929 1.00 50.72  ? 83  ARG D C     1 
ATOM   2729  O  O     . ARG D 4 56  ? 7.038   27.600 -18.685 1.00 50.99  ? 83  ARG D O     1 
ATOM   2730  C  CB    . ARG D 4 56  ? 5.537   24.806 -18.958 1.00 52.45  ? 83  ARG D CB    1 
ATOM   2731  C  CG    . ARG D 4 56  ? 4.373   23.833 -19.026 1.00 57.48  ? 83  ARG D CG    1 
ATOM   2732  C  CD    . ARG D 4 56  ? 4.845   22.416 -19.285 1.00 62.78  ? 83  ARG D CD    1 
ATOM   2733  N  NE    . ARG D 4 56  ? 5.411   21.764 -18.098 1.00 67.10  ? 83  ARG D NE    1 
ATOM   2734  C  CZ    . ARG D 4 56  ? 6.714   21.667 -17.840 1.00 69.89  ? 83  ARG D CZ    1 
ATOM   2735  N  NH1   . ARG D 4 56  ? 7.605   22.198 -18.671 1.00 68.95  ? 83  ARG D NH1   1 
ATOM   2736  N  NH2   . ARG D 4 56  ? 7.135   21.038 -16.748 1.00 70.27  ? 83  ARG D NH2   1 
ATOM   2737  N  N     . SER D 4 57  ? 6.506   26.919 -16.606 1.00 50.67  ? 84  SER D N     1 
ATOM   2738  C  CA    . SER D 4 57  ? 7.584   27.666 -15.958 1.00 51.00  ? 84  SER D CA    1 
ATOM   2739  C  C     . SER D 4 57  ? 8.858   26.839 -15.680 1.00 51.01  ? 84  SER D C     1 
ATOM   2740  O  O     . SER D 4 57  ? 9.726   27.298 -14.938 1.00 51.21  ? 84  SER D O     1 
ATOM   2741  C  CB    . SER D 4 57  ? 7.073   28.310 -14.669 1.00 52.34  ? 84  SER D CB    1 
ATOM   2742  O  OG    . SER D 4 57  ? 7.326   29.706 -14.637 1.00 55.03  ? 84  SER D OG    1 
ATOM   2743  N  N     . THR D 4 58  ? 8.985   25.638 -16.271 1.00 50.66  ? 85  THR D N     1 
ATOM   2744  C  CA    . THR D 4 58  ? 10.161  24.790 -16.020 1.00 50.86  ? 85  THR D CA    1 
ATOM   2745  C  C     . THR D 4 58  ? 10.678  24.082 -17.278 1.00 50.36  ? 85  THR D C     1 
ATOM   2746  O  O     . THR D 4 58  ? 9.882   23.520 -18.034 1.00 50.62  ? 85  THR D O     1 
ATOM   2747  C  CB    . THR D 4 58  ? 9.851   23.711 -14.946 1.00 52.50  ? 85  THR D CB    1 
ATOM   2748  O  OG1   . THR D 4 58  ? 9.054   24.239 -13.885 1.00 53.90  ? 85  THR D OG1   1 
ATOM   2749  C  CG2   . THR D 4 58  ? 11.103  23.042 -14.390 1.00 52.69  ? 85  THR D CG2   1 
ATOM   2750  N  N     . ILE D 4 59  ? 12.011  24.064 -17.481 1.00 49.37  ? 86  ILE D N     1 
ATOM   2751  C  CA    . ILE D 4 59  ? 12.611  23.322 -18.591 1.00 48.88  ? 86  ILE D CA    1 
ATOM   2752  C  C     . ILE D 4 59  ? 12.907  21.928 -18.057 1.00 49.13  ? 86  ILE D C     1 
ATOM   2753  O  O     . ILE D 4 59  ? 13.867  21.770 -17.310 1.00 49.83  ? 86  ILE D O     1 
ATOM   2754  C  CB    . ILE D 4 59  ? 13.909  23.974 -19.149 1.00 48.51  ? 86  ILE D CB    1 
ATOM   2755  C  CG1   . ILE D 4 59  ? 13.576  25.215 -19.976 1.00 49.31  ? 86  ILE D CG1   1 
ATOM   2756  C  CG2   . ILE D 4 59  ? 14.724  22.977 -20.000 1.00 48.50  ? 86  ILE D CG2   1 
ATOM   2757  C  CD1   . ILE D 4 59  ? 14.776  25.997 -20.399 1.00 50.34  ? 86  ILE D CD1   1 
ATOM   2758  N  N     . THR D 4 60  ? 12.100  20.929 -18.413 1.00 48.17  ? 87  THR D N     1 
ATOM   2759  C  CA    . THR D 4 60  ? 12.353  19.553 -17.983 1.00 47.78  ? 87  THR D CA    1 
ATOM   2760  C  C     . THR D 4 60  ? 13.043  18.770 -19.121 1.00 46.64  ? 87  THR D C     1 
ATOM   2761  O  O     . THR D 4 60  ? 13.168  19.290 -20.229 1.00 46.96  ? 87  THR D O     1 
ATOM   2762  C  CB    . THR D 4 60  ? 11.043  18.912 -17.516 1.00 49.70  ? 87  THR D CB    1 
ATOM   2763  O  OG1   . THR D 4 60  ? 10.184  18.715 -18.643 1.00 51.24  ? 87  THR D OG1   1 
ATOM   2764  C  CG2   . THR D 4 60  ? 10.342  19.740 -16.453 1.00 50.22  ? 87  THR D CG2   1 
ATOM   2765  N  N     . SER D 4 61  ? 13.498  17.536 -18.865 1.00 45.26  ? 88  SER D N     1 
ATOM   2766  C  CA    . SER D 4 61  ? 14.126  16.714 -19.908 1.00 44.19  ? 88  SER D CA    1 
ATOM   2767  C  C     . SER D 4 61  ? 13.196  16.446 -21.128 1.00 42.48  ? 88  SER D C     1 
ATOM   2768  O  O     . SER D 4 61  ? 13.667  16.050 -22.184 1.00 42.17  ? 88  SER D O     1 
ATOM   2769  C  CB    . SER D 4 61  ? 14.671  15.414 -19.321 1.00 45.67  ? 88  SER D CB    1 
ATOM   2770  O  OG    . SER D 4 61  ? 13.749  14.827 -18.416 1.00 48.11  ? 88  SER D OG    1 
ATOM   2771  N  N     . ARG D 4 62  ? 11.896  16.690 -20.984 1.00 41.17  ? 89  ARG D N     1 
ATOM   2772  C  CA    . ARG D 4 62  ? 10.931  16.544 -22.068 1.00 40.81  ? 89  ARG D CA    1 
ATOM   2773  C  C     . ARG D 4 62  ? 11.101  17.711 -23.087 1.00 40.55  ? 89  ARG D C     1 
ATOM   2774  O  O     . ARG D 4 62  ? 10.895  17.535 -24.295 1.00 41.13  ? 89  ARG D O     1 
ATOM   2775  C  CB    . ARG D 4 62  ? 9.516   16.528 -21.470 1.00 41.73  ? 89  ARG D CB    1 
ATOM   2776  C  CG    . ARG D 4 62  ? 8.417   16.600 -22.501 1.00 43.88  ? 89  ARG D CG    1 
ATOM   2777  C  CD    . ARG D 4 62  ? 7.116   16.095 -21.959 1.00 46.64  ? 89  ARG D CD    1 
ATOM   2778  N  NE    . ARG D 4 62  ? 6.400   15.328 -22.979 1.00 48.76  ? 89  ARG D NE    1 
ATOM   2779  C  CZ    . ARG D 4 62  ? 5.447   15.825 -23.758 1.00 50.06  ? 89  ARG D CZ    1 
ATOM   2780  N  NH1   . ARG D 4 62  ? 5.080   17.097 -23.640 1.00 49.48  ? 89  ARG D NH1   1 
ATOM   2781  N  NH2   . ARG D 4 62  ? 4.842   15.052 -24.649 1.00 49.34  ? 89  ARG D NH2   1 
ATOM   2782  N  N     . GLU D 4 63  ? 11.462  18.902 -22.590 1.00 39.28  ? 90  GLU D N     1 
ATOM   2783  C  CA    . GLU D 4 63  ? 11.729  20.081 -23.399 1.00 38.39  ? 90  GLU D CA    1 
ATOM   2784  C  C     . GLU D 4 63  ? 13.078  19.877 -24.123 1.00 37.33  ? 90  GLU D C     1 
ATOM   2785  O  O     . GLU D 4 63  ? 13.184  20.165 -25.314 1.00 37.65  ? 90  GLU D O     1 
ATOM   2786  C  CB    . GLU D 4 63  ? 11.771  21.330 -22.509 1.00 40.32  ? 90  GLU D CB    1 
ATOM   2787  C  CG    . GLU D 4 63  ? 10.413  21.956 -22.258 1.00 45.00  ? 90  GLU D CG    1 
ATOM   2788  C  CD    . GLU D 4 63  ? 9.410   21.156 -21.452 1.00 51.20  ? 90  GLU D CD    1 
ATOM   2789  O  OE1   . GLU D 4 63  ? 8.269   20.988 -21.933 1.00 51.06  ? 90  GLU D OE1   1 
ATOM   2790  O  OE2   . GLU D 4 63  ? 9.734   20.766 -20.310 1.00 54.74  ? 90  GLU D OE2   1 
ATOM   2791  N  N     . ILE D 4 64  ? 14.098  19.326 -23.421 1.00 35.63  ? 91  ILE D N     1 
ATOM   2792  C  CA    . ILE D 4 64  ? 15.401  19.009 -24.018 1.00 34.34  ? 91  ILE D CA    1 
ATOM   2793  C  C     . ILE D 4 64  ? 15.190  17.981 -25.124 1.00 33.46  ? 91  ILE D C     1 
ATOM   2794  O  O     . ILE D 4 64  ? 15.711  18.142 -26.216 1.00 33.32  ? 91  ILE D O     1 
ATOM   2795  C  CB    . ILE D 4 64  ? 16.396  18.473 -22.957 1.00 34.46  ? 91  ILE D CB    1 
ATOM   2796  C  CG1   . ILE D 4 64  ? 16.636  19.481 -21.819 1.00 35.60  ? 91  ILE D CG1   1 
ATOM   2797  C  CG2   . ILE D 4 64  ? 17.705  18.050 -23.593 1.00 34.62  ? 91  ILE D CG2   1 
ATOM   2798  C  CD1   . ILE D 4 64  ? 17.435  20.738 -22.202 1.00 37.10  ? 91  ILE D CD1   1 
ATOM   2799  N  N     . GLN D 4 65  ? 14.350  16.971 -24.842 1.00 33.21  ? 92  GLN D N     1 
ATOM   2800  C  CA    . GLN D 4 65  ? 13.955  15.876 -25.724 1.00 33.64  ? 92  GLN D CA    1 
ATOM   2801  C  C     . GLN D 4 65  ? 13.502  16.406 -27.086 1.00 33.45  ? 92  GLN D C     1 
ATOM   2802  O  O     . GLN D 4 65  ? 14.076  16.042 -28.109 1.00 34.05  ? 92  GLN D O     1 
ATOM   2803  C  CB    . GLN D 4 65  ? 12.773  15.088 -25.088 1.00 35.68  ? 92  GLN D CB    1 
ATOM   2804  C  CG    . GLN D 4 65  ? 13.034  13.647 -24.652 1.00 39.76  ? 92  GLN D CG    1 
ATOM   2805  C  CD    . GLN D 4 65  ? 12.709  12.579 -25.666 1.00 43.01  ? 92  GLN D CD    1 
ATOM   2806  O  OE1   . GLN D 4 65  ? 11.715  12.630 -26.408 1.00 44.56  ? 92  GLN D OE1   1 
ATOM   2807  N  NE2   . GLN D 4 65  ? 13.549  11.571 -25.690 1.00 43.10  ? 92  GLN D NE2   1 
ATOM   2808  N  N     . THR D 4 66  ? 12.456  17.241 -27.099 1.00 32.34  ? 93  THR D N     1 
ATOM   2809  C  CA    . THR D 4 66  ? 11.863  17.736 -28.330 1.00 32.02  ? 93  THR D CA    1 
ATOM   2810  C  C     . THR D 4 66  ? 12.737  18.774 -28.995 1.00 31.91  ? 93  THR D C     1 
ATOM   2811  O  O     . THR D 4 66  ? 12.728  18.844 -30.216 1.00 32.03  ? 93  THR D O     1 
ATOM   2812  C  CB    . THR D 4 66  ? 10.412  18.186 -28.142 1.00 33.11  ? 93  THR D CB    1 
ATOM   2813  O  OG1   . THR D 4 66  ? 10.234  18.713 -26.832 1.00 33.68  ? 93  THR D OG1   1 
ATOM   2814  C  CG2   . THR D 4 66  ? 9.418   17.033 -28.361 1.00 33.87  ? 93  THR D CG2   1 
ATOM   2815  N  N     . ALA D 4 67  ? 13.555  19.516 -28.230 1.00 31.67  ? 94  ALA D N     1 
ATOM   2816  C  CA    . ALA D 4 67  ? 14.498  20.475 -28.793 1.00 31.87  ? 94  ALA D CA    1 
ATOM   2817  C  C     . ALA D 4 67  ? 15.533  19.726 -29.637 1.00 32.10  ? 94  ALA D C     1 
ATOM   2818  O  O     . ALA D 4 67  ? 15.821  20.152 -30.745 1.00 32.22  ? 94  ALA D O     1 
ATOM   2819  C  CB    . ALA D 4 67  ? 15.192  21.241 -27.678 1.00 32.01  ? 94  ALA D CB    1 
ATOM   2820  N  N     . VAL D 4 68  ? 16.028  18.580 -29.147 1.00 31.96  ? 95  VAL D N     1 
ATOM   2821  C  CA    . VAL D 4 68  ? 17.003  17.751 -29.844 1.00 32.47  ? 95  VAL D CA    1 
ATOM   2822  C  C     . VAL D 4 68  ? 16.374  17.140 -31.104 1.00 33.52  ? 95  VAL D C     1 
ATOM   2823  O  O     . VAL D 4 68  ? 17.012  17.097 -32.145 1.00 33.74  ? 95  VAL D O     1 
ATOM   2824  C  CB    . VAL D 4 68  ? 17.620  16.699 -28.881 1.00 32.42  ? 95  VAL D CB    1 
ATOM   2825  C  CG1   . VAL D 4 68  ? 18.329  15.592 -29.641 1.00 32.50  ? 95  VAL D CG1   1 
ATOM   2826  C  CG2   . VAL D 4 68  ? 18.574  17.366 -27.893 1.00 32.54  ? 95  VAL D CG2   1 
ATOM   2827  N  N     . ARG D 4 69  ? 15.105  16.729 -31.026 1.00 34.00  ? 96  ARG D N     1 
ATOM   2828  C  CA    . ARG D 4 69  ? 14.360  16.200 -32.176 1.00 34.56  ? 96  ARG D CA    1 
ATOM   2829  C  C     . ARG D 4 69  ? 14.239  17.295 -33.279 1.00 32.72  ? 96  ARG D C     1 
ATOM   2830  O  O     . ARG D 4 69  ? 14.330  16.997 -34.476 1.00 33.10  ? 96  ARG D O     1 
ATOM   2831  C  CB    . ARG D 4 69  ? 12.941  15.738 -31.743 1.00 38.06  ? 96  ARG D CB    1 
ATOM   2832  C  CG    . ARG D 4 69  ? 12.889  14.398 -31.015 1.00 46.19  ? 96  ARG D CG    1 
ATOM   2833  C  CD    . ARG D 4 69  ? 11.650  13.573 -31.388 1.00 54.93  ? 96  ARG D CD    1 
ATOM   2834  N  NE    . ARG D 4 69  ? 10.393  14.262 -31.055 1.00 62.92  ? 96  ARG D NE    1 
ATOM   2835  C  CZ    . ARG D 4 69  ? 9.196   13.970 -31.577 1.00 67.29  ? 96  ARG D CZ    1 
ATOM   2836  N  NH1   . ARG D 4 69  ? 9.076   13.004 -32.485 1.00 67.45  ? 96  ARG D NH1   1 
ATOM   2837  N  NH2   . ARG D 4 69  ? 8.115   14.649 -31.201 1.00 67.65  ? 96  ARG D NH2   1 
ATOM   2838  N  N     . LEU D 4 70  ? 14.065  18.559 -32.865 1.00 30.20  ? 97  LEU D N     1 
ATOM   2839  C  CA    . LEU D 4 70  ? 13.917  19.661 -33.809 1.00 28.39  ? 97  LEU D CA    1 
ATOM   2840  C  C     . LEU D 4 70  ? 15.253  20.100 -34.390 1.00 28.42  ? 97  LEU D C     1 
ATOM   2841  O  O     . LEU D 4 70  ? 15.345  20.417 -35.572 1.00 28.11  ? 97  LEU D O     1 
ATOM   2842  C  CB    . LEU D 4 70  ? 13.248  20.867 -33.122 1.00 26.67  ? 97  LEU D CB    1 
ATOM   2843  C  CG    . LEU D 4 70  ? 11.788  20.714 -32.770 1.00 25.30  ? 97  LEU D CG    1 
ATOM   2844  C  CD1   . LEU D 4 70  ? 11.348  21.798 -31.831 1.00 25.17  ? 97  LEU D CD1   1 
ATOM   2845  C  CD2   . LEU D 4 70  ? 10.929  20.670 -34.009 1.00 24.88  ? 97  LEU D CD2   1 
ATOM   2846  N  N     . LEU D 4 71  ? 16.280  20.129 -33.545 1.00 28.54  ? 98  LEU D N     1 
ATOM   2847  C  CA    . LEU D 4 71  ? 17.578  20.657 -33.900 1.00 29.10  ? 98  LEU D CA    1 
ATOM   2848  C  C     . LEU D 4 71  ? 18.518  19.686 -34.548 1.00 29.05  ? 98  LEU D C     1 
ATOM   2849  O  O     . LEU D 4 71  ? 19.213  20.077 -35.489 1.00 29.18  ? 98  LEU D O     1 
ATOM   2850  C  CB    . LEU D 4 71  ? 18.240  21.294 -32.675 1.00 29.73  ? 98  LEU D CB    1 
ATOM   2851  C  CG    . LEU D 4 71  ? 17.580  22.608 -32.229 1.00 31.96  ? 98  LEU D CG    1 
ATOM   2852  C  CD1   . LEU D 4 71  ? 17.664  22.799 -30.744 1.00 32.60  ? 98  LEU D CD1   1 
ATOM   2853  C  CD2   . LEU D 4 71  ? 18.123  23.814 -33.006 1.00 32.45  ? 98  LEU D CD2   1 
ATOM   2854  N  N     . LEU D 4 72  ? 18.551  18.448 -34.045 1.00 28.82  ? 99  LEU D N     1 
ATOM   2855  C  CA    . LEU D 4 72  ? 19.453  17.398 -34.592 1.00 28.96  ? 99  LEU D CA    1 
ATOM   2856  C  C     . LEU D 4 72  ? 18.725  16.620 -35.694 1.00 30.05  ? 99  LEU D C     1 
ATOM   2857  O  O     . LEU D 4 72  ? 17.479  16.654 -35.718 1.00 29.32  ? 99  LEU D O     1 
ATOM   2858  C  CB    . LEU D 4 72  ? 19.881  16.468 -33.452 1.00 28.05  ? 99  LEU D CB    1 
ATOM   2859  C  CG    . LEU D 4 72  ? 20.806  17.093 -32.408 1.00 28.06  ? 99  LEU D CG    1 
ATOM   2860  C  CD1   . LEU D 4 72  ? 21.579  16.020 -31.657 1.00 27.98  ? 99  LEU D CD1   1 
ATOM   2861  C  CD2   . LEU D 4 72  ? 21.761  18.085 -33.054 1.00 28.61  ? 99  LEU D CD2   1 
ATOM   2862  N  N     . PRO D 4 73  ? 19.447  15.925 -36.602 1.00 31.59  ? 100 PRO D N     1 
ATOM   2863  C  CA    . PRO D 4 73  ? 18.825  15.151 -37.682 1.00 33.21  ? 100 PRO D CA    1 
ATOM   2864  C  C     . PRO D 4 73  ? 18.207  13.841 -37.170 1.00 36.17  ? 100 PRO D C     1 
ATOM   2865  O  O     . PRO D 4 73  ? 18.524  13.432 -36.066 1.00 37.00  ? 100 PRO D O     1 
ATOM   2866  C  CB    . PRO D 4 73  ? 19.989  14.822 -38.632 1.00 33.14  ? 100 PRO D CB    1 
ATOM   2867  C  CG    . PRO D 4 73  ? 21.145  15.677 -38.149 1.00 33.02  ? 100 PRO D CG    1 
ATOM   2868  C  CD    . PRO D 4 73  ? 20.905  15.866 -36.666 1.00 31.17  ? 100 PRO D CD    1 
ATOM   2869  N  N     . GLY D 4 74  ? 17.355  13.216 -37.992 1.00 37.28  ? 101 GLY D N     1 
ATOM   2870  C  CA    . GLY D 4 74  ? 16.690  11.949 -37.628 1.00 38.17  ? 101 GLY D CA    1 
ATOM   2871  C  C     . GLY D 4 74  ? 17.675  10.925 -37.090 1.00 38.81  ? 101 GLY D C     1 
ATOM   2872  O  O     . GLY D 4 74  ? 17.400  10.349 -36.019 1.00 39.20  ? 101 GLY D O     1 
ATOM   2873  N  N     . GLU D 4 75  ? 18.782  10.707 -37.808 1.00 38.62  ? 102 GLU D N     1 
ATOM   2874  C  CA    . GLU D 4 75  ? 19.820  9.731  -37.380 1.00 38.61  ? 102 GLU D CA    1 
ATOM   2875  C  C     . GLU D 4 75  ? 20.499  10.244 -36.105 1.00 38.24  ? 102 GLU D C     1 
ATOM   2876  O  O     . GLU D 4 75  ? 20.261  9.656  -35.031 1.00 38.52  ? 102 GLU D O     1 
ATOM   2877  C  CB    . GLU D 4 75  ? 20.843  9.516  -38.498 1.00 40.93  ? 102 GLU D CB    1 
ATOM   2878  C  CG    . GLU D 4 75  ? 20.915  8.079  -38.983 1.00 45.39  ? 102 GLU D CG    1 
ATOM   2879  C  CD    . GLU D 4 75  ? 19.911  7.143  -38.334 1.00 50.77  ? 102 GLU D CD    1 
ATOM   2880  O  OE1   . GLU D 4 75  ? 18.734  7.161  -38.748 1.00 51.05  ? 102 GLU D OE1   1 
ATOM   2881  O  OE2   . GLU D 4 75  ? 20.307  6.398  -37.416 1.00 52.98  ? 102 GLU D OE2   1 
ATOM   2882  N  N     . LEU D 4 76  ? 21.309  11.300 -36.230 1.00 37.81  ? 103 LEU D N     1 
ATOM   2883  C  CA    . LEU D 4 76  ? 22.015  11.883 -35.084 1.00 38.17  ? 103 LEU D CA    1 
ATOM   2884  C  C     . LEU D 4 76  ? 21.036  12.170 -33.952 1.00 38.11  ? 103 LEU D C     1 
ATOM   2885  O  O     . LEU D 4 76  ? 21.316  11.840 -32.808 1.00 38.18  ? 103 LEU D O     1 
ATOM   2886  C  CB    . LEU D 4 76  ? 22.734  13.177 -35.494 1.00 38.67  ? 103 LEU D CB    1 
ATOM   2887  C  CG    . LEU D 4 76  ? 24.260  13.190 -35.389 1.00 40.57  ? 103 LEU D CG    1 
ATOM   2888  C  CD1   . LEU D 4 76  ? 24.897  12.013 -36.180 1.00 41.62  ? 103 LEU D CD1   1 
ATOM   2889  C  CD2   . LEU D 4 76  ? 24.821  14.536 -35.856 1.00 41.09  ? 103 LEU D CD2   1 
ATOM   2890  N  N     . ALA D 4 77  ? 19.848  12.671 -34.304 1.00 37.87  ? 104 ALA D N     1 
ATOM   2891  C  CA    . ALA D 4 77  ? 18.761  12.951 -33.374 1.00 38.54  ? 104 ALA D CA    1 
ATOM   2892  C  C     . ALA D 4 77  ? 18.223  11.680 -32.724 1.00 39.09  ? 104 ALA D C     1 
ATOM   2893  O  O     . ALA D 4 77  ? 17.797  11.709 -31.580 1.00 39.07  ? 104 ALA D O     1 
ATOM   2894  C  CB    . ALA D 4 77  ? 17.631  13.654 -34.108 1.00 38.68  ? 104 ALA D CB    1 
ATOM   2895  N  N     . LYS D 4 78  ? 18.173  10.596 -33.479 1.00 39.44  ? 105 LYS D N     1 
ATOM   2896  C  CA    . LYS D 4 78  ? 17.695  9.317  -33.003 1.00 40.73  ? 105 LYS D CA    1 
ATOM   2897  C  C     . LYS D 4 78  ? 18.658  8.778  -31.953 1.00 41.19  ? 105 LYS D C     1 
ATOM   2898  O  O     . LYS D 4 78  ? 18.225  8.318  -30.899 1.00 41.19  ? 105 LYS D O     1 
ATOM   2899  C  CB    . LYS D 4 78  ? 17.575  8.344  -34.187 1.00 43.72  ? 105 LYS D CB    1 
ATOM   2900  C  CG    . LYS D 4 78  ? 16.778  7.104  -33.885 1.00 49.70  ? 105 LYS D CG    1 
ATOM   2901  C  CD    . LYS D 4 78  ? 16.903  6.057  -35.015 1.00 55.65  ? 105 LYS D CD    1 
ATOM   2902  C  CE    . LYS D 4 78  ? 17.760  4.874  -34.596 1.00 59.38  ? 105 LYS D CE    1 
ATOM   2903  N  NZ    . LYS D 4 78  ? 17.908  3.869  -35.686 1.00 61.24  ? 105 LYS D NZ    1 
ATOM   2904  N  N     . HIS D 4 79  ? 19.961  8.885  -32.213 1.00 41.55  ? 106 HIS D N     1 
ATOM   2905  C  CA    . HIS D 4 79  ? 20.968  8.399  -31.287 1.00 42.51  ? 106 HIS D CA    1 
ATOM   2906  C  C     . HIS D 4 79  ? 21.158  9.326  -30.072 1.00 42.48  ? 106 HIS D C     1 
ATOM   2907  O  O     . HIS D 4 79  ? 21.516  8.854  -28.998 1.00 42.72  ? 106 HIS D O     1 
ATOM   2908  C  CB    . HIS D 4 79  ? 22.293  8.110  -32.014 1.00 44.40  ? 106 HIS D CB    1 
ATOM   2909  C  CG    . HIS D 4 79  ? 22.199  7.081  -33.110 1.00 48.27  ? 106 HIS D CG    1 
ATOM   2910  N  ND1   . HIS D 4 79  ? 22.687  7.334  -34.386 1.00 50.45  ? 106 HIS D ND1   1 
ATOM   2911  C  CD2   . HIS D 4 79  ? 21.687  5.826  -33.084 1.00 49.93  ? 106 HIS D CD2   1 
ATOM   2912  C  CE1   . HIS D 4 79  ? 22.444  6.238  -35.091 1.00 51.12  ? 106 HIS D CE1   1 
ATOM   2913  N  NE2   . HIS D 4 79  ? 21.844  5.302  -34.352 1.00 51.20  ? 106 HIS D NE2   1 
ATOM   2914  N  N     . ALA D 4 80  ? 20.886  10.624 -30.220 1.00 42.13  ? 107 ALA D N     1 
ATOM   2915  C  CA    . ALA D 4 80  ? 21.001  11.570 -29.108 1.00 42.27  ? 107 ALA D CA    1 
ATOM   2916  C  C     . ALA D 4 80  ? 19.817  11.411 -28.152 1.00 42.37  ? 107 ALA D C     1 
ATOM   2917  O  O     . ALA D 4 80  ? 19.991  11.456 -26.943 1.00 42.08  ? 107 ALA D O     1 
ATOM   2918  C  CB    . ALA D 4 80  ? 21.067  12.992 -29.629 1.00 42.41  ? 107 ALA D CB    1 
ATOM   2919  N  N     . VAL D 4 81  ? 18.613  11.218 -28.700 1.00 42.75  ? 108 VAL D N     1 
ATOM   2920  C  CA    . VAL D 4 81  ? 17.395  10.964 -27.927 1.00 43.22  ? 108 VAL D CA    1 
ATOM   2921  C  C     . VAL D 4 81  ? 17.547  9.635  -27.140 1.00 43.66  ? 108 VAL D C     1 
ATOM   2922  O  O     . VAL D 4 81  ? 17.089  9.529  -25.996 1.00 43.81  ? 108 VAL D O     1 
ATOM   2923  C  CB    . VAL D 4 81  ? 16.141  11.007 -28.847 1.00 43.53  ? 108 VAL D CB    1 
ATOM   2924  C  CG1   . VAL D 4 81  ? 14.970  10.220 -28.274 1.00 44.08  ? 108 VAL D CG1   1 
ATOM   2925  C  CG2   . VAL D 4 81  ? 15.732  12.438 -29.140 1.00 43.53  ? 108 VAL D CG2   1 
ATOM   2926  N  N     . SER D 4 82  ? 18.243  8.656  -27.739 1.00 43.74  ? 109 SER D N     1 
ATOM   2927  C  CA    . SER D 4 82  ? 18.554  7.382  -27.112 1.00 44.57  ? 109 SER D CA    1 
ATOM   2928  C  C     . SER D 4 82  ? 19.526  7.631  -25.949 1.00 44.87  ? 109 SER D C     1 
ATOM   2929  O  O     . SER D 4 82  ? 19.133  7.467  -24.800 1.00 45.03  ? 109 SER D O     1 
ATOM   2930  C  CB    . SER D 4 82  ? 19.126  6.402  -28.145 1.00 46.08  ? 109 SER D CB    1 
ATOM   2931  O  OG    . SER D 4 82  ? 20.075  5.481  -27.626 1.00 48.22  ? 109 SER D OG    1 
ATOM   2932  N  N     . GLU D 4 83  ? 20.766  8.068  -26.220 1.00 44.76  ? 110 GLU D N     1 
ATOM   2933  C  CA    . GLU D 4 83  ? 21.752  8.313  -25.166 1.00 44.97  ? 110 GLU D CA    1 
ATOM   2934  C  C     . GLU D 4 83  ? 21.247  9.247  -24.058 1.00 44.02  ? 110 GLU D C     1 
ATOM   2935  O  O     . GLU D 4 83  ? 21.646  9.119  -22.906 1.00 43.51  ? 110 GLU D O     1 
ATOM   2936  C  CB    . GLU D 4 83  ? 23.068  8.811  -25.775 1.00 48.47  ? 110 GLU D CB    1 
ATOM   2937  C  CG    . GLU D 4 83  ? 24.258  7.938  -25.422 1.00 56.71  ? 110 GLU D CG    1 
ATOM   2938  C  CD    . GLU D 4 83  ? 25.024  8.438  -24.210 1.00 68.00  ? 110 GLU D CD    1 
ATOM   2939  O  OE1   . GLU D 4 83  ? 25.593  9.554  -24.292 1.00 70.68  ? 110 GLU D OE1   1 
ATOM   2940  O  OE2   . GLU D 4 83  ? 25.053  7.722  -23.181 1.00 70.98  ? 110 GLU D OE2   1 
ATOM   2941  N  N     . GLY D 4 84  ? 20.337  10.137 -24.415 1.00 43.93  ? 111 GLY D N     1 
ATOM   2942  C  CA    . GLY D 4 84  ? 19.753  11.066 -23.469 1.00 44.44  ? 111 GLY D CA    1 
ATOM   2943  C  C     . GLY D 4 84  ? 18.840  10.391 -22.476 1.00 45.07  ? 111 GLY D C     1 
ATOM   2944  O  O     . GLY D 4 84  ? 19.073  10.495 -21.273 1.00 45.13  ? 111 GLY D O     1 
ATOM   2945  N  N     . THR D 4 85  ? 17.784  9.708  -22.963 1.00 45.63  ? 112 THR D N     1 
ATOM   2946  C  CA    . THR D 4 85  ? 16.841  9.000  -22.081 1.00 47.03  ? 112 THR D CA    1 
ATOM   2947  C  C     . THR D 4 85  ? 17.549  7.923  -21.233 1.00 47.86  ? 112 THR D C     1 
ATOM   2948  O  O     . THR D 4 85  ? 17.158  7.673  -20.096 1.00 47.56  ? 112 THR D O     1 
ATOM   2949  C  CB    . THR D 4 85  ? 15.652  8.415  -22.863 1.00 48.91  ? 112 THR D CB    1 
ATOM   2950  O  OG1   . THR D 4 85  ? 16.119  7.816  -24.065 1.00 50.45  ? 112 THR D OG1   1 
ATOM   2951  C  CG2   . THR D 4 85  ? 14.602  9.445  -23.199 1.00 49.28  ? 112 THR D CG2   1 
ATOM   2952  N  N     . LYS D 4 86  ? 18.612  7.326  -21.793 1.00 48.59  ? 113 LYS D N     1 
ATOM   2953  C  CA    . LYS D 4 86  ? 19.465  6.339  -21.164 1.00 49.89  ? 113 LYS D CA    1 
ATOM   2954  C  C     . LYS D 4 86  ? 20.134  6.954  -19.940 1.00 51.32  ? 113 LYS D C     1 
ATOM   2955  O  O     . LYS D 4 86  ? 19.920  6.457  -18.844 1.00 51.64  ? 113 LYS D O     1 
ATOM   2956  C  CB    . LYS D 4 86  ? 20.498  5.840  -22.196 1.00 51.97  ? 113 LYS D CB    1 
ATOM   2957  C  CG    . LYS D 4 86  ? 21.694  5.059  -21.661 1.00 56.11  ? 113 LYS D CG    1 
ATOM   2958  C  CD    . LYS D 4 86  ? 22.649  4.718  -22.822 1.00 60.92  ? 113 LYS D CD    1 
ATOM   2959  C  CE    . LYS D 4 86  ? 24.012  4.200  -22.395 1.00 65.77  ? 113 LYS D CE    1 
ATOM   2960  N  NZ    . LYS D 4 86  ? 25.153  4.986  -22.975 1.00 68.82  ? 113 LYS D NZ    1 
ATOM   2961  N  N     . ALA D 4 87  ? 20.882  8.064  -20.102 1.00 52.05  ? 114 ALA D N     1 
ATOM   2962  C  CA    . ALA D 4 87  ? 21.570  8.735  -19.000 1.00 53.28  ? 114 ALA D CA    1 
ATOM   2963  C  C     . ALA D 4 87  ? 20.591  9.194  -17.911 1.00 54.44  ? 114 ALA D C     1 
ATOM   2964  O  O     . ALA D 4 87  ? 20.912  9.120  -16.731 1.00 54.14  ? 114 ALA D O     1 
ATOM   2965  C  CB    . ALA D 4 87  ? 22.368  9.908  -19.530 1.00 53.29  ? 114 ALA D CB    1 
ATOM   2966  N  N     . VAL D 4 88  ? 19.391  9.631  -18.308 1.00 56.08  ? 115 VAL D N     1 
ATOM   2967  C  CA    . VAL D 4 88  ? 18.346  10.062 -17.380 1.00 58.16  ? 115 VAL D CA    1 
ATOM   2968  C  C     . VAL D 4 88  ? 17.885  8.868  -16.548 1.00 60.28  ? 115 VAL D C     1 
ATOM   2969  O  O     . VAL D 4 88  ? 17.882  8.943  -15.319 1.00 60.53  ? 115 VAL D O     1 
ATOM   2970  C  CB    . VAL D 4 88  ? 17.184  10.788 -18.131 1.00 58.87  ? 115 VAL D CB    1 
ATOM   2971  C  CG1   . VAL D 4 88  ? 15.847  10.691 -17.392 1.00 59.26  ? 115 VAL D CG1   1 
ATOM   2972  C  CG2   . VAL D 4 88  ? 17.547  12.242 -18.391 1.00 59.39  ? 115 VAL D CG2   1 
ATOM   2973  N  N     . THR D 4 89  ? 17.552  7.755  -17.218 1.00 61.67  ? 116 THR D N     1 
ATOM   2974  C  CA    . THR D 4 89  ? 17.123  6.502  -16.591 1.00 63.49  ? 116 THR D CA    1 
ATOM   2975  C  C     . THR D 4 89  ? 18.154  6.033  -15.557 1.00 65.09  ? 116 THR D C     1 
ATOM   2976  O  O     . THR D 4 89  ? 17.798  5.838  -14.401 1.00 65.13  ? 116 THR D O     1 
ATOM   2977  C  CB    . THR D 4 89  ? 16.855  5.462  -17.689 1.00 64.89  ? 116 THR D CB    1 
ATOM   2978  O  OG1   . THR D 4 89  ? 15.608  5.768  -18.314 1.00 66.28  ? 116 THR D OG1   1 
ATOM   2979  C  CG2   . THR D 4 89  ? 16.845  4.042  -17.173 1.00 65.10  ? 116 THR D CG2   1 
ATOM   2980  N  N     . LYS D 4 90  ? 19.436  5.958  -15.958 1.00 66.28  ? 117 LYS D N     1 
ATOM   2981  C  CA    . LYS D 4 90  ? 20.559  5.563  -15.114 1.00 68.00  ? 117 LYS D CA    1 
ATOM   2982  C  C     . LYS D 4 90  ? 20.711  6.472  -13.889 1.00 70.42  ? 117 LYS D C     1 
ATOM   2983  O  O     . LYS D 4 90  ? 21.049  5.993  -12.810 1.00 70.74  ? 117 LYS D O     1 
ATOM   2984  C  CB    . LYS D 4 90  ? 21.848  5.544  -15.944 1.00 69.25  ? 117 LYS D CB    1 
ATOM   2985  C  CG    . LYS D 4 90  ? 23.066  5.062  -15.182 1.00 73.06  ? 117 LYS D CG    1 
ATOM   2986  C  CD    . LYS D 4 90  ? 24.175  4.629  -16.126 1.00 77.50  ? 117 LYS D CD    1 
ATOM   2987  C  CE    . LYS D 4 90  ? 25.334  4.014  -15.383 1.00 81.39  ? 117 LYS D CE    1 
ATOM   2988  N  NZ    . LYS D 4 90  ? 25.926  4.963  -14.404 1.00 83.90  ? 117 LYS D NZ    1 
ATOM   2989  N  N     . TYR D 4 91  ? 20.447  7.774  -14.051 1.00 72.12  ? 118 TYR D N     1 
ATOM   2990  C  CA    . TYR D 4 91  ? 20.526  8.772  -12.983 1.00 74.13  ? 118 TYR D CA    1 
ATOM   2991  C  C     . TYR D 4 91  ? 19.408  8.557  -11.954 1.00 76.16  ? 118 TYR D C     1 
ATOM   2992  O  O     . TYR D 4 91  ? 19.636  8.735  -10.758 1.00 76.15  ? 118 TYR D O     1 
ATOM   2993  C  CB    . TYR D 4 91  ? 20.461  10.192 -13.582 1.00 74.18  ? 118 TYR D CB    1 
ATOM   2994  C  CG    . TYR D 4 91  ? 20.549  11.314 -12.569 1.00 74.88  ? 118 TYR D CG    1 
ATOM   2995  C  CD1   . TYR D 4 91  ? 21.778  11.751 -12.088 1.00 75.78  ? 118 TYR D CD1   1 
ATOM   2996  C  CD2   . TYR D 4 91  ? 19.406  11.980 -12.136 1.00 75.70  ? 118 TYR D CD2   1 
ATOM   2997  C  CE1   . TYR D 4 91  ? 21.866  12.796 -11.173 1.00 76.61  ? 118 TYR D CE1   1 
ATOM   2998  C  CE2   . TYR D 4 91  ? 19.480  13.012 -11.207 1.00 76.50  ? 118 TYR D CE2   1 
ATOM   2999  C  CZ    . TYR D 4 91  ? 20.714  13.428 -10.738 1.00 77.38  ? 118 TYR D CZ    1 
ATOM   3000  O  OH    . TYR D 4 91  ? 20.789  14.467 -9.843  1.00 78.63  ? 118 TYR D OH    1 
ATOM   3001  N  N     . THR D 4 92  ? 18.201  8.191  -12.426 1.00 77.77  ? 119 THR D N     1 
ATOM   3002  C  CA    . THR D 4 92  ? 17.036  7.917  -11.572 1.00 79.96  ? 119 THR D CA    1 
ATOM   3003  C  C     . THR D 4 92  ? 17.269  6.641  -10.727 1.00 81.94  ? 119 THR D C     1 
ATOM   3004  O  O     . THR D 4 92  ? 16.812  6.557  -9.582  1.00 82.18  ? 119 THR D O     1 
ATOM   3005  C  CB    . THR D 4 92  ? 15.755  7.829  -12.432 1.00 81.56  ? 119 THR D CB    1 
ATOM   3006  O  OG1   . THR D 4 92  ? 15.660  8.986  -13.263 1.00 82.70  ? 119 THR D OG1   1 
ATOM   3007  C  CG2   . THR D 4 92  ? 14.489  7.698  -11.597 1.00 82.00  ? 119 THR D CG2   1 
ATOM   3008  N  N     . SER D 4 93  ? 18.006  5.666  -11.292 1.00 83.10  ? 120 SER D N     1 
ATOM   3009  C  CA    . SER D 4 93  ? 18.359  4.430  -10.612 1.00 84.63  ? 120 SER D CA    1 
ATOM   3010  C  C     . SER D 4 93  ? 19.291  4.730  -9.429  1.00 86.00  ? 120 SER D C     1 
ATOM   3011  O  O     . SER D 4 93  ? 19.002  4.325  -8.303  1.00 86.48  ? 120 SER D O     1 
ATOM   3012  C  CB    . SER D 4 93  ? 19.022  3.458  -11.590 1.00 86.06  ? 120 SER D CB    1 
ATOM   3013  O  OG    . SER D 4 93  ? 18.127  3.036  -12.606 1.00 88.36  ? 120 SER D OG    1 
ATOM   3014  N  N     . ALA D 4 94  ? 20.374  5.474  -9.671  1.00 86.45  ? 121 ALA D N     1 
ATOM   3015  C  CA    . ALA D 4 94  ? 21.321  5.809  -8.618  1.00 87.46  ? 121 ALA D CA    1 
ATOM   3016  C  C     . ALA D 4 94  ? 21.007  7.144  -7.935  1.00 88.58  ? 121 ALA D C     1 
ATOM   3017  O  O     . ALA D 4 94  ? 20.896  8.174  -8.603  1.00 88.96  ? 121 ALA D O     1 
ATOM   3018  C  CB    . ALA D 4 94  ? 22.731  5.835  -9.187  1.00 87.58  ? 121 ALA D CB    1 
ATOM   3019  N  N     . LYS D 4 95  ? 20.914  7.141  -6.605  1.00 89.00  ? 122 LYS D N     1 
ATOM   3020  C  CA    . LYS D 4 95  ? 20.683  8.372  -5.851  1.00 89.89  ? 122 LYS D CA    1 
ATOM   3021  C  C     . LYS D 4 95  ? 22.039  8.936  -5.354  1.00 90.49  ? 122 LYS D C     1 
ATOM   3022  O  O     . LYS D 4 95  ? 22.364  10.100 -5.691  1.00 90.63  ? 122 LYS D O     1 
ATOM   3023  C  CB    . LYS D 4 95  ? 19.700  8.114  -4.693  1.00 91.70  ? 122 LYS D CB    1 
ATOM   3024  C  CG    . LYS D 4 95  ? 19.344  9.343  -3.862  1.00 95.22  ? 122 LYS D CG    1 
ATOM   3025  C  CD    . LYS D 4 95  ? 18.253  9.006  -2.851  1.00 98.92  ? 122 LYS D CD    1 
ATOM   3026  C  CE    . LYS D 4 95  ? 18.151  9.995  -1.721  1.00 102.10 ? 122 LYS D CE    1 
ATOM   3027  N  NZ    . LYS D 4 95  ? 17.310  9.455  -0.623  1.00 104.21 ? 122 LYS D NZ    1 
ATOM   3028  O  OXT   . LYS D 4 95  ? 22.791  8.200  -4.668  1.00 91.80  ? 122 LYS D OXT   1 
ATOM   3029  N  N     . ARG E 1 1   ? 56.618  24.338 -71.523 1.00 112.33 ? 40  ARG E N     1 
ATOM   3030  C  CA    . ARG E 1 1   ? 55.490  25.251 -71.323 1.00 112.84 ? 40  ARG E CA    1 
ATOM   3031  C  C     . ARG E 1 1   ? 54.147  24.508 -71.213 1.00 112.84 ? 40  ARG E C     1 
ATOM   3032  O  O     . ARG E 1 1   ? 53.737  23.823 -72.154 1.00 112.93 ? 40  ARG E O     1 
ATOM   3033  C  CB    . ARG E 1 1   ? 55.437  26.289 -72.441 1.00 114.37 ? 40  ARG E CB    1 
ATOM   3034  C  CG    . ARG E 1 1   ? 54.357  27.337 -72.245 1.00 117.58 ? 40  ARG E CG    1 
ATOM   3035  C  CD    . ARG E 1 1   ? 54.511  28.428 -73.279 1.00 120.79 ? 40  ARG E CD    1 
ATOM   3036  N  NE    . ARG E 1 1   ? 53.959  29.690 -72.808 1.00 123.66 ? 40  ARG E NE    1 
ATOM   3037  C  CZ    . ARG E 1 1   ? 53.828  30.782 -73.559 1.00 126.03 ? 40  ARG E CZ    1 
ATOM   3038  N  NH1   . ARG E 1 1   ? 54.223  30.777 -74.829 1.00 125.66 ? 40  ARG E NH1   1 
ATOM   3039  N  NH2   . ARG E 1 1   ? 53.307  31.888 -73.048 1.00 126.03 ? 40  ARG E NH2   1 
ATOM   3040  N  N     . TYR E 1 2   ? 53.463  24.656 -70.058 1.00 112.39 ? 41  TYR E N     1 
ATOM   3041  C  CA    . TYR E 1 2   ? 52.179  24.011 -69.775 1.00 112.30 ? 41  TYR E CA    1 
ATOM   3042  C  C     . TYR E 1 2   ? 51.009  24.637 -70.529 1.00 112.03 ? 41  TYR E C     1 
ATOM   3043  O  O     . TYR E 1 2   ? 50.960  25.852 -70.709 1.00 112.02 ? 41  TYR E O     1 
ATOM   3044  C  CB    . TYR E 1 2   ? 51.880  24.039 -68.269 1.00 112.41 ? 41  TYR E CB    1 
ATOM   3045  C  CG    . TYR E 1 2   ? 52.792  23.171 -67.431 1.00 113.30 ? 41  TYR E CG    1 
ATOM   3046  C  CD1   . TYR E 1 2   ? 52.624  21.795 -67.385 1.00 114.28 ? 41  TYR E CD1   1 
ATOM   3047  C  CD2   . TYR E 1 2   ? 53.774  23.734 -66.630 1.00 114.25 ? 41  TYR E CD2   1 
ATOM   3048  C  CE1   . TYR E 1 2   ? 53.443  20.995 -66.603 1.00 115.27 ? 41  TYR E CE1   1 
ATOM   3049  C  CE2   . TYR E 1 2   ? 54.594  22.945 -65.836 1.00 115.24 ? 41  TYR E CE2   1 
ATOM   3050  C  CZ    . TYR E 1 2   ? 54.427  21.573 -65.827 1.00 116.31 ? 41  TYR E CZ    1 
ATOM   3051  O  OH    . TYR E 1 2   ? 55.233  20.768 -65.060 1.00 118.13 ? 41  TYR E OH    1 
ATOM   3052  N  N     . ARG E 1 3   ? 50.037  23.801 -70.917 1.00 111.67 ? 42  ARG E N     1 
ATOM   3053  C  CA    . ARG E 1 3   ? 48.826  24.211 -71.632 1.00 111.86 ? 42  ARG E CA    1 
ATOM   3054  C  C     . ARG E 1 3   ? 47.908  25.075 -70.741 1.00 111.39 ? 42  ARG E C     1 
ATOM   3055  O  O     . ARG E 1 3   ? 47.992  25.011 -69.508 1.00 111.64 ? 42  ARG E O     1 
ATOM   3056  C  CB    . ARG E 1 3   ? 48.064  22.961 -72.126 1.00 113.72 ? 42  ARG E CB    1 
ATOM   3057  C  CG    . ARG E 1 3   ? 48.906  22.027 -72.978 1.00 117.64 ? 42  ARG E CG    1 
ATOM   3058  C  CD    . ARG E 1 3   ? 48.106  20.832 -73.453 1.00 121.50 ? 42  ARG E CD    1 
ATOM   3059  N  NE    . ARG E 1 3   ? 47.024  21.229 -74.356 1.00 124.79 ? 42  ARG E NE    1 
ATOM   3060  C  CZ    . ARG E 1 3   ? 46.106  20.398 -74.838 1.00 127.16 ? 42  ARG E CZ    1 
ATOM   3061  N  NH1   . ARG E 1 3   ? 46.120  19.113 -74.502 1.00 126.78 ? 42  ARG E NH1   1 
ATOM   3062  N  NH2   . ARG E 1 3   ? 45.159  20.847 -75.652 1.00 127.18 ? 42  ARG E NH2   1 
ATOM   3063  N  N     . PRO E 1 4   ? 47.013  25.885 -71.345 1.00 110.49 ? 43  PRO E N     1 
ATOM   3064  C  CA    . PRO E 1 4   ? 46.115  26.720 -70.530 1.00 109.80 ? 43  PRO E CA    1 
ATOM   3065  C  C     . PRO E 1 4   ? 45.107  25.913 -69.708 1.00 108.75 ? 43  PRO E C     1 
ATOM   3066  O  O     . PRO E 1 4   ? 44.180  25.304 -70.246 1.00 108.85 ? 43  PRO E O     1 
ATOM   3067  C  CB    . PRO E 1 4   ? 45.421  27.618 -71.565 1.00 110.63 ? 43  PRO E CB    1 
ATOM   3068  C  CG    . PRO E 1 4   ? 46.248  27.498 -72.811 1.00 111.25 ? 43  PRO E CG    1 
ATOM   3069  C  CD    . PRO E 1 4   ? 46.792  26.110 -72.784 1.00 109.83 ? 43  PRO E CD    1 
ATOM   3070  N  N     . GLY E 1 5   ? 45.314  25.917 -68.400 1.00 107.48 ? 44  GLY E N     1 
ATOM   3071  C  CA    . GLY E 1 5   ? 44.464  25.189 -67.476 1.00 106.74 ? 44  GLY E CA    1 
ATOM   3072  C  C     . GLY E 1 5   ? 45.120  23.928 -66.962 1.00 105.70 ? 44  GLY E C     1 
ATOM   3073  O  O     . GLY E 1 5   ? 44.447  22.932 -66.714 1.00 105.91 ? 44  GLY E O     1 
ATOM   3074  N  N     . THR E 1 6   ? 46.440  23.953 -66.809 1.00 104.49 ? 45  THR E N     1 
ATOM   3075  C  CA    . THR E 1 6   ? 47.200  22.810 -66.292 1.00 103.97 ? 45  THR E CA    1 
ATOM   3076  C  C     . THR E 1 6   ? 47.915  23.162 -64.983 1.00 102.62 ? 45  THR E C     1 
ATOM   3077  O  O     . THR E 1 6   ? 48.022  22.341 -64.063 1.00 102.71 ? 45  THR E O     1 
ATOM   3078  C  CB    . THR E 1 6   ? 48.114  22.280 -67.368 1.00 105.85 ? 45  THR E CB    1 
ATOM   3079  O  OG1   . THR E 1 6   ? 47.294  21.811 -68.440 1.00 107.03 ? 45  THR E OG1   1 
ATOM   3080  C  CG2   . THR E 1 6   ? 49.024  21.168 -66.870 1.00 106.49 ? 45  THR E CG2   1 
ATOM   3081  N  N     . VAL E 1 7   ? 48.406  24.394 -64.906 1.00 101.20 ? 46  VAL E N     1 
ATOM   3082  C  CA    . VAL E 1 7   ? 48.960  24.930 -63.670 1.00 100.32 ? 46  VAL E CA    1 
ATOM   3083  C  C     . VAL E 1 7   ? 47.751  25.368 -62.780 1.00 98.92  ? 46  VAL E C     1 
ATOM   3084  O  O     . VAL E 1 7   ? 47.824  25.246 -61.560 1.00 98.92  ? 46  VAL E O     1 
ATOM   3085  C  CB    . VAL E 1 7   ? 49.952  26.091 -63.932 1.00 101.18 ? 46  VAL E CB    1 
ATOM   3086  C  CG1   . VAL E 1 7   ? 50.673  26.498 -62.650 1.00 101.80 ? 46  VAL E CG1   1 
ATOM   3087  C  CG2   . VAL E 1 7   ? 50.959  25.713 -65.017 1.00 101.68 ? 46  VAL E CG2   1 
ATOM   3088  N  N     . ALA E 1 8   ? 46.622  25.817 -63.405 1.00 97.46  ? 47  ALA E N     1 
ATOM   3089  C  CA    . ALA E 1 8   ? 45.383  26.206 -62.738 1.00 96.28  ? 47  ALA E CA    1 
ATOM   3090  C  C     . ALA E 1 8   ? 44.836  25.011 -61.963 1.00 94.58  ? 47  ALA E C     1 
ATOM   3091  O  O     . ALA E 1 8   ? 44.522  25.161 -60.789 1.00 94.97  ? 47  ALA E O     1 
ATOM   3092  C  CB    . ALA E 1 8   ? 44.356  26.698 -63.760 1.00 96.45  ? 47  ALA E CB    1 
ATOM   3093  N  N     . LEU E 1 9   ? 44.794  23.816 -62.581 1.00 92.55  ? 48  LEU E N     1 
ATOM   3094  C  CA    . LEU E 1 9   ? 44.322  22.611 -61.905 1.00 91.08  ? 48  LEU E CA    1 
ATOM   3095  C  C     . LEU E 1 9   ? 45.269  22.153 -60.813 1.00 89.81  ? 48  LEU E C     1 
ATOM   3096  O  O     . LEU E 1 9   ? 44.815  21.645 -59.798 1.00 89.85  ? 48  LEU E O     1 
ATOM   3097  C  CB    . LEU E 1 9   ? 44.039  21.497 -62.906 1.00 90.86  ? 48  LEU E CB    1 
ATOM   3098  C  CG    . LEU E 1 9   ? 42.816  21.742 -63.768 1.00 92.05  ? 48  LEU E CG    1 
ATOM   3099  C  CD1   . LEU E 1 9   ? 42.722  20.725 -64.854 1.00 92.53  ? 48  LEU E CD1   1 
ATOM   3100  C  CD2   . LEU E 1 9   ? 41.563  21.718 -62.944 1.00 92.81  ? 48  LEU E CD2   1 
ATOM   3101  N  N     . ARG E 1 10  ? 46.569  22.373 -60.989 1.00 88.70  ? 49  ARG E N     1 
ATOM   3102  C  CA    . ARG E 1 10  ? 47.557  22.021 -59.976 1.00 88.28  ? 49  ARG E CA    1 
ATOM   3103  C  C     . ARG E 1 10  ? 47.408  22.940 -58.752 1.00 86.97  ? 49  ARG E C     1 
ATOM   3104  O  O     . ARG E 1 10  ? 47.506  22.482 -57.613 1.00 87.03  ? 49  ARG E O     1 
ATOM   3105  C  CB    . ARG E 1 10  ? 48.970  22.124 -60.573 1.00 90.36  ? 49  ARG E CB    1 
ATOM   3106  C  CG    . ARG E 1 10  ? 50.091  21.611 -59.662 1.00 94.16  ? 49  ARG E CG    1 
ATOM   3107  C  CD    . ARG E 1 10  ? 51.314  21.120 -60.453 1.00 97.16  ? 49  ARG E CD    1 
ATOM   3108  N  NE    . ARG E 1 10  ? 52.076  22.210 -61.068 1.00 99.38  ? 49  ARG E NE    1 
ATOM   3109  C  CZ    . ARG E 1 10  ? 52.054  22.509 -62.365 1.00 101.01 ? 49  ARG E CZ    1 
ATOM   3110  N  NH1   . ARG E 1 10  ? 51.310  21.797 -63.206 1.00 100.23 ? 49  ARG E NH1   1 
ATOM   3111  N  NH2   . ARG E 1 10  ? 52.767  23.526 -62.828 1.00 100.85 ? 49  ARG E NH2   1 
ATOM   3112  N  N     . GLU E 1 11  ? 47.146  24.232 -59.001 1.00 85.83  ? 50  GLU E N     1 
ATOM   3113  C  CA    . GLU E 1 11  ? 46.934  25.261 -57.978 1.00 85.36  ? 50  GLU E CA    1 
ATOM   3114  C  C     . GLU E 1 11  ? 45.700  24.916 -57.122 1.00 84.19  ? 50  GLU E C     1 
ATOM   3115  O  O     . GLU E 1 11  ? 45.794  24.908 -55.895 1.00 84.44  ? 50  GLU E O     1 
ATOM   3116  C  CB    . GLU E 1 11  ? 46.769  26.654 -58.629 1.00 87.93  ? 50  GLU E CB    1 
ATOM   3117  C  CG    . GLU E 1 11  ? 48.065  27.361 -58.999 1.00 93.52  ? 50  GLU E CG    1 
ATOM   3118  C  CD    . GLU E 1 11  ? 47.897  28.777 -59.520 1.00 101.25 ? 50  GLU E CD    1 
ATOM   3119  O  OE1   . GLU E 1 11  ? 48.142  29.002 -60.728 1.00 102.90 ? 50  GLU E OE1   1 
ATOM   3120  O  OE2   . GLU E 1 11  ? 47.524  29.664 -58.718 1.00 103.73 ? 50  GLU E OE2   1 
ATOM   3121  N  N     . ILE E 1 12  ? 44.564  24.562 -57.766 1.00 82.68  ? 51  ILE E N     1 
ATOM   3122  C  CA    . ILE E 1 12  ? 43.324  24.166 -57.089 1.00 81.62  ? 51  ILE E CA    1 
ATOM   3123  C  C     . ILE E 1 12  ? 43.584  23.052 -56.066 1.00 81.12  ? 51  ILE E C     1 
ATOM   3124  O  O     . ILE E 1 12  ? 43.247  23.212 -54.900 1.00 81.29  ? 51  ILE E O     1 
ATOM   3125  C  CB    . ILE E 1 12  ? 42.252  23.763 -58.126 1.00 81.42  ? 51  ILE E CB    1 
ATOM   3126  C  CG1   . ILE E 1 12  ? 41.798  24.978 -58.925 1.00 82.23  ? 51  ILE E CG1   1 
ATOM   3127  C  CG2   . ILE E 1 12  ? 41.070  23.088 -57.468 1.00 81.59  ? 51  ILE E CG2   1 
ATOM   3128  C  CD1   . ILE E 1 12  ? 40.982  24.625 -60.118 1.00 83.47  ? 51  ILE E CD1   1 
ATOM   3129  N  N     . ARG E 1 13  ? 44.258  21.972 -56.483 1.00 80.31  ? 52  ARG E N     1 
ATOM   3130  C  CA    . ARG E 1 13  ? 44.577  20.871 -55.582 1.00 79.98  ? 52  ARG E CA    1 
ATOM   3131  C  C     . ARG E 1 13  ? 45.543  21.317 -54.489 1.00 79.75  ? 52  ARG E C     1 
ATOM   3132  O  O     . ARG E 1 13  ? 45.394  20.915 -53.344 1.00 79.80  ? 52  ARG E O     1 
ATOM   3133  C  CB    . ARG E 1 13  ? 45.176  19.693 -56.355 1.00 81.15  ? 52  ARG E CB    1 
ATOM   3134  C  CG    . ARG E 1 13  ? 44.392  19.291 -57.586 1.00 83.99  ? 52  ARG E CG    1 
ATOM   3135  C  CD    . ARG E 1 13  ? 44.702  17.860 -58.030 1.00 86.91  ? 52  ARG E CD    1 
ATOM   3136  N  NE    . ARG E 1 13  ? 44.932  17.692 -59.473 1.00 89.73  ? 52  ARG E NE    1 
ATOM   3137  C  CZ    . ARG E 1 13  ? 43.978  17.709 -60.399 1.00 92.24  ? 52  ARG E CZ    1 
ATOM   3138  N  NH1   . ARG E 1 13  ? 42.712  17.898 -60.052 1.00 92.59  ? 52  ARG E NH1   1 
ATOM   3139  N  NH2   . ARG E 1 13  ? 44.283  17.545 -61.682 1.00 92.04  ? 52  ARG E NH2   1 
ATOM   3140  N  N     . ARG E 1 14  ? 46.517  22.157 -54.836 1.00 79.55  ? 53  ARG E N     1 
ATOM   3141  C  CA    . ARG E 1 14  ? 47.513  22.657 -53.892 1.00 80.08  ? 53  ARG E CA    1 
ATOM   3142  C  C     . ARG E 1 14  ? 46.875  23.407 -52.720 1.00 79.88  ? 53  ARG E C     1 
ATOM   3143  O  O     . ARG E 1 14  ? 47.297  23.255 -51.568 1.00 79.69  ? 53  ARG E O     1 
ATOM   3144  C  CB    . ARG E 1 14  ? 48.515  23.569 -54.631 1.00 82.06  ? 53  ARG E CB    1 
ATOM   3145  C  CG    . ARG E 1 14  ? 49.472  24.340 -53.724 1.00 85.94  ? 53  ARG E CG    1 
ATOM   3146  C  CD    . ARG E 1 14  ? 50.281  25.348 -54.506 1.00 89.91  ? 53  ARG E CD    1 
ATOM   3147  N  NE    . ARG E 1 14  ? 51.020  26.245 -53.618 1.00 93.62  ? 53  ARG E NE    1 
ATOM   3148  C  CZ    . ARG E 1 14  ? 51.885  27.167 -54.032 1.00 96.91  ? 53  ARG E CZ    1 
ATOM   3149  N  NH1   . ARG E 1 14  ? 52.131  27.324 -55.330 1.00 96.93  ? 53  ARG E NH1   1 
ATOM   3150  N  NH2   . ARG E 1 14  ? 52.506  27.945 -53.154 1.00 97.39  ? 53  ARG E NH2   1 
ATOM   3151  N  N     . TYR E 1 15  ? 45.869  24.227 -53.027 1.00 79.67  ? 54  TYR E N     1 
ATOM   3152  C  CA    . TYR E 1 15  ? 45.213  25.059 -52.036 1.00 79.73  ? 54  TYR E CA    1 
ATOM   3153  C  C     . TYR E 1 15  ? 44.057  24.380 -51.321 1.00 78.85  ? 54  TYR E C     1 
ATOM   3154  O  O     . TYR E 1 15  ? 43.921  24.562 -50.112 1.00 79.18  ? 54  TYR E O     1 
ATOM   3155  C  CB    . TYR E 1 15  ? 44.789  26.389 -52.663 1.00 80.32  ? 54  TYR E CB    1 
ATOM   3156  C  CG    . TYR E 1 15  ? 45.991  27.262 -52.905 1.00 81.92  ? 54  TYR E CG    1 
ATOM   3157  C  CD1   . TYR E 1 15  ? 46.797  27.667 -51.852 1.00 83.25  ? 54  TYR E CD1   1 
ATOM   3158  C  CD2   . TYR E 1 15  ? 46.377  27.605 -54.194 1.00 83.22  ? 54  TYR E CD2   1 
ATOM   3159  C  CE1   . TYR E 1 15  ? 47.930  28.437 -52.065 1.00 84.44  ? 54  TYR E CE1   1 
ATOM   3160  C  CE2   . TYR E 1 15  ? 47.518  28.363 -54.425 1.00 84.45  ? 54  TYR E CE2   1 
ATOM   3161  C  CZ    . TYR E 1 15  ? 48.291  28.784 -53.352 1.00 85.53  ? 54  TYR E CZ    1 
ATOM   3162  O  OH    . TYR E 1 15  ? 49.420  29.548 -53.538 1.00 87.18  ? 54  TYR E OH    1 
ATOM   3163  N  N     . GLN E 1 16  ? 43.241  23.575 -52.030 1.00 77.56  ? 55  GLN E N     1 
ATOM   3164  C  CA    . GLN E 1 16  ? 42.119  22.878 -51.394 1.00 76.87  ? 55  GLN E CA    1 
ATOM   3165  C  C     . GLN E 1 16  ? 42.602  21.952 -50.299 1.00 76.65  ? 55  GLN E C     1 
ATOM   3166  O  O     . GLN E 1 16  ? 42.083  21.982 -49.190 1.00 76.79  ? 55  GLN E O     1 
ATOM   3167  C  CB    . GLN E 1 16  ? 41.290  22.105 -52.418 1.00 77.44  ? 55  GLN E CB    1 
ATOM   3168  C  CG    . GLN E 1 16  ? 40.565  23.029 -53.350 1.00 79.56  ? 55  GLN E CG    1 
ATOM   3169  C  CD    . GLN E 1 16  ? 39.541  22.294 -54.144 1.00 82.96  ? 55  GLN E CD    1 
ATOM   3170  O  OE1   . GLN E 1 16  ? 39.779  21.189 -54.642 1.00 83.97  ? 55  GLN E OE1   1 
ATOM   3171  N  NE2   . GLN E 1 16  ? 38.371  22.895 -54.274 1.00 83.45  ? 55  GLN E NE2   1 
ATOM   3172  N  N     . LYS E 1 17  ? 43.672  21.225 -50.572 1.00 76.17  ? 56  LYS E N     1 
ATOM   3173  C  CA    . LYS E 1 17  ? 44.286  20.312 -49.625 1.00 76.06  ? 56  LYS E CA    1 
ATOM   3174  C  C     . LYS E 1 17  ? 45.286  21.077 -48.735 1.00 75.58  ? 56  LYS E C     1 
ATOM   3175  O  O     . LYS E 1 17  ? 46.377  20.587 -48.454 1.00 75.72  ? 56  LYS E O     1 
ATOM   3176  C  CB    . LYS E 1 17  ? 44.969  19.181 -50.407 1.00 77.95  ? 56  LYS E CB    1 
ATOM   3177  C  CG    . LYS E 1 17  ? 44.026  18.546 -51.435 1.00 82.13  ? 56  LYS E CG    1 
ATOM   3178  C  CD    . LYS E 1 17  ? 44.740  17.811 -52.561 1.00 86.53  ? 56  LYS E CD    1 
ATOM   3179  C  CE    . LYS E 1 17  ? 43.794  17.509 -53.699 1.00 89.94  ? 56  LYS E CE    1 
ATOM   3180  N  NZ    . LYS E 1 17  ? 43.256  18.754 -54.313 1.00 91.98  ? 56  LYS E NZ    1 
ATOM   3181  N  N     . SER E 1 18  ? 44.890  22.274 -48.282 1.00 74.85  ? 57  SER E N     1 
ATOM   3182  C  CA    . SER E 1 18  ? 45.700  23.148 -47.438 1.00 74.65  ? 57  SER E CA    1 
ATOM   3183  C  C     . SER E 1 18  ? 44.812  24.080 -46.597 1.00 73.88  ? 57  SER E C     1 
ATOM   3184  O  O     . SER E 1 18  ? 43.657  24.310 -46.958 1.00 73.95  ? 57  SER E O     1 
ATOM   3185  C  CB    . SER E 1 18  ? 46.642  23.974 -48.302 1.00 76.26  ? 57  SER E CB    1 
ATOM   3186  O  OG    . SER E 1 18  ? 47.638  24.564 -47.490 1.00 78.74  ? 57  SER E OG    1 
ATOM   3187  N  N     . THR E 1 19  ? 45.335  24.612 -45.477 1.00 73.06  ? 58  THR E N     1 
ATOM   3188  C  CA    . THR E 1 19  ? 44.538  25.489 -44.615 1.00 73.02  ? 58  THR E CA    1 
ATOM   3189  C  C     . THR E 1 19  ? 45.130  26.859 -44.345 1.00 73.45  ? 58  THR E C     1 
ATOM   3190  O  O     . THR E 1 19  ? 44.474  27.675 -43.702 1.00 73.59  ? 58  THR E O     1 
ATOM   3191  C  CB    . THR E 1 19  ? 44.244  24.832 -43.281 1.00 73.73  ? 58  THR E CB    1 
ATOM   3192  O  OG1   . THR E 1 19  ? 45.461  24.664 -42.566 1.00 74.76  ? 58  THR E OG1   1 
ATOM   3193  C  CG2   . THR E 1 19  ? 43.533  23.527 -43.422 1.00 73.82  ? 58  THR E CG2   1 
ATOM   3194  N  N     . GLU E 1 20  ? 46.369  27.109 -44.773 1.00 73.63  ? 59  GLU E N     1 
ATOM   3195  C  CA    . GLU E 1 20  ? 47.026  28.405 -44.558 1.00 74.13  ? 59  GLU E CA    1 
ATOM   3196  C  C     . GLU E 1 20  ? 46.206  29.573 -45.126 1.00 74.30  ? 59  GLU E C     1 
ATOM   3197  O  O     . GLU E 1 20  ? 45.461  29.376 -46.093 1.00 74.38  ? 59  GLU E O     1 
ATOM   3198  C  CB    . GLU E 1 20  ? 48.474  28.434 -45.130 1.00 76.37  ? 59  GLU E CB    1 
ATOM   3199  C  CG    . GLU E 1 20  ? 48.876  27.318 -46.094 1.00 80.62  ? 59  GLU E CG    1 
ATOM   3200  C  CD    . GLU E 1 20  ? 48.582  27.508 -47.573 1.00 85.31  ? 59  GLU E CD    1 
ATOM   3201  O  OE1   . GLU E 1 20  ? 49.028  26.661 -48.382 1.00 85.58  ? 59  GLU E OE1   1 
ATOM   3202  O  OE2   . GLU E 1 20  ? 47.892  28.489 -47.925 1.00 87.26  ? 59  GLU E OE2   1 
ATOM   3203  N  N     . LEU E 1 21  ? 46.318  30.774 -44.522 1.00 74.00  ? 60  LEU E N     1 
ATOM   3204  C  CA    . LEU E 1 21  ? 45.582  31.924 -45.047 1.00 74.36  ? 60  LEU E CA    1 
ATOM   3205  C  C     . LEU E 1 21  ? 46.187  32.385 -46.391 1.00 74.62  ? 60  LEU E C     1 
ATOM   3206  O  O     . LEU E 1 21  ? 47.374  32.181 -46.644 1.00 74.84  ? 60  LEU E O     1 
ATOM   3207  C  CB    . LEU E 1 21  ? 45.424  33.056 -44.015 1.00 74.50  ? 60  LEU E CB    1 
ATOM   3208  C  CG    . LEU E 1 21  ? 44.533  32.698 -42.814 1.00 75.68  ? 60  LEU E CG    1 
ATOM   3209  C  CD1   . LEU E 1 21  ? 44.678  33.691 -41.705 1.00 76.05  ? 60  LEU E CD1   1 
ATOM   3210  C  CD2   . LEU E 1 21  ? 43.075  32.581 -43.215 1.00 76.37  ? 60  LEU E CD2   1 
ATOM   3211  N  N     . LEU E 1 22  ? 45.350  32.913 -47.280 1.00 74.27  ? 61  LEU E N     1 
ATOM   3212  C  CA    . LEU E 1 22  ? 45.734  33.296 -48.636 1.00 74.38  ? 61  LEU E CA    1 
ATOM   3213  C  C     . LEU E 1 22  ? 45.861  34.821 -48.868 1.00 75.03  ? 61  LEU E C     1 
ATOM   3214  O  O     . LEU E 1 22  ? 46.105  35.262 -49.993 1.00 75.37  ? 61  LEU E O     1 
ATOM   3215  C  CB    . LEU E 1 22  ? 44.751  32.649 -49.631 1.00 74.22  ? 61  LEU E CB    1 
ATOM   3216  C  CG    . LEU E 1 22  ? 44.595  31.133 -49.460 1.00 75.21  ? 61  LEU E CG    1 
ATOM   3217  C  CD1   . LEU E 1 22  ? 43.489  30.579 -50.301 1.00 75.66  ? 61  LEU E CD1   1 
ATOM   3218  C  CD2   . LEU E 1 22  ? 45.859  30.436 -49.779 1.00 75.83  ? 61  LEU E CD2   1 
ATOM   3219  N  N     . ILE E 1 23  ? 45.704  35.621 -47.810 1.00 74.85  ? 62  ILE E N     1 
ATOM   3220  C  CA    . ILE E 1 23  ? 45.868  37.077 -47.845 1.00 74.91  ? 62  ILE E CA    1 
ATOM   3221  C  C     . ILE E 1 23  ? 46.953  37.376 -46.811 1.00 75.14  ? 62  ILE E C     1 
ATOM   3222  O  O     . ILE E 1 23  ? 46.930  36.771 -45.728 1.00 75.41  ? 62  ILE E O     1 
ATOM   3223  C  CB    . ILE E 1 23  ? 44.546  37.810 -47.487 1.00 75.18  ? 62  ILE E CB    1 
ATOM   3224  C  CG1   . ILE E 1 23  ? 43.462  37.577 -48.552 1.00 75.70  ? 62  ILE E CG1   1 
ATOM   3225  C  CG2   . ILE E 1 23  ? 44.789  39.299 -47.259 1.00 75.72  ? 62  ILE E CG2   1 
ATOM   3226  C  CD1   . ILE E 1 23  ? 42.111  38.100 -48.173 1.00 76.61  ? 62  ILE E CD1   1 
ATOM   3227  N  N     . ARG E 1 24  ? 47.920  38.260 -47.133 1.00 74.83  ? 63  ARG E N     1 
ATOM   3228  C  CA    . ARG E 1 24  ? 48.980  38.557 -46.166 1.00 74.87  ? 63  ARG E CA    1 
ATOM   3229  C  C     . ARG E 1 24  ? 48.403  39.318 -44.977 1.00 73.90  ? 63  ARG E C     1 
ATOM   3230  O  O     . ARG E 1 24  ? 47.480  40.119 -45.127 1.00 73.64  ? 63  ARG E O     1 
ATOM   3231  C  CB    . ARG E 1 24  ? 50.232  39.217 -46.779 1.00 76.77  ? 63  ARG E CB    1 
ATOM   3232  C  CG    . ARG E 1 24  ? 51.176  38.236 -47.513 1.00 80.13  ? 63  ARG E CG    1 
ATOM   3233  C  CD    . ARG E 1 24  ? 50.747  37.967 -48.953 1.00 83.82  ? 63  ARG E CD    1 
ATOM   3234  N  NE    . ARG E 1 24  ? 50.635  39.199 -49.747 1.00 87.61  ? 63  ARG E NE    1 
ATOM   3235  C  CZ    . ARG E 1 24  ? 49.483  39.780 -50.084 1.00 90.24  ? 63  ARG E CZ    1 
ATOM   3236  N  NH1   . ARG E 1 24  ? 48.327  39.257 -49.693 1.00 90.40  ? 63  ARG E NH1   1 
ATOM   3237  N  NH2   . ARG E 1 24  ? 49.481  40.903 -50.791 1.00 89.96  ? 63  ARG E NH2   1 
ATOM   3238  N  N     . LYS E 1 25  ? 48.876  38.955 -43.784 1.00 73.04  ? 64  LYS E N     1 
ATOM   3239  C  CA    . LYS E 1 25  ? 48.389  39.466 -42.513 1.00 72.73  ? 64  LYS E CA    1 
ATOM   3240  C  C     . LYS E 1 25  ? 48.460  40.981 -42.365 1.00 72.21  ? 64  LYS E C     1 
ATOM   3241  O  O     . LYS E 1 25  ? 47.543  41.548 -41.778 1.00 72.36  ? 64  LYS E O     1 
ATOM   3242  C  CB    . LYS E 1 25  ? 49.096  38.768 -41.341 1.00 74.36  ? 64  LYS E CB    1 
ATOM   3243  C  CG    . LYS E 1 25  ? 49.016  37.247 -41.419 1.00 78.05  ? 64  LYS E CG    1 
ATOM   3244  C  CD    . LYS E 1 25  ? 49.399  36.581 -40.100 1.00 81.98  ? 64  LYS E CD    1 
ATOM   3245  C  CE    . LYS E 1 25  ? 49.287  35.076 -40.197 1.00 85.12  ? 64  LYS E CE    1 
ATOM   3246  N  NZ    . LYS E 1 25  ? 49.403  34.414 -38.870 1.00 86.66  ? 64  LYS E NZ    1 
ATOM   3247  N  N     . LEU E 1 26  ? 49.511  41.641 -42.886 1.00 71.53  ? 65  LEU E N     1 
ATOM   3248  C  CA    . LEU E 1 26  ? 49.625  43.093 -42.749 1.00 71.41  ? 65  LEU E CA    1 
ATOM   3249  C  C     . LEU E 1 26  ? 48.707  43.893 -43.701 1.00 70.86  ? 65  LEU E C     1 
ATOM   3250  O  O     . LEU E 1 26  ? 47.979  44.751 -43.192 1.00 70.87  ? 65  LEU E O     1 
ATOM   3251  C  CB    . LEU E 1 26  ? 51.067  43.588 -42.838 1.00 71.94  ? 65  LEU E CB    1 
ATOM   3252  C  CG    . LEU E 1 26  ? 51.228  45.079 -42.536 1.00 74.04  ? 65  LEU E CG    1 
ATOM   3253  C  CD1   . LEU E 1 26  ? 50.879  45.399 -41.078 1.00 74.69  ? 65  LEU E CD1   1 
ATOM   3254  C  CD2   . LEU E 1 26  ? 52.604  45.577 -42.932 1.00 74.90  ? 65  LEU E CD2   1 
ATOM   3255  N  N     . PRO E 1 27  ? 48.641  43.639 -45.038 1.00 70.20  ? 66  PRO E N     1 
ATOM   3256  C  CA    . PRO E 1 27  ? 47.693  44.400 -45.883 1.00 69.90  ? 66  PRO E CA    1 
ATOM   3257  C  C     . PRO E 1 27  ? 46.261  44.341 -45.337 1.00 69.74  ? 66  PRO E C     1 
ATOM   3258  O  O     . PRO E 1 27  ? 45.569  45.364 -45.274 1.00 69.66  ? 66  PRO E O     1 
ATOM   3259  C  CB    . PRO E 1 27  ? 47.799  43.712 -47.251 1.00 70.51  ? 66  PRO E CB    1 
ATOM   3260  C  CG    . PRO E 1 27  ? 49.097  43.059 -47.250 1.00 71.01  ? 66  PRO E CG    1 
ATOM   3261  C  CD    . PRO E 1 27  ? 49.400  42.664 -45.840 1.00 69.56  ? 66  PRO E CD    1 
ATOM   3262  N  N     . PHE E 1 28  ? 45.887  43.145 -44.833 1.00 69.48  ? 67  PHE E N     1 
ATOM   3263  C  CA    . PHE E 1 28  ? 44.607  42.826 -44.226 1.00 69.59  ? 67  PHE E CA    1 
ATOM   3264  C  C     . PHE E 1 28  ? 44.411  43.603 -42.933 1.00 69.14  ? 67  PHE E C     1 
ATOM   3265  O  O     . PHE E 1 28  ? 43.370  44.239 -42.756 1.00 69.16  ? 67  PHE E O     1 
ATOM   3266  C  CB    . PHE E 1 28  ? 44.486  41.309 -43.982 1.00 69.72  ? 67  PHE E CB    1 
ATOM   3267  C  CG    . PHE E 1 28  ? 43.046  40.879 -43.883 1.00 70.54  ? 67  PHE E CG    1 
ATOM   3268  C  CD1   . PHE E 1 28  ? 42.327  40.550 -45.019 1.00 71.34  ? 67  PHE E CD1   1 
ATOM   3269  C  CD2   . PHE E 1 28  ? 42.387  40.890 -42.668 1.00 71.42  ? 67  PHE E CD2   1 
ATOM   3270  C  CE1   . PHE E 1 28  ? 40.988  40.211 -44.937 1.00 72.08  ? 67  PHE E CE1   1 
ATOM   3271  C  CE2   . PHE E 1 28  ? 41.046  40.563 -42.591 1.00 72.18  ? 67  PHE E CE2   1 
ATOM   3272  C  CZ    . PHE E 1 28  ? 40.358  40.212 -43.724 1.00 72.00  ? 67  PHE E CZ    1 
ATOM   3273  N  N     . GLN E 1 29  ? 45.414  43.587 -42.047 1.00 68.65  ? 68  GLN E N     1 
ATOM   3274  C  CA    . GLN E 1 29  ? 45.337  44.334 -40.795 1.00 68.74  ? 68  GLN E CA    1 
ATOM   3275  C  C     . GLN E 1 29  ? 45.178  45.844 -41.037 1.00 68.24  ? 68  GLN E C     1 
ATOM   3276  O  O     . GLN E 1 29  ? 44.562  46.536 -40.223 1.00 68.00  ? 68  GLN E O     1 
ATOM   3277  C  CB    . GLN E 1 29  ? 46.557  44.071 -39.907 1.00 70.74  ? 68  GLN E CB    1 
ATOM   3278  C  CG    . GLN E 1 29  ? 46.206  44.180 -38.435 1.00 75.20  ? 68  GLN E CG    1 
ATOM   3279  C  CD    . GLN E 1 29  ? 47.299  44.765 -37.574 1.00 81.08  ? 68  GLN E CD    1 
ATOM   3280  O  OE1   . GLN E 1 29  ? 47.640  45.958 -37.662 1.00 82.70  ? 68  GLN E OE1   1 
ATOM   3281  N  NE2   . GLN E 1 29  ? 47.853  43.932 -36.694 1.00 82.23  ? 68  GLN E NE2   1 
ATOM   3282  N  N     . ARG E 1 30  ? 45.736  46.355 -42.149 1.00 67.76  ? 69  ARG E N     1 
ATOM   3283  C  CA    . ARG E 1 30  ? 45.605  47.765 -42.474 1.00 67.67  ? 69  ARG E CA    1 
ATOM   3284  C  C     . ARG E 1 30  ? 44.168  48.017 -42.894 1.00 66.71  ? 69  ARG E C     1 
ATOM   3285  O  O     . ARG E 1 30  ? 43.534  48.917 -42.347 1.00 67.21  ? 69  ARG E O     1 
ATOM   3286  C  CB    . ARG E 1 30  ? 46.595  48.198 -43.577 1.00 69.59  ? 69  ARG E CB    1 
ATOM   3287  C  CG    . ARG E 1 30  ? 48.018  48.460 -43.073 1.00 73.33  ? 69  ARG E CG    1 
ATOM   3288  C  CD    . ARG E 1 30  ? 48.901  49.107 -44.128 1.00 76.88  ? 69  ARG E CD    1 
ATOM   3289  N  NE    . ARG E 1 30  ? 48.976  48.321 -45.363 1.00 79.90  ? 69  ARG E NE    1 
ATOM   3290  C  CZ    . ARG E 1 30  ? 50.062  47.703 -45.798 1.00 82.16  ? 69  ARG E CZ    1 
ATOM   3291  N  NH1   . ARG E 1 30  ? 51.208  47.815 -45.138 1.00 81.90  ? 69  ARG E NH1   1 
ATOM   3292  N  NH2   . ARG E 1 30  ? 50.024  46.989 -46.913 1.00 82.17  ? 69  ARG E NH2   1 
ATOM   3293  N  N     . LEU E 1 31  ? 43.628  47.173 -43.801 1.00 65.05  ? 70  LEU E N     1 
ATOM   3294  C  CA    . LEU E 1 31  ? 42.251  47.298 -44.279 1.00 63.75  ? 70  LEU E CA    1 
ATOM   3295  C  C     . LEU E 1 31  ? 41.257  47.251 -43.148 1.00 62.71  ? 70  LEU E C     1 
ATOM   3296  O  O     . LEU E 1 31  ? 40.319  48.041 -43.124 1.00 62.51  ? 70  LEU E O     1 
ATOM   3297  C  CB    . LEU E 1 31  ? 41.926  46.226 -45.320 1.00 63.44  ? 70  LEU E CB    1 
ATOM   3298  C  CG    . LEU E 1 31  ? 40.560  46.337 -45.985 1.00 64.25  ? 70  LEU E CG    1 
ATOM   3299  C  CD1   . LEU E 1 31  ? 40.344  47.691 -46.616 1.00 64.44  ? 70  LEU E CD1   1 
ATOM   3300  C  CD2   . LEU E 1 31  ? 40.407  45.294 -47.038 1.00 65.00  ? 70  LEU E CD2   1 
ATOM   3301  N  N     . VAL E 1 32  ? 41.494  46.370 -42.181 1.00 62.15  ? 71  VAL E N     1 
ATOM   3302  C  CA    . VAL E 1 32  ? 40.628  46.253 -41.016 1.00 62.17  ? 71  VAL E CA    1 
ATOM   3303  C  C     . VAL E 1 32  ? 40.646  47.554 -40.197 1.00 62.09  ? 71  VAL E C     1 
ATOM   3304  O  O     . VAL E 1 32  ? 39.587  48.106 -39.916 1.00 62.01  ? 71  VAL E O     1 
ATOM   3305  C  CB    . VAL E 1 32  ? 40.971  44.988 -40.181 1.00 62.60  ? 71  VAL E CB    1 
ATOM   3306  C  CG1   . VAL E 1 32  ? 40.415  45.075 -38.763 1.00 63.11  ? 71  VAL E CG1   1 
ATOM   3307  C  CG2   . VAL E 1 32  ? 40.479  43.726 -40.880 1.00 62.74  ? 71  VAL E CG2   1 
ATOM   3308  N  N     . ARG E 1 33  ? 41.838  48.071 -39.875 1.00 62.06  ? 72  ARG E N     1 
ATOM   3309  C  CA    . ARG E 1 33  ? 41.962  49.295 -39.089 1.00 62.58  ? 72  ARG E CA    1 
ATOM   3310  C  C     . ARG E 1 33  ? 41.419  50.519 -39.817 1.00 63.07  ? 72  ARG E C     1 
ATOM   3311  O  O     . ARG E 1 33  ? 40.865  51.407 -39.166 1.00 63.01  ? 72  ARG E O     1 
ATOM   3312  C  CB    . ARG E 1 33  ? 43.407  49.517 -38.636 1.00 63.85  ? 72  ARG E CB    1 
ATOM   3313  C  CG    . ARG E 1 33  ? 43.929  48.435 -37.707 1.00 66.79  ? 72  ARG E CG    1 
ATOM   3314  C  CD    . ARG E 1 33  ? 45.278  48.827 -37.162 1.00 69.81  ? 72  ARG E CD    1 
ATOM   3315  N  NE    . ARG E 1 33  ? 45.900  47.766 -36.370 1.00 72.66  ? 72  ARG E NE    1 
ATOM   3316  C  CZ    . ARG E 1 33  ? 45.759  47.624 -35.054 1.00 75.02  ? 72  ARG E CZ    1 
ATOM   3317  N  NH1   . ARG E 1 33  ? 44.980  48.453 -34.368 1.00 74.25  ? 72  ARG E NH1   1 
ATOM   3318  N  NH2   . ARG E 1 33  ? 46.390  46.646 -34.416 1.00 75.41  ? 72  ARG E NH2   1 
ATOM   3319  N  N     . GLU E 1 34  ? 41.546  50.545 -41.168 1.00 63.31  ? 73  GLU E N     1 
ATOM   3320  C  CA    . GLU E 1 34  ? 41.032  51.616 -42.025 1.00 63.92  ? 73  GLU E CA    1 
ATOM   3321  C  C     . GLU E 1 34  ? 39.510  51.640 -41.882 1.00 64.60  ? 73  GLU E C     1 
ATOM   3322  O  O     . GLU E 1 34  ? 38.977  52.605 -41.338 1.00 64.66  ? 73  GLU E O     1 
ATOM   3323  C  CB    . GLU E 1 34  ? 41.469  51.421 -43.496 1.00 65.96  ? 73  GLU E CB    1 
ATOM   3324  C  CG    . GLU E 1 34  ? 40.806  52.391 -44.461 1.00 70.82  ? 73  GLU E CG    1 
ATOM   3325  C  CD    . GLU E 1 34  ? 41.004  52.073 -45.930 1.00 77.34  ? 73  GLU E CD    1 
ATOM   3326  O  OE1   . GLU E 1 34  ? 42.124  51.657 -46.308 1.00 78.28  ? 73  GLU E OE1   1 
ATOM   3327  O  OE2   . GLU E 1 34  ? 40.039  52.254 -46.710 1.00 79.62  ? 73  GLU E OE2   1 
ATOM   3328  N  N     . ILE E 1 35  ? 38.825  50.534 -42.266 1.00 64.80  ? 74  ILE E N     1 
ATOM   3329  C  CA    . ILE E 1 35  ? 37.377  50.369 -42.152 1.00 65.28  ? 74  ILE E CA    1 
ATOM   3330  C  C     . ILE E 1 35  ? 36.876  50.699 -40.731 1.00 66.38  ? 74  ILE E C     1 
ATOM   3331  O  O     . ILE E 1 35  ? 35.907  51.437 -40.602 1.00 66.90  ? 74  ILE E O     1 
ATOM   3332  C  CB    . ILE E 1 35  ? 36.958  48.960 -42.641 1.00 65.31  ? 74  ILE E CB    1 
ATOM   3333  C  CG1   . ILE E 1 35  ? 37.172  48.825 -44.152 1.00 65.95  ? 74  ILE E CG1   1 
ATOM   3334  C  CG2   . ILE E 1 35  ? 35.524  48.632 -42.265 1.00 65.83  ? 74  ILE E CG2   1 
ATOM   3335  C  CD1   . ILE E 1 35  ? 37.114  47.422 -44.647 1.00 66.98  ? 74  ILE E CD1   1 
ATOM   3336  N  N     . ALA E 1 36  ? 37.590  50.263 -39.675 1.00 66.50  ? 75  ALA E N     1 
ATOM   3337  C  CA    . ALA E 1 36  ? 37.202  50.554 -38.289 1.00 67.37  ? 75  ALA E CA    1 
ATOM   3338  C  C     . ALA E 1 36  ? 37.153  52.043 -37.948 1.00 68.29  ? 75  ALA E C     1 
ATOM   3339  O  O     . ALA E 1 36  ? 36.215  52.480 -37.274 1.00 68.35  ? 75  ALA E O     1 
ATOM   3340  C  CB    . ALA E 1 36  ? 38.124  49.845 -37.325 1.00 67.40  ? 75  ALA E CB    1 
ATOM   3341  N  N     . GLN E 1 37  ? 38.149  52.822 -38.413 1.00 68.92  ? 76  GLN E N     1 
ATOM   3342  C  CA    . GLN E 1 37  ? 38.213  54.268 -38.173 1.00 70.06  ? 76  GLN E CA    1 
ATOM   3343  C  C     . GLN E 1 37  ? 36.944  54.988 -38.665 1.00 70.36  ? 76  GLN E C     1 
ATOM   3344  O  O     . GLN E 1 37  ? 36.571  56.019 -38.104 1.00 70.46  ? 76  GLN E O     1 
ATOM   3345  C  CB    . GLN E 1 37  ? 39.467  54.872 -38.833 1.00 72.61  ? 76  GLN E CB    1 
ATOM   3346  C  CG    . GLN E 1 37  ? 39.931  56.205 -38.233 1.00 78.02  ? 76  GLN E CG    1 
ATOM   3347  C  CD    . GLN E 1 37  ? 40.934  56.028 -37.109 1.00 84.67  ? 76  GLN E CD    1 
ATOM   3348  O  OE1   . GLN E 1 37  ? 40.603  55.587 -35.995 1.00 87.16  ? 76  GLN E OE1   1 
ATOM   3349  N  NE2   . GLN E 1 37  ? 42.191  56.373 -37.375 1.00 85.54  ? 76  GLN E NE2   1 
ATOM   3350  N  N     . ASP E 1 38  ? 36.266  54.429 -39.691 1.00 70.35  ? 77  ASP E N     1 
ATOM   3351  C  CA    . ASP E 1 38  ? 35.034  55.000 -40.227 1.00 70.68  ? 77  ASP E CA    1 
ATOM   3352  C  C     . ASP E 1 38  ? 33.891  54.905 -39.222 1.00 70.53  ? 77  ASP E C     1 
ATOM   3353  O  O     . ASP E 1 38  ? 33.050  55.792 -39.196 1.00 70.90  ? 77  ASP E O     1 
ATOM   3354  C  CB    . ASP E 1 38  ? 34.642  54.342 -41.563 1.00 72.80  ? 77  ASP E CB    1 
ATOM   3355  C  CG    . ASP E 1 38  ? 35.721  54.421 -42.631 1.00 78.66  ? 77  ASP E CG    1 
ATOM   3356  O  OD1   . ASP E 1 38  ? 36.436  55.456 -42.683 1.00 79.63  ? 77  ASP E OD1   1 
ATOM   3357  O  OD2   . ASP E 1 38  ? 35.850  53.450 -43.422 1.00 81.10  ? 77  ASP E OD2   1 
ATOM   3358  N  N     . PHE E 1 39  ? 33.862  53.863 -38.380 1.00 70.00  ? 78  PHE E N     1 
ATOM   3359  C  CA    . PHE E 1 39  ? 32.795  53.722 -37.388 1.00 70.17  ? 78  PHE E CA    1 
ATOM   3360  C  C     . PHE E 1 39  ? 33.162  54.381 -36.073 1.00 70.42  ? 78  PHE E C     1 
ATOM   3361  O  O     . PHE E 1 39  ? 32.305  54.989 -35.430 1.00 70.15  ? 78  PHE E O     1 
ATOM   3362  C  CB    . PHE E 1 39  ? 32.382  52.248 -37.200 1.00 69.92  ? 78  PHE E CB    1 
ATOM   3363  C  CG    . PHE E 1 39  ? 31.821  51.654 -38.468 1.00 70.22  ? 78  PHE E CG    1 
ATOM   3364  C  CD1   . PHE E 1 39  ? 30.590  52.063 -38.959 1.00 70.86  ? 78  PHE E CD1   1 
ATOM   3365  C  CD2   . PHE E 1 39  ? 32.553  50.739 -39.208 1.00 70.71  ? 78  PHE E CD2   1 
ATOM   3366  C  CE1   . PHE E 1 39  ? 30.099  51.557 -40.156 1.00 71.45  ? 78  PHE E CE1   1 
ATOM   3367  C  CE2   . PHE E 1 39  ? 32.060  50.235 -40.403 1.00 71.33  ? 78  PHE E CE2   1 
ATOM   3368  C  CZ    . PHE E 1 39  ? 30.837  50.649 -40.871 1.00 71.20  ? 78  PHE E CZ    1 
ATOM   3369  N  N     . LYS E 1 40  ? 34.435  54.275 -35.677 1.00 70.84  ? 79  LYS E N     1 
ATOM   3370  C  CA    . LYS E 1 40  ? 34.902  54.889 -34.446 1.00 71.97  ? 79  LYS E CA    1 
ATOM   3371  C  C     . LYS E 1 40  ? 36.410  55.169 -34.491 1.00 74.07  ? 79  LYS E C     1 
ATOM   3372  O  O     . LYS E 1 40  ? 37.190  54.312 -34.905 1.00 74.09  ? 79  LYS E O     1 
ATOM   3373  C  CB    . LYS E 1 40  ? 34.546  54.019 -33.228 1.00 72.47  ? 79  LYS E CB    1 
ATOM   3374  C  CG    . LYS E 1 40  ? 34.791  54.712 -31.896 1.00 75.01  ? 79  LYS E CG    1 
ATOM   3375  C  CD    . LYS E 1 40  ? 34.723  53.736 -30.730 1.00 78.06  ? 79  LYS E CD    1 
ATOM   3376  C  CE    . LYS E 1 40  ? 35.387  54.262 -29.476 1.00 80.19  ? 79  LYS E CE    1 
ATOM   3377  N  NZ    . LYS E 1 40  ? 35.115  53.391 -28.299 1.00 80.89  ? 79  LYS E NZ    1 
ATOM   3378  N  N     . THR E 1 41  ? 36.822  56.385 -34.095 1.00 75.66  ? 80  THR E N     1 
ATOM   3379  C  CA    . THR E 1 41  ? 38.252  56.706 -34.005 1.00 77.47  ? 80  THR E CA    1 
ATOM   3380  C  C     . THR E 1 41  ? 38.822  56.235 -32.645 1.00 79.08  ? 80  THR E C     1 
ATOM   3381  O  O     . THR E 1 41  ? 38.047  55.888 -31.742 1.00 79.23  ? 80  THR E O     1 
ATOM   3382  C  CB    . THR E 1 41  ? 38.513  58.195 -34.287 1.00 78.79  ? 80  THR E CB    1 
ATOM   3383  O  OG1   . THR E 1 41  ? 37.621  58.992 -33.506 1.00 79.82  ? 80  THR E OG1   1 
ATOM   3384  C  CG2   . THR E 1 41  ? 38.356  58.544 -35.764 1.00 79.16  ? 80  THR E CG2   1 
ATOM   3385  N  N     . ASP E 1 42  ? 40.167  56.203 -32.511 1.00 80.26  ? 81  ASP E N     1 
ATOM   3386  C  CA    . ASP E 1 42  ? 40.851  55.772 -31.285 1.00 81.72  ? 81  ASP E CA    1 
ATOM   3387  C  C     . ASP E 1 42  ? 40.529  54.301 -30.988 1.00 82.64  ? 81  ASP E C     1 
ATOM   3388  O  O     . ASP E 1 42  ? 40.268  53.939 -29.831 1.00 82.89  ? 81  ASP E O     1 
ATOM   3389  C  CB    . ASP E 1 42  ? 40.467  56.672 -30.090 1.00 83.77  ? 81  ASP E CB    1 
ATOM   3390  C  CG    . ASP E 1 42  ? 41.614  57.089 -29.187 1.00 88.36  ? 81  ASP E CG    1 
ATOM   3391  O  OD1   . ASP E 1 42  ? 42.588  56.305 -29.052 1.00 88.98  ? 81  ASP E OD1   1 
ATOM   3392  O  OD2   . ASP E 1 42  ? 41.533  58.192 -28.602 1.00 90.57  ? 81  ASP E OD2   1 
ATOM   3393  N  N     . LEU E 1 43  ? 40.523  53.455 -32.042 1.00 82.61  ? 82  LEU E N     1 
ATOM   3394  C  CA    . LEU E 1 43  ? 40.214  52.037 -31.874 1.00 83.03  ? 82  LEU E CA    1 
ATOM   3395  C  C     . LEU E 1 43  ? 41.431  51.116 -31.792 1.00 83.13  ? 82  LEU E C     1 
ATOM   3396  O  O     . LEU E 1 43  ? 42.391  51.248 -32.558 1.00 83.15  ? 82  LEU E O     1 
ATOM   3397  C  CB    . LEU E 1 43  ? 39.258  51.531 -32.964 1.00 83.30  ? 82  LEU E CB    1 
ATOM   3398  C  CG    . LEU E 1 43  ? 37.759  51.720 -32.733 1.00 84.77  ? 82  LEU E CG    1 
ATOM   3399  C  CD1   . LEU E 1 43  ? 36.971  51.100 -33.859 1.00 85.32  ? 82  LEU E CD1   1 
ATOM   3400  C  CD2   . LEU E 1 43  ? 37.308  51.121 -31.408 1.00 85.42  ? 82  LEU E CD2   1 
ATOM   3401  N  N     . ARG E 1 44  ? 41.349  50.147 -30.878 1.00 82.77  ? 83  ARG E N     1 
ATOM   3402  C  CA    . ARG E 1 44  ? 42.362  49.121 -30.685 1.00 82.75  ? 83  ARG E CA    1 
ATOM   3403  C  C     . ARG E 1 44  ? 41.768  47.764 -31.084 1.00 81.78  ? 83  ARG E C     1 
ATOM   3404  O  O     . ARG E 1 44  ? 40.570  47.551 -30.943 1.00 81.96  ? 83  ARG E O     1 
ATOM   3405  C  CB    . ARG E 1 44  ? 42.863  49.115 -29.236 1.00 84.60  ? 83  ARG E CB    1 
ATOM   3406  C  CG    . ARG E 1 44  ? 43.731  50.319 -28.942 1.00 88.06  ? 83  ARG E CG    1 
ATOM   3407  C  CD    . ARG E 1 44  ? 44.542  50.221 -27.666 1.00 91.62  ? 83  ARG E CD    1 
ATOM   3408  N  NE    . ARG E 1 44  ? 44.676  51.533 -27.019 1.00 95.64  ? 83  ARG E NE    1 
ATOM   3409  C  CZ    . ARG E 1 44  ? 45.617  52.436 -27.310 1.00 98.63  ? 83  ARG E CZ    1 
ATOM   3410  N  NH1   . ARG E 1 44  ? 46.545  52.169 -28.222 1.00 98.56  ? 83  ARG E NH1   1 
ATOM   3411  N  NH2   . ARG E 1 44  ? 45.642  53.608 -26.681 1.00 98.63  ? 83  ARG E NH2   1 
ATOM   3412  N  N     . PHE E 1 45  ? 42.591  46.871 -31.626 1.00 80.56  ? 84  PHE E N     1 
ATOM   3413  C  CA    . PHE E 1 45  ? 42.139  45.557 -32.058 1.00 79.87  ? 84  PHE E CA    1 
ATOM   3414  C  C     . PHE E 1 45  ? 42.932  44.458 -31.403 1.00 78.94  ? 84  PHE E C     1 
ATOM   3415  O  O     . PHE E 1 45  ? 44.148  44.420 -31.602 1.00 79.48  ? 84  PHE E O     1 
ATOM   3416  C  CB    . PHE E 1 45  ? 42.365  45.420 -33.561 1.00 79.85  ? 84  PHE E CB    1 
ATOM   3417  C  CG    . PHE E 1 45  ? 41.187  45.851 -34.374 1.00 80.55  ? 84  PHE E CG    1 
ATOM   3418  C  CD1   . PHE E 1 45  ? 40.028  45.100 -34.390 1.00 81.43  ? 84  PHE E CD1   1 
ATOM   3419  C  CD2   . PHE E 1 45  ? 41.236  47.001 -35.129 1.00 81.24  ? 84  PHE E CD2   1 
ATOM   3420  C  CE1   . PHE E 1 45  ? 38.941  45.496 -35.143 1.00 82.10  ? 84  PHE E CE1   1 
ATOM   3421  C  CE2   . PHE E 1 45  ? 40.153  47.386 -35.891 1.00 81.96  ? 84  PHE E CE2   1 
ATOM   3422  C  CZ    . PHE E 1 45  ? 39.004  46.642 -35.880 1.00 81.86  ? 84  PHE E CZ    1 
ATOM   3423  N  N     . GLN E 1 46  ? 42.271  43.490 -30.724 1.00 77.36  ? 85  GLN E N     1 
ATOM   3424  C  CA    . GLN E 1 46  ? 43.002  42.348 -30.165 1.00 76.43  ? 85  GLN E CA    1 
ATOM   3425  C  C     . GLN E 1 46  ? 43.619  41.538 -31.316 1.00 76.01  ? 85  GLN E C     1 
ATOM   3426  O  O     . GLN E 1 46  ? 42.998  41.423 -32.367 1.00 76.14  ? 85  GLN E O     1 
ATOM   3427  C  CB    . GLN E 1 46  ? 42.091  41.455 -29.325 1.00 76.81  ? 85  GLN E CB    1 
ATOM   3428  C  CG    . GLN E 1 46  ? 41.810  42.016 -27.946 1.00 77.88  ? 85  GLN E CG    1 
ATOM   3429  C  CD    . GLN E 1 46  ? 41.229  40.974 -27.026 1.00 79.91  ? 85  GLN E CD    1 
ATOM   3430  O  OE1   . GLN E 1 46  ? 40.556  40.032 -27.449 1.00 80.68  ? 85  GLN E OE1   1 
ATOM   3431  N  NE2   . GLN E 1 46  ? 41.456  41.132 -25.736 1.00 79.78  ? 85  GLN E NE2   1 
ATOM   3432  N  N     . SER E 1 47  ? 44.845  41.018 -31.155 1.00 75.38  ? 86  SER E N     1 
ATOM   3433  C  CA    . SER E 1 47  ? 45.554  40.239 -32.195 1.00 75.12  ? 86  SER E CA    1 
ATOM   3434  C  C     . SER E 1 47  ? 44.641  39.144 -32.802 1.00 74.31  ? 86  SER E C     1 
ATOM   3435  O  O     . SER E 1 47  ? 44.531  38.993 -34.027 1.00 74.43  ? 86  SER E O     1 
ATOM   3436  C  CB    . SER E 1 47  ? 46.808  39.578 -31.614 1.00 76.69  ? 86  SER E CB    1 
ATOM   3437  O  OG    . SER E 1 47  ? 47.338  40.180 -30.439 1.00 79.08  ? 86  SER E OG    1 
ATOM   3438  N  N     . SER E 1 48  ? 43.925  38.460 -31.886 1.00 73.14  ? 87  SER E N     1 
ATOM   3439  C  CA    . SER E 1 48  ? 42.957  37.393 -32.092 1.00 72.28  ? 87  SER E CA    1 
ATOM   3440  C  C     . SER E 1 48  ? 41.735  37.886 -32.851 1.00 71.15  ? 87  SER E C     1 
ATOM   3441  O  O     . SER E 1 48  ? 41.276  37.182 -33.734 1.00 71.29  ? 87  SER E O     1 
ATOM   3442  C  CB    . SER E 1 48  ? 42.529  36.812 -30.743 1.00 73.11  ? 87  SER E CB    1 
ATOM   3443  O  OG    . SER E 1 48  ? 42.176  37.832 -29.819 1.00 74.88  ? 87  SER E OG    1 
ATOM   3444  N  N     . ALA E 1 49  ? 41.208  39.083 -32.518 1.00 69.99  ? 88  ALA E N     1 
ATOM   3445  C  CA    . ALA E 1 49  ? 40.045  39.680 -33.186 1.00 69.15  ? 88  ALA E CA    1 
ATOM   3446  C  C     . ALA E 1 49  ? 40.317  39.916 -34.655 1.00 67.94  ? 88  ALA E C     1 
ATOM   3447  O  O     . ALA E 1 49  ? 39.418  39.731 -35.469 1.00 68.46  ? 88  ALA E O     1 
ATOM   3448  C  CB    . ALA E 1 49  ? 39.671  40.992 -32.529 1.00 69.16  ? 88  ALA E CB    1 
ATOM   3449  N  N     . VAL E 1 50  ? 41.541  40.329 -35.000 1.00 66.52  ? 89  VAL E N     1 
ATOM   3450  C  CA    . VAL E 1 50  ? 41.898  40.537 -36.397 1.00 65.88  ? 89  VAL E CA    1 
ATOM   3451  C  C     . VAL E 1 50  ? 41.944  39.196 -37.106 1.00 65.19  ? 89  VAL E C     1 
ATOM   3452  O  O     . VAL E 1 50  ? 41.383  39.053 -38.193 1.00 65.37  ? 89  VAL E O     1 
ATOM   3453  C  CB    . VAL E 1 50  ? 43.215  41.325 -36.554 1.00 66.71  ? 89  VAL E CB    1 
ATOM   3454  C  CG1   . VAL E 1 50  ? 43.645  41.388 -38.018 1.00 67.32  ? 89  VAL E CG1   1 
ATOM   3455  C  CG2   . VAL E 1 50  ? 43.077  42.725 -35.971 1.00 67.25  ? 89  VAL E CG2   1 
ATOM   3456  N  N     . MET E 1 51  ? 42.543  38.189 -36.466 1.00 64.39  ? 90  MET E N     1 
ATOM   3457  C  CA    . MET E 1 51  ? 42.610  36.852 -37.041 1.00 64.21  ? 90  MET E CA    1 
ATOM   3458  C  C     . MET E 1 51  ? 41.218  36.227 -37.228 1.00 62.76  ? 90  MET E C     1 
ATOM   3459  O  O     . MET E 1 51  ? 40.946  35.646 -38.282 1.00 62.77  ? 90  MET E O     1 
ATOM   3460  C  CB    . MET E 1 51  ? 43.570  35.967 -36.237 1.00 65.64  ? 90  MET E CB    1 
ATOM   3461  C  CG    . MET E 1 51  ? 45.009  36.441 -36.334 1.00 69.04  ? 90  MET E CG    1 
ATOM   3462  S  SD    . MET E 1 51  ? 45.592  36.598 -38.058 1.00 76.75  ? 90  MET E SD    1 
ATOM   3463  C  CE    . MET E 1 51  ? 45.627  34.884 -38.524 1.00 74.88  ? 90  MET E CE    1 
ATOM   3464  N  N     . ALA E 1 52  ? 40.311  36.461 -36.262 1.00 61.07  ? 91  ALA E N     1 
ATOM   3465  C  CA    . ALA E 1 52  ? 38.914  36.046 -36.316 1.00 59.77  ? 91  ALA E CA    1 
ATOM   3466  C  C     . ALA E 1 52  ? 38.243  36.687 -37.530 1.00 58.62  ? 91  ALA E C     1 
ATOM   3467  O  O     . ALA E 1 52  ? 37.452  36.040 -38.200 1.00 59.26  ? 91  ALA E O     1 
ATOM   3468  C  CB    . ALA E 1 52  ? 38.198  36.472 -35.047 1.00 59.57  ? 91  ALA E CB    1 
ATOM   3469  N  N     . LEU E 1 53  ? 38.583  37.940 -37.836 1.00 57.01  ? 92  LEU E N     1 
ATOM   3470  C  CA    . LEU E 1 53  ? 38.063  38.646 -38.996 1.00 55.97  ? 92  LEU E CA    1 
ATOM   3471  C  C     . LEU E 1 53  ? 38.635  38.090 -40.297 1.00 55.86  ? 92  LEU E C     1 
ATOM   3472  O  O     . LEU E 1 53  ? 37.913  37.972 -41.285 1.00 56.06  ? 92  LEU E O     1 
ATOM   3473  C  CB    . LEU E 1 53  ? 38.396  40.121 -38.878 1.00 55.23  ? 92  LEU E CB    1 
ATOM   3474  C  CG    . LEU E 1 53  ? 37.286  40.928 -38.298 1.00 55.84  ? 92  LEU E CG    1 
ATOM   3475  C  CD1   . LEU E 1 53  ? 37.803  42.199 -37.684 1.00 56.17  ? 92  LEU E CD1   1 
ATOM   3476  C  CD2   . LEU E 1 53  ? 36.233  41.169 -39.332 1.00 56.54  ? 92  LEU E CD2   1 
ATOM   3477  N  N     . GLN E 1 54  ? 39.924  37.748 -40.300 1.00 55.24  ? 93  GLN E N     1 
ATOM   3478  C  CA    . GLN E 1 54  ? 40.580  37.238 -41.490 1.00 55.03  ? 93  GLN E CA    1 
ATOM   3479  C  C     . GLN E 1 54  ? 40.092  35.873 -41.878 1.00 54.05  ? 93  GLN E C     1 
ATOM   3480  O  O     . GLN E 1 54  ? 39.843  35.618 -43.059 1.00 54.14  ? 93  GLN E O     1 
ATOM   3481  C  CB    . GLN E 1 54  ? 42.096  37.238 -41.324 1.00 57.08  ? 93  GLN E CB    1 
ATOM   3482  C  CG    . GLN E 1 54  ? 42.794  36.927 -42.635 1.00 61.05  ? 93  GLN E CG    1 
ATOM   3483  C  CD    . GLN E 1 54  ? 44.257  37.234 -42.611 1.00 65.87  ? 93  GLN E CD    1 
ATOM   3484  O  OE1   . GLN E 1 54  ? 44.882  37.363 -41.546 1.00 67.57  ? 93  GLN E OE1   1 
ATOM   3485  N  NE2   . GLN E 1 54  ? 44.831  37.351 -43.799 1.00 66.53  ? 93  GLN E NE2   1 
ATOM   3486  N  N     . GLU E 1 55  ? 39.910  34.999 -40.882 1.00 53.02  ? 94  GLU E N     1 
ATOM   3487  C  CA    . GLU E 1 55  ? 39.417  33.648 -41.110 1.00 52.45  ? 94  GLU E CA    1 
ATOM   3488  C  C     . GLU E 1 55  ? 38.018  33.707 -41.717 1.00 51.44  ? 94  GLU E C     1 
ATOM   3489  O  O     . GLU E 1 55  ? 37.775  33.112 -42.763 1.00 51.04  ? 94  GLU E O     1 
ATOM   3490  C  CB    . GLU E 1 55  ? 39.397  32.870 -39.791 1.00 54.84  ? 94  GLU E CB    1 
ATOM   3491  C  CG    . GLU E 1 55  ? 40.776  32.513 -39.278 1.00 60.19  ? 94  GLU E CG    1 
ATOM   3492  C  CD    . GLU E 1 55  ? 41.482  31.365 -39.980 1.00 67.08  ? 94  GLU E CD    1 
ATOM   3493  O  OE1   . GLU E 1 55  ? 40.806  30.495 -40.576 1.00 68.09  ? 94  GLU E OE1   1 
ATOM   3494  O  OE2   . GLU E 1 55  ? 42.732  31.349 -39.938 1.00 69.66  ? 94  GLU E OE2   1 
ATOM   3495  N  N     . ALA E 1 56  ? 37.148  34.527 -41.104 1.00 50.93  ? 95  ALA E N     1 
ATOM   3496  C  CA    . ALA E 1 56  ? 35.767  34.762 -41.504 1.00 51.03  ? 95  ALA E CA    1 
ATOM   3497  C  C     . ALA E 1 56  ? 35.655  35.219 -42.960 1.00 51.17  ? 95  ALA E C     1 
ATOM   3498  O  O     . ALA E 1 56  ? 34.774  34.749 -43.685 1.00 51.52  ? 95  ALA E O     1 
ATOM   3499  C  CB    . ALA E 1 56  ? 35.143  35.804 -40.588 1.00 50.93  ? 95  ALA E CB    1 
ATOM   3500  N  N     . CYS E 1 57  ? 36.565  36.124 -43.379 1.00 50.53  ? 96  CYS E N     1 
ATOM   3501  C  CA    . CYS E 1 57  ? 36.609  36.731 -44.702 1.00 50.14  ? 96  CYS E CA    1 
ATOM   3502  C  C     . CYS E 1 57  ? 36.967  35.739 -45.756 1.00 48.87  ? 96  CYS E C     1 
ATOM   3503  O  O     . CYS E 1 57  ? 36.307  35.656 -46.788 1.00 48.38  ? 96  CYS E O     1 
ATOM   3504  C  CB    . CYS E 1 57  ? 37.584  37.906 -44.712 1.00 51.42  ? 96  CYS E CB    1 
ATOM   3505  S  SG    . CYS E 1 57  ? 36.853  39.480 -44.228 1.00 56.51  ? 96  CYS E SG    1 
ATOM   3506  N  N     . GLU E 1 58  ? 38.043  35.008 -45.511 1.00 48.40  ? 97  GLU E N     1 
ATOM   3507  C  CA    . GLU E 1 58  ? 38.535  34.048 -46.468 1.00 48.68  ? 97  GLU E CA    1 
ATOM   3508  C  C     . GLU E 1 58  ? 37.547  32.903 -46.616 1.00 48.02  ? 97  GLU E C     1 
ATOM   3509  O  O     . GLU E 1 58  ? 37.110  32.625 -47.731 1.00 47.96  ? 97  GLU E O     1 
ATOM   3510  C  CB    . GLU E 1 58  ? 39.938  33.585 -46.069 1.00 51.44  ? 97  GLU E CB    1 
ATOM   3511  C  CG    . GLU E 1 58  ? 40.889  34.758 -45.934 1.00 56.61  ? 97  GLU E CG    1 
ATOM   3512  C  CD    . GLU E 1 58  ? 42.351  34.405 -46.059 1.00 63.36  ? 97  GLU E CD    1 
ATOM   3513  O  OE1   . GLU E 1 58  ? 42.649  33.343 -46.650 1.00 65.20  ? 97  GLU E OE1   1 
ATOM   3514  O  OE2   . GLU E 1 58  ? 43.200  35.183 -45.566 1.00 65.36  ? 97  GLU E OE2   1 
ATOM   3515  N  N     . ALA E 1 59  ? 37.067  32.352 -45.485 1.00 46.86  ? 98  ALA E N     1 
ATOM   3516  C  CA    . ALA E 1 59  ? 36.084  31.279 -45.498 1.00 46.18  ? 98  ALA E CA    1 
ATOM   3517  C  C     . ALA E 1 59  ? 34.828  31.678 -46.277 1.00 45.39  ? 98  ALA E C     1 
ATOM   3518  O  O     . ALA E 1 59  ? 34.298  30.871 -47.043 1.00 45.63  ? 98  ALA E O     1 
ATOM   3519  C  CB    . ALA E 1 59  ? 35.722  30.904 -44.083 1.00 46.34  ? 98  ALA E CB    1 
ATOM   3520  N  N     . TYR E 1 60  ? 34.405  32.949 -46.132 1.00 44.14  ? 99  TYR E N     1 
ATOM   3521  C  CA    . TYR E 1 60  ? 33.253  33.491 -46.841 1.00 43.15  ? 99  TYR E CA    1 
ATOM   3522  C  C     . TYR E 1 60  ? 33.527  33.537 -48.333 1.00 42.81  ? 99  TYR E C     1 
ATOM   3523  O  O     . TYR E 1 60  ? 32.677  33.089 -49.105 1.00 42.66  ? 99  TYR E O     1 
ATOM   3524  C  CB    . TYR E 1 60  ? 32.886  34.904 -46.314 1.00 42.48  ? 99  TYR E CB    1 
ATOM   3525  C  CG    . TYR E 1 60  ? 32.005  35.706 -47.252 1.00 42.42  ? 99  TYR E CG    1 
ATOM   3526  C  CD1   . TYR E 1 60  ? 30.703  35.316 -47.520 1.00 42.90  ? 99  TYR E CD1   1 
ATOM   3527  C  CD2   . TYR E 1 60  ? 32.489  36.832 -47.896 1.00 43.35  ? 99  TYR E CD2   1 
ATOM   3528  C  CE1   . TYR E 1 60  ? 29.903  36.029 -48.399 1.00 43.70  ? 99  TYR E CE1   1 
ATOM   3529  C  CE2   . TYR E 1 60  ? 31.696  37.560 -48.771 1.00 44.19  ? 99  TYR E CE2   1 
ATOM   3530  C  CZ    . TYR E 1 60  ? 30.408  37.145 -49.033 1.00 44.96  ? 99  TYR E CZ    1 
ATOM   3531  O  OH    . TYR E 1 60  ? 29.640  37.858 -49.921 1.00 46.94  ? 99  TYR E OH    1 
ATOM   3532  N  N     . LEU E 1 61  ? 34.687  34.137 -48.727 1.00 42.59  ? 100 LEU E N     1 
ATOM   3533  C  CA    . LEU E 1 61  ? 35.107  34.365 -50.112 1.00 42.58  ? 100 LEU E CA    1 
ATOM   3534  C  C     . LEU E 1 61  ? 35.342  33.102 -50.877 1.00 42.58  ? 100 LEU E C     1 
ATOM   3535  O  O     . LEU E 1 61  ? 34.992  33.038 -52.046 1.00 42.29  ? 100 LEU E O     1 
ATOM   3536  C  CB    . LEU E 1 61  ? 36.329  35.265 -50.185 1.00 42.66  ? 100 LEU E CB    1 
ATOM   3537  C  CG    . LEU E 1 61  ? 36.076  36.747 -49.912 1.00 44.16  ? 100 LEU E CG    1 
ATOM   3538  C  CD1   . LEU E 1 61  ? 37.366  37.511 -49.919 1.00 44.75  ? 100 LEU E CD1   1 
ATOM   3539  C  CD2   . LEU E 1 61  ? 35.117  37.355 -50.924 1.00 44.76  ? 100 LEU E CD2   1 
ATOM   3540  N  N     . VAL E 1 62  ? 35.876  32.078 -50.213 1.00 42.67  ? 101 VAL E N     1 
ATOM   3541  C  CA    . VAL E 1 62  ? 36.082  30.761 -50.805 1.00 43.32  ? 101 VAL E CA    1 
ATOM   3542  C  C     . VAL E 1 62  ? 34.726  30.114 -51.102 1.00 42.88  ? 101 VAL E C     1 
ATOM   3543  O  O     . VAL E 1 62  ? 34.524  29.586 -52.191 1.00 42.72  ? 101 VAL E O     1 
ATOM   3544  C  CB    . VAL E 1 62  ? 36.941  29.879 -49.883 1.00 44.67  ? 101 VAL E CB    1 
ATOM   3545  C  CG1   . VAL E 1 62  ? 36.979  28.446 -50.385 1.00 45.52  ? 101 VAL E CG1   1 
ATOM   3546  C  CG2   . VAL E 1 62  ? 38.351  30.449 -49.753 1.00 45.37  ? 101 VAL E CG2   1 
ATOM   3547  N  N     . GLY E 1 63  ? 33.798  30.217 -50.157 1.00 42.57  ? 102 GLY E N     1 
ATOM   3548  C  CA    . GLY E 1 63  ? 32.439  29.729 -50.340 1.00 42.85  ? 102 GLY E CA    1 
ATOM   3549  C  C     . GLY E 1 63  ? 31.713  30.499 -51.426 1.00 42.84  ? 102 GLY E C     1 
ATOM   3550  O  O     . GLY E 1 63  ? 30.912  29.933 -52.170 1.00 43.21  ? 102 GLY E O     1 
ATOM   3551  N  N     . LEU E 1 64  ? 31.987  31.795 -51.529 1.00 42.49  ? 103 LEU E N     1 
ATOM   3552  C  CA    . LEU E 1 64  ? 31.417  32.632 -52.573 1.00 42.87  ? 103 LEU E CA    1 
ATOM   3553  C  C     . LEU E 1 64  ? 31.987  32.219 -53.925 1.00 44.07  ? 103 LEU E C     1 
ATOM   3554  O  O     . LEU E 1 64  ? 31.254  32.186 -54.906 1.00 44.09  ? 103 LEU E O     1 
ATOM   3555  C  CB    . LEU E 1 64  ? 31.676  34.120 -52.308 1.00 42.42  ? 103 LEU E CB    1 
ATOM   3556  C  CG    . LEU E 1 64  ? 31.059  35.097 -53.309 1.00 43.27  ? 103 LEU E CG    1 
ATOM   3557  C  CD1   . LEU E 1 64  ? 29.562  34.940 -53.403 1.00 43.73  ? 103 LEU E CD1   1 
ATOM   3558  C  CD2   . LEU E 1 64  ? 31.371  36.511 -52.942 1.00 43.80  ? 103 LEU E CD2   1 
ATOM   3559  N  N     . PHE E 1 65  ? 33.279  31.861 -53.977 1.00 44.85  ? 104 PHE E N     1 
ATOM   3560  C  CA    . PHE E 1 65  ? 33.894  31.394 -55.208 1.00 46.10  ? 104 PHE E CA    1 
ATOM   3561  C  C     . PHE E 1 65  ? 33.271  30.100 -55.657 1.00 46.20  ? 104 PHE E C     1 
ATOM   3562  O  O     . PHE E 1 65  ? 32.905  29.984 -56.823 1.00 46.24  ? 104 PHE E O     1 
ATOM   3563  C  CB    . PHE E 1 65  ? 35.420  31.302 -55.088 1.00 46.80  ? 104 PHE E CB    1 
ATOM   3564  C  CG    . PHE E 1 65  ? 36.045  32.660 -55.295 1.00 48.53  ? 104 PHE E CG    1 
ATOM   3565  C  CD1   . PHE E 1 65  ? 35.602  33.500 -56.309 1.00 49.83  ? 104 PHE E CD1   1 
ATOM   3566  C  CD2   . PHE E 1 65  ? 37.052  33.112 -54.464 1.00 49.96  ? 104 PHE E CD2   1 
ATOM   3567  C  CE1   . PHE E 1 65  ? 36.145  34.769 -56.475 1.00 50.87  ? 104 PHE E CE1   1 
ATOM   3568  C  CE2   . PHE E 1 65  ? 37.606  34.378 -54.643 1.00 51.15  ? 104 PHE E CE2   1 
ATOM   3569  C  CZ    . PHE E 1 65  ? 37.144  35.200 -55.643 1.00 50.94  ? 104 PHE E CZ    1 
ATOM   3570  N  N     . GLU E 1 66  ? 33.011  29.178 -54.709 1.00 45.93  ? 105 GLU E N     1 
ATOM   3571  C  CA    . GLU E 1 66  ? 32.337  27.908 -54.973 1.00 45.83  ? 105 GLU E CA    1 
ATOM   3572  C  C     . GLU E 1 66  ? 31.013  28.128 -55.727 1.00 46.30  ? 105 GLU E C     1 
ATOM   3573  O  O     . GLU E 1 66  ? 30.841  27.583 -56.818 1.00 46.97  ? 105 GLU E O     1 
ATOM   3574  C  CB    . GLU E 1 66  ? 32.098  27.142 -53.654 1.00 46.75  ? 105 GLU E CB    1 
ATOM   3575  C  CG    . GLU E 1 66  ? 33.367  26.566 -53.057 1.00 49.98  ? 105 GLU E CG    1 
ATOM   3576  C  CD    . GLU E 1 66  ? 33.208  25.924 -51.695 1.00 53.47  ? 105 GLU E CD    1 
ATOM   3577  O  OE1   . GLU E 1 66  ? 32.057  25.587 -51.333 1.00 54.17  ? 105 GLU E OE1   1 
ATOM   3578  O  OE2   . GLU E 1 66  ? 34.232  25.754 -50.991 1.00 53.85  ? 105 GLU E OE2   1 
ATOM   3579  N  N     . ASP E 1 67  ? 30.130  28.995 -55.191 1.00 45.66  ? 106 ASP E N     1 
ATOM   3580  C  CA    . ASP E 1 67  ? 28.849  29.273 -55.823 1.00 45.18  ? 106 ASP E CA    1 
ATOM   3581  C  C     . ASP E 1 67  ? 29.041  30.016 -57.127 1.00 45.57  ? 106 ASP E C     1 
ATOM   3582  O  O     . ASP E 1 67  ? 28.302  29.773 -58.072 1.00 45.52  ? 106 ASP E O     1 
ATOM   3583  C  CB    . ASP E 1 67  ? 27.934  30.078 -54.890 1.00 45.40  ? 106 ASP E CB    1 
ATOM   3584  C  CG    . ASP E 1 67  ? 27.667  29.448 -53.544 1.00 47.14  ? 106 ASP E CG    1 
ATOM   3585  O  OD1   . ASP E 1 67  ? 27.614  28.204 -53.471 1.00 47.54  ? 106 ASP E OD1   1 
ATOM   3586  O  OD2   . ASP E 1 67  ? 27.502  30.199 -52.566 1.00 47.84  ? 106 ASP E OD2   1 
ATOM   3587  N  N     . THR E 1 68  ? 30.026  30.915 -57.192 1.00 46.14  ? 107 THR E N     1 
ATOM   3588  C  CA    . THR E 1 68  ? 30.293  31.698 -58.394 1.00 47.38  ? 107 THR E CA    1 
ATOM   3589  C  C     . THR E 1 68  ? 30.670  30.791 -59.556 1.00 48.30  ? 107 THR E C     1 
ATOM   3590  O  O     . THR E 1 68  ? 30.160  30.955 -60.669 1.00 48.34  ? 107 THR E O     1 
ATOM   3591  C  CB    . THR E 1 68  ? 31.396  32.721 -58.116 1.00 48.93  ? 107 THR E CB    1 
ATOM   3592  O  OG1   . THR E 1 68  ? 31.032  33.499 -56.978 1.00 49.88  ? 107 THR E OG1   1 
ATOM   3593  C  CG2   . THR E 1 68  ? 31.642  33.633 -59.294 1.00 49.49  ? 107 THR E CG2   1 
ATOM   3594  N  N     . ASN E 1 69  ? 31.526  29.801 -59.274 1.00 48.59  ? 108 ASN E N     1 
ATOM   3595  C  CA    . ASN E 1 69  ? 32.021  28.837 -60.243 1.00 49.38  ? 108 ASN E CA    1 
ATOM   3596  C  C     . ASN E 1 69  ? 30.868  28.020 -60.790 1.00 49.33  ? 108 ASN E C     1 
ATOM   3597  O  O     . ASN E 1 69  ? 30.789  27.827 -61.999 1.00 49.54  ? 108 ASN E O     1 
ATOM   3598  C  CB    . ASN E 1 69  ? 33.097  27.951 -59.597 1.00 51.30  ? 108 ASN E CB    1 
ATOM   3599  C  CG    . ASN E 1 69  ? 34.085  27.340 -60.566 1.00 55.57  ? 108 ASN E CG    1 
ATOM   3600  O  OD1   . ASN E 1 69  ? 34.890  28.028 -61.229 1.00 57.38  ? 108 ASN E OD1   1 
ATOM   3601  N  ND2   . ASN E 1 69  ? 34.067  26.020 -60.642 1.00 56.12  ? 108 ASN E ND2   1 
ATOM   3602  N  N     . LEU E 1 70  ? 29.932  27.614 -59.913 1.00 49.17  ? 109 LEU E N     1 
ATOM   3603  C  CA    . LEU E 1 70  ? 28.716  26.874 -60.275 1.00 49.43  ? 109 LEU E CA    1 
ATOM   3604  C  C     . LEU E 1 70  ? 27.823  27.696 -61.211 1.00 49.91  ? 109 LEU E C     1 
ATOM   3605  O  O     . LEU E 1 70  ? 27.092  27.122 -62.013 1.00 49.58  ? 109 LEU E O     1 
ATOM   3606  C  CB    . LEU E 1 70  ? 27.941  26.486 -59.021 1.00 49.60  ? 109 LEU E CB    1 
ATOM   3607  C  CG    . LEU E 1 70  ? 28.424  25.229 -58.314 1.00 51.34  ? 109 LEU E CG    1 
ATOM   3608  C  CD1   . LEU E 1 70  ? 28.088  25.283 -56.842 1.00 52.03  ? 109 LEU E CD1   1 
ATOM   3609  C  CD2   . LEU E 1 70  ? 28.005  23.973 -59.067 1.00 52.18  ? 109 LEU E CD2   1 
ATOM   3610  N  N     . CYS E 1 71  ? 27.873  29.033 -61.096 1.00 50.47  ? 110 CYS E N     1 
ATOM   3611  C  CA    . CYS E 1 71  ? 27.127  29.951 -61.952 1.00 51.35  ? 110 CYS E CA    1 
ATOM   3612  C  C     . CYS E 1 71  ? 27.810  30.078 -63.309 1.00 52.04  ? 110 CYS E C     1 
ATOM   3613  O  O     . CYS E 1 71  ? 27.126  30.164 -64.334 1.00 53.13  ? 110 CYS E O     1 
ATOM   3614  C  CB    . CYS E 1 71  ? 26.976  31.309 -61.281 1.00 51.79  ? 110 CYS E CB    1 
ATOM   3615  S  SG    . CYS E 1 71  ? 26.151  31.244 -59.678 1.00 54.44  ? 110 CYS E SG    1 
ATOM   3616  N  N     . ALA E 1 72  ? 29.163  30.067 -63.323 1.00 51.15  ? 111 ALA E N     1 
ATOM   3617  C  CA    . ALA E 1 72  ? 29.924  30.121 -64.556 1.00 50.70  ? 111 ALA E CA    1 
ATOM   3618  C  C     . ALA E 1 72  ? 29.643  28.827 -65.346 1.00 50.32  ? 111 ALA E C     1 
ATOM   3619  O  O     . ALA E 1 72  ? 29.240  28.901 -66.501 1.00 50.44  ? 111 ALA E O     1 
ATOM   3620  C  CB    . ALA E 1 72  ? 31.406  30.269 -64.244 1.00 50.81  ? 111 ALA E CB    1 
ATOM   3621  N  N     . ILE E 1 73  ? 29.718  27.664 -64.684 1.00 49.72  ? 112 ILE E N     1 
ATOM   3622  C  CA    . ILE E 1 73  ? 29.435  26.379 -65.294 1.00 49.82  ? 112 ILE E CA    1 
ATOM   3623  C  C     . ILE E 1 73  ? 27.976  26.286 -65.741 1.00 51.17  ? 112 ILE E C     1 
ATOM   3624  O  O     . ILE E 1 73  ? 27.694  25.640 -66.741 1.00 51.56  ? 112 ILE E O     1 
ATOM   3625  C  CB    . ILE E 1 73  ? 29.828  25.245 -64.317 1.00 49.56  ? 112 ILE E CB    1 
ATOM   3626  C  CG1   . ILE E 1 73  ? 31.302  25.362 -63.903 1.00 49.85  ? 112 ILE E CG1   1 
ATOM   3627  C  CG2   . ILE E 1 73  ? 29.526  23.867 -64.896 1.00 49.84  ? 112 ILE E CG2   1 
ATOM   3628  C  CD1   . ILE E 1 73  ? 31.724  24.393 -62.802 1.00 50.62  ? 112 ILE E CD1   1 
ATOM   3629  N  N     . HIS E 1 74  ? 27.052  26.944 -65.031 1.00 51.97  ? 113 HIS E N     1 
ATOM   3630  C  CA    . HIS E 1 74  ? 25.636  26.921 -65.400 1.00 53.42  ? 113 HIS E CA    1 
ATOM   3631  C  C     . HIS E 1 74  ? 25.395  27.572 -66.749 1.00 55.61  ? 113 HIS E C     1 
ATOM   3632  O  O     . HIS E 1 74  ? 24.556  27.103 -67.520 1.00 55.54  ? 113 HIS E O     1 
ATOM   3633  C  CB    . HIS E 1 74  ? 24.775  27.613 -64.345 1.00 53.42  ? 113 HIS E CB    1 
ATOM   3634  C  CG    . HIS E 1 74  ? 23.315  27.508 -64.641 1.00 54.47  ? 113 HIS E CG    1 
ATOM   3635  N  ND1   . HIS E 1 74  ? 22.604  26.362 -64.345 1.00 56.08  ? 113 HIS E ND1   1 
ATOM   3636  C  CD2   . HIS E 1 74  ? 22.493  28.384 -65.260 1.00 55.49  ? 113 HIS E CD2   1 
ATOM   3637  C  CE1   . HIS E 1 74  ? 21.368  26.587 -64.757 1.00 56.51  ? 113 HIS E CE1   1 
ATOM   3638  N  NE2   . HIS E 1 74  ? 21.253  27.787 -65.320 1.00 56.51  ? 113 HIS E NE2   1 
ATOM   3639  N  N     . ALA E 1 75  ? 26.123  28.662 -67.031 1.00 57.48  ? 114 ALA E N     1 
ATOM   3640  C  CA    . ALA E 1 75  ? 26.020  29.397 -68.293 1.00 59.66  ? 114 ALA E CA    1 
ATOM   3641  C  C     . ALA E 1 75  ? 27.109  28.946 -69.294 1.00 61.65  ? 114 ALA E C     1 
ATOM   3642  O  O     . ALA E 1 75  ? 27.674  29.765 -70.024 1.00 62.01  ? 114 ALA E O     1 
ATOM   3643  C  CB    . ALA E 1 75  ? 26.101  30.901 -68.045 1.00 59.71  ? 114 ALA E CB    1 
ATOM   3644  N  N     . LYS E 1 76  ? 27.394  27.633 -69.306 1.00 62.55  ? 115 LYS E N     1 
ATOM   3645  C  CA    . LYS E 1 76  ? 28.338  26.970 -70.200 1.00 63.85  ? 115 LYS E CA    1 
ATOM   3646  C  C     . LYS E 1 76  ? 29.732  27.617 -70.247 1.00 64.30  ? 115 LYS E C     1 
ATOM   3647  O  O     . LYS E 1 76  ? 30.333  27.683 -71.314 1.00 64.60  ? 115 LYS E O     1 
ATOM   3648  C  CB    . LYS E 1 76  ? 27.733  26.839 -71.617 1.00 66.71  ? 115 LYS E CB    1 
ATOM   3649  C  CG    . LYS E 1 76  ? 26.269  26.358 -71.656 1.00 72.37  ? 115 LYS E CG    1 
ATOM   3650  C  CD    . LYS E 1 76  ? 26.083  24.917 -71.080 1.00 78.36  ? 115 LYS E CD    1 
ATOM   3651  C  CE    . LYS E 1 76  ? 24.654  24.611 -70.652 1.00 82.63  ? 115 LYS E CE    1 
ATOM   3652  N  NZ    . LYS E 1 76  ? 24.541  23.337 -69.878 1.00 84.54  ? 115 LYS E NZ    1 
ATOM   3653  N  N     . ARG E 1 77  ? 30.245  28.079 -69.105 1.00 64.24  ? 116 ARG E N     1 
ATOM   3654  C  CA    . ARG E 1 77  ? 31.568  28.705 -69.061 1.00 64.93  ? 116 ARG E CA    1 
ATOM   3655  C  C     . ARG E 1 77  ? 32.518  28.009 -68.086 1.00 65.56  ? 116 ARG E C     1 
ATOM   3656  O  O     . ARG E 1 77  ? 32.099  27.155 -67.310 1.00 65.86  ? 116 ARG E O     1 
ATOM   3657  C  CB    . ARG E 1 77  ? 31.449  30.205 -68.737 1.00 66.14  ? 116 ARG E CB    1 
ATOM   3658  C  CG    . ARG E 1 77  ? 30.886  31.011 -69.886 1.00 68.91  ? 116 ARG E CG    1 
ATOM   3659  C  CD    . ARG E 1 77  ? 30.855  32.483 -69.567 1.00 71.93  ? 116 ARG E CD    1 
ATOM   3660  N  NE    . ARG E 1 77  ? 29.673  32.855 -68.790 1.00 74.84  ? 116 ARG E NE    1 
ATOM   3661  C  CZ    . ARG E 1 77  ? 29.698  33.212 -67.510 1.00 76.88  ? 116 ARG E CZ    1 
ATOM   3662  N  NH1   . ARG E 1 77  ? 30.848  33.242 -66.843 1.00 76.55  ? 116 ARG E NH1   1 
ATOM   3663  N  NH2   . ARG E 1 77  ? 28.575  33.539 -66.884 1.00 76.62  ? 116 ARG E NH2   1 
ATOM   3664  N  N     . VAL E 1 78  ? 33.805  28.342 -68.153 1.00 65.62  ? 117 VAL E N     1 
ATOM   3665  C  CA    . VAL E 1 78  ? 34.836  27.821 -67.249 1.00 66.33  ? 117 VAL E CA    1 
ATOM   3666  C  C     . VAL E 1 78  ? 35.458  28.960 -66.396 1.00 66.72  ? 117 VAL E C     1 
ATOM   3667  O  O     . VAL E 1 78  ? 36.026  28.703 -65.319 1.00 66.90  ? 117 VAL E O     1 
ATOM   3668  C  CB    . VAL E 1 78  ? 35.904  27.031 -68.033 1.00 67.45  ? 117 VAL E CB    1 
ATOM   3669  C  CG1   . VAL E 1 78  ? 37.108  26.685 -67.158 1.00 68.04  ? 117 VAL E CG1   1 
ATOM   3670  C  CG2   . VAL E 1 78  ? 35.302  25.772 -68.652 1.00 68.21  ? 117 VAL E CG2   1 
ATOM   3671  N  N     . THR E 1 79  ? 35.323  30.227 -66.883 1.00 66.39  ? 118 THR E N     1 
ATOM   3672  C  CA    . THR E 1 79  ? 35.822  31.422 -66.222 1.00 66.40  ? 118 THR E CA    1 
ATOM   3673  C  C     . THR E 1 79  ? 34.711  32.217 -65.513 1.00 65.62  ? 118 THR E C     1 
ATOM   3674  O  O     . THR E 1 79  ? 33.656  32.510 -66.095 1.00 65.44  ? 118 THR E O     1 
ATOM   3675  C  CB    . THR E 1 79  ? 36.664  32.291 -67.175 1.00 68.03  ? 118 THR E CB    1 
ATOM   3676  O  OG1   . THR E 1 79  ? 36.991  33.548 -66.557 1.00 68.71  ? 118 THR E OG1   1 
ATOM   3677  C  CG2   . THR E 1 79  ? 36.015  32.487 -68.525 1.00 68.78  ? 118 THR E CG2   1 
ATOM   3678  N  N     . ILE E 1 80  ? 34.995  32.563 -64.234 1.00 64.82  ? 119 ILE E N     1 
ATOM   3679  C  CA    . ILE E 1 80  ? 34.129  33.328 -63.348 1.00 64.37  ? 119 ILE E CA    1 
ATOM   3680  C  C     . ILE E 1 80  ? 34.099  34.796 -63.769 1.00 64.40  ? 119 ILE E C     1 
ATOM   3681  O  O     . ILE E 1 80  ? 35.133  35.388 -64.047 1.00 64.42  ? 119 ILE E O     1 
ATOM   3682  C  CB    . ILE E 1 80  ? 34.555  33.131 -61.874 1.00 64.20  ? 119 ILE E CB    1 
ATOM   3683  C  CG1   . ILE E 1 80  ? 36.028  33.503 -61.650 1.00 64.63  ? 119 ILE E CG1   1 
ATOM   3684  C  CG2   . ILE E 1 80  ? 34.295  31.706 -61.435 1.00 64.57  ? 119 ILE E CG2   1 
ATOM   3685  C  CD1   . ILE E 1 80  ? 36.415  33.614 -60.206 1.00 65.60  ? 119 ILE E CD1   1 
ATOM   3686  N  N     . MET E 1 81  ? 32.908  35.357 -63.881 1.00 64.30  ? 120 MET E N     1 
ATOM   3687  C  CA    . MET E 1 81  ? 32.710  36.737 -64.316 1.00 64.75  ? 120 MET E CA    1 
ATOM   3688  C  C     . MET E 1 81  ? 31.915  37.505 -63.266 1.00 64.33  ? 120 MET E C     1 
ATOM   3689  O  O     . MET E 1 81  ? 31.195  36.880 -62.497 1.00 64.46  ? 120 MET E O     1 
ATOM   3690  C  CB    . MET E 1 81  ? 31.919  36.739 -65.635 1.00 66.13  ? 120 MET E CB    1 
ATOM   3691  C  CG    . MET E 1 81  ? 32.734  36.345 -66.835 1.00 69.21  ? 120 MET E CG    1 
ATOM   3692  S  SD    . MET E 1 81  ? 31.700  36.354 -68.311 1.00 75.57  ? 120 MET E SD    1 
ATOM   3693  C  CE    . MET E 1 81  ? 32.948  36.109 -69.562 1.00 76.57  ? 120 MET E CE    1 
ATOM   3694  N  N     . PRO E 1 82  ? 31.975  38.853 -63.219 1.00 63.88  ? 121 PRO E N     1 
ATOM   3695  C  CA    . PRO E 1 82  ? 31.176  39.586 -62.215 1.00 63.36  ? 121 PRO E CA    1 
ATOM   3696  C  C     . PRO E 1 82  ? 29.690  39.225 -62.201 1.00 62.37  ? 121 PRO E C     1 
ATOM   3697  O  O     . PRO E 1 82  ? 29.115  39.126 -61.121 1.00 62.62  ? 121 PRO E O     1 
ATOM   3698  C  CB    . PRO E 1 82  ? 31.415  41.050 -62.576 1.00 64.29  ? 121 PRO E CB    1 
ATOM   3699  C  CG    . PRO E 1 82  ? 32.772  41.040 -63.194 1.00 64.98  ? 121 PRO E CG    1 
ATOM   3700  C  CD    . PRO E 1 82  ? 32.793  39.782 -64.023 1.00 63.39  ? 121 PRO E CD    1 
ATOM   3701  N  N     . LYS E 1 83  ? 29.091  38.933 -63.372 1.00 60.96  ? 122 LYS E N     1 
ATOM   3702  C  CA    . LYS E 1 83  ? 27.679  38.544 -63.431 1.00 59.90  ? 122 LYS E CA    1 
ATOM   3703  C  C     . LYS E 1 83  ? 27.376  37.216 -62.709 1.00 57.94  ? 122 LYS E C     1 
ATOM   3704  O  O     . LYS E 1 83  ? 26.229  36.962 -62.363 1.00 57.92  ? 122 LYS E O     1 
ATOM   3705  C  CB    . LYS E 1 83  ? 27.155  38.535 -64.876 1.00 62.05  ? 122 LYS E CB    1 
ATOM   3706  C  CG    . LYS E 1 83  ? 27.917  37.646 -65.847 1.00 65.92  ? 122 LYS E CG    1 
ATOM   3707  C  CD    . LYS E 1 83  ? 27.352  37.849 -67.249 1.00 70.29  ? 122 LYS E CD    1 
ATOM   3708  C  CE    . LYS E 1 83  ? 27.592  36.682 -68.168 1.00 74.45  ? 122 LYS E CE    1 
ATOM   3709  N  NZ    . LYS E 1 83  ? 26.658  36.700 -69.327 1.00 76.88  ? 122 LYS E NZ    1 
ATOM   3710  N  N     . ASP E 1 84  ? 28.402  36.399 -62.455 1.00 56.16  ? 123 ASP E N     1 
ATOM   3711  C  CA    . ASP E 1 84  ? 28.281  35.148 -61.714 1.00 54.73  ? 123 ASP E CA    1 
ATOM   3712  C  C     . ASP E 1 84  ? 28.348  35.467 -60.221 1.00 53.35  ? 123 ASP E C     1 
ATOM   3713  O  O     . ASP E 1 84  ? 27.525  34.962 -59.467 1.00 53.55  ? 123 ASP E O     1 
ATOM   3714  C  CB    . ASP E 1 84  ? 29.392  34.154 -62.096 1.00 55.24  ? 123 ASP E CB    1 
ATOM   3715  C  CG    . ASP E 1 84  ? 29.453  33.812 -63.567 1.00 56.49  ? 123 ASP E CG    1 
ATOM   3716  O  OD1   . ASP E 1 84  ? 28.380  33.648 -64.183 1.00 56.03  ? 123 ASP E OD1   1 
ATOM   3717  O  OD2   . ASP E 1 84  ? 30.576  33.691 -64.099 1.00 57.73  ? 123 ASP E OD2   1 
ATOM   3718  N  N     . ILE E 1 85  ? 29.286  36.338 -59.790 1.00 51.90  ? 124 ILE E N     1 
ATOM   3719  C  CA    . ILE E 1 85  ? 29.382  36.756 -58.384 1.00 50.97  ? 124 ILE E CA    1 
ATOM   3720  C  C     . ILE E 1 85  ? 28.068  37.420 -57.952 1.00 50.11  ? 124 ILE E C     1 
ATOM   3721  O  O     . ILE E 1 85  ? 27.554  37.135 -56.876 1.00 50.09  ? 124 ILE E O     1 
ATOM   3722  C  CB    . ILE E 1 85  ? 30.572  37.719 -58.130 1.00 51.06  ? 124 ILE E CB    1 
ATOM   3723  C  CG1   . ILE E 1 85  ? 31.923  37.069 -58.487 1.00 51.72  ? 124 ILE E CG1   1 
ATOM   3724  C  CG2   . ILE E 1 85  ? 30.550  38.214 -56.683 1.00 51.47  ? 124 ILE E CG2   1 
ATOM   3725  C  CD1   . ILE E 1 85  ? 33.214  37.807 -57.964 1.00 52.81  ? 124 ILE E CD1   1 
ATOM   3726  N  N     . GLN E 1 86  ? 27.513  38.264 -58.828 1.00 49.29  ? 125 GLN E N     1 
ATOM   3727  C  CA    . GLN E 1 86  ? 26.259  38.968 -58.604 1.00 49.03  ? 125 GLN E CA    1 
ATOM   3728  C  C     . GLN E 1 86  ? 25.091  38.001 -58.507 1.00 47.79  ? 125 GLN E C     1 
ATOM   3729  O  O     . GLN E 1 86  ? 24.249  38.176 -57.633 1.00 48.15  ? 125 GLN E O     1 
ATOM   3730  C  CB    . GLN E 1 86  ? 25.988  39.973 -59.735 1.00 51.35  ? 125 GLN E CB    1 
ATOM   3731  C  CG    . GLN E 1 86  ? 26.860  41.213 -59.704 1.00 55.37  ? 125 GLN E CG    1 
ATOM   3732  C  CD    . GLN E 1 86  ? 26.929  41.856 -61.071 1.00 60.42  ? 125 GLN E CD    1 
ATOM   3733  O  OE1   . GLN E 1 86  ? 25.984  41.787 -61.885 1.00 60.89  ? 125 GLN E OE1   1 
ATOM   3734  N  NE2   . GLN E 1 86  ? 28.068  42.490 -61.349 1.00 62.37  ? 125 GLN E NE2   1 
ATOM   3735  N  N     . LEU E 1 87  ? 25.021  36.998 -59.397 1.00 46.22  ? 126 LEU E N     1 
ATOM   3736  C  CA    . LEU E 1 87  ? 23.932  36.033 -59.357 1.00 45.47  ? 126 LEU E CA    1 
ATOM   3737  C  C     . LEU E 1 87  ? 24.020  35.211 -58.067 1.00 45.53  ? 126 LEU E C     1 
ATOM   3738  O  O     . LEU E 1 87  ? 22.993  34.992 -57.418 1.00 45.95  ? 126 LEU E O     1 
ATOM   3739  C  CB    . LEU E 1 87  ? 23.957  35.114 -60.586 1.00 45.03  ? 126 LEU E CB    1 
ATOM   3740  C  CG    . LEU E 1 87  ? 22.844  34.078 -60.659 1.00 45.47  ? 126 LEU E CG    1 
ATOM   3741  C  CD1   . LEU E 1 87  ? 21.500  34.735 -60.825 1.00 45.91  ? 126 LEU E CD1   1 
ATOM   3742  C  CD2   . LEU E 1 87  ? 23.081  33.114 -61.767 1.00 45.54  ? 126 LEU E CD2   1 
ATOM   3743  N  N     . ALA E 1 88  ? 25.253  34.816 -57.660 1.00 44.58  ? 127 ALA E N     1 
ATOM   3744  C  CA    . ALA E 1 88  ? 25.477  34.054 -56.435 1.00 43.77  ? 127 ALA E CA    1 
ATOM   3745  C  C     . ALA E 1 88  ? 25.008  34.848 -55.214 1.00 43.38  ? 127 ALA E C     1 
ATOM   3746  O  O     . ALA E 1 88  ? 24.241  34.325 -54.412 1.00 43.55  ? 127 ALA E O     1 
ATOM   3747  C  CB    . ALA E 1 88  ? 26.949  33.672 -56.307 1.00 43.53  ? 127 ALA E CB    1 
ATOM   3748  N  N     . ARG E 1 89  ? 25.388  36.126 -55.122 1.00 42.75  ? 128 ARG E N     1 
ATOM   3749  C  CA    . ARG E 1 89  ? 24.995  36.952 -54.003 1.00 42.87  ? 128 ARG E CA    1 
ATOM   3750  C  C     . ARG E 1 89  ? 23.534  37.287 -54.023 1.00 43.05  ? 128 ARG E C     1 
ATOM   3751  O  O     . ARG E 1 89  ? 22.966  37.428 -52.957 1.00 43.42  ? 128 ARG E O     1 
ATOM   3752  C  CB    . ARG E 1 89  ? 25.821  38.219 -53.945 1.00 44.52  ? 128 ARG E CB    1 
ATOM   3753  C  CG    . ARG E 1 89  ? 27.307  37.964 -53.756 1.00 48.01  ? 128 ARG E CG    1 
ATOM   3754  C  CD    . ARG E 1 89  ? 28.175  39.209 -53.548 1.00 51.79  ? 128 ARG E CD    1 
ATOM   3755  N  NE    . ARG E 1 89  ? 27.475  40.498 -53.420 1.00 56.35  ? 128 ARG E NE    1 
ATOM   3756  C  CZ    . ARG E 1 89  ? 27.167  41.075 -52.264 1.00 59.91  ? 128 ARG E CZ    1 
ATOM   3757  N  NH1   . ARG E 1 89  ? 27.493  40.493 -51.115 1.00 60.15  ? 128 ARG E NH1   1 
ATOM   3758  N  NH2   . ARG E 1 89  ? 26.518  42.233 -52.246 1.00 60.39  ? 128 ARG E NH2   1 
ATOM   3759  N  N     . ARG E 1 90  ? 22.918  37.443 -55.199 1.00 42.99  ? 129 ARG E N     1 
ATOM   3760  C  CA    . ARG E 1 90  ? 21.488  37.740 -55.279 1.00 43.62  ? 129 ARG E CA    1 
ATOM   3761  C  C     . ARG E 1 90  ? 20.646  36.555 -54.744 1.00 44.17  ? 129 ARG E C     1 
ATOM   3762  O  O     . ARG E 1 90  ? 19.772  36.752 -53.901 1.00 44.49  ? 129 ARG E O     1 
ATOM   3763  C  CB    . ARG E 1 90  ? 21.081  38.077 -56.711 1.00 45.27  ? 129 ARG E CB    1 
ATOM   3764  C  CG    . ARG E 1 90  ? 19.596  38.368 -56.851 1.00 50.80  ? 129 ARG E CG    1 
ATOM   3765  C  CD    . ARG E 1 90  ? 19.267  39.145 -58.126 1.00 57.30  ? 129 ARG E CD    1 
ATOM   3766  N  NE    . ARG E 1 90  ? 19.609  40.572 -58.027 1.00 62.31  ? 129 ARG E NE    1 
ATOM   3767  C  CZ    . ARG E 1 90  ? 18.719  41.561 -58.047 1.00 64.93  ? 129 ARG E CZ    1 
ATOM   3768  N  NH1   . ARG E 1 90  ? 17.422  41.294 -58.187 1.00 64.91  ? 129 ARG E NH1   1 
ATOM   3769  N  NH2   . ARG E 1 90  ? 19.118  42.824 -57.937 1.00 64.40  ? 129 ARG E NH2   1 
ATOM   3770  N  N     . ILE E 1 91  ? 20.934  35.328 -55.197 1.00 43.99  ? 130 ILE E N     1 
ATOM   3771  C  CA    . ILE E 1 91  ? 20.217  34.127 -54.762 1.00 44.23  ? 130 ILE E CA    1 
ATOM   3772  C  C     . ILE E 1 91  ? 20.548  33.757 -53.296 1.00 44.03  ? 130 ILE E C     1 
ATOM   3773  O  O     . ILE E 1 91  ? 19.666  33.290 -52.569 1.00 43.78  ? 130 ILE E O     1 
ATOM   3774  C  CB    . ILE E 1 91  ? 20.461  32.991 -55.770 1.00 44.62  ? 130 ILE E CB    1 
ATOM   3775  C  CG1   . ILE E 1 91  ? 19.956  33.442 -57.162 1.00 45.24  ? 130 ILE E CG1   1 
ATOM   3776  C  CG2   . ILE E 1 91  ? 19.807  31.692 -55.311 1.00 45.10  ? 130 ILE E CG2   1 
ATOM   3777  C  CD1   . ILE E 1 91  ? 20.202  32.526 -58.229 1.00 46.46  ? 130 ILE E CD1   1 
ATOM   3778  N  N     . ARG E 1 92  ? 21.784  34.071 -52.845 1.00 43.78  ? 131 ARG E N     1 
ATOM   3779  C  CA    . ARG E 1 92  ? 22.227  33.906 -51.456 1.00 44.13  ? 131 ARG E CA    1 
ATOM   3780  C  C     . ARG E 1 92  ? 21.455  34.872 -50.477 1.00 46.00  ? 131 ARG E C     1 
ATOM   3781  O  O     . ARG E 1 92  ? 21.527  34.709 -49.255 1.00 46.34  ? 131 ARG E O     1 
ATOM   3782  C  CB    . ARG E 1 92  ? 23.743  34.193 -51.347 1.00 43.60  ? 131 ARG E CB    1 
ATOM   3783  C  CG    . ARG E 1 92  ? 24.684  32.995 -51.391 1.00 43.59  ? 131 ARG E CG    1 
ATOM   3784  C  CD    . ARG E 1 92  ? 26.102  33.475 -51.644 1.00 44.53  ? 131 ARG E CD    1 
ATOM   3785  N  NE    . ARG E 1 92  ? 27.143  32.575 -51.138 1.00 46.83  ? 131 ARG E NE    1 
ATOM   3786  C  CZ    . ARG E 1 92  ? 28.076  32.930 -50.255 1.00 49.01  ? 131 ARG E CZ    1 
ATOM   3787  N  NH1   . ARG E 1 92  ? 28.097  34.160 -49.760 1.00 49.05  ? 131 ARG E NH1   1 
ATOM   3788  N  NH2   . ARG E 1 92  ? 28.993  32.053 -49.854 1.00 48.58  ? 131 ARG E NH2   1 
ATOM   3789  N  N     . GLY E 1 93  ? 20.764  35.876 -51.013 1.00 46.98  ? 132 GLY E N     1 
ATOM   3790  C  CA    . GLY E 1 93  ? 20.026  36.825 -50.196 1.00 48.81  ? 132 GLY E CA    1 
ATOM   3791  C  C     . GLY E 1 93  ? 20.908  37.917 -49.631 1.00 50.70  ? 132 GLY E C     1 
ATOM   3792  O  O     . GLY E 1 93  ? 20.742  38.334 -48.482 1.00 51.20  ? 132 GLY E O     1 
ATOM   3793  N  N     . GLU E 1 94  ? 21.915  38.302 -50.400 1.00 51.53  ? 133 GLU E N     1 
ATOM   3794  C  CA    . GLU E 1 94  ? 22.827  39.381 -49.969 1.00 53.08  ? 133 GLU E CA    1 
ATOM   3795  C  C     . GLU E 1 94  ? 22.544  40.590 -50.857 1.00 56.08  ? 133 GLU E C     1 
ATOM   3796  O  O     . GLU E 1 94  ? 22.716  41.716 -50.392 1.00 56.01  ? 133 GLU E O     1 
ATOM   3797  C  CB    . GLU E 1 94  ? 24.279  38.933 -50.121 1.00 53.16  ? 133 GLU E CB    1 
ATOM   3798  C  CG    . GLU E 1 94  ? 24.621  37.690 -49.330 1.00 53.39  ? 133 GLU E CG    1 
ATOM   3799  C  CD    . GLU E 1 94  ? 26.021  37.155 -49.532 1.00 53.89  ? 133 GLU E CD    1 
ATOM   3800  O  OE1   . GLU E 1 94  ? 26.888  37.935 -49.851 1.00 54.35  ? 133 GLU E OE1   1 
ATOM   3801  O  OE2   . GLU E 1 94  ? 26.227  35.968 -49.361 1.00 53.69  ? 133 GLU E OE2   1 
ATOM   3802  N  N     . ARG E 1 95  ? 22.062  40.330 -52.070 1.00 58.52  ? 134 ARG E N     1 
ATOM   3803  C  CA    . ARG E 1 95  ? 21.787  41.387 -53.071 1.00 61.32  ? 134 ARG E CA    1 
ATOM   3804  C  C     . ARG E 1 95  ? 20.359  41.885 -53.305 1.00 63.32  ? 134 ARG E C     1 
ATOM   3805  O  O     . ARG E 1 95  ? 20.089  43.029 -52.947 1.00 63.95  ? 134 ARG E O     1 
ATOM   3806  C  CB    . ARG E 1 95  ? 22.309  40.949 -54.442 1.00 63.66  ? 134 ARG E CB    1 
ATOM   3807  C  CG    . ARG E 1 95  ? 22.155  41.991 -55.538 1.00 68.05  ? 134 ARG E CG    1 
ATOM   3808  C  CD    . ARG E 1 95  ? 23.306  42.023 -56.517 1.00 72.57  ? 134 ARG E CD    1 
ATOM   3809  N  NE    . ARG E 1 95  ? 24.206  43.121 -56.207 1.00 77.27  ? 134 ARG E NE    1 
ATOM   3810  C  CZ    . ARG E 1 95  ? 23.851  44.397 -56.091 1.00 80.10  ? 134 ARG E CZ    1 
ATOM   3811  N  NH1   . ARG E 1 95  ? 22.595  44.762 -56.272 1.00 79.57  ? 134 ARG E NH1   1 
ATOM   3812  N  NH2   . ARG E 1 95  ? 24.756  45.311 -55.798 1.00 80.27  ? 134 ARG E NH2   1 
ATOM   3813  N  N     . ALA E 1 96  ? 19.483  41.061 -53.882 1.00 64.05  ? 135 ALA E N     1 
ATOM   3814  C  CA    . ALA E 1 96  ? 18.048  41.425 -53.977 1.00 65.06  ? 135 ALA E CA    1 
ATOM   3815  C  C     . ALA E 1 96  ? 17.136  40.191 -53.927 1.00 65.84  ? 135 ALA E C     1 
ATOM   3816  O  O     . ALA E 1 96  ? 17.522  39.177 -53.370 1.00 65.92  ? 135 ALA E O     1 
ATOM   3817  C  CB    . ALA E 1 96  ? 17.824  42.223 -55.235 1.00 65.05  ? 135 ALA E CB    1 
ATOM   3818  O  OXT   . ALA E 1 96  ? 16.023  40.290 -54.456 1.00 67.87  ? 135 ALA E OXT   1 
ATOM   3819  N  N     . ASN F 2 10  ? 44.276  50.990 -48.845 1.00 84.42  ? 25  ASN F N     1 
ATOM   3820  C  CA    . ASN F 2 10  ? 44.677  49.633 -48.462 1.00 85.02  ? 25  ASN F CA    1 
ATOM   3821  C  C     . ASN F 2 10  ? 43.850  48.523 -49.089 1.00 84.98  ? 25  ASN F C     1 
ATOM   3822  O  O     . ASN F 2 10  ? 44.266  47.358 -49.042 1.00 84.64  ? 25  ASN F O     1 
ATOM   3823  C  CB    . ASN F 2 10  ? 44.694  49.483 -46.955 1.00 86.46  ? 25  ASN F CB    1 
ATOM   3824  C  CG    . ASN F 2 10  ? 45.735  50.358 -46.324 1.00 89.61  ? 25  ASN F CG    1 
ATOM   3825  O  OD1   . ASN F 2 10  ? 46.928  50.216 -46.601 1.00 90.57  ? 25  ASN F OD1   1 
ATOM   3826  N  ND2   . ASN F 2 10  ? 45.303  51.291 -45.481 1.00 90.19  ? 25  ASN F ND2   1 
ATOM   3827  N  N     . ILE F 2 11  ? 42.686  48.872 -49.671 1.00 85.07  ? 26  ILE F N     1 
ATOM   3828  C  CA    . ILE F 2 11  ? 41.826  47.914 -50.364 1.00 85.60  ? 26  ILE F CA    1 
ATOM   3829  C  C     . ILE F 2 11  ? 42.591  47.245 -51.538 1.00 85.80  ? 26  ILE F C     1 
ATOM   3830  O  O     . ILE F 2 11  ? 42.311  46.089 -51.872 1.00 86.36  ? 26  ILE F O     1 
ATOM   3831  C  CB    . ILE F 2 11  ? 40.456  48.554 -50.767 1.00 86.16  ? 26  ILE F CB    1 
ATOM   3832  C  CG1   . ILE F 2 11  ? 39.266  47.789 -50.144 1.00 87.17  ? 26  ILE F CG1   1 
ATOM   3833  C  CG2   . ILE F 2 11  ? 40.273  48.756 -52.279 1.00 86.59  ? 26  ILE F CG2   1 
ATOM   3834  C  CD1   . ILE F 2 11  ? 39.141  46.322 -50.523 1.00 88.31  ? 26  ILE F CD1   1 
ATOM   3835  N  N     . GLN F 2 12  ? 43.593  47.940 -52.114 1.00 85.15  ? 27  GLN F N     1 
ATOM   3836  C  CA    . GLN F 2 12  ? 44.393  47.361 -53.185 1.00 84.98  ? 27  GLN F CA    1 
ATOM   3837  C  C     . GLN F 2 12  ? 45.465  46.372 -52.672 1.00 85.11  ? 27  GLN F C     1 
ATOM   3838  O  O     . GLN F 2 12  ? 46.005  45.612 -53.480 1.00 85.20  ? 27  GLN F O     1 
ATOM   3839  C  CB    . GLN F 2 12  ? 44.983  48.450 -54.076 1.00 86.10  ? 27  GLN F CB    1 
ATOM   3840  C  CG    . GLN F 2 12  ? 43.908  49.355 -54.670 1.00 89.12  ? 27  GLN F CG    1 
ATOM   3841  C  CD    . GLN F 2 12  ? 42.995  48.617 -55.616 1.00 93.02  ? 27  GLN F CD    1 
ATOM   3842  O  OE1   . GLN F 2 12  ? 43.434  47.814 -56.449 1.00 94.55  ? 27  GLN F OE1   1 
ATOM   3843  N  NE2   . GLN F 2 12  ? 41.702  48.887 -55.521 1.00 93.23  ? 27  GLN F NE2   1 
ATOM   3844  N  N     . GLY F 2 13  ? 45.718  46.361 -51.344 1.00 84.82  ? 28  GLY F N     1 
ATOM   3845  C  CA    . GLY F 2 13  ? 46.624  45.445 -50.642 1.00 84.87  ? 28  GLY F CA    1 
ATOM   3846  C  C     . GLY F 2 13  ? 46.187  43.991 -50.732 1.00 84.56  ? 28  GLY F C     1 
ATOM   3847  O  O     . GLY F 2 13  ? 46.997  43.067 -50.570 1.00 84.74  ? 28  GLY F O     1 
ATOM   3848  N  N     . ILE F 2 14  ? 44.879  43.787 -50.987 1.00 83.87  ? 29  ILE F N     1 
ATOM   3849  C  CA    . ILE F 2 14  ? 44.245  42.506 -51.258 1.00 83.36  ? 29  ILE F CA    1 
ATOM   3850  C  C     . ILE F 2 14  ? 44.458  42.435 -52.770 1.00 82.89  ? 29  ILE F C     1 
ATOM   3851  O  O     . ILE F 2 14  ? 43.605  42.868 -53.547 1.00 83.10  ? 29  ILE F O     1 
ATOM   3852  C  CB    . ILE F 2 14  ? 42.738  42.546 -50.886 1.00 83.63  ? 29  ILE F CB    1 
ATOM   3853  C  CG1   . ILE F 2 14  ? 42.514  43.130 -49.477 1.00 84.27  ? 29  ILE F CG1   1 
ATOM   3854  C  CG2   . ILE F 2 14  ? 42.103  41.164 -51.014 1.00 84.08  ? 29  ILE F CG2   1 
ATOM   3855  C  CD1   . ILE F 2 14  ? 43.199  42.374 -48.370 1.00 85.30  ? 29  ILE F CD1   1 
ATOM   3856  N  N     . THR F 2 15  ? 45.675  42.012 -53.156 1.00 81.94  ? 30  THR F N     1 
ATOM   3857  C  CA    . THR F 2 15  ? 46.247  41.940 -54.503 1.00 81.38  ? 30  THR F CA    1 
ATOM   3858  C  C     . THR F 2 15  ? 45.501  41.019 -55.487 1.00 80.74  ? 30  THR F C     1 
ATOM   3859  O  O     . THR F 2 15  ? 44.621  40.274 -55.074 1.00 81.25  ? 30  THR F O     1 
ATOM   3860  C  CB    . THR F 2 15  ? 47.730  41.528 -54.350 1.00 82.33  ? 30  THR F CB    1 
ATOM   3861  O  OG1   . THR F 2 15  ? 47.819  40.317 -53.587 1.00 82.86  ? 30  THR F OG1   1 
ATOM   3862  C  CG2   . THR F 2 15  ? 48.556  42.607 -53.674 1.00 82.77  ? 30  THR F CG2   1 
ATOM   3863  N  N     . LYS F 2 16  ? 45.836  41.089 -56.794 1.00 79.46  ? 31  LYS F N     1 
ATOM   3864  C  CA    . LYS F 2 16  ? 45.296  40.173 -57.804 1.00 78.75  ? 31  LYS F CA    1 
ATOM   3865  C  C     . LYS F 2 16  ? 45.788  38.700 -57.549 1.00 78.06  ? 31  LYS F C     1 
ATOM   3866  O  O     . LYS F 2 16  ? 44.975  37.784 -57.680 1.00 77.79  ? 31  LYS F O     1 
ATOM   3867  C  CB    . LYS F 2 16  ? 45.605  40.681 -59.230 1.00 80.02  ? 31  LYS F CB    1 
ATOM   3868  C  CG    . LYS F 2 16  ? 45.464  39.647 -60.350 1.00 83.20  ? 31  LYS F CG    1 
ATOM   3869  C  CD    . LYS F 2 16  ? 46.816  39.325 -61.000 1.00 86.90  ? 31  LYS F CD    1 
ATOM   3870  C  CE    . LYS F 2 16  ? 46.751  38.235 -62.048 1.00 90.02  ? 31  LYS F CE    1 
ATOM   3871  N  NZ    . LYS F 2 16  ? 45.950  38.637 -63.237 1.00 91.77  ? 31  LYS F NZ    1 
ATOM   3872  N  N     . PRO F 2 17  ? 47.059  38.441 -57.113 1.00 77.71  ? 32  PRO F N     1 
ATOM   3873  C  CA    . PRO F 2 17  ? 47.469  37.054 -56.829 1.00 77.39  ? 32  PRO F CA    1 
ATOM   3874  C  C     . PRO F 2 17  ? 46.848  36.471 -55.554 1.00 76.64  ? 32  PRO F C     1 
ATOM   3875  O  O     . PRO F 2 17  ? 46.598  35.266 -55.509 1.00 76.59  ? 32  PRO F O     1 
ATOM   3876  C  CB    . PRO F 2 17  ? 48.994  37.154 -56.711 1.00 78.40  ? 32  PRO F CB    1 
ATOM   3877  C  CG    . PRO F 2 17  ? 49.253  38.541 -56.267 1.00 78.86  ? 32  PRO F CG    1 
ATOM   3878  C  CD    . PRO F 2 17  ? 48.188  39.378 -56.913 1.00 77.27  ? 32  PRO F CD    1 
ATOM   3879  N  N     . ALA F 2 18  ? 46.583  37.316 -54.528 1.00 75.85  ? 33  ALA F N     1 
ATOM   3880  C  CA    . ALA F 2 18  ? 45.940  36.875 -53.281 1.00 75.44  ? 33  ALA F CA    1 
ATOM   3881  C  C     . ALA F 2 18  ? 44.481  36.444 -53.549 1.00 74.70  ? 33  ALA F C     1 
ATOM   3882  O  O     . ALA F 2 18  ? 44.000  35.487 -52.947 1.00 74.43  ? 33  ALA F O     1 
ATOM   3883  C  CB    . ALA F 2 18  ? 45.981  37.989 -52.243 1.00 75.40  ? 33  ALA F CB    1 
ATOM   3884  N  N     . ILE F 2 19  ? 43.796  37.143 -54.477 1.00 74.03  ? 34  ILE F N     1 
ATOM   3885  C  CA    . ILE F 2 19  ? 42.430  36.845 -54.909 1.00 73.72  ? 34  ILE F CA    1 
ATOM   3886  C  C     . ILE F 2 19  ? 42.407  35.559 -55.746 1.00 73.86  ? 34  ILE F C     1 
ATOM   3887  O  O     . ILE F 2 19  ? 41.481  34.768 -55.620 1.00 73.98  ? 34  ILE F O     1 
ATOM   3888  C  CB    . ILE F 2 19  ? 41.817  38.061 -55.660 1.00 73.81  ? 34  ILE F CB    1 
ATOM   3889  C  CG1   . ILE F 2 19  ? 41.501  39.195 -54.674 1.00 74.40  ? 34  ILE F CG1   1 
ATOM   3890  C  CG2   . ILE F 2 19  ? 40.583  37.685 -56.494 1.00 74.21  ? 34  ILE F CG2   1 
ATOM   3891  C  CD1   . ILE F 2 19  ? 41.161  40.500 -55.332 1.00 75.61  ? 34  ILE F CD1   1 
ATOM   3892  N  N     . ARG F 2 20  ? 43.445  35.321 -56.557 1.00 73.85  ? 35  ARG F N     1 
ATOM   3893  C  CA    . ARG F 2 20  ? 43.548  34.121 -57.383 1.00 74.30  ? 35  ARG F CA    1 
ATOM   3894  C  C     . ARG F 2 20  ? 43.733  32.867 -56.553 1.00 74.04  ? 35  ARG F C     1 
ATOM   3895  O  O     . ARG F 2 20  ? 43.290  31.810 -56.979 1.00 74.25  ? 35  ARG F O     1 
ATOM   3896  C  CB    . ARG F 2 20  ? 44.691  34.237 -58.391 1.00 76.55  ? 35  ARG F CB    1 
ATOM   3897  C  CG    . ARG F 2 20  ? 44.350  35.040 -59.635 1.00 81.16  ? 35  ARG F CG    1 
ATOM   3898  C  CD    . ARG F 2 20  ? 45.497  35.085 -60.631 1.00 85.76  ? 35  ARG F CD    1 
ATOM   3899  N  NE    . ARG F 2 20  ? 45.629  33.848 -61.404 1.00 90.10  ? 35  ARG F NE    1 
ATOM   3900  C  CZ    . ARG F 2 20  ? 46.485  32.868 -61.117 1.00 93.63  ? 35  ARG F CZ    1 
ATOM   3901  N  NH1   . ARG F 2 20  ? 47.294  32.967 -60.066 1.00 93.46  ? 35  ARG F NH1   1 
ATOM   3902  N  NH2   . ARG F 2 20  ? 46.541  31.783 -61.881 1.00 94.19  ? 35  ARG F NH2   1 
ATOM   3903  N  N     . ARG F 2 21  ? 44.393  32.958 -55.388 1.00 73.54  ? 36  ARG F N     1 
ATOM   3904  C  CA    . ARG F 2 21  ? 44.573  31.803 -54.503 1.00 73.59  ? 36  ARG F CA    1 
ATOM   3905  C  C     . ARG F 2 21  ? 43.239  31.398 -53.870 1.00 73.23  ? 36  ARG F C     1 
ATOM   3906  O  O     . ARG F 2 21  ? 42.931  30.203 -53.782 1.00 73.47  ? 36  ARG F O     1 
ATOM   3907  C  CB    . ARG F 2 21  ? 45.608  32.104 -53.418 1.00 75.08  ? 36  ARG F CB    1 
ATOM   3908  C  CG    . ARG F 2 21  ? 46.943  32.502 -54.006 1.00 78.52  ? 36  ARG F CG    1 
ATOM   3909  C  CD    . ARG F 2 21  ? 48.079  32.359 -53.022 1.00 82.23  ? 36  ARG F CD    1 
ATOM   3910  N  NE    . ARG F 2 21  ? 48.188  33.466 -52.068 1.00 85.44  ? 36  ARG F NE    1 
ATOM   3911  C  CZ    . ARG F 2 21  ? 48.888  34.574 -52.280 1.00 87.51  ? 36  ARG F CZ    1 
ATOM   3912  N  NH1   . ARG F 2 21  ? 49.496  34.772 -53.441 1.00 87.08  ? 36  ARG F NH1   1 
ATOM   3913  N  NH2   . ARG F 2 21  ? 48.965  35.506 -51.339 1.00 87.66  ? 36  ARG F NH2   1 
ATOM   3914  N  N     . LEU F 2 22  ? 42.430  32.395 -53.460 1.00 72.32  ? 37  LEU F N     1 
ATOM   3915  C  CA    . LEU F 2 22  ? 41.112  32.137 -52.890 1.00 71.63  ? 37  LEU F CA    1 
ATOM   3916  C  C     . LEU F 2 22  ? 40.170  31.516 -53.940 1.00 71.66  ? 37  LEU F C     1 
ATOM   3917  O  O     . LEU F 2 22  ? 39.347  30.680 -53.589 1.00 71.98  ? 37  LEU F O     1 
ATOM   3918  C  CB    . LEU F 2 22  ? 40.533  33.403 -52.267 1.00 71.22  ? 37  LEU F CB    1 
ATOM   3919  C  CG    . LEU F 2 22  ? 41.319  33.940 -51.071 1.00 72.16  ? 37  LEU F CG    1 
ATOM   3920  C  CD1   . LEU F 2 22  ? 41.024  35.398 -50.831 1.00 72.74  ? 37  LEU F CD1   1 
ATOM   3921  C  CD2   . LEU F 2 22  ? 41.022  33.157 -49.822 1.00 72.61  ? 37  LEU F CD2   1 
ATOM   3922  N  N     . ALA F 2 23  ? 40.334  31.857 -55.227 1.00 71.31  ? 38  ALA F N     1 
ATOM   3923  C  CA    . ALA F 2 23  ? 39.534  31.255 -56.295 1.00 71.56  ? 38  ALA F CA    1 
ATOM   3924  C  C     . ALA F 2 23  ? 39.930  29.791 -56.490 1.00 71.76  ? 38  ALA F C     1 
ATOM   3925  O  O     . ALA F 2 23  ? 39.057  28.949 -56.646 1.00 71.79  ? 38  ALA F O     1 
ATOM   3926  C  CB    . ALA F 2 23  ? 39.714  32.024 -57.587 1.00 71.71  ? 38  ALA F CB    1 
ATOM   3927  N  N     . ARG F 2 24  ? 41.238  29.477 -56.404 1.00 71.80  ? 39  ARG F N     1 
ATOM   3928  C  CA    . ARG F 2 24  ? 41.750  28.106 -56.527 1.00 72.24  ? 39  ARG F CA    1 
ATOM   3929  C  C     . ARG F 2 24  ? 41.200  27.212 -55.423 1.00 72.00  ? 39  ARG F C     1 
ATOM   3930  O  O     . ARG F 2 24  ? 40.711  26.125 -55.722 1.00 72.34  ? 39  ARG F O     1 
ATOM   3931  C  CB    . ARG F 2 24  ? 43.288  28.067 -56.533 1.00 73.74  ? 39  ARG F CB    1 
ATOM   3932  C  CG    . ARG F 2 24  ? 43.943  28.886 -57.640 1.00 77.13  ? 39  ARG F CG    1 
ATOM   3933  C  CD    . ARG F 2 24  ? 43.414  28.592 -59.033 1.00 80.63  ? 39  ARG F CD    1 
ATOM   3934  N  NE    . ARG F 2 24  ? 44.331  29.084 -60.063 1.00 83.77  ? 39  ARG F NE    1 
ATOM   3935  C  CZ    . ARG F 2 24  ? 43.971  29.402 -61.302 1.00 86.09  ? 39  ARG F CZ    1 
ATOM   3936  N  NH1   . ARG F 2 24  ? 42.704  29.304 -61.678 1.00 86.49  ? 39  ARG F NH1   1 
ATOM   3937  N  NH2   . ARG F 2 24  ? 44.875  29.833 -62.173 1.00 85.49  ? 39  ARG F NH2   1 
ATOM   3938  N  N     . ARG F 2 25  ? 41.200  27.686 -54.163 1.00 71.31  ? 40  ARG F N     1 
ATOM   3939  C  CA    . ARG F 2 25  ? 40.620  26.927 -53.055 1.00 70.99  ? 40  ARG F CA    1 
ATOM   3940  C  C     . ARG F 2 25  ? 39.119  26.688 -53.295 1.00 71.91  ? 40  ARG F C     1 
ATOM   3941  O  O     . ARG F 2 25  ? 38.614  25.604 -53.025 1.00 71.93  ? 40  ARG F O     1 
ATOM   3942  C  CB    . ARG F 2 25  ? 40.859  27.652 -51.739 1.00 70.76  ? 40  ARG F CB    1 
ATOM   3943  C  CG    . ARG F 2 25  ? 40.513  26.831 -50.541 1.00 72.00  ? 40  ARG F CG    1 
ATOM   3944  C  CD    . ARG F 2 25  ? 41.145  27.438 -49.324 1.00 74.70  ? 40  ARG F CD    1 
ATOM   3945  N  NE    . ARG F 2 25  ? 42.558  27.090 -49.253 1.00 77.65  ? 40  ARG F NE    1 
ATOM   3946  C  CZ    . ARG F 2 25  ? 43.406  27.557 -48.340 1.00 79.91  ? 40  ARG F CZ    1 
ATOM   3947  N  NH1   . ARG F 2 25  ? 42.999  28.437 -47.432 1.00 79.54  ? 40  ARG F NH1   1 
ATOM   3948  N  NH2   . ARG F 2 25  ? 44.676  27.169 -48.345 1.00 79.76  ? 40  ARG F NH2   1 
ATOM   3949  N  N     . GLY F 2 26  ? 38.442  27.672 -53.879 1.00 72.60  ? 41  GLY F N     1 
ATOM   3950  C  CA    . GLY F 2 26  ? 37.036  27.558 -54.244 1.00 73.87  ? 41  GLY F CA    1 
ATOM   3951  C  C     . GLY F 2 26  ? 36.768  26.711 -55.480 1.00 75.06  ? 41  GLY F C     1 
ATOM   3952  O  O     . GLY F 2 26  ? 35.613  26.550 -55.882 1.00 75.54  ? 41  GLY F O     1 
ATOM   3953  N  N     . GLY F 2 27  ? 37.826  26.179 -56.091 1.00 75.34  ? 42  GLY F N     1 
ATOM   3954  C  CA    . GLY F 2 27  ? 37.738  25.327 -57.270 1.00 76.17  ? 42  GLY F CA    1 
ATOM   3955  C  C     . GLY F 2 27  ? 37.459  26.085 -58.548 1.00 76.74  ? 42  GLY F C     1 
ATOM   3956  O  O     . GLY F 2 27  ? 36.603  25.676 -59.330 1.00 76.80  ? 42  GLY F O     1 
ATOM   3957  N  N     . VAL F 2 28  ? 38.184  27.189 -58.776 1.00 76.88  ? 43  VAL F N     1 
ATOM   3958  C  CA    . VAL F 2 28  ? 37.982  28.016 -59.964 1.00 77.39  ? 43  VAL F CA    1 
ATOM   3959  C  C     . VAL F 2 28  ? 39.136  27.863 -60.958 1.00 77.70  ? 43  VAL F C     1 
ATOM   3960  O  O     . VAL F 2 28  ? 40.296  28.037 -60.577 1.00 77.95  ? 43  VAL F O     1 
ATOM   3961  C  CB    . VAL F 2 28  ? 37.752  29.490 -59.573 1.00 78.27  ? 43  VAL F CB    1 
ATOM   3962  C  CG1   . VAL F 2 28  ? 37.665  30.365 -60.802 1.00 79.07  ? 43  VAL F CG1   1 
ATOM   3963  C  CG2   . VAL F 2 28  ? 36.503  29.649 -58.712 1.00 78.76  ? 43  VAL F CG2   1 
ATOM   3964  N  N     . LYS F 2 29  ? 38.819  27.528 -62.228 1.00 77.51  ? 44  LYS F N     1 
ATOM   3965  C  CA    . LYS F 2 29  ? 39.845  27.339 -63.255 1.00 77.77  ? 44  LYS F CA    1 
ATOM   3966  C  C     . LYS F 2 29  ? 40.202  28.640 -63.964 1.00 77.67  ? 44  LYS F C     1 
ATOM   3967  O  O     . LYS F 2 29  ? 41.380  29.009 -64.011 1.00 77.96  ? 44  LYS F O     1 
ATOM   3968  C  CB    . LYS F 2 29  ? 39.431  26.262 -64.276 1.00 79.59  ? 44  LYS F CB    1 
ATOM   3969  C  CG    . LYS F 2 29  ? 40.607  25.727 -65.104 1.00 83.23  ? 44  LYS F CG    1 
ATOM   3970  C  CD    . LYS F 2 29  ? 40.141  24.820 -66.242 1.00 86.88  ? 44  LYS F CD    1 
ATOM   3971  C  CE    . LYS F 2 29  ? 41.188  23.829 -66.706 1.00 89.70  ? 44  LYS F CE    1 
ATOM   3972  N  NZ    . LYS F 2 29  ? 40.769  23.120 -67.945 1.00 91.16  ? 44  LYS F NZ    1 
ATOM   3973  N  N     . ARG F 2 30  ? 39.203  29.335 -64.519 1.00 77.08  ? 45  ARG F N     1 
ATOM   3974  C  CA    . ARG F 2 30  ? 39.467  30.588 -65.220 1.00 77.12  ? 45  ARG F CA    1 
ATOM   3975  C  C     . ARG F 2 30  ? 38.940  31.790 -64.425 1.00 76.18  ? 45  ARG F C     1 
ATOM   3976  O  O     . ARG F 2 30  ? 37.821  31.754 -63.930 1.00 76.27  ? 45  ARG F O     1 
ATOM   3977  C  CB    . ARG F 2 30  ? 38.925  30.524 -66.660 1.00 79.17  ? 45  ARG F CB    1 
ATOM   3978  C  CG    . ARG F 2 30  ? 39.747  31.334 -67.651 1.00 83.43  ? 45  ARG F CG    1 
ATOM   3979  C  CD    . ARG F 2 30  ? 39.806  30.705 -69.037 1.00 87.47  ? 45  ARG F CD    1 
ATOM   3980  N  NE    . ARG F 2 30  ? 40.515  31.578 -69.969 1.00 91.60  ? 45  ARG F NE    1 
ATOM   3981  C  CZ    . ARG F 2 30  ? 39.915  32.341 -70.878 1.00 95.26  ? 45  ARG F CZ    1 
ATOM   3982  N  NH1   . ARG F 2 30  ? 38.592  32.312 -71.013 1.00 95.63  ? 45  ARG F NH1   1 
ATOM   3983  N  NH2   . ARG F 2 30  ? 40.632  33.124 -71.675 1.00 95.60  ? 45  ARG F NH2   1 
ATOM   3984  N  N     . ILE F 2 31  ? 39.751  32.835 -64.266 1.00 75.22  ? 46  ILE F N     1 
ATOM   3985  C  CA    . ILE F 2 31  ? 39.351  34.009 -63.493 1.00 74.88  ? 46  ILE F CA    1 
ATOM   3986  C  C     . ILE F 2 31  ? 39.356  35.274 -64.350 1.00 74.37  ? 46  ILE F C     1 
ATOM   3987  O  O     . ILE F 2 31  ? 40.436  35.782 -64.655 1.00 74.72  ? 46  ILE F O     1 
ATOM   3988  C  CB    . ILE F 2 31  ? 40.294  34.200 -62.273 1.00 75.37  ? 46  ILE F CB    1 
ATOM   3989  C  CG1   . ILE F 2 31  ? 40.482  32.913 -61.463 1.00 76.33  ? 46  ILE F CG1   1 
ATOM   3990  C  CG2   . ILE F 2 31  ? 39.821  35.340 -61.389 1.00 75.94  ? 46  ILE F CG2   1 
ATOM   3991  C  CD1   . ILE F 2 31  ? 41.631  32.991 -60.508 1.00 77.68  ? 46  ILE F CD1   1 
ATOM   3992  N  N     . SER F 2 32  ? 38.177  35.836 -64.672 1.00 73.48  ? 47  SER F N     1 
ATOM   3993  C  CA    . SER F 2 32  ? 38.100  37.089 -65.439 1.00 73.09  ? 47  SER F CA    1 
ATOM   3994  C  C     . SER F 2 32  ? 38.905  38.239 -64.771 1.00 72.52  ? 47  SER F C     1 
ATOM   3995  O  O     . SER F 2 32  ? 39.188  38.191 -63.578 1.00 72.39  ? 47  SER F O     1 
ATOM   3996  C  CB    . SER F 2 32  ? 36.643  37.502 -65.655 1.00 74.34  ? 47  SER F CB    1 
ATOM   3997  O  OG    . SER F 2 32  ? 36.496  38.728 -66.359 1.00 76.28  ? 47  SER F OG    1 
ATOM   3998  N  N     . GLY F 2 33  ? 39.313  39.227 -65.558 1.00 71.85  ? 48  GLY F N     1 
ATOM   3999  C  CA    . GLY F 2 33  ? 40.072  40.361 -65.049 1.00 71.59  ? 48  GLY F CA    1 
ATOM   4000  C  C     . GLY F 2 33  ? 39.215  41.339 -64.273 1.00 71.11  ? 48  GLY F C     1 
ATOM   4001  O  O     . GLY F 2 33  ? 39.706  42.034 -63.384 1.00 71.05  ? 48  GLY F O     1 
ATOM   4002  N  N     . LEU F 2 34  ? 37.923  41.410 -64.613 1.00 70.76  ? 49  LEU F N     1 
ATOM   4003  C  CA    . LEU F 2 34  ? 36.971  42.279 -63.922 1.00 70.71  ? 49  LEU F CA    1 
ATOM   4004  C  C     . LEU F 2 34  ? 36.699  41.787 -62.491 1.00 70.41  ? 49  LEU F C     1 
ATOM   4005  O  O     . LEU F 2 34  ? 36.386  42.594 -61.616 1.00 70.49  ? 49  LEU F O     1 
ATOM   4006  C  CB    . LEU F 2 34  ? 35.650  42.325 -64.693 1.00 71.01  ? 49  LEU F CB    1 
ATOM   4007  C  CG    . LEU F 2 34  ? 35.720  42.639 -66.175 1.00 72.36  ? 49  LEU F CG    1 
ATOM   4008  C  CD1   . LEU F 2 34  ? 34.343  42.529 -66.803 1.00 73.00  ? 49  LEU F CD1   1 
ATOM   4009  C  CD2   . LEU F 2 34  ? 36.306  44.010 -66.415 1.00 72.78  ? 49  LEU F CD2   1 
ATOM   4010  N  N     . ILE F 2 35  ? 36.793  40.456 -62.273 1.00 69.70  ? 50  ILE F N     1 
ATOM   4011  C  CA    . ILE F 2 35  ? 36.605  39.772 -61.000 1.00 69.35  ? 50  ILE F CA    1 
ATOM   4012  C  C     . ILE F 2 35  ? 37.410  40.425 -59.891 1.00 68.99  ? 50  ILE F C     1 
ATOM   4013  O  O     . ILE F 2 35  ? 36.816  40.803 -58.893 1.00 69.58  ? 50  ILE F O     1 
ATOM   4014  C  CB    . ILE F 2 35  ? 36.951  38.262 -61.154 1.00 69.86  ? 50  ILE F CB    1 
ATOM   4015  C  CG1   . ILE F 2 35  ? 35.856  37.518 -61.921 1.00 71.00  ? 50  ILE F CG1   1 
ATOM   4016  C  CG2   . ILE F 2 35  ? 37.300  37.564 -59.821 1.00 70.18  ? 50  ILE F CG2   1 
ATOM   4017  C  CD1   . ILE F 2 35  ? 34.584  37.448 -61.238 1.00 72.32  ? 50  ILE F CD1   1 
ATOM   4018  N  N     . TYR F 2 36  ? 38.730  40.622 -60.073 1.00 67.76  ? 51  TYR F N     1 
ATOM   4019  C  CA    . TYR F 2 36  ? 39.613  41.175 -59.041 1.00 66.94  ? 51  TYR F CA    1 
ATOM   4020  C  C     . TYR F 2 36  ? 39.072  42.451 -58.392 1.00 64.92  ? 51  TYR F C     1 
ATOM   4021  O  O     . TYR F 2 36  ? 39.205  42.621 -57.182 1.00 64.83  ? 51  TYR F O     1 
ATOM   4022  C  CB    . TYR F 2 36  ? 41.038  41.371 -59.576 1.00 67.77  ? 51  TYR F CB    1 
ATOM   4023  C  CG    . TYR F 2 36  ? 41.571  40.149 -60.294 1.00 69.45  ? 51  TYR F CG    1 
ATOM   4024  C  CD1   . TYR F 2 36  ? 41.924  39.005 -59.594 1.00 70.87  ? 51  TYR F CD1   1 
ATOM   4025  C  CD2   . TYR F 2 36  ? 41.659  40.116 -61.679 1.00 70.55  ? 51  TYR F CD2   1 
ATOM   4026  C  CE1   . TYR F 2 36  ? 42.356  37.858 -60.254 1.00 71.85  ? 51  TYR F CE1   1 
ATOM   4027  C  CE2   . TYR F 2 36  ? 42.109  38.984 -62.348 1.00 71.55  ? 51  TYR F CE2   1 
ATOM   4028  C  CZ    . TYR F 2 36  ? 42.457  37.854 -61.633 1.00 72.57  ? 51  TYR F CZ    1 
ATOM   4029  O  OH    . TYR F 2 36  ? 42.896  36.725 -62.291 1.00 73.94  ? 51  TYR F OH    1 
ATOM   4030  N  N     . GLU F 2 37  ? 38.378  43.288 -59.177 1.00 63.04  ? 52  GLU F N     1 
ATOM   4031  C  CA    . GLU F 2 37  ? 37.791  44.509 -58.651 1.00 61.73  ? 52  GLU F CA    1 
ATOM   4032  C  C     . GLU F 2 37  ? 36.461  44.232 -57.949 1.00 60.12  ? 52  GLU F C     1 
ATOM   4033  O  O     . GLU F 2 37  ? 36.258  44.722 -56.840 1.00 60.49  ? 52  GLU F O     1 
ATOM   4034  C  CB    . GLU F 2 37  ? 37.682  45.586 -59.744 1.00 63.55  ? 52  GLU F CB    1 
ATOM   4035  C  CG    . GLU F 2 37  ? 37.735  47.020 -59.232 1.00 67.64  ? 52  GLU F CG    1 
ATOM   4036  C  CD    . GLU F 2 37  ? 38.916  47.461 -58.378 1.00 72.69  ? 52  GLU F CD    1 
ATOM   4037  O  OE1   . GLU F 2 37  ? 38.811  48.536 -57.742 1.00 73.07  ? 52  GLU F OE1   1 
ATOM   4038  O  OE2   . GLU F 2 37  ? 39.944  46.747 -58.344 1.00 74.77  ? 52  GLU F OE2   1 
ATOM   4039  N  N     . GLU F 2 38  ? 35.593  43.395 -58.544 1.00 58.09  ? 53  GLU F N     1 
ATOM   4040  C  CA    . GLU F 2 38  ? 34.295  43.004 -57.966 1.00 56.79  ? 53  GLU F CA    1 
ATOM   4041  C  C     . GLU F 2 38  ? 34.459  42.292 -56.621 1.00 54.86  ? 53  GLU F C     1 
ATOM   4042  O  O     . GLU F 2 38  ? 33.671  42.524 -55.709 1.00 54.84  ? 53  GLU F O     1 
ATOM   4043  C  CB    . GLU F 2 38  ? 33.472  42.136 -58.949 1.00 58.94  ? 53  GLU F CB    1 
ATOM   4044  C  CG    . GLU F 2 38  ? 32.274  42.840 -59.586 1.00 62.82  ? 53  GLU F CG    1 
ATOM   4045  C  CD    . GLU F 2 38  ? 31.001  42.956 -58.763 1.00 66.58  ? 53  GLU F CD    1 
ATOM   4046  O  OE1   . GLU F 2 38  ? 30.080  43.695 -59.182 1.00 66.02  ? 53  GLU F OE1   1 
ATOM   4047  O  OE2   . GLU F 2 38  ? 30.935  42.323 -57.686 1.00 68.74  ? 53  GLU F OE2   1 
ATOM   4048  N  N     . THR F 2 39  ? 35.504  41.469 -56.486 1.00 53.40  ? 54  THR F N     1 
ATOM   4049  C  CA    . THR F 2 39  ? 35.834  40.765 -55.248 1.00 52.80  ? 54  THR F CA    1 
ATOM   4050  C  C     . THR F 2 39  ? 36.234  41.771 -54.185 1.00 52.13  ? 54  THR F C     1 
ATOM   4051  O  O     . THR F 2 39  ? 35.810  41.657 -53.044 1.00 52.09  ? 54  THR F O     1 
ATOM   4052  C  CB    . THR F 2 39  ? 36.953  39.745 -55.475 1.00 54.11  ? 54  THR F CB    1 
ATOM   4053  O  OG1   . THR F 2 39  ? 36.609  38.897 -56.566 1.00 55.56  ? 54  THR F OG1   1 
ATOM   4054  C  CG2   . THR F 2 39  ? 37.217  38.892 -54.250 1.00 54.26  ? 54  THR F CG2   1 
ATOM   4055  N  N     . ARG F 2 40  ? 37.032  42.770 -54.568 1.00 51.62  ? 55  ARG F N     1 
ATOM   4056  C  CA    . ARG F 2 40  ? 37.448  43.828 -53.666 1.00 51.74  ? 55  ARG F CA    1 
ATOM   4057  C  C     . ARG F 2 40  ? 36.253  44.607 -53.122 1.00 51.11  ? 55  ARG F C     1 
ATOM   4058  O  O     . ARG F 2 40  ? 36.252  44.991 -51.957 1.00 51.55  ? 55  ARG F O     1 
ATOM   4059  C  CB    . ARG F 2 40  ? 38.479  44.747 -54.340 1.00 53.89  ? 55  ARG F CB    1 
ATOM   4060  C  CG    . ARG F 2 40  ? 39.887  44.152 -54.310 1.00 58.33  ? 55  ARG F CG    1 
ATOM   4061  C  CD    . ARG F 2 40  ? 40.963  45.116 -54.764 1.00 62.36  ? 55  ARG F CD    1 
ATOM   4062  N  NE    . ARG F 2 40  ? 41.211  45.031 -56.202 1.00 66.66  ? 55  ARG F NE    1 
ATOM   4063  C  CZ    . ARG F 2 40  ? 42.131  44.247 -56.764 1.00 70.00  ? 55  ARG F CZ    1 
ATOM   4064  N  NH1   . ARG F 2 40  ? 42.295  44.244 -58.081 1.00 70.31  ? 55  ARG F NH1   1 
ATOM   4065  N  NH2   . ARG F 2 40  ? 42.893  43.461 -56.013 1.00 69.75  ? 55  ARG F NH2   1 
ATOM   4066  N  N     . GLY F 2 41  ? 35.235  44.795 -53.947 1.00 50.09  ? 56  GLY F N     1 
ATOM   4067  C  CA    . GLY F 2 41  ? 34.012  45.466 -53.539 1.00 49.71  ? 56  GLY F CA    1 
ATOM   4068  C  C     . GLY F 2 41  ? 33.237  44.638 -52.538 1.00 48.77  ? 56  GLY F C     1 
ATOM   4069  O  O     . GLY F 2 41  ? 32.902  45.121 -51.459 1.00 48.36  ? 56  GLY F O     1 
ATOM   4070  N  N     . VAL F 2 42  ? 33.016  43.361 -52.869 1.00 48.22  ? 57  VAL F N     1 
ATOM   4071  C  CA    . VAL F 2 42  ? 32.301  42.387 -52.048 1.00 48.03  ? 57  VAL F CA    1 
ATOM   4072  C  C     . VAL F 2 42  ? 32.992  42.120 -50.699 1.00 48.00  ? 57  VAL F C     1 
ATOM   4073  O  O     . VAL F 2 42  ? 32.305  42.001 -49.687 1.00 48.14  ? 57  VAL F O     1 
ATOM   4074  C  CB    . VAL F 2 42  ? 32.056  41.104 -52.869 1.00 48.25  ? 57  VAL F CB    1 
ATOM   4075  C  CG1   . VAL F 2 42  ? 31.587  39.949 -51.995 1.00 48.69  ? 57  VAL F CG1   1 
ATOM   4076  C  CG2   . VAL F 2 42  ? 31.057  41.384 -53.980 1.00 48.42  ? 57  VAL F CG2   1 
ATOM   4077  N  N     . LEU F 2 43  ? 34.330  42.094 -50.667 1.00 47.73  ? 58  LEU F N     1 
ATOM   4078  C  CA    . LEU F 2 43  ? 35.086  41.925 -49.422 1.00 48.08  ? 58  LEU F CA    1 
ATOM   4079  C  C     . LEU F 2 43  ? 34.883  43.160 -48.531 1.00 48.66  ? 58  LEU F C     1 
ATOM   4080  O  O     . LEU F 2 43  ? 34.707  43.018 -47.318 1.00 49.20  ? 58  LEU F O     1 
ATOM   4081  C  CB    . LEU F 2 43  ? 36.592  41.742 -49.717 1.00 48.25  ? 58  LEU F CB    1 
ATOM   4082  C  CG    . LEU F 2 43  ? 37.550  41.855 -48.522 1.00 49.65  ? 58  LEU F CG    1 
ATOM   4083  C  CD1   . LEU F 2 43  ? 37.325  40.728 -47.530 1.00 50.41  ? 58  LEU F CD1   1 
ATOM   4084  C  CD2   . LEU F 2 43  ? 38.976  41.867 -48.981 1.00 50.24  ? 58  LEU F CD2   1 
ATOM   4085  N  N     . LYS F 2 44  ? 34.909  44.369 -49.136 1.00 48.22  ? 59  LYS F N     1 
ATOM   4086  C  CA    . LYS F 2 44  ? 34.734  45.623 -48.411 1.00 48.11  ? 59  LYS F CA    1 
ATOM   4087  C  C     . LYS F 2 44  ? 33.381  45.660 -47.738 1.00 47.89  ? 59  LYS F C     1 
ATOM   4088  O  O     . LYS F 2 44  ? 33.295  46.081 -46.590 1.00 48.27  ? 59  LYS F O     1 
ATOM   4089  C  CB    . LYS F 2 44  ? 34.905  46.838 -49.347 1.00 50.00  ? 59  LYS F CB    1 
ATOM   4090  C  CG    . LYS F 2 44  ? 35.109  48.180 -48.641 1.00 53.56  ? 59  LYS F CG    1 
ATOM   4091  C  CD    . LYS F 2 44  ? 35.297  49.327 -49.649 1.00 57.97  ? 59  LYS F CD    1 
ATOM   4092  C  CE    . LYS F 2 44  ? 35.580  50.658 -48.992 1.00 62.39  ? 59  LYS F CE    1 
ATOM   4093  N  NZ    . LYS F 2 44  ? 36.117  51.667 -49.962 1.00 64.40  ? 59  LYS F NZ    1 
ATOM   4094  N  N     . VAL F 2 45  ? 32.332  45.168 -48.427 1.00 47.20  ? 60  VAL F N     1 
ATOM   4095  C  CA    . VAL F 2 45  ? 30.983  45.148 -47.874 1.00 46.97  ? 60  VAL F CA    1 
ATOM   4096  C  C     . VAL F 2 45  ? 30.940  44.220 -46.697 1.00 46.63  ? 60  VAL F C     1 
ATOM   4097  O  O     . VAL F 2 45  ? 30.524  44.623 -45.617 1.00 46.84  ? 60  VAL F O     1 
ATOM   4098  C  CB    . VAL F 2 45  ? 29.914  44.784 -48.922 1.00 47.57  ? 60  VAL F CB    1 
ATOM   4099  C  CG1   . VAL F 2 45  ? 28.533  44.791 -48.289 1.00 48.08  ? 60  VAL F CG1   1 
ATOM   4100  C  CG2   . VAL F 2 45  ? 29.954  45.739 -50.104 1.00 48.11  ? 60  VAL F CG2   1 
ATOM   4101  N  N     . PHE F 2 46  ? 31.482  43.018 -46.863 1.00 46.30  ? 61  PHE F N     1 
ATOM   4102  C  CA    . PHE F 2 46  ? 31.515  42.024 -45.797 1.00 46.54  ? 61  PHE F CA    1 
ATOM   4103  C  C     . PHE F 2 46  ? 32.223  42.556 -44.548 1.00 46.17  ? 61  PHE F C     1 
ATOM   4104  O  O     . PHE F 2 46  ? 31.679  42.491 -43.444 1.00 46.30  ? 61  PHE F O     1 
ATOM   4105  C  CB    . PHE F 2 46  ? 32.176  40.725 -46.293 1.00 46.59  ? 61  PHE F CB    1 
ATOM   4106  C  CG    . PHE F 2 46  ? 32.228  39.619 -45.272 1.00 47.57  ? 61  PHE F CG    1 
ATOM   4107  C  CD1   . PHE F 2 46  ? 33.253  39.553 -44.349 1.00 48.57  ? 61  PHE F CD1   1 
ATOM   4108  C  CD2   . PHE F 2 46  ? 31.274  38.624 -45.259 1.00 48.62  ? 61  PHE F CD2   1 
ATOM   4109  C  CE1   . PHE F 2 46  ? 33.300  38.536 -43.407 1.00 49.41  ? 61  PHE F CE1   1 
ATOM   4110  C  CE2   . PHE F 2 46  ? 31.342  37.592 -44.339 1.00 49.47  ? 61  PHE F CE2   1 
ATOM   4111  C  CZ    . PHE F 2 46  ? 32.355  37.551 -43.420 1.00 49.31  ? 61  PHE F CZ    1 
ATOM   4112  N  N     . LEU F 2 47  ? 33.403  43.140 -44.743 1.00 45.28  ? 62  LEU F N     1 
ATOM   4113  C  CA    . LEU F 2 47  ? 34.180  43.672 -43.648 1.00 44.65  ? 62  LEU F CA    1 
ATOM   4114  C  C     . LEU F 2 47  ? 33.466  44.806 -42.955 1.00 43.89  ? 62  LEU F C     1 
ATOM   4115  O  O     . LEU F 2 47  ? 33.462  44.874 -41.724 1.00 44.77  ? 62  LEU F O     1 
ATOM   4116  C  CB    . LEU F 2 47  ? 35.522  44.134 -44.172 1.00 44.87  ? 62  LEU F CB    1 
ATOM   4117  C  CG    . LEU F 2 47  ? 36.577  43.110 -43.990 1.00 46.88  ? 62  LEU F CG    1 
ATOM   4118  C  CD1   . LEU F 2 47  ? 37.717  43.349 -44.926 1.00 47.97  ? 62  LEU F CD1   1 
ATOM   4119  C  CD2   . LEU F 2 47  ? 36.998  43.026 -42.541 1.00 47.57  ? 62  LEU F CD2   1 
ATOM   4120  N  N     . GLU F 2 48  ? 32.796  45.676 -43.727 1.00 42.03  ? 63  GLU F N     1 
ATOM   4121  C  CA    . GLU F 2 48  ? 32.089  46.807 -43.152 1.00 41.14  ? 63  GLU F CA    1 
ATOM   4122  C  C     . GLU F 2 48  ? 31.025  46.313 -42.200 1.00 39.93  ? 63  GLU F C     1 
ATOM   4123  O  O     . GLU F 2 48  ? 31.076  46.638 -41.025 1.00 39.77  ? 63  GLU F O     1 
ATOM   4124  C  CB    . GLU F 2 48  ? 31.471  47.703 -44.255 1.00 43.98  ? 63  GLU F CB    1 
ATOM   4125  C  CG    . GLU F 2 48  ? 32.446  48.653 -44.938 1.00 49.73  ? 63  GLU F CG    1 
ATOM   4126  C  CD    . GLU F 2 48  ? 31.964  49.261 -46.246 1.00 56.82  ? 63  GLU F CD    1 
ATOM   4127  O  OE1   . GLU F 2 48  ? 30.897  48.843 -46.752 1.00 58.12  ? 63  GLU F OE1   1 
ATOM   4128  O  OE2   . GLU F 2 48  ? 32.662  50.159 -46.767 1.00 59.55  ? 63  GLU F OE2   1 
ATOM   4129  N  N     . ASN F 2 49  ? 30.205  45.370 -42.678 1.00 38.95  ? 64  ASN F N     1 
ATOM   4130  C  CA    . ASN F 2 49  ? 29.080  44.812 -41.944 1.00 38.09  ? 64  ASN F CA    1 
ATOM   4131  C  C     . ASN F 2 49  ? 29.503  44.112 -40.669 1.00 37.03  ? 64  ASN F C     1 
ATOM   4132  O  O     . ASN F 2 49  ? 28.890  44.336 -39.627 1.00 36.44  ? 64  ASN F O     1 
ATOM   4133  C  CB    . ASN F 2 49  ? 28.232  43.922 -42.858 1.00 38.40  ? 64  ASN F CB    1 
ATOM   4134  C  CG    . ASN F 2 49  ? 27.592  44.668 -44.021 1.00 40.93  ? 64  ASN F CG    1 
ATOM   4135  O  OD1   . ASN F 2 49  ? 27.320  44.092 -45.069 1.00 42.08  ? 64  ASN F OD1   1 
ATOM   4136  N  ND2   . ASN F 2 49  ? 27.337  45.966 -43.880 1.00 41.25  ? 64  ASN F ND2   1 
ATOM   4137  N  N     . VAL F 2 50  ? 30.581  43.328 -40.728 1.00 36.89  ? 65  VAL F N     1 
ATOM   4138  C  CA    . VAL F 2 50  ? 31.083  42.638 -39.542 1.00 37.20  ? 65  VAL F CA    1 
ATOM   4139  C  C     . VAL F 2 50  ? 31.682  43.613 -38.516 1.00 38.21  ? 65  VAL F C     1 
ATOM   4140  O  O     . VAL F 2 50  ? 31.264  43.603 -37.354 1.00 38.48  ? 65  VAL F O     1 
ATOM   4141  C  CB    . VAL F 2 50  ? 32.058  41.495 -39.894 1.00 37.33  ? 65  VAL F CB    1 
ATOM   4142  C  CG1   . VAL F 2 50  ? 32.649  40.881 -38.628 1.00 37.87  ? 65  VAL F CG1   1 
ATOM   4143  C  CG2   . VAL F 2 50  ? 31.367  40.426 -40.737 1.00 37.49  ? 65  VAL F CG2   1 
ATOM   4144  N  N     . ILE F 2 51  ? 32.635  44.476 -38.951 1.00 38.25  ? 66  ILE F N     1 
ATOM   4145  C  CA    . ILE F 2 51  ? 33.288  45.436 -38.066 1.00 38.06  ? 66  ILE F CA    1 
ATOM   4146  C  C     . ILE F 2 51  ? 32.300  46.408 -37.455 1.00 38.08  ? 66  ILE F C     1 
ATOM   4147  O  O     . ILE F 2 51  ? 32.389  46.673 -36.269 1.00 38.12  ? 66  ILE F O     1 
ATOM   4148  C  CB    . ILE F 2 51  ? 34.462  46.142 -38.762 1.00 38.29  ? 66  ILE F CB    1 
ATOM   4149  C  CG1   . ILE F 2 51  ? 35.487  45.109 -39.252 1.00 39.15  ? 66  ILE F CG1   1 
ATOM   4150  C  CG2   . ILE F 2 51  ? 35.116  47.133 -37.807 1.00 38.67  ? 66  ILE F CG2   1 
ATOM   4151  C  CD1   . ILE F 2 51  ? 36.523  45.693 -40.160 1.00 40.35  ? 66  ILE F CD1   1 
ATOM   4152  N  N     . ARG F 2 52  ? 31.292  46.852 -38.209 1.00 38.02  ? 67  ARG F N     1 
ATOM   4153  C  CA    . ARG F 2 52  ? 30.271  47.761 -37.689 1.00 38.70  ? 67  ARG F CA    1 
ATOM   4154  C  C     . ARG F 2 52  ? 29.576  47.195 -36.452 1.00 39.47  ? 67  ARG F C     1 
ATOM   4155  O  O     . ARG F 2 52  ? 29.422  47.899 -35.456 1.00 39.48  ? 67  ARG F O     1 
ATOM   4156  C  CB    . ARG F 2 52  ? 29.236  48.068 -38.770 1.00 40.25  ? 67  ARG F CB    1 
ATOM   4157  C  CG    . ARG F 2 52  ? 28.100  48.976 -38.314 1.00 44.42  ? 67  ARG F CG    1 
ATOM   4158  C  CD    . ARG F 2 52  ? 27.003  49.051 -39.364 1.00 49.62  ? 67  ARG F CD    1 
ATOM   4159  N  NE    . ARG F 2 52  ? 27.498  49.566 -40.644 1.00 54.00  ? 67  ARG F NE    1 
ATOM   4160  C  CZ    . ARG F 2 52  ? 27.468  48.890 -41.790 1.00 56.26  ? 67  ARG F CZ    1 
ATOM   4161  N  NH1   . ARG F 2 52  ? 26.938  47.671 -41.837 1.00 55.87  ? 67  ARG F NH1   1 
ATOM   4162  N  NH2   . ARG F 2 52  ? 27.946  49.437 -42.900 1.00 55.83  ? 67  ARG F NH2   1 
ATOM   4163  N  N     . ASP F 2 53  ? 29.182  45.915 -36.508 1.00 40.04  ? 68  ASP F N     1 
ATOM   4164  C  CA    . ASP F 2 53  ? 28.505  45.274 -35.383 1.00 40.64  ? 68  ASP F CA    1 
ATOM   4165  C  C     . ASP F 2 53  ? 29.501  44.983 -34.267 1.00 40.89  ? 68  ASP F C     1 
ATOM   4166  O  O     . ASP F 2 53  ? 29.204  45.263 -33.108 1.00 41.58  ? 68  ASP F O     1 
ATOM   4167  C  CB    . ASP F 2 53  ? 27.770  43.997 -35.823 1.00 41.81  ? 68  ASP F CB    1 
ATOM   4168  C  CG    . ASP F 2 53  ? 26.630  44.205 -36.812 1.00 46.20  ? 68  ASP F CG    1 
ATOM   4169  O  OD1   . ASP F 2 53  ? 26.134  45.363 -36.933 1.00 46.45  ? 68  ASP F OD1   1 
ATOM   4170  O  OD2   . ASP F 2 53  ? 26.216  43.211 -37.454 1.00 48.32  ? 68  ASP F OD2   1 
ATOM   4171  N  N     . ALA F 2 54  ? 30.720  44.536 -34.616 1.00 39.97  ? 69  ALA F N     1 
ATOM   4172  C  CA    . ALA F 2 54  ? 31.767  44.255 -33.636 1.00 39.61  ? 69  ALA F CA    1 
ATOM   4173  C  C     . ALA F 2 54  ? 32.079  45.485 -32.796 1.00 39.15  ? 69  ALA F C     1 
ATOM   4174  O  O     . ALA F 2 54  ? 32.177  45.399 -31.576 1.00 39.12  ? 69  ALA F O     1 
ATOM   4175  C  CB    . ALA F 2 54  ? 33.026  43.769 -34.343 1.00 39.86  ? 69  ALA F CB    1 
ATOM   4176  N  N     . VAL F 2 55  ? 32.149  46.636 -33.451 1.00 38.74  ? 70  VAL F N     1 
ATOM   4177  C  CA    . VAL F 2 55  ? 32.433  47.897 -32.825 1.00 38.75  ? 70  VAL F CA    1 
ATOM   4178  C  C     . VAL F 2 55  ? 31.238  48.331 -32.013 1.00 39.55  ? 70  VAL F C     1 
ATOM   4179  O  O     . VAL F 2 55  ? 31.427  48.743 -30.882 1.00 39.97  ? 70  VAL F O     1 
ATOM   4180  C  CB    . VAL F 2 55  ? 32.891  48.908 -33.888 1.00 38.88  ? 70  VAL F CB    1 
ATOM   4181  C  CG1   . VAL F 2 55  ? 32.850  50.330 -33.357 1.00 39.52  ? 70  VAL F CG1   1 
ATOM   4182  C  CG2   . VAL F 2 55  ? 34.285  48.549 -34.394 1.00 38.88  ? 70  VAL F CG2   1 
ATOM   4183  N  N     . THR F 2 56  ? 30.008  48.121 -32.508 1.00 39.71  ? 71  THR F N     1 
ATOM   4184  C  CA    . THR F 2 56  ? 28.782  48.408 -31.757 1.00 40.45  ? 71  THR F CA    1 
ATOM   4185  C  C     . THR F 2 56  ? 28.768  47.619 -30.427 1.00 40.70  ? 71  THR F C     1 
ATOM   4186  O  O     . THR F 2 56  ? 28.265  48.117 -29.420 1.00 40.61  ? 71  THR F O     1 
ATOM   4187  C  CB    . THR F 2 56  ? 27.556  48.062 -32.614 1.00 42.15  ? 71  THR F CB    1 
ATOM   4188  O  OG1   . THR F 2 56  ? 27.681  48.658 -33.903 1.00 43.19  ? 71  THR F OG1   1 
ATOM   4189  C  CG2   . THR F 2 56  ? 26.257  48.498 -31.976 1.00 42.82  ? 71  THR F CG2   1 
ATOM   4190  N  N     . TYR F 2 57  ? 29.362  46.411 -30.417 1.00 41.02  ? 72  TYR F N     1 
ATOM   4191  C  CA    . TYR F 2 57  ? 29.467  45.590 -29.204 1.00 42.02  ? 72  TYR F CA    1 
ATOM   4192  C  C     . TYR F 2 57  ? 30.504  46.192 -28.252 1.00 44.15  ? 72  TYR F C     1 
ATOM   4193  O  O     . TYR F 2 57  ? 30.256  46.295 -27.046 1.00 44.70  ? 72  TYR F O     1 
ATOM   4194  C  CB    . TYR F 2 57  ? 29.843  44.128 -29.538 1.00 41.00  ? 72  TYR F CB    1 
ATOM   4195  C  CG    . TYR F 2 57  ? 28.652  43.272 -29.901 1.00 40.07  ? 72  TYR F CG    1 
ATOM   4196  C  CD1   . TYR F 2 57  ? 27.601  43.101 -29.018 1.00 40.24  ? 72  TYR F CD1   1 
ATOM   4197  C  CD2   . TYR F 2 57  ? 28.575  42.638 -31.130 1.00 40.24  ? 72  TYR F CD2   1 
ATOM   4198  C  CE1   . TYR F 2 57  ? 26.494  42.338 -29.354 1.00 40.74  ? 72  TYR F CE1   1 
ATOM   4199  C  CE2   . TYR F 2 57  ? 27.463  41.884 -31.484 1.00 40.68  ? 72  TYR F CE2   1 
ATOM   4200  C  CZ    . TYR F 2 57  ? 26.430  41.725 -30.585 1.00 41.26  ? 72  TYR F CZ    1 
ATOM   4201  O  OH    . TYR F 2 57  ? 25.322  40.983 -30.900 1.00 42.35  ? 72  TYR F OH    1 
ATOM   4202  N  N     . THR F 2 58  ? 31.661  46.598 -28.810 1.00 44.84  ? 73  THR F N     1 
ATOM   4203  C  CA    . THR F 2 58  ? 32.777  47.225 -28.110 1.00 45.69  ? 73  THR F CA    1 
ATOM   4204  C  C     . THR F 2 58  ? 32.284  48.493 -27.431 1.00 46.64  ? 73  THR F C     1 
ATOM   4205  O  O     . THR F 2 58  ? 32.458  48.642 -26.231 1.00 46.60  ? 73  THR F O     1 
ATOM   4206  C  CB    . THR F 2 58  ? 33.910  47.486 -29.115 1.00 46.98  ? 73  THR F CB    1 
ATOM   4207  O  OG1   . THR F 2 58  ? 34.216  46.262 -29.775 1.00 48.29  ? 73  THR F OG1   1 
ATOM   4208  C  CG2   . THR F 2 58  ? 35.152  48.040 -28.467 1.00 47.14  ? 73  THR F CG2   1 
ATOM   4209  N  N     . GLU F 2 59  ? 31.584  49.353 -28.172 1.00 47.67  ? 74  GLU F N     1 
ATOM   4210  C  CA    . GLU F 2 59  ? 31.031  50.592 -27.649 1.00 49.47  ? 74  GLU F CA    1 
ATOM   4211  C  C     . GLU F 2 59  ? 30.017  50.330 -26.539 1.00 50.04  ? 74  GLU F C     1 
ATOM   4212  O  O     . GLU F 2 59  ? 30.008  51.068 -25.552 1.00 50.60  ? 74  GLU F O     1 
ATOM   4213  C  CB    . GLU F 2 59  ? 30.391  51.428 -28.762 1.00 53.23  ? 74  GLU F CB    1 
ATOM   4214  C  CG    . GLU F 2 59  ? 31.385  52.061 -29.716 1.00 60.90  ? 74  GLU F CG    1 
ATOM   4215  C  CD    . GLU F 2 59  ? 30.763  53.161 -30.553 1.00 72.57  ? 74  GLU F CD    1 
ATOM   4216  O  OE1   . GLU F 2 59  ? 30.057  52.830 -31.536 1.00 75.18  ? 74  GLU F OE1   1 
ATOM   4217  O  OE2   . GLU F 2 59  ? 30.967  54.353 -30.217 1.00 76.65  ? 74  GLU F OE2   1 
ATOM   4218  N  N     . HIS F 2 60  ? 29.172  49.288 -26.680 1.00 49.53  ? 75  HIS F N     1 
ATOM   4219  C  CA    . HIS F 2 60  ? 28.221  48.960 -25.619 1.00 49.48  ? 75  HIS F CA    1 
ATOM   4220  C  C     . HIS F 2 60  ? 28.966  48.500 -24.372 1.00 50.55  ? 75  HIS F C     1 
ATOM   4221  O  O     . HIS F 2 60  ? 28.583  48.859 -23.261 1.00 50.68  ? 75  HIS F O     1 
ATOM   4222  C  CB    . HIS F 2 60  ? 27.209  47.902 -26.049 1.00 48.95  ? 75  HIS F CB    1 
ATOM   4223  C  CG    . HIS F 2 60  ? 26.196  47.623 -24.981 1.00 49.10  ? 75  HIS F CG    1 
ATOM   4224  N  ND1   . HIS F 2 60  ? 26.362  46.585 -24.083 1.00 50.22  ? 75  HIS F ND1   1 
ATOM   4225  C  CD2   . HIS F 2 60  ? 25.078  48.307 -24.646 1.00 49.90  ? 75  HIS F CD2   1 
ATOM   4226  C  CE1   . HIS F 2 60  ? 25.318  46.631 -23.274 1.00 50.52  ? 75  HIS F CE1   1 
ATOM   4227  N  NE2   . HIS F 2 60  ? 24.510  47.642 -23.579 1.00 50.75  ? 75  HIS F NE2   1 
ATOM   4228  N  N     . ALA F 2 61  ? 30.052  47.736 -24.549 1.00 51.25  ? 76  ALA F N     1 
ATOM   4229  C  CA    . ALA F 2 61  ? 30.874  47.270 -23.433 1.00 52.41  ? 76  ALA F CA    1 
ATOM   4230  C  C     . ALA F 2 61  ? 31.709  48.375 -22.762 1.00 53.21  ? 76  ALA F C     1 
ATOM   4231  O  O     . ALA F 2 61  ? 32.457  48.084 -21.826 1.00 53.59  ? 76  ALA F O     1 
ATOM   4232  C  CB    . ALA F 2 61  ? 31.794  46.169 -23.911 1.00 52.84  ? 76  ALA F CB    1 
ATOM   4233  N  N     . LYS F 2 62  ? 31.600  49.623 -23.258 1.00 53.10  ? 77  LYS F N     1 
ATOM   4234  C  CA    . LYS F 2 62  ? 32.339  50.797 -22.811 1.00 53.28  ? 77  LYS F CA    1 
ATOM   4235  C  C     . LYS F 2 62  ? 33.843  50.605 -22.984 1.00 53.80  ? 77  LYS F C     1 
ATOM   4236  O  O     . LYS F 2 62  ? 34.615  51.117 -22.185 1.00 54.61  ? 77  LYS F O     1 
ATOM   4237  C  CB    . LYS F 2 62  ? 31.948  51.209 -21.379 1.00 54.20  ? 77  LYS F CB    1 
ATOM   4238  C  CG    . LYS F 2 62  ? 30.653  52.016 -21.322 1.00 56.93  ? 77  LYS F CG    1 
ATOM   4239  C  CD    . LYS F 2 62  ? 29.981  51.955 -19.957 1.00 60.34  ? 77  LYS F CD    1 
ATOM   4240  C  CE    . LYS F 2 62  ? 28.746  52.822 -19.914 1.00 63.70  ? 77  LYS F CE    1 
ATOM   4241  N  NZ    . LYS F 2 62  ? 28.140  52.859 -18.560 1.00 65.64  ? 77  LYS F NZ    1 
ATOM   4242  N  N     . ARG F 2 63  ? 34.261  49.887 -24.036 1.00 53.38  ? 78  ARG F N     1 
ATOM   4243  C  CA    . ARG F 2 63  ? 35.671  49.632 -24.286 1.00 53.84  ? 78  ARG F CA    1 
ATOM   4244  C  C     . ARG F 2 63  ? 36.204  50.344 -25.514 1.00 54.59  ? 78  ARG F C     1 
ATOM   4245  O  O     . ARG F 2 63  ? 35.433  50.738 -26.384 1.00 55.11  ? 78  ARG F O     1 
ATOM   4246  C  CB    . ARG F 2 63  ? 35.914  48.135 -24.433 1.00 55.23  ? 78  ARG F CB    1 
ATOM   4247  C  CG    . ARG F 2 63  ? 35.477  47.345 -23.220 1.00 58.43  ? 78  ARG F CG    1 
ATOM   4248  C  CD    . ARG F 2 63  ? 36.029  45.943 -23.274 1.00 61.49  ? 78  ARG F CD    1 
ATOM   4249  N  NE    . ARG F 2 63  ? 35.010  44.966 -23.645 1.00 64.36  ? 78  ARG F NE    1 
ATOM   4250  C  CZ    . ARG F 2 63  ? 34.770  44.565 -24.887 1.00 67.17  ? 78  ARG F CZ    1 
ATOM   4251  N  NH1   . ARG F 2 63  ? 35.453  45.081 -25.904 1.00 66.86  ? 78  ARG F NH1   1 
ATOM   4252  N  NH2   . ARG F 2 63  ? 33.830  43.660 -25.128 1.00 67.71  ? 78  ARG F NH2   1 
ATOM   4253  N  N     . LYS F 2 64  ? 37.534  50.539 -25.568 1.00 54.74  ? 79  LYS F N     1 
ATOM   4254  C  CA    . LYS F 2 64  ? 38.240  51.133 -26.721 1.00 55.43  ? 79  LYS F CA    1 
ATOM   4255  C  C     . LYS F 2 64  ? 38.876  50.054 -27.610 1.00 54.78  ? 79  LYS F C     1 
ATOM   4256  O  O     . LYS F 2 64  ? 39.231  50.339 -28.753 1.00 54.56  ? 79  LYS F O     1 
ATOM   4257  C  CB    . LYS F 2 64  ? 39.339  52.143 -26.286 1.00 58.43  ? 79  LYS F CB    1 
ATOM   4258  C  CG    . LYS F 2 64  ? 38.864  53.591 -26.124 1.00 63.60  ? 79  LYS F CG    1 
ATOM   4259  C  CD    . LYS F 2 64  ? 39.863  54.633 -26.626 1.00 68.55  ? 79  LYS F CD    1 
ATOM   4260  C  CE    . LYS F 2 64  ? 39.303  56.049 -26.570 1.00 72.13  ? 79  LYS F CE    1 
ATOM   4261  N  NZ    . LYS F 2 64  ? 38.361  56.336 -27.687 1.00 74.04  ? 79  LYS F NZ    1 
ATOM   4262  N  N     . THR F 2 65  ? 39.051  48.831 -27.066 1.00 54.42  ? 80  THR F N     1 
ATOM   4263  C  CA    . THR F 2 65  ? 39.638  47.693 -27.759 1.00 54.32  ? 80  THR F CA    1 
ATOM   4264  C  C     . THR F 2 65  ? 38.569  46.653 -28.140 1.00 53.31  ? 80  THR F C     1 
ATOM   4265  O  O     . THR F 2 65  ? 37.868  46.109 -27.279 1.00 53.24  ? 80  THR F O     1 
ATOM   4266  C  CB    . THR F 2 65  ? 40.742  47.051 -26.907 1.00 56.32  ? 80  THR F CB    1 
ATOM   4267  O  OG1   . THR F 2 65  ? 41.590  48.065 -26.343 1.00 57.71  ? 80  THR F OG1   1 
ATOM   4268  C  CG2   . THR F 2 65  ? 41.561  46.022 -27.688 1.00 56.64  ? 80  THR F CG2   1 
ATOM   4269  N  N     . VAL F 2 66  ? 38.456  46.406 -29.452 1.00 52.20  ? 81  VAL F N     1 
ATOM   4270  C  CA    . VAL F 2 66  ? 37.574  45.443 -30.090 1.00 51.46  ? 81  VAL F CA    1 
ATOM   4271  C  C     . VAL F 2 66  ? 38.169  44.064 -29.814 1.00 51.24  ? 81  VAL F C     1 
ATOM   4272  O  O     . VAL F 2 66  ? 39.255  43.759 -30.313 1.00 51.66  ? 81  VAL F O     1 
ATOM   4273  C  CB    . VAL F 2 66  ? 37.509  45.748 -31.599 1.00 51.22  ? 81  VAL F CB    1 
ATOM   4274  C  CG1   . VAL F 2 66  ? 36.703  44.694 -32.335 1.00 51.83  ? 81  VAL F CG1   1 
ATOM   4275  C  CG2   . VAL F 2 66  ? 36.934  47.132 -31.837 1.00 51.26  ? 81  VAL F CG2   1 
ATOM   4276  N  N     . THR F 2 67  ? 37.504  43.263 -28.958 1.00 50.40  ? 82  THR F N     1 
ATOM   4277  C  CA    . THR F 2 67  ? 38.019  41.952 -28.565 1.00 49.86  ? 82  THR F CA    1 
ATOM   4278  C  C     . THR F 2 67  ? 37.652  40.857 -29.565 1.00 48.83  ? 82  THR F C     1 
ATOM   4279  O  O     . THR F 2 67  ? 36.890  41.110 -30.489 1.00 48.82  ? 82  THR F O     1 
ATOM   4280  C  CB    . THR F 2 67  ? 37.597  41.623 -27.109 1.00 51.49  ? 82  THR F CB    1 
ATOM   4281  O  OG1   . THR F 2 67  ? 36.187  41.399 -27.026 1.00 52.45  ? 82  THR F OG1   1 
ATOM   4282  C  CG2   . THR F 2 67  ? 38.029  42.702 -26.120 1.00 52.14  ? 82  THR F CG2   1 
ATOM   4283  N  N     . ALA F 2 68  ? 38.235  39.654 -29.418 1.00 48.21  ? 83  ALA F N     1 
ATOM   4284  C  CA    . ALA F 2 68  ? 37.923  38.503 -30.273 1.00 48.32  ? 83  ALA F CA    1 
ATOM   4285  C  C     . ALA F 2 68  ? 36.451  38.141 -30.144 1.00 48.04  ? 83  ALA F C     1 
ATOM   4286  O  O     . ALA F 2 68  ? 35.830  37.776 -31.136 1.00 47.72  ? 83  ALA F O     1 
ATOM   4287  C  CB    . ALA F 2 68  ? 38.773  37.308 -29.882 1.00 48.64  ? 83  ALA F CB    1 
ATOM   4288  N  N     . MET F 2 69  ? 35.887  38.283 -28.926 1.00 48.02  ? 84  MET F N     1 
ATOM   4289  C  CA    . MET F 2 69  ? 34.480  38.018 -28.655 1.00 48.30  ? 84  MET F CA    1 
ATOM   4290  C  C     . MET F 2 69  ? 33.561  38.946 -29.381 1.00 47.94  ? 84  MET F C     1 
ATOM   4291  O  O     . MET F 2 69  ? 32.585  38.487 -29.939 1.00 48.45  ? 84  MET F O     1 
ATOM   4292  C  CB    . MET F 2 69  ? 34.169  38.005 -27.157 1.00 49.10  ? 84  MET F CB    1 
ATOM   4293  C  CG    . MET F 2 69  ? 34.622  36.746 -26.486 1.00 51.58  ? 84  MET F CG    1 
ATOM   4294  S  SD    . MET F 2 69  ? 33.913  35.268 -27.238 1.00 59.15  ? 84  MET F SD    1 
ATOM   4295  C  CE    . MET F 2 69  ? 32.750  34.778 -25.963 1.00 59.12  ? 84  MET F CE    1 
ATOM   4296  N  N     . ASP F 2 70  ? 33.901  40.219 -29.472 1.00 47.03  ? 85  ASP F N     1 
ATOM   4297  C  CA    . ASP F 2 70  ? 33.093  41.180 -30.217 1.00 46.60  ? 85  ASP F CA    1 
ATOM   4298  C  C     . ASP F 2 70  ? 33.018  40.791 -31.691 1.00 45.55  ? 85  ASP F C     1 
ATOM   4299  O  O     . ASP F 2 70  ? 31.932  40.811 -32.256 1.00 46.12  ? 85  ASP F O     1 
ATOM   4300  C  CB    . ASP F 2 70  ? 33.652  42.595 -30.044 1.00 48.35  ? 85  ASP F CB    1 
ATOM   4301  C  CG    . ASP F 2 70  ? 33.732  43.051 -28.601 1.00 52.02  ? 85  ASP F CG    1 
ATOM   4302  O  OD1   . ASP F 2 70  ? 33.160  42.355 -27.715 1.00 52.97  ? 85  ASP F OD1   1 
ATOM   4303  O  OD2   . ASP F 2 70  ? 34.371  44.093 -28.350 1.00 53.19  ? 85  ASP F OD2   1 
ATOM   4304  N  N     . VAL F 2 71  ? 34.146  40.359 -32.280 1.00 43.77  ? 86  VAL F N     1 
ATOM   4305  C  CA    . VAL F 2 71  ? 34.168  39.894 -33.662 1.00 42.47  ? 86  VAL F CA    1 
ATOM   4306  C  C     . VAL F 2 71  ? 33.379  38.598 -33.810 1.00 40.86  ? 86  VAL F C     1 
ATOM   4307  O  O     . VAL F 2 71  ? 32.725  38.398 -34.829 1.00 41.17  ? 86  VAL F O     1 
ATOM   4308  C  CB    . VAL F 2 71  ? 35.603  39.795 -34.216 1.00 43.14  ? 86  VAL F CB    1 
ATOM   4309  C  CG1   . VAL F 2 71  ? 35.646  39.021 -35.531 1.00 43.72  ? 86  VAL F CG1   1 
ATOM   4310  C  CG2   . VAL F 2 71  ? 36.186  41.185 -34.401 1.00 43.56  ? 86  VAL F CG2   1 
ATOM   4311  N  N     . VAL F 2 72  ? 33.406  37.742 -32.788 1.00 39.12  ? 87  VAL F N     1 
ATOM   4312  C  CA    . VAL F 2 72  ? 32.657  36.498 -32.784 1.00 38.21  ? 87  VAL F CA    1 
ATOM   4313  C  C     . VAL F 2 72  ? 31.159  36.777 -32.705 1.00 37.32  ? 87  VAL F C     1 
ATOM   4314  O  O     . VAL F 2 72  ? 30.410  36.233 -33.512 1.00 37.77  ? 87  VAL F O     1 
ATOM   4315  C  CB    . VAL F 2 72  ? 33.148  35.547 -31.663 1.00 38.80  ? 87  VAL F CB    1 
ATOM   4316  C  CG1   . VAL F 2 72  ? 32.129  34.456 -31.351 1.00 39.34  ? 87  VAL F CG1   1 
ATOM   4317  C  CG2   . VAL F 2 72  ? 34.480  34.923 -32.038 1.00 39.31  ? 87  VAL F CG2   1 
ATOM   4318  N  N     . TYR F 2 73  ? 30.720  37.643 -31.780 1.00 35.94  ? 88  TYR F N     1 
ATOM   4319  C  CA    . TYR F 2 73  ? 29.312  37.961 -31.632 1.00 35.32  ? 88  TYR F CA    1 
ATOM   4320  C  C     . TYR F 2 73  ? 28.758  38.601 -32.897 1.00 34.71  ? 88  TYR F C     1 
ATOM   4321  O  O     . TYR F 2 73  ? 27.624  38.316 -33.275 1.00 34.99  ? 88  TYR F O     1 
ATOM   4322  C  CB    . TYR F 2 73  ? 29.084  38.891 -30.451 1.00 35.56  ? 88  TYR F CB    1 
ATOM   4323  C  CG    . TYR F 2 73  ? 29.417  38.316 -29.102 1.00 37.22  ? 88  TYR F CG    1 
ATOM   4324  C  CD1   . TYR F 2 73  ? 29.272  36.963 -28.846 1.00 38.95  ? 88  TYR F CD1   1 
ATOM   4325  C  CD2   . TYR F 2 73  ? 29.883  39.125 -28.080 1.00 38.88  ? 88  TYR F CD2   1 
ATOM   4326  C  CE1   . TYR F 2 73  ? 29.586  36.427 -27.603 1.00 40.62  ? 88  TYR F CE1   1 
ATOM   4327  C  CE2   . TYR F 2 73  ? 30.205  38.605 -26.834 1.00 40.54  ? 88  TYR F CE2   1 
ATOM   4328  C  CZ    . TYR F 2 73  ? 30.051  37.254 -26.596 1.00 42.27  ? 88  TYR F CZ    1 
ATOM   4329  O  OH    . TYR F 2 73  ? 30.313  36.750 -25.341 1.00 45.07  ? 88  TYR F OH    1 
ATOM   4330  N  N     . ALA F 2 74  ? 29.549  39.452 -33.559 1.00 33.81  ? 89  ALA F N     1 
ATOM   4331  C  CA    . ALA F 2 74  ? 29.132  40.108 -34.787 1.00 33.62  ? 89  ALA F CA    1 
ATOM   4332  C  C     . ALA F 2 74  ? 28.954  39.104 -35.913 1.00 34.14  ? 89  ALA F C     1 
ATOM   4333  O  O     . ALA F 2 74  ? 28.019  39.225 -36.693 1.00 34.42  ? 89  ALA F O     1 
ATOM   4334  C  CB    . ALA F 2 74  ? 30.164  41.127 -35.182 1.00 33.73  ? 89  ALA F CB    1 
ATOM   4335  N  N     . LEU F 2 75  ? 29.828  38.095 -35.981 1.00 34.17  ? 90  LEU F N     1 
ATOM   4336  C  CA    . LEU F 2 75  ? 29.764  37.048 -36.978 1.00 34.58  ? 90  LEU F CA    1 
ATOM   4337  C  C     . LEU F 2 75  ? 28.531  36.204 -36.750 1.00 36.13  ? 90  LEU F C     1 
ATOM   4338  O  O     . LEU F 2 75  ? 27.816  35.942 -37.709 1.00 37.01  ? 90  LEU F O     1 
ATOM   4339  C  CB    . LEU F 2 75  ? 31.032  36.194 -36.945 1.00 33.99  ? 90  LEU F CB    1 
ATOM   4340  C  CG    . LEU F 2 75  ? 32.208  36.831 -37.649 1.00 34.43  ? 90  LEU F CG    1 
ATOM   4341  C  CD1   . LEU F 2 75  ? 33.491  36.158 -37.292 1.00 34.62  ? 90  LEU F CD1   1 
ATOM   4342  C  CD2   . LEU F 2 75  ? 31.992  36.869 -39.135 1.00 34.76  ? 90  LEU F CD2   1 
ATOM   4343  N  N     . LYS F 2 76  ? 28.219  35.843 -35.490 1.00 36.25  ? 91  LYS F N     1 
ATOM   4344  C  CA    . LYS F 2 76  ? 26.990  35.090 -35.209 1.00 36.73  ? 91  LYS F CA    1 
ATOM   4345  C  C     . LYS F 2 76  ? 25.740  35.888 -35.633 1.00 37.25  ? 91  LYS F C     1 
ATOM   4346  O  O     . LYS F 2 76  ? 24.824  35.305 -36.216 1.00 37.46  ? 91  LYS F O     1 
ATOM   4347  C  CB    . LYS F 2 76  ? 26.897  34.642 -33.738 1.00 38.53  ? 91  LYS F CB    1 
ATOM   4348  C  CG    . LYS F 2 76  ? 25.957  33.450 -33.531 1.00 43.81  ? 91  LYS F CG    1 
ATOM   4349  C  CD    . LYS F 2 76  ? 26.219  32.729 -32.206 1.00 49.70  ? 91  LYS F CD    1 
ATOM   4350  C  CE    . LYS F 2 76  ? 26.378  31.233 -32.341 1.00 54.13  ? 91  LYS F CE    1 
ATOM   4351  N  NZ    . LYS F 2 76  ? 26.755  30.602 -31.044 1.00 56.51  ? 91  LYS F NZ    1 
ATOM   4352  N  N     . ARG F 2 77  ? 25.745  37.224 -35.423 1.00 37.14  ? 92  ARG F N     1 
ATOM   4353  C  CA    . ARG F 2 77  ? 24.657  38.107 -35.836 1.00 37.52  ? 92  ARG F CA    1 
ATOM   4354  C  C     . ARG F 2 77  ? 24.519  38.063 -37.354 1.00 37.12  ? 92  ARG F C     1 
ATOM   4355  O  O     . ARG F 2 77  ? 23.399  37.970 -37.858 1.00 37.87  ? 92  ARG F O     1 
ATOM   4356  C  CB    . ARG F 2 77  ? 24.919  39.549 -35.385 1.00 39.68  ? 92  ARG F CB    1 
ATOM   4357  C  CG    . ARG F 2 77  ? 24.113  39.957 -34.170 1.00 45.17  ? 92  ARG F CG    1 
ATOM   4358  C  CD    . ARG F 2 77  ? 23.521  41.349 -34.315 1.00 50.55  ? 92  ARG F CD    1 
ATOM   4359  N  NE    . ARG F 2 77  ? 22.440  41.361 -35.300 1.00 55.95  ? 92  ARG F NE    1 
ATOM   4360  C  CZ    . ARG F 2 77  ? 22.527  41.918 -36.507 1.00 59.77  ? 92  ARG F CZ    1 
ATOM   4361  N  NH1   . ARG F 2 77  ? 23.634  42.547 -36.877 1.00 59.36  ? 92  ARG F NH1   1 
ATOM   4362  N  NH2   . ARG F 2 77  ? 21.496  41.873 -37.344 1.00 60.59  ? 92  ARG F NH2   1 
ATOM   4363  N  N     . GLN F 2 78  ? 25.655  38.094 -38.084 1.00 35.80  ? 93  GLN F N     1 
ATOM   4364  C  CA    . GLN F 2 78  ? 25.677  38.013 -39.548 1.00 35.14  ? 93  GLN F CA    1 
ATOM   4365  C  C     . GLN F 2 78  ? 25.346  36.621 -40.102 1.00 35.51  ? 93  GLN F C     1 
ATOM   4366  O  O     . GLN F 2 78  ? 25.265  36.462 -41.321 1.00 35.81  ? 93  GLN F O     1 
ATOM   4367  C  CB    . GLN F 2 78  ? 27.056  38.411 -40.091 1.00 35.15  ? 93  GLN F CB    1 
ATOM   4368  C  CG    . GLN F 2 78  ? 27.514  39.811 -39.725 1.00 35.32  ? 93  GLN F CG    1 
ATOM   4369  C  CD    . GLN F 2 78  ? 26.578  40.859 -40.233 1.00 36.18  ? 93  GLN F CD    1 
ATOM   4370  O  OE1   . GLN F 2 78  ? 26.292  40.932 -41.430 1.00 36.97  ? 93  GLN F OE1   1 
ATOM   4371  N  NE2   . GLN F 2 78  ? 26.087  41.698 -39.332 1.00 35.36  ? 93  GLN F NE2   1 
ATOM   4372  N  N     . GLY F 2 79  ? 25.215  35.625 -39.227 1.00 35.33  ? 94  GLY F N     1 
ATOM   4373  C  CA    . GLY F 2 79  ? 24.971  34.248 -39.621 1.00 35.60  ? 94  GLY F CA    1 
ATOM   4374  C  C     . GLY F 2 79  ? 26.196  33.616 -40.246 1.00 35.93  ? 94  GLY F C     1 
ATOM   4375  O  O     . GLY F 2 79  ? 26.076  32.778 -41.140 1.00 35.97  ? 94  GLY F O     1 
ATOM   4376  N  N     . ARG F 2 80  ? 27.387  34.041 -39.816 1.00 36.18  ? 95  ARG F N     1 
ATOM   4377  C  CA    . ARG F 2 80  ? 28.651  33.519 -40.331 1.00 37.31  ? 95  ARG F CA    1 
ATOM   4378  C  C     . ARG F 2 80  ? 29.425  33.235 -39.016 1.00 38.99  ? 95  ARG F C     1 
ATOM   4379  O  O     . ARG F 2 80  ? 30.508  33.819 -38.806 1.00 39.20  ? 95  ARG F O     1 
ATOM   4380  C  CB    . ARG F 2 80  ? 29.444  34.636 -41.024 1.00 37.67  ? 95  ARG F CB    1 
ATOM   4381  C  CG    . ARG F 2 80  ? 28.630  35.368 -42.081 1.00 38.89  ? 95  ARG F CG    1 
ATOM   4382  C  CD    . ARG F 2 80  ? 29.173  35.179 -43.472 1.00 40.75  ? 95  ARG F CD    1 
ATOM   4383  N  NE    . ARG F 2 80  ? 29.061  33.818 -44.000 1.00 42.78  ? 95  ARG F NE    1 
ATOM   4384  C  CZ    . ARG F 2 80  ? 30.084  32.975 -44.132 1.00 44.32  ? 95  ARG F CZ    1 
ATOM   4385  N  NH1   . ARG F 2 80  ? 31.296  33.316 -43.692 1.00 43.50  ? 95  ARG F NH1   1 
ATOM   4386  N  NH2   . ARG F 2 80  ? 29.901  31.778 -44.672 1.00 43.76  ? 95  ARG F NH2   1 
ATOM   4387  N  N     . THR F 2 81  ? 28.856  32.303 -38.162 1.00 39.50  ? 96  THR F N     1 
ATOM   4388  C  CA    . THR F 2 81  ? 29.291  31.787 -36.848 1.00 39.79  ? 96  THR F CA    1 
ATOM   4389  C  C     . THR F 2 81  ? 30.702  31.241 -36.942 1.00 40.65  ? 96  THR F C     1 
ATOM   4390  O  O     . THR F 2 81  ? 30.967  30.428 -37.824 1.00 41.03  ? 96  THR F O     1 
ATOM   4391  C  CB    . THR F 2 81  ? 28.312  30.691 -36.470 1.00 40.23  ? 96  THR F CB    1 
ATOM   4392  O  OG1   . THR F 2 81  ? 27.025  31.270 -36.323 1.00 40.95  ? 96  THR F OG1   1 
ATOM   4393  C  CG2   . THR F 2 81  ? 28.700  29.975 -35.198 1.00 40.46  ? 96  THR F CG2   1 
ATOM   4394  N  N     . LEU F 2 82  ? 31.616  31.705 -36.075 1.00 40.78  ? 97  LEU F N     1 
ATOM   4395  C  CA    . LEU F 2 82  ? 33.000  31.253 -36.150 1.00 41.34  ? 97  LEU F CA    1 
ATOM   4396  C  C     . LEU F 2 82  ? 33.437  30.388 -34.973 1.00 42.48  ? 97  LEU F C     1 
ATOM   4397  O  O     . LEU F 2 82  ? 33.320  30.785 -33.807 1.00 42.77  ? 97  LEU F O     1 
ATOM   4398  C  CB    . LEU F 2 82  ? 33.939  32.442 -36.338 1.00 41.05  ? 97  LEU F CB    1 
ATOM   4399  C  CG    . LEU F 2 82  ? 35.419  32.121 -36.533 1.00 41.86  ? 97  LEU F CG    1 
ATOM   4400  C  CD1   . LEU F 2 82  ? 35.653  31.203 -37.721 1.00 41.90  ? 97  LEU F CD1   1 
ATOM   4401  C  CD2   . LEU F 2 82  ? 36.192  33.381 -36.731 1.00 42.29  ? 97  LEU F CD2   1 
ATOM   4402  N  N     . TYR F 2 83  ? 33.950  29.193 -35.290 1.00 43.02  ? 98  TYR F N     1 
ATOM   4403  C  CA    . TYR F 2 83  ? 34.433  28.250 -34.289 1.00 43.84  ? 98  TYR F CA    1 
ATOM   4404  C  C     . TYR F 2 83  ? 35.932  28.405 -34.057 1.00 46.38  ? 98  TYR F C     1 
ATOM   4405  O  O     . TYR F 2 83  ? 36.703  28.404 -35.019 1.00 46.46  ? 98  TYR F O     1 
ATOM   4406  C  CB    . TYR F 2 83  ? 34.156  26.812 -34.744 1.00 42.56  ? 98  TYR F CB    1 
ATOM   4407  C  CG    . TYR F 2 83  ? 32.790  26.269 -34.394 1.00 41.98  ? 98  TYR F CG    1 
ATOM   4408  C  CD1   . TYR F 2 83  ? 31.756  27.114 -34.015 1.00 42.27  ? 98  TYR F CD1   1 
ATOM   4409  C  CD2   . TYR F 2 83  ? 32.519  24.914 -34.488 1.00 42.68  ? 98  TYR F CD2   1 
ATOM   4410  C  CE1   . TYR F 2 83  ? 30.493  26.620 -33.714 1.00 42.86  ? 98  TYR F CE1   1 
ATOM   4411  C  CE2   . TYR F 2 83  ? 31.254  24.411 -34.212 1.00 43.34  ? 98  TYR F CE2   1 
ATOM   4412  C  CZ    . TYR F 2 83  ? 30.245  25.267 -33.817 1.00 43.80  ? 98  TYR F CZ    1 
ATOM   4413  O  OH    . TYR F 2 83  ? 29.010  24.756 -33.529 1.00 44.72  ? 98  TYR F OH    1 
ATOM   4414  N  N     . GLY F 2 84  ? 36.333  28.513 -32.791 1.00 48.12  ? 99  GLY F N     1 
ATOM   4415  C  CA    . GLY F 2 84  ? 37.745  28.562 -32.434 1.00 50.11  ? 99  GLY F CA    1 
ATOM   4416  C  C     . GLY F 2 84  ? 38.311  29.812 -31.798 1.00 51.77  ? 99  GLY F C     1 
ATOM   4417  O  O     . GLY F 2 84  ? 39.471  29.790 -31.367 1.00 52.02  ? 99  GLY F O     1 
ATOM   4418  N  N     . PHE F 2 85  ? 37.528  30.904 -31.738 1.00 52.69  ? 100 PHE F N     1 
ATOM   4419  C  CA    . PHE F 2 85  ? 38.042  32.136 -31.155 1.00 54.21  ? 100 PHE F CA    1 
ATOM   4420  C  C     . PHE F 2 85  ? 37.412  32.468 -29.806 1.00 55.63  ? 100 PHE F C     1 
ATOM   4421  O  O     . PHE F 2 85  ? 37.268  33.639 -29.448 1.00 55.94  ? 100 PHE F O     1 
ATOM   4422  C  CB    . PHE F 2 85  ? 37.948  33.295 -32.143 1.00 54.39  ? 100 PHE F CB    1 
ATOM   4423  C  CG    . PHE F 2 85  ? 38.930  33.151 -33.285 1.00 55.27  ? 100 PHE F CG    1 
ATOM   4424  C  CD1   . PHE F 2 85  ? 38.618  32.398 -34.401 1.00 56.05  ? 100 PHE F CD1   1 
ATOM   4425  C  CD2   . PHE F 2 85  ? 40.164  33.766 -33.238 1.00 56.10  ? 100 PHE F CD2   1 
ATOM   4426  C  CE1   . PHE F 2 85  ? 39.511  32.294 -35.462 1.00 56.57  ? 100 PHE F CE1   1 
ATOM   4427  C  CE2   . PHE F 2 85  ? 41.063  33.637 -34.292 1.00 56.66  ? 100 PHE F CE2   1 
ATOM   4428  C  CZ    . PHE F 2 85  ? 40.732  32.900 -35.395 1.00 56.29  ? 100 PHE F CZ    1 
ATOM   4429  N  N     . GLY F 2 86  ? 37.166  31.428 -29.023 1.00 56.49  ? 101 GLY F N     1 
ATOM   4430  C  CA    . GLY F 2 86  ? 36.612  31.563 -27.685 1.00 57.91  ? 101 GLY F CA    1 
ATOM   4431  C  C     . GLY F 2 86  ? 35.098  31.653 -27.624 1.00 59.24  ? 101 GLY F C     1 
ATOM   4432  O  O     . GLY F 2 86  ? 34.550  31.905 -26.546 1.00 59.61  ? 101 GLY F O     1 
ATOM   4433  N  N     . GLY F 2 87  ? 34.430  31.426 -28.763 1.00 59.52  ? 102 GLY F N     1 
ATOM   4434  C  CA    . GLY F 2 87  ? 32.971  31.489 -28.888 1.00 59.97  ? 102 GLY F CA    1 
ATOM   4435  C  C     . GLY F 2 87  ? 32.206  30.678 -27.829 1.00 60.05  ? 102 GLY F C     1 
ATOM   4436  O  O     . GLY F 2 87  ? 31.918  31.224 -26.735 1.00 59.90  ? 102 GLY F O     1 
ATOM   4437  O  OXT   . GLY F 2 87  ? 31.880  29.508 -28.112 1.00 61.31  ? 102 GLY F OXT   1 
ATOM   4438  N  N     . ALA G 3 1   ? -0.332  62.851 -15.445 1.00 73.82  ? 14  ALA G N     1 
ATOM   4439  C  CA    . ALA G 3 1   ? -0.531  61.604 -16.180 1.00 74.28  ? 14  ALA G CA    1 
ATOM   4440  C  C     . ALA G 3 1   ? -0.410  60.392 -15.234 1.00 74.37  ? 14  ALA G C     1 
ATOM   4441  O  O     . ALA G 3 1   ? 0.499   60.371 -14.401 1.00 74.88  ? 14  ALA G O     1 
ATOM   4442  C  CB    . ALA G 3 1   ? 0.488   61.504 -17.307 1.00 74.54  ? 14  ALA G CB    1 
ATOM   4443  N  N     . LYS G 3 2   ? -1.333  59.398 -15.334 1.00 73.47  ? 15  LYS G N     1 
ATOM   4444  C  CA    . LYS G 3 2   ? -1.296  58.213 -14.457 1.00 72.72  ? 15  LYS G CA    1 
ATOM   4445  C  C     . LYS G 3 2   ? -0.745  56.975 -15.177 1.00 71.53  ? 15  LYS G C     1 
ATOM   4446  O  O     . LYS G 3 2   ? -0.055  56.163 -14.557 1.00 71.70  ? 15  LYS G O     1 
ATOM   4447  C  CB    . LYS G 3 2   ? -2.658  57.934 -13.793 1.00 74.16  ? 15  LYS G CB    1 
ATOM   4448  C  CG    . LYS G 3 2   ? -2.551  57.682 -12.292 1.00 77.44  ? 15  LYS G CG    1 
ATOM   4449  C  CD    . LYS G 3 2   ? -3.920  57.603 -11.633 1.00 81.43  ? 15  LYS G CD    1 
ATOM   4450  C  CE    . LYS G 3 2   ? -4.710  58.891 -11.748 1.00 85.00  ? 15  LYS G CE    1 
ATOM   4451  N  NZ    . LYS G 3 2   ? -4.518  59.791 -10.577 1.00 86.84  ? 15  LYS G NZ    1 
ATOM   4452  N  N     . THR G 3 3   ? -1.052  56.822 -16.479 1.00 69.94  ? 16  THR G N     1 
ATOM   4453  C  CA    . THR G 3 3   ? -0.481  55.712 -17.255 1.00 68.41  ? 16  THR G CA    1 
ATOM   4454  C  C     . THR G 3 3   ? 0.970   56.070 -17.588 1.00 66.36  ? 16  THR G C     1 
ATOM   4455  O  O     . THR G 3 3   ? 1.273   57.252 -17.813 1.00 66.76  ? 16  THR G O     1 
ATOM   4456  C  CB    . THR G 3 3   ? -1.285  55.432 -18.546 1.00 69.51  ? 16  THR G CB    1 
ATOM   4457  O  OG1   . THR G 3 3   ? -1.481  56.642 -19.274 1.00 70.56  ? 16  THR G OG1   1 
ATOM   4458  C  CG2   . THR G 3 3   ? -2.622  54.772 -18.267 1.00 69.75  ? 16  THR G CG2   1 
ATOM   4459  N  N     . ARG G 3 4   ? 1.868   55.063 -17.617 1.00 63.86  ? 17  ARG G N     1 
ATOM   4460  C  CA    . ARG G 3 4   ? 3.277   55.277 -17.954 1.00 61.91  ? 17  ARG G CA    1 
ATOM   4461  C  C     . ARG G 3 4   ? 3.457   55.724 -19.407 1.00 59.58  ? 17  ARG G C     1 
ATOM   4462  O  O     . ARG G 3 4   ? 4.419   56.426 -19.704 1.00 59.32  ? 17  ARG G O     1 
ATOM   4463  C  CB    . ARG G 3 4   ? 4.109   54.024 -17.680 1.00 63.30  ? 17  ARG G CB    1 
ATOM   4464  C  CG    . ARG G 3 4   ? 4.025   53.532 -16.248 1.00 66.86  ? 17  ARG G CG    1 
ATOM   4465  C  CD    . ARG G 3 4   ? 5.173   52.600 -15.916 1.00 70.58  ? 17  ARG G CD    1 
ATOM   4466  N  NE    . ARG G 3 4   ? 4.806   51.179 -15.949 1.00 73.68  ? 17  ARG G NE    1 
ATOM   4467  C  CZ    . ARG G 3 4   ? 5.684   50.181 -15.870 1.00 75.84  ? 17  ARG G CZ    1 
ATOM   4468  N  NH1   . ARG G 3 4   ? 6.984   50.436 -15.767 1.00 75.90  ? 17  ARG G NH1   1 
ATOM   4469  N  NH2   . ARG G 3 4   ? 5.269   48.921 -15.900 1.00 75.43  ? 17  ARG G NH2   1 
ATOM   4470  N  N     . SER G 3 5   ? 2.527   55.329 -20.303 1.00 57.88  ? 18  SER G N     1 
ATOM   4471  C  CA    . SER G 3 5   ? 2.541   55.702 -21.714 1.00 56.74  ? 18  SER G CA    1 
ATOM   4472  C  C     . SER G 3 5   ? 2.284   57.190 -21.875 1.00 56.17  ? 18  SER G C     1 
ATOM   4473  O  O     . SER G 3 5   ? 2.950   57.838 -22.682 1.00 56.60  ? 18  SER G O     1 
ATOM   4474  C  CB    . SER G 3 5   ? 1.497   54.911 -22.490 1.00 56.82  ? 18  SER G CB    1 
ATOM   4475  O  OG    . SER G 3 5   ? 1.773   53.524 -22.443 1.00 57.55  ? 18  SER G OG    1 
ATOM   4476  N  N     . SER G 3 6   ? 1.348   57.744 -21.087 1.00 55.16  ? 19  SER G N     1 
ATOM   4477  C  CA    . SER G 3 6   ? 1.048   59.177 -21.129 1.00 54.60  ? 19  SER G CA    1 
ATOM   4478  C  C     . SER G 3 6   ? 2.241   59.993 -20.650 1.00 52.67  ? 19  SER G C     1 
ATOM   4479  O  O     . SER G 3 6   ? 2.562   60.996 -21.273 1.00 53.06  ? 19  SER G O     1 
ATOM   4480  C  CB    . SER G 3 6   ? -0.180  59.509 -20.283 1.00 56.94  ? 19  SER G CB    1 
ATOM   4481  O  OG    . SER G 3 6   ? -1.395  59.166 -20.929 1.00 59.85  ? 19  SER G OG    1 
ATOM   4482  N  N     . ARG G 3 7   ? 2.919   59.558 -19.579 1.00 50.59  ? 20  ARG G N     1 
ATOM   4483  C  CA    . ARG G 3 7   ? 4.109   60.248 -19.087 1.00 49.42  ? 20  ARG G CA    1 
ATOM   4484  C  C     . ARG G 3 7   ? 5.209   60.329 -20.165 1.00 47.63  ? 20  ARG G C     1 
ATOM   4485  O  O     . ARG G 3 7   ? 5.976   61.288 -20.194 1.00 47.68  ? 20  ARG G O     1 
ATOM   4486  C  CB    . ARG G 3 7   ? 4.681   59.529 -17.862 1.00 51.29  ? 20  ARG G CB    1 
ATOM   4487  C  CG    . ARG G 3 7   ? 3.704   59.338 -16.731 1.00 55.64  ? 20  ARG G CG    1 
ATOM   4488  C  CD    . ARG G 3 7   ? 4.432   58.779 -15.528 1.00 60.80  ? 20  ARG G CD    1 
ATOM   4489  N  NE    . ARG G 3 7   ? 3.632   58.900 -14.311 1.00 66.18  ? 20  ARG G NE    1 
ATOM   4490  C  CZ    . ARG G 3 7   ? 2.936   57.906 -13.764 1.00 70.11  ? 20  ARG G CZ    1 
ATOM   4491  N  NH1   . ARG G 3 7   ? 2.959   56.693 -14.306 1.00 70.39  ? 20  ARG G NH1   1 
ATOM   4492  N  NH2   . ARG G 3 7   ? 2.235   58.111 -12.652 1.00 70.63  ? 20  ARG G NH2   1 
ATOM   4493  N  N     . ALA G 3 8   ? 5.288   59.318 -21.040 1.00 45.80  ? 21  ALA G N     1 
ATOM   4494  C  CA    . ALA G 3 8   ? 6.299   59.244 -22.092 1.00 44.31  ? 21  ALA G CA    1 
ATOM   4495  C  C     . ALA G 3 8   ? 5.859   59.763 -23.462 1.00 42.71  ? 21  ALA G C     1 
ATOM   4496  O  O     . ALA G 3 8   ? 6.684   59.869 -24.366 1.00 42.25  ? 21  ALA G O     1 
ATOM   4497  C  CB    . ALA G 3 8   ? 6.801   57.824 -22.215 1.00 44.32  ? 21  ALA G CB    1 
ATOM   4498  N  N     . GLY G 3 9   ? 4.582   60.087 -23.607 1.00 42.07  ? 22  GLY G N     1 
ATOM   4499  C  CA    . GLY G 3 9   ? 4.039   60.606 -24.859 1.00 42.33  ? 22  GLY G CA    1 
ATOM   4500  C  C     . GLY G 3 9   ? 3.837   59.532 -25.908 1.00 41.97  ? 22  GLY G C     1 
ATOM   4501  O  O     . GLY G 3 9   ? 3.981   59.772 -27.114 1.00 42.50  ? 22  GLY G O     1 
ATOM   4502  N  N     . LEU G 3 10  ? 3.494   58.335 -25.446 1.00 40.70  ? 23  LEU G N     1 
ATOM   4503  C  CA    . LEU G 3 10  ? 3.337   57.196 -26.315 1.00 39.95  ? 23  LEU G CA    1 
ATOM   4504  C  C     . LEU G 3 10  ? 1.912   56.680 -26.367 1.00 40.07  ? 23  LEU G C     1 
ATOM   4505  O  O     . LEU G 3 10  ? 1.136   56.846 -25.422 1.00 40.62  ? 23  LEU G O     1 
ATOM   4506  C  CB    . LEU G 3 10  ? 4.264   56.073 -25.838 1.00 39.21  ? 23  LEU G CB    1 
ATOM   4507  C  CG    . LEU G 3 10  ? 5.734   56.422 -25.779 1.00 39.79  ? 23  LEU G CG    1 
ATOM   4508  C  CD1   . LEU G 3 10  ? 6.485   55.401 -25.029 1.00 40.48  ? 23  LEU G CD1   1 
ATOM   4509  C  CD2   . LEU G 3 10  ? 6.317   56.564 -27.156 1.00 40.35  ? 23  LEU G CD2   1 
ATOM   4510  N  N     . GLN G 3 11  ? 1.585   56.040 -27.489 1.00 39.37  ? 24  GLN G N     1 
ATOM   4511  C  CA    . GLN G 3 11  ? 0.340   55.337 -27.739 1.00 39.28  ? 24  GLN G CA    1 
ATOM   4512  C  C     . GLN G 3 11  ? 0.535   53.871 -27.324 1.00 39.36  ? 24  GLN G C     1 
ATOM   4513  O  O     . GLN G 3 11  ? -0.357  53.295 -26.709 1.00 39.46  ? 24  GLN G O     1 
ATOM   4514  C  CB    . GLN G 3 11  ? -0.051  55.417 -29.219 1.00 40.50  ? 24  GLN G CB    1 
ATOM   4515  C  CG    . GLN G 3 11  ? -0.051  56.833 -29.773 1.00 43.19  ? 24  GLN G CG    1 
ATOM   4516  C  CD    . GLN G 3 11  ? -0.991  57.779 -29.056 1.00 47.29  ? 24  GLN G CD    1 
ATOM   4517  O  OE1   . GLN G 3 11  ? -1.994  57.396 -28.429 1.00 48.01  ? 24  GLN G OE1   1 
ATOM   4518  N  NE2   . GLN G 3 11  ? -0.688  59.060 -29.155 1.00 48.90  ? 24  GLN G NE2   1 
ATOM   4519  N  N     . PHE G 3 12  ? 1.717   53.289 -27.620 1.00 38.86  ? 25  PHE G N     1 
ATOM   4520  C  CA    . PHE G 3 12  ? 2.060   51.922 -27.276 1.00 39.11  ? 25  PHE G CA    1 
ATOM   4521  C  C     . PHE G 3 12  ? 2.119   51.723 -25.760 1.00 39.42  ? 25  PHE G C     1 
ATOM   4522  O  O     . PHE G 3 12  ? 2.446   52.659 -25.022 1.00 39.48  ? 25  PHE G O     1 
ATOM   4523  C  CB    . PHE G 3 12  ? 3.346   51.496 -27.993 1.00 39.09  ? 25  PHE G CB    1 
ATOM   4524  C  CG    . PHE G 3 12  ? 3.052   50.893 -29.344 1.00 39.71  ? 25  PHE G CG    1 
ATOM   4525  C  CD1   . PHE G 3 12  ? 2.230   51.543 -30.246 1.00 40.55  ? 25  PHE G CD1   1 
ATOM   4526  C  CD2   . PHE G 3 12  ? 3.570   49.662 -29.700 1.00 40.36  ? 25  PHE G CD2   1 
ATOM   4527  C  CE1   . PHE G 3 12  ? 1.950   50.984 -31.481 1.00 41.27  ? 25  PHE G CE1   1 
ATOM   4528  C  CE2   . PHE G 3 12  ? 3.282   49.102 -30.936 1.00 41.02  ? 25  PHE G CE2   1 
ATOM   4529  C  CZ    . PHE G 3 12  ? 2.464   49.761 -31.810 1.00 40.91  ? 25  PHE G CZ    1 
ATOM   4530  N  N     . PRO G 3 13  ? 1.703   50.532 -25.276 1.00 39.27  ? 26  PRO G N     1 
ATOM   4531  C  CA    . PRO G 3 13  ? 1.609   50.317 -23.825 1.00 39.46  ? 26  PRO G CA    1 
ATOM   4532  C  C     . PRO G 3 13  ? 2.922   50.089 -23.102 1.00 40.41  ? 26  PRO G C     1 
ATOM   4533  O  O     . PRO G 3 13  ? 3.454   48.993 -23.139 1.00 40.59  ? 26  PRO G O     1 
ATOM   4534  C  CB    . PRO G 3 13  ? 0.704   49.101 -23.722 1.00 39.84  ? 26  PRO G CB    1 
ATOM   4535  C  CG    . PRO G 3 13  ? 1.008   48.326 -24.962 1.00 40.25  ? 26  PRO G CG    1 
ATOM   4536  C  CD    . PRO G 3 13  ? 1.225   49.355 -26.025 1.00 38.64  ? 26  PRO G CD    1 
ATOM   4537  N  N     . VAL G 3 14  ? 3.414   51.100 -22.394 1.00 41.25  ? 27  VAL G N     1 
ATOM   4538  C  CA    . VAL G 3 14  ? 4.668   50.989 -21.643 1.00 42.51  ? 27  VAL G CA    1 
ATOM   4539  C  C     . VAL G 3 14  ? 4.565   49.957 -20.529 1.00 43.31  ? 27  VAL G C     1 
ATOM   4540  O  O     . VAL G 3 14  ? 5.528   49.222 -20.285 1.00 43.98  ? 27  VAL G O     1 
ATOM   4541  C  CB    . VAL G 3 14  ? 5.183   52.369 -21.140 1.00 43.39  ? 27  VAL G CB    1 
ATOM   4542  C  CG1   . VAL G 3 14  ? 6.269   52.224 -20.075 1.00 43.75  ? 27  VAL G CG1   1 
ATOM   4543  C  CG2   . VAL G 3 14  ? 5.689   53.210 -22.308 1.00 43.78  ? 27  VAL G CG2   1 
ATOM   4544  N  N     . GLY G 3 15  ? 3.399   49.876 -19.899 1.00 42.98  ? 28  GLY G N     1 
ATOM   4545  C  CA    . GLY G 3 15  ? 3.173   48.923 -18.822 1.00 42.86  ? 28  GLY G CA    1 
ATOM   4546  C  C     . GLY G 3 15  ? 3.194   47.482 -19.275 1.00 42.20  ? 28  GLY G C     1 
ATOM   4547  O  O     . GLY G 3 15  ? 3.792   46.630 -18.613 1.00 42.56  ? 28  GLY G O     1 
ATOM   4548  N  N     . ARG G 3 16  ? 2.545   47.208 -20.414 1.00 41.31  ? 29  ARG G N     1 
ATOM   4549  C  CA    . ARG G 3 16  ? 2.455   45.863 -20.990 1.00 40.68  ? 29  ARG G CA    1 
ATOM   4550  C  C     . ARG G 3 16  ? 3.814   45.355 -21.445 1.00 40.75  ? 29  ARG G C     1 
ATOM   4551  O  O     . ARG G 3 16  ? 4.192   44.252 -21.089 1.00 40.84  ? 29  ARG G O     1 
ATOM   4552  C  CB    . ARG G 3 16  ? 1.420   45.838 -22.126 1.00 40.54  ? 29  ARG G CB    1 
ATOM   4553  C  CG    . ARG G 3 16  ? 1.374   44.557 -22.892 1.00 41.46  ? 29  ARG G CG    1 
ATOM   4554  C  CD    . ARG G 3 16  ? 0.371   44.660 -23.999 1.00 43.41  ? 29  ARG G CD    1 
ATOM   4555  N  NE    . ARG G 3 16  ? -0.991  44.607 -23.483 1.00 45.34  ? 29  ARG G NE    1 
ATOM   4556  C  CZ    . ARG G 3 16  ? -2.047  44.233 -24.200 1.00 46.91  ? 29  ARG G CZ    1 
ATOM   4557  N  NH1   . ARG G 3 16  ? -1.900  43.852 -25.467 1.00 45.19  ? 29  ARG G NH1   1 
ATOM   4558  N  NH2   . ARG G 3 16  ? -3.247  44.178 -23.642 1.00 47.32  ? 29  ARG G NH2   1 
ATOM   4559  N  N     . VAL G 3 17  ? 4.569   46.181 -22.166 1.00 41.04  ? 30  VAL G N     1 
ATOM   4560  C  CA    . VAL G 3 17  ? 5.906   45.856 -22.648 1.00 42.08  ? 30  VAL G CA    1 
ATOM   4561  C  C     . VAL G 3 17  ? 6.826   45.504 -21.481 1.00 44.00  ? 30  VAL G C     1 
ATOM   4562  O  O     . VAL G 3 17  ? 7.559   44.525 -21.562 1.00 44.30  ? 30  VAL G O     1 
ATOM   4563  C  CB    . VAL G 3 17  ? 6.479   47.005 -23.523 1.00 42.14  ? 30  VAL G CB    1 
ATOM   4564  C  CG1   . VAL G 3 17  ? 7.961   46.790 -23.836 1.00 42.60  ? 30  VAL G CG1   1 
ATOM   4565  C  CG2   . VAL G 3 17  ? 5.674   47.161 -24.807 1.00 42.02  ? 30  VAL G CG2   1 
ATOM   4566  N  N     . HIS G 3 18  ? 6.729   46.248 -20.370 1.00 45.39  ? 31  HIS G N     1 
ATOM   4567  C  CA    . HIS G 3 18  ? 7.544   45.980 -19.183 1.00 47.47  ? 31  HIS G CA    1 
ATOM   4568  C  C     . HIS G 3 18  ? 7.221   44.610 -18.594 1.00 47.92  ? 31  HIS G C     1 
ATOM   4569  O  O     . HIS G 3 18  ? 8.121   43.918 -18.106 1.00 49.00  ? 31  HIS G O     1 
ATOM   4570  C  CB    . HIS G 3 18  ? 7.348   47.059 -18.105 1.00 50.21  ? 31  HIS G CB    1 
ATOM   4571  C  CG    . HIS G 3 18  ? 8.203   46.843 -16.891 1.00 55.72  ? 31  HIS G CG    1 
ATOM   4572  N  ND1   . HIS G 3 18  ? 9.578   47.012 -16.937 1.00 58.50  ? 31  HIS G ND1   1 
ATOM   4573  C  CD2   . HIS G 3 18  ? 7.855   46.438 -15.647 1.00 57.66  ? 31  HIS G CD2   1 
ATOM   4574  C  CE1   . HIS G 3 18  ? 10.017  46.733 -15.720 1.00 59.35  ? 31  HIS G CE1   1 
ATOM   4575  N  NE2   . HIS G 3 18  ? 9.019   46.372 -14.912 1.00 59.29  ? 31  HIS G NE2   1 
ATOM   4576  N  N     . ARG G 3 19  ? 5.936   44.228 -18.631 1.00 46.68  ? 32  ARG G N     1 
ATOM   4577  C  CA    . ARG G 3 19  ? 5.479   42.951 -18.124 1.00 45.91  ? 32  ARG G CA    1 
ATOM   4578  C  C     . ARG G 3 19  ? 5.994   41.812 -19.007 1.00 45.08  ? 32  ARG G C     1 
ATOM   4579  O  O     . ARG G 3 19  ? 6.465   40.816 -18.473 1.00 45.67  ? 32  ARG G O     1 
ATOM   4580  C  CB    . ARG G 3 19  ? 3.951   42.968 -18.044 1.00 46.89  ? 32  ARG G CB    1 
ATOM   4581  C  CG    . ARG G 3 19  ? 3.291   41.608 -17.984 1.00 48.46  ? 32  ARG G CG    1 
ATOM   4582  C  CD    . ARG G 3 19  ? 1.906   41.753 -18.521 1.00 50.52  ? 32  ARG G CD    1 
ATOM   4583  N  NE    . ARG G 3 19  ? 1.640   40.746 -19.531 1.00 52.56  ? 32  ARG G NE    1 
ATOM   4584  C  CZ    . ARG G 3 19  ? 0.769   40.883 -20.520 1.00 54.08  ? 32  ARG G CZ    1 
ATOM   4585  N  NH1   . ARG G 3 19  ? 0.075   42.009 -20.655 1.00 52.11  ? 32  ARG G NH1   1 
ATOM   4586  N  NH2   . ARG G 3 19  ? 0.583   39.895 -21.385 1.00 54.72  ? 32  ARG G NH2   1 
ATOM   4587  N  N     . LEU G 3 20  ? 5.917   41.965 -20.342 1.00 43.61  ? 33  LEU G N     1 
ATOM   4588  C  CA    . LEU G 3 20  ? 6.372   40.968 -21.310 1.00 42.68  ? 33  LEU G CA    1 
ATOM   4589  C  C     . LEU G 3 20  ? 7.880   40.745 -21.259 1.00 42.80  ? 33  LEU G C     1 
ATOM   4590  O  O     . LEU G 3 20  ? 8.339   39.645 -21.548 1.00 43.10  ? 33  LEU G O     1 
ATOM   4591  C  CB    . LEU G 3 20  ? 5.972   41.367 -22.727 1.00 42.15  ? 33  LEU G CB    1 
ATOM   4592  C  CG    . LEU G 3 20  ? 4.494   41.491 -23.003 1.00 42.96  ? 33  LEU G CG    1 
ATOM   4593  C  CD1   . LEU G 3 20  ? 4.259   42.035 -24.382 1.00 43.67  ? 33  LEU G CD1   1 
ATOM   4594  C  CD2   . LEU G 3 20  ? 3.816   40.180 -22.876 1.00 43.26  ? 33  LEU G CD2   1 
ATOM   4595  N  N     . LEU G 3 21  ? 8.653   41.777 -20.915 1.00 42.54  ? 34  LEU G N     1 
ATOM   4596  C  CA    . LEU G 3 21  ? 10.102  41.651 -20.811 1.00 43.18  ? 34  LEU G CA    1 
ATOM   4597  C  C     . LEU G 3 21  ? 10.495  40.766 -19.622 1.00 45.43  ? 34  LEU G C     1 
ATOM   4598  O  O     . LEU G 3 21  ? 11.455  39.989 -19.713 1.00 45.84  ? 34  LEU G O     1 
ATOM   4599  C  CB    . LEU G 3 21  ? 10.738  43.021 -20.665 1.00 42.36  ? 34  LEU G CB    1 
ATOM   4600  C  CG    . LEU G 3 21  ? 10.781  43.845 -21.914 1.00 42.57  ? 34  LEU G CG    1 
ATOM   4601  C  CD1   . LEU G 3 21  ? 10.987  45.301 -21.579 1.00 42.96  ? 34  LEU G CD1   1 
ATOM   4602  C  CD2   . LEU G 3 21  ? 11.846  43.335 -22.855 1.00 42.67  ? 34  LEU G CD2   1 
ATOM   4603  N  N     . ARG G 3 22  ? 9.734   40.862 -18.516 1.00 46.63  ? 35  ARG G N     1 
ATOM   4604  C  CA    . ARG G 3 22  ? 9.968   40.051 -17.323 1.00 48.23  ? 35  ARG G CA    1 
ATOM   4605  C  C     . ARG G 3 22  ? 9.387   38.649 -17.557 1.00 48.58  ? 35  ARG G C     1 
ATOM   4606  O  O     . ARG G 3 22  ? 10.081  37.633 -17.388 1.00 48.96  ? 35  ARG G O     1 
ATOM   4607  C  CB    . ARG G 3 22  ? 9.327   40.720 -16.086 1.00 50.86  ? 35  ARG G CB    1 
ATOM   4608  C  CG    . ARG G 3 22  ? 9.739   42.190 -15.890 1.00 55.54  ? 35  ARG G CG    1 
ATOM   4609  C  CD    . ARG G 3 22  ? 9.301   42.783 -14.557 1.00 59.81  ? 35  ARG G CD    1 
ATOM   4610  N  NE    . ARG G 3 22  ? 8.046   43.530 -14.656 1.00 63.85  ? 35  ARG G NE    1 
ATOM   4611  C  CZ    . ARG G 3 22  ? 6.839   43.015 -14.417 1.00 67.09  ? 35  ARG G CZ    1 
ATOM   4612  N  NH1   . ARG G 3 22  ? 6.711   41.740 -14.060 1.00 66.92  ? 35  ARG G NH1   1 
ATOM   4613  N  NH2   . ARG G 3 22  ? 5.753   43.775 -14.522 1.00 67.45  ? 35  ARG G NH2   1 
ATOM   4614  N  N     . LYS G 3 23  ? 8.133   38.607 -18.039 1.00 48.07  ? 36  LYS G N     1 
ATOM   4615  C  CA    . LYS G 3 23  ? 7.413   37.371 -18.327 1.00 48.07  ? 36  LYS G CA    1 
ATOM   4616  C  C     . LYS G 3 23  ? 7.898   36.627 -19.587 1.00 47.83  ? 36  LYS G C     1 
ATOM   4617  O  O     . LYS G 3 23  ? 7.284   35.637 -19.964 1.00 48.37  ? 36  LYS G O     1 
ATOM   4618  C  CB    . LYS G 3 23  ? 5.893   37.626 -18.396 1.00 49.94  ? 36  LYS G CB    1 
ATOM   4619  C  CG    . LYS G 3 23  ? 5.162   37.424 -17.056 1.00 55.06  ? 36  LYS G CG    1 
ATOM   4620  C  CD    . LYS G 3 23  ? 5.580   38.427 -15.941 1.00 60.01  ? 36  LYS G CD    1 
ATOM   4621  C  CE    . LYS G 3 23  ? 5.237   37.983 -14.527 1.00 62.97  ? 36  LYS G CE    1 
ATOM   4622  N  NZ    . LYS G 3 23  ? 6.036   38.730 -13.510 1.00 64.70  ? 36  LYS G NZ    1 
ATOM   4623  N  N     . GLY G 3 24  ? 8.978   37.085 -20.213 1.00 46.90  ? 37  GLY G N     1 
ATOM   4624  C  CA    . GLY G 3 24  ? 9.532   36.457 -21.405 1.00 46.48  ? 37  GLY G CA    1 
ATOM   4625  C  C     . GLY G 3 24  ? 10.899  35.831 -21.222 1.00 45.99  ? 37  GLY G C     1 
ATOM   4626  O  O     . GLY G 3 24  ? 11.460  35.307 -22.191 1.00 46.03  ? 37  GLY G O     1 
ATOM   4627  N  N     . ASN G 3 25  ? 11.448  35.869 -19.992 1.00 45.78  ? 38  ASN G N     1 
ATOM   4628  C  CA    . ASN G 3 25  ? 12.746  35.256 -19.678 1.00 46.65  ? 38  ASN G CA    1 
ATOM   4629  C  C     . ASN G 3 25  ? 13.942  35.875 -20.439 1.00 46.64  ? 38  ASN G C     1 
ATOM   4630  O  O     . ASN G 3 25  ? 14.774  35.136 -20.981 1.00 47.18  ? 38  ASN G O     1 
ATOM   4631  C  CB    . ASN G 3 25  ? 12.713  33.704 -19.893 1.00 48.50  ? 38  ASN G CB    1 
ATOM   4632  C  CG    . ASN G 3 25  ? 11.656  32.958 -19.111 1.00 52.30  ? 38  ASN G CG    1 
ATOM   4633  O  OD1   . ASN G 3 25  ? 11.411  33.252 -17.925 1.00 54.42  ? 38  ASN G OD1   1 
ATOM   4634  N  ND2   . ASN G 3 25  ? 11.010  31.977 -19.760 1.00 52.03  ? 38  ASN G ND2   1 
ATOM   4635  N  N     . TYR G 3 26  ? 14.027  37.212 -20.494 1.00 45.63  ? 39  TYR G N     1 
ATOM   4636  C  CA    . TYR G 3 26  ? 15.132  37.867 -21.199 1.00 45.16  ? 39  TYR G CA    1 
ATOM   4637  C  C     . TYR G 3 26  ? 16.284  38.213 -20.250 1.00 46.57  ? 39  TYR G C     1 
ATOM   4638  O  O     . TYR G 3 26  ? 17.452  38.154 -20.638 1.00 46.57  ? 39  TYR G O     1 
ATOM   4639  C  CB    . TYR G 3 26  ? 14.637  39.077 -21.986 1.00 43.65  ? 39  TYR G CB    1 
ATOM   4640  C  CG    . TYR G 3 26  ? 13.568  38.725 -22.995 1.00 43.02  ? 39  TYR G CG    1 
ATOM   4641  C  CD1   . TYR G 3 26  ? 13.886  38.068 -24.173 1.00 43.26  ? 39  TYR G CD1   1 
ATOM   4642  C  CD2   . TYR G 3 26  ? 12.239  39.056 -22.774 1.00 43.15  ? 39  TYR G CD2   1 
ATOM   4643  C  CE1   . TYR G 3 26  ? 12.903  37.719 -25.095 1.00 43.68  ? 39  TYR G CE1   1 
ATOM   4644  C  CE2   . TYR G 3 26  ? 11.250  38.732 -23.698 1.00 43.65  ? 39  TYR G CE2   1 
ATOM   4645  C  CZ    . TYR G 3 26  ? 11.585  38.050 -24.853 1.00 44.11  ? 39  TYR G CZ    1 
ATOM   4646  O  OH    . TYR G 3 26  ? 10.623  37.718 -25.774 1.00 44.88  ? 39  TYR G OH    1 
ATOM   4647  N  N     . SER G 3 27  ? 15.965  38.538 -18.994 1.00 47.66  ? 40  SER G N     1 
ATOM   4648  C  CA    . SER G 3 27  ? 16.971  38.833 -17.967 1.00 49.11  ? 40  SER G CA    1 
ATOM   4649  C  C     . SER G 3 27  ? 16.350  38.776 -16.568 1.00 50.31  ? 40  SER G C     1 
ATOM   4650  O  O     . SER G 3 27  ? 15.116  38.750 -16.429 1.00 50.39  ? 40  SER G O     1 
ATOM   4651  C  CB    . SER G 3 27  ? 17.624  40.197 -18.197 1.00 50.53  ? 40  SER G CB    1 
ATOM   4652  O  OG    . SER G 3 27  ? 16.753  41.272 -17.878 1.00 52.54  ? 40  SER G OG    1 
ATOM   4653  N  N     . GLU G 3 28  ? 17.208  38.775 -15.528 1.00 51.11  ? 41  GLU G N     1 
ATOM   4654  C  CA    . GLU G 3 28  ? 16.774  38.769 -14.139 1.00 52.23  ? 41  GLU G CA    1 
ATOM   4655  C  C     . GLU G 3 28  ? 15.891  40.026 -13.861 1.00 51.86  ? 41  GLU G C     1 
ATOM   4656  O  O     . GLU G 3 28  ? 14.727  39.872 -13.476 1.00 51.99  ? 41  GLU G O     1 
ATOM   4657  C  CB    . GLU G 3 28  ? 18.005  38.710 -13.214 1.00 56.42  ? 41  GLU G CB    1 
ATOM   4658  C  CG    . GLU G 3 28  ? 17.773  38.008 -11.885 1.00 64.66  ? 41  GLU G CG    1 
ATOM   4659  C  CD    . GLU G 3 28  ? 18.982  38.010 -10.961 1.00 74.18  ? 41  GLU G CD    1 
ATOM   4660  O  OE1   . GLU G 3 28  ? 19.140  38.983 -10.186 1.00 75.34  ? 41  GLU G OE1   1 
ATOM   4661  O  OE2   . GLU G 3 28  ? 19.779  37.042 -11.016 1.00 77.43  ? 41  GLU G OE2   1 
ATOM   4662  N  N     . ARG G 3 29  ? 16.414  41.253 -14.147 1.00 51.09  ? 42  ARG G N     1 
ATOM   4663  C  CA    . ARG G 3 29  ? 15.676  42.516 -13.934 1.00 50.76  ? 42  ARG G CA    1 
ATOM   4664  C  C     . ARG G 3 29  ? 15.501  43.374 -15.214 1.00 49.18  ? 42  ARG G C     1 
ATOM   4665  O  O     . ARG G 3 29  ? 16.285  43.276 -16.155 1.00 49.45  ? 42  ARG G O     1 
ATOM   4666  C  CB    . ARG G 3 29  ? 16.301  43.362 -12.801 1.00 53.10  ? 42  ARG G CB    1 
ATOM   4667  C  CG    . ARG G 3 29  ? 16.811  42.552 -11.626 1.00 58.11  ? 42  ARG G CG    1 
ATOM   4668  C  CD    . ARG G 3 29  ? 17.636  43.371 -10.684 1.00 63.19  ? 42  ARG G CD    1 
ATOM   4669  N  NE    . ARG G 3 29  ? 16.924  43.558 -9.423  1.00 67.98  ? 42  ARG G NE    1 
ATOM   4670  C  CZ    . ARG G 3 29  ? 17.073  44.598 -8.618  1.00 71.71  ? 42  ARG G CZ    1 
ATOM   4671  N  NH1   . ARG G 3 29  ? 17.913  45.580 -8.940  1.00 71.99  ? 42  ARG G NH1   1 
ATOM   4672  N  NH2   . ARG G 3 29  ? 16.383  44.678 -7.487  1.00 71.86  ? 42  ARG G NH2   1 
ATOM   4673  N  N     . VAL G 3 30  ? 14.457  44.207 -15.243 1.00 47.33  ? 43  VAL G N     1 
ATOM   4674  C  CA    . VAL G 3 30  ? 14.139  45.077 -16.374 1.00 46.06  ? 43  VAL G CA    1 
ATOM   4675  C  C     . VAL G 3 30  ? 14.160  46.539 -15.929 1.00 45.18  ? 43  VAL G C     1 
ATOM   4676  O  O     . VAL G 3 30  ? 13.342  46.952 -15.110 1.00 45.13  ? 43  VAL G O     1 
ATOM   4677  C  CB    . VAL G 3 30  ? 12.758  44.712 -16.971 1.00 46.30  ? 43  VAL G CB    1 
ATOM   4678  C  CG1   . VAL G 3 30  ? 12.339  45.696 -18.056 1.00 46.64  ? 43  VAL G CG1   1 
ATOM   4679  C  CG2   . VAL G 3 30  ? 12.757  43.288 -17.502 1.00 46.78  ? 43  VAL G CG2   1 
ATOM   4680  N  N     . GLY G 3 31  ? 15.075  47.314 -16.489 1.00 44.39  ? 44  GLY G N     1 
ATOM   4681  C  CA    . GLY G 3 31  ? 15.219  48.739 -16.211 1.00 43.98  ? 44  GLY G CA    1 
ATOM   4682  C  C     . GLY G 3 31  ? 13.945  49.541 -16.388 1.00 43.34  ? 44  GLY G C     1 
ATOM   4683  O  O     . GLY G 3 31  ? 13.017  49.102 -17.064 1.00 43.59  ? 44  GLY G O     1 
ATOM   4684  N  N     . ALA G 3 32  ? 13.871  50.703 -15.740 1.00 42.56  ? 45  ALA G N     1 
ATOM   4685  C  CA    . ALA G 3 32  ? 12.675  51.551 -15.758 1.00 42.06  ? 45  ALA G CA    1 
ATOM   4686  C  C     . ALA G 3 32  ? 12.384  52.162 -17.112 1.00 40.74  ? 45  ALA G C     1 
ATOM   4687  O  O     . ALA G 3 32  ? 11.217  52.357 -17.467 1.00 40.25  ? 45  ALA G O     1 
ATOM   4688  C  CB    . ALA G 3 32  ? 12.807  52.649 -14.710 1.00 42.53  ? 45  ALA G CB    1 
ATOM   4689  N  N     . GLY G 3 33  ? 13.454  52.472 -17.838 1.00 39.99  ? 46  GLY G N     1 
ATOM   4690  C  CA    . GLY G 3 33  ? 13.392  53.101 -19.147 1.00 39.53  ? 46  GLY G CA    1 
ATOM   4691  C  C     . GLY G 3 33  ? 13.409  52.143 -20.316 1.00 38.33  ? 46  GLY G C     1 
ATOM   4692  O  O     . GLY G 3 33  ? 13.117  52.561 -21.439 1.00 38.29  ? 46  GLY G O     1 
ATOM   4693  N  N     . ALA G 3 34  ? 13.764  50.865 -20.081 1.00 37.01  ? 47  ALA G N     1 
ATOM   4694  C  CA    . ALA G 3 34  ? 13.760  49.883 -21.160 1.00 36.34  ? 47  ALA G CA    1 
ATOM   4695  C  C     . ALA G 3 34  ? 12.381  49.688 -21.802 1.00 35.82  ? 47  ALA G C     1 
ATOM   4696  O  O     . ALA G 3 34  ? 12.320  49.803 -23.018 1.00 36.34  ? 47  ALA G O     1 
ATOM   4697  C  CB    . ALA G 3 34  ? 14.351  48.560 -20.710 1.00 36.24  ? 47  ALA G CB    1 
ATOM   4698  N  N     . PRO G 3 35  ? 11.256  49.473 -21.073 1.00 34.87  ? 48  PRO G N     1 
ATOM   4699  C  CA    . PRO G 3 35  ? 9.951   49.327 -21.760 1.00 33.86  ? 48  PRO G CA    1 
ATOM   4700  C  C     . PRO G 3 35  ? 9.472   50.579 -22.459 1.00 31.96  ? 48  PRO G C     1 
ATOM   4701  O  O     . PRO G 3 35  ? 8.713   50.484 -23.407 1.00 31.75  ? 48  PRO G O     1 
ATOM   4702  C  CB    . PRO G 3 35  ? 8.984   48.972 -20.633 1.00 34.98  ? 48  PRO G CB    1 
ATOM   4703  C  CG    . PRO G 3 35  ? 9.614   49.499 -19.422 1.00 35.98  ? 48  PRO G CG    1 
ATOM   4704  C  CD    . PRO G 3 35  ? 11.093  49.311 -19.620 1.00 34.60  ? 48  PRO G CD    1 
ATOM   4705  N  N     . VAL G 3 36  ? 9.898   51.737 -21.966 1.00 30.72  ? 49  VAL G N     1 
ATOM   4706  C  CA    . VAL G 3 36  ? 9.586   53.061 -22.496 1.00 29.86  ? 49  VAL G CA    1 
ATOM   4707  C  C     . VAL G 3 36  ? 10.308  53.240 -23.847 1.00 28.48  ? 49  VAL G C     1 
ATOM   4708  O  O     . VAL G 3 36  ? 9.675   53.572 -24.846 1.00 28.33  ? 49  VAL G O     1 
ATOM   4709  C  CB    . VAL G 3 36  ? 10.027  54.134 -21.474 1.00 30.19  ? 49  VAL G CB    1 
ATOM   4710  C  CG1   . VAL G 3 36  ? 9.732   55.528 -21.990 1.00 30.55  ? 49  VAL G CG1   1 
ATOM   4711  C  CG2   . VAL G 3 36  ? 9.372   53.896 -20.120 1.00 30.67  ? 49  VAL G CG2   1 
ATOM   4712  N  N     . TYR G 3 37  ? 11.623  52.955 -23.885 1.00 27.06  ? 50  TYR G N     1 
ATOM   4713  C  CA    . TYR G 3 37  ? 12.434  53.035 -25.088 1.00 25.93  ? 50  TYR G CA    1 
ATOM   4714  C  C     . TYR G 3 37  ? 11.888  52.051 -26.122 1.00 25.48  ? 50  TYR G C     1 
ATOM   4715  O  O     . TYR G 3 37  ? 11.685  52.431 -27.271 1.00 25.59  ? 50  TYR G O     1 
ATOM   4716  C  CB    . TYR G 3 37  ? 13.892  52.695 -24.742 1.00 25.36  ? 50  TYR G CB    1 
ATOM   4717  C  CG    . TYR G 3 37  ? 14.896  53.155 -25.774 1.00 25.61  ? 50  TYR G CG    1 
ATOM   4718  C  CD1   . TYR G 3 37  ? 14.915  52.606 -27.044 1.00 26.37  ? 50  TYR G CD1   1 
ATOM   4719  C  CD2   . TYR G 3 37  ? 15.856  54.105 -25.465 1.00 26.25  ? 50  TYR G CD2   1 
ATOM   4720  C  CE1   . TYR G 3 37  ? 15.847  53.001 -27.988 1.00 27.07  ? 50  TYR G CE1   1 
ATOM   4721  C  CE2   . TYR G 3 37  ? 16.808  54.493 -26.396 1.00 26.97  ? 50  TYR G CE2   1 
ATOM   4722  C  CZ    . TYR G 3 37  ? 16.789  53.948 -27.663 1.00 27.66  ? 50  TYR G CZ    1 
ATOM   4723  O  OH    . TYR G 3 37  ? 17.689  54.332 -28.616 1.00 28.81  ? 50  TYR G OH    1 
ATOM   4724  N  N     . LEU G 3 38  ? 11.599  50.806 -25.691 1.00 24.75  ? 51  LEU G N     1 
ATOM   4725  C  CA    . LEU G 3 38  ? 11.094  49.740 -26.550 1.00 24.37  ? 51  LEU G CA    1 
ATOM   4726  C  C     . LEU G 3 38  ? 9.720   50.035 -27.089 1.00 24.24  ? 51  LEU G C     1 
ATOM   4727  O  O     . LEU G 3 38  ? 9.568   49.977 -28.308 1.00 25.17  ? 51  LEU G O     1 
ATOM   4728  C  CB    . LEU G 3 38  ? 11.132  48.384 -25.843 1.00 24.42  ? 51  LEU G CB    1 
ATOM   4729  C  CG    . LEU G 3 38  ? 10.750  47.119 -26.651 1.00 25.17  ? 51  LEU G CG    1 
ATOM   4730  C  CD1   . LEU G 3 38  ? 11.512  47.025 -27.981 1.00 25.30  ? 51  LEU G CD1   1 
ATOM   4731  C  CD2   . LEU G 3 38  ? 11.014  45.889 -25.836 1.00 24.68  ? 51  LEU G CD2   1 
ATOM   4732  N  N     . ALA G 3 39  ? 8.732   50.429 -26.234 1.00 22.84  ? 52  ALA G N     1 
ATOM   4733  C  CA    . ALA G 3 39  ? 7.380   50.774 -26.714 1.00 21.94  ? 52  ALA G CA    1 
ATOM   4734  C  C     . ALA G 3 39  ? 7.434   51.874 -27.775 1.00 22.08  ? 52  ALA G C     1 
ATOM   4735  O  O     . ALA G 3 39  ? 6.658   51.843 -28.723 1.00 22.22  ? 52  ALA G O     1 
ATOM   4736  C  CB    . ALA G 3 39  ? 6.489   51.199 -25.564 1.00 21.42  ? 52  ALA G CB    1 
ATOM   4737  N  N     . ALA G 3 40  ? 8.407   52.802 -27.641 1.00 21.83  ? 53  ALA G N     1 
ATOM   4738  C  CA    . ALA G 3 40  ? 8.669   53.911 -28.555 1.00 21.70  ? 53  ALA G CA    1 
ATOM   4739  C  C     . ALA G 3 40  ? 9.254   53.444 -29.897 1.00 20.98  ? 53  ALA G C     1 
ATOM   4740  O  O     . ALA G 3 40  ? 8.858   53.963 -30.945 1.00 21.10  ? 53  ALA G O     1 
ATOM   4741  C  CB    . ALA G 3 40  ? 9.608   54.903 -27.899 1.00 22.15  ? 53  ALA G CB    1 
ATOM   4742  N  N     . VAL G 3 41  ? 10.204  52.487 -29.860 1.00 19.84  ? 54  VAL G N     1 
ATOM   4743  C  CA    . VAL G 3 41  ? 10.813  51.912 -31.061 1.00 19.31  ? 54  VAL G CA    1 
ATOM   4744  C  C     . VAL G 3 41  ? 9.765   51.106 -31.831 1.00 18.69  ? 54  VAL G C     1 
ATOM   4745  O  O     . VAL G 3 41  ? 9.735   51.153 -33.060 1.00 19.31  ? 54  VAL G O     1 
ATOM   4746  C  CB    . VAL G 3 41  ? 12.061  51.041 -30.727 1.00 19.45  ? 54  VAL G CB    1 
ATOM   4747  C  CG1   . VAL G 3 41  ? 12.556  50.289 -31.956 1.00 19.35  ? 54  VAL G CG1   1 
ATOM   4748  C  CG2   . VAL G 3 41  ? 13.182  51.889 -30.156 1.00 19.86  ? 54  VAL G CG2   1 
ATOM   4749  N  N     . LEU G 3 42  ? 8.896   50.384 -31.112 1.00 17.43  ? 55  LEU G N     1 
ATOM   4750  C  CA    . LEU G 3 42  ? 7.836   49.604 -31.727 1.00 17.22  ? 55  LEU G CA    1 
ATOM   4751  C  C     . LEU G 3 42  ? 6.785   50.525 -32.319 1.00 17.70  ? 55  LEU G C     1 
ATOM   4752  O  O     . LEU G 3 42  ? 6.366   50.308 -33.449 1.00 16.94  ? 55  LEU G O     1 
ATOM   4753  C  CB    . LEU G 3 42  ? 7.210   48.665 -30.703 1.00 17.37  ? 55  LEU G CB    1 
ATOM   4754  C  CG    . LEU G 3 42  ? 8.118   47.535 -30.244 1.00 18.94  ? 55  LEU G CG    1 
ATOM   4755  C  CD1   . LEU G 3 42  ? 7.552   46.849 -29.040 1.00 19.86  ? 55  LEU G CD1   1 
ATOM   4756  C  CD2   . LEU G 3 42  ? 8.374   46.537 -31.363 1.00 19.48  ? 55  LEU G CD2   1 
ATOM   4757  N  N     . GLU G 3 43  ? 6.415   51.598 -31.582 1.00 18.62  ? 56  GLU G N     1 
ATOM   4758  C  CA    . GLU G 3 43  ? 5.453   52.594 -32.033 1.00 19.63  ? 56  GLU G CA    1 
ATOM   4759  C  C     . GLU G 3 43  ? 5.977   53.334 -33.267 1.00 20.59  ? 56  GLU G C     1 
ATOM   4760  O  O     . GLU G 3 43  ? 5.216   53.581 -34.209 1.00 20.97  ? 56  GLU G O     1 
ATOM   4761  C  CB    . GLU G 3 43  ? 5.130   53.596 -30.919 1.00 22.22  ? 56  GLU G CB    1 
ATOM   4762  C  CG    . GLU G 3 43  ? 4.116   54.643 -31.362 1.00 27.96  ? 56  GLU G CG    1 
ATOM   4763  C  CD    . GLU G 3 43  ? 3.710   55.672 -30.329 1.00 32.92  ? 56  GLU G CD    1 
ATOM   4764  O  OE1   . GLU G 3 43  ? 3.635   55.296 -29.138 1.00 32.34  ? 56  GLU G OE1   1 
ATOM   4765  O  OE2   . GLU G 3 43  ? 3.443   56.842 -30.703 1.00 35.00  ? 56  GLU G OE2   1 
ATOM   4766  N  N     . TYR G 3 44  ? 7.273   53.676 -33.283 1.00 20.81  ? 57  TYR G N     1 
ATOM   4767  C  CA    . TYR G 3 44  ? 7.860   54.342 -34.439 1.00 21.72  ? 57  TYR G CA    1 
ATOM   4768  C  C     . TYR G 3 44  ? 7.757   53.447 -35.677 1.00 20.54  ? 57  TYR G C     1 
ATOM   4769  O  O     . TYR G 3 44  ? 7.297   53.909 -36.724 1.00 21.01  ? 57  TYR G O     1 
ATOM   4770  C  CB    . TYR G 3 44  ? 9.331   54.751 -34.183 1.00 23.25  ? 57  TYR G CB    1 
ATOM   4771  C  CG    . TYR G 3 44  ? 10.101  55.044 -35.461 1.00 25.46  ? 57  TYR G CG    1 
ATOM   4772  C  CD1   . TYR G 3 44  ? 9.771   56.132 -36.265 1.00 26.93  ? 57  TYR G CD1   1 
ATOM   4773  C  CD2   . TYR G 3 44  ? 11.088  54.176 -35.914 1.00 26.85  ? 57  TYR G CD2   1 
ATOM   4774  C  CE1   . TYR G 3 44  ? 10.426  56.366 -37.467 1.00 28.36  ? 57  TYR G CE1   1 
ATOM   4775  C  CE2   . TYR G 3 44  ? 11.752  54.402 -37.113 1.00 28.19  ? 57  TYR G CE2   1 
ATOM   4776  C  CZ    . TYR G 3 44  ? 11.418  55.498 -37.888 1.00 29.82  ? 57  TYR G CZ    1 
ATOM   4777  O  OH    . TYR G 3 44  ? 12.097  55.744 -39.059 1.00 32.19  ? 57  TYR G OH    1 
ATOM   4778  N  N     . LEU G 3 45  ? 8.191   52.185 -35.550 1.00 18.66  ? 58  LEU G N     1 
ATOM   4779  C  CA    . LEU G 3 45  ? 8.184   51.262 -36.662 1.00 17.63  ? 58  LEU G CA    1 
ATOM   4780  C  C     . LEU G 3 45  ? 6.786   50.986 -37.161 1.00 17.75  ? 58  LEU G C     1 
ATOM   4781  O  O     . LEU G 3 45  ? 6.605   50.904 -38.378 1.00 17.94  ? 58  LEU G O     1 
ATOM   4782  C  CB    . LEU G 3 45  ? 8.935   49.976 -36.318 1.00 17.03  ? 58  LEU G CB    1 
ATOM   4783  C  CG    . LEU G 3 45  ? 10.440  50.142 -36.089 1.00 17.66  ? 58  LEU G CG    1 
ATOM   4784  C  CD1   . LEU G 3 45  ? 11.078  48.852 -35.577 1.00 18.21  ? 58  LEU G CD1   1 
ATOM   4785  C  CD2   . LEU G 3 45  ? 11.133  50.609 -37.339 1.00 17.85  ? 58  LEU G CD2   1 
ATOM   4786  N  N     . THR G 3 46  ? 5.775   50.902 -36.254 1.00 17.67  ? 59  THR G N     1 
ATOM   4787  C  CA    . THR G 3 46  ? 4.410   50.654 -36.747 1.00 18.20  ? 59  THR G CA    1 
ATOM   4788  C  C     . THR G 3 46  ? 3.913   51.872 -37.471 1.00 19.76  ? 59  THR G C     1 
ATOM   4789  O  O     . THR G 3 46  ? 3.279   51.690 -38.490 1.00 20.74  ? 59  THR G O     1 
ATOM   4790  C  CB    . THR G 3 46  ? 3.387   50.071 -35.738 1.00 18.44  ? 59  THR G CB    1 
ATOM   4791  O  OG1   . THR G 3 46  ? 2.528   51.074 -35.192 1.00 18.99  ? 59  THR G OG1   1 
ATOM   4792  C  CG2   . THR G 3 46  ? 4.016   49.263 -34.659 1.00 18.41  ? 59  THR G CG2   1 
ATOM   4793  N  N     . ALA G 3 47  ? 4.231   53.101 -37.002 1.00 19.80  ? 60  ALA G N     1 
ATOM   4794  C  CA    . ALA G 3 47  ? 3.827   54.317 -37.679 1.00 20.10  ? 60  ALA G CA    1 
ATOM   4795  C  C     . ALA G 3 47  ? 4.487   54.421 -39.069 1.00 20.36  ? 60  ALA G C     1 
ATOM   4796  O  O     . ALA G 3 47  ? 3.836   54.754 -40.057 1.00 19.87  ? 60  ALA G O     1 
ATOM   4797  C  CB    . ALA G 3 47  ? 4.201   55.509 -36.824 1.00 20.53  ? 60  ALA G CB    1 
ATOM   4798  N  N     . GLU G 3 48  ? 5.763   54.069 -39.141 1.00 21.10  ? 61  GLU G N     1 
ATOM   4799  C  CA    . GLU G 3 48  ? 6.534   54.068 -40.363 1.00 22.65  ? 61  GLU G CA    1 
ATOM   4800  C  C     . GLU G 3 48  ? 5.892   53.111 -41.397 1.00 23.33  ? 61  GLU G C     1 
ATOM   4801  O  O     . GLU G 3 48  ? 5.753   53.477 -42.564 1.00 24.19  ? 61  GLU G O     1 
ATOM   4802  C  CB    . GLU G 3 48  ? 7.972   53.650 -40.016 1.00 26.57  ? 61  GLU G CB    1 
ATOM   4803  C  CG    . GLU G 3 48  ? 9.007   53.944 -41.081 1.00 34.69  ? 61  GLU G CG    1 
ATOM   4804  C  CD    . GLU G 3 48  ? 9.040   55.379 -41.554 1.00 46.20  ? 61  GLU G CD    1 
ATOM   4805  O  OE1   . GLU G 3 48  ? 9.410   56.279 -40.759 1.00 48.18  ? 61  GLU G OE1   1 
ATOM   4806  O  OE2   . GLU G 3 48  ? 8.695   55.597 -42.739 1.00 50.46  ? 61  GLU G OE2   1 
ATOM   4807  N  N     . ILE G 3 49  ? 5.439   51.921 -40.957 1.00 22.76  ? 62  ILE G N     1 
ATOM   4808  C  CA    . ILE G 3 49  ? 4.769   50.955 -41.844 1.00 22.57  ? 62  ILE G CA    1 
ATOM   4809  C  C     . ILE G 3 49  ? 3.389   51.457 -42.278 1.00 22.00  ? 62  ILE G C     1 
ATOM   4810  O  O     . ILE G 3 49  ? 3.136   51.570 -43.476 1.00 22.15  ? 62  ILE G O     1 
ATOM   4811  C  CB    . ILE G 3 49  ? 4.711   49.520 -41.239 1.00 22.97  ? 62  ILE G CB    1 
ATOM   4812  C  CG1   . ILE G 3 49  ? 6.115   48.913 -41.175 1.00 24.24  ? 62  ILE G CG1   1 
ATOM   4813  C  CG2   . ILE G 3 49  ? 3.727   48.599 -42.018 1.00 23.45  ? 62  ILE G CG2   1 
ATOM   4814  C  CD1   . ILE G 3 49  ? 6.153   47.434 -40.866 1.00 26.44  ? 62  ILE G CD1   1 
ATOM   4815  N  N     . LEU G 3 50  ? 2.515   51.787 -41.295 1.00 21.04  ? 63  LEU G N     1 
ATOM   4816  C  CA    . LEU G 3 50  ? 1.155   52.292 -41.485 1.00 20.28  ? 63  LEU G CA    1 
ATOM   4817  C  C     . LEU G 3 50  ? 1.130   53.441 -42.461 1.00 21.34  ? 63  LEU G C     1 
ATOM   4818  O  O     . LEU G 3 50  ? 0.217   53.526 -43.281 1.00 21.46  ? 63  LEU G O     1 
ATOM   4819  C  CB    . LEU G 3 50  ? 0.539   52.718 -40.145 1.00 19.22  ? 63  LEU G CB    1 
ATOM   4820  C  CG    . LEU G 3 50  ? 0.166   51.565 -39.221 1.00 19.45  ? 63  LEU G CG    1 
ATOM   4821  C  CD1   . LEU G 3 50  ? -0.170  52.041 -37.834 1.00 20.02  ? 63  LEU G CD1   1 
ATOM   4822  C  CD2   . LEU G 3 50  ? -0.946  50.765 -39.784 1.00 19.29  ? 63  LEU G CD2   1 
ATOM   4823  N  N     . GLU G 3 51  ? 2.162   54.302 -42.407 1.00 22.00  ? 64  GLU G N     1 
ATOM   4824  C  CA    . GLU G 3 51  ? 2.294   55.440 -43.302 1.00 22.71  ? 64  GLU G CA    1 
ATOM   4825  C  C     . GLU G 3 51  ? 2.360   54.980 -44.748 1.00 22.79  ? 64  GLU G C     1 
ATOM   4826  O  O     . GLU G 3 51  ? 1.472   55.304 -45.525 1.00 23.33  ? 64  GLU G O     1 
ATOM   4827  C  CB    . GLU G 3 51  ? 3.512   56.320 -42.918 1.00 25.18  ? 64  GLU G CB    1 
ATOM   4828  C  CG    . GLU G 3 51  ? 3.860   57.416 -43.922 1.00 30.57  ? 64  GLU G CG    1 
ATOM   4829  C  CD    . GLU G 3 51  ? 2.993   58.673 -43.930 1.00 36.95  ? 64  GLU G CD    1 
ATOM   4830  O  OE1   . GLU G 3 51  ? 2.691   59.181 -45.038 1.00 37.74  ? 64  GLU G OE1   1 
ATOM   4831  O  OE2   . GLU G 3 51  ? 2.629   59.156 -42.832 1.00 39.23  ? 64  GLU G OE2   1 
ATOM   4832  N  N     . LEU G 3 52  ? 3.346   54.175 -45.085 1.00 22.34  ? 65  LEU G N     1 
ATOM   4833  C  CA    . LEU G 3 52  ? 3.540   53.730 -46.448 1.00 23.22  ? 65  LEU G CA    1 
ATOM   4834  C  C     . LEU G 3 52  ? 2.407   52.811 -46.956 1.00 24.32  ? 65  LEU G C     1 
ATOM   4835  O  O     . LEU G 3 52  ? 2.143   52.747 -48.166 1.00 23.82  ? 65  LEU G O     1 
ATOM   4836  C  CB    . LEU G 3 52  ? 4.922   53.080 -46.569 1.00 23.41  ? 65  LEU G CB    1 
ATOM   4837  C  CG    . LEU G 3 52  ? 6.074   53.892 -46.010 1.00 24.61  ? 65  LEU G CG    1 
ATOM   4838  C  CD1   . LEU G 3 52  ? 7.316   53.066 -45.898 1.00 25.29  ? 65  LEU G CD1   1 
ATOM   4839  C  CD2   . LEU G 3 52  ? 6.324   55.073 -46.849 1.00 25.55  ? 65  LEU G CD2   1 
ATOM   4840  N  N     . ALA G 3 53  ? 1.735   52.107 -46.023 1.00 25.45  ? 66  ALA G N     1 
ATOM   4841  C  CA    . ALA G 3 53  ? 0.633   51.204 -46.352 1.00 26.28  ? 66  ALA G CA    1 
ATOM   4842  C  C     . ALA G 3 53  ? -0.615  52.013 -46.674 1.00 26.94  ? 66  ALA G C     1 
ATOM   4843  O  O     . ALA G 3 53  ? -1.251  51.744 -47.685 1.00 27.93  ? 66  ALA G O     1 
ATOM   4844  C  CB    . ALA G 3 53  ? 0.368   50.232 -45.209 1.00 26.23  ? 66  ALA G CB    1 
ATOM   4845  N  N     . GLY G 3 54  ? -0.905  53.053 -45.893 1.00 26.17  ? 67  GLY G N     1 
ATOM   4846  C  CA    . GLY G 3 54  ? -2.043  53.928 -46.167 1.00 25.96  ? 67  GLY G CA    1 
ATOM   4847  C  C     . GLY G 3 54  ? -1.925  54.603 -47.519 1.00 25.51  ? 67  GLY G C     1 
ATOM   4848  O  O     . GLY G 3 54  ? -2.918  54.774 -48.219 1.00 25.40  ? 67  GLY G O     1 
ATOM   4849  N  N     . ASN G 3 55  ? -0.681  54.912 -47.919 1.00 25.50  ? 68  ASN G N     1 
ATOM   4850  C  CA    . ASN G 3 55  ? -0.326  55.496 -49.205 1.00 25.97  ? 68  ASN G CA    1 
ATOM   4851  C  C     . ASN G 3 55  ? -0.579  54.514 -50.319 1.00 27.19  ? 68  ASN G C     1 
ATOM   4852  O  O     . ASN G 3 55  ? -1.039  54.921 -51.376 1.00 27.53  ? 68  ASN G O     1 
ATOM   4853  C  CB    . ASN G 3 55  ? 1.149   55.887 -49.248 1.00 26.01  ? 68  ASN G CB    1 
ATOM   4854  C  CG    . ASN G 3 55  ? 1.516   57.028 -48.347 1.00 26.27  ? 68  ASN G CG    1 
ATOM   4855  O  OD1   . ASN G 3 55  ? 0.741   57.444 -47.479 1.00 25.30  ? 68  ASN G OD1   1 
ATOM   4856  N  ND2   . ASN G 3 55  ? 2.734   57.523 -48.526 1.00 26.52  ? 68  ASN G ND2   1 
ATOM   4857  N  N     . ALA G 3 56  ? -0.241  53.236 -50.117 1.00 27.74  ? 69  ALA G N     1 
ATOM   4858  C  CA    . ALA G 3 56  ? -0.477  52.234 -51.140 1.00 28.59  ? 69  ALA G CA    1 
ATOM   4859  C  C     . ALA G 3 56  ? -1.972  51.938 -51.252 1.00 30.36  ? 69  ALA G C     1 
ATOM   4860  O  O     . ALA G 3 56  ? -2.415  51.642 -52.352 1.00 30.18  ? 69  ALA G O     1 
ATOM   4861  C  CB    . ALA G 3 56  ? 0.306   50.988 -50.835 1.00 28.21  ? 69  ALA G CB    1 
ATOM   4862  N  N     . ALA G 3 57  ? -2.759  52.085 -50.134 1.00 32.21  ? 70  ALA G N     1 
ATOM   4863  C  CA    . ALA G 3 57  ? -4.217  51.876 -50.054 1.00 34.57  ? 70  ALA G CA    1 
ATOM   4864  C  C     . ALA G 3 57  ? -4.938  52.988 -50.797 1.00 38.72  ? 70  ALA G C     1 
ATOM   4865  O  O     . ALA G 3 57  ? -5.895  52.717 -51.520 1.00 39.41  ? 70  ALA G O     1 
ATOM   4866  C  CB    . ALA G 3 57  ? -4.682  51.835 -48.603 1.00 33.73  ? 70  ALA G CB    1 
ATOM   4867  N  N     . ARG G 3 58  ? -4.469  54.239 -50.637 1.00 41.09  ? 71  ARG G N     1 
ATOM   4868  C  CA    . ARG G 3 58  ? -5.002  55.398 -51.328 1.00 43.70  ? 71  ARG G CA    1 
ATOM   4869  C  C     . ARG G 3 58  ? -4.713  55.293 -52.844 1.00 45.94  ? 71  ARG G C     1 
ATOM   4870  O  O     . ARG G 3 58  ? -5.508  55.785 -53.644 1.00 46.78  ? 71  ARG G O     1 
ATOM   4871  C  CB    . ARG G 3 58  ? -4.368  56.670 -50.749 1.00 46.19  ? 71  ARG G CB    1 
ATOM   4872  C  CG    . ARG G 3 58  ? -4.679  57.961 -51.514 1.00 50.88  ? 71  ARG G CG    1 
ATOM   4873  C  CD    . ARG G 3 58  ? -3.515  58.936 -51.465 1.00 55.90  ? 71  ARG G CD    1 
ATOM   4874  N  NE    . ARG G 3 58  ? -2.317  58.434 -52.158 1.00 60.17  ? 71  ARG G NE    1 
ATOM   4875  C  CZ    . ARG G 3 58  ? -1.097  58.407 -51.617 1.00 62.60  ? 71  ARG G CZ    1 
ATOM   4876  N  NH1   . ARG G 3 58  ? -0.903  58.835 -50.372 1.00 62.24  ? 71  ARG G NH1   1 
ATOM   4877  N  NH2   . ARG G 3 58  ? -0.065  57.938 -52.311 1.00 62.08  ? 71  ARG G NH2   1 
ATOM   4878  N  N     . ASP G 3 59  ? -3.587  54.674 -53.246 1.00 46.60  ? 72  ASP G N     1 
ATOM   4879  C  CA    . ASP G 3 59  ? -3.277  54.498 -54.668 1.00 47.91  ? 72  ASP G CA    1 
ATOM   4880  C  C     . ASP G 3 59  ? -4.229  53.486 -55.286 1.00 49.23  ? 72  ASP G C     1 
ATOM   4881  O  O     . ASP G 3 59  ? -4.674  53.660 -56.419 1.00 49.37  ? 72  ASP G O     1 
ATOM   4882  C  CB    . ASP G 3 59  ? -1.833  54.031 -54.871 1.00 49.46  ? 72  ASP G CB    1 
ATOM   4883  C  CG    . ASP G 3 59  ? -0.807  55.046 -54.435 1.00 54.15  ? 72  ASP G CG    1 
ATOM   4884  O  OD1   . ASP G 3 59  ? -1.125  56.264 -54.464 1.00 55.07  ? 72  ASP G OD1   1 
ATOM   4885  O  OD2   . ASP G 3 59  ? 0.314   54.629 -54.043 1.00 55.80  ? 72  ASP G OD2   1 
ATOM   4886  N  N     . ASN G 3 60  ? -4.541  52.416 -54.537 1.00 50.19  ? 73  ASN G N     1 
ATOM   4887  C  CA    . ASN G 3 60  ? -5.467  51.367 -54.972 1.00 51.08  ? 73  ASN G CA    1 
ATOM   4888  C  C     . ASN G 3 60  ? -6.929  51.782 -54.752 1.00 50.61  ? 73  ASN G C     1 
ATOM   4889  O  O     . ASN G 3 60  ? -7.781  50.908 -54.698 1.00 50.96  ? 73  ASN G O     1 
ATOM   4890  C  CB    . ASN G 3 60  ? -5.212  50.056 -54.192 1.00 53.49  ? 73  ASN G CB    1 
ATOM   4891  C  CG    . ASN G 3 60  ? -4.055  49.171 -54.644 1.00 57.67  ? 73  ASN G CG    1 
ATOM   4892  O  OD1   . ASN G 3 60  ? -4.109  47.933 -54.495 1.00 58.85  ? 73  ASN G OD1   1 
ATOM   4893  N  ND2   . ASN G 3 60  ? -2.979  49.769 -55.175 1.00 58.39  ? 73  ASN G ND2   1 
ATOM   4894  N  N     . LYS G 3 61  ? -7.211  53.086 -54.575 1.00 49.90  ? 74  LYS G N     1 
ATOM   4895  C  CA    . LYS G 3 61  ? -8.543  53.659 -54.370 1.00 49.71  ? 74  LYS G CA    1 
ATOM   4896  C  C     . LYS G 3 61  ? -9.297  53.104 -53.143 1.00 48.81  ? 74  LYS G C     1 
ATOM   4897  O  O     . LYS G 3 61  ? -10.470 53.425 -52.939 1.00 48.72  ? 74  LYS G O     1 
ATOM   4898  C  CB    . LYS G 3 61  ? -9.390  53.535 -55.649 1.00 51.89  ? 74  LYS G CB    1 
ATOM   4899  C  CG    . LYS G 3 61  ? -8.783  54.273 -56.843 1.00 56.18  ? 74  LYS G CG    1 
ATOM   4900  C  CD    . LYS G 3 61  ? -7.907  53.372 -57.717 1.00 60.60  ? 74  LYS G CD    1 
ATOM   4901  C  CE    . LYS G 3 61  ? -7.151  54.161 -58.760 1.00 64.26  ? 74  LYS G CE    1 
ATOM   4902  N  NZ    . LYS G 3 61  ? -6.228  55.151 -58.152 1.00 66.35  ? 74  LYS G NZ    1 
ATOM   4903  N  N     . LYS G 3 62  ? -8.616  52.311 -52.315 1.00 47.96  ? 75  LYS G N     1 
ATOM   4904  C  CA    . LYS G 3 62  ? -9.225  51.728 -51.139 1.00 47.78  ? 75  LYS G CA    1 
ATOM   4905  C  C     . LYS G 3 62  ? -9.157  52.664 -49.934 1.00 46.92  ? 75  LYS G C     1 
ATOM   4906  O  O     . LYS G 3 62  ? -8.255  53.491 -49.794 1.00 46.76  ? 75  LYS G O     1 
ATOM   4907  C  CB    . LYS G 3 62  ? -8.588  50.355 -50.803 1.00 49.90  ? 75  LYS G CB    1 
ATOM   4908  C  CG    . LYS G 3 62  ? -8.475  49.379 -51.977 1.00 53.55  ? 75  LYS G CG    1 
ATOM   4909  C  CD    . LYS G 3 62  ? -9.426  48.185 -51.853 1.00 58.44  ? 75  LYS G CD    1 
ATOM   4910  C  CE    . LYS G 3 62  ? -9.149  47.109 -52.892 1.00 62.07  ? 75  LYS G CE    1 
ATOM   4911  N  NZ    . LYS G 3 62  ? -10.134 45.985 -52.842 1.00 63.58  ? 75  LYS G NZ    1 
ATOM   4912  N  N     . THR G 3 63  ? -10.143 52.518 -49.075 1.00 46.30  ? 76  THR G N     1 
ATOM   4913  C  CA    . THR G 3 63  ? -10.259 53.219 -47.811 1.00 46.27  ? 76  THR G CA    1 
ATOM   4914  C  C     . THR G 3 63  ? -9.499  52.400 -46.769 1.00 45.52  ? 76  THR G C     1 
ATOM   4915  O  O     . THR G 3 63  ? -8.752  52.972 -45.998 1.00 44.94  ? 76  THR G O     1 
ATOM   4916  C  CB    . THR G 3 63  ? -11.749 53.340 -47.436 1.00 48.19  ? 76  THR G CB    1 
ATOM   4917  O  OG1   . THR G 3 63  ? -12.379 54.310 -48.289 1.00 49.57  ? 76  THR G OG1   1 
ATOM   4918  C  CG2   . THR G 3 63  ? -11.978 53.645 -45.935 1.00 48.64  ? 76  THR G CG2   1 
ATOM   4919  N  N     . ARG G 3 64  ? -9.684  51.053 -46.757 1.00 45.42  ? 77  ARG G N     1 
ATOM   4920  C  CA    . ARG G 3 64  ? -9.031  50.137 -45.817 1.00 45.35  ? 77  ARG G CA    1 
ATOM   4921  C  C     . ARG G 3 64  ? -7.763  49.467 -46.387 1.00 43.84  ? 77  ARG G C     1 
ATOM   4922  O  O     . ARG G 3 64  ? -7.727  49.020 -47.545 1.00 43.70  ? 77  ARG G O     1 
ATOM   4923  C  CB    . ARG G 3 64  ? -10.001 49.053 -45.293 1.00 47.89  ? 77  ARG G CB    1 
ATOM   4924  C  CG    . ARG G 3 64  ? -11.304 49.532 -44.691 1.00 53.95  ? 77  ARG G CG    1 
ATOM   4925  C  CD    . ARG G 3 64  ? -12.453 49.067 -45.572 1.00 60.82  ? 77  ARG G CD    1 
ATOM   4926  N  NE    . ARG G 3 64  ? -13.755 49.224 -44.932 1.00 67.84  ? 77  ARG G NE    1 
ATOM   4927  C  CZ    . ARG G 3 64  ? -14.678 48.267 -44.848 1.00 73.15  ? 77  ARG G CZ    1 
ATOM   4928  N  NH1   . ARG G 3 64  ? -15.839 48.509 -44.252 1.00 74.30  ? 77  ARG G NH1   1 
ATOM   4929  N  NH2   . ARG G 3 64  ? -14.451 47.066 -45.369 1.00 73.61  ? 77  ARG G NH2   1 
ATOM   4930  N  N     . ILE G 3 65  ? -6.739  49.380 -45.527 1.00 42.26  ? 78  ILE G N     1 
ATOM   4931  C  CA    . ILE G 3 65  ? -5.458  48.740 -45.781 1.00 40.99  ? 78  ILE G CA    1 
ATOM   4932  C  C     . ILE G 3 65  ? -5.642  47.233 -45.628 1.00 38.62  ? 78  ILE G C     1 
ATOM   4933  O  O     . ILE G 3 65  ? -6.078  46.761 -44.582 1.00 38.39  ? 78  ILE G O     1 
ATOM   4934  C  CB    . ILE G 3 65  ? -4.406  49.253 -44.763 1.00 41.93  ? 78  ILE G CB    1 
ATOM   4935  C  CG1   . ILE G 3 65  ? -4.015  50.706 -45.044 1.00 42.65  ? 78  ILE G CG1   1 
ATOM   4936  C  CG2   . ILE G 3 65  ? -3.155  48.357 -44.739 1.00 43.03  ? 78  ILE G CG2   1 
ATOM   4937  C  CD1   . ILE G 3 65  ? -3.263  51.352 -43.902 1.00 43.68  ? 78  ILE G CD1   1 
ATOM   4938  N  N     . ILE G 3 66  ? -5.338  46.496 -46.678 1.00 36.56  ? 79  ILE G N     1 
ATOM   4939  C  CA    . ILE G 3 66  ? -5.388  45.042 -46.661 1.00 35.04  ? 79  ILE G CA    1 
ATOM   4940  C  C     . ILE G 3 66  ? -3.918  44.559 -46.668 1.00 34.40  ? 79  ILE G C     1 
ATOM   4941  O  O     . ILE G 3 66  ? -2.994  45.365 -46.908 1.00 34.70  ? 79  ILE G O     1 
ATOM   4942  C  CB    . ILE G 3 66  ? -6.170  44.516 -47.893 1.00 34.37  ? 79  ILE G CB    1 
ATOM   4943  C  CG1   . ILE G 3 66  ? -5.460  44.898 -49.215 1.00 34.18  ? 79  ILE G CG1   1 
ATOM   4944  C  CG2   . ILE G 3 66  ? -7.624  44.947 -47.847 1.00 34.83  ? 79  ILE G CG2   1 
ATOM   4945  C  CD1   . ILE G 3 66  ? -6.083  44.433 -50.479 1.00 34.48  ? 79  ILE G CD1   1 
ATOM   4946  N  N     . PRO G 3 67  ? -3.665  43.255 -46.431 1.00 33.00  ? 80  PRO G N     1 
ATOM   4947  C  CA    . PRO G 3 67  ? -2.277  42.779 -46.451 1.00 31.80  ? 80  PRO G CA    1 
ATOM   4948  C  C     . PRO G 3 67  ? -1.523  43.082 -47.754 1.00 29.89  ? 80  PRO G C     1 
ATOM   4949  O  O     . PRO G 3 67  ? -0.299  43.189 -47.718 1.00 30.18  ? 80  PRO G O     1 
ATOM   4950  C  CB    . PRO G 3 67  ? -2.409  41.282 -46.154 1.00 32.75  ? 80  PRO G CB    1 
ATOM   4951  C  CG    . PRO G 3 67  ? -3.708  41.143 -45.446 1.00 33.50  ? 80  PRO G CG    1 
ATOM   4952  C  CD    . PRO G 3 67  ? -4.599  42.161 -46.094 1.00 32.48  ? 80  PRO G CD    1 
ATOM   4953  N  N     . ARG G 3 68  ? -2.231  43.303 -48.882 1.00 27.73  ? 81  ARG G N     1 
ATOM   4954  C  CA    . ARG G 3 68  ? -1.560  43.654 -50.135 1.00 26.26  ? 81  ARG G CA    1 
ATOM   4955  C  C     . ARG G 3 68  ? -0.882  44.988 -49.989 1.00 26.18  ? 81  ARG G C     1 
ATOM   4956  O  O     . ARG G 3 68  ? 0.238   45.150 -50.441 1.00 26.70  ? 81  ARG G O     1 
ATOM   4957  C  CB    . ARG G 3 68  ? -2.537  43.722 -51.321 1.00 25.91  ? 81  ARG G CB    1 
ATOM   4958  C  CG    . ARG G 3 68  ? -1.931  43.309 -52.664 1.00 26.35  ? 81  ARG G CG    1 
ATOM   4959  C  CD    . ARG G 3 68  ? -0.686  44.047 -53.059 1.00 27.13  ? 81  ARG G CD    1 
ATOM   4960  N  NE    . ARG G 3 68  ? 0.305   43.212 -53.742 1.00 28.33  ? 81  ARG G NE    1 
ATOM   4961  C  CZ    . ARG G 3 68  ? 0.345   43.010 -55.047 1.00 30.16  ? 81  ARG G CZ    1 
ATOM   4962  N  NH1   . ARG G 3 68  ? -0.609  43.491 -55.828 1.00 30.74  ? 81  ARG G NH1   1 
ATOM   4963  N  NH2   . ARG G 3 68  ? 1.320   42.303 -55.580 1.00 29.80  ? 81  ARG G NH2   1 
ATOM   4964  N  N     . HIS G 3 69  ? -1.543  45.946 -49.348 1.00 25.71  ? 82  HIS G N     1 
ATOM   4965  C  CA    . HIS G 3 69  ? -1.007  47.291 -49.154 1.00 24.89  ? 82  HIS G CA    1 
ATOM   4966  C  C     . HIS G 3 69  ? 0.225   47.242 -48.237 1.00 24.47  ? 82  HIS G C     1 
ATOM   4967  O  O     . HIS G 3 69  ? 1.216   47.909 -48.518 1.00 24.65  ? 82  HIS G O     1 
ATOM   4968  C  CB    . HIS G 3 69  ? -2.110  48.208 -48.613 1.00 24.78  ? 82  HIS G CB    1 
ATOM   4969  C  CG    . HIS G 3 69  ? -3.353  48.191 -49.456 1.00 25.24  ? 82  HIS G CG    1 
ATOM   4970  N  ND1   . HIS G 3 69  ? -4.615  48.357 -48.895 1.00 26.67  ? 82  HIS G ND1   1 
ATOM   4971  C  CD2   . HIS G 3 69  ? -3.486  48.020 -50.796 1.00 25.65  ? 82  HIS G CD2   1 
ATOM   4972  C  CE1   . HIS G 3 69  ? -5.464  48.306 -49.909 1.00 27.06  ? 82  HIS G CE1   1 
ATOM   4973  N  NE2   . HIS G 3 69  ? -4.831  48.076 -51.071 1.00 26.78  ? 82  HIS G NE2   1 
ATOM   4974  N  N     . LEU G 3 70  ? 0.195   46.373 -47.204 1.00 23.47  ? 83  LEU G N     1 
ATOM   4975  C  CA    . LEU G 3 70  ? 1.327   46.161 -46.311 1.00 22.32  ? 83  LEU G CA    1 
ATOM   4976  C  C     . LEU G 3 70  ? 2.515   45.603 -47.080 1.00 21.48  ? 83  LEU G C     1 
ATOM   4977  O  O     . LEU G 3 70  ? 3.604   46.135 -46.952 1.00 21.70  ? 83  LEU G O     1 
ATOM   4978  C  CB    . LEU G 3 70  ? 0.936   45.229 -45.165 1.00 21.72  ? 83  LEU G CB    1 
ATOM   4979  C  CG    . LEU G 3 70  ? 0.010   45.876 -44.169 1.00 22.46  ? 83  LEU G CG    1 
ATOM   4980  C  CD1   . LEU G 3 70  ? -0.596  44.862 -43.265 1.00 22.68  ? 83  LEU G CD1   1 
ATOM   4981  C  CD2   . LEU G 3 70  ? 0.729   46.957 -43.390 1.00 22.73  ? 83  LEU G CD2   1 
ATOM   4982  N  N     . GLN G 3 71  ? 2.302   44.603 -47.940 1.00 20.41  ? 84  GLN G N     1 
ATOM   4983  C  CA    . GLN G 3 71  ? 3.392   44.032 -48.730 1.00 20.06  ? 84  GLN G CA    1 
ATOM   4984  C  C     . GLN G 3 71  ? 3.984   45.048 -49.666 1.00 20.15  ? 84  GLN G C     1 
ATOM   4985  O  O     . GLN G 3 71  ? 5.195   45.208 -49.716 1.00 19.62  ? 84  GLN G O     1 
ATOM   4986  C  CB    . GLN G 3 71  ? 2.936   42.775 -49.489 1.00 21.07  ? 84  GLN G CB    1 
ATOM   4987  C  CG    . GLN G 3 71  ? 3.994   42.188 -50.435 1.00 23.58  ? 84  GLN G CG    1 
ATOM   4988  C  CD    . GLN G 3 71  ? 4.983   41.248 -49.793 1.00 26.20  ? 84  GLN G CD    1 
ATOM   4989  O  OE1   . GLN G 3 71  ? 5.687   40.507 -50.478 1.00 28.04  ? 84  GLN G OE1   1 
ATOM   4990  N  NE2   . GLN G 3 71  ? 5.099   41.269 -48.476 1.00 25.25  ? 84  GLN G NE2   1 
ATOM   4991  N  N     . LEU G 3 72  ? 3.130   45.807 -50.351 1.00 20.89  ? 85  LEU G N     1 
ATOM   4992  C  CA    . LEU G 3 72  ? 3.575   46.824 -51.282 1.00 21.99  ? 85  LEU G CA    1 
ATOM   4993  C  C     . LEU G 3 72  ? 4.422   47.863 -50.593 1.00 23.75  ? 85  LEU G C     1 
ATOM   4994  O  O     . LEU G 3 72  ? 5.467   48.232 -51.125 1.00 24.73  ? 85  LEU G O     1 
ATOM   4995  C  CB    . LEU G 3 72  ? 2.374   47.476 -51.960 1.00 21.78  ? 85  LEU G CB    1 
ATOM   4996  C  CG    . LEU G 3 72  ? 1.631   46.589 -52.938 1.00 22.93  ? 85  LEU G CG    1 
ATOM   4997  C  CD1   . LEU G 3 72  ? 0.449   47.316 -53.515 1.00 23.48  ? 85  LEU G CD1   1 
ATOM   4998  C  CD2   . LEU G 3 72  ? 2.556   46.063 -54.037 1.00 23.44  ? 85  LEU G CD2   1 
ATOM   4999  N  N     . ALA G 3 73  ? 4.023   48.259 -49.365 1.00 23.49  ? 86  ALA G N     1 
ATOM   5000  C  CA    . ALA G 3 73  ? 4.769   49.228 -48.572 1.00 23.10  ? 86  ALA G CA    1 
ATOM   5001  C  C     . ALA G 3 73  ? 6.138   48.675 -48.171 1.00 23.64  ? 86  ALA G C     1 
ATOM   5002  O  O     . ALA G 3 73  ? 7.138   49.369 -48.353 1.00 24.36  ? 86  ALA G O     1 
ATOM   5003  C  CB    . ALA G 3 73  ? 3.976   49.620 -47.338 1.00 22.55  ? 86  ALA G CB    1 
ATOM   5004  N  N     . ILE G 3 74  ? 6.191   47.414 -47.691 1.00 23.18  ? 87  ILE G N     1 
ATOM   5005  C  CA    . ILE G 3 74  ? 7.420   46.785 -47.241 1.00 22.95  ? 87  ILE G CA    1 
ATOM   5006  C  C     . ILE G 3 74  ? 8.426   46.625 -48.360 1.00 22.88  ? 87  ILE G C     1 
ATOM   5007  O  O     . ILE G 3 74  ? 9.548   47.103 -48.239 1.00 23.16  ? 87  ILE G O     1 
ATOM   5008  C  CB    . ILE G 3 74  ? 7.169   45.427 -46.506 1.00 23.19  ? 87  ILE G CB    1 
ATOM   5009  C  CG1   . ILE G 3 74  ? 6.150   45.532 -45.377 1.00 24.37  ? 87  ILE G CG1   1 
ATOM   5010  C  CG2   . ILE G 3 74  ? 8.469   44.837 -45.996 1.00 23.65  ? 87  ILE G CG2   1 
ATOM   5011  C  CD1   . ILE G 3 74  ? 6.478   46.556 -44.354 1.00 26.12  ? 87  ILE G CD1   1 
ATOM   5012  N  N     . ARG G 3 75  ? 8.035   45.973 -49.450 1.00 22.47  ? 88  ARG G N     1 
ATOM   5013  C  CA    . ARG G 3 75  ? 8.963   45.646 -50.525 1.00 22.70  ? 88  ARG G CA    1 
ATOM   5014  C  C     . ARG G 3 75  ? 9.367   46.825 -51.364 1.00 24.00  ? 88  ARG G C     1 
ATOM   5015  O  O     . ARG G 3 75  ? 10.411  46.768 -52.007 1.00 24.24  ? 88  ARG G O     1 
ATOM   5016  C  CB    . ARG G 3 75  ? 8.415   44.509 -51.386 1.00 23.01  ? 88  ARG G CB    1 
ATOM   5017  C  CG    . ARG G 3 75  ? 7.680   43.422 -50.568 1.00 23.93  ? 88  ARG G CG    1 
ATOM   5018  C  CD    . ARG G 3 75  ? 8.478   42.157 -50.325 1.00 24.76  ? 88  ARG G CD    1 
ATOM   5019  N  NE    . ARG G 3 75  ? 9.389   42.193 -49.177 1.00 25.00  ? 88  ARG G NE    1 
ATOM   5020  C  CZ    . ARG G 3 75  ? 9.119   41.678 -47.982 1.00 25.62  ? 88  ARG G CZ    1 
ATOM   5021  N  NH1   . ARG G 3 75  ? 7.934   41.136 -47.736 1.00 25.74  ? 88  ARG G NH1   1 
ATOM   5022  N  NH2   . ARG G 3 75  ? 10.026  41.708 -47.025 1.00 24.55  ? 88  ARG G NH2   1 
ATOM   5023  N  N     . ASN G 3 76  ? 8.578   47.904 -51.350 1.00 24.85  ? 89  ASN G N     1 
ATOM   5024  C  CA    . ASN G 3 76  ? 8.939   49.105 -52.086 1.00 26.53  ? 89  ASN G CA    1 
ATOM   5025  C  C     . ASN G 3 76  ? 9.929   49.997 -51.300 1.00 28.78  ? 89  ASN G C     1 
ATOM   5026  O  O     . ASN G 3 76  ? 10.656  50.781 -51.912 1.00 29.50  ? 89  ASN G O     1 
ATOM   5027  C  CB    . ASN G 3 76  ? 7.714   49.844 -52.556 1.00 26.88  ? 89  ASN G CB    1 
ATOM   5028  C  CG    . ASN G 3 76  ? 7.178   49.242 -53.835 1.00 28.18  ? 89  ASN G CG    1 
ATOM   5029  O  OD1   . ASN G 3 76  ? 7.934   48.966 -54.784 1.00 29.08  ? 89  ASN G OD1   1 
ATOM   5030  N  ND2   . ASN G 3 76  ? 5.871   49.026 -53.890 1.00 27.61  ? 89  ASN G ND2   1 
ATOM   5031  N  N     . ASP G 3 77  ? 10.003  49.839 -49.962 1.00 29.49  ? 90  ASP G N     1 
ATOM   5032  C  CA    . ASP G 3 77  ? 11.026  50.492 -49.151 1.00 30.55  ? 90  ASP G CA    1 
ATOM   5033  C  C     . ASP G 3 77  ? 12.317  49.642 -49.255 1.00 30.93  ? 90  ASP G C     1 
ATOM   5034  O  O     . ASP G 3 77  ? 12.271  48.464 -49.623 1.00 31.77  ? 90  ASP G O     1 
ATOM   5035  C  CB    . ASP G 3 77  ? 10.594  50.594 -47.678 1.00 33.46  ? 90  ASP G CB    1 
ATOM   5036  C  CG    . ASP G 3 77  ? 11.357  51.641 -46.861 1.00 41.95  ? 90  ASP G CG    1 
ATOM   5037  O  OD1   . ASP G 3 77  ? 12.311  52.246 -47.401 1.00 43.74  ? 90  ASP G OD1   1 
ATOM   5038  O  OD2   . ASP G 3 77  ? 10.995  51.861 -45.686 1.00 45.37  ? 90  ASP G OD2   1 
ATOM   5039  N  N     . GLU G 3 78  ? 13.468  50.243 -48.970 1.00 30.36  ? 91  GLU G N     1 
ATOM   5040  C  CA    . GLU G 3 78  ? 14.734  49.526 -48.989 1.00 30.12  ? 91  GLU G CA    1 
ATOM   5041  C  C     . GLU G 3 78  ? 15.010  48.965 -47.595 1.00 30.04  ? 91  GLU G C     1 
ATOM   5042  O  O     . GLU G 3 78  ? 15.414  47.816 -47.462 1.00 30.77  ? 91  GLU G O     1 
ATOM   5043  C  CB    . GLU G 3 78  ? 15.867  50.446 -49.444 1.00 32.37  ? 91  GLU G CB    1 
ATOM   5044  C  CG    . GLU G 3 78  ? 17.153  49.701 -49.730 1.00 38.52  ? 91  GLU G CG    1 
ATOM   5045  C  CD    . GLU G 3 78  ? 18.253  50.530 -50.365 1.00 47.91  ? 91  GLU G CD    1 
ATOM   5046  O  OE1   . GLU G 3 78  ? 18.651  51.559 -49.767 1.00 49.56  ? 91  GLU G OE1   1 
ATOM   5047  O  OE2   . GLU G 3 78  ? 18.723  50.141 -51.461 1.00 50.97  ? 91  GLU G OE2   1 
ATOM   5048  N  N     . GLU G 3 79  ? 14.751  49.762 -46.555 1.00 29.51  ? 92  GLU G N     1 
ATOM   5049  C  CA    . GLU G 3 79  ? 14.994  49.388 -45.168 1.00 29.18  ? 92  GLU G CA    1 
ATOM   5050  C  C     . GLU G 3 79  ? 13.959  48.448 -44.625 1.00 27.80  ? 92  GLU G C     1 
ATOM   5051  O  O     . GLU G 3 79  ? 14.326  47.503 -43.939 1.00 28.00  ? 92  GLU G O     1 
ATOM   5052  C  CB    . GLU G 3 79  ? 15.121  50.633 -44.287 1.00 32.45  ? 92  GLU G CB    1 
ATOM   5053  C  CG    . GLU G 3 79  ? 16.067  51.647 -44.894 1.00 39.37  ? 92  GLU G CG    1 
ATOM   5054  C  CD    . GLU G 3 79  ? 16.837  52.477 -43.892 1.00 47.37  ? 92  GLU G CD    1 
ATOM   5055  O  OE1   . GLU G 3 79  ? 16.186  53.268 -43.174 1.00 50.12  ? 92  GLU G OE1   1 
ATOM   5056  O  OE2   . GLU G 3 79  ? 18.083  52.354 -43.833 1.00 48.33  ? 92  GLU G OE2   1 
ATOM   5057  N  N     . LEU G 3 80  ? 12.669  48.676 -44.926 1.00 26.25  ? 93  LEU G N     1 
ATOM   5058  C  CA    . LEU G 3 80  ? 11.618  47.766 -44.466 1.00 24.97  ? 93  LEU G CA    1 
ATOM   5059  C  C     . LEU G 3 80  ? 11.788  46.410 -45.145 1.00 24.13  ? 93  LEU G C     1 
ATOM   5060  O  O     . LEU G 3 80  ? 11.641  45.376 -44.492 1.00 24.56  ? 93  LEU G O     1 
ATOM   5061  C  CB    . LEU G 3 80  ? 10.202  48.326 -44.690 1.00 24.64  ? 93  LEU G CB    1 
ATOM   5062  C  CG    . LEU G 3 80  ? 9.766   49.460 -43.760 1.00 25.19  ? 93  LEU G CG    1 
ATOM   5063  C  CD1   . LEU G 3 80  ? 8.408   49.964 -44.128 1.00 25.50  ? 93  LEU G CD1   1 
ATOM   5064  C  CD2   . LEU G 3 80  ? 9.754   49.025 -42.329 1.00 25.46  ? 93  LEU G CD2   1 
ATOM   5065  N  N     . ASN G 3 81  ? 12.183  46.403 -46.428 1.00 22.64  ? 94  ASN G N     1 
ATOM   5066  C  CA    . ASN G 3 81  ? 12.430  45.161 -47.122 1.00 21.83  ? 94  ASN G CA    1 
ATOM   5067  C  C     . ASN G 3 81  ? 13.594  44.418 -46.479 1.00 21.77  ? 94  ASN G C     1 
ATOM   5068  O  O     . ASN G 3 81  ? 13.494  43.220 -46.297 1.00 22.78  ? 94  ASN G O     1 
ATOM   5069  C  CB    . ASN G 3 81  ? 12.711  45.407 -48.572 1.00 22.87  ? 94  ASN G CB    1 
ATOM   5070  C  CG    . ASN G 3 81  ? 12.889  44.115 -49.321 1.00 27.01  ? 94  ASN G CG    1 
ATOM   5071  O  OD1   . ASN G 3 81  ? 12.164  43.137 -49.106 1.00 27.74  ? 94  ASN G OD1   1 
ATOM   5072  N  ND2   . ASN G 3 81  ? 13.880  44.068 -50.187 1.00 28.75  ? 94  ASN G ND2   1 
ATOM   5073  N  N     . LYS G 3 82  ? 14.684  45.107 -46.125 1.00 20.86  ? 95  LYS G N     1 
ATOM   5074  C  CA    . LYS G 3 82  ? 15.848  44.456 -45.502 1.00 19.96  ? 95  LYS G CA    1 
ATOM   5075  C  C     . LYS G 3 82  ? 15.507  43.944 -44.111 1.00 18.37  ? 95  LYS G C     1 
ATOM   5076  O  O     . LYS G 3 82  ? 15.927  42.855 -43.740 1.00 17.51  ? 95  LYS G O     1 
ATOM   5077  C  CB    . LYS G 3 82  ? 17.064  45.407 -45.451 1.00 21.94  ? 95  LYS G CB    1 
ATOM   5078  C  CG    . LYS G 3 82  ? 18.307  44.745 -44.841 1.00 26.63  ? 95  LYS G CG    1 
ATOM   5079  C  CD    . LYS G 3 82  ? 19.609  45.037 -45.582 1.00 31.71  ? 95  LYS G CD    1 
ATOM   5080  C  CE    . LYS G 3 82  ? 20.732  44.114 -45.155 1.00 35.26  ? 95  LYS G CE    1 
ATOM   5081  N  NZ    . LYS G 3 82  ? 20.416  42.676 -45.415 1.00 37.21  ? 95  LYS G NZ    1 
ATOM   5082  N  N     . LEU G 3 83  ? 14.731  44.731 -43.350 1.00 17.83  ? 96  LEU G N     1 
ATOM   5083  C  CA    . LEU G 3 83  ? 14.326  44.381 -41.987 1.00 17.74  ? 96  LEU G CA    1 
ATOM   5084  C  C     . LEU G 3 83  ? 13.390  43.167 -41.991 1.00 17.94  ? 96  LEU G C     1 
ATOM   5085  O  O     . LEU G 3 83  ? 13.524  42.266 -41.163 1.00 18.65  ? 96  LEU G O     1 
ATOM   5086  C  CB    . LEU G 3 83  ? 13.658  45.593 -41.310 1.00 17.57  ? 96  LEU G CB    1 
ATOM   5087  C  CG    . LEU G 3 83  ? 13.047  45.356 -39.942 1.00 18.60  ? 96  LEU G CG    1 
ATOM   5088  C  CD1   . LEU G 3 83  ? 14.091  45.033 -38.957 1.00 19.36  ? 96  LEU G CD1   1 
ATOM   5089  C  CD2   . LEU G 3 83  ? 12.346  46.575 -39.460 1.00 18.79  ? 96  LEU G CD2   1 
ATOM   5090  N  N     . LEU G 3 84  ? 12.479  43.116 -42.959 1.00 17.10  ? 97  LEU G N     1 
ATOM   5091  C  CA    . LEU G 3 84  ? 11.547  42.006 -43.084 1.00 16.67  ? 97  LEU G CA    1 
ATOM   5092  C  C     . LEU G 3 84  ? 11.917  41.162 -44.323 1.00 18.46  ? 97  LEU G C     1 
ATOM   5093  O  O     . LEU G 3 84  ? 11.047  40.777 -45.102 1.00 19.06  ? 97  LEU G O     1 
ATOM   5094  C  CB    . LEU G 3 84  ? 10.123  42.554 -43.169 1.00 15.22  ? 97  LEU G CB    1 
ATOM   5095  C  CG    . LEU G 3 84  ? 9.758   43.456 -42.018 1.00 15.02  ? 97  LEU G CG    1 
ATOM   5096  C  CD1   . LEU G 3 84  ? 8.604   44.322 -42.344 1.00 14.85  ? 97  LEU G CD1   1 
ATOM   5097  C  CD2   . LEU G 3 84  ? 9.551   42.674 -40.777 1.00 15.66  ? 97  LEU G CD2   1 
ATOM   5098  N  N     . GLY G 3 85  ? 13.208  40.905 -44.501 1.00 18.86  ? 98  GLY G N     1 
ATOM   5099  C  CA    . GLY G 3 85  ? 13.704  40.171 -45.649 1.00 19.96  ? 98  GLY G CA    1 
ATOM   5100  C  C     . GLY G 3 85  ? 13.382  38.697 -45.637 1.00 21.54  ? 98  GLY G C     1 
ATOM   5101  O  O     . GLY G 3 85  ? 13.057  38.126 -46.682 1.00 22.49  ? 98  GLY G O     1 
ATOM   5102  N  N     . ARG G 3 86  ? 13.489  38.058 -44.471 1.00 21.50  ? 99  ARG G N     1 
ATOM   5103  C  CA    . ARG G 3 86  ? 13.197  36.630 -44.375 1.00 21.26  ? 99  ARG G CA    1 
ATOM   5104  C  C     . ARG G 3 86  ? 11.858  36.411 -43.687 1.00 21.38  ? 99  ARG G C     1 
ATOM   5105  O  O     . ARG G 3 86  ? 11.722  35.497 -42.881 1.00 22.36  ? 99  ARG G O     1 
ATOM   5106  C  CB    . ARG G 3 86  ? 14.332  35.902 -43.653 1.00 23.32  ? 99  ARG G CB    1 
ATOM   5107  C  CG    . ARG G 3 86  ? 15.709  36.184 -44.254 1.00 29.00  ? 99  ARG G CG    1 
ATOM   5108  C  CD    . ARG G 3 86  ? 16.430  34.950 -44.807 1.00 35.34  ? 99  ARG G CD    1 
ATOM   5109  N  NE    . ARG G 3 86  ? 15.964  34.572 -46.146 1.00 41.71  ? 99  ARG G NE    1 
ATOM   5110  C  CZ    . ARG G 3 86  ? 15.257  33.472 -46.413 1.00 47.45  ? 99  ARG G CZ    1 
ATOM   5111  N  NH1   . ARG G 3 86  ? 14.961  32.609 -45.444 1.00 47.26  ? 99  ARG G NH1   1 
ATOM   5112  N  NH2   . ARG G 3 86  ? 14.865  33.213 -47.656 1.00 49.29  ? 99  ARG G NH2   1 
ATOM   5113  N  N     . VAL G 3 87  ? 10.869  37.265 -44.010 1.00 20.56  ? 100 VAL G N     1 
ATOM   5114  C  CA    . VAL G 3 87  ? 9.496   37.261 -43.489 1.00 20.63  ? 100 VAL G CA    1 
ATOM   5115  C  C     . VAL G 3 87  ? 8.516   37.149 -44.673 1.00 21.20  ? 100 VAL G C     1 
ATOM   5116  O  O     . VAL G 3 87  ? 8.785   37.690 -45.759 1.00 22.27  ? 100 VAL G O     1 
ATOM   5117  C  CB    . VAL G 3 87  ? 9.223   38.555 -42.673 1.00 20.73  ? 100 VAL G CB    1 
ATOM   5118  C  CG1   . VAL G 3 87  ? 7.746   38.770 -42.440 1.00 20.87  ? 100 VAL G CG1   1 
ATOM   5119  C  CG2   . VAL G 3 87  ? 9.963   38.542 -41.349 1.00 21.44  ? 100 VAL G CG2   1 
ATOM   5120  N  N     . THR G 3 88  ? 7.373   36.451 -44.458 1.00 20.15  ? 101 THR G N     1 
ATOM   5121  C  CA    . THR G 3 88  ? 6.332   36.247 -45.455 1.00 19.41  ? 101 THR G CA    1 
ATOM   5122  C  C     . THR G 3 88  ? 5.016   36.861 -44.984 1.00 18.04  ? 101 THR G C     1 
ATOM   5123  O  O     . THR G 3 88  ? 4.467   36.425 -43.977 1.00 17.03  ? 101 THR G O     1 
ATOM   5124  C  CB    . THR G 3 88  ? 6.173   34.724 -45.716 1.00 21.51  ? 101 THR G CB    1 
ATOM   5125  O  OG1   . THR G 3 88  ? 7.368   34.184 -46.268 1.00 22.72  ? 101 THR G OG1   1 
ATOM   5126  C  CG2   . THR G 3 88  ? 5.019   34.396 -46.616 1.00 21.72  ? 101 THR G CG2   1 
ATOM   5127  N  N     . ILE G 3 89  ? 4.508   37.881 -45.702 1.00 18.26  ? 102 ILE G N     1 
ATOM   5128  C  CA    . ILE G 3 89  ? 3.213   38.499 -45.366 1.00 18.99  ? 102 ILE G CA    1 
ATOM   5129  C  C     . ILE G 3 89  ? 2.107   37.662 -46.026 1.00 19.89  ? 102 ILE G C     1 
ATOM   5130  O  O     . ILE G 3 89  ? 2.086   37.514 -47.259 1.00 19.92  ? 102 ILE G O     1 
ATOM   5131  C  CB    . ILE G 3 89  ? 3.138   40.029 -45.723 1.00 18.99  ? 102 ILE G CB    1 
ATOM   5132  C  CG1   . ILE G 3 89  ? 3.879   40.879 -44.689 1.00 18.60  ? 102 ILE G CG1   1 
ATOM   5133  C  CG2   . ILE G 3 89  ? 1.699   40.528 -45.853 1.00 19.73  ? 102 ILE G CG2   1 
ATOM   5134  C  CD1   . ILE G 3 89  ? 5.118   41.396 -45.160 1.00 19.18  ? 102 ILE G CD1   1 
ATOM   5135  N  N     . ALA G 3 90  ? 1.251   37.023 -45.200 1.00 20.24  ? 103 ALA G N     1 
ATOM   5136  C  CA    . ALA G 3 90  ? 0.182   36.192 -45.751 1.00 20.59  ? 103 ALA G CA    1 
ATOM   5137  C  C     . ALA G 3 90  ? -0.842  37.074 -46.497 1.00 21.33  ? 103 ALA G C     1 
ATOM   5138  O  O     . ALA G 3 90  ? -1.238  38.131 -46.008 1.00 21.28  ? 103 ALA G O     1 
ATOM   5139  C  CB    . ALA G 3 90  ? -0.491  35.397 -44.660 1.00 20.19  ? 103 ALA G CB    1 
ATOM   5140  N  N     . GLN G 3 91  ? -1.203  36.648 -47.711 1.00 21.19  ? 104 GLN G N     1 
ATOM   5141  C  CA    . GLN G 3 91  ? -2.099  37.354 -48.618 1.00 20.92  ? 104 GLN G CA    1 
ATOM   5142  C  C     . GLN G 3 91  ? -1.452  38.635 -49.172 1.00 20.67  ? 104 GLN G C     1 
ATOM   5143  O  O     . GLN G 3 91  ? -2.150  39.571 -49.523 1.00 21.35  ? 104 GLN G O     1 
ATOM   5144  C  CB    . GLN G 3 91  ? -3.476  37.593 -47.970 1.00 22.26  ? 104 GLN G CB    1 
ATOM   5145  C  CG    . GLN G 3 91  ? -4.503  36.502 -48.272 1.00 27.24  ? 104 GLN G CG    1 
ATOM   5146  C  CD    . GLN G 3 91  ? -4.709  36.260 -49.784 1.00 33.45  ? 104 GLN G CD    1 
ATOM   5147  O  OE1   . GLN G 3 91  ? -5.245  37.123 -50.528 1.00 35.82  ? 104 GLN G OE1   1 
ATOM   5148  N  NE2   . GLN G 3 91  ? -4.287  35.074 -50.282 1.00 31.75  ? 104 GLN G NE2   1 
ATOM   5149  N  N     . GLY G 3 92  ? -0.136  38.650 -49.289 1.00 19.86  ? 105 GLY G N     1 
ATOM   5150  C  CA    . GLY G 3 92  ? 0.592   39.813 -49.751 1.00 19.34  ? 105 GLY G CA    1 
ATOM   5151  C  C     . GLY G 3 92  ? 0.892   39.880 -51.223 1.00 19.63  ? 105 GLY G C     1 
ATOM   5152  O  O     . GLY G 3 92  ? 1.067   40.969 -51.745 1.00 20.39  ? 105 GLY G O     1 
ATOM   5153  N  N     . GLY G 3 93  ? 0.963   38.756 -51.901 1.00 20.25  ? 106 GLY G N     1 
ATOM   5154  C  CA    . GLY G 3 93  ? 1.298   38.730 -53.326 1.00 21.83  ? 106 GLY G CA    1 
ATOM   5155  C  C     . GLY G 3 93  ? 2.732   39.148 -53.591 1.00 23.75  ? 106 GLY G C     1 
ATOM   5156  O  O     . GLY G 3 93  ? 3.508   39.289 -52.643 1.00 23.94  ? 106 GLY G O     1 
ATOM   5157  N  N     . VAL G 3 94  ? 3.117   39.351 -54.866 1.00 25.19  ? 107 VAL G N     1 
ATOM   5158  C  CA    . VAL G 3 94  ? 4.493   39.799 -55.155 1.00 27.56  ? 107 VAL G CA    1 
ATOM   5159  C  C     . VAL G 3 94  ? 4.529   41.205 -55.782 1.00 30.53  ? 107 VAL G C     1 
ATOM   5160  O  O     . VAL G 3 94  ? 3.485   41.721 -56.195 1.00 31.08  ? 107 VAL G O     1 
ATOM   5161  C  CB    . VAL G 3 94  ? 5.339   38.789 -55.978 1.00 27.93  ? 107 VAL G CB    1 
ATOM   5162  C  CG1   . VAL G 3 94  ? 5.162   37.381 -55.473 1.00 28.75  ? 107 VAL G CG1   1 
ATOM   5163  C  CG2   . VAL G 3 94  ? 5.031   38.879 -57.458 1.00 28.31  ? 107 VAL G CG2   1 
ATOM   5164  N  N     . LEU G 3 95  ? 5.721   41.847 -55.837 1.00 31.79  ? 108 LEU G N     1 
ATOM   5165  C  CA    . LEU G 3 95  ? 5.841   43.134 -56.519 1.00 33.07  ? 108 LEU G CA    1 
ATOM   5166  C  C     . LEU G 3 95  ? 5.805   42.813 -58.006 1.00 35.49  ? 108 LEU G C     1 
ATOM   5167  O  O     . LEU G 3 95  ? 6.452   41.856 -58.452 1.00 35.81  ? 108 LEU G O     1 
ATOM   5168  C  CB    . LEU G 3 95  ? 7.174   43.853 -56.222 1.00 32.12  ? 108 LEU G CB    1 
ATOM   5169  C  CG    . LEU G 3 95  ? 7.328   44.660 -54.932 1.00 31.87  ? 108 LEU G CG    1 
ATOM   5170  C  CD1   . LEU G 3 95  ? 8.575   45.486 -55.003 1.00 31.79  ? 108 LEU G CD1   1 
ATOM   5171  C  CD2   . LEU G 3 95  ? 6.107   45.536 -54.620 1.00 32.09  ? 108 LEU G CD2   1 
ATOM   5172  N  N     . PRO G 3 96  ? 5.061   43.602 -58.789 1.00 36.99  ? 109 PRO G N     1 
ATOM   5173  C  CA    . PRO G 3 96  ? 5.018   43.349 -60.231 1.00 38.40  ? 109 PRO G CA    1 
ATOM   5174  C  C     . PRO G 3 96  ? 6.348   43.690 -60.883 1.00 40.79  ? 109 PRO G C     1 
ATOM   5175  O  O     . PRO G 3 96  ? 6.750   44.834 -60.862 1.00 41.01  ? 109 PRO G O     1 
ATOM   5176  C  CB    . PRO G 3 96  ? 3.882   44.261 -60.720 1.00 38.70  ? 109 PRO G CB    1 
ATOM   5177  C  CG    . PRO G 3 96  ? 3.176   44.763 -59.451 1.00 38.58  ? 109 PRO G CG    1 
ATOM   5178  C  CD    . PRO G 3 96  ? 4.229   44.760 -58.410 1.00 36.68  ? 109 PRO G CD    1 
ATOM   5179  N  N     . ASN G 3 97  ? 7.043   42.700 -61.423 1.00 42.91  ? 110 ASN G N     1 
ATOM   5180  C  CA    . ASN G 3 97  ? 8.312   42.888 -62.106 1.00 45.82  ? 110 ASN G CA    1 
ATOM   5181  C  C     . ASN G 3 97  ? 8.464   41.782 -63.156 1.00 48.70  ? 110 ASN G C     1 
ATOM   5182  O  O     . ASN G 3 97  ? 8.310   40.601 -62.841 1.00 48.39  ? 110 ASN G O     1 
ATOM   5183  C  CB    . ASN G 3 97  ? 9.484   42.919 -61.105 1.00 47.75  ? 110 ASN G CB    1 
ATOM   5184  C  CG    . ASN G 3 97  ? 10.876  42.715 -61.686 1.00 52.81  ? 110 ASN G CG    1 
ATOM   5185  O  OD1   . ASN G 3 97  ? 11.472  41.633 -61.557 1.00 55.02  ? 110 ASN G OD1   1 
ATOM   5186  N  ND2   . ASN G 3 97  ? 11.447  43.746 -62.317 1.00 53.44  ? 110 ASN G ND2   1 
ATOM   5187  N  N     . ILE G 3 98  ? 8.725   42.183 -64.413 1.00 51.13  ? 111 ILE G N     1 
ATOM   5188  C  CA    . ILE G 3 98  ? 8.943   41.296 -65.557 1.00 53.79  ? 111 ILE G CA    1 
ATOM   5189  C  C     . ILE G 3 98  ? 10.324  41.623 -66.108 1.00 56.81  ? 111 ILE G C     1 
ATOM   5190  O  O     . ILE G 3 98  ? 10.568  42.769 -66.466 1.00 56.75  ? 111 ILE G O     1 
ATOM   5191  C  CB    . ILE G 3 98  ? 7.850   41.466 -66.657 1.00 54.01  ? 111 ILE G CB    1 
ATOM   5192  C  CG1   . ILE G 3 98  ? 6.436   41.085 -66.141 1.00 54.71  ? 111 ILE G CG1   1 
ATOM   5193  C  CG2   . ILE G 3 98  ? 8.214   40.657 -67.913 1.00 54.26  ? 111 ILE G CG2   1 
ATOM   5194  C  CD1   . ILE G 3 98  ? 5.515   42.229 -65.675 1.00 55.50  ? 111 ILE G CD1   1 
ATOM   5195  N  N     . GLN G 3 99  ? 11.233  40.651 -66.150 1.00 59.55  ? 112 GLN G N     1 
ATOM   5196  C  CA    . GLN G 3 99  ? 12.587  40.884 -66.653 1.00 62.74  ? 112 GLN G CA    1 
ATOM   5197  C  C     . GLN G 3 99  ? 12.583  41.379 -68.104 1.00 65.54  ? 112 GLN G C     1 
ATOM   5198  O  O     . GLN G 3 99  ? 11.763  40.928 -68.910 1.00 65.78  ? 112 GLN G O     1 
ATOM   5199  C  CB    . GLN G 3 99  ? 13.459  39.633 -66.474 1.00 64.82  ? 112 GLN G CB    1 
ATOM   5200  C  CG    . GLN G 3 99  ? 13.728  39.303 -65.009 1.00 68.53  ? 112 GLN G CG    1 
ATOM   5201  C  CD    . GLN G 3 99  ? 15.070  39.839 -64.584 1.00 73.52  ? 112 GLN G CD    1 
ATOM   5202  O  OE1   . GLN G 3 99  ? 16.051  39.796 -65.346 1.00 74.68  ? 112 GLN G OE1   1 
ATOM   5203  N  NE2   . GLN G 3 99  ? 15.141  40.352 -63.353 1.00 74.57  ? 112 GLN G NE2   1 
ATOM   5204  N  N     . ALA G 3 100 ? 13.459  42.352 -68.409 1.00 67.40  ? 113 ALA G N     1 
ATOM   5205  C  CA    . ALA G 3 100 ? 13.547  42.998 -69.724 1.00 69.53  ? 113 ALA G CA    1 
ATOM   5206  C  C     . ALA G 3 100 ? 13.767  42.036 -70.881 1.00 71.42  ? 113 ALA G C     1 
ATOM   5207  O  O     . ALA G 3 100 ? 13.309  42.307 -71.995 1.00 71.79  ? 113 ALA G O     1 
ATOM   5208  C  CB    . ALA G 3 100 ? 14.628  44.068 -69.721 1.00 69.72  ? 113 ALA G CB    1 
ATOM   5209  N  N     . VAL G 3 101 ? 14.458  40.917 -70.625 1.00 72.23  ? 114 VAL G N     1 
ATOM   5210  C  CA    . VAL G 3 101 ? 14.716  39.914 -71.660 1.00 73.53  ? 114 VAL G CA    1 
ATOM   5211  C  C     . VAL G 3 101 ? 13.407  39.200 -72.075 1.00 75.19  ? 114 VAL G C     1 
ATOM   5212  O  O     . VAL G 3 101 ? 13.229  38.846 -73.243 1.00 75.13  ? 114 VAL G O     1 
ATOM   5213  C  CB    . VAL G 3 101 ? 15.832  38.921 -71.248 1.00 74.00  ? 114 VAL G CB    1 
ATOM   5214  C  CG1   . VAL G 3 101 ? 16.303  38.114 -72.444 1.00 74.50  ? 114 VAL G CG1   1 
ATOM   5215  C  CG2   . VAL G 3 101 ? 17.016  39.645 -70.609 1.00 74.53  ? 114 VAL G CG2   1 
ATOM   5216  N  N     . LEU G 3 102 ? 12.465  39.052 -71.125 1.00 76.48  ? 115 LEU G N     1 
ATOM   5217  C  CA    . LEU G 3 102 ? 11.162  38.438 -71.377 1.00 78.15  ? 115 LEU G CA    1 
ATOM   5218  C  C     . LEU G 3 102 ? 10.162  39.384 -72.068 1.00 80.44  ? 115 LEU G C     1 
ATOM   5219  O  O     . LEU G 3 102 ? 9.040   38.968 -72.349 1.00 80.26  ? 115 LEU G O     1 
ATOM   5220  C  CB    . LEU G 3 102 ? 10.547  37.916 -70.065 1.00 77.93  ? 115 LEU G CB    1 
ATOM   5221  C  CG    . LEU G 3 102 ? 11.433  37.056 -69.169 1.00 78.81  ? 115 LEU G CG    1 
ATOM   5222  C  CD1   . LEU G 3 102 ? 10.682  36.626 -67.945 1.00 79.26  ? 115 LEU G CD1   1 
ATOM   5223  C  CD2   . LEU G 3 102 ? 11.944  35.837 -69.892 1.00 79.32  ? 115 LEU G CD2   1 
ATOM   5224  N  N     . LEU G 3 103 ? 10.544  40.649 -72.320 1.00 82.43  ? 116 LEU G N     1 
ATOM   5225  C  CA    . LEU G 3 103 ? 9.669   41.620 -72.972 1.00 84.79  ? 116 LEU G CA    1 
ATOM   5226  C  C     . LEU G 3 103 ? 9.632   41.405 -74.504 1.00 86.65  ? 116 LEU G C     1 
ATOM   5227  O  O     . LEU G 3 103 ? 10.652  41.031 -75.100 1.00 86.87  ? 116 LEU G O     1 
ATOM   5228  C  CB    . LEU G 3 103 ? 10.106  43.059 -72.620 1.00 85.33  ? 116 LEU G CB    1 
ATOM   5229  C  CG    . LEU G 3 103 ? 9.899   43.485 -71.167 1.00 87.18  ? 116 LEU G CG    1 
ATOM   5230  C  CD1   . LEU G 3 103 ? 10.452  44.881 -70.918 1.00 87.71  ? 116 LEU G CD1   1 
ATOM   5231  C  CD2   . LEU G 3 103 ? 8.427   43.419 -70.780 1.00 87.98  ? 116 LEU G CD2   1 
ATOM   5232  N  N     . PRO G 3 104 ? 8.457   41.626 -75.151 1.00 87.55  ? 117 PRO G N     1 
ATOM   5233  C  CA    . PRO G 3 104 ? 8.374   41.419 -76.610 1.00 88.27  ? 117 PRO G CA    1 
ATOM   5234  C  C     . PRO G 3 104 ? 9.273   42.345 -77.442 1.00 89.46  ? 117 PRO G C     1 
ATOM   5235  O  O     . PRO G 3 104 ? 9.543   43.473 -77.031 1.00 89.56  ? 117 PRO G O     1 
ATOM   5236  C  CB    . PRO G 3 104 ? 6.885   41.634 -76.916 1.00 88.68  ? 117 PRO G CB    1 
ATOM   5237  C  CG    . PRO G 3 104 ? 6.348   42.408 -75.765 1.00 88.89  ? 117 PRO G CG    1 
ATOM   5238  C  CD    . PRO G 3 104 ? 7.157   42.044 -74.577 1.00 87.20  ? 117 PRO G CD    1 
ATOM   5239  N  N     . LYS G 3 105 ? 9.746   41.867 -78.606 1.00 90.25  ? 118 LYS G N     1 
ATOM   5240  C  CA    . LYS G 3 105 ? 10.620  42.649 -79.488 1.00 91.39  ? 118 LYS G CA    1 
ATOM   5241  C  C     . LYS G 3 105 ? 9.892   43.849 -80.154 1.00 91.93  ? 118 LYS G C     1 
ATOM   5242  O  O     . LYS G 3 105 ? 10.347  44.994 -80.059 1.00 92.01  ? 118 LYS G O     1 
ATOM   5243  C  CB    . LYS G 3 105 ? 11.267  41.732 -80.544 1.00 93.64  ? 118 LYS G CB    1 
ATOM   5244  C  CG    . LYS G 3 105 ? 12.107  42.476 -81.585 1.00 98.15  ? 118 LYS G CG    1 
ATOM   5245  C  CD    . LYS G 3 105 ? 12.724  41.539 -82.625 1.00 102.75 ? 118 LYS G CD    1 
ATOM   5246  C  CE    . LYS G 3 105 ? 13.903  40.782 -82.072 1.00 106.57 ? 118 LYS G CE    1 
ATOM   5247  N  NZ    . LYS G 3 105 ? 14.741  40.209 -83.163 1.00 108.74 ? 118 LYS G NZ    1 
ATOM   5248  N  N     . ARG H 4 1   ? -13.564 30.089 -21.325 1.00 90.78  ? 28  ARG H N     1 
ATOM   5249  C  CA    . ARG H 4 1   ? -12.698 30.708 -22.335 1.00 91.25  ? 28  ARG H CA    1 
ATOM   5250  C  C     . ARG H 4 1   ? -11.456 31.394 -21.708 1.00 90.71  ? 28  ARG H C     1 
ATOM   5251  O  O     . ARG H 4 1   ? -11.296 31.403 -20.476 1.00 90.84  ? 28  ARG H O     1 
ATOM   5252  C  CB    . ARG H 4 1   ? -13.503 31.724 -23.190 1.00 93.43  ? 28  ARG H CB    1 
ATOM   5253  C  CG    . ARG H 4 1   ? -14.054 31.179 -24.503 1.00 97.90  ? 28  ARG H CG    1 
ATOM   5254  C  CD    . ARG H 4 1   ? -14.297 32.303 -25.501 1.00 102.56 ? 28  ARG H CD    1 
ATOM   5255  N  NE    . ARG H 4 1   ? -13.133 32.572 -26.353 1.00 106.93 ? 28  ARG H NE    1 
ATOM   5256  C  CZ    . ARG H 4 1   ? -13.131 33.402 -27.394 1.00 109.69 ? 28  ARG H CZ    1 
ATOM   5257  N  NH1   . ARG H 4 1   ? -14.242 34.042 -27.744 1.00 109.25 ? 28  ARG H NH1   1 
ATOM   5258  N  NH2   . ARG H 4 1   ? -12.025 33.582 -28.106 1.00 109.79 ? 28  ARG H NH2   1 
ATOM   5259  N  N     . SER H 4 2   ? -10.563 31.950 -22.563 1.00 89.78  ? 29  SER H N     1 
ATOM   5260  C  CA    . SER H 4 2   ? -9.376  32.692 -22.113 1.00 89.12  ? 29  SER H CA    1 
ATOM   5261  C  C     . SER H 4 2   ? -9.250  33.993 -22.911 1.00 87.89  ? 29  SER H C     1 
ATOM   5262  O  O     . SER H 4 2   ? -9.606  34.018 -24.096 1.00 88.21  ? 29  SER H O     1 
ATOM   5263  C  CB    . SER H 4 2   ? -8.106  31.860 -22.271 1.00 90.33  ? 29  SER H CB    1 
ATOM   5264  O  OG    . SER H 4 2   ? -7.785  31.636 -23.635 1.00 92.11  ? 29  SER H OG    1 
ATOM   5265  N  N     . ARG H 4 3   ? -8.755  35.074 -22.271 1.00 86.10  ? 30  ARG H N     1 
ATOM   5266  C  CA    . ARG H 4 3   ? -8.601  36.359 -22.964 1.00 84.66  ? 30  ARG H CA    1 
ATOM   5267  C  C     . ARG H 4 3   ? -7.359  36.361 -23.848 1.00 82.09  ? 30  ARG H C     1 
ATOM   5268  O  O     . ARG H 4 3   ? -6.335  35.789 -23.478 1.00 82.12  ? 30  ARG H O     1 
ATOM   5269  C  CB    . ARG H 4 3   ? -8.627  37.561 -21.995 1.00 86.30  ? 30  ARG H CB    1 
ATOM   5270  C  CG    . ARG H 4 3   ? -9.816  37.558 -21.050 1.00 89.35  ? 30  ARG H CG    1 
ATOM   5271  C  CD    . ARG H 4 3   ? -11.143 37.743 -21.771 1.00 91.86  ? 30  ARG H CD    1 
ATOM   5272  N  NE    . ARG H 4 3   ? -11.688 39.095 -21.610 1.00 94.03  ? 30  ARG H NE    1 
ATOM   5273  C  CZ    . ARG H 4 3   ? -12.638 39.428 -20.740 1.00 95.48  ? 30  ARG H CZ    1 
ATOM   5274  N  NH1   . ARG H 4 3   ? -13.161 38.512 -19.934 1.00 95.15  ? 30  ARG H NH1   1 
ATOM   5275  N  NH2   . ARG H 4 3   ? -13.071 40.680 -20.669 1.00 94.66  ? 30  ARG H NH2   1 
ATOM   5276  N  N     . LYS H 4 4   ? -7.475  36.967 -25.034 1.00 79.54  ? 31  LYS H N     1 
ATOM   5277  C  CA    . LYS H 4 4   ? -6.391  36.997 -25.997 1.00 77.54  ? 31  LYS H CA    1 
ATOM   5278  C  C     . LYS H 4 4   ? -5.812  38.404 -26.212 1.00 74.70  ? 31  LYS H C     1 
ATOM   5279  O  O     . LYS H 4 4   ? -6.495  39.280 -26.726 1.00 74.77  ? 31  LYS H O     1 
ATOM   5280  C  CB    . LYS H 4 4   ? -6.844  36.360 -27.323 1.00 79.58  ? 31  LYS H CB    1 
ATOM   5281  C  CG    . LYS H 4 4   ? -7.326  34.924 -27.171 1.00 83.99  ? 31  LYS H CG    1 
ATOM   5282  C  CD    . LYS H 4 4   ? -6.862  34.047 -28.337 1.00 88.80  ? 31  LYS H CD    1 
ATOM   5283  C  CE    . LYS H 4 4   ? -7.457  32.662 -28.271 1.00 92.62  ? 31  LYS H CE    1 
ATOM   5284  N  NZ    . LYS H 4 4   ? -7.650  32.185 -26.877 1.00 94.75  ? 31  LYS H NZ    1 
ATOM   5285  N  N     . GLU H 4 5   ? -4.542  38.588 -25.856 1.00 71.94  ? 32  GLU H N     1 
ATOM   5286  C  CA    . GLU H 4 5   ? -3.783  39.830 -26.002 1.00 69.47  ? 32  GLU H CA    1 
ATOM   5287  C  C     . GLU H 4 5   ? -3.706  40.315 -27.452 1.00 66.09  ? 32  GLU H C     1 
ATOM   5288  O  O     . GLU H 4 5   ? -3.779  39.500 -28.377 1.00 66.60  ? 32  GLU H O     1 
ATOM   5289  C  CB    . GLU H 4 5   ? -2.354  39.590 -25.518 1.00 71.83  ? 32  GLU H CB    1 
ATOM   5290  C  CG    . GLU H 4 5   ? -2.273  39.279 -24.049 1.00 76.31  ? 32  GLU H CG    1 
ATOM   5291  C  CD    . GLU H 4 5   ? -1.423  40.330 -23.386 1.00 81.87  ? 32  GLU H CD    1 
ATOM   5292  O  OE1   . GLU H 4 5   ? -0.210  40.382 -23.694 1.00 83.07  ? 32  GLU H OE1   1 
ATOM   5293  O  OE2   . GLU H 4 5   ? -1.966  41.112 -22.573 1.00 83.73  ? 32  GLU H OE2   1 
ATOM   5294  N  N     . SER H 4 6   ? -3.484  41.628 -27.645 1.00 62.44  ? 33  SER H N     1 
ATOM   5295  C  CA    . SER H 4 6   ? -3.384  42.210 -28.977 1.00 59.24  ? 33  SER H CA    1 
ATOM   5296  C  C     . SER H 4 6   ? -2.866  43.657 -28.931 1.00 56.77  ? 33  SER H C     1 
ATOM   5297  O  O     . SER H 4 6   ? -3.175  44.410 -28.007 1.00 56.87  ? 33  SER H O     1 
ATOM   5298  C  CB    . SER H 4 6   ? -4.757  42.194 -29.645 1.00 58.95  ? 33  SER H CB    1 
ATOM   5299  O  OG    . SER H 4 6   ? -4.682  42.150 -31.057 1.00 59.47  ? 33  SER H OG    1 
ATOM   5300  N  N     . TYR H 4 7   ? -2.109  44.055 -29.949 1.00 54.27  ? 34  TYR H N     1 
ATOM   5301  C  CA    . TYR H 4 7   ? -1.658  45.435 -30.089 1.00 52.32  ? 34  TYR H CA    1 
ATOM   5302  C  C     . TYR H 4 7   ? -2.607  46.212 -31.034 1.00 51.78  ? 34  TYR H C     1 
ATOM   5303  O  O     . TYR H 4 7   ? -2.191  47.224 -31.589 1.00 51.87  ? 34  TYR H O     1 
ATOM   5304  C  CB    . TYR H 4 7   ? -0.246  45.481 -30.685 1.00 51.39  ? 34  TYR H CB    1 
ATOM   5305  C  CG    . TYR H 4 7   ? 0.851   44.978 -29.775 1.00 51.26  ? 34  TYR H CG    1 
ATOM   5306  C  CD1   . TYR H 4 7   ? 1.486   45.828 -28.885 1.00 51.60  ? 34  TYR H CD1   1 
ATOM   5307  C  CD2   . TYR H 4 7   ? 1.309   43.677 -29.862 1.00 52.16  ? 34  TYR H CD2   1 
ATOM   5308  C  CE1   . TYR H 4 7   ? 2.517   45.383 -28.068 1.00 52.23  ? 34  TYR H CE1   1 
ATOM   5309  C  CE2   . TYR H 4 7   ? 2.336   43.218 -29.048 1.00 53.04  ? 34  TYR H CE2   1 
ATOM   5310  C  CZ    . TYR H 4 7   ? 2.946   44.077 -28.155 1.00 53.49  ? 34  TYR H CZ    1 
ATOM   5311  O  OH    . TYR H 4 7   ? 3.978   43.619 -27.359 1.00 55.13  ? 34  TYR H OH    1 
ATOM   5312  N  N     . SER H 4 8   ? -3.863  45.741 -31.232 1.00 51.07  ? 35  SER H N     1 
ATOM   5313  C  CA    . SER H 4 8   ? -4.830  46.318 -32.178 1.00 50.78  ? 35  SER H CA    1 
ATOM   5314  C  C     . SER H 4 8   ? -5.322  47.710 -31.805 1.00 49.25  ? 35  SER H C     1 
ATOM   5315  O  O     . SER H 4 8   ? -5.571  48.541 -32.680 1.00 48.85  ? 35  SER H O     1 
ATOM   5316  C  CB    . SER H 4 8   ? -6.023  45.383 -32.366 1.00 52.99  ? 35  SER H CB    1 
ATOM   5317  O  OG    . SER H 4 8   ? -5.629  44.027 -32.506 1.00 56.58  ? 35  SER H OG    1 
ATOM   5318  N  N     . VAL H 4 9   ? -5.483  47.953 -30.507 1.00 48.00  ? 36  VAL H N     1 
ATOM   5319  C  CA    . VAL H 4 9   ? -5.938  49.230 -29.976 1.00 47.15  ? 36  VAL H CA    1 
ATOM   5320  C  C     . VAL H 4 9   ? -4.936  50.331 -30.364 1.00 46.03  ? 36  VAL H C     1 
ATOM   5321  O  O     . VAL H 4 9   ? -5.327  51.390 -30.863 1.00 46.14  ? 36  VAL H O     1 
ATOM   5322  C  CB    . VAL H 4 9   ? -6.102  49.118 -28.438 1.00 47.83  ? 36  VAL H CB    1 
ATOM   5323  C  CG1   . VAL H 4 9   ? -6.613  50.421 -27.838 1.00 48.57  ? 36  VAL H CG1   1 
ATOM   5324  C  CG2   . VAL H 4 9   ? -7.015  47.956 -28.063 1.00 48.21  ? 36  VAL H CG2   1 
ATOM   5325  N  N     . TYR H 4 10  ? -3.639  50.019 -30.214 1.00 44.54  ? 37  TYR H N     1 
ATOM   5326  C  CA    . TYR H 4 10  ? -2.515  50.907 -30.499 1.00 43.29  ? 37  TYR H CA    1 
ATOM   5327  C  C     . TYR H 4 10  ? -2.235  51.022 -31.990 1.00 42.88  ? 37  TYR H C     1 
ATOM   5328  O  O     . TYR H 4 10  ? -1.892  52.104 -32.442 1.00 43.52  ? 37  TYR H O     1 
ATOM   5329  C  CB    . TYR H 4 10  ? -1.252  50.484 -29.736 1.00 42.72  ? 37  TYR H CB    1 
ATOM   5330  C  CG    . TYR H 4 10  ? -1.555  49.883 -28.387 1.00 43.06  ? 37  TYR H CG    1 
ATOM   5331  C  CD1   . TYR H 4 10  ? -1.956  50.678 -27.332 1.00 44.16  ? 37  TYR H CD1   1 
ATOM   5332  C  CD2   . TYR H 4 10  ? -1.607  48.513 -28.215 1.00 43.77  ? 37  TYR H CD2   1 
ATOM   5333  C  CE1   . TYR H 4 10  ? -2.282  50.132 -26.101 1.00 45.31  ? 37  TYR H CE1   1 
ATOM   5334  C  CE2   . TYR H 4 10  ? -1.954  47.950 -26.998 1.00 44.91  ? 37  TYR H CE2   1 
ATOM   5335  C  CZ    . TYR H 4 10  ? -2.294  48.764 -25.941 1.00 46.33  ? 37  TYR H CZ    1 
ATOM   5336  O  OH    . TYR H 4 10  ? -2.615  48.215 -24.725 1.00 48.56  ? 37  TYR H OH    1 
ATOM   5337  N  N     . VAL H 4 11  ? -2.378  49.936 -32.764 1.00 42.03  ? 38  VAL H N     1 
ATOM   5338  C  CA    . VAL H 4 11  ? -2.172  50.006 -34.216 1.00 41.77  ? 38  VAL H CA    1 
ATOM   5339  C  C     . VAL H 4 11  ? -3.246  50.919 -34.835 1.00 42.03  ? 38  VAL H C     1 
ATOM   5340  O  O     . VAL H 4 11  ? -2.924  51.689 -35.739 1.00 42.31  ? 38  VAL H O     1 
ATOM   5341  C  CB    . VAL H 4 11  ? -2.086  48.604 -34.882 1.00 41.95  ? 38  VAL H CB    1 
ATOM   5342  C  CG1   . VAL H 4 11  ? -2.217  48.689 -36.398 1.00 42.44  ? 38  VAL H CG1   1 
ATOM   5343  C  CG2   . VAL H 4 11  ? -0.793  47.900 -34.503 1.00 42.01  ? 38  VAL H CG2   1 
ATOM   5344  N  N     . TYR H 4 12  ? -4.491  50.910 -34.268 1.00 42.03  ? 39  TYR H N     1 
ATOM   5345  C  CA    . TYR H 4 12  ? -5.618  51.768 -34.680 1.00 42.37  ? 39  TYR H CA    1 
ATOM   5346  C  C     . TYR H 4 12  ? -5.288  53.254 -34.368 1.00 40.71  ? 39  TYR H C     1 
ATOM   5347  O  O     . TYR H 4 12  ? -5.352  54.098 -35.270 1.00 40.62  ? 39  TYR H O     1 
ATOM   5348  C  CB    . TYR H 4 12  ? -6.913  51.352 -33.948 1.00 43.53  ? 39  TYR H CB    1 
ATOM   5349  C  CG    . TYR H 4 12  ? -7.940  50.639 -34.800 1.00 45.95  ? 39  TYR H CG    1 
ATOM   5350  C  CD1   . TYR H 4 12  ? -8.651  51.317 -35.780 1.00 47.34  ? 39  TYR H CD1   1 
ATOM   5351  C  CD2   . TYR H 4 12  ? -8.275  49.308 -34.554 1.00 48.26  ? 39  TYR H CD2   1 
ATOM   5352  C  CE1   . TYR H 4 12  ? -9.636  50.676 -36.536 1.00 49.17  ? 39  TYR H CE1   1 
ATOM   5353  C  CE2   . TYR H 4 12  ? -9.257  48.652 -35.302 1.00 49.74  ? 39  TYR H CE2   1 
ATOM   5354  C  CZ    . TYR H 4 12  ? -9.940  49.339 -36.295 1.00 50.85  ? 39  TYR H CZ    1 
ATOM   5355  O  OH    . TYR H 4 12  ? -10.926 48.688 -37.024 1.00 52.27  ? 39  TYR H OH    1 
ATOM   5356  N  N     . LYS H 4 13  ? -4.890  53.553 -33.099 1.00 38.73  ? 40  LYS H N     1 
ATOM   5357  C  CA    . LYS H 4 13  ? -4.504  54.884 -32.634 1.00 37.31  ? 40  LYS H CA    1 
ATOM   5358  C  C     . LYS H 4 13  ? -3.436  55.488 -33.553 1.00 36.48  ? 40  LYS H C     1 
ATOM   5359  O  O     . LYS H 4 13  ? -3.616  56.604 -34.060 1.00 37.00  ? 40  LYS H O     1 
ATOM   5360  C  CB    . LYS H 4 13  ? -3.954  54.811 -31.194 1.00 37.84  ? 40  LYS H CB    1 
ATOM   5361  C  CG    . LYS H 4 13  ? -4.996  54.770 -30.103 1.00 40.47  ? 40  LYS H CG    1 
ATOM   5362  C  CD    . LYS H 4 13  ? -4.320  54.829 -28.747 1.00 43.74  ? 40  LYS H CD    1 
ATOM   5363  C  CE    . LYS H 4 13  ? -5.300  55.067 -27.624 1.00 47.27  ? 40  LYS H CE    1 
ATOM   5364  N  NZ    . LYS H 4 13  ? -6.236  53.929 -27.447 1.00 49.60  ? 40  LYS H NZ    1 
ATOM   5365  N  N     . VAL H 4 14  ? -2.347  54.722 -33.794 1.00 35.00  ? 41  VAL H N     1 
ATOM   5366  C  CA    . VAL H 4 14  ? -1.222  55.122 -34.628 1.00 34.14  ? 41  VAL H CA    1 
ATOM   5367  C  C     . VAL H 4 14  ? -1.668  55.269 -36.107 1.00 34.28  ? 41  VAL H C     1 
ATOM   5368  O  O     . VAL H 4 14  ? -1.228  56.207 -36.774 1.00 33.84  ? 41  VAL H O     1 
ATOM   5369  C  CB    . VAL H 4 14  ? 0.008   54.197 -34.409 1.00 33.73  ? 41  VAL H CB    1 
ATOM   5370  C  CG1   . VAL H 4 14  ? 1.131   54.528 -35.369 1.00 33.95  ? 41  VAL H CG1   1 
ATOM   5371  C  CG2   . VAL H 4 14  ? 0.515   54.282 -32.975 1.00 33.46  ? 41  VAL H CG2   1 
ATOM   5372  N  N     . LEU H 4 15  ? -2.613  54.417 -36.591 1.00 34.50  ? 42  LEU H N     1 
ATOM   5373  C  CA    . LEU H 4 15  ? -3.142  54.565 -37.959 1.00 35.09  ? 42  LEU H CA    1 
ATOM   5374  C  C     . LEU H 4 15  ? -3.864  55.922 -38.131 1.00 37.14  ? 42  LEU H C     1 
ATOM   5375  O  O     . LEU H 4 15  ? -3.658  56.609 -39.127 1.00 37.23  ? 42  LEU H O     1 
ATOM   5376  C  CB    . LEU H 4 15  ? -4.103  53.429 -38.329 1.00 33.97  ? 42  LEU H CB    1 
ATOM   5377  C  CG    . LEU H 4 15  ? -4.751  53.505 -39.724 1.00 33.75  ? 42  LEU H CG    1 
ATOM   5378  C  CD1   . LEU H 4 15  ? -3.701  53.606 -40.855 1.00 33.38  ? 42  LEU H CD1   1 
ATOM   5379  C  CD2   . LEU H 4 15  ? -5.644  52.314 -39.948 1.00 34.08  ? 42  LEU H CD2   1 
ATOM   5380  N  N     . LYS H 4 16  ? -4.699  56.306 -37.160 1.00 38.22  ? 43  LYS H N     1 
ATOM   5381  C  CA    . LYS H 4 16  ? -5.426  57.567 -37.236 1.00 39.46  ? 43  LYS H CA    1 
ATOM   5382  C  C     . LYS H 4 16  ? -4.483  58.762 -37.294 1.00 39.51  ? 43  LYS H C     1 
ATOM   5383  O  O     . LYS H 4 16  ? -4.677  59.631 -38.139 1.00 40.19  ? 43  LYS H O     1 
ATOM   5384  C  CB    . LYS H 4 16  ? -6.460  57.679 -36.100 1.00 42.15  ? 43  LYS H CB    1 
ATOM   5385  C  CG    . LYS H 4 16  ? -7.514  56.573 -36.162 1.00 47.04  ? 43  LYS H CG    1 
ATOM   5386  C  CD    . LYS H 4 16  ? -8.378  56.680 -37.425 1.00 52.18  ? 43  LYS H CD    1 
ATOM   5387  C  CE    . LYS H 4 16  ? -8.221  55.493 -38.342 1.00 56.47  ? 43  LYS H CE    1 
ATOM   5388  N  NZ    . LYS H 4 16  ? -9.044  55.649 -39.564 1.00 59.28  ? 43  LYS H NZ    1 
ATOM   5389  N  N     . GLN H 4 17  ? -3.410  58.773 -36.479 1.00 38.61  ? 44  GLN H N     1 
ATOM   5390  C  CA    . GLN H 4 17  ? -2.453  59.877 -36.507 1.00 37.92  ? 44  GLN H CA    1 
ATOM   5391  C  C     . GLN H 4 17  ? -1.848  60.074 -37.902 1.00 38.68  ? 44  GLN H C     1 
ATOM   5392  O  O     . GLN H 4 17  ? -1.729  61.202 -38.398 1.00 39.38  ? 44  GLN H O     1 
ATOM   5393  C  CB    . GLN H 4 17  ? -1.323  59.633 -35.508 1.00 37.82  ? 44  GLN H CB    1 
ATOM   5394  C  CG    . GLN H 4 17  ? -1.756  59.439 -34.080 1.00 39.29  ? 44  GLN H CG    1 
ATOM   5395  C  CD    . GLN H 4 17  ? -0.533  59.215 -33.224 1.00 43.43  ? 44  GLN H CD    1 
ATOM   5396  O  OE1   . GLN H 4 17  ? -0.409  58.214 -32.517 1.00 45.11  ? 44  GLN H OE1   1 
ATOM   5397  N  NE2   . GLN H 4 17  ? 0.427   60.123 -33.287 1.00 43.84  ? 44  GLN H NE2   1 
ATOM   5398  N  N     . VAL H 4 18  ? -1.513  58.970 -38.542 1.00 38.66  ? 45  VAL H N     1 
ATOM   5399  C  CA    . VAL H 4 18  ? -0.847  58.989 -39.818 1.00 39.62  ? 45  VAL H CA    1 
ATOM   5400  C  C     . VAL H 4 18  ? -1.828  59.246 -40.968 1.00 41.25  ? 45  VAL H C     1 
ATOM   5401  O  O     . VAL H 4 18  ? -1.655  60.242 -41.673 1.00 41.97  ? 45  VAL H O     1 
ATOM   5402  C  CB    . VAL H 4 18  ? -0.006  57.707 -39.945 1.00 39.91  ? 45  VAL H CB    1 
ATOM   5403  C  CG1   . VAL H 4 18  ? 0.316   57.386 -41.378 1.00 40.60  ? 45  VAL H CG1   1 
ATOM   5404  C  CG2   . VAL H 4 18  ? 1.266   57.836 -39.137 1.00 40.00  ? 45  VAL H CG2   1 
ATOM   5405  N  N     . HIS H 4 19  ? -2.846  58.384 -41.147 1.00 41.75  ? 46  HIS H N     1 
ATOM   5406  C  CA    . HIS H 4 19  ? -3.903  58.502 -42.159 1.00 42.88  ? 46  HIS H CA    1 
ATOM   5407  C  C     . HIS H 4 19  ? -5.242  58.440 -41.436 1.00 44.44  ? 46  HIS H C     1 
ATOM   5408  O  O     . HIS H 4 19  ? -5.689  57.361 -41.014 1.00 44.62  ? 46  HIS H O     1 
ATOM   5409  C  CB    . HIS H 4 19  ? -3.826  57.370 -43.170 1.00 43.03  ? 46  HIS H CB    1 
ATOM   5410  C  CG    . HIS H 4 19  ? -2.611  57.439 -44.022 1.00 44.74  ? 46  HIS H CG    1 
ATOM   5411  N  ND1   . HIS H 4 19  ? -1.371  57.130 -43.521 1.00 46.28  ? 46  HIS H ND1   1 
ATOM   5412  C  CD2   . HIS H 4 19  ? -2.487  57.768 -45.327 1.00 46.09  ? 46  HIS H CD2   1 
ATOM   5413  C  CE1   . HIS H 4 19  ? -0.526  57.295 -44.526 1.00 46.84  ? 46  HIS H CE1   1 
ATOM   5414  N  NE2   . HIS H 4 19  ? -1.154  57.665 -45.635 1.00 46.92  ? 46  HIS H NE2   1 
ATOM   5415  N  N     . PRO H 4 20  ? -5.863  59.613 -41.211 1.00 44.95  ? 47  PRO H N     1 
ATOM   5416  C  CA    . PRO H 4 20  ? -7.101  59.641 -40.418 1.00 45.16  ? 47  PRO H CA    1 
ATOM   5417  C  C     . PRO H 4 20  ? -8.355  59.199 -41.167 1.00 45.63  ? 47  PRO H C     1 
ATOM   5418  O  O     . PRO H 4 20  ? -9.399  59.004 -40.545 1.00 46.11  ? 47  PRO H O     1 
ATOM   5419  C  CB    . PRO H 4 20  ? -7.174  61.094 -39.927 1.00 45.67  ? 47  PRO H CB    1 
ATOM   5420  C  CG    . PRO H 4 20  ? -5.849  61.754 -40.376 1.00 45.90  ? 47  PRO H CG    1 
ATOM   5421  C  CD    . PRO H 4 20  ? -5.430  60.975 -41.573 1.00 44.36  ? 47  PRO H CD    1 
ATOM   5422  N  N     . ASP H 4 21  ? -8.248  59.021 -42.490 1.00 45.38  ? 48  ASP H N     1 
ATOM   5423  C  CA    . ASP H 4 21  ? -9.344  58.561 -43.343 1.00 45.94  ? 48  ASP H CA    1 
ATOM   5424  C  C     . ASP H 4 21  ? -9.242  57.068 -43.638 1.00 45.34  ? 48  ASP H C     1 
ATOM   5425  O  O     . ASP H 4 21  ? -10.253 56.442 -43.970 1.00 45.59  ? 48  ASP H O     1 
ATOM   5426  C  CB    . ASP H 4 21  ? -9.302  59.288 -44.698 1.00 48.93  ? 48  ASP H CB    1 
ATOM   5427  C  CG    . ASP H 4 21  ? -10.068 60.607 -44.765 1.00 55.12  ? 48  ASP H CG    1 
ATOM   5428  O  OD1   . ASP H 4 21  ? -10.235 61.265 -43.690 1.00 55.66  ? 48  ASP H OD1   1 
ATOM   5429  O  OD2   . ASP H 4 21  ? -10.495 60.990 -45.889 1.00 57.74  ? 48  ASP H OD2   1 
ATOM   5430  N  N     . THR H 4 22  ? -8.004  56.540 -43.624 1.00 44.13  ? 49  THR H N     1 
ATOM   5431  C  CA    . THR H 4 22  ? -7.634  55.183 -43.975 1.00 43.00  ? 49  THR H CA    1 
ATOM   5432  C  C     . THR H 4 22  ? -7.945  54.183 -42.826 1.00 41.95  ? 49  THR H C     1 
ATOM   5433  O  O     . THR H 4 22  ? -7.680  54.482 -41.660 1.00 41.89  ? 49  THR H O     1 
ATOM   5434  C  CB    . THR H 4 22  ? -6.167  55.214 -44.458 1.00 43.48  ? 49  THR H CB    1 
ATOM   5435  O  OG1   . THR H 4 22  ? -6.032  56.172 -45.523 1.00 43.95  ? 49  THR H OG1   1 
ATOM   5436  C  CG2   . THR H 4 22  ? -5.681  53.882 -44.932 1.00 43.62  ? 49  THR H CG2   1 
ATOM   5437  N  N     . GLY H 4 23  ? -8.566  53.048 -43.189 1.00 40.91  ? 50  GLY H N     1 
ATOM   5438  C  CA    . GLY H 4 23  ? -8.944  51.947 -42.299 1.00 40.54  ? 50  GLY H CA    1 
ATOM   5439  C  C     . GLY H 4 23  ? -8.043  50.713 -42.388 1.00 39.63  ? 50  GLY H C     1 
ATOM   5440  O  O     . GLY H 4 23  ? -7.069  50.716 -43.139 1.00 39.52  ? 50  GLY H O     1 
ATOM   5441  N  N     . ILE H 4 24  ? -8.344  49.638 -41.644 1.00 38.79  ? 51  ILE H N     1 
ATOM   5442  C  CA    . ILE H 4 24  ? -7.497  48.438 -41.663 1.00 38.67  ? 51  ILE H CA    1 
ATOM   5443  C  C     . ILE H 4 24  ? -8.306  47.119 -41.587 1.00 38.79  ? 51  ILE H C     1 
ATOM   5444  O  O     . ILE H 4 24  ? -9.154  46.949 -40.699 1.00 38.24  ? 51  ILE H O     1 
ATOM   5445  C  CB    . ILE H 4 24  ? -6.419  48.541 -40.550 1.00 38.83  ? 51  ILE H CB    1 
ATOM   5446  C  CG1   . ILE H 4 24  ? -5.327  47.447 -40.691 1.00 39.26  ? 51  ILE H CG1   1 
ATOM   5447  C  CG2   . ILE H 4 24  ? -7.058  48.564 -39.149 1.00 39.22  ? 51  ILE H CG2   1 
ATOM   5448  C  CD1   . ILE H 4 24  ? -4.235  47.461 -39.590 1.00 40.00  ? 51  ILE H CD1   1 
ATOM   5449  N  N     . SER H 4 25  ? -8.014  46.169 -42.523 1.00 39.09  ? 52  SER H N     1 
ATOM   5450  C  CA    . SER H 4 25  ? -8.674  44.854 -42.590 1.00 39.16  ? 52  SER H CA    1 
ATOM   5451  C  C     . SER H 4 25  ? -8.297  43.939 -41.408 1.00 38.51  ? 52  SER H C     1 
ATOM   5452  O  O     . SER H 4 25  ? -7.293  44.186 -40.746 1.00 38.22  ? 52  SER H O     1 
ATOM   5453  C  CB    . SER H 4 25  ? -8.433  44.184 -43.945 1.00 40.85  ? 52  SER H CB    1 
ATOM   5454  O  OG    . SER H 4 25  ? -7.328  43.295 -43.989 1.00 43.65  ? 52  SER H OG    1 
ATOM   5455  N  N     . SER H 4 26  ? -9.113  42.908 -41.117 1.00 38.40  ? 53  SER H N     1 
ATOM   5456  C  CA    . SER H 4 26  ? -8.826  41.998 -39.997 1.00 38.40  ? 53  SER H CA    1 
ATOM   5457  C  C     . SER H 4 26  ? -7.553  41.213 -40.238 1.00 37.02  ? 53  SER H C     1 
ATOM   5458  O  O     . SER H 4 26  ? -6.782  40.992 -39.293 1.00 37.05  ? 53  SER H O     1 
ATOM   5459  C  CB    . SER H 4 26  ? -9.985  41.040 -39.752 1.00 40.66  ? 53  SER H CB    1 
ATOM   5460  O  OG    . SER H 4 26  ? -9.722  40.255 -38.600 1.00 43.60  ? 53  SER H OG    1 
ATOM   5461  N  N     . LYS H 4 27  ? -7.331  40.799 -41.508 1.00 35.37  ? 54  LYS H N     1 
ATOM   5462  C  CA    . LYS H 4 27  ? -6.116  40.089 -41.881 1.00 34.12  ? 54  LYS H CA    1 
ATOM   5463  C  C     . LYS H 4 27  ? -4.903  41.024 -41.800 1.00 31.39  ? 54  LYS H C     1 
ATOM   5464  O  O     . LYS H 4 27  ? -3.907  40.661 -41.176 1.00 31.06  ? 54  LYS H O     1 
ATOM   5465  C  CB    . LYS H 4 27  ? -6.254  39.416 -43.263 1.00 36.26  ? 54  LYS H CB    1 
ATOM   5466  C  CG    . LYS H 4 27  ? -7.379  38.403 -43.257 1.00 39.99  ? 54  LYS H CG    1 
ATOM   5467  C  CD    . LYS H 4 27  ? -7.586  37.702 -44.596 1.00 44.16  ? 54  LYS H CD    1 
ATOM   5468  C  CE    . LYS H 4 27  ? -8.750  36.724 -44.540 1.00 46.80  ? 54  LYS H CE    1 
ATOM   5469  N  NZ    . LYS H 4 27  ? -10.057 37.409 -44.309 1.00 48.26  ? 54  LYS H NZ    1 
ATOM   5470  N  N     . ALA H 4 28  ? -5.017  42.260 -42.309 1.00 29.37  ? 55  ALA H N     1 
ATOM   5471  C  CA    . ALA H 4 28  ? -3.916  43.220 -42.231 1.00 28.04  ? 55  ALA H CA    1 
ATOM   5472  C  C     . ALA H 4 28  ? -3.569  43.572 -40.792 1.00 26.88  ? 55  ALA H C     1 
ATOM   5473  O  O     . ALA H 4 28  ? -2.399  43.730 -40.480 1.00 26.91  ? 55  ALA H O     1 
ATOM   5474  C  CB    . ALA H 4 28  ? -4.235  44.463 -43.021 1.00 27.88  ? 55  ALA H CB    1 
ATOM   5475  N  N     . MET H 4 29  ? -4.557  43.619 -39.902 1.00 26.04  ? 56  MET H N     1 
ATOM   5476  C  CA    . MET H 4 29  ? -4.302  43.859 -38.482 1.00 25.93  ? 56  MET H CA    1 
ATOM   5477  C  C     . MET H 4 29  ? -3.517  42.684 -37.880 1.00 25.20  ? 56  MET H C     1 
ATOM   5478  O  O     . MET H 4 29  ? -2.678  42.894 -37.006 1.00 25.66  ? 56  MET H O     1 
ATOM   5479  C  CB    . MET H 4 29  ? -5.616  44.076 -37.728 1.00 27.47  ? 56  MET H CB    1 
ATOM   5480  C  CG    . MET H 4 29  ? -5.440  44.289 -36.239 1.00 30.65  ? 56  MET H CG    1 
ATOM   5481  S  SD    . MET H 4 29  ? -4.497  45.766 -35.833 1.00 37.35  ? 56  MET H SD    1 
ATOM   5482  C  CE    . MET H 4 29  ? -5.717  46.998 -36.059 1.00 38.99  ? 56  MET H CE    1 
ATOM   5483  N  N     . GLY H 4 30  ? -3.776  41.463 -38.363 1.00 23.95  ? 57  GLY H N     1 
ATOM   5484  C  CA    . GLY H 4 30  ? -3.046  40.274 -37.953 1.00 22.64  ? 57  GLY H CA    1 
ATOM   5485  C  C     . GLY H 4 30  ? -1.601  40.382 -38.392 1.00 21.08  ? 57  GLY H C     1 
ATOM   5486  O  O     . GLY H 4 30  ? -0.702  40.171 -37.580 1.00 21.58  ? 57  GLY H O     1 
ATOM   5487  N  N     . ILE H 4 31  ? -1.361  40.801 -39.652 1.00 19.26  ? 58  ILE H N     1 
ATOM   5488  C  CA    . ILE H 4 31  ? -0.010  41.032 -40.170 1.00 18.11  ? 58  ILE H CA    1 
ATOM   5489  C  C     . ILE H 4 31  ? 0.707   42.104 -39.311 1.00 17.25  ? 58  ILE H C     1 
ATOM   5490  O  O     . ILE H 4 31  ? 1.871   41.925 -38.965 1.00 17.42  ? 58  ILE H O     1 
ATOM   5491  C  CB    . ILE H 4 31  ? 0.023   41.313 -41.712 1.00 18.15  ? 58  ILE H CB    1 
ATOM   5492  C  CG1   . ILE H 4 31  ? 0.021   40.002 -42.502 1.00 19.63  ? 58  ILE H CG1   1 
ATOM   5493  C  CG2   . ILE H 4 31  ? 1.263   42.100 -42.124 1.00 18.07  ? 58  ILE H CG2   1 
ATOM   5494  C  CD1   . ILE H 4 31  ? -1.260  39.319 -42.677 1.00 21.68  ? 58  ILE H CD1   1 
ATOM   5495  N  N     . MET H 4 32  ? -0.002  43.161 -38.899 1.00 16.40  ? 59  MET H N     1 
ATOM   5496  C  CA    . MET H 4 32  ? 0.599   44.191 -38.045 1.00 16.12  ? 59  MET H CA    1 
ATOM   5497  C  C     . MET H 4 32  ? 0.909   43.653 -36.650 1.00 16.90  ? 59  MET H C     1 
ATOM   5498  O  O     . MET H 4 32  ? 1.911   44.019 -36.067 1.00 17.08  ? 59  MET H O     1 
ATOM   5499  C  CB    . MET H 4 32  ? -0.266  45.453 -37.966 1.00 15.26  ? 59  MET H CB    1 
ATOM   5500  C  CG    . MET H 4 32  ? -0.349  46.215 -39.260 1.00 15.60  ? 59  MET H CG    1 
ATOM   5501  S  SD    . MET H 4 32  ? 1.232   46.826 -39.899 1.00 16.31  ? 59  MET H SD    1 
ATOM   5502  C  CE    . MET H 4 32  ? 1.831   47.748 -38.467 1.00 11.70  ? 59  MET H CE    1 
ATOM   5503  N  N     . ASN H 4 33  ? 0.080   42.763 -36.136 1.00 17.50  ? 60  ASN H N     1 
ATOM   5504  C  CA    . ASN H 4 33  ? 0.293   42.161 -34.827 1.00 18.91  ? 60  ASN H CA    1 
ATOM   5505  C  C     . ASN H 4 33  ? 1.483   41.199 -34.823 1.00 18.88  ? 60  ASN H C     1 
ATOM   5506  O  O     . ASN H 4 33  ? 2.226   41.111 -33.845 1.00 18.69  ? 60  ASN H O     1 
ATOM   5507  C  CB    . ASN H 4 33  ? -0.953  41.453 -34.385 1.00 21.63  ? 60  ASN H CB    1 
ATOM   5508  C  CG    . ASN H 4 33  ? -1.576  42.191 -33.257 1.00 28.13  ? 60  ASN H CG    1 
ATOM   5509  O  OD1   . ASN H 4 33  ? -0.887  42.645 -32.332 1.00 29.91  ? 60  ASN H OD1   1 
ATOM   5510  N  ND2   . ASN H 4 33  ? -2.888  42.346 -33.321 1.00 30.30  ? 60  ASN H ND2   1 
ATOM   5511  N  N     . SER H 4 34  ? 1.644   40.462 -35.921 1.00 18.49  ? 61  SER H N     1 
ATOM   5512  C  CA    . SER H 4 34  ? 2.766   39.572 -36.104 1.00 18.56  ? 61  SER H CA    1 
ATOM   5513  C  C     . SER H 4 34  ? 4.053   40.411 -36.227 1.00 18.62  ? 61  SER H C     1 
ATOM   5514  O  O     . SER H 4 34  ? 5.079   40.025 -35.675 1.00 19.39  ? 61  SER H O     1 
ATOM   5515  C  CB    . SER H 4 34  ? 2.548   38.703 -37.339 1.00 20.29  ? 61  SER H CB    1 
ATOM   5516  O  OG    . SER H 4 34  ? 1.425   37.853 -37.144 1.00 23.60  ? 61  SER H OG    1 
ATOM   5517  N  N     . PHE H 4 35  ? 3.981   41.598 -36.885 1.00 17.54  ? 62  PHE H N     1 
ATOM   5518  C  CA    . PHE H 4 35  ? 5.116   42.480 -37.053 1.00 16.64  ? 62  PHE H CA    1 
ATOM   5519  C  C     . PHE H 4 35  ? 5.595   43.002 -35.726 1.00 16.88  ? 62  PHE H C     1 
ATOM   5520  O  O     . PHE H 4 35  ? 6.790   42.994 -35.475 1.00 16.90  ? 62  PHE H O     1 
ATOM   5521  C  CB    . PHE H 4 35  ? 4.796   43.607 -38.039 1.00 16.15  ? 62  PHE H CB    1 
ATOM   5522  C  CG    . PHE H 4 35  ? 5.838   44.706 -38.064 1.00 16.83  ? 62  PHE H CG    1 
ATOM   5523  C  CD1   . PHE H 4 35  ? 7.072   44.502 -38.655 1.00 18.05  ? 62  PHE H CD1   1 
ATOM   5524  C  CD2   . PHE H 4 35  ? 5.614   45.913 -37.427 1.00 17.08  ? 62  PHE H CD2   1 
ATOM   5525  C  CE1   . PHE H 4 35  ? 8.047   45.502 -38.639 1.00 18.29  ? 62  PHE H CE1   1 
ATOM   5526  C  CE2   . PHE H 4 35  ? 6.603   46.888 -37.380 1.00 17.59  ? 62  PHE H CE2   1 
ATOM   5527  C  CZ    . PHE H 4 35  ? 7.812   46.677 -37.985 1.00 17.50  ? 62  PHE H CZ    1 
ATOM   5528  N  N     . VAL H 4 36  ? 4.679   43.473 -34.879 1.00 17.10  ? 63  VAL H N     1 
ATOM   5529  C  CA    . VAL H 4 36  ? 5.043   44.031 -33.576 1.00 17.43  ? 63  VAL H CA    1 
ATOM   5530  C  C     . VAL H 4 36  ? 5.642   42.961 -32.685 1.00 19.07  ? 63  VAL H C     1 
ATOM   5531  O  O     . VAL H 4 36  ? 6.645   43.205 -32.027 1.00 19.67  ? 63  VAL H O     1 
ATOM   5532  C  CB    . VAL H 4 36  ? 3.824   44.690 -32.905 1.00 17.11  ? 63  VAL H CB    1 
ATOM   5533  C  CG1   . VAL H 4 36  ? 4.182   45.206 -31.528 1.00 17.62  ? 63  VAL H CG1   1 
ATOM   5534  C  CG2   . VAL H 4 36  ? 3.274   45.810 -33.766 1.00 17.17  ? 63  VAL H CG2   1 
ATOM   5535  N  N     . ASN H 4 37  ? 5.052   41.761 -32.694 1.00 19.48  ? 64  ASN H N     1 
ATOM   5536  C  CA    . ASN H 4 37  ? 5.531   40.661 -31.873 1.00 20.31  ? 64  ASN H CA    1 
ATOM   5537  C  C     . ASN H 4 37  ? 6.890   40.157 -32.299 1.00 19.30  ? 64  ASN H C     1 
ATOM   5538  O  O     . ASN H 4 37  ? 7.708   39.802 -31.448 1.00 19.03  ? 64  ASN H O     1 
ATOM   5539  C  CB    . ASN H 4 37  ? 4.518   39.524 -31.844 1.00 22.66  ? 64  ASN H CB    1 
ATOM   5540  C  CG    . ASN H 4 37  ? 3.397   39.821 -30.888 1.00 28.91  ? 64  ASN H CG    1 
ATOM   5541  O  OD1   . ASN H 4 37  ? 3.620   40.210 -29.727 1.00 31.26  ? 64  ASN H OD1   1 
ATOM   5542  N  ND2   . ASN H 4 37  ? 2.167   39.680 -31.355 1.00 30.45  ? 64  ASN H ND2   1 
ATOM   5543  N  N     . ASP H 4 38  ? 7.138   40.128 -33.606 1.00 18.43  ? 65  ASP H N     1 
ATOM   5544  C  CA    . ASP H 4 38  ? 8.405   39.655 -34.127 1.00 18.45  ? 65  ASP H CA    1 
ATOM   5545  C  C     . ASP H 4 38  ? 9.514   40.615 -33.720 1.00 19.19  ? 65  ASP H C     1 
ATOM   5546  O  O     . ASP H 4 38  ? 10.523  40.183 -33.175 1.00 19.57  ? 65  ASP H O     1 
ATOM   5547  C  CB    . ASP H 4 38  ? 8.319   39.506 -35.650 1.00 19.91  ? 65  ASP H CB    1 
ATOM   5548  C  CG    . ASP H 4 38  ? 9.634   39.222 -36.329 1.00 26.55  ? 65  ASP H CG    1 
ATOM   5549  O  OD1   . ASP H 4 38  ? 10.528  38.629 -35.669 1.00 28.71  ? 65  ASP H OD1   1 
ATOM   5550  O  OD2   . ASP H 4 38  ? 9.771   39.577 -37.523 1.00 28.63  ? 65  ASP H OD2   1 
ATOM   5551  N  N     . ILE H 4 39  ? 9.325   41.919 -33.983 1.00 19.11  ? 66  ILE H N     1 
ATOM   5552  C  CA    . ILE H 4 39  ? 10.312  42.934 -33.664 1.00 18.76  ? 66  ILE H CA    1 
ATOM   5553  C  C     . ILE H 4 39  ? 10.484  43.047 -32.160 1.00 19.57  ? 66  ILE H C     1 
ATOM   5554  O  O     . ILE H 4 39  ? 11.606  43.235 -31.705 1.00 19.80  ? 66  ILE H O     1 
ATOM   5555  C  CB    . ILE H 4 39  ? 9.983   44.279 -34.336 1.00 18.40  ? 66  ILE H CB    1 
ATOM   5556  C  CG1   . ILE H 4 39  ? 9.720   44.122 -35.829 1.00 18.61  ? 66  ILE H CG1   1 
ATOM   5557  C  CG2   . ILE H 4 39  ? 11.074  45.304 -34.070 1.00 18.79  ? 66  ILE H CG2   1 
ATOM   5558  C  CD1   . ILE H 4 39  ? 10.849  43.626 -36.607 1.00 19.88  ? 66  ILE H CD1   1 
ATOM   5559  N  N     . PHE H 4 40  ? 9.415   42.818 -31.357 1.00 19.84  ? 67  PHE H N     1 
ATOM   5560  C  CA    . PHE H 4 40  ? 9.545   42.842 -29.900 1.00 20.44  ? 67  PHE H CA    1 
ATOM   5561  C  C     . PHE H 4 40  ? 10.561  41.790 -29.459 1.00 19.46  ? 67  PHE H C     1 
ATOM   5562  O  O     . PHE H 4 40  ? 11.540  42.142 -28.826 1.00 19.33  ? 67  PHE H O     1 
ATOM   5563  C  CB    . PHE H 4 40  ? 8.184   42.687 -29.161 1.00 21.54  ? 67  PHE H CB    1 
ATOM   5564  C  CG    . PHE H 4 40  ? 8.351   42.374 -27.682 1.00 23.46  ? 67  PHE H CG    1 
ATOM   5565  C  CD1   . PHE H 4 40  ? 8.805   43.334 -26.799 1.00 24.36  ? 67  PHE H CD1   1 
ATOM   5566  C  CD2   . PHE H 4 40  ? 8.178   41.087 -27.206 1.00 25.32  ? 67  PHE H CD2   1 
ATOM   5567  C  CE1   . PHE H 4 40  ? 9.053   43.021 -25.467 1.00 25.24  ? 67  PHE H CE1   1 
ATOM   5568  C  CE2   . PHE H 4 40  ? 8.425   40.781 -25.874 1.00 26.13  ? 67  PHE H CE2   1 
ATOM   5569  C  CZ    . PHE H 4 40  ? 8.868   41.753 -25.014 1.00 25.50  ? 67  PHE H CZ    1 
ATOM   5570  N  N     . GLU H 4 41  ? 10.381  40.530 -29.896 1.00 18.61  ? 68  GLU H N     1 
ATOM   5571  C  CA    . GLU H 4 41  ? 11.285  39.467 -29.516 1.00 18.32  ? 68  GLU H CA    1 
ATOM   5572  C  C     . GLU H 4 41  ? 12.643  39.580 -30.179 1.00 17.20  ? 68  GLU H C     1 
ATOM   5573  O  O     . GLU H 4 41  ? 13.603  39.119 -29.593 1.00 17.14  ? 68  GLU H O     1 
ATOM   5574  C  CB    . GLU H 4 41  ? 10.661  38.085 -29.715 1.00 22.38  ? 68  GLU H CB    1 
ATOM   5575  C  CG    . GLU H 4 41  ? 10.564  37.646 -31.163 1.00 31.72  ? 68  GLU H CG    1 
ATOM   5576  C  CD    . GLU H 4 41  ? 9.494   36.605 -31.469 1.00 42.93  ? 68  GLU H CD    1 
ATOM   5577  O  OE1   . GLU H 4 41  ? 9.420   36.151 -32.640 1.00 44.34  ? 68  GLU H OE1   1 
ATOM   5578  O  OE2   . GLU H 4 41  ? 8.721   36.256 -30.541 1.00 46.25  ? 68  GLU H OE2   1 
ATOM   5579  N  N     . ARG H 4 42  ? 12.759  40.228 -31.340 1.00 16.68  ? 69  ARG H N     1 
ATOM   5580  C  CA    . ARG H 4 42  ? 14.055  40.434 -31.977 1.00 17.23  ? 69  ARG H CA    1 
ATOM   5581  C  C     . ARG H 4 42  ? 14.924  41.375 -31.119 1.00 19.37  ? 69  ARG H C     1 
ATOM   5582  O  O     . ARG H 4 42  ? 16.085  41.069 -30.830 1.00 19.95  ? 69  ARG H O     1 
ATOM   5583  C  CB    . ARG H 4 42  ? 13.866  41.037 -33.362 1.00 16.81  ? 69  ARG H CB    1 
ATOM   5584  C  CG    . ARG H 4 42  ? 13.478  40.038 -34.409 1.00 16.78  ? 69  ARG H CG    1 
ATOM   5585  C  CD    . ARG H 4 42  ? 13.797  40.628 -35.744 1.00 19.39  ? 69  ARG H CD    1 
ATOM   5586  N  NE    . ARG H 4 42  ? 12.826  40.280 -36.779 1.00 21.03  ? 69  ARG H NE    1 
ATOM   5587  C  CZ    . ARG H 4 42  ? 12.945  40.617 -38.062 1.00 22.84  ? 69  ARG H CZ    1 
ATOM   5588  N  NH1   . ARG H 4 42  ? 14.012  41.280 -38.485 1.00 21.91  ? 69  ARG H NH1   1 
ATOM   5589  N  NH2   . ARG H 4 42  ? 12.030  40.239 -38.941 1.00 23.57  ? 69  ARG H NH2   1 
ATOM   5590  N  N     . ILE H 4 43  ? 14.334  42.490 -30.662 1.00 20.18  ? 70  ILE H N     1 
ATOM   5591  C  CA    . ILE H 4 43  ? 15.028  43.470 -29.843 1.00 21.63  ? 70  ILE H CA    1 
ATOM   5592  C  C     . ILE H 4 43  ? 15.270  42.938 -28.448 1.00 22.99  ? 70  ILE H C     1 
ATOM   5593  O  O     . ILE H 4 43  ? 16.414  42.915 -28.009 1.00 23.23  ? 70  ILE H O     1 
ATOM   5594  C  CB    . ILE H 4 43  ? 14.318  44.857 -29.859 1.00 22.37  ? 70  ILE H CB    1 
ATOM   5595  C  CG1   . ILE H 4 43  ? 14.152  45.373 -31.307 1.00 22.89  ? 70  ILE H CG1   1 
ATOM   5596  C  CG2   . ILE H 4 43  ? 15.068  45.887 -29.000 1.00 23.04  ? 70  ILE H CG2   1 
ATOM   5597  C  CD1   . ILE H 4 43  ? 13.390  46.617 -31.412 1.00 23.93  ? 70  ILE H CD1   1 
ATOM   5598  N  N     . ALA H 4 44  ? 14.219  42.430 -27.783 1.00 23.79  ? 71  ALA H N     1 
ATOM   5599  C  CA    . ALA H 4 44  ? 14.314  41.884 -26.425 1.00 24.56  ? 71  ALA H CA    1 
ATOM   5600  C  C     . ALA H 4 44  ? 15.364  40.805 -26.305 1.00 25.19  ? 71  ALA H C     1 
ATOM   5601  O  O     . ALA H 4 44  ? 16.127  40.817 -25.350 1.00 25.67  ? 71  ALA H O     1 
ATOM   5602  C  CB    . ALA H 4 44  ? 12.963  41.363 -25.947 1.00 24.70  ? 71  ALA H CB    1 
ATOM   5603  N  N     . GLY H 4 45  ? 15.431  39.919 -27.285 1.00 25.42  ? 72  GLY H N     1 
ATOM   5604  C  CA    . GLY H 4 45  ? 16.394  38.829 -27.296 1.00 26.08  ? 72  GLY H CA    1 
ATOM   5605  C  C     . GLY H 4 45  ? 17.809  39.324 -27.463 1.00 26.79  ? 72  GLY H C     1 
ATOM   5606  O  O     . GLY H 4 45  ? 18.704  38.856 -26.766 1.00 26.48  ? 72  GLY H O     1 
ATOM   5607  N  N     . GLU H 4 46  ? 18.018  40.305 -28.352 1.00 27.74  ? 73  GLU H N     1 
ATOM   5608  C  CA    . GLU H 4 46  ? 19.347  40.879 -28.579 1.00 29.17  ? 73  GLU H CA    1 
ATOM   5609  C  C     . GLU H 4 46  ? 19.841  41.630 -27.327 1.00 30.63  ? 73  GLU H C     1 
ATOM   5610  O  O     . GLU H 4 46  ? 21.022  41.570 -26.979 1.00 30.85  ? 73  GLU H O     1 
ATOM   5611  C  CB    . GLU H 4 46  ? 19.330  41.807 -29.802 1.00 30.88  ? 73  GLU H CB    1 
ATOM   5612  C  CG    . GLU H 4 46  ? 20.695  42.367 -30.162 1.00 34.36  ? 73  GLU H CG    1 
ATOM   5613  C  CD    . GLU H 4 46  ? 21.755  41.332 -30.487 1.00 38.79  ? 73  GLU H CD    1 
ATOM   5614  O  OE1   . GLU H 4 46  ? 22.729  41.221 -29.708 1.00 38.56  ? 73  GLU H OE1   1 
ATOM   5615  O  OE2   . GLU H 4 46  ? 21.611  40.635 -31.519 1.00 40.54  ? 73  GLU H OE2   1 
ATOM   5616  N  N     . ALA H 4 47  ? 18.925  42.315 -26.643 1.00 31.16  ? 74  ALA H N     1 
ATOM   5617  C  CA    . ALA H 4 47  ? 19.228  43.017 -25.406 1.00 32.04  ? 74  ALA H CA    1 
ATOM   5618  C  C     . ALA H 4 47  ? 19.506  42.021 -24.280 1.00 33.08  ? 74  ALA H C     1 
ATOM   5619  O  O     . ALA H 4 47  ? 20.341  42.292 -23.425 1.00 33.86  ? 74  ALA H O     1 
ATOM   5620  C  CB    . ALA H 4 47  ? 18.064  43.902 -25.028 1.00 32.29  ? 74  ALA H CB    1 
ATOM   5621  N  N     . SER H 4 48  ? 18.814  40.879 -24.276 1.00 33.05  ? 75  SER H N     1 
ATOM   5622  C  CA    . SER H 4 48  ? 19.018  39.800 -23.313 1.00 34.00  ? 75  SER H CA    1 
ATOM   5623  C  C     . SER H 4 48  ? 20.443  39.242 -23.425 1.00 34.67  ? 75  SER H C     1 
ATOM   5624  O  O     . SER H 4 48  ? 21.036  38.853 -22.421 1.00 35.02  ? 75  SER H O     1 
ATOM   5625  C  CB    . SER H 4 48  ? 18.009  38.678 -23.562 1.00 35.22  ? 75  SER H CB    1 
ATOM   5626  O  OG    . SER H 4 48  ? 18.312  37.498 -22.834 1.00 37.21  ? 75  SER H OG    1 
ATOM   5627  N  N     . ARG H 4 49  ? 20.966  39.178 -24.653 1.00 34.68  ? 76  ARG H N     1 
ATOM   5628  C  CA    . ARG H 4 49  ? 22.285  38.678 -24.960 1.00 35.11  ? 76  ARG H CA    1 
ATOM   5629  C  C     . ARG H 4 49  ? 23.309  39.697 -24.556 1.00 36.71  ? 76  ARG H C     1 
ATOM   5630  O  O     . ARG H 4 49  ? 24.268  39.319 -23.926 1.00 36.84  ? 76  ARG H O     1 
ATOM   5631  C  CB    . ARG H 4 49  ? 22.388  38.404 -26.448 1.00 35.70  ? 76  ARG H CB    1 
ATOM   5632  C  CG    . ARG H 4 49  ? 22.756  36.996 -26.767 1.00 37.90  ? 76  ARG H CG    1 
ATOM   5633  C  CD    . ARG H 4 49  ? 22.486  36.732 -28.220 1.00 39.46  ? 76  ARG H CD    1 
ATOM   5634  N  NE    . ARG H 4 49  ? 21.069  36.465 -28.440 1.00 40.22  ? 76  ARG H NE    1 
ATOM   5635  C  CZ    . ARG H 4 49  ? 20.351  36.996 -29.417 1.00 41.23  ? 76  ARG H CZ    1 
ATOM   5636  N  NH1   . ARG H 4 49  ? 20.908  37.847 -30.273 1.00 40.97  ? 76  ARG H NH1   1 
ATOM   5637  N  NH2   . ARG H 4 49  ? 19.069  36.683 -29.549 1.00 40.81  ? 76  ARG H NH2   1 
ATOM   5638  N  N     . LEU H 4 50  ? 23.097  40.989 -24.877 1.00 37.90  ? 77  LEU H N     1 
ATOM   5639  C  CA    . LEU H 4 50  ? 23.991  42.100 -24.513 1.00 39.44  ? 77  LEU H CA    1 
ATOM   5640  C  C     . LEU H 4 50  ? 24.218  42.146 -22.997 1.00 40.91  ? 77  LEU H C     1 
ATOM   5641  O  O     . LEU H 4 50  ? 25.361  42.190 -22.540 1.00 40.55  ? 77  LEU H O     1 
ATOM   5642  C  CB    . LEU H 4 50  ? 23.371  43.428 -24.974 1.00 39.50  ? 77  LEU H CB    1 
ATOM   5643  C  CG    . LEU H 4 50  ? 23.519  43.734 -26.432 1.00 40.72  ? 77  LEU H CG    1 
ATOM   5644  C  CD1   . LEU H 4 50  ? 22.621  44.872 -26.831 1.00 41.54  ? 77  LEU H CD1   1 
ATOM   5645  C  CD2   . LEU H 4 50  ? 24.935  44.080 -26.741 1.00 40.85  ? 77  LEU H CD2   1 
ATOM   5646  N  N     . ALA H 4 51  ? 23.120  42.074 -22.218 1.00 42.27  ? 78  ALA H N     1 
ATOM   5647  C  CA    . ALA H 4 51  ? 23.164  42.078 -20.767 1.00 44.28  ? 78  ALA H CA    1 
ATOM   5648  C  C     . ALA H 4 51  ? 24.007  40.896 -20.273 1.00 46.87  ? 78  ALA H C     1 
ATOM   5649  O  O     . ALA H 4 51  ? 24.931  41.107 -19.496 1.00 46.88  ? 78  ALA H O     1 
ATOM   5650  C  CB    . ALA H 4 51  ? 21.757  42.028 -20.204 1.00 44.31  ? 78  ALA H CB    1 
ATOM   5651  N  N     . HIS H 4 52  ? 23.784  39.691 -20.853 1.00 48.97  ? 79  HIS H N     1 
ATOM   5652  C  CA    . HIS H 4 52  ? 24.528  38.458 -20.568 1.00 51.30  ? 79  HIS H CA    1 
ATOM   5653  C  C     . HIS H 4 52  ? 26.017  38.604 -20.882 1.00 51.55  ? 79  HIS H C     1 
ATOM   5654  O  O     . HIS H 4 52  ? 26.842  38.300 -20.034 1.00 51.67  ? 79  HIS H O     1 
ATOM   5655  C  CB    . HIS H 4 52  ? 23.974  37.276 -21.388 1.00 54.55  ? 79  HIS H CB    1 
ATOM   5656  C  CG    . HIS H 4 52  ? 22.809  36.558 -20.775 1.00 61.29  ? 79  HIS H CG    1 
ATOM   5657  N  ND1   . HIS H 4 52  ? 21.626  36.353 -21.487 1.00 64.30  ? 79  HIS H ND1   1 
ATOM   5658  C  CD2   . HIS H 4 52  ? 22.701  35.951 -19.568 1.00 63.39  ? 79  HIS H CD2   1 
ATOM   5659  C  CE1   . HIS H 4 52  ? 20.834  35.670 -20.680 1.00 65.02  ? 79  HIS H CE1   1 
ATOM   5660  N  NE2   . HIS H 4 52  ? 21.437  35.400 -19.514 1.00 64.91  ? 79  HIS H NE2   1 
ATOM   5661  N  N     . TYR H 4 53  ? 26.366  39.082 -22.087 1.00 51.73  ? 80  TYR H N     1 
ATOM   5662  C  CA    . TYR H 4 53  ? 27.753  39.233 -22.524 1.00 52.55  ? 80  TYR H CA    1 
ATOM   5663  C  C     . TYR H 4 53  ? 28.537  40.104 -21.571 1.00 53.35  ? 80  TYR H C     1 
ATOM   5664  O  O     . TYR H 4 53  ? 29.704  39.829 -21.321 1.00 53.84  ? 80  TYR H O     1 
ATOM   5665  C  CB    . TYR H 4 53  ? 27.839  39.895 -23.906 1.00 52.72  ? 80  TYR H CB    1 
ATOM   5666  C  CG    . TYR H 4 53  ? 27.268  39.117 -25.066 1.00 53.52  ? 80  TYR H CG    1 
ATOM   5667  C  CD1   . TYR H 4 53  ? 27.120  37.738 -25.003 1.00 54.28  ? 80  TYR H CD1   1 
ATOM   5668  C  CD2   . TYR H 4 53  ? 26.841  39.765 -26.214 1.00 54.46  ? 80  TYR H CD2   1 
ATOM   5669  C  CE1   . TYR H 4 53  ? 26.594  37.020 -26.071 1.00 55.15  ? 80  TYR H CE1   1 
ATOM   5670  C  CE2   . TYR H 4 53  ? 26.333  39.059 -27.294 1.00 55.47  ? 80  TYR H CE2   1 
ATOM   5671  C  CZ    . TYR H 4 53  ? 26.217  37.685 -27.225 1.00 56.33  ? 80  TYR H CZ    1 
ATOM   5672  O  OH    . TYR H 4 53  ? 25.720  37.005 -28.316 1.00 57.88  ? 80  TYR H OH    1 
ATOM   5673  N  N     . ASN H 4 54  ? 27.911  41.171 -21.060 1.00 53.41  ? 81  ASN H N     1 
ATOM   5674  C  CA    . ASN H 4 54  ? 28.591  42.102 -20.174 1.00 54.07  ? 81  ASN H CA    1 
ATOM   5675  C  C     . ASN H 4 54  ? 28.337  41.811 -18.690 1.00 54.33  ? 81  ASN H C     1 
ATOM   5676  O  O     . ASN H 4 54  ? 28.349  42.726 -17.872 1.00 54.36  ? 81  ASN H O     1 
ATOM   5677  C  CB    . ASN H 4 54  ? 28.240  43.548 -20.549 1.00 55.36  ? 81  ASN H CB    1 
ATOM   5678  C  CG    . ASN H 4 54  ? 28.421  43.853 -22.026 1.00 58.96  ? 81  ASN H CG    1 
ATOM   5679  O  OD1   . ASN H 4 54  ? 29.507  43.725 -22.611 1.00 59.98  ? 81  ASN H OD1   1 
ATOM   5680  N  ND2   . ASN H 4 54  ? 27.351  44.261 -22.670 1.00 60.25  ? 81  ASN H ND2   1 
ATOM   5681  N  N     . LYS H 4 55  ? 28.111  40.532 -18.351 1.00 54.46  ? 82  LYS H N     1 
ATOM   5682  C  CA    . LYS H 4 55  ? 27.878  40.038 -16.992 1.00 54.85  ? 82  LYS H CA    1 
ATOM   5683  C  C     . LYS H 4 55  ? 26.947  40.925 -16.161 1.00 55.25  ? 82  LYS H C     1 
ATOM   5684  O  O     . LYS H 4 55  ? 27.212  41.207 -14.993 1.00 55.18  ? 82  LYS H O     1 
ATOM   5685  C  CB    . LYS H 4 55  ? 29.208  39.795 -16.278 1.00 56.45  ? 82  LYS H CB    1 
ATOM   5686  C  CG    . LYS H 4 55  ? 30.061  38.739 -16.969 1.00 60.25  ? 82  LYS H CG    1 
ATOM   5687  C  CD    . LYS H 4 55  ? 31.509  38.823 -16.505 1.00 65.38  ? 82  LYS H CD    1 
ATOM   5688  C  CE    . LYS H 4 55  ? 32.462  37.889 -17.231 1.00 69.59  ? 82  LYS H CE    1 
ATOM   5689  N  NZ    . LYS H 4 55  ? 32.931  38.458 -18.535 1.00 71.91  ? 82  LYS H NZ    1 
ATOM   5690  N  N     . ARG H 4 56  ? 25.854  41.356 -16.774 1.00 55.42  ? 83  ARG H N     1 
ATOM   5691  C  CA    . ARG H 4 56  ? 24.885  42.203 -16.116 1.00 56.37  ? 83  ARG H CA    1 
ATOM   5692  C  C     . ARG H 4 56  ? 23.532  41.524 -15.943 1.00 55.97  ? 83  ARG H C     1 
ATOM   5693  O  O     . ARG H 4 56  ? 23.021  40.896 -16.873 1.00 56.22  ? 83  ARG H O     1 
ATOM   5694  C  CB    . ARG H 4 56  ? 24.755  43.526 -16.860 1.00 59.39  ? 83  ARG H CB    1 
ATOM   5695  C  CG    . ARG H 4 56  ? 25.624  44.596 -16.237 1.00 65.60  ? 83  ARG H CG    1 
ATOM   5696  C  CD    . ARG H 4 56  ? 26.070  45.640 -17.240 1.00 71.57  ? 83  ARG H CD    1 
ATOM   5697  N  NE    . ARG H 4 56  ? 26.912  46.657 -16.608 1.00 76.99  ? 83  ARG H NE    1 
ATOM   5698  C  CZ    . ARG H 4 56  ? 28.231  46.554 -16.454 1.00 81.35  ? 83  ARG H CZ    1 
ATOM   5699  N  NH1   . ARG H 4 56  ? 28.880  45.485 -16.910 1.00 81.45  ? 83  ARG H NH1   1 
ATOM   5700  N  NH2   . ARG H 4 56  ? 28.915  47.529 -15.866 1.00 82.27  ? 83  ARG H NH2   1 
ATOM   5701  N  N     . SER H 4 57  ? 22.950  41.664 -14.741 1.00 55.16  ? 84  SER H N     1 
ATOM   5702  C  CA    . SER H 4 57  ? 21.663  41.072 -14.354 1.00 54.81  ? 84  SER H CA    1 
ATOM   5703  C  C     . SER H 4 57  ? 20.421  41.825 -14.851 1.00 53.58  ? 84  SER H C     1 
ATOM   5704  O  O     . SER H 4 57  ? 19.308  41.364 -14.601 1.00 53.70  ? 84  SER H O     1 
ATOM   5705  C  CB    . SER H 4 57  ? 21.581  40.975 -12.833 1.00 56.61  ? 84  SER H CB    1 
ATOM   5706  O  OG    . SER H 4 57  ? 21.357  39.645 -12.392 1.00 59.73  ? 84  SER H OG    1 
ATOM   5707  N  N     . THR H 4 58  ? 20.593  42.998 -15.488 1.00 52.06  ? 85  THR H N     1 
ATOM   5708  C  CA    . THR H 4 58  ? 19.467  43.826 -15.896 1.00 50.93  ? 85  THR H CA    1 
ATOM   5709  C  C     . THR H 4 58  ? 19.474  44.258 -17.366 1.00 48.70  ? 85  THR H C     1 
ATOM   5710  O  O     . THR H 4 58  ? 20.532  44.518 -17.940 1.00 48.40  ? 85  THR H O     1 
ATOM   5711  C  CB    . THR H 4 58  ? 19.480  45.095 -15.033 1.00 53.40  ? 85  THR H CB    1 
ATOM   5712  O  OG1   . THR H 4 58  ? 20.708  45.789 -15.276 1.00 55.30  ? 85  THR H OG1   1 
ATOM   5713  C  CG2   . THR H 4 58  ? 19.391  44.802 -13.541 1.00 53.88  ? 85  THR H CG2   1 
ATOM   5714  N  N     . ILE H 4 59  ? 18.276  44.404 -17.952 1.00 47.16  ? 86  ILE H N     1 
ATOM   5715  C  CA    . ILE H 4 59  ? 18.132  44.939 -19.303 1.00 46.27  ? 86  ILE H CA    1 
ATOM   5716  C  C     . ILE H 4 59  ? 17.707  46.391 -19.121 1.00 45.68  ? 86  ILE H C     1 
ATOM   5717  O  O     . ILE H 4 59  ? 16.556  46.636 -18.785 1.00 45.92  ? 86  ILE H O     1 
ATOM   5718  C  CB    . ILE H 4 59  ? 17.082  44.177 -20.168 1.00 46.29  ? 86  ILE H CB    1 
ATOM   5719  C  CG1   . ILE H 4 59  ? 17.623  42.827 -20.644 1.00 46.69  ? 86  ILE H CG1   1 
ATOM   5720  C  CG2   . ILE H 4 59  ? 16.649  45.015 -21.391 1.00 46.76  ? 86  ILE H CG2   1 
ATOM   5721  C  CD1   . ILE H 4 59  ? 16.608  41.988 -21.359 1.00 47.23  ? 86  ILE H CD1   1 
ATOM   5722  N  N     . THR H 4 60  ? 18.613  47.346 -19.326 1.00 44.67  ? 87  THR H N     1 
ATOM   5723  C  CA    . THR H 4 60  ? 18.263  48.767 -19.231 1.00 44.10  ? 87  THR H CA    1 
ATOM   5724  C  C     . THR H 4 60  ? 18.027  49.344 -20.650 1.00 42.80  ? 87  THR H C     1 
ATOM   5725  O  O     . THR H 4 60  ? 18.286  48.654 -21.641 1.00 43.57  ? 87  THR H O     1 
ATOM   5726  C  CB    . THR H 4 60  ? 19.341  49.516 -18.454 1.00 45.67  ? 87  THR H CB    1 
ATOM   5727  O  OG1   . THR H 4 60  ? 20.539  49.541 -19.235 1.00 46.79  ? 87  THR H OG1   1 
ATOM   5728  C  CG2   . THR H 4 60  ? 19.597  48.900 -17.094 1.00 46.36  ? 87  THR H CG2   1 
ATOM   5729  N  N     . SER H 4 61  ? 17.533  50.581 -20.763 1.00 40.69  ? 88  SER H N     1 
ATOM   5730  C  CA    . SER H 4 61  ? 17.324  51.198 -22.074 1.00 39.52  ? 88  SER H CA    1 
ATOM   5731  C  C     . SER H 4 61  ? 18.622  51.312 -22.925 1.00 37.93  ? 88  SER H C     1 
ATOM   5732  O  O     . SER H 4 61  ? 18.552  51.522 -24.133 1.00 38.03  ? 88  SER H O     1 
ATOM   5733  C  CB    . SER H 4 61  ? 16.634  52.547 -21.926 1.00 40.74  ? 88  SER H CB    1 
ATOM   5734  O  OG    . SER H 4 61  ? 17.213  53.307 -20.878 1.00 43.22  ? 88  SER H OG    1 
ATOM   5735  N  N     . ARG H 4 62  ? 19.788  51.146 -22.304 1.00 36.40  ? 89  ARG H N     1 
ATOM   5736  C  CA    . ARG H 4 62  ? 21.070  51.160 -22.995 1.00 35.95  ? 89  ARG H CA    1 
ATOM   5737  C  C     . ARG H 4 62  ? 21.240  49.845 -23.820 1.00 35.35  ? 89  ARG H C     1 
ATOM   5738  O  O     . ARG H 4 62  ? 21.861  49.844 -24.894 1.00 35.53  ? 89  ARG H O     1 
ATOM   5739  C  CB    . ARG H 4 62  ? 22.182  51.330 -21.953 1.00 37.70  ? 89  ARG H CB    1 
ATOM   5740  C  CG    . ARG H 4 62  ? 23.580  51.073 -22.475 1.00 42.23  ? 89  ARG H CG    1 
ATOM   5741  C  CD    . ARG H 4 62  ? 24.628  51.749 -21.623 1.00 46.45  ? 89  ARG H CD    1 
ATOM   5742  N  NE    . ARG H 4 62  ? 25.690  52.304 -22.467 1.00 49.36  ? 89  ARG H NE    1 
ATOM   5743  C  CZ    . ARG H 4 62  ? 26.827  51.678 -22.749 1.00 50.61  ? 89  ARG H CZ    1 
ATOM   5744  N  NH1   . ARG H 4 62  ? 27.090  50.490 -22.213 1.00 49.15  ? 89  ARG H NH1   1 
ATOM   5745  N  NH2   . ARG H 4 62  ? 27.727  52.249 -23.544 1.00 50.41  ? 89  ARG H NH2   1 
ATOM   5746  N  N     . GLU H 4 63  ? 20.693  48.723 -23.300 1.00 33.94  ? 90  GLU H N     1 
ATOM   5747  C  CA    . GLU H 4 63  ? 20.689  47.419 -23.959 1.00 32.42  ? 90  GLU H CA    1 
ATOM   5748  C  C     . GLU H 4 63  ? 19.687  47.465 -25.122 1.00 30.45  ? 90  GLU H C     1 
ATOM   5749  O  O     . GLU H 4 63  ? 20.000  47.011 -26.215 1.00 30.22  ? 90  GLU H O     1 
ATOM   5750  C  CB    . GLU H 4 63  ? 20.314  46.323 -22.957 1.00 34.38  ? 90  GLU H CB    1 
ATOM   5751  C  CG    . GLU H 4 63  ? 21.486  45.790 -22.149 1.00 38.70  ? 90  GLU H CG    1 
ATOM   5752  C  CD    . GLU H 4 63  ? 22.165  46.750 -21.189 1.00 41.94  ? 90  GLU H CD    1 
ATOM   5753  O  OE1   . GLU H 4 63  ? 21.562  47.101 -20.148 1.00 41.70  ? 90  GLU H OE1   1 
ATOM   5754  O  OE2   . GLU H 4 63  ? 23.309  47.158 -21.487 1.00 42.99  ? 90  GLU H OE2   1 
ATOM   5755  N  N     . ILE H 4 64  ? 18.507  48.076 -24.907 1.00 29.01  ? 91  ILE H N     1 
ATOM   5756  C  CA    . ILE H 4 64  ? 17.502  48.249 -25.954 1.00 28.14  ? 91  ILE H CA    1 
ATOM   5757  C  C     . ILE H 4 64  ? 18.091  49.089 -27.085 1.00 27.65  ? 91  ILE H C     1 
ATOM   5758  O  O     . ILE H 4 64  ? 17.990  48.709 -28.241 1.00 27.68  ? 91  ILE H O     1 
ATOM   5759  C  CB    . ILE H 4 64  ? 16.206  48.916 -25.409 1.00 27.90  ? 91  ILE H CB    1 
ATOM   5760  C  CG1   . ILE H 4 64  ? 15.553  48.093 -24.292 1.00 28.38  ? 91  ILE H CG1   1 
ATOM   5761  C  CG2   . ILE H 4 64  ? 15.223  49.196 -26.531 1.00 28.09  ? 91  ILE H CG2   1 
ATOM   5762  C  CD1   . ILE H 4 64  ? 14.894  46.785 -24.735 1.00 29.22  ? 91  ILE H CD1   1 
ATOM   5763  N  N     . GLN H 4 65  ? 18.757  50.178 -26.749 1.00 27.18  ? 92  GLN H N     1 
ATOM   5764  C  CA    . GLN H 4 65  ? 19.324  51.066 -27.754 1.00 27.40  ? 92  GLN H CA    1 
ATOM   5765  C  C     . GLN H 4 65  ? 20.379  50.392 -28.649 1.00 27.68  ? 92  GLN H C     1 
ATOM   5766  O  O     . GLN H 4 65  ? 20.298  50.547 -29.873 1.00 27.78  ? 92  GLN H O     1 
ATOM   5767  C  CB    . GLN H 4 65  ? 19.856  52.344 -27.105 1.00 28.07  ? 92  GLN H CB    1 
ATOM   5768  C  CG    . GLN H 4 65  ? 20.272  53.413 -28.090 1.00 28.52  ? 92  GLN H CG    1 
ATOM   5769  C  CD    . GLN H 4 65  ? 20.782  54.598 -27.340 1.00 29.69  ? 92  GLN H CD    1 
ATOM   5770  O  OE1   . GLN H 4 65  ? 20.060  55.240 -26.575 1.00 30.64  ? 92  GLN H OE1   1 
ATOM   5771  N  NE2   . GLN H 4 65  ? 22.051  54.885 -27.520 1.00 29.35  ? 92  GLN H NE2   1 
ATOM   5772  N  N     . THR H 4 66  ? 21.345  49.648 -28.071 1.00 27.66  ? 93  THR H N     1 
ATOM   5773  C  CA    . THR H 4 66  ? 22.360  48.988 -28.905 1.00 28.57  ? 93  THR H CA    1 
ATOM   5774  C  C     . THR H 4 66  ? 21.764  47.822 -29.670 1.00 29.69  ? 93  THR H C     1 
ATOM   5775  O  O     . THR H 4 66  ? 22.222  47.556 -30.780 1.00 30.37  ? 93  THR H O     1 
ATOM   5776  C  CB    . THR H 4 66  ? 23.641  48.623 -28.156 1.00 29.75  ? 93  THR H CB    1 
ATOM   5777  O  OG1   . THR H 4 66  ? 23.326  48.315 -26.803 1.00 30.86  ? 93  THR H OG1   1 
ATOM   5778  C  CG2   . THR H 4 66  ? 24.672  49.742 -28.200 1.00 30.20  ? 93  THR H CG2   1 
ATOM   5779  N  N     . ALA H 4 67  ? 20.699  47.174 -29.135 1.00 29.41  ? 94  ALA H N     1 
ATOM   5780  C  CA    . ALA H 4 67  ? 19.995  46.113 -29.843 1.00 29.10  ? 94  ALA H CA    1 
ATOM   5781  C  C     . ALA H 4 67  ? 19.352  46.712 -31.107 1.00 29.40  ? 94  ALA H C     1 
ATOM   5782  O  O     . ALA H 4 67  ? 19.473  46.123 -32.178 1.00 30.02  ? 94  ALA H O     1 
ATOM   5783  C  CB    . ALA H 4 67  ? 18.927  45.515 -28.954 1.00 28.99  ? 94  ALA H CB    1 
ATOM   5784  N  N     . VAL H 4 68  ? 18.750  47.931 -30.995 1.00 28.32  ? 95  VAL H N     1 
ATOM   5785  C  CA    . VAL H 4 68  ? 18.146  48.647 -32.116 1.00 27.72  ? 95  VAL H CA    1 
ATOM   5786  C  C     . VAL H 4 68  ? 19.224  48.932 -33.152 1.00 28.12  ? 95  VAL H C     1 
ATOM   5787  O  O     . VAL H 4 68  ? 19.049  48.633 -34.326 1.00 28.33  ? 95  VAL H O     1 
ATOM   5788  C  CB    . VAL H 4 68  ? 17.427  49.945 -31.665 1.00 27.64  ? 95  VAL H CB    1 
ATOM   5789  C  CG1   . VAL H 4 68  ? 17.032  50.798 -32.855 1.00 27.91  ? 95  VAL H CG1   1 
ATOM   5790  C  CG2   . VAL H 4 68  ? 16.201  49.635 -30.830 1.00 28.00  ? 95  VAL H CG2   1 
ATOM   5791  N  N     . ARG H 4 69  ? 20.365  49.442 -32.707 1.00 28.34  ? 96  ARG H N     1 
ATOM   5792  C  CA    . ARG H 4 69  ? 21.479  49.744 -33.599 1.00 29.09  ? 96  ARG H CA    1 
ATOM   5793  C  C     . ARG H 4 69  ? 22.023  48.526 -34.330 1.00 28.49  ? 96  ARG H C     1 
ATOM   5794  O  O     . ARG H 4 69  ? 22.586  48.674 -35.416 1.00 29.12  ? 96  ARG H O     1 
ATOM   5795  C  CB    . ARG H 4 69  ? 22.610  50.438 -32.842 1.00 31.63  ? 96  ARG H CB    1 
ATOM   5796  C  CG    . ARG H 4 69  ? 22.263  51.840 -32.410 1.00 36.86  ? 96  ARG H CG    1 
ATOM   5797  C  CD    . ARG H 4 69  ? 23.515  52.677 -32.282 1.00 42.74  ? 96  ARG H CD    1 
ATOM   5798  N  NE    . ARG H 4 69  ? 23.217  54.086 -32.002 1.00 48.28  ? 96  ARG H NE    1 
ATOM   5799  C  CZ    . ARG H 4 69  ? 23.190  54.618 -30.781 1.00 51.10  ? 96  ARG H CZ    1 
ATOM   5800  N  NH1   . ARG H 4 69  ? 23.426  53.860 -29.711 1.00 50.89  ? 96  ARG H NH1   1 
ATOM   5801  N  NH2   . ARG H 4 69  ? 22.922  55.908 -30.619 1.00 50.59  ? 96  ARG H NH2   1 
ATOM   5802  N  N     . LEU H 4 70  ? 21.880  47.335 -33.742 1.00 27.00  ? 97  LEU H N     1 
ATOM   5803  C  CA    . LEU H 4 70  ? 22.365  46.114 -34.362 1.00 26.14  ? 97  LEU H CA    1 
ATOM   5804  C  C     . LEU H 4 70  ? 21.355  45.527 -35.321 1.00 26.83  ? 97  LEU H C     1 
ATOM   5805  O  O     . LEU H 4 70  ? 21.754  44.999 -36.350 1.00 27.09  ? 97  LEU H O     1 
ATOM   5806  C  CB    . LEU H 4 70  ? 22.714  45.068 -33.299 1.00 25.06  ? 97  LEU H CB    1 
ATOM   5807  C  CG    . LEU H 4 70  ? 23.947  45.327 -32.458 1.00 25.26  ? 97  LEU H CG    1 
ATOM   5808  C  CD1   . LEU H 4 70  ? 23.975  44.418 -31.294 1.00 25.62  ? 97  LEU H CD1   1 
ATOM   5809  C  CD2   . LEU H 4 70  ? 25.208  45.149 -33.250 1.00 25.53  ? 97  LEU H CD2   1 
ATOM   5810  N  N     . LEU H 4 71  ? 20.054  45.608 -35.004 1.00 27.26  ? 98  LEU H N     1 
ATOM   5811  C  CA    . LEU H 4 71  ? 19.002  44.937 -35.790 1.00 28.13  ? 98  LEU H CA    1 
ATOM   5812  C  C     . LEU H 4 71  ? 18.364  45.727 -36.940 1.00 27.87  ? 98  LEU H C     1 
ATOM   5813  O  O     . LEU H 4 71  ? 18.087  45.152 -38.013 1.00 28.14  ? 98  LEU H O     1 
ATOM   5814  C  CB    . LEU H 4 71  ? 17.892  44.453 -34.853 1.00 28.94  ? 98  LEU H CB    1 
ATOM   5815  C  CG    . LEU H 4 71  ? 18.361  43.511 -33.743 1.00 31.44  ? 98  LEU H CG    1 
ATOM   5816  C  CD1   . LEU H 4 71  ? 17.374  43.478 -32.630 1.00 32.36  ? 98  LEU H CD1   1 
ATOM   5817  C  CD2   . LEU H 4 71  ? 18.697  42.093 -34.268 1.00 32.04  ? 98  LEU H CD2   1 
ATOM   5818  N  N     . LEU H 4 72  ? 18.126  47.022 -36.708 1.00 26.83  ? 99  LEU H N     1 
ATOM   5819  C  CA    . LEU H 4 72  ? 17.504  47.903 -37.732 1.00 26.20  ? 99  LEU H CA    1 
ATOM   5820  C  C     . LEU H 4 72  ? 18.592  48.745 -38.408 1.00 27.61  ? 99  LEU H C     1 
ATOM   5821  O  O     . LEU H 4 72  ? 19.661  48.934 -37.794 1.00 27.52  ? 99  LEU H O     1 
ATOM   5822  C  CB    . LEU H 4 72  ? 16.461  48.797 -37.052 1.00 24.82  ? 99  LEU H CB    1 
ATOM   5823  C  CG    . LEU H 4 72  ? 15.425  48.065 -36.200 1.00 24.90  ? 99  LEU H CG    1 
ATOM   5824  C  CD1   . LEU H 4 72  ? 14.559  49.053 -35.434 1.00 25.13  ? 99  LEU H CD1   1 
ATOM   5825  C  CD2   . LEU H 4 72  ? 14.562  47.154 -37.059 1.00 25.73  ? 99  LEU H CD2   1 
ATOM   5826  N  N     . PRO H 4 73  ? 18.368  49.254 -39.641 1.00 28.82  ? 100 PRO H N     1 
ATOM   5827  C  CA    . PRO H 4 73  ? 19.361  50.074 -40.345 1.00 29.96  ? 100 PRO H CA    1 
ATOM   5828  C  C     . PRO H 4 73  ? 19.518  51.462 -39.706 1.00 31.80  ? 100 PRO H C     1 
ATOM   5829  O  O     . PRO H 4 73  ? 18.608  51.901 -39.023 1.00 32.21  ? 100 PRO H O     1 
ATOM   5830  C  CB    . PRO H 4 73  ? 18.783  50.231 -41.762 1.00 30.38  ? 100 PRO H CB    1 
ATOM   5831  C  CG    . PRO H 4 73  ? 17.691  49.185 -41.853 1.00 30.59  ? 100 PRO H CG    1 
ATOM   5832  C  CD    . PRO H 4 73  ? 17.163  49.049 -40.441 1.00 28.63  ? 100 PRO H CD    1 
ATOM   5833  N  N     . GLY H 4 74  ? 20.657  52.117 -39.958 1.00 32.37  ? 101 GLY H N     1 
ATOM   5834  C  CA    . GLY H 4 74  ? 20.939  53.458 -39.409 1.00 33.00  ? 101 GLY H CA    1 
ATOM   5835  C  C     . GLY H 4 74  ? 19.779  54.416 -39.620 1.00 33.58  ? 101 GLY H C     1 
ATOM   5836  O  O     . GLY H 4 74  ? 19.374  55.076 -38.642 1.00 34.59  ? 101 GLY H O     1 
ATOM   5837  N  N     . GLU H 4 75  ? 19.264  54.491 -40.852 1.00 32.41  ? 102 GLU H N     1 
ATOM   5838  C  CA    . GLU H 4 75  ? 18.124  55.390 -41.177 1.00 31.84  ? 102 GLU H CA    1 
ATOM   5839  C  C     . GLU H 4 75  ? 16.932  55.044 -40.277 1.00 30.73  ? 102 GLU H C     1 
ATOM   5840  O  O     . GLU H 4 75  ? 16.489  55.928 -39.518 1.00 30.68  ? 102 GLU H O     1 
ATOM   5841  C  CB    . GLU H 4 75  ? 17.752  55.266 -42.656 1.00 35.29  ? 102 GLU H CB    1 
ATOM   5842  C  CG    . GLU H 4 75  ? 17.965  56.548 -43.441 1.00 41.92  ? 102 GLU H CG    1 
ATOM   5843  C  CD    . GLU H 4 75  ? 18.412  57.733 -42.603 1.00 49.88  ? 102 GLU H CD    1 
ATOM   5844  O  OE1   . GLU H 4 75  ? 19.635  57.935 -42.473 1.00 51.72  ? 102 GLU H OE1   1 
ATOM   5845  O  OE2   . GLU H 4 75  ? 17.535  58.451 -42.082 1.00 52.31  ? 102 GLU H OE2   1 
ATOM   5846  N  N     . LEU H 4 76  ? 16.441  53.803 -40.366 1.00 30.00  ? 103 LEU H N     1 
ATOM   5847  C  CA    . LEU H 4 76  ? 15.306  53.358 -39.559 1.00 29.01  ? 103 LEU H CA    1 
ATOM   5848  C  C     . LEU H 4 76  ? 15.737  53.318 -38.086 1.00 28.28  ? 103 LEU H C     1 
ATOM   5849  O  O     . LEU H 4 76  ? 14.981  53.755 -37.218 1.00 28.01  ? 103 LEU H O     1 
ATOM   5850  C  CB    . LEU H 4 76  ? 14.892  51.968 -40.035 1.00 28.47  ? 103 LEU H CB    1 
ATOM   5851  C  CG    . LEU H 4 76  ? 13.432  51.756 -40.248 1.00 29.28  ? 103 LEU H CG    1 
ATOM   5852  C  CD1   . LEU H 4 76  ? 12.897  52.695 -41.313 1.00 29.37  ? 103 LEU H CD1   1 
ATOM   5853  C  CD2   . LEU H 4 76  ? 13.171  50.298 -40.636 1.00 30.07  ? 103 LEU H CD2   1 
ATOM   5854  N  N     . ALA H 4 77  ? 16.974  52.813 -37.830 1.00 27.61  ? 104 ALA H N     1 
ATOM   5855  C  CA    . ALA H 4 77  ? 17.606  52.726 -36.528 1.00 27.82  ? 104 ALA H CA    1 
ATOM   5856  C  C     . ALA H 4 77  ? 17.858  54.138 -36.010 1.00 29.51  ? 104 ALA H C     1 
ATOM   5857  O  O     . ALA H 4 77  ? 17.560  54.411 -34.853 1.00 30.16  ? 104 ALA H O     1 
ATOM   5858  C  CB    . ALA H 4 77  ? 18.925  51.980 -36.648 1.00 27.33  ? 104 ALA H CB    1 
ATOM   5859  N  N     . LYS H 4 78  ? 18.336  55.064 -36.880 1.00 29.56  ? 105 LYS H N     1 
ATOM   5860  C  CA    . LYS H 4 78  ? 18.635  56.425 -36.499 1.00 30.17  ? 105 LYS H CA    1 
ATOM   5861  C  C     . LYS H 4 78  ? 17.391  57.112 -35.971 1.00 29.92  ? 105 LYS H C     1 
ATOM   5862  O  O     . LYS H 4 78  ? 17.433  57.719 -34.907 1.00 29.98  ? 105 LYS H O     1 
ATOM   5863  C  CB    . LYS H 4 78  ? 19.218  57.182 -37.696 1.00 33.56  ? 105 LYS H CB    1 
ATOM   5864  C  CG    . LYS H 4 78  ? 19.882  58.508 -37.324 1.00 40.39  ? 105 LYS H CG    1 
ATOM   5865  C  CD    . LYS H 4 78  ? 20.272  59.334 -38.555 1.00 47.45  ? 105 LYS H CD    1 
ATOM   5866  C  CE    . LYS H 4 78  ? 21.649  58.968 -39.096 1.00 53.30  ? 105 LYS H CE    1 
ATOM   5867  N  NZ    . LYS H 4 78  ? 22.056  59.814 -40.265 1.00 56.53  ? 105 LYS H NZ    1 
ATOM   5868  N  N     . HIS H 4 79  ? 16.273  56.952 -36.669 1.00 29.84  ? 106 HIS H N     1 
ATOM   5869  C  CA    . HIS H 4 79  ? 15.024  57.567 -36.257 1.00 30.68  ? 106 HIS H CA    1 
ATOM   5870  C  C     . HIS H 4 79  ? 14.359  56.847 -35.060 1.00 29.86  ? 106 HIS H C     1 
ATOM   5871  O  O     . HIS H 4 79  ? 13.659  57.492 -34.269 1.00 30.10  ? 106 HIS H O     1 
ATOM   5872  C  CB    . HIS H 4 79  ? 14.068  57.710 -37.453 1.00 32.89  ? 106 HIS H CB    1 
ATOM   5873  C  CG    . HIS H 4 79  ? 14.594  58.557 -38.581 1.00 37.50  ? 106 HIS H CG    1 
ATOM   5874  N  ND1   . HIS H 4 79  ? 14.570  58.108 -39.895 1.00 40.21  ? 106 HIS H ND1   1 
ATOM   5875  C  CD2   . HIS H 4 79  ? 15.122  59.805 -38.563 1.00 38.94  ? 106 HIS H CD2   1 
ATOM   5876  C  CE1   . HIS H 4 79  ? 15.088  59.087 -40.627 1.00 40.64  ? 106 HIS H CE1   1 
ATOM   5877  N  NE2   . HIS H 4 79  ? 15.447  60.123 -39.871 1.00 40.25  ? 106 HIS H NE2   1 
ATOM   5878  N  N     . ALA H 4 80  ? 14.605  55.532 -34.903 1.00 28.41  ? 107 ALA H N     1 
ATOM   5879  C  CA    . ALA H 4 80  ? 14.051  54.774 -33.785 1.00 27.40  ? 107 ALA H CA    1 
ATOM   5880  C  C     . ALA H 4 80  ? 14.811  55.094 -32.498 1.00 26.70  ? 107 ALA H C     1 
ATOM   5881  O  O     . ALA H 4 80  ? 14.200  55.258 -31.445 1.00 26.24  ? 107 ALA H O     1 
ATOM   5882  C  CB    . ALA H 4 80  ? 14.111  53.296 -34.080 1.00 27.26  ? 107 ALA H CB    1 
ATOM   5883  N  N     . VAL H 4 81  ? 16.143  55.208 -32.591 1.00 26.59  ? 108 VAL H N     1 
ATOM   5884  C  CA    . VAL H 4 81  ? 17.017  55.592 -31.480 1.00 26.93  ? 108 VAL H CA    1 
ATOM   5885  C  C     . VAL H 4 81  ? 16.672  57.025 -31.014 1.00 27.73  ? 108 VAL H C     1 
ATOM   5886  O  O     . VAL H 4 81  ? 16.699  57.303 -29.814 1.00 27.36  ? 108 VAL H O     1 
ATOM   5887  C  CB    . VAL H 4 81  ? 18.506  55.404 -31.858 1.00 27.01  ? 108 VAL H CB    1 
ATOM   5888  C  CG1   . VAL H 4 81  ? 19.425  56.244 -30.994 1.00 27.31  ? 108 VAL H CG1   1 
ATOM   5889  C  CG2   . VAL H 4 81  ? 18.901  53.941 -31.780 1.00 27.20  ? 108 VAL H CG2   1 
ATOM   5890  N  N     . SER H 4 82  ? 16.290  57.906 -31.964 1.00 28.51  ? 109 SER H N     1 
ATOM   5891  C  CA    . SER H 4 82  ? 15.840  59.260 -31.686 1.00 29.85  ? 109 SER H CA    1 
ATOM   5892  C  C     . SER H 4 82  ? 14.500  59.188 -30.918 1.00 30.64  ? 109 SER H C     1 
ATOM   5893  O  O     . SER H 4 82  ? 14.431  59.531 -29.735 1.00 30.66  ? 109 SER H O     1 
ATOM   5894  C  CB    . SER H 4 82  ? 15.705  60.045 -32.996 1.00 32.02  ? 109 SER H CB    1 
ATOM   5895  O  OG    . SER H 4 82  ? 14.700  61.052 -32.977 1.00 34.73  ? 109 SER H OG    1 
ATOM   5896  N  N     . GLU H 4 83  ? 13.472  58.650 -31.589 1.00 31.26  ? 110 GLU H N     1 
ATOM   5897  C  CA    . GLU H 4 83  ? 12.131  58.471 -31.051 1.00 32.29  ? 110 GLU H CA    1 
ATOM   5898  C  C     . GLU H 4 83  ? 12.091  57.770 -29.684 1.00 31.99  ? 110 GLU H C     1 
ATOM   5899  O  O     . GLU H 4 83  ? 11.173  58.002 -28.890 1.00 32.18  ? 110 GLU H O     1 
ATOM   5900  C  CB    . GLU H 4 83  ? 11.282  57.719 -32.079 1.00 35.63  ? 110 GLU H CB    1 
ATOM   5901  C  CG    . GLU H 4 83  ? 10.385  58.633 -32.890 1.00 43.44  ? 110 GLU H CG    1 
ATOM   5902  C  CD    . GLU H 4 83  ? 9.032   58.855 -32.237 1.00 54.41  ? 110 GLU H CD    1 
ATOM   5903  O  OE1   . GLU H 4 83  ? 8.049   58.199 -32.662 1.00 56.19  ? 110 GLU H OE1   1 
ATOM   5904  O  OE2   . GLU H 4 83  ? 8.959   59.668 -31.283 1.00 57.89  ? 110 GLU H OE2   1 
ATOM   5905  N  N     . GLY H 4 84  ? 13.105  56.958 -29.425 1.00 31.49  ? 111 GLY H N     1 
ATOM   5906  C  CA    . GLY H 4 84  ? 13.263  56.200 -28.202 1.00 32.03  ? 111 GLY H CA    1 
ATOM   5907  C  C     . GLY H 4 84  ? 13.831  57.005 -27.058 1.00 32.36  ? 111 GLY H C     1 
ATOM   5908  O  O     . GLY H 4 84  ? 13.210  57.061 -25.997 1.00 32.09  ? 111 GLY H O     1 
ATOM   5909  N  N     . THR H 4 85  ? 15.017  57.623 -27.248 1.00 32.59  ? 112 THR H N     1 
ATOM   5910  C  CA    . THR H 4 85  ? 15.643  58.455 -26.203 1.00 33.56  ? 112 THR H CA    1 
ATOM   5911  C  C     . THR H 4 85  ? 14.741  59.613 -25.792 1.00 33.61  ? 112 THR H C     1 
ATOM   5912  O  O     . THR H 4 85  ? 14.737  60.006 -24.632 1.00 33.55  ? 112 THR H O     1 
ATOM   5913  C  CB    . THR H 4 85  ? 17.047  58.936 -26.602 1.00 35.40  ? 112 THR H CB    1 
ATOM   5914  O  OG1   . THR H 4 85  ? 17.027  59.367 -27.956 1.00 36.74  ? 112 THR H OG1   1 
ATOM   5915  C  CG2   . THR H 4 85  ? 18.107  57.856 -26.437 1.00 36.11  ? 112 THR H CG2   1 
ATOM   5916  N  N     . LYS H 4 86  ? 13.958  60.123 -26.743 1.00 33.91  ? 113 LYS H N     1 
ATOM   5917  C  CA    . LYS H 4 86  ? 12.988  61.179 -26.559 1.00 34.88  ? 113 LYS H CA    1 
ATOM   5918  C  C     . LYS H 4 86  ? 11.906  60.731 -25.554 1.00 36.39  ? 113 LYS H C     1 
ATOM   5919  O  O     . LYS H 4 86  ? 11.750  61.359 -24.511 1.00 36.69  ? 113 LYS H O     1 
ATOM   5920  C  CB    . LYS H 4 86  ? 12.405  61.550 -27.933 1.00 36.10  ? 113 LYS H CB    1 
ATOM   5921  C  CG    . LYS H 4 86  ? 11.159  62.418 -27.911 1.00 39.31  ? 113 LYS H CG    1 
ATOM   5922  C  CD    . LYS H 4 86  ? 10.821  62.779 -29.344 1.00 43.27  ? 113 LYS H CD    1 
ATOM   5923  C  CE    . LYS H 4 86  ? 9.519   63.495 -29.552 1.00 45.56  ? 113 LYS H CE    1 
ATOM   5924  N  NZ    . LYS H 4 86  ? 9.436   63.936 -30.964 1.00 46.33  ? 113 LYS H NZ    1 
ATOM   5925  N  N     . ALA H 4 87  ? 11.218  59.615 -25.824 1.00 37.25  ? 114 ALA H N     1 
ATOM   5926  C  CA    . ALA H 4 87  ? 10.184  59.073 -24.936 1.00 38.24  ? 114 ALA H CA    1 
ATOM   5927  C  C     . ALA H 4 87  ? 10.727  58.769 -23.529 1.00 38.86  ? 114 ALA H C     1 
ATOM   5928  O  O     . ALA H 4 87  ? 10.038  58.994 -22.536 1.00 38.52  ? 114 ALA H O     1 
ATOM   5929  C  CB    . ALA H 4 87  ? 9.583   57.815 -25.554 1.00 38.33  ? 114 ALA H CB    1 
ATOM   5930  N  N     . VAL H 4 88  ? 11.970  58.284 -23.451 1.00 39.60  ? 115 VAL H N     1 
ATOM   5931  C  CA    . VAL H 4 88  ? 12.634  57.982 -22.181 1.00 40.84  ? 115 VAL H CA    1 
ATOM   5932  C  C     . VAL H 4 88  ? 12.841  59.275 -21.398 1.00 41.19  ? 115 VAL H C     1 
ATOM   5933  O  O     . VAL H 4 88  ? 12.438  59.356 -20.239 1.00 41.56  ? 115 VAL H O     1 
ATOM   5934  C  CB    . VAL H 4 88  ? 13.954  57.178 -22.403 1.00 42.10  ? 115 VAL H CB    1 
ATOM   5935  C  CG1   . VAL H 4 88  ? 14.981  57.396 -21.288 1.00 42.79  ? 115 VAL H CG1   1 
ATOM   5936  C  CG2   . VAL H 4 88  ? 13.657  55.698 -22.571 1.00 42.68  ? 115 VAL H CG2   1 
ATOM   5937  N  N     . THR H 4 89  ? 13.416  60.300 -22.051 1.00 40.78  ? 116 THR H N     1 
ATOM   5938  C  CA    . THR H 4 89  ? 13.663  61.623 -21.480 1.00 40.59  ? 116 THR H CA    1 
ATOM   5939  C  C     . THR H 4 89  ? 12.371  62.207 -20.910 1.00 40.35  ? 116 THR H C     1 
ATOM   5940  O  O     . THR H 4 89  ? 12.337  62.543 -19.733 1.00 40.10  ? 116 THR H O     1 
ATOM   5941  C  CB    . THR H 4 89  ? 14.316  62.511 -22.550 1.00 41.68  ? 116 THR H CB    1 
ATOM   5942  O  OG1   . THR H 4 89  ? 15.692  62.153 -22.694 1.00 42.33  ? 116 THR H OG1   1 
ATOM   5943  C  CG2   . THR H 4 89  ? 14.212  63.968 -22.240 1.00 42.55  ? 116 THR H CG2   1 
ATOM   5944  N  N     . LYS H 4 90  ? 11.295  62.216 -21.715 1.00 40.63  ? 117 LYS H N     1 
ATOM   5945  C  CA    . LYS H 4 90  ? 9.974   62.705 -21.335 1.00 41.98  ? 117 LYS H CA    1 
ATOM   5946  C  C     . LYS H 4 90  ? 9.389   61.962 -20.120 1.00 45.59  ? 117 LYS H C     1 
ATOM   5947  O  O     . LYS H 4 90  ? 8.737   62.570 -19.266 1.00 45.87  ? 117 LYS H O     1 
ATOM   5948  C  CB    . LYS H 4 90  ? 9.027   62.623 -22.535 1.00 41.01  ? 117 LYS H CB    1 
ATOM   5949  C  CG    . LYS H 4 90  ? 7.653   63.196 -22.267 1.00 42.25  ? 117 LYS H CG    1 
ATOM   5950  C  CD    . LYS H 4 90  ? 7.048   63.817 -23.519 1.00 44.88  ? 117 LYS H CD    1 
ATOM   5951  C  CE    . LYS H 4 90  ? 5.784   64.614 -23.264 1.00 47.26  ? 117 LYS H CE    1 
ATOM   5952  N  NZ    . LYS H 4 90  ? 4.791   63.839 -22.472 1.00 48.80  ? 117 LYS H NZ    1 
ATOM   5953  N  N     . TYR H 4 91  ? 9.655   60.650 -20.031 1.00 48.26  ? 118 TYR H N     1 
ATOM   5954  C  CA    . TYR H 4 91  ? 9.201   59.797 -18.931 1.00 51.06  ? 118 TYR H CA    1 
ATOM   5955  C  C     . TYR H 4 91  ? 9.939   60.150 -17.627 1.00 53.60  ? 118 TYR H C     1 
ATOM   5956  O  O     . TYR H 4 91  ? 9.336   60.123 -16.552 1.00 53.60  ? 118 TYR H O     1 
ATOM   5957  C  CB    . TYR H 4 91  ? 9.409   58.313 -19.301 1.00 51.58  ? 118 TYR H CB    1 
ATOM   5958  C  CG    . TYR H 4 91  ? 8.969   57.323 -18.237 1.00 52.82  ? 118 TYR H CG    1 
ATOM   5959  C  CD1   . TYR H 4 91  ? 7.641   56.934 -18.127 1.00 53.95  ? 118 TYR H CD1   1 
ATOM   5960  C  CD2   . TYR H 4 91  ? 9.895   56.724 -17.389 1.00 53.67  ? 118 TYR H CD2   1 
ATOM   5961  C  CE1   . TYR H 4 91  ? 7.234   56.022 -17.158 1.00 54.93  ? 118 TYR H CE1   1 
ATOM   5962  C  CE2   . TYR H 4 91  ? 9.497   55.831 -16.401 1.00 54.57  ? 118 TYR H CE2   1 
ATOM   5963  C  CZ    . TYR H 4 91  ? 8.165   55.473 -16.295 1.00 55.85  ? 118 TYR H CZ    1 
ATOM   5964  O  OH    . TYR H 4 91  ? 7.761   54.579 -15.331 1.00 57.90  ? 118 TYR H OH    1 
ATOM   5965  N  N     . THR H 4 92  ? 11.243  60.465 -17.724 1.00 55.53  ? 119 THR H N     1 
ATOM   5966  C  CA    . THR H 4 92  ? 12.074  60.855 -16.576 1.00 57.92  ? 119 THR H CA    1 
ATOM   5967  C  C     . THR H 4 92  ? 11.627  62.238 -16.020 1.00 60.14  ? 119 THR H C     1 
ATOM   5968  O  O     . THR H 4 92  ? 11.723  62.494 -14.814 1.00 60.34  ? 119 THR H O     1 
ATOM   5969  C  CB    . THR H 4 92  ? 13.566  60.835 -16.974 1.00 59.33  ? 119 THR H CB    1 
ATOM   5970  O  OG1   . THR H 4 92  ? 13.882  59.581 -17.574 1.00 60.06  ? 119 THR H OG1   1 
ATOM   5971  C  CG2   . THR H 4 92  ? 14.496  61.073 -15.791 1.00 59.85  ? 119 THR H CG2   1 
ATOM   5972  N  N     . SER H 4 93  ? 11.131  63.114 -16.909 1.00 61.40  ? 120 SER H N     1 
ATOM   5973  C  CA    . SER H 4 93  ? 10.625  64.431 -16.550 1.00 63.09  ? 120 SER H CA    1 
ATOM   5974  C  C     . SER H 4 93  ? 9.356   64.274 -15.693 1.00 64.46  ? 120 SER H C     1 
ATOM   5975  O  O     . SER H 4 93  ? 9.276   64.856 -14.609 1.00 64.99  ? 120 SER H O     1 
ATOM   5976  C  CB    . SER H 4 93  ? 10.325  65.252 -17.803 1.00 64.50  ? 120 SER H CB    1 
ATOM   5977  O  OG    . SER H 4 93  ? 11.514  65.562 -18.517 1.00 66.94  ? 120 SER H OG    1 
ATOM   5978  N  N     . ALA H 4 94  ? 8.392   63.447 -16.143 1.00 64.74  ? 121 ALA H N     1 
ATOM   5979  C  CA    . ALA H 4 94  ? 7.154   63.232 -15.395 1.00 65.50  ? 121 ALA H CA    1 
ATOM   5980  C  C     . ALA H 4 94  ? 7.245   62.034 -14.453 1.00 66.06  ? 121 ALA H C     1 
ATOM   5981  O  O     . ALA H 4 94  ? 7.888   62.117 -13.407 1.00 66.26  ? 121 ALA H O     1 
ATOM   5982  C  CB    . ALA H 4 94  ? 5.993   63.054 -16.353 1.00 65.72  ? 121 ALA H CB    1 
ATOM   5983  O  "O5'" . DA  I 5 1   ? 48.809  4.903  -74.586 1.00 200.50 ? -72 DA  I "O5'" 1 
ATOM   5984  C  "C5'" . DA  I 5 1   ? 49.798  3.921  -74.281 1.00 200.53 ? -72 DA  I "C5'" 1 
ATOM   5985  C  "C4'" . DA  I 5 1   ? 50.456  3.400  -75.549 1.00 200.56 ? -72 DA  I "C4'" 1 
ATOM   5986  O  "O4'" . DA  I 5 1   ? 49.754  3.926  -76.706 1.00 200.56 ? -72 DA  I "O4'" 1 
ATOM   5987  C  "C3'" . DA  I 5 1   ? 51.912  3.812  -75.730 1.00 200.62 ? -72 DA  I "C3'" 1 
ATOM   5988  O  "O3'" . DA  I 5 1   ? 52.631  2.812  -76.461 1.00 200.67 ? -72 DA  I "O3'" 1 
ATOM   5989  C  "C2'" . DA  I 5 1   ? 51.784  5.103  -76.524 1.00 200.62 ? -72 DA  I "C2'" 1 
ATOM   5990  C  "C1'" . DA  I 5 1   ? 50.607  4.784  -77.438 1.00 200.59 ? -72 DA  I "C1'" 1 
ATOM   5991  N  N9    . DA  I 5 1   ? 49.844  5.963  -77.832 1.00 200.68 ? -72 DA  I N9    1 
ATOM   5992  C  C8    . DA  I 5 1   ? 48.553  6.259  -77.491 1.00 200.69 ? -72 DA  I C8    1 
ATOM   5993  N  N7    . DA  I 5 1   ? 48.119  7.391  -77.995 1.00 200.73 ? -72 DA  I N7    1 
ATOM   5994  C  C5    . DA  I 5 1   ? 49.201  7.871  -78.719 1.00 200.78 ? -72 DA  I C5    1 
ATOM   5995  C  C6    . DA  I 5 1   ? 49.389  9.039  -79.488 1.00 200.75 ? -72 DA  I C6    1 
ATOM   5996  N  N6    . DA  I 5 1   ? 48.439  9.965  -79.669 1.00 200.77 ? -72 DA  I N6    1 
ATOM   5997  N  N1    . DA  I 5 1   ? 50.590  9.209  -80.086 1.00 200.76 ? -72 DA  I N1    1 
ATOM   5998  C  C2    . DA  I 5 1   ? 51.535  8.278  -79.911 1.00 200.71 ? -72 DA  I C2    1 
ATOM   5999  N  N3    . DA  I 5 1   ? 51.480  7.150  -79.205 1.00 200.74 ? -72 DA  I N3    1 
ATOM   6000  C  C4    . DA  I 5 1   ? 50.273  7.004  -78.629 1.00 200.71 ? -72 DA  I C4    1 
ATOM   6001  P  P     . DT  I 5 2   ? 54.222  2.675  -76.286 1.00 200.73 ? -71 DT  I P     1 
ATOM   6002  O  OP1   . DT  I 5 2   ? 54.550  1.237  -76.174 1.00 200.75 ? -71 DT  I OP1   1 
ATOM   6003  O  OP2   . DT  I 5 2   ? 54.644  3.610  -75.219 1.00 200.80 ? -71 DT  I OP2   1 
ATOM   6004  O  "O5'" . DT  I 5 2   ? 54.794  3.228  -77.674 1.00 200.64 ? -71 DT  I "O5'" 1 
ATOM   6005  C  "C5'" . DT  I 5 2   ? 56.164  3.035  -78.002 1.00 200.59 ? -71 DT  I "C5'" 1 
ATOM   6006  C  "C4'" . DT  I 5 2   ? 56.896  4.363  -78.061 1.00 200.58 ? -71 DT  I "C4'" 1 
ATOM   6007  O  "O4'" . DT  I 5 2   ? 55.935  5.450  -78.013 1.00 200.55 ? -71 DT  I "O4'" 1 
ATOM   6008  C  "C3'" . DT  I 5 2   ? 57.882  4.611  -76.907 1.00 200.64 ? -71 DT  I "C3'" 1 
ATOM   6009  O  "O3'" . DT  I 5 2   ? 59.183  4.899  -77.417 1.00 200.72 ? -71 DT  I "O3'" 1 
ATOM   6010  C  "C2'" . DT  I 5 2   ? 57.292  5.813  -76.164 1.00 200.60 ? -71 DT  I "C2'" 1 
ATOM   6011  C  "C1'" . DT  I 5 2   ? 56.482  6.495  -77.253 1.00 200.53 ? -71 DT  I "C1'" 1 
ATOM   6012  N  N1    . DT  I 5 2   ? 55.373  7.378  -76.732 1.00 200.44 ? -71 DT  I N1    1 
ATOM   6013  C  C2    . DT  I 5 2   ? 55.124  8.571  -77.364 1.00 200.36 ? -71 DT  I C2    1 
ATOM   6014  O  O2    . DT  I 5 2   ? 55.704  8.921  -78.370 1.00 200.33 ? -71 DT  I O2    1 
ATOM   6015  N  N3    . DT  I 5 2   ? 54.138  9.330  -76.792 1.00 200.31 ? -71 DT  I N3    1 
ATOM   6016  C  C4    . DT  I 5 2   ? 53.415  9.038  -75.651 1.00 200.32 ? -71 DT  I C4    1 
ATOM   6017  O  O4    . DT  I 5 2   ? 52.564  9.828  -75.257 1.00 200.32 ? -71 DT  I O4    1 
ATOM   6018  C  C5    . DT  I 5 2   ? 53.749  7.788  -75.011 1.00 200.34 ? -71 DT  I C5    1 
ATOM   6019  C  C7    . DT  I 5 2   ? 53.027  7.359  -73.767 1.00 200.30 ? -71 DT  I C7    1 
ATOM   6020  C  C6    . DT  I 5 2   ? 54.709  7.034  -75.568 1.00 200.40 ? -71 DT  I C6    1 
ATOM   6021  P  P     . DC  I 5 3   ? 60.467  4.810  -76.456 1.00 200.74 ? -70 DC  I P     1 
ATOM   6022  O  OP1   . DC  I 5 3   ? 61.527  4.067  -77.178 1.00 200.83 ? -70 DC  I OP1   1 
ATOM   6023  O  OP2   . DC  I 5 3   ? 60.015  4.330  -75.127 1.00 200.75 ? -70 DC  I OP2   1 
ATOM   6024  O  "O5'" . DC  I 5 3   ? 60.907  6.349  -76.303 1.00 200.62 ? -70 DC  I "O5'" 1 
ATOM   6025  C  "C5'" . DC  I 5 3   ? 61.681  6.992  -77.324 1.00 200.51 ? -70 DC  I "C5'" 1 
ATOM   6026  C  "C4'" . DC  I 5 3   ? 61.303  8.456  -77.445 1.00 200.45 ? -70 DC  I "C4'" 1 
ATOM   6027  O  "O4'" . DC  I 5 3   ? 59.874  8.586  -77.297 1.00 200.49 ? -70 DC  I "O4'" 1 
ATOM   6028  C  "C3'" . DC  I 5 3   ? 61.886  9.363  -76.374 1.00 200.36 ? -70 DC  I "C3'" 1 
ATOM   6029  O  "O3'" . DC  I 5 3   ? 63.185  9.819  -76.767 1.00 200.17 ? -70 DC  I "O3'" 1 
ATOM   6030  C  "C2'" . DC  I 5 3   ? 60.877  10.516 -76.321 1.00 200.46 ? -70 DC  I "C2'" 1 
ATOM   6031  C  "C1'" . DC  I 5 3   ? 59.563  9.870  -76.793 1.00 200.57 ? -70 DC  I "C1'" 1 
ATOM   6032  N  N1    . DC  I 5 3   ? 58.528  9.728  -75.707 1.00 200.71 ? -70 DC  I N1    1 
ATOM   6033  C  C2    . DC  I 5 3   ? 57.368  10.516 -75.744 1.00 200.75 ? -70 DC  I C2    1 
ATOM   6034  O  O2    . DC  I 5 3   ? 57.203  11.308 -76.684 1.00 200.73 ? -70 DC  I O2    1 
ATOM   6035  N  N3    . DC  I 5 3   ? 56.446  10.374 -74.754 1.00 200.76 ? -70 DC  I N3    1 
ATOM   6036  C  C4    . DC  I 5 3   ? 56.659  9.508  -73.757 1.00 200.71 ? -70 DC  I C4    1 
ATOM   6037  N  N4    . DC  I 5 3   ? 55.728  9.407  -72.802 1.00 200.66 ? -70 DC  I N4    1 
ATOM   6038  C  C5    . DC  I 5 3   ? 57.832  8.699  -73.705 1.00 200.73 ? -70 DC  I C5    1 
ATOM   6039  C  C6    . DC  I 5 3   ? 58.733  8.846  -74.683 1.00 200.74 ? -70 DC  I C6    1 
ATOM   6040  P  P     . DT  I 5 4   ? 64.270  10.232 -75.658 1.00 199.99 ? -69 DT  I P     1 
ATOM   6041  O  OP1   . DT  I 5 4   ? 65.618  10.058 -76.247 1.00 199.99 ? -69 DT  I OP1   1 
ATOM   6042  O  OP2   . DT  I 5 4   ? 63.921  9.540  -74.397 1.00 199.97 ? -69 DT  I OP2   1 
ATOM   6043  O  "O5'" . DT  I 5 4   ? 63.999  11.794 -75.453 1.00 199.81 ? -69 DT  I "O5'" 1 
ATOM   6044  C  "C5'" . DT  I 5 4   ? 64.619  12.494 -74.375 1.00 199.62 ? -69 DT  I "C5'" 1 
ATOM   6045  C  "C4'" . DT  I 5 4   ? 63.831  13.747 -74.032 1.00 199.40 ? -69 DT  I "C4'" 1 
ATOM   6046  O  "O4'" . DT  I 5 4   ? 62.427  13.404 -73.872 1.00 199.39 ? -69 DT  I "O4'" 1 
ATOM   6047  C  "C3'" . DT  I 5 4   ? 64.245  14.449 -72.737 1.00 199.13 ? -69 DT  I "C3'" 1 
ATOM   6048  O  "O3'" . DT  I 5 4   ? 64.153  15.864 -72.905 1.00 198.76 ? -69 DT  I "O3'" 1 
ATOM   6049  C  "C2'" . DT  I 5 4   ? 63.223  13.930 -71.730 1.00 199.24 ? -69 DT  I "C2'" 1 
ATOM   6050  C  "C1'" . DT  I 5 4   ? 61.978  13.805 -72.595 1.00 199.32 ? -69 DT  I "C1'" 1 
ATOM   6051  N  N1    . DT  I 5 4   ? 60.999  12.792 -72.090 1.00 199.31 ? -69 DT  I N1    1 
ATOM   6052  C  C2    . DT  I 5 4   ? 59.800  13.220 -71.574 1.00 199.24 ? -69 DT  I C2    1 
ATOM   6053  O  O2    . DT  I 5 4   ? 59.474  14.393 -71.536 1.00 199.23 ? -69 DT  I O2    1 
ATOM   6054  N  N3    . DT  I 5 4   ? 58.979  12.219 -71.124 1.00 199.20 ? -69 DT  I N3    1 
ATOM   6055  C  C4    . DT  I 5 4   ? 59.241  10.860 -71.125 1.00 199.11 ? -69 DT  I C4    1 
ATOM   6056  O  O4    . DT  I 5 4   ? 58.403  10.083 -70.678 1.00 199.06 ? -69 DT  I O4    1 
ATOM   6057  C  C5    . DT  I 5 4   ? 60.525  10.479 -71.665 1.00 199.15 ? -69 DT  I C5    1 
ATOM   6058  C  C7    . DT  I 5 4   ? 60.925  9.034  -71.713 1.00 199.09 ? -69 DT  I C7    1 
ATOM   6059  C  C6    . DT  I 5 4   ? 61.335  11.452 -72.111 1.00 199.23 ? -69 DT  I C6    1 
ATOM   6060  P  P     . DT  I 5 5   ? 64.685  16.857 -71.766 1.00 198.39 ? -68 DT  I P     1 
ATOM   6061  O  OP1   . DT  I 5 5   ? 65.238  18.059 -72.433 1.00 198.34 ? -68 DT  I OP1   1 
ATOM   6062  O  OP2   . DT  I 5 5   ? 65.526  16.079 -70.826 1.00 198.33 ? -68 DT  I OP2   1 
ATOM   6063  O  "O5'" . DT  I 5 5   ? 63.338  17.265 -71.003 1.00 198.18 ? -68 DT  I "O5'" 1 
ATOM   6064  C  "C5'" . DT  I 5 5   ? 62.235  17.791 -71.744 1.00 197.88 ? -68 DT  I "C5'" 1 
ATOM   6065  C  "C4'" . DT  I 5 5   ? 61.039  18.059 -70.842 1.00 197.53 ? -68 DT  I "C4'" 1 
ATOM   6066  O  "O4'" . DT  I 5 5   ? 60.479  16.801 -70.387 1.00 197.37 ? -68 DT  I "O4'" 1 
ATOM   6067  C  "C3'" . DT  I 5 5   ? 61.339  18.884 -69.581 1.00 197.36 ? -68 DT  I "C3'" 1 
ATOM   6068  O  "O3'" . DT  I 5 5   ? 60.405  19.978 -69.467 1.00 197.20 ? -68 DT  I "O3'" 1 
ATOM   6069  C  "C2'" . DT  I 5 5   ? 61.167  17.872 -68.443 1.00 197.30 ? -68 DT  I "C2'" 1 
ATOM   6070  C  "C1'" . DT  I 5 5   ? 60.140  16.918 -69.031 1.00 197.26 ? -68 DT  I "C1'" 1 
ATOM   6071  N  N1    . DT  I 5 5   ? 60.161  15.563 -68.416 1.00 197.13 ? -68 DT  I N1    1 
ATOM   6072  C  C2    . DT  I 5 5   ? 59.104  15.169 -67.631 1.00 197.12 ? -68 DT  I C2    1 
ATOM   6073  O  O2    . DT  I 5 5   ? 58.126  15.868 -67.428 1.00 197.14 ? -68 DT  I O2    1 
ATOM   6074  N  N3    . DT  I 5 5   ? 59.222  13.913 -67.101 1.00 197.05 ? -68 DT  I N3    1 
ATOM   6075  C  C4    . DT  I 5 5   ? 60.277  13.035 -67.262 1.00 196.98 ? -68 DT  I C4    1 
ATOM   6076  O  O4    . DT  I 5 5   ? 60.237  11.937 -66.715 1.00 196.94 ? -68 DT  I O4    1 
ATOM   6077  C  C5    . DT  I 5 5   ? 61.360  13.516 -68.086 1.00 196.98 ? -68 DT  I C5    1 
ATOM   6078  C  C7    . DT  I 5 5   ? 62.561  12.652 -68.329 1.00 196.95 ? -68 DT  I C7    1 
ATOM   6079  C  C6    . DT  I 5 5   ? 61.256  14.746 -68.610 1.00 197.04 ? -68 DT  I C6    1 
ATOM   6080  P  P     . DA  I 5 6   ? 60.914  21.454 -69.076 1.00 196.96 ? -67 DA  I P     1 
ATOM   6081  O  OP1   . DA  I 5 6   ? 60.413  22.399 -70.104 1.00 196.96 ? -67 DA  I OP1   1 
ATOM   6082  O  OP2   . DA  I 5 6   ? 62.364  21.379 -68.787 1.00 196.96 ? -67 DA  I OP2   1 
ATOM   6083  O  "O5'" . DA  I 5 6   ? 60.153  21.748 -67.700 1.00 196.64 ? -67 DA  I "O5'" 1 
ATOM   6084  C  "C5'" . DA  I 5 6   ? 60.448  20.980 -66.544 1.00 196.35 ? -67 DA  I "C5'" 1 
ATOM   6085  C  "C4'" . DA  I 5 6   ? 59.191  20.735 -65.739 1.00 196.08 ? -67 DA  I "C4'" 1 
ATOM   6086  O  "O4'" . DA  I 5 6   ? 58.867  19.323 -65.750 1.00 195.91 ? -67 DA  I "O4'" 1 
ATOM   6087  C  "C3'" . DA  I 5 6   ? 59.276  21.149 -64.273 1.00 196.02 ? -67 DA  I "C3'" 1 
ATOM   6088  O  "O3'" . DA  I 5 6   ? 58.131  21.910 -63.926 1.00 196.10 ? -67 DA  I "O3'" 1 
ATOM   6089  C  "C2'" . DA  I 5 6   ? 59.322  19.818 -63.523 1.00 195.91 ? -67 DA  I "C2'" 1 
ATOM   6090  C  "C1'" . DA  I 5 6   ? 58.531  18.913 -64.450 1.00 195.82 ? -67 DA  I "C1'" 1 
ATOM   6091  N  N9    . DA  I 5 6   ? 58.875  17.506 -64.311 1.00 195.75 ? -67 DA  I N9    1 
ATOM   6092  C  C8    . DA  I 5 6   ? 60.112  16.984 -64.053 1.00 195.71 ? -67 DA  I C8    1 
ATOM   6093  N  N7    . DA  I 5 6   ? 60.128  15.675 -63.971 1.00 195.75 ? -67 DA  I N7    1 
ATOM   6094  C  C5    . DA  I 5 6   ? 58.807  15.312 -64.180 1.00 195.70 ? -67 DA  I C5    1 
ATOM   6095  C  C6    . DA  I 5 6   ? 58.160  14.060 -64.216 1.00 195.66 ? -67 DA  I C6    1 
ATOM   6096  N  N6    . DA  I 5 6   ? 58.793  12.895 -64.034 1.00 195.58 ? -67 DA  I N6    1 
ATOM   6097  N  N1    . DA  I 5 6   ? 56.832  14.050 -64.459 1.00 195.60 ? -67 DA  I N1    1 
ATOM   6098  C  C2    . DA  I 5 6   ? 56.202  15.217 -64.646 1.00 195.65 ? -67 DA  I C2    1 
ATOM   6099  N  N3    . DA  I 5 6   ? 56.702  16.453 -64.633 1.00 195.67 ? -67 DA  I N3    1 
ATOM   6100  C  C4    . DA  I 5 6   ? 58.021  16.430 -64.390 1.00 195.71 ? -67 DA  I C4    1 
ATOM   6101  P  P     . DG  I 5 7   ? 58.162  22.875 -62.652 1.00 196.12 ? -66 DG  I P     1 
ATOM   6102  O  OP1   . DG  I 5 7   ? 57.381  24.090 -62.982 1.00 196.09 ? -66 DG  I OP1   1 
ATOM   6103  O  OP2   . DG  I 5 7   ? 59.567  22.997 -62.202 1.00 196.15 ? -66 DG  I OP2   1 
ATOM   6104  O  "O5'" . DG  I 5 7   ? 57.364  22.022 -61.559 1.00 196.31 ? -66 DG  I "O5'" 1 
ATOM   6105  C  "C5'" . DG  I 5 7   ? 56.240  21.241 -61.960 1.00 196.39 ? -66 DG  I "C5'" 1 
ATOM   6106  C  "C4'" . DG  I 5 7   ? 55.979  20.111 -60.983 1.00 196.49 ? -66 DG  I "C4'" 1 
ATOM   6107  O  "O4'" . DG  I 5 7   ? 56.866  18.998 -61.265 1.00 196.61 ? -66 DG  I "O4'" 1 
ATOM   6108  C  "C3'" . DG  I 5 7   ? 56.189  20.469 -59.509 1.00 196.38 ? -66 DG  I "C3'" 1 
ATOM   6109  O  "O3'" . DG  I 5 7   ? 55.042  20.102 -58.758 1.00 196.06 ? -66 DG  I "O3'" 1 
ATOM   6110  C  "C2'" . DG  I 5 7   ? 57.415  19.646 -59.107 1.00 196.56 ? -66 DG  I "C2'" 1 
ATOM   6111  C  "C1'" . DG  I 5 7   ? 57.306  18.459 -60.046 1.00 196.76 ? -66 DG  I "C1'" 1 
ATOM   6112  N  N9    . DG  I 5 7   ? 58.573  17.769 -60.265 1.00 197.10 ? -66 DG  I N9    1 
ATOM   6113  C  C8    . DG  I 5 7   ? 59.831  18.325 -60.255 1.00 197.19 ? -66 DG  I C8    1 
ATOM   6114  N  N7    . DG  I 5 7   ? 60.784  17.456 -60.450 1.00 197.29 ? -66 DG  I N7    1 
ATOM   6115  C  C5    . DG  I 5 7   ? 60.118  16.241 -60.574 1.00 197.40 ? -66 DG  I C5    1 
ATOM   6116  C  C6    . DG  I 5 7   ? 60.629  14.936 -60.794 1.00 197.49 ? -66 DG  I C6    1 
ATOM   6117  O  O6    . DG  I 5 7   ? 61.811  14.585 -60.925 1.00 197.49 ? -66 DG  I O6    1 
ATOM   6118  N  N1    . DG  I 5 7   ? 59.608  13.987 -60.857 1.00 197.53 ? -66 DG  I N1    1 
ATOM   6119  C  C2    . DG  I 5 7   ? 58.265  14.264 -60.723 1.00 197.49 ? -66 DG  I C2    1 
ATOM   6120  N  N2    . DG  I 5 7   ? 57.431  13.216 -60.803 1.00 197.46 ? -66 DG  I N2    1 
ATOM   6121  N  N3    . DG  I 5 7   ? 57.774  15.481 -60.517 1.00 197.43 ? -66 DG  I N3    1 
ATOM   6122  C  C4    . DG  I 5 7   ? 58.756  16.417 -60.451 1.00 197.33 ? -66 DG  I C4    1 
ATOM   6123  P  P     . DG  I 5 8   ? 54.373  21.150 -57.751 1.00 195.73 ? -65 DG  I P     1 
ATOM   6124  O  OP1   . DG  I 5 8   ? 53.626  22.145 -58.554 1.00 195.64 ? -65 DG  I OP1   1 
ATOM   6125  O  OP2   . DG  I 5 8   ? 55.416  21.597 -56.801 1.00 195.70 ? -65 DG  I OP2   1 
ATOM   6126  O  "O5'" . DG  I 5 8   ? 53.332  20.243 -56.947 1.00 195.38 ? -65 DG  I "O5'" 1 
ATOM   6127  C  "C5'" . DG  I 5 8   ? 52.764  19.097 -57.570 1.00 195.08 ? -65 DG  I "C5'" 1 
ATOM   6128  C  "C4'" . DG  I 5 8   ? 53.151  17.823 -56.835 1.00 194.72 ? -65 DG  I "C4'" 1 
ATOM   6129  O  "O4'" . DG  I 5 8   ? 54.535  17.490 -57.119 1.00 194.78 ? -65 DG  I "O4'" 1 
ATOM   6130  C  "C3'" . DG  I 5 8   ? 53.030  17.873 -55.309 1.00 194.36 ? -65 DG  I "C3'" 1 
ATOM   6131  O  "O3'" . DG  I 5 8   ? 52.467  16.656 -54.847 1.00 193.82 ? -65 DG  I "O3'" 1 
ATOM   6132  C  "C2'" . DG  I 5 8   ? 54.484  18.019 -54.852 1.00 194.56 ? -65 DG  I "C2'" 1 
ATOM   6133  C  "C1'" . DG  I 5 8   ? 55.198  17.200 -55.910 1.00 194.75 ? -65 DG  I "C1'" 1 
ATOM   6134  N  N9    . DG  I 5 8   ? 56.612  17.527 -56.065 1.00 194.94 ? -65 DG  I N9    1 
ATOM   6135  C  C8    . DG  I 5 8   ? 57.228  18.722 -55.779 1.00 194.95 ? -65 DG  I C8    1 
ATOM   6136  N  N7    . DG  I 5 8   ? 58.503  18.726 -56.059 1.00 194.96 ? -65 DG  I N7    1 
ATOM   6137  C  C5    . DG  I 5 8   ? 58.753  17.442 -56.529 1.00 195.08 ? -65 DG  I C5    1 
ATOM   6138  C  C6    . DG  I 5 8   ? 59.961  16.845 -56.966 1.00 195.14 ? -65 DG  I C6    1 
ATOM   6139  O  O6    . DG  I 5 8   ? 61.089  17.354 -57.032 1.00 195.18 ? -65 DG  I O6    1 
ATOM   6140  N  N1    . DG  I 5 8   ? 59.772  15.520 -57.355 1.00 195.21 ? -65 DG  I N1    1 
ATOM   6141  C  C2    . DG  I 5 8   ? 58.568  14.857 -57.329 1.00 195.21 ? -65 DG  I C2    1 
ATOM   6142  N  N2    . DG  I 5 8   ? 58.580  13.582 -57.747 1.00 195.27 ? -65 DG  I N2    1 
ATOM   6143  N  N3    . DG  I 5 8   ? 57.430  15.405 -56.926 1.00 195.17 ? -65 DG  I N3    1 
ATOM   6144  C  C4    . DG  I 5 8   ? 57.598  16.693 -56.539 1.00 195.05 ? -65 DG  I C4    1 
ATOM   6145  P  P     . DG  I 5 9   ? 51.549  16.627 -53.540 1.00 193.33 ? -64 DG  I P     1 
ATOM   6146  O  OP1   . DG  I 5 9   ? 50.135  16.672 -53.976 1.00 193.29 ? -64 DG  I OP1   1 
ATOM   6147  O  OP2   . DG  I 5 9   ? 52.062  17.640 -52.590 1.00 193.30 ? -64 DG  I OP2   1 
ATOM   6148  O  "O5'" . DG  I 5 9   ? 51.860  15.181 -52.933 1.00 192.95 ? -64 DG  I "O5'" 1 
ATOM   6149  C  "C5'" . DG  I 5 9   ? 51.552  14.010 -53.690 1.00 192.59 ? -64 DG  I "C5'" 1 
ATOM   6150  C  "C4'" . DG  I 5 9   ? 52.614  12.934 -53.505 1.00 192.17 ? -64 DG  I "C4'" 1 
ATOM   6151  O  "O4'" . DG  I 5 9   ? 53.919  13.460 -53.856 1.00 192.15 ? -64 DG  I "O4'" 1 
ATOM   6152  C  "C3'" . DG  I 5 9   ? 52.745  12.369 -52.092 1.00 191.82 ? -64 DG  I "C3'" 1 
ATOM   6153  O  "O3'" . DG  I 5 9   ? 52.928  10.971 -52.158 1.00 191.36 ? -64 DG  I "O3'" 1 
ATOM   6154  C  "C2'" . DG  I 5 9   ? 53.989  13.068 -51.547 1.00 191.92 ? -64 DG  I "C2'" 1 
ATOM   6155  C  "C1'" . DG  I 5 9   ? 54.830  13.220 -52.804 1.00 192.04 ? -64 DG  I "C1'" 1 
ATOM   6156  N  N9    . DG  I 5 9   ? 55.767  14.338 -52.747 1.00 191.98 ? -64 DG  I N9    1 
ATOM   6157  C  C8    . DG  I 5 9   ? 55.544  15.580 -52.198 1.00 192.00 ? -64 DG  I C8    1 
ATOM   6158  N  N7    . DG  I 5 9   ? 56.565  16.385 -52.302 1.00 191.94 ? -64 DG  I N7    1 
ATOM   6159  C  C5    . DG  I 5 9   ? 57.525  15.629 -52.961 1.00 191.87 ? -64 DG  I C5    1 
ATOM   6160  C  C6    . DG  I 5 9   ? 58.831  15.976 -53.367 1.00 191.79 ? -64 DG  I C6    1 
ATOM   6161  O  O6    . DG  I 5 9   ? 59.426  17.048 -53.194 1.00 191.76 ? -64 DG  I O6    1 
ATOM   6162  N  N1    . DG  I 5 9   ? 59.472  14.914 -54.000 1.00 191.74 ? -64 DG  I N1    1 
ATOM   6163  C  C2    . DG  I 5 9   ? 58.905  13.684 -54.239 1.00 191.70 ? -64 DG  I C2    1 
ATOM   6164  N  N2    . DG  I 5 9   ? 59.667  12.793 -54.885 1.00 191.69 ? -64 DG  I N2    1 
ATOM   6165  N  N3    . DG  I 5 9   ? 57.678  13.350 -53.873 1.00 191.73 ? -64 DG  I N3    1 
ATOM   6166  C  C4    . DG  I 5 9   ? 57.046  14.370 -53.249 1.00 191.86 ? -64 DG  I C4    1 
ATOM   6167  P  P     . DT  I 5 10  ? 52.604  10.059 -50.892 1.00 191.03 ? -63 DT  I P     1 
ATOM   6168  O  OP1   . DT  I 5 10  ? 51.739  8.950  -51.346 1.00 191.00 ? -63 DT  I OP1   1 
ATOM   6169  O  OP2   . DT  I 5 10  ? 52.163  10.937 -49.787 1.00 190.92 ? -63 DT  I OP2   1 
ATOM   6170  O  "O5'" . DT  I 5 10  ? 54.038  9.476  -50.510 1.00 191.02 ? -63 DT  I "O5'" 1 
ATOM   6171  C  "C5'" . DT  I 5 10  ? 54.820  8.817  -51.499 1.00 191.00 ? -63 DT  I "C5'" 1 
ATOM   6172  C  "C4'" . DT  I 5 10  ? 56.275  8.718  -51.072 1.00 190.99 ? -63 DT  I "C4'" 1 
ATOM   6173  O  "O4'" . DT  I 5 10  ? 56.965  9.923  -51.441 1.00 190.88 ? -63 DT  I "O4'" 1 
ATOM   6174  C  "C3'" . DT  I 5 10  ? 56.506  8.582  -49.568 1.00 191.00 ? -63 DT  I "C3'" 1 
ATOM   6175  O  "O3'" . DT  I 5 10  ? 56.676  7.210  -49.214 1.00 191.14 ? -63 DT  I "O3'" 1 
ATOM   6176  C  "C2'" . DT  I 5 10  ? 57.785  9.394  -49.304 1.00 190.89 ? -63 DT  I "C2'" 1 
ATOM   6177  C  "C1'" . DT  I 5 10  ? 58.124  10.013 -50.659 1.00 190.79 ? -63 DT  I "C1'" 1 
ATOM   6178  N  N1    . DT  I 5 10  ? 58.518  11.432 -50.561 1.00 190.62 ? -63 DT  I N1    1 
ATOM   6179  C  C2    . DT  I 5 10  ? 59.823  11.778 -50.798 1.00 190.55 ? -63 DT  I C2    1 
ATOM   6180  O  O2    . DT  I 5 10  ? 60.667  10.977 -51.154 1.00 190.58 ? -63 DT  I O2    1 
ATOM   6181  N  N3    . DT  I 5 10  ? 60.095  13.111 -50.648 1.00 190.52 ? -63 DT  I N3    1 
ATOM   6182  C  C4    . DT  I 5 10  ? 59.213  14.104 -50.261 1.00 190.43 ? -63 DT  I C4    1 
ATOM   6183  O  O4    . DT  I 5 10  ? 59.611  15.255 -50.136 1.00 190.41 ? -63 DT  I O4    1 
ATOM   6184  C  C5    . DT  I 5 10  ? 57.872  13.659 -49.978 1.00 190.52 ? -63 DT  I C5    1 
ATOM   6185  C  C7    . DT  I 5 10  ? 56.829  14.643 -49.542 1.00 190.52 ? -63 DT  I C7    1 
ATOM   6186  C  C6    . DT  I 5 10  ? 57.595  12.359 -50.133 1.00 190.54 ? -63 DT  I C6    1 
ATOM   6187  P  P     . DT  I 5 11  ? 56.533  6.754  -47.683 1.00 191.17 ? -62 DT  I P     1 
ATOM   6188  O  OP1   . DT  I 5 11  ? 56.056  5.353  -47.667 1.00 191.18 ? -62 DT  I OP1   1 
ATOM   6189  O  OP2   . DT  I 5 11  ? 55.770  7.800  -46.966 1.00 191.22 ? -62 DT  I OP2   1 
ATOM   6190  O  "O5'" . DT  I 5 11  ? 58.044  6.797  -47.157 1.00 191.20 ? -62 DT  I "O5'" 1 
ATOM   6191  C  "C5'" . DT  I 5 11  ? 58.995  5.868  -47.661 1.00 191.22 ? -62 DT  I "C5'" 1 
ATOM   6192  C  "C4'" . DT  I 5 11  ? 60.393  6.452  -47.623 1.00 191.26 ? -62 DT  I "C4'" 1 
ATOM   6193  O  "O4'" . DT  I 5 11  ? 60.343  7.843  -48.009 1.00 191.30 ? -62 DT  I "O4'" 1 
ATOM   6194  C  "C3'" . DT  I 5 11  ? 61.074  6.409  -46.252 1.00 191.24 ? -62 DT  I "C3'" 1 
ATOM   6195  O  "O3'" . DT  I 5 11  ? 62.255  5.615  -46.311 1.00 191.17 ? -62 DT  I "O3'" 1 
ATOM   6196  C  "C2'" . DT  I 5 11  ? 61.396  7.874  -45.936 1.00 191.31 ? -62 DT  I "C2'" 1 
ATOM   6197  C  "C1'" . DT  I 5 11  ? 61.327  8.542  -47.302 1.00 191.38 ? -62 DT  I "C1'" 1 
ATOM   6198  N  N1    . DT  I 5 11  ? 60.930  9.977  -47.235 1.00 191.52 ? -62 DT  I N1    1 
ATOM   6199  C  C2    . DT  I 5 11  ? 61.723  10.924 -47.840 1.00 191.59 ? -62 DT  I C2    1 
ATOM   6200  O  O2    . DT  I 5 11  ? 62.724  10.649 -48.481 1.00 191.55 ? -62 DT  I O2    1 
ATOM   6201  N  N3    . DT  I 5 11  ? 61.281  12.214 -47.694 1.00 191.71 ? -62 DT  I N3    1 
ATOM   6202  C  C4    . DT  I 5 11  ? 60.164  12.643 -46.993 1.00 191.72 ? -62 DT  I C4    1 
ATOM   6203  O  O4    . DT  I 5 11  ? 59.901  13.842 -46.940 1.00 191.76 ? -62 DT  I O4    1 
ATOM   6204  C  C5    . DT  I 5 11  ? 59.394  11.600 -46.363 1.00 191.64 ? -62 DT  I C5    1 
ATOM   6205  C  C7    . DT  I 5 11  ? 58.166  11.944 -45.575 1.00 191.63 ? -62 DT  I C7    1 
ATOM   6206  C  C6    . DT  I 5 11  ? 59.817  10.335 -46.501 1.00 191.57 ? -62 DT  I C6    1 
ATOM   6207  P  P     . DA  I 5 12  ? 62.817  4.915  -44.985 1.00 191.07 ? -61 DA  I P     1 
ATOM   6208  O  OP1   . DA  I 5 12  ? 63.660  3.769  -45.399 1.00 191.06 ? -61 DA  I OP1   1 
ATOM   6209  O  OP2   . DA  I 5 12  ? 61.676  4.696  -44.070 1.00 191.07 ? -61 DA  I OP2   1 
ATOM   6210  O  "O5'" . DA  I 5 12  ? 63.748  6.055  -44.343 1.00 190.99 ? -61 DA  I "O5'" 1 
ATOM   6211  C  "C5'" . DA  I 5 12  ? 65.016  6.349  -44.919 1.00 190.91 ? -61 DA  I "C5'" 1 
ATOM   6212  C  "C4'" . DA  I 5 12  ? 65.532  7.705  -44.463 1.00 190.84 ? -61 DA  I "C4'" 1 
ATOM   6213  O  "O4'" . DA  I 5 12  ? 64.590  8.743  -44.812 1.00 190.82 ? -61 DA  I "O4'" 1 
ATOM   6214  C  "C3'" . DA  I 5 12  ? 65.787  7.856  -42.953 1.00 190.75 ? -61 DA  I "C3'" 1 
ATOM   6215  O  "O3'" . DA  I 5 12  ? 67.200  7.985  -42.712 1.00 190.58 ? -61 DA  I "O3'" 1 
ATOM   6216  C  "C2'" . DA  I 5 12  ? 65.024  9.144  -42.571 1.00 190.78 ? -61 DA  I "C2'" 1 
ATOM   6217  C  "C1'" . DA  I 5 12  ? 64.801  9.806  -43.926 1.00 190.77 ? -61 DA  I "C1'" 1 
ATOM   6218  N  N9    . DA  I 5 12  ? 63.652  10.713 -43.971 1.00 190.63 ? -61 DA  I N9    1 
ATOM   6219  C  C8    . DA  I 5 12  ? 62.340  10.397 -43.765 1.00 190.58 ? -61 DA  I C8    1 
ATOM   6220  N  N7    . DA  I 5 12  ? 61.525  11.423 -43.862 1.00 190.56 ? -61 DA  I N7    1 
ATOM   6221  C  C5    . DA  I 5 12  ? 62.366  12.493 -44.119 1.00 190.57 ? -61 DA  I C5    1 
ATOM   6222  C  C6    . DA  I 5 12  ? 62.123  13.871 -44.313 1.00 190.56 ? -61 DA  I C6    1 
ATOM   6223  N  N6    . DA  I 5 12  ? 60.901  14.416 -44.279 1.00 190.53 ? -61 DA  I N6    1 
ATOM   6224  N  N1    . DA  I 5 12  ? 63.188  14.667 -44.549 1.00 190.53 ? -61 DA  I N1    1 
ATOM   6225  C  C2    . DA  I 5 12  ? 64.409  14.120 -44.563 1.00 190.54 ? -61 DA  I C2    1 
ATOM   6226  N  N3    . DA  I 5 12  ? 64.759  12.842 -44.415 1.00 190.56 ? -61 DA  I N3    1 
ATOM   6227  C  C4    . DA  I 5 12  ? 63.681  12.075 -44.183 1.00 190.60 ? -61 DA  I C4    1 
ATOM   6228  P  P     . DG  I 5 13  ? 67.826  7.692  -41.261 1.00 190.30 ? -60 DG  I P     1 
ATOM   6229  O  OP1   . DG  I 5 13  ? 68.937  6.729  -41.431 1.00 190.25 ? -60 DG  I OP1   1 
ATOM   6230  O  OP2   . DG  I 5 13  ? 66.717  7.384  -40.328 1.00 190.32 ? -60 DG  I OP2   1 
ATOM   6231  O  "O5'" . DG  I 5 13  ? 68.434  9.115  -40.853 1.00 189.99 ? -60 DG  I "O5'" 1 
ATOM   6232  C  "C5'" . DG  I 5 13  ? 69.016  9.946  -41.853 1.00 189.68 ? -60 DG  I "C5'" 1 
ATOM   6233  C  "C4'" . DG  I 5 13  ? 68.947  11.411 -41.457 1.00 189.38 ? -60 DG  I "C4'" 1 
ATOM   6234  O  "O4'" . DG  I 5 13  ? 67.601  11.912 -41.658 1.00 189.44 ? -60 DG  I "O4'" 1 
ATOM   6235  C  "C3'" . DG  I 5 13  ? 69.302  11.707 -39.996 1.00 189.00 ? -60 DG  I "C3'" 1 
ATOM   6236  O  "O3'" . DG  I 5 13  ? 70.282  12.726 -39.931 1.00 188.37 ? -60 DG  I "O3'" 1 
ATOM   6237  C  "C2'" . DG  I 5 13  ? 67.981  12.167 -39.381 1.00 189.25 ? -60 DG  I "C2'" 1 
ATOM   6238  C  "C1'" . DG  I 5 13  ? 67.267  12.755 -40.585 1.00 189.47 ? -60 DG  I "C1'" 1 
ATOM   6239  N  N9    . DG  I 5 13  ? 65.813  12.784 -40.436 1.00 189.70 ? -60 DG  I N9    1 
ATOM   6240  C  C8    . DG  I 5 13  ? 65.012  11.774 -39.956 1.00 189.76 ? -60 DG  I C8    1 
ATOM   6241  N  N7    . DG  I 5 13  ? 63.753  12.105 -39.869 1.00 189.82 ? -60 DG  I N7    1 
ATOM   6242  C  C5    . DG  I 5 13  ? 63.719  13.430 -40.291 1.00 189.88 ? -60 DG  I C5    1 
ATOM   6243  C  C6    . DG  I 5 13  ? 62.624  14.321 -40.411 1.00 189.99 ? -60 DG  I C6    1 
ATOM   6244  O  O6    . DG  I 5 13  ? 61.427  14.106 -40.162 1.00 190.06 ? -60 DG  I O6    1 
ATOM   6245  N  N1    . DG  I 5 13  ? 63.025  15.574 -40.875 1.00 189.97 ? -60 DG  I N1    1 
ATOM   6246  C  C2    . DG  I 5 13  ? 64.319  15.920 -41.187 1.00 189.92 ? -60 DG  I C2    1 
ATOM   6247  N  N2    . DG  I 5 13  ? 64.510  17.173 -41.625 1.00 189.89 ? -60 DG  I N2    1 
ATOM   6248  N  N3    . DG  I 5 13  ? 65.355  15.093 -41.080 1.00 189.88 ? -60 DG  I N3    1 
ATOM   6249  C  C4    . DG  I 5 13  ? 64.981  13.870 -40.625 1.00 189.83 ? -60 DG  I C4    1 
ATOM   6250  P  P     . DG  I 5 14  ? 71.222  12.835 -38.646 1.00 187.80 ? -59 DG  I P     1 
ATOM   6251  O  OP1   . DG  I 5 14  ? 72.562  13.279 -39.101 1.00 187.77 ? -59 DG  I OP1   1 
ATOM   6252  O  OP2   . DG  I 5 14  ? 71.087  11.575 -37.881 1.00 187.79 ? -59 DG  I OP2   1 
ATOM   6253  O  "O5'" . DG  I 5 14  ? 70.529  14.003 -37.791 1.00 187.21 ? -59 DG  I "O5'" 1 
ATOM   6254  C  "C5'" . DG  I 5 14  ? 70.743  15.368 -38.134 1.00 186.74 ? -59 DG  I "C5'" 1 
ATOM   6255  C  "C4'" . DG  I 5 14  ? 69.655  16.256 -37.559 1.00 186.29 ? -59 DG  I "C4'" 1 
ATOM   6256  O  "O4'" . DG  I 5 14  ? 68.356  15.619 -37.710 1.00 186.23 ? -59 DG  I "O4'" 1 
ATOM   6257  C  "C3'" . DG  I 5 14  ? 69.789  16.588 -36.066 1.00 185.91 ? -59 DG  I "C3'" 1 
ATOM   6258  O  "O3'" . DG  I 5 14  ? 69.493  17.963 -35.873 1.00 185.42 ? -59 DG  I "O3'" 1 
ATOM   6259  C  "C2'" . DG  I 5 14  ? 68.714  15.707 -35.431 1.00 186.03 ? -59 DG  I "C2'" 1 
ATOM   6260  C  "C1'" . DG  I 5 14  ? 67.649  15.777 -36.505 1.00 186.14 ? -59 DG  I "C1'" 1 
ATOM   6261  N  N9    . DG  I 5 14  ? 66.622  14.743 -36.403 1.00 186.15 ? -59 DG  I N9    1 
ATOM   6262  C  C8    . DG  I 5 14  ? 66.749  13.501 -35.828 1.00 186.19 ? -59 DG  I C8    1 
ATOM   6263  N  N7    . DG  I 5 14  ? 65.645  12.803 -35.848 1.00 186.17 ? -59 DG  I N7    1 
ATOM   6264  C  C5    . DG  I 5 14  ? 64.720  13.647 -36.449 1.00 186.12 ? -59 DG  I C5    1 
ATOM   6265  C  C6    . DG  I 5 14  ? 63.351  13.439 -36.740 1.00 186.09 ? -59 DG  I C6    1 
ATOM   6266  O  O6    . DG  I 5 14  ? 62.663  12.432 -36.516 1.00 186.06 ? -59 DG  I O6    1 
ATOM   6267  N  N1    . DG  I 5 14  ? 62.780  14.553 -37.354 1.00 186.01 ? -59 DG  I N1    1 
ATOM   6268  C  C2    . DG  I 5 14  ? 63.449  15.718 -37.652 1.00 186.01 ? -59 DG  I C2    1 
ATOM   6269  N  N2    . DG  I 5 14  ? 62.731  16.683 -38.247 1.00 185.92 ? -59 DG  I N2    1 
ATOM   6270  N  N3    . DG  I 5 14  ? 64.732  15.925 -37.384 1.00 186.01 ? -59 DG  I N3    1 
ATOM   6271  C  C4    . DG  I 5 14  ? 65.301  14.852 -36.781 1.00 186.10 ? -59 DG  I C4    1 
ATOM   6272  P  P     . DG  I 5 15  ? 70.148  18.788 -34.669 1.00 184.91 ? -58 DG  I P     1 
ATOM   6273  O  OP1   . DG  I 5 15  ? 71.502  19.204 -35.092 1.00 184.97 ? -58 DG  I OP1   1 
ATOM   6274  O  OP2   . DG  I 5 15  ? 69.968  18.013 -33.419 1.00 184.82 ? -58 DG  I OP2   1 
ATOM   6275  O  "O5'" . DG  I 5 15  ? 69.208  20.086 -34.593 1.00 184.42 ? -58 DG  I "O5'" 1 
ATOM   6276  C  "C5'" . DG  I 5 15  ? 68.890  20.808 -35.792 1.00 183.89 ? -58 DG  I "C5'" 1 
ATOM   6277  C  "C4'" . DG  I 5 15  ? 67.511  21.457 -35.710 1.00 183.34 ? -58 DG  I "C4'" 1 
ATOM   6278  O  "O4'" . DG  I 5 15  ? 66.488  20.490 -36.065 1.00 183.42 ? -58 DG  I "O4'" 1 
ATOM   6279  C  "C3'" . DG  I 5 15  ? 67.125  22.013 -34.336 1.00 182.68 ? -58 DG  I "C3'" 1 
ATOM   6280  O  "O3'" . DG  I 5 15  ? 66.802  23.392 -34.435 1.00 181.64 ? -58 DG  I "O3'" 1 
ATOM   6281  C  "C2'" . DG  I 5 15  ? 65.910  21.183 -33.917 1.00 183.05 ? -58 DG  I "C2'" 1 
ATOM   6282  C  "C1'" . DG  I 5 15  ? 65.365  20.675 -35.239 1.00 183.44 ? -58 DG  I "C1'" 1 
ATOM   6283  N  N9    . DG  I 5 15  ? 64.676  19.396 -35.100 1.00 183.82 ? -58 DG  I N9    1 
ATOM   6284  C  C8    . DG  I 5 15  ? 65.259  18.162 -34.939 1.00 183.94 ? -58 DG  I C8    1 
ATOM   6285  N  N7    . DG  I 5 15  ? 64.401  17.200 -34.746 1.00 184.05 ? -58 DG  I N7    1 
ATOM   6286  C  C5    . DG  I 5 15  ? 63.169  17.840 -34.738 1.00 184.12 ? -58 DG  I C5    1 
ATOM   6287  C  C6    . DG  I 5 15  ? 61.869  17.307 -34.574 1.00 184.17 ? -58 DG  I C6    1 
ATOM   6288  O  O6    . DG  I 5 15  ? 61.540  16.125 -34.396 1.00 184.14 ? -58 DG  I O6    1 
ATOM   6289  N  N1    . DG  I 5 15  ? 60.894  18.301 -34.636 1.00 184.23 ? -58 DG  I N1    1 
ATOM   6290  C  C2    . DG  I 5 15  ? 61.144  19.636 -34.857 1.00 184.25 ? -58 DG  I C2    1 
ATOM   6291  N  N2    . DG  I 5 15  ? 60.074  20.447 -34.856 1.00 184.27 ? -58 DG  I N2    1 
ATOM   6292  N  N3    . DG  I 5 15  ? 62.361  20.153 -34.987 1.00 184.19 ? -58 DG  I N3    1 
ATOM   6293  C  C4    . DG  I 5 15  ? 63.322  19.197 -34.929 1.00 184.07 ? -58 DG  I C4    1 
ATOM   6294  P  P     . DT  I 5 16  ? 66.674  24.282 -33.110 1.00 180.56 ? -57 DT  I P     1 
ATOM   6295  O  OP1   . DT  I 5 16  ? 67.212  25.627 -33.411 1.00 180.55 ? -57 DT  I OP1   1 
ATOM   6296  O  OP2   . DT  I 5 16  ? 67.222  23.503 -31.972 1.00 180.54 ? -57 DT  I OP2   1 
ATOM   6297  O  "O5'" . DT  I 5 16  ? 65.092  24.387 -32.910 1.00 179.38 ? -57 DT  I "O5'" 1 
ATOM   6298  C  "C5'" . DT  I 5 16  ? 64.265  24.867 -33.965 1.00 178.16 ? -57 DT  I "C5'" 1 
ATOM   6299  C  "C4'" . DT  I 5 16  ? 62.800  24.821 -33.565 1.00 176.94 ? -57 DT  I "C4'" 1 
ATOM   6300  O  "O4'" . DT  I 5 16  ? 62.394  23.444 -33.370 1.00 176.71 ? -57 DT  I "O4'" 1 
ATOM   6301  C  "C3'" . DT  I 5 16  ? 62.452  25.570 -32.280 1.00 176.02 ? -57 DT  I "C3'" 1 
ATOM   6302  O  "O3'" . DT  I 5 16  ? 61.254  26.315 -32.456 1.00 174.83 ? -57 DT  I "O3'" 1 
ATOM   6303  C  "C2'" . DT  I 5 16  ? 62.291  24.466 -31.232 1.00 176.26 ? -57 DT  I "C2'" 1 
ATOM   6304  C  "C1'" . DT  I 5 16  ? 61.900  23.243 -32.060 1.00 176.46 ? -57 DT  I "C1'" 1 
ATOM   6305  N  N1    . DT  I 5 16  ? 62.481  21.959 -31.536 1.00 176.45 ? -57 DT  I N1    1 
ATOM   6306  C  C2    . DT  I 5 16  ? 61.686  20.837 -31.465 1.00 176.38 ? -57 DT  I C2    1 
ATOM   6307  O  O2    . DT  I 5 16  ? 60.513  20.825 -31.798 1.00 176.34 ? -57 DT  I O2    1 
ATOM   6308  N  N3    . DT  I 5 16  ? 62.322  19.716 -30.991 1.00 176.41 ? -57 DT  I N3    1 
ATOM   6309  C  C4    . DT  I 5 16  ? 63.643  19.611 -30.578 1.00 176.34 ? -57 DT  I C4    1 
ATOM   6310  O  O4    . DT  I 5 16  ? 64.068  18.534 -30.172 1.00 176.33 ? -57 DT  I O4    1 
ATOM   6311  C  C5    . DT  I 5 16  ? 64.416  20.828 -30.665 1.00 176.32 ? -57 DT  I C5    1 
ATOM   6312  C  C7    . DT  I 5 16  ? 65.858  20.840 -30.245 1.00 176.19 ? -57 DT  I C7    1 
ATOM   6313  C  C6    . DT  I 5 16  ? 63.805  21.929 -31.131 1.00 176.39 ? -57 DT  I C6    1 
ATOM   6314  P  P     . DT  I 5 17  ? 60.953  27.608 -31.554 1.00 173.65 ? -56 DT  I P     1 
ATOM   6315  O  OP1   . DT  I 5 17  ? 60.985  28.796 -32.437 1.00 173.60 ? -56 DT  I OP1   1 
ATOM   6316  O  OP2   . DT  I 5 17  ? 61.813  27.555 -30.350 1.00 173.59 ? -56 DT  I OP2   1 
ATOM   6317  O  "O5'" . DT  I 5 17  ? 59.450  27.349 -31.095 1.00 172.57 ? -56 DT  I "O5'" 1 
ATOM   6318  C  "C5'" . DT  I 5 17  ? 58.521  26.833 -32.032 1.00 171.50 ? -56 DT  I "C5'" 1 
ATOM   6319  C  "C4'" . DT  I 5 17  ? 57.708  25.706 -31.429 1.00 170.37 ? -56 DT  I "C4'" 1 
ATOM   6320  O  "O4'" . DT  I 5 17  ? 58.586  24.648 -30.974 1.00 170.11 ? -56 DT  I "O4'" 1 
ATOM   6321  C  "C3'" . DT  I 5 17  ? 56.850  26.099 -30.223 1.00 169.47 ? -56 DT  I "C3'" 1 
ATOM   6322  O  "O3'" . DT  I 5 17  ? 55.508  25.741 -30.464 1.00 168.35 ? -56 DT  I "O3'" 1 
ATOM   6323  C  "C2'" . DT  I 5 17  ? 57.444  25.289 -29.069 1.00 169.66 ? -56 DT  I "C2'" 1 
ATOM   6324  C  "C1'" . DT  I 5 17  ? 58.048  24.107 -29.801 1.00 169.91 ? -56 DT  I "C1'" 1 
ATOM   6325  N  N1    . DT  I 5 17  ? 59.130  23.428 -29.046 1.00 170.01 ? -56 DT  I N1    1 
ATOM   6326  C  C2    . DT  I 5 17  ? 59.128  22.059 -28.971 1.00 170.05 ? -56 DT  I C2    1 
ATOM   6327  O  O2    . DT  I 5 17  ? 58.322  21.361 -29.557 1.00 170.02 ? -56 DT  I O2    1 
ATOM   6328  N  N3    . DT  I 5 17  ? 60.161  21.525 -28.249 1.00 170.11 ? -56 DT  I N3    1 
ATOM   6329  C  C4    . DT  I 5 17  ? 61.148  22.215 -27.567 1.00 170.18 ? -56 DT  I C4    1 
ATOM   6330  O  O4    . DT  I 5 17  ? 62.004  21.592 -26.949 1.00 170.23 ? -56 DT  I O4    1 
ATOM   6331  C  C5    . DT  I 5 17  ? 61.073  23.655 -27.660 1.00 170.14 ? -56 DT  I C5    1 
ATOM   6332  C  C7    . DT  I 5 17  ? 62.090  24.513 -26.965 1.00 170.10 ? -56 DT  I C7    1 
ATOM   6333  C  C6    . DT  I 5 17  ? 60.074  24.186 -28.379 1.00 170.11 ? -56 DT  I C6    1 
ATOM   6334  P  P     . DA  I 5 18  ? 54.315  26.636 -29.889 1.00 167.14 ? -55 DA  I P     1 
ATOM   6335  O  OP1   . DA  I 5 18  ? 53.980  27.656 -30.909 1.00 167.05 ? -55 DA  I OP1   1 
ATOM   6336  O  OP2   . DA  I 5 18  ? 54.667  27.051 -28.513 1.00 167.02 ? -55 DA  I OP2   1 
ATOM   6337  O  "O5'" . DA  I 5 18  ? 53.117  25.583 -29.791 1.00 166.26 ? -55 DA  I "O5'" 1 
ATOM   6338  C  "C5'" . DA  I 5 18  ? 53.182  24.357 -30.525 1.00 165.35 ? -55 DA  I "C5'" 1 
ATOM   6339  C  "C4'" . DA  I 5 18  ? 52.876  23.166 -29.633 1.00 164.45 ? -55 DA  I "C4'" 1 
ATOM   6340  O  "O4'" . DA  I 5 18  ? 54.060  22.812 -28.877 1.00 164.27 ? -55 DA  I "O4'" 1 
ATOM   6341  C  "C3'" . DA  I 5 18  ? 51.763  23.388 -28.613 1.00 163.74 ? -55 DA  I "C3'" 1 
ATOM   6342  O  "O3'" . DA  I 5 18  ? 50.931  22.239 -28.535 1.00 162.83 ? -55 DA  I "O3'" 1 
ATOM   6343  C  "C2'" . DA  I 5 18  ? 52.518  23.632 -27.309 1.00 163.94 ? -55 DA  I "C2'" 1 
ATOM   6344  C  "C1'" . DA  I 5 18  ? 53.763  22.781 -27.499 1.00 164.21 ? -55 DA  I "C1'" 1 
ATOM   6345  N  N9    . DA  I 5 18  ? 54.917  23.299 -26.783 1.00 164.47 ? -55 DA  I N9    1 
ATOM   6346  C  C8    . DA  I 5 18  ? 55.178  24.606 -26.488 1.00 164.61 ? -55 DA  I C8    1 
ATOM   6347  N  N7    . DA  I 5 18  ? 56.306  24.788 -25.845 1.00 164.69 ? -55 DA  I N7    1 
ATOM   6348  C  C5    . DA  I 5 18  ? 56.811  23.509 -25.690 1.00 164.73 ? -55 DA  I C5    1 
ATOM   6349  C  C6    . DA  I 5 18  ? 57.981  23.017 -25.074 1.00 164.80 ? -55 DA  I C6    1 
ATOM   6350  N  N6    . DA  I 5 18  ? 58.887  23.803 -24.478 1.00 164.81 ? -55 DA  I N6    1 
ATOM   6351  N  N1    . DA  I 5 18  ? 58.184  21.683 -25.097 1.00 164.82 ? -55 DA  I N1    1 
ATOM   6352  C  C2    . DA  I 5 18  ? 57.273  20.903 -25.693 1.00 164.77 ? -55 DA  I C2    1 
ATOM   6353  N  N3    . DA  I 5 18  ? 56.139  21.249 -26.302 1.00 164.71 ? -55 DA  I N3    1 
ATOM   6354  C  C4    . DA  I 5 18  ? 55.966  22.578 -26.264 1.00 164.64 ? -55 DA  I C4    1 
ATOM   6355  P  P     . DG  I 5 19  ? 49.358  22.417 -28.330 1.00 161.97 ? -54 DG  I P     1 
ATOM   6356  O  OP1   . DG  I 5 19  ? 48.739  22.531 -29.672 1.00 161.83 ? -54 DG  I OP1   1 
ATOM   6357  O  OP2   . DG  I 5 19  ? 49.153  23.488 -27.331 1.00 161.89 ? -54 DG  I OP2   1 
ATOM   6358  O  "O5'" . DG  I 5 19  ? 48.922  21.039 -27.646 1.00 161.60 ? -54 DG  I "O5'" 1 
ATOM   6359  C  "C5'" . DG  I 5 19  ? 48.581  19.908 -28.436 1.00 161.33 ? -54 DG  I "C5'" 1 
ATOM   6360  C  "C4'" . DG  I 5 19  ? 49.401  18.697 -28.036 1.00 161.03 ? -54 DG  I "C4'" 1 
ATOM   6361  O  "O4'" . DG  I 5 19  ? 50.679  19.123 -27.502 1.00 161.11 ? -54 DG  I "O4'" 1 
ATOM   6362  C  "C3'" . DG  I 5 19  ? 48.793  17.809 -26.962 1.00 160.70 ? -54 DG  I "C3'" 1 
ATOM   6363  O  "O3'" . DG  I 5 19  ? 49.274  16.484 -27.133 1.00 160.20 ? -54 DG  I "O3'" 1 
ATOM   6364  C  "C2'" . DG  I 5 19  ? 49.353  18.434 -25.694 1.00 160.92 ? -54 DG  I "C2'" 1 
ATOM   6365  C  "C1'" . DG  I 5 19  ? 50.776  18.741 -26.143 1.00 161.18 ? -54 DG  I "C1'" 1 
ATOM   6366  N  N9    . DG  I 5 19  ? 51.402  19.834 -25.409 1.00 161.57 ? -54 DG  I N9    1 
ATOM   6367  C  C8    . DG  I 5 19  ? 50.983  21.141 -25.360 1.00 161.70 ? -54 DG  I C8    1 
ATOM   6368  N  N7    . DG  I 5 19  ? 51.768  21.913 -24.660 1.00 161.77 ? -54 DG  I N7    1 
ATOM   6369  C  C5    . DG  I 5 19  ? 52.769  21.060 -24.212 1.00 161.83 ? -54 DG  I C5    1 
ATOM   6370  C  C6    . DG  I 5 19  ? 53.892  21.326 -23.396 1.00 161.95 ? -54 DG  I C6    1 
ATOM   6371  O  O6    . DG  I 5 19  ? 54.239  22.406 -22.902 1.00 162.03 ? -54 DG  I O6    1 
ATOM   6372  N  N1    . DG  I 5 19  ? 54.657  20.182 -23.180 1.00 161.99 ? -54 DG  I N1    1 
ATOM   6373  C  C2    . DG  I 5 19  ? 54.368  18.936 -23.683 1.00 161.96 ? -54 DG  I C2    1 
ATOM   6374  N  N2    . DG  I 5 19  ? 55.224  17.951 -23.366 1.00 162.05 ? -54 DG  I N2    1 
ATOM   6375  N  N3    . DG  I 5 19  ? 53.315  18.672 -24.448 1.00 161.91 ? -54 DG  I N3    1 
ATOM   6376  C  C4    . DG  I 5 19  ? 52.562  19.778 -24.669 1.00 161.75 ? -54 DG  I C4    1 
ATOM   6377  P  P     . DG  I 5 20  ? 48.402  15.239 -26.647 1.00 159.78 ? -53 DG  I P     1 
ATOM   6378  O  OP1   . DG  I 5 20  ? 48.961  14.022 -27.275 1.00 159.75 ? -53 DG  I OP1   1 
ATOM   6379  O  OP2   . DG  I 5 20  ? 46.979  15.580 -26.843 1.00 159.80 ? -53 DG  I OP2   1 
ATOM   6380  O  "O5'" . DG  I 5 20  ? 48.683  15.194 -25.070 1.00 159.44 ? -53 DG  I "O5'" 1 
ATOM   6381  C  "C5'" . DG  I 5 20  ? 50.006  14.982 -24.586 1.00 159.09 ? -53 DG  I "C5'" 1 
ATOM   6382  C  "C4'" . DG  I 5 20  ? 50.113  15.319 -23.106 1.00 158.73 ? -53 DG  I "C4'" 1 
ATOM   6383  O  "O4'" . DG  I 5 20  ? 50.396  16.732 -22.932 1.00 158.78 ? -53 DG  I "O4'" 1 
ATOM   6384  C  "C3'" . DG  I 5 20  ? 48.862  15.030 -22.265 1.00 158.41 ? -53 DG  I "C3'" 1 
ATOM   6385  O  "O3'" . DG  I 5 20  ? 49.248  14.372 -21.068 1.00 157.89 ? -53 DG  I "O3'" 1 
ATOM   6386  C  "C2'" . DG  I 5 20  ? 48.321  16.431 -21.964 1.00 158.63 ? -53 DG  I "C2'" 1 
ATOM   6387  C  "C1'" . DG  I 5 20  ? 49.617  17.207 -21.864 1.00 158.84 ? -53 DG  I "C1'" 1 
ATOM   6388  N  N9    . DG  I 5 20  ? 49.467  18.654 -21.984 1.00 159.23 ? -53 DG  I N9    1 
ATOM   6389  C  C8    . DG  I 5 20  ? 48.365  19.344 -22.434 1.00 159.34 ? -53 DG  I C8    1 
ATOM   6390  N  N7    . DG  I 5 20  ? 48.513  20.642 -22.399 1.00 159.45 ? -53 DG  I N7    1 
ATOM   6391  C  C5    . DG  I 5 20  ? 49.786  20.825 -21.861 1.00 159.52 ? -53 DG  I C5    1 
ATOM   6392  C  C6    . DG  I 5 20  ? 50.502  22.020 -21.582 1.00 159.57 ? -53 DG  I C6    1 
ATOM   6393  O  O6    . DG  I 5 20  ? 50.137  23.194 -21.751 1.00 159.59 ? -53 DG  I O6    1 
ATOM   6394  N  N1    . DG  I 5 20  ? 51.762  21.753 -21.045 1.00 159.53 ? -53 DG  I N1    1 
ATOM   6395  C  C2    . DG  I 5 20  ? 52.271  20.493 -20.818 1.00 159.50 ? -53 DG  I C2    1 
ATOM   6396  N  N2    . DG  I 5 20  ? 53.500  20.436 -20.284 1.00 159.51 ? -53 DG  I N2    1 
ATOM   6397  N  N3    . DG  I 5 20  ? 51.609  19.369 -21.065 1.00 159.46 ? -53 DG  I N3    1 
ATOM   6398  C  C4    . DG  I 5 20  ? 50.380  19.610 -21.590 1.00 159.43 ? -53 DG  I C4    1 
ATOM   6399  P  P     . DG  I 5 21  ? 48.661  12.929 -20.704 1.00 157.34 ? -52 DG  I P     1 
ATOM   6400  O  OP1   . DG  I 5 21  ? 48.757  12.079 -21.914 1.00 157.36 ? -52 DG  I OP1   1 
ATOM   6401  O  OP2   . DG  I 5 21  ? 47.351  13.121 -20.034 1.00 157.31 ? -52 DG  I OP2   1 
ATOM   6402  O  "O5'" . DG  I 5 21  ? 49.705  12.397 -19.608 1.00 156.73 ? -52 DG  I "O5'" 1 
ATOM   6403  C  "C5'" . DG  I 5 21  ? 51.115  12.541 -19.830 1.00 156.05 ? -52 DG  I "C5'" 1 
ATOM   6404  C  "C4'" . DG  I 5 21  ? 51.816  13.163 -18.626 1.00 155.48 ? -52 DG  I "C4'" 1 
ATOM   6405  O  "O4'" . DG  I 5 21  ? 51.936  14.601 -18.817 1.00 155.28 ? -52 DG  I "O4'" 1 
ATOM   6406  C  "C3'" . DG  I 5 21  ? 51.121  12.967 -17.272 1.00 155.06 ? -52 DG  I "C3'" 1 
ATOM   6407  O  "O3'" . DG  I 5 21  ? 52.085  12.612 -16.275 1.00 154.70 ? -52 DG  I "O3'" 1 
ATOM   6408  C  "C2'" . DG  I 5 21  ? 50.502  14.338 -16.997 1.00 155.12 ? -52 DG  I "C2'" 1 
ATOM   6409  C  "C1'" . DG  I 5 21  ? 51.513  15.266 -17.646 1.00 155.14 ? -52 DG  I "C1'" 1 
ATOM   6410  N  N9    . DG  I 5 21  ? 50.945  16.565 -18.007 1.00 154.99 ? -52 DG  I N9    1 
ATOM   6411  C  C8    . DG  I 5 21  ? 49.764  16.791 -18.671 1.00 154.94 ? -52 DG  I C8    1 
ATOM   6412  N  N7    . DG  I 5 21  ? 49.471  18.054 -18.797 1.00 154.88 ? -52 DG  I N7    1 
ATOM   6413  C  C5    . DG  I 5 21  ? 50.502  18.708 -18.139 1.00 154.84 ? -52 DG  I C5    1 
ATOM   6414  C  C6    . DG  I 5 21  ? 50.719  20.088 -17.940 1.00 154.81 ? -52 DG  I C6    1 
ATOM   6415  O  O6    . DG  I 5 21  ? 50.021  21.032 -18.321 1.00 154.74 ? -52 DG  I O6    1 
ATOM   6416  N  N1    . DG  I 5 21  ? 51.882  20.329 -17.215 1.00 154.85 ? -52 DG  I N1    1 
ATOM   6417  C  C2    . DG  I 5 21  ? 52.734  19.356 -16.752 1.00 154.97 ? -52 DG  I C2    1 
ATOM   6418  N  N2    . DG  I 5 21  ? 53.809  19.781 -16.071 1.00 155.01 ? -52 DG  I N2    1 
ATOM   6419  N  N3    . DG  I 5 21  ? 52.537  18.055 -16.924 1.00 154.95 ? -52 DG  I N3    1 
ATOM   6420  C  C4    . DG  I 5 21  ? 51.407  17.806 -17.629 1.00 154.94 ? -52 DG  I C4    1 
ATOM   6421  P  P     . DT  I 5 22  ? 51.624  12.257 -14.779 1.00 154.26 ? -51 DT  I P     1 
ATOM   6422  O  OP1   . DT  I 5 22  ? 52.613  11.304 -14.218 1.00 154.19 ? -51 DT  I OP1   1 
ATOM   6423  O  OP2   . DT  I 5 22  ? 50.193  11.883 -14.820 1.00 154.20 ? -51 DT  I OP2   1 
ATOM   6424  O  "O5'" . DT  I 5 22  ? 51.743  13.683 -14.028 1.00 154.15 ? -51 DT  I "O5'" 1 
ATOM   6425  C  "C5'" . DT  I 5 22  ? 52.669  13.883 -12.946 1.00 154.00 ? -51 DT  I "C5'" 1 
ATOM   6426  C  "C4'" . DT  I 5 22  ? 53.079  15.350 -12.816 1.00 153.85 ? -51 DT  I "C4'" 1 
ATOM   6427  O  "O4'" . DT  I 5 22  ? 52.626  16.104 -13.968 1.00 153.84 ? -51 DT  I "O4'" 1 
ATOM   6428  C  "C3'" . DT  I 5 22  ? 52.474  16.098 -11.642 1.00 153.68 ? -51 DT  I "C3'" 1 
ATOM   6429  O  "O3'" . DT  I 5 22  ? 53.174  15.802 -10.431 1.00 153.41 ? -51 DT  I "O3'" 1 
ATOM   6430  C  "C2'" . DT  I 5 22  ? 52.685  17.545 -12.074 1.00 153.71 ? -51 DT  I "C2'" 1 
ATOM   6431  C  "C1'" . DT  I 5 22  ? 52.450  17.466 -13.590 1.00 153.74 ? -51 DT  I "C1'" 1 
ATOM   6432  N  N1    . DT  I 5 22  ? 51.076  17.930 -14.013 1.00 153.61 ? -51 DT  I N1    1 
ATOM   6433  C  C2    . DT  I 5 22  ? 50.780  19.276 -13.970 1.00 153.57 ? -51 DT  I C2    1 
ATOM   6434  O  O2    . DT  I 5 22  ? 51.578  20.127 -13.619 1.00 153.53 ? -51 DT  I O2    1 
ATOM   6435  N  N3    . DT  I 5 22  ? 49.506  19.596 -14.358 1.00 153.51 ? -51 DT  I N3    1 
ATOM   6436  C  C4    . DT  I 5 22  ? 48.515  18.727 -14.776 1.00 153.49 ? -51 DT  I C4    1 
ATOM   6437  O  O4    . DT  I 5 22  ? 47.415  19.170 -15.089 1.00 153.45 ? -51 DT  I O4    1 
ATOM   6438  C  C5    . DT  I 5 22  ? 48.888  17.334 -14.808 1.00 153.44 ? -51 DT  I C5    1 
ATOM   6439  C  C7    . DT  I 5 22  ? 47.889  16.300 -15.236 1.00 153.38 ? -51 DT  I C7    1 
ATOM   6440  C  C6    . DT  I 5 22  ? 50.137  17.004 -14.431 1.00 153.53 ? -51 DT  I C6    1 
ATOM   6441  P  P     . DT  I 5 23  ? 52.358  15.642 -9.059  1.00 153.12 ? -50 DT  I P     1 
ATOM   6442  O  OP1   . DT  I 5 23  ? 53.170  14.819 -8.137  1.00 153.17 ? -50 DT  I OP1   1 
ATOM   6443  O  OP2   . DT  I 5 23  ? 50.978  15.225 -9.393  1.00 153.10 ? -50 DT  I OP2   1 
ATOM   6444  O  "O5'" . DT  I 5 23  ? 52.297  17.142 -8.504  1.00 152.75 ? -50 DT  I "O5'" 1 
ATOM   6445  C  "C5'" . DT  I 5 23  ? 53.483  17.925 -8.436  1.00 152.38 ? -50 DT  I "C5'" 1 
ATOM   6446  C  "C4'" . DT  I 5 23  ? 53.145  19.398 -8.320  1.00 152.04 ? -50 DT  I "C4'" 1 
ATOM   6447  O  "O4'" . DT  I 5 23  ? 52.497  19.839 -9.535  1.00 151.90 ? -50 DT  I "O4'" 1 
ATOM   6448  C  "C3'" . DT  I 5 23  ? 52.158  19.741 -7.222  1.00 151.83 ? -50 DT  I "C3'" 1 
ATOM   6449  O  "O3'" . DT  I 5 23  ? 52.840  19.904 -5.986  1.00 151.71 ? -50 DT  I "O3'" 1 
ATOM   6450  C  "C2'" . DT  I 5 23  ? 51.580  21.063 -7.716  1.00 151.83 ? -50 DT  I "C2'" 1 
ATOM   6451  C  "C1'" . DT  I 5 23  ? 51.585  20.885 -9.235  1.00 151.80 ? -50 DT  I "C1'" 1 
ATOM   6452  N  N1    . DT  I 5 23  ? 50.244  20.542 -9.812  1.00 151.66 ? -50 DT  I N1    1 
ATOM   6453  C  C2    . DT  I 5 23  ? 49.291  21.529 -9.943  1.00 151.54 ? -50 DT  I C2    1 
ATOM   6454  O  O2    . DT  I 5 23  ? 49.469  22.683 -9.588  1.00 151.40 ? -50 DT  I O2    1 
ATOM   6455  N  N3    . DT  I 5 23  ? 48.109  21.110 -10.504 1.00 151.57 ? -50 DT  I N3    1 
ATOM   6456  C  C4    . DT  I 5 23  ? 47.799  19.835 -10.949 1.00 151.55 ? -50 DT  I C4    1 
ATOM   6457  O  O4    . DT  I 5 23  ? 46.699  19.613 -11.451 1.00 151.48 ? -50 DT  I O4    1 
ATOM   6458  C  C5    . DT  I 5 23  ? 48.845  18.856 -10.787 1.00 151.60 ? -50 DT  I C5    1 
ATOM   6459  C  C7    . DT  I 5 23  ? 48.620  17.438 -11.211 1.00 151.61 ? -50 DT  I C7    1 
ATOM   6460  C  C6    . DT  I 5 23  ? 50.004  19.254 -10.243 1.00 151.64 ? -50 DT  I C6    1 
ATOM   6461  P  P     . DA  I 5 24  ? 52.077  19.632 -4.605  1.00 151.52 ? -49 DA  I P     1 
ATOM   6462  O  OP1   . DA  I 5 24  ? 53.089  19.619 -3.527  1.00 151.55 ? -49 DA  I OP1   1 
ATOM   6463  O  OP2   . DA  I 5 24  ? 51.194  18.459 -4.799  1.00 151.43 ? -49 DA  I OP2   1 
ATOM   6464  O  "O5'" . DA  I 5 24  ? 51.146  20.937 -4.436  1.00 151.45 ? -49 DA  I "O5'" 1 
ATOM   6465  C  "C5'" . DA  I 5 24  ? 51.729  22.215 -4.126  1.00 151.29 ? -49 DA  I "C5'" 1 
ATOM   6466  C  "C4'" . DA  I 5 24  ? 50.765  23.360 -4.427  1.00 151.10 ? -49 DA  I "C4'" 1 
ATOM   6467  O  "O4'" . DA  I 5 24  ? 49.967  23.046 -5.600  1.00 151.19 ? -49 DA  I "O4'" 1 
ATOM   6468  C  "C3'" . DA  I 5 24  ? 49.765  23.692 -3.316  1.00 150.94 ? -49 DA  I "C3'" 1 
ATOM   6469  O  "O3'" . DA  I 5 24  ? 49.602  25.100 -3.221  1.00 150.76 ? -49 DA  I "O3'" 1 
ATOM   6470  C  "C2'" . DA  I 5 24  ? 48.484  23.021 -3.798  1.00 151.05 ? -49 DA  I "C2'" 1 
ATOM   6471  C  "C1'" . DA  I 5 24  ? 48.597  23.226 -5.298  1.00 151.14 ? -49 DA  I "C1'" 1 
ATOM   6472  N  N9    . DA  I 5 24  ? 47.806  22.270 -6.075  1.00 151.24 ? -49 DA  I N9    1 
ATOM   6473  C  C8    . DA  I 5 24  ? 47.565  20.959 -5.768  1.00 151.21 ? -49 DA  I C8    1 
ATOM   6474  N  N7    . DA  I 5 24  ? 46.795  20.343 -6.634  1.00 151.16 ? -49 DA  I N7    1 
ATOM   6475  C  C5    . DA  I 5 24  ? 46.491  21.321 -7.562  1.00 151.21 ? -49 DA  I C5    1 
ATOM   6476  C  C6    . DA  I 5 24  ? 45.690  21.310 -8.716  1.00 151.16 ? -49 DA  I C6    1 
ATOM   6477  N  N6    . DA  I 5 24  ? 45.058  20.218 -9.160  1.00 151.11 ? -49 DA  I N6    1 
ATOM   6478  N  N1    . DA  I 5 24  ? 45.600  22.454 -9.426  1.00 151.27 ? -49 DA  I N1    1 
ATOM   6479  C  C2    . DA  I 5 24  ? 46.232  23.545 -8.975  1.00 151.23 ? -49 DA  I C2    1 
ATOM   6480  N  N3    . DA  I 5 24  ? 47.018  23.677 -7.908  1.00 151.26 ? -49 DA  I N3    1 
ATOM   6481  C  C4    . DA  I 5 24  ? 47.092  22.521 -7.227  1.00 151.24 ? -49 DA  I C4    1 
ATOM   6482  P  P     . DG  I 5 25  ? 48.819  25.738 -1.979  1.00 150.57 ? -48 DG  I P     1 
ATOM   6483  O  OP1   . DG  I 5 25  ? 49.477  27.023 -1.637  1.00 150.58 ? -48 DG  I OP1   1 
ATOM   6484  O  OP2   . DG  I 5 25  ? 48.668  24.688 -0.945  1.00 150.56 ? -48 DG  I OP2   1 
ATOM   6485  O  "O5'" . DG  I 5 25  ? 47.370  26.029 -2.584  1.00 150.43 ? -48 DG  I "O5'" 1 
ATOM   6486  C  "C5'" . DG  I 5 25  ? 47.095  27.241 -3.270  1.00 150.37 ? -48 DG  I "C5'" 1 
ATOM   6487  C  "C4'" . DG  I 5 25  ? 45.642  27.287 -3.680  1.00 150.45 ? -48 DG  I "C4'" 1 
ATOM   6488  O  "O4'" . DG  I 5 25  ? 45.291  26.037 -4.332  1.00 150.43 ? -48 DG  I "O4'" 1 
ATOM   6489  C  "C3'" . DG  I 5 25  ? 44.648  27.457 -2.526  1.00 150.57 ? -48 DG  I "C3'" 1 
ATOM   6490  O  "O3'" . DG  I 5 25  ? 43.590  28.319 -2.932  1.00 150.77 ? -48 DG  I "O3'" 1 
ATOM   6491  C  "C2'" . DG  I 5 25  ? 44.141  26.031 -2.299  1.00 150.48 ? -48 DG  I "C2'" 1 
ATOM   6492  C  "C1'" . DG  I 5 25  ? 44.139  25.498 -3.723  1.00 150.37 ? -48 DG  I "C1'" 1 
ATOM   6493  N  N9    . DG  I 5 25  ? 44.195  24.039 -3.820  1.00 150.15 ? -48 DG  I N9    1 
ATOM   6494  C  C8    . DG  I 5 25  ? 44.589  23.155 -2.846  1.00 150.10 ? -48 DG  I C8    1 
ATOM   6495  N  N7    . DG  I 5 25  ? 44.523  21.906 -3.221  1.00 150.04 ? -48 DG  I N7    1 
ATOM   6496  C  C5    . DG  I 5 25  ? 44.055  21.967 -4.526  1.00 149.96 ? -48 DG  I C5    1 
ATOM   6497  C  C6    . DG  I 5 25  ? 43.780  20.928 -5.448  1.00 149.89 ? -48 DG  I C6    1 
ATOM   6498  O  O6    . DG  I 5 25  ? 43.906  19.706 -5.289  1.00 149.87 ? -48 DG  I O6    1 
ATOM   6499  N  N1    . DG  I 5 25  ? 43.325  21.427 -6.664  1.00 149.85 ? -48 DG  I N1    1 
ATOM   6500  C  C2    . DG  I 5 25  ? 43.144  22.759 -6.948  1.00 149.84 ? -48 DG  I C2    1 
ATOM   6501  N  N2    . DG  I 5 25  ? 42.698  23.050 -8.175  1.00 149.82 ? -48 DG  I N2    1 
ATOM   6502  N  N3    . DG  I 5 25  ? 43.392  23.739 -6.094  1.00 149.91 ? -48 DG  I N3    1 
ATOM   6503  C  C4    . DG  I 5 25  ? 43.844  23.272 -4.907  1.00 150.00 ? -48 DG  I C4    1 
ATOM   6504  P  P     . DG  I 5 26  ? 43.297  29.689 -2.151  1.00 150.89 ? -47 DG  I P     1 
ATOM   6505  O  OP1   . DG  I 5 26  ? 44.578  30.193 -1.599  1.00 150.93 ? -47 DG  I OP1   1 
ATOM   6506  O  OP2   . DG  I 5 26  ? 42.139  29.463 -1.253  1.00 150.90 ? -47 DG  I OP2   1 
ATOM   6507  O  "O5'" . DG  I 5 26  ? 42.821  30.664 -3.331  1.00 150.85 ? -47 DG  I "O5'" 1 
ATOM   6508  C  "C5'" . DG  I 5 26  ? 43.170  30.366 -4.698  1.00 150.67 ? -47 DG  I "C5'" 1 
ATOM   6509  C  "C4'" . DG  I 5 26  ? 41.937  30.254 -5.595  1.00 150.43 ? -47 DG  I "C4'" 1 
ATOM   6510  O  "O4'" . DG  I 5 26  ? 41.639  28.856 -5.852  1.00 150.45 ? -47 DG  I "O4'" 1 
ATOM   6511  C  "C3'" . DG  I 5 26  ? 40.646  30.866 -5.051  1.00 150.10 ? -47 DG  I "C3'" 1 
ATOM   6512  O  "O3'" . DG  I 5 26  ? 39.913  31.454 -6.114  1.00 149.50 ? -47 DG  I "O3'" 1 
ATOM   6513  C  "C2'" . DG  I 5 26  ? 39.917  29.661 -4.464  1.00 150.20 ? -47 DG  I "C2'" 1 
ATOM   6514  C  "C1'" . DG  I 5 26  ? 40.325  28.551 -5.418  1.00 150.53 ? -47 DG  I "C1'" 1 
ATOM   6515  N  N9    . DG  I 5 26  ? 40.340  27.232 -4.791  1.00 150.66 ? -47 DG  I N9    1 
ATOM   6516  C  C8    . DG  I 5 26  ? 40.648  26.943 -3.482  1.00 150.75 ? -47 DG  I C8    1 
ATOM   6517  N  N7    . DG  I 5 26  ? 40.591  25.670 -3.205  1.00 150.81 ? -47 DG  I N7    1 
ATOM   6518  C  C5    . DG  I 5 26  ? 40.213  25.077 -4.405  1.00 150.86 ? -47 DG  I C5    1 
ATOM   6519  C  C6    . DG  I 5 26  ? 39.980  23.717 -4.715  1.00 150.92 ? -47 DG  I C6    1 
ATOM   6520  O  O6    . DG  I 5 26  ? 40.085  22.733 -3.972  1.00 150.96 ? -47 DG  I O6    1 
ATOM   6521  N  N1    . DG  I 5 26  ? 39.610  23.547 -6.047  1.00 150.92 ? -47 DG  I N1    1 
ATOM   6522  C  C2    . DG  I 5 26  ? 39.481  24.563 -6.963  1.00 150.93 ? -47 DG  I C2    1 
ATOM   6523  N  N2    . DG  I 5 26  ? 39.110  24.204 -8.202  1.00 150.98 ? -47 DG  I N2    1 
ATOM   6524  N  N3    . DG  I 5 26  ? 39.690  25.843 -6.684  1.00 150.87 ? -47 DG  I N3    1 
ATOM   6525  C  C4    . DG  I 5 26  ? 40.047  26.026 -5.389  1.00 150.81 ? -47 DG  I C4    1 
ATOM   6526  P  P     . DG  I 5 27  ? 38.694  32.447 -5.815  1.00 149.00 ? -46 DG  I P     1 
ATOM   6527  O  OP1   . DG  I 5 27  ? 38.891  33.669 -6.628  1.00 149.03 ? -46 DG  I OP1   1 
ATOM   6528  O  OP2   . DG  I 5 27  ? 38.521  32.556 -4.346  1.00 148.92 ? -46 DG  I OP2   1 
ATOM   6529  O  "O5'" . DG  I 5 27  ? 37.451  31.634 -6.402  1.00 148.50 ? -46 DG  I "O5'" 1 
ATOM   6530  C  "C5'" . DG  I 5 27  ? 37.606  30.895 -7.611  1.00 147.89 ? -46 DG  I "C5'" 1 
ATOM   6531  C  "C4'" . DG  I 5 27  ? 36.702  29.676 -7.627  1.00 147.26 ? -46 DG  I "C4'" 1 
ATOM   6532  O  "O4'" . DG  I 5 27  ? 37.141  28.722 -6.626  1.00 147.30 ? -46 DG  I "O4'" 1 
ATOM   6533  C  "C3'" . DG  I 5 27  ? 35.225  29.953 -7.346  1.00 146.58 ? -46 DG  I "C3'" 1 
ATOM   6534  O  "O3'" . DG  I 5 27  ? 34.438  29.285 -8.304  1.00 145.65 ? -46 DG  I "O3'" 1 
ATOM   6535  C  "C2'" . DG  I 5 27  ? 35.009  29.378 -5.942  1.00 146.95 ? -46 DG  I "C2'" 1 
ATOM   6536  C  "C1'" . DG  I 5 27  ? 36.024  28.245 -5.912  1.00 147.31 ? -46 DG  I "C1'" 1 
ATOM   6537  N  N9    . DG  I 5 27  ? 36.454  27.867 -4.560  1.00 147.59 ? -46 DG  I N9    1 
ATOM   6538  C  C8    . DG  I 5 27  ? 36.686  28.709 -3.495  1.00 147.71 ? -46 DG  I C8    1 
ATOM   6539  N  N7    . DG  I 5 27  ? 37.068  28.087 -2.411  1.00 147.73 ? -46 DG  I N7    1 
ATOM   6540  C  C5    . DG  I 5 27  ? 37.054  26.745 -2.767  1.00 147.66 ? -46 DG  I C5    1 
ATOM   6541  C  C6    . DG  I 5 27  ? 37.360  25.596 -2.000  1.00 147.64 ? -46 DG  I C6    1 
ATOM   6542  O  O6    . DG  I 5 27  ? 37.717  25.539 -0.813  1.00 147.63 ? -46 DG  I O6    1 
ATOM   6543  N  N1    . DG  I 5 27  ? 37.227  24.428 -2.750  1.00 147.55 ? -46 DG  I N1    1 
ATOM   6544  C  C2    . DG  I 5 27  ? 36.840  24.379 -4.070  1.00 147.49 ? -46 DG  I C2    1 
ATOM   6545  N  N2    . DG  I 5 27  ? 36.772  23.164 -4.627  1.00 147.44 ? -46 DG  I N2    1 
ATOM   6546  N  N3    . DG  I 5 27  ? 36.551  25.446 -4.798  1.00 147.52 ? -46 DG  I N3    1 
ATOM   6547  C  C4    . DG  I 5 27  ? 36.687  26.592 -4.089  1.00 147.61 ? -46 DG  I C4    1 
ATOM   6548  P  P     . DT  I 5 28  ? 33.082  29.937 -8.834  1.00 144.73 ? -45 DT  I P     1 
ATOM   6549  O  OP1   . DT  I 5 28  ? 33.429  30.907 -9.897  1.00 144.73 ? -45 DT  I OP1   1 
ATOM   6550  O  OP2   . DT  I 5 28  ? 32.290  30.369 -7.661  1.00 144.64 ? -45 DT  I OP2   1 
ATOM   6551  O  "O5'" . DT  I 5 28  ? 32.345  28.687 -9.496  1.00 144.01 ? -45 DT  I "O5'" 1 
ATOM   6552  C  "C5'" . DT  I 5 28  ? 33.116  27.679 -10.127 1.00 143.29 ? -45 DT  I "C5'" 1 
ATOM   6553  C  "C4'" . DT  I 5 28  ? 32.713  26.299 -9.640  1.00 142.60 ? -45 DT  I "C4'" 1 
ATOM   6554  O  "O4'" . DT  I 5 28  ? 33.336  26.013 -8.360  1.00 142.55 ? -45 DT  I "O4'" 1 
ATOM   6555  C  "C3'" . DT  I 5 28  ? 31.208  26.079 -9.442  1.00 141.95 ? -45 DT  I "C3'" 1 
ATOM   6556  O  "O3'" . DT  I 5 28  ? 30.824  24.914 -10.140 1.00 141.21 ? -45 DT  I "O3'" 1 
ATOM   6557  C  "C2'" . DT  I 5 28  ? 31.068  25.888 -7.925  1.00 142.14 ? -45 DT  I "C2'" 1 
ATOM   6558  C  "C1'" . DT  I 5 28  ? 32.420  25.284 -7.583  1.00 142.37 ? -45 DT  I "C1'" 1 
ATOM   6559  N  N1    . DT  I 5 28  ? 32.803  25.389 -6.132  1.00 142.36 ? -45 DT  I N1    1 
ATOM   6560  C  C2    . DT  I 5 28  ? 33.424  24.319 -5.517  1.00 142.33 ? -45 DT  I C2    1 
ATOM   6561  O  O2    . DT  I 5 28  ? 33.702  23.280 -6.092  1.00 142.33 ? -45 DT  I O2    1 
ATOM   6562  N  N3    . DT  I 5 28  ? 33.721  24.515 -4.198  1.00 142.33 ? -45 DT  I N3    1 
ATOM   6563  C  C4    . DT  I 5 28  ? 33.454  25.638 -3.441  1.00 142.36 ? -45 DT  I C4    1 
ATOM   6564  O  O4    . DT  I 5 28  ? 33.807  25.673 -2.271  1.00 142.40 ? -45 DT  I O4    1 
ATOM   6565  C  C5    . DT  I 5 28  ? 32.806  26.719 -4.142  1.00 142.36 ? -45 DT  I C5    1 
ATOM   6566  C  C7    . DT  I 5 28  ? 32.474  27.992 -3.422  1.00 142.38 ? -45 DT  I C7    1 
ATOM   6567  C  C6    . DT  I 5 28  ? 32.506  26.541 -5.434  1.00 142.33 ? -45 DT  I C6    1 
ATOM   6568  P  P     . DT  I 5 29  ? 29.326  24.731 -10.645 1.00 140.61 ? -44 DT  I P     1 
ATOM   6569  O  OP1   . DT  I 5 29  ? 29.355  24.701 -12.122 1.00 140.58 ? -44 DT  I OP1   1 
ATOM   6570  O  OP2   . DT  I 5 29  ? 28.471  25.710 -9.937  1.00 140.45 ? -44 DT  I OP2   1 
ATOM   6571  O  "O5'" . DT  I 5 29  ? 28.954  23.273 -10.104 1.00 140.46 ? -44 DT  I "O5'" 1 
ATOM   6572  C  "C5'" . DT  I 5 29  ? 29.845  22.179 -10.332 1.00 140.26 ? -44 DT  I "C5'" 1 
ATOM   6573  C  "C4'" . DT  I 5 29  ? 29.781  21.167 -9.195  1.00 140.05 ? -44 DT  I "C4'" 1 
ATOM   6574  O  "O4'" . DT  I 5 29  ? 30.271  21.771 -7.968  1.00 139.98 ? -44 DT  I "O4'" 1 
ATOM   6575  C  "C3'" . DT  I 5 29  ? 28.388  20.617 -8.877  1.00 139.94 ? -44 DT  I "C3'" 1 
ATOM   6576  O  "O3'" . DT  I 5 29  ? 28.453  19.211 -8.714  1.00 139.94 ? -44 DT  I "O3'" 1 
ATOM   6577  C  "C2'" . DT  I 5 29  ? 28.019  21.316 -7.569  1.00 139.89 ? -44 DT  I "C2'" 1 
ATOM   6578  C  "C1'" . DT  I 5 29  ? 29.382  21.484 -6.913  1.00 139.89 ? -44 DT  I "C1'" 1 
ATOM   6579  N  N1    . DT  I 5 29  ? 29.457  22.607 -5.896  1.00 139.80 ? -44 DT  I N1    1 
ATOM   6580  C  C2    . DT  I 5 29  ? 30.460  22.594 -4.951  1.00 139.79 ? -44 DT  I C2    1 
ATOM   6581  O  O2    . DT  I 5 29  ? 31.294  21.710 -4.870  1.00 139.75 ? -44 DT  I O2    1 
ATOM   6582  N  N3    . DT  I 5 29  ? 30.456  23.666 -4.100  1.00 139.80 ? -44 DT  I N3    1 
ATOM   6583  C  C4    . DT  I 5 29  ? 29.566  24.724 -4.093  1.00 139.77 ? -44 DT  I C4    1 
ATOM   6584  O  O4    . DT  I 5 29  ? 29.687  25.611 -3.257  1.00 139.79 ? -44 DT  I O4    1 
ATOM   6585  C  C5    . DT  I 5 29  ? 28.544  24.677 -5.106  1.00 139.74 ? -44 DT  I C5    1 
ATOM   6586  C  C7    . DT  I 5 29  ? 27.529  25.772 -5.201  1.00 139.77 ? -44 DT  I C7    1 
ATOM   6587  C  C6    . DT  I 5 29  ? 28.541  23.641 -5.950  1.00 139.75 ? -44 DT  I C6    1 
ATOM   6588  P  P     . DA  I 5 30  ? 27.115  18.336 -8.661  1.00 140.11 ? -43 DA  I P     1 
ATOM   6589  O  OP1   . DA  I 5 30  ? 27.307  17.168 -9.548  1.00 140.05 ? -43 DA  I OP1   1 
ATOM   6590  O  OP2   . DA  I 5 30  ? 25.954  19.232 -8.869  1.00 139.87 ? -43 DA  I OP2   1 
ATOM   6591  O  "O5'" . DA  I 5 30  ? 27.085  17.838 -7.135  1.00 140.89 ? -43 DA  I "O5'" 1 
ATOM   6592  C  "C5'" . DA  I 5 30  ? 28.311  17.505 -6.455  1.00 141.48 ? -43 DA  I "C5'" 1 
ATOM   6593  C  "C4'" . DA  I 5 30  ? 28.091  17.313 -4.955  1.00 142.05 ? -43 DA  I "C4'" 1 
ATOM   6594  O  "O4'" . DA  I 5 30  ? 28.258  18.581 -4.266  1.00 142.00 ? -43 DA  I "O4'" 1 
ATOM   6595  C  "C3'" . DA  I 5 30  ? 26.716  16.773 -4.540  1.00 142.68 ? -43 DA  I "C3'" 1 
ATOM   6596  O  "O3'" . DA  I 5 30  ? 26.872  15.783 -3.512  1.00 143.74 ? -43 DA  I "O3'" 1 
ATOM   6597  C  "C2'" . DA  I 5 30  ? 25.995  18.017 -4.017  1.00 142.33 ? -43 DA  I "C2'" 1 
ATOM   6598  C  "C1'" . DA  I 5 30  ? 27.148  18.820 -3.429  1.00 142.06 ? -43 DA  I "C1'" 1 
ATOM   6599  N  N9    . DA  I 5 30  ? 26.901  20.261 -3.386  1.00 141.96 ? -43 DA  I N9    1 
ATOM   6600  C  C8    . DA  I 5 30  ? 26.577  21.075 -4.433  1.00 141.89 ? -43 DA  I C8    1 
ATOM   6601  N  N7    . DA  I 5 30  ? 26.426  22.336 -4.102  1.00 141.87 ? -43 DA  I N7    1 
ATOM   6602  C  C5    . DA  I 5 30  ? 26.640  22.345 -2.737  1.00 141.89 ? -43 DA  I C5    1 
ATOM   6603  C  C6    . DA  I 5 30  ? 26.613  23.378 -1.779  1.00 141.91 ? -43 DA  I C6    1 
ATOM   6604  N  N6    . DA  I 5 30  ? 26.339  24.651 -2.077  1.00 141.79 ? -43 DA  I N6    1 
ATOM   6605  N  N1    . DA  I 5 30  ? 26.874  23.046 -0.497  1.00 141.97 ? -43 DA  I N1    1 
ATOM   6606  C  C2    . DA  I 5 30  ? 27.138  21.766 -0.204  1.00 142.00 ? -43 DA  I C2    1 
ATOM   6607  N  N3    . DA  I 5 30  ? 27.203  20.715 -1.016  1.00 142.01 ? -43 DA  I N3    1 
ATOM   6608  C  C4    . DA  I 5 30  ? 26.934  21.073 -2.279  1.00 141.97 ? -43 DA  I C4    1 
ATOM   6609  P  P     . DG  I 5 31  ? 25.844  14.557 -3.388  1.00 144.68 ? -42 DG  I P     1 
ATOM   6610  O  OP1   . DG  I 5 31  ? 26.631  13.300 -3.385  1.00 144.56 ? -42 DG  I OP1   1 
ATOM   6611  O  OP2   . DG  I 5 31  ? 24.774  14.754 -4.392  1.00 144.66 ? -42 DG  I OP2   1 
ATOM   6612  O  "O5'" . DG  I 5 31  ? 25.198  14.778 -1.936  1.00 145.82 ? -42 DG  I "O5'" 1 
ATOM   6613  C  "C5'" . DG  I 5 31  ? 25.985  14.571 -0.756  1.00 146.95 ? -42 DG  I "C5'" 1 
ATOM   6614  C  "C4'" . DG  I 5 31  ? 25.409  15.324 0.441   1.00 148.05 ? -42 DG  I "C4'" 1 
ATOM   6615  O  "O4'" . DG  I 5 31  ? 25.305  16.741 0.139   1.00 148.33 ? -42 DG  I "O4'" 1 
ATOM   6616  C  "C3'" . DG  I 5 31  ? 24.016  14.880 0.900   1.00 148.81 ? -42 DG  I "C3'" 1 
ATOM   6617  O  "O3'" . DG  I 5 31  ? 23.975  14.816 2.327   1.00 149.69 ? -42 DG  I "O3'" 1 
ATOM   6618  C  "C2'" . DG  I 5 31  ? 23.102  15.982 0.364   1.00 148.68 ? -42 DG  I "C2'" 1 
ATOM   6619  C  "C1'" . DG  I 5 31  ? 24.007  17.200 0.451   1.00 148.55 ? -42 DG  I "C1'" 1 
ATOM   6620  N  N9    . DG  I 5 31  ? 23.649  18.249 -0.497  1.00 148.62 ? -42 DG  I N9    1 
ATOM   6621  C  C8    . DG  I 5 31  ? 23.240  18.084 -1.800  1.00 148.64 ? -42 DG  I C8    1 
ATOM   6622  N  N7    . DG  I 5 31  ? 22.991  19.208 -2.413  1.00 148.65 ? -42 DG  I N7    1 
ATOM   6623  C  C5    . DG  I 5 31  ? 23.217  20.180 -1.445  1.00 148.65 ? -42 DG  I C5    1 
ATOM   6624  C  C6    . DG  I 5 31  ? 23.104  21.590 -1.522  1.00 148.63 ? -42 DG  I C6    1 
ATOM   6625  O  O6    . DG  I 5 31  ? 22.759  22.284 -2.492  1.00 148.57 ? -42 DG  I O6    1 
ATOM   6626  N  N1    . DG  I 5 31  ? 23.431  22.198 -0.310  1.00 148.64 ? -42 DG  I N1    1 
ATOM   6627  C  C2    . DG  I 5 31  ? 23.817  21.529 0.828   1.00 148.56 ? -42 DG  I C2    1 
ATOM   6628  N  N2    . DG  I 5 31  ? 24.111  22.287 1.891   1.00 148.53 ? -42 DG  I N2    1 
ATOM   6629  N  N3    . DG  I 5 31  ? 23.940  20.211 0.909   1.00 148.54 ? -42 DG  I N3    1 
ATOM   6630  C  C4    . DG  I 5 31  ? 23.616  19.603 -0.257  1.00 148.60 ? -42 DG  I C4    1 
ATOM   6631  P  P     . DG  I 5 32  ? 22.776  14.052 3.076   1.00 150.47 ? -41 DG  I P     1 
ATOM   6632  O  OP1   . DG  I 5 32  ? 23.377  13.221 4.149   1.00 150.57 ? -41 DG  I OP1   1 
ATOM   6633  O  OP2   . DG  I 5 32  ? 21.924  13.411 2.047   1.00 150.45 ? -41 DG  I OP2   1 
ATOM   6634  O  "O5'" . DG  I 5 32  ? 21.936  15.269 3.725   1.00 150.91 ? -41 DG  I "O5'" 1 
ATOM   6635  C  "C5'" . DG  I 5 32  ? 21.673  15.333 5.139   1.00 151.25 ? -41 DG  I "C5'" 1 
ATOM   6636  C  "C4'" . DG  I 5 32  ? 21.819  16.757 5.649   1.00 151.63 ? -41 DG  I "C4'" 1 
ATOM   6637  O  "O4'" . DG  I 5 32  ? 22.385  17.585 4.604   1.00 151.77 ? -41 DG  I "O4'" 1 
ATOM   6638  C  "C3'" . DG  I 5 32  ? 20.516  17.442 6.012   1.00 151.88 ? -41 DG  I "C3'" 1 
ATOM   6639  O  "O3'" . DG  I 5 32  ? 20.148  17.119 7.345   1.00 152.12 ? -41 DG  I "O3'" 1 
ATOM   6640  C  "C2'" . DG  I 5 32  ? 20.875  18.921 5.872   1.00 151.86 ? -41 DG  I "C2'" 1 
ATOM   6641  C  "C1'" . DG  I 5 32  ? 21.876  18.907 4.711   1.00 151.87 ? -41 DG  I "C1'" 1 
ATOM   6642  N  N9    . DG  I 5 32  ? 21.303  19.312 3.420   1.00 151.89 ? -41 DG  I N9    1 
ATOM   6643  C  C8    . DG  I 5 32  ? 20.747  18.497 2.458   1.00 151.88 ? -41 DG  I C8    1 
ATOM   6644  N  N7    . DG  I 5 32  ? 20.332  19.147 1.403   1.00 151.82 ? -41 DG  I N7    1 
ATOM   6645  C  C5    . DG  I 5 32  ? 20.635  20.475 1.681   1.00 151.78 ? -41 DG  I C5    1 
ATOM   6646  C  C6    . DG  I 5 32  ? 20.425  21.643 0.908   1.00 151.69 ? -41 DG  I C6    1 
ATOM   6647  O  O6    . DG  I 5 32  ? 19.929  21.742 -0.220  1.00 151.64 ? -41 DG  I O6    1 
ATOM   6648  N  N1    . DG  I 5 32  ? 20.885  22.778 1.561   1.00 151.79 ? -41 DG  I N1    1 
ATOM   6649  C  C2    . DG  I 5 32  ? 21.474  22.788 2.801   1.00 151.89 ? -41 DG  I C2    1 
ATOM   6650  N  N2    . DG  I 5 32  ? 21.862  23.982 3.267   1.00 152.01 ? -41 DG  I N2    1 
ATOM   6651  N  N3    . DG  I 5 32  ? 21.672  21.706 3.537   1.00 151.85 ? -41 DG  I N3    1 
ATOM   6652  C  C4    . DG  I 5 32  ? 21.228  20.590 2.918   1.00 151.83 ? -41 DG  I C4    1 
ATOM   6653  P  P     . DG  I 5 33  ? 18.633  16.721 7.674   1.00 152.39 ? -40 DG  I P     1 
ATOM   6654  O  OP1   . DG  I 5 33  ? 18.539  16.422 9.120   1.00 152.52 ? -40 DG  I OP1   1 
ATOM   6655  O  OP2   . DG  I 5 33  ? 18.208  15.706 6.683   1.00 152.37 ? -40 DG  I OP2   1 
ATOM   6656  O  "O5'" . DG  I 5 33  ? 17.831  18.071 7.374   1.00 152.44 ? -40 DG  I "O5'" 1 
ATOM   6657  C  "C5'" . DG  I 5 33  ? 17.973  19.198 8.234   1.00 152.48 ? -40 DG  I "C5'" 1 
ATOM   6658  C  "C4'" . DG  I 5 33  ? 17.228  20.390 7.671   1.00 152.55 ? -40 DG  I "C4'" 1 
ATOM   6659  O  "O4'" . DG  I 5 33  ? 17.684  20.647 6.313   1.00 152.62 ? -40 DG  I "O4'" 1 
ATOM   6660  C  "C3'" . DG  I 5 33  ? 15.706  20.215 7.590   1.00 152.49 ? -40 DG  I "C3'" 1 
ATOM   6661  O  "O3'" . DG  I 5 33  ? 15.052  21.378 8.079   1.00 152.30 ? -40 DG  I "O3'" 1 
ATOM   6662  C  "C2'" . DG  I 5 33  ? 15.448  20.017 6.097   1.00 152.57 ? -40 DG  I "C2'" 1 
ATOM   6663  C  "C1'" . DG  I 5 33  ? 16.564  20.841 5.478   1.00 152.59 ? -40 DG  I "C1'" 1 
ATOM   6664  N  N9    . DG  I 5 33  ? 16.892  20.417 4.117   1.00 152.55 ? -40 DG  I N9    1 
ATOM   6665  C  C8    . DG  I 5 33  ? 17.331  19.175 3.722   1.00 152.56 ? -40 DG  I C8    1 
ATOM   6666  N  N7    . DG  I 5 33  ? 17.448  19.051 2.428   1.00 152.53 ? -40 DG  I N7    1 
ATOM   6667  C  C5    . DG  I 5 33  ? 17.007  20.270 1.931   1.00 152.41 ? -40 DG  I C5    1 
ATOM   6668  C  C6    . DG  I 5 33  ? 16.868  20.710 0.596   1.00 152.26 ? -40 DG  I C6    1 
ATOM   6669  O  O6    . DG  I 5 33  ? 17.177  20.113 -0.445  1.00 152.23 ? -40 DG  I O6    1 
ATOM   6670  N  N1    . DG  I 5 33  ? 16.410  22.020 0.535   1.00 152.21 ? -40 DG  I N1    1 
ATOM   6671  C  C2    . DG  I 5 33  ? 16.063  22.781 1.624   1.00 152.18 ? -40 DG  I C2    1 
ATOM   6672  N  N2    . DG  I 5 33  ? 15.597  24.006 1.365   1.00 152.17 ? -40 DG  I N2    1 
ATOM   6673  N  N3    . DG  I 5 33  ? 16.160  22.372 2.877   1.00 152.25 ? -40 DG  I N3    1 
ATOM   6674  C  C4    . DG  I 5 33  ? 16.633  21.109 2.956   1.00 152.38 ? -40 DG  I C4    1 
ATOM   6675  P  P     . DT  I 5 34  ? 13.581  21.281 8.714   1.00 152.03 ? -39 DT  I P     1 
ATOM   6676  O  OP1   . DT  I 5 34  ? 13.731  21.025 10.164  1.00 152.05 ? -39 DT  I OP1   1 
ATOM   6677  O  OP2   . DT  I 5 34  ? 12.772  20.365 7.882   1.00 151.97 ? -39 DT  I OP2   1 
ATOM   6678  O  "O5'" . DT  I 5 34  ? 13.010  22.759 8.503   1.00 151.81 ? -39 DT  I "O5'" 1 
ATOM   6679  C  "C5'" . DT  I 5 34  ? 13.906  23.828 8.240   1.00 151.59 ? -39 DT  I "C5'" 1 
ATOM   6680  C  "C4'" . DT  I 5 34  ? 13.365  24.726 7.148   1.00 151.41 ? -39 DT  I "C4'" 1 
ATOM   6681  O  "O4'" . DT  I 5 34  ? 13.665  24.158 5.846   1.00 151.36 ? -39 DT  I "O4'" 1 
ATOM   6682  C  "C3'" . DT  I 5 34  ? 11.848  24.951 7.178   1.00 151.21 ? -39 DT  I "C3'" 1 
ATOM   6683  O  "O3'" . DT  I 5 34  ? 11.581  26.350 7.139   1.00 151.02 ? -39 DT  I "O3'" 1 
ATOM   6684  C  "C2'" . DT  I 5 34  ? 11.347  24.241 5.913   1.00 151.22 ? -39 DT  I "C2'" 1 
ATOM   6685  C  "C1'" . DT  I 5 34  ? 12.557  24.360 5.003   1.00 151.27 ? -39 DT  I "C1'" 1 
ATOM   6686  N  N1    . DT  I 5 34  ? 12.592  23.345 3.894   1.00 151.13 ? -39 DT  I N1    1 
ATOM   6687  C  C2    . DT  I 5 34  ? 12.822  23.766 2.601   1.00 151.01 ? -39 DT  I C2    1 
ATOM   6688  O  O2    . DT  I 5 34  ? 13.029  24.930 2.303   1.00 150.90 ? -39 DT  I O2    1 
ATOM   6689  N  N3    . DT  I 5 34  ? 12.824  22.764 1.666   1.00 150.90 ? -39 DT  I N3    1 
ATOM   6690  C  C4    . DT  I 5 34  ? 12.614  21.414 1.886   1.00 150.92 ? -39 DT  I C4    1 
ATOM   6691  O  O4    . DT  I 5 34  ? 12.648  20.635 0.941   1.00 150.92 ? -39 DT  I O4    1 
ATOM   6692  C  C5    . DT  I 5 34  ? 12.362  21.043 3.257   1.00 150.91 ? -39 DT  I C5    1 
ATOM   6693  C  C7    . DT  I 5 34  ? 12.119  19.607 3.616   1.00 150.85 ? -39 DT  I C7    1 
ATOM   6694  C  C6    . DT  I 5 34  ? 12.355  22.014 4.184   1.00 151.05 ? -39 DT  I C6    1 
ATOM   6695  P  P     . DT  I 5 35  ? 10.110  26.907 7.443   1.00 150.72 ? -38 DT  I P     1 
ATOM   6696  O  OP1   . DT  I 5 35  ? 10.248  28.193 8.174   1.00 150.75 ? -38 DT  I OP1   1 
ATOM   6697  O  OP2   . DT  I 5 35  ? 9.313   25.800 8.031   1.00 150.84 ? -38 DT  I OP2   1 
ATOM   6698  O  "O5'" . DT  I 5 35  ? 9.541   27.205 5.971   1.00 149.85 ? -38 DT  I "O5'" 1 
ATOM   6699  C  "C5'" . DT  I 5 35  ? 10.386  27.816 4.984   1.00 148.71 ? -38 DT  I "C5'" 1 
ATOM   6700  C  "C4'" . DT  I 5 35  ? 9.683   27.928 3.639   1.00 147.56 ? -38 DT  I "C4'" 1 
ATOM   6701  O  "O4'" . DT  I 5 35  ? 10.017  26.786 2.805   1.00 147.28 ? -38 DT  I "O4'" 1 
ATOM   6702  C  "C3'" . DT  I 5 35  ? 8.147   27.982 3.682   1.00 146.75 ? -38 DT  I "C3'" 1 
ATOM   6703  O  "O3'" . DT  I 5 35  ? 7.696   28.963 2.759   1.00 145.85 ? -38 DT  I "O3'" 1 
ATOM   6704  C  "C2'" . DT  I 5 35  ? 7.749   26.577 3.227   1.00 146.88 ? -38 DT  I "C2'" 1 
ATOM   6705  C  "C1'" . DT  I 5 35  ? 8.834   26.316 2.200   1.00 147.08 ? -38 DT  I "C1'" 1 
ATOM   6706  N  N1    . DT  I 5 35  ? 9.013   24.869 1.788   1.00 147.03 ? -38 DT  I N1    1 
ATOM   6707  C  C2    . DT  I 5 35  ? 9.951   24.570 0.829   1.00 147.01 ? -38 DT  I C2    1 
ATOM   6708  O  O2    . DT  I 5 35  ? 10.666  25.410 0.317   1.00 147.03 ? -38 DT  I O2    1 
ATOM   6709  N  N3    . DT  I 5 35  ? 10.033  23.244 0.496   1.00 146.94 ? -38 DT  I N3    1 
ATOM   6710  C  C4    . DT  I 5 35  ? 9.268   22.208 0.994   1.00 146.91 ? -38 DT  I C4    1 
ATOM   6711  O  O4    . DT  I 5 35  ? 9.456   21.066 0.587   1.00 146.88 ? -38 DT  I O4    1 
ATOM   6712  C  C5    . DT  I 5 35  ? 8.285   22.585 1.980   1.00 146.96 ? -38 DT  I C5    1 
ATOM   6713  C  C7    . DT  I 5 35  ? 7.401   21.541 2.598   1.00 146.95 ? -38 DT  I C7    1 
ATOM   6714  C  C6    . DT  I 5 35  ? 8.197   23.883 2.320   1.00 147.00 ? -38 DT  I C6    1 
ATOM   6715  P  P     . DA  I 5 36  ? 6.239   29.622 2.888   1.00 144.91 ? -37 DA  I P     1 
ATOM   6716  O  OP1   . DA  I 5 36  ? 6.361   30.835 3.729   1.00 144.97 ? -37 DA  I OP1   1 
ATOM   6717  O  OP2   . DA  I 5 36  ? 5.271   28.556 3.253   1.00 144.93 ? -37 DA  I OP2   1 
ATOM   6718  O  "O5'" . DA  I 5 36  ? 5.929   30.072 1.383   1.00 143.72 ? -37 DA  I "O5'" 1 
ATOM   6719  C  "C5'" . DA  I 5 36  ? 7.004   30.265 0.464   1.00 142.38 ? -37 DA  I "C5'" 1 
ATOM   6720  C  "C4'" . DA  I 5 36  ? 6.658   29.734 -0.916  1.00 140.97 ? -37 DA  I "C4'" 1 
ATOM   6721  O  "O4'" . DA  I 5 36  ? 7.032   28.337 -1.030  1.00 140.67 ? -37 DA  I "O4'" 1 
ATOM   6722  C  "C3'" . DA  I 5 36  ? 5.182   29.808 -1.308  1.00 139.92 ? -37 DA  I "C3'" 1 
ATOM   6723  O  "O3'" . DA  I 5 36  ? 5.104   30.232 -2.638  1.00 138.75 ? -37 DA  I "O3'" 1 
ATOM   6724  C  "C2'" . DA  I 5 36  ? 4.721   28.358 -1.174  1.00 140.11 ? -37 DA  I "C2'" 1 
ATOM   6725  C  "C1'" . DA  I 5 36  ? 5.970   27.635 -1.625  1.00 140.41 ? -37 DA  I "C1'" 1 
ATOM   6726  N  N9    . DA  I 5 36  ? 6.034   26.249 -1.201  1.00 140.54 ? -37 DA  I N9    1 
ATOM   6727  C  C8    . DA  I 5 36  ? 5.484   25.705 -0.079  1.00 140.60 ? -37 DA  I C8    1 
ATOM   6728  N  N7    . DA  I 5 36  ? 5.706   24.418 0.044   1.00 140.74 ? -37 DA  I N7    1 
ATOM   6729  C  C5    . DA  I 5 36  ? 6.448   24.098 -1.083  1.00 140.88 ? -37 DA  I C5    1 
ATOM   6730  C  C6    . DA  I 5 36  ? 6.998   22.881 -1.554  1.00 141.08 ? -37 DA  I C6    1 
ATOM   6731  N  N6    . DA  I 5 36  ? 6.879   21.715 -0.905  1.00 141.14 ? -37 DA  I N6    1 
ATOM   6732  N  N1    . DA  I 5 36  ? 7.677   22.912 -2.724  1.00 141.10 ? -37 DA  I N1    1 
ATOM   6733  C  C2    . DA  I 5 36  ? 7.793   24.079 -3.370  1.00 141.03 ? -37 DA  I C2    1 
ATOM   6734  N  N3    . DA  I 5 36  ? 7.322   25.279 -3.025  1.00 140.93 ? -37 DA  I N3    1 
ATOM   6735  C  C4    . DA  I 5 36  ? 6.653   25.217 -1.861  1.00 140.77 ? -37 DA  I C4    1 
ATOM   6736  P  P     . DG  I 5 37  ? 3.870   31.098 -3.156  1.00 137.63 ? -36 DG  I P     1 
ATOM   6737  O  OP1   . DG  I 5 37  ? 4.184   32.528 -2.920  1.00 137.60 ? -36 DG  I OP1   1 
ATOM   6738  O  OP2   . DG  I 5 37  ? 2.627   30.509 -2.608  1.00 137.64 ? -36 DG  I OP2   1 
ATOM   6739  O  "O5'" . DG  I 5 37  ? 3.904   30.806 -4.729  1.00 136.43 ? -36 DG  I "O5'" 1 
ATOM   6740  C  "C5'" . DG  I 5 37  ? 5.140   30.421 -5.351  1.00 135.22 ? -36 DG  I "C5'" 1 
ATOM   6741  C  "C4'" . DG  I 5 37  ? 4.984   29.151 -6.176  1.00 133.77 ? -36 DG  I "C4'" 1 
ATOM   6742  O  "O4'" . DG  I 5 37  ? 4.954   27.983 -5.313  1.00 133.73 ? -36 DG  I "O4'" 1 
ATOM   6743  C  "C3'" . DG  I 5 37  ? 3.717   29.069 -7.032  1.00 132.64 ? -36 DG  I "C3'" 1 
ATOM   6744  O  "O3'" . DG  I 5 37  ? 4.049   28.527 -8.270  1.00 130.90 ? -36 DG  I "O3'" 1 
ATOM   6745  C  "C2'" . DG  I 5 37  ? 2.844   28.095 -6.250  1.00 133.08 ? -36 DG  I "C2'" 1 
ATOM   6746  C  "C1'" . DG  I 5 37  ? 3.911   27.149 -5.751  1.00 133.56 ? -36 DG  I "C1'" 1 
ATOM   6747  N  N9    . DG  I 5 37  ? 3.482   26.284 -4.665  1.00 133.92 ? -36 DG  I N9    1 
ATOM   6748  C  C8    . DG  I 5 37  ? 2.658   26.606 -3.612  1.00 134.00 ? -36 DG  I C8    1 
ATOM   6749  N  N7    . DG  I 5 37  ? 2.405   25.595 -2.828  1.00 134.11 ? -36 DG  I N7    1 
ATOM   6750  C  C5    . DG  I 5 37  ? 3.072   24.529 -3.425  1.00 134.24 ? -36 DG  I C5    1 
ATOM   6751  C  C6    . DG  I 5 37  ? 3.159   23.168 -3.039  1.00 134.37 ? -36 DG  I C6    1 
ATOM   6752  O  O6    . DG  I 5 37  ? 2.640   22.614 -2.061  1.00 134.45 ? -36 DG  I O6    1 
ATOM   6753  N  N1    . DG  I 5 37  ? 3.942   22.427 -3.928  1.00 134.39 ? -36 DG  I N1    1 
ATOM   6754  C  C2    . DG  I 5 37  ? 4.560   22.940 -5.047  1.00 134.34 ? -36 DG  I C2    1 
ATOM   6755  N  N2    . DG  I 5 37  ? 5.274   22.080 -5.786  1.00 134.34 ? -36 DG  I N2    1 
ATOM   6756  N  N3    . DG  I 5 37  ? 4.480   24.208 -5.418  1.00 134.27 ? -36 DG  I N3    1 
ATOM   6757  C  C4    . DG  I 5 37  ? 3.721   24.939 -4.566  1.00 134.16 ? -36 DG  I C4    1 
ATOM   6758  P  P     . DG  I 5 38  ? 3.881   29.394 -9.584  1.00 129.35 ? -35 DG  I P     1 
ATOM   6759  O  OP1   . DG  I 5 38  ? 4.790   30.558 -9.474  1.00 129.24 ? -35 DG  I OP1   1 
ATOM   6760  O  OP2   . DG  I 5 38  ? 2.431   29.595 -9.816  1.00 129.16 ? -35 DG  I OP2   1 
ATOM   6761  O  "O5'" . DG  I 5 38  ? 4.436   28.405 -10.706 1.00 128.13 ? -35 DG  I "O5'" 1 
ATOM   6762  C  "C5'" . DG  I 5 38  ? 5.688   27.740 -10.511 1.00 126.80 ? -35 DG  I "C5'" 1 
ATOM   6763  C  "C4'" . DG  I 5 38  ? 5.620   26.282 -10.945 1.00 125.41 ? -35 DG  I "C4'" 1 
ATOM   6764  O  "O4'" . DG  I 5 38  ? 4.912   25.507 -9.945  1.00 125.00 ? -35 DG  I "O4'" 1 
ATOM   6765  C  "C3'" . DG  I 5 38  ? 4.915   26.014 -12.273 1.00 124.48 ? -35 DG  I "C3'" 1 
ATOM   6766  O  "O3'" . DG  I 5 38  ? 5.582   24.970 -12.979 1.00 123.28 ? -35 DG  I "O3'" 1 
ATOM   6767  C  "C2'" . DG  I 5 38  ? 3.513   25.599 -11.839 1.00 124.68 ? -35 DG  I "C2'" 1 
ATOM   6768  C  "C1'" . DG  I 5 38  ? 3.774   24.897 -10.517 1.00 124.83 ? -35 DG  I "C1'" 1 
ATOM   6769  N  N9    . DG  I 5 38  ? 2.669   25.033 -9.584  1.00 124.84 ? -35 DG  I N9    1 
ATOM   6770  C  C8    . DG  I 5 38  ? 1.851   26.126 -9.426  1.00 124.94 ? -35 DG  I C8    1 
ATOM   6771  N  N7    . DG  I 5 38  ? 0.930   25.958 -8.520  1.00 124.96 ? -35 DG  I N7    1 
ATOM   6772  C  C5    . DG  I 5 38  ? 1.148   24.669 -8.056  1.00 124.93 ? -35 DG  I C5    1 
ATOM   6773  C  C6    . DG  I 5 38  ? 0.451   23.928 -7.080  1.00 124.98 ? -35 DG  I C6    1 
ATOM   6774  O  O6    . DG  I 5 38  ? -0.514  24.287 -6.392  1.00 124.98 ? -35 DG  I O6    1 
ATOM   6775  N  N1    . DG  I 5 38  ? 0.984   22.649 -6.929  1.00 124.99 ? -35 DG  I N1    1 
ATOM   6776  C  C2    . DG  I 5 38  ? 2.055   22.154 -7.638  1.00 124.99 ? -35 DG  I C2    1 
ATOM   6777  N  N2    . DG  I 5 38  ? 2.425   20.894 -7.359  1.00 125.04 ? -35 DG  I N2    1 
ATOM   6778  N  N3    . DG  I 5 38  ? 2.718   22.843 -8.554  1.00 124.91 ? -35 DG  I N3    1 
ATOM   6779  C  C4    . DG  I 5 38  ? 2.199   24.080 -8.722  1.00 124.88 ? -35 DG  I C4    1 
ATOM   6780  P  P     . DG  I 5 39  ? 5.161   24.592 -14.477 1.00 122.18 ? -34 DG  I P     1 
ATOM   6781  O  OP1   . DG  I 5 39  ? 6.397   24.497 -15.276 1.00 122.06 ? -34 DG  I OP1   1 
ATOM   6782  O  OP2   . DG  I 5 39  ? 4.062   25.486 -14.909 1.00 121.89 ? -34 DG  I OP2   1 
ATOM   6783  O  "O5'" . DG  I 5 39  ? 4.562   23.135 -14.302 1.00 122.01 ? -34 DG  I "O5'" 1 
ATOM   6784  C  "C5'" . DG  I 5 39  ? 5.262   22.186 -13.516 1.00 121.99 ? -34 DG  I "C5'" 1 
ATOM   6785  C  "C4'" . DG  I 5 39  ? 4.337   21.082 -13.040 1.00 121.88 ? -34 DG  I "C4'" 1 
ATOM   6786  O  "O4'" . DG  I 5 39  ? 3.330   21.623 -12.149 1.00 121.91 ? -34 DG  I "O4'" 1 
ATOM   6787  C  "C3'" . DG  I 5 39  ? 3.584   20.345 -14.137 1.00 121.78 ? -34 DG  I "C3'" 1 
ATOM   6788  O  "O3'" . DG  I 5 39  ? 3.583   18.981 -13.839 1.00 121.68 ? -34 DG  I "O3'" 1 
ATOM   6789  C  "C2'" . DG  I 5 39  ? 2.175   20.940 -14.061 1.00 121.81 ? -34 DG  I "C2'" 1 
ATOM   6790  C  "C1'" . DG  I 5 39  ? 2.046   21.228 -12.577 1.00 121.95 ? -34 DG  I "C1'" 1 
ATOM   6791  N  N9    . DG  I 5 39  ? 1.108   22.303 -12.258 1.00 122.34 ? -34 DG  I N9    1 
ATOM   6792  C  C8    . DG  I 5 39  ? 0.956   23.498 -12.922 1.00 122.52 ? -34 DG  I C8    1 
ATOM   6793  N  N7    . DG  I 5 39  ? 0.089   24.301 -12.361 1.00 122.56 ? -34 DG  I N7    1 
ATOM   6794  C  C5    . DG  I 5 39  ? -0.373  23.586 -11.264 1.00 122.60 ? -34 DG  I C5    1 
ATOM   6795  C  C6    . DG  I 5 39  ? -1.351  23.928 -10.300 1.00 122.69 ? -34 DG  I C6    1 
ATOM   6796  O  O6    . DG  I 5 39  ? -2.017  24.970 -10.219 1.00 122.68 ? -34 DG  I O6    1 
ATOM   6797  N  N1    . DG  I 5 39  ? -1.508  22.920 -9.347  1.00 122.75 ? -34 DG  I N1    1 
ATOM   6798  C  C2    . DG  I 5 39  ? -0.823  21.723 -9.345  1.00 122.76 ? -34 DG  I C2    1 
ATOM   6799  N  N2    . DG  I 5 39  ? -1.117  20.867 -8.353  1.00 122.82 ? -34 DG  I N2    1 
ATOM   6800  N  N3    . DG  I 5 39  ? 0.082   21.385 -10.253 1.00 122.66 ? -34 DG  I N3    1 
ATOM   6801  C  C4    . DG  I 5 39  ? 0.253   22.359 -11.180 1.00 122.54 ? -34 DG  I C4    1 
ATOM   6802  P  P     . DT  I 5 40  ? 3.677   17.901 -15.000 1.00 121.68 ? -33 DT  I P     1 
ATOM   6803  O  OP1   . DT  I 5 40  ? 5.090   17.479 -15.109 1.00 121.46 ? -33 DT  I OP1   1 
ATOM   6804  O  OP2   . DT  I 5 40  ? 2.965   18.433 -16.180 1.00 121.41 ? -33 DT  I OP2   1 
ATOM   6805  O  "O5'" . DT  I 5 40  ? 2.811   16.700 -14.395 1.00 122.61 ? -33 DT  I "O5'" 1 
ATOM   6806  C  "C5'" . DT  I 5 40  ? 2.967   16.356 -13.015 1.00 123.48 ? -33 DT  I "C5'" 1 
ATOM   6807  C  "C4'" . DT  I 5 40  ? 1.653   15.917 -12.375 1.00 124.29 ? -33 DT  I "C4'" 1 
ATOM   6808  O  "O4'" . DT  I 5 40  ? 0.931   17.063 -11.860 1.00 124.27 ? -33 DT  I "O4'" 1 
ATOM   6809  C  "C3'" . DT  I 5 40  ? 0.672   15.162 -13.284 1.00 125.11 ? -33 DT  I "C3'" 1 
ATOM   6810  O  "O3'" . DT  I 5 40  ? 0.347   13.903 -12.693 1.00 126.25 ? -33 DT  I "O3'" 1 
ATOM   6811  C  "C2'" . DT  I 5 40  ? -0.551  16.079 -13.337 1.00 124.71 ? -33 DT  I "C2'" 1 
ATOM   6812  C  "C1'" . DT  I 5 40  ? -0.437  16.821 -12.018 1.00 124.37 ? -33 DT  I "C1'" 1 
ATOM   6813  N  N1    . DT  I 5 40  ? -1.165  18.113 -11.994 1.00 124.26 ? -33 DT  I N1    1 
ATOM   6814  C  C2    . DT  I 5 40  ? -1.772  18.511 -10.831 1.00 124.27 ? -33 DT  I C2    1 
ATOM   6815  O  O2    . DT  I 5 40  ? -1.695  17.884 -9.788  1.00 124.27 ? -33 DT  I O2    1 
ATOM   6816  N  N3    . DT  I 5 40  ? -2.458  19.693 -10.923 1.00 124.29 ? -33 DT  I N3    1 
ATOM   6817  C  C4    . DT  I 5 40  ? -2.612  20.486 -12.048 1.00 124.27 ? -33 DT  I C4    1 
ATOM   6818  O  O4    . DT  I 5 40  ? -3.264  21.520 -11.976 1.00 124.31 ? -33 DT  I O4    1 
ATOM   6819  C  C5    . DT  I 5 40  ? -1.963  19.999 -13.240 1.00 124.23 ? -33 DT  I C5    1 
ATOM   6820  C  C7    . DT  I 5 40  ? -2.052  20.774 -14.523 1.00 124.17 ? -33 DT  I C7    1 
ATOM   6821  C  C6    . DT  I 5 40  ? -1.282  18.852 -13.157 1.00 124.24 ? -33 DT  I C6    1 
ATOM   6822  P  P     . DT  I 5 41  ? -0.533  12.828 -13.489 1.00 127.20 ? -32 DT  I P     1 
ATOM   6823  O  OP1   . DT  I 5 41  ? -0.071  11.483 -13.065 1.00 127.13 ? -32 DT  I OP1   1 
ATOM   6824  O  OP2   . DT  I 5 41  ? -0.515  13.189 -14.928 1.00 127.20 ? -32 DT  I OP2   1 
ATOM   6825  O  "O5'" . DT  I 5 41  ? -2.020  13.115 -12.930 1.00 128.29 ? -32 DT  I "O5'" 1 
ATOM   6826  C  "C5'" . DT  I 5 41  ? -2.691  12.174 -12.080 1.00 129.46 ? -32 DT  I "C5'" 1 
ATOM   6827  C  "C4'" . DT  I 5 41  ? -3.716  12.867 -11.199 1.00 130.53 ? -32 DT  I "C4'" 1 
ATOM   6828  O  "O4'" . DT  I 5 41  ? -3.444  14.278 -11.170 1.00 130.76 ? -32 DT  I "O4'" 1 
ATOM   6829  C  "C3'" . DT  I 5 41  ? -5.151  12.775 -11.682 1.00 131.40 ? -32 DT  I "C3'" 1 
ATOM   6830  O  "O3'" . DT  I 5 41  ? -5.735  11.567 -11.241 1.00 132.52 ? -32 DT  I "O3'" 1 
ATOM   6831  C  "C2'" . DT  I 5 41  ? -5.797  13.977 -11.002 1.00 131.17 ? -32 DT  I "C2'" 1 
ATOM   6832  C  "C1'" . DT  I 5 41  ? -4.645  14.979 -10.921 1.00 131.04 ? -32 DT  I "C1'" 1 
ATOM   6833  N  N1    . DT  I 5 41  ? -4.757  16.069 -11.895 1.00 131.23 ? -32 DT  I N1    1 
ATOM   6834  C  C2    . DT  I 5 41  ? -5.438  17.201 -11.542 1.00 131.36 ? -32 DT  I C2    1 
ATOM   6835  O  O2    . DT  I 5 41  ? -5.944  17.355 -10.448 1.00 131.34 ? -32 DT  I O2    1 
ATOM   6836  N  N3    . DT  I 5 41  ? -5.492  18.162 -12.514 1.00 131.50 ? -32 DT  I N3    1 
ATOM   6837  C  C4    . DT  I 5 41  ? -4.951  18.088 -13.786 1.00 131.60 ? -32 DT  I C4    1 
ATOM   6838  O  O4    . DT  I 5 41  ? -5.071  19.040 -14.550 1.00 131.73 ? -32 DT  I O4    1 
ATOM   6839  C  C5    . DT  I 5 41  ? -4.258  16.859 -14.092 1.00 131.52 ? -32 DT  I C5    1 
ATOM   6840  C  C7    . DT  I 5 41  ? -3.628  16.660 -15.437 1.00 131.61 ? -32 DT  I C7    1 
ATOM   6841  C  C6    . DT  I 5 41  ? -4.197  15.921 -13.143 1.00 131.35 ? -32 DT  I C6    1 
ATOM   6842  P  P     . DA  I 5 42  ? -6.790  10.808 -12.170 1.00 133.62 ? -31 DA  I P     1 
ATOM   6843  O  OP1   . DA  I 5 42  ? -7.061  9.487  -11.559 1.00 133.73 ? -31 DA  I OP1   1 
ATOM   6844  O  OP2   . DA  I 5 42  ? -6.314  10.894 -13.572 1.00 133.71 ? -31 DA  I OP2   1 
ATOM   6845  O  "O5'" . DA  I 5 42  ? -8.095  11.713 -12.049 1.00 134.34 ? -31 DA  I "O5'" 1 
ATOM   6846  C  "C5'" . DA  I 5 42  ? -8.831  11.754 -10.840 1.00 135.07 ? -31 DA  I "C5'" 1 
ATOM   6847  C  "C4'" . DA  I 5 42  ? -9.974  12.730 -10.977 1.00 135.86 ? -31 DA  I "C4'" 1 
ATOM   6848  O  "O4'" . DA  I 5 42  ? -9.438  14.030 -11.355 1.00 136.14 ? -31 DA  I "O4'" 1 
ATOM   6849  C  "C3'" . DA  I 5 42  ? -10.993 12.355 -12.057 1.00 136.38 ? -31 DA  I "C3'" 1 
ATOM   6850  O  "O3'" . DA  I 5 42  ? -12.314 12.481 -11.557 1.00 136.86 ? -31 DA  I "O3'" 1 
ATOM   6851  C  "C2'" . DA  I 5 42  ? -10.719 13.353 -13.181 1.00 136.40 ? -31 DA  I "C2'" 1 
ATOM   6852  C  "C1'" . DA  I 5 42  ? -10.197 14.556 -12.417 1.00 136.32 ? -31 DA  I "C1'" 1 
ATOM   6853  N  N9    . DA  I 5 42  ? -9.351  15.428 -13.233 1.00 136.38 ? -31 DA  I N9    1 
ATOM   6854  C  C8    . DA  I 5 42  ? -8.246  15.065 -13.955 1.00 136.39 ? -31 DA  I C8    1 
ATOM   6855  N  N7    . DA  I 5 42  ? -7.729  16.044 -14.662 1.00 136.38 ? -31 DA  I N7    1 
ATOM   6856  C  C5    . DA  I 5 42  ? -8.575  17.112 -14.415 1.00 136.40 ? -31 DA  I C5    1 
ATOM   6857  C  C6    . DA  I 5 42  ? -8.575  18.447 -14.866 1.00 136.46 ? -31 DA  I C6    1 
ATOM   6858  N  N6    . DA  I 5 42  ? -7.666  18.936 -15.716 1.00 136.49 ? -31 DA  I N6    1 
ATOM   6859  N  N1    . DA  I 5 42  ? -9.559  19.257 -14.422 1.00 136.43 ? -31 DA  I N1    1 
ATOM   6860  C  C2    . DA  I 5 42  ? -10.481 18.756 -13.593 1.00 136.39 ? -31 DA  I C2    1 
ATOM   6861  N  N3    . DA  I 5 42  ? -10.588 17.522 -13.106 1.00 136.36 ? -31 DA  I N3    1 
ATOM   6862  C  C4    . DA  I 5 42  ? -9.595  16.743 -13.558 1.00 136.38 ? -31 DA  I C4    1 
ATOM   6863  P  P     . DG  I 5 43  ? -13.539 11.849 -12.369 1.00 137.33 ? -30 DG  I P     1 
ATOM   6864  O  OP1   . DG  I 5 43  ? -14.500 11.306 -11.381 1.00 137.43 ? -30 DG  I OP1   1 
ATOM   6865  O  OP2   . DG  I 5 43  ? -12.986 10.966 -13.424 1.00 137.31 ? -30 DG  I OP2   1 
ATOM   6866  O  "O5'" . DG  I 5 43  ? -14.193 13.124 -13.085 1.00 137.70 ? -30 DG  I "O5'" 1 
ATOM   6867  C  "C5'" . DG  I 5 43  ? -14.893 14.096 -12.311 1.00 138.13 ? -30 DG  I "C5'" 1 
ATOM   6868  C  "C4'" . DG  I 5 43  ? -14.698 15.493 -12.879 1.00 138.57 ? -30 DG  I "C4'" 1 
ATOM   6869  O  "O4'" . DG  I 5 43  ? -13.334 15.643 -13.358 1.00 138.76 ? -30 DG  I "O4'" 1 
ATOM   6870  C  "C3'" . DG  I 5 43  ? -15.561 15.823 -14.083 1.00 138.62 ? -30 DG  I "C3'" 1 
ATOM   6871  O  "O3'" . DG  I 5 43  ? -16.860 16.262 -13.656 1.00 138.48 ? -30 DG  I "O3'" 1 
ATOM   6872  C  "C2'" . DG  I 5 43  ? -14.760 16.955 -14.734 1.00 138.75 ? -30 DG  I "C2'" 1 
ATOM   6873  C  "C1'" . DG  I 5 43  ? -13.310 16.524 -14.475 1.00 138.83 ? -30 DG  I "C1'" 1 
ATOM   6874  N  N9    . DG  I 5 43  ? -12.685 15.838 -15.614 1.00 138.88 ? -30 DG  I N9    1 
ATOM   6875  C  C8    . DG  I 5 43  ? -12.682 14.487 -15.868 1.00 138.98 ? -30 DG  I C8    1 
ATOM   6876  N  N7    . DG  I 5 43  ? -12.064 14.164 -16.970 1.00 138.96 ? -30 DG  I N7    1 
ATOM   6877  C  C5    . DG  I 5 43  ? -11.646 15.378 -17.493 1.00 138.99 ? -30 DG  I C5    1 
ATOM   6878  C  C6    . DG  I 5 43  ? -10.934 15.660 -18.683 1.00 139.01 ? -30 DG  I C6    1 
ATOM   6879  O  O6    . DG  I 5 43  ? -10.517 14.864 -19.538 1.00 138.94 ? -30 DG  I O6    1 
ATOM   6880  N  N1    . DG  I 5 43  ? -10.725 17.027 -18.843 1.00 139.13 ? -30 DG  I N1    1 
ATOM   6881  C  C2    . DG  I 5 43  ? -11.152 17.999 -17.964 1.00 139.18 ? -30 DG  I C2    1 
ATOM   6882  N  N2    . DG  I 5 43  ? -10.858 19.269 -18.290 1.00 139.21 ? -30 DG  I N2    1 
ATOM   6883  N  N3    . DG  I 5 43  ? -11.817 17.746 -16.844 1.00 139.08 ? -30 DG  I N3    1 
ATOM   6884  C  C4    . DG  I 5 43  ? -12.028 16.421 -16.673 1.00 139.00 ? -30 DG  I C4    1 
ATOM   6885  P  P     . DG  I 5 44  ? -18.137 15.321 -13.888 1.00 138.26 ? -29 DG  I P     1 
ATOM   6886  O  OP1   . DG  I 5 44  ? -18.944 15.344 -12.648 1.00 138.28 ? -29 DG  I OP1   1 
ATOM   6887  O  OP2   . DG  I 5 44  ? -17.650 14.028 -14.425 1.00 138.12 ? -29 DG  I OP2   1 
ATOM   6888  O  "O5'" . DG  I 5 44  ? -18.944 16.067 -15.062 1.00 138.24 ? -29 DG  I "O5'" 1 
ATOM   6889  C  "C5'" . DG  I 5 44  ? -19.742 17.233 -14.786 1.00 138.22 ? -29 DG  I "C5'" 1 
ATOM   6890  C  "C4'" . DG  I 5 44  ? -19.142 18.458 -15.455 1.00 138.20 ? -29 DG  I "C4'" 1 
ATOM   6891  O  "O4'" . DG  I 5 44  ? -17.689 18.316 -15.437 1.00 138.34 ? -29 DG  I "O4'" 1 
ATOM   6892  C  "C3'" . DG  I 5 44  ? -19.477 18.618 -16.939 1.00 138.07 ? -29 DG  I "C3'" 1 
ATOM   6893  O  "O3'" . DG  I 5 44  ? -20.687 19.346 -17.136 1.00 137.70 ? -29 DG  I "O3'" 1 
ATOM   6894  C  "C2'" . DG  I 5 44  ? -18.270 19.396 -17.446 1.00 138.26 ? -29 DG  I "C2'" 1 
ATOM   6895  C  "C1'" . DG  I 5 44  ? -17.139 18.717 -16.694 1.00 138.41 ? -29 DG  I "C1'" 1 
ATOM   6896  N  N9    . DG  I 5 44  ? -16.569 17.549 -17.408 1.00 138.48 ? -29 DG  I N9    1 
ATOM   6897  C  C8    . DG  I 5 44  ? -17.041 16.252 -17.402 1.00 138.51 ? -29 DG  I C8    1 
ATOM   6898  N  N7    . DG  I 5 44  ? -16.359 15.445 -18.167 1.00 138.46 ? -29 DG  I N7    1 
ATOM   6899  C  C5    . DG  I 5 44  ? -15.390 16.255 -18.740 1.00 138.40 ? -29 DG  I C5    1 
ATOM   6900  C  C6    . DG  I 5 44  ? -14.347 15.927 -19.640 1.00 138.31 ? -29 DG  I C6    1 
ATOM   6901  O  O6    . DG  I 5 44  ? -14.089 14.827 -20.154 1.00 138.22 ? -29 DG  I O6    1 
ATOM   6902  N  N1    . DG  I 5 44  ? -13.599 17.050 -19.985 1.00 138.33 ? -29 DG  I N1    1 
ATOM   6903  C  C2    . DG  I 5 44  ? -13.800 18.317 -19.483 1.00 138.31 ? -29 DG  I C2    1 
ATOM   6904  N  N2    . DG  I 5 44  ? -12.963 19.266 -19.917 1.00 138.34 ? -29 DG  I N2    1 
ATOM   6905  N  N3    . DG  I 5 44  ? -14.767 18.636 -18.634 1.00 138.32 ? -29 DG  I N3    1 
ATOM   6906  C  C4    . DG  I 5 44  ? -15.518 17.558 -18.302 1.00 138.40 ? -29 DG  I C4    1 
ATOM   6907  P  P     . DG  I 5 45  ? -21.400 19.322 -18.580 1.00 137.37 ? -28 DG  I P     1 
ATOM   6908  O  OP1   . DG  I 5 45  ? -22.863 19.311 -18.372 1.00 137.36 ? -28 DG  I OP1   1 
ATOM   6909  O  OP2   . DG  I 5 45  ? -20.764 18.254 -19.388 1.00 137.34 ? -28 DG  I OP2   1 
ATOM   6910  O  "O5'" . DG  I 5 45  ? -20.982 20.729 -19.216 1.00 137.12 ? -28 DG  I "O5'" 1 
ATOM   6911  C  "C5'" . DG  I 5 45  ? -20.850 21.883 -18.384 1.00 136.95 ? -28 DG  I "C5'" 1 
ATOM   6912  C  "C4'" . DG  I 5 45  ? -19.835 22.867 -18.952 1.00 136.70 ? -28 DG  I "C4'" 1 
ATOM   6913  O  "O4'" . DG  I 5 45  ? -18.563 22.202 -19.173 1.00 136.71 ? -28 DG  I "O4'" 1 
ATOM   6914  C  "C3'" . DG  I 5 45  ? -20.212 23.490 -20.289 1.00 136.54 ? -28 DG  I "C3'" 1 
ATOM   6915  O  "O3'" . DG  I 5 45  ? -19.685 24.809 -20.375 1.00 136.24 ? -28 DG  I "O3'" 1 
ATOM   6916  C  "C2'" . DG  I 5 45  ? -19.539 22.559 -21.284 1.00 136.62 ? -28 DG  I "C2'" 1 
ATOM   6917  C  "C1'" . DG  I 5 45  ? -18.250 22.208 -20.552 1.00 136.79 ? -28 DG  I "C1'" 1 
ATOM   6918  N  N9    . DG  I 5 45  ? -17.721 20.896 -20.916 1.00 137.03 ? -28 DG  I N9    1 
ATOM   6919  C  C8    . DG  I 5 45  ? -18.356 19.680 -20.799 1.00 137.15 ? -28 DG  I C8    1 
ATOM   6920  N  N7    . DG  I 5 45  ? -17.639 18.675 -21.214 1.00 137.12 ? -28 DG  I N7    1 
ATOM   6921  C  C5    . DG  I 5 45  ? -16.479 19.269 -21.690 1.00 137.17 ? -28 DG  I C5    1 
ATOM   6922  C  C6    . DG  I 5 45  ? -15.353 18.688 -22.301 1.00 137.33 ? -28 DG  I C6    1 
ATOM   6923  O  O6    . DG  I 5 45  ? -15.139 17.491 -22.518 1.00 137.41 ? -28 DG  I O6    1 
ATOM   6924  N  N1    . DG  I 5 45  ? -14.405 19.647 -22.654 1.00 137.27 ? -28 DG  I N1    1 
ATOM   6925  C  C2    . DG  I 5 45  ? -14.535 20.997 -22.434 1.00 137.21 ? -28 DG  I C2    1 
ATOM   6926  N  N2    . DG  I 5 45  ? -13.520 21.768 -22.847 1.00 137.26 ? -28 DG  I N2    1 
ATOM   6927  N  N3    . DG  I 5 45  ? -15.597 21.557 -21.879 1.00 137.11 ? -28 DG  I N3    1 
ATOM   6928  C  C4    . DG  I 5 45  ? -16.526 20.637 -21.536 1.00 137.11 ? -28 DG  I C4    1 
ATOM   6929  P  P     . DT  I 5 46  ? -20.380 25.896 -21.327 1.00 135.85 ? -27 DT  I P     1 
ATOM   6930  O  OP1   . DT  I 5 46  ? -20.029 27.244 -20.816 1.00 136.03 ? -27 DT  I OP1   1 
ATOM   6931  O  OP2   . DT  I 5 46  ? -21.802 25.515 -21.489 1.00 135.86 ? -27 DT  I OP2   1 
ATOM   6932  O  "O5'" . DT  I 5 46  ? -19.651 25.664 -22.736 1.00 135.08 ? -27 DT  I "O5'" 1 
ATOM   6933  C  "C5'" . DT  I 5 46  ? -18.219 25.588 -22.819 1.00 134.31 ? -27 DT  I "C5'" 1 
ATOM   6934  C  "C4'" . DT  I 5 46  ? -17.776 25.031 -24.167 1.00 133.48 ? -27 DT  I "C4'" 1 
ATOM   6935  O  "O4'" . DT  I 5 46  ? -17.485 23.610 -24.051 1.00 133.48 ? -27 DT  I "O4'" 1 
ATOM   6936  C  "C3'" . DT  I 5 46  ? -18.801 25.167 -25.297 1.00 132.90 ? -27 DT  I "C3'" 1 
ATOM   6937  O  "O3'" . DT  I 5 46  ? -18.189 25.720 -26.424 1.00 132.01 ? -27 DT  I "O3'" 1 
ATOM   6938  C  "C2'" . DT  I 5 46  ? -19.254 23.728 -25.552 1.00 133.17 ? -27 DT  I "C2'" 1 
ATOM   6939  C  "C1'" . DT  I 5 46  ? -18.004 22.948 -25.179 1.00 133.46 ? -27 DT  I "C1'" 1 
ATOM   6940  N  N1    . DT  I 5 46  ? -18.243 21.484 -24.839 1.00 133.77 ? -27 DT  I N1    1 
ATOM   6941  C  C2    . DT  I 5 46  ? -17.222 20.583 -25.033 1.00 133.93 ? -27 DT  I C2    1 
ATOM   6942  O  O2    . DT  I 5 46  ? -16.123 20.906 -25.438 1.00 133.95 ? -27 DT  I O2    1 
ATOM   6943  N  N3    . DT  I 5 46  ? -17.528 19.285 -24.711 1.00 134.05 ? -27 DT  I N3    1 
ATOM   6944  C  C4    . DT  I 5 46  ? -18.738 18.798 -24.241 1.00 134.12 ? -27 DT  I C4    1 
ATOM   6945  O  O4    . DT  I 5 46  ? -18.851 17.598 -23.986 1.00 134.15 ? -27 DT  I O4    1 
ATOM   6946  C  C5    . DT  I 5 46  ? -19.777 19.793 -24.072 1.00 134.04 ? -27 DT  I C5    1 
ATOM   6947  C  C7    . DT  I 5 46  ? -21.135 19.393 -23.564 1.00 134.00 ? -27 DT  I C7    1 
ATOM   6948  C  C6    . DT  I 5 46  ? -19.489 21.066 -24.398 1.00 133.92 ? -27 DT  I C6    1 
ATOM   6949  P  P     . DT  I 5 47  ? -18.888 26.922 -27.209 1.00 131.16 ? -26 DT  I P     1 
ATOM   6950  O  OP1   . DT  I 5 47  ? -19.184 27.993 -26.233 1.00 131.15 ? -26 DT  I OP1   1 
ATOM   6951  O  OP2   . DT  I 5 47  ? -19.973 26.352 -28.043 1.00 131.16 ? -26 DT  I OP2   1 
ATOM   6952  O  "O5'" . DT  I 5 47  ? -17.721 27.416 -28.177 1.00 130.26 ? -26 DT  I "O5'" 1 
ATOM   6953  C  "C5'" . DT  I 5 47  ? -16.388 27.416 -27.701 1.00 129.27 ? -26 DT  I "C5'" 1 
ATOM   6954  C  "C4'" . DT  I 5 47  ? -15.575 26.302 -28.340 1.00 128.29 ? -26 DT  I "C4'" 1 
ATOM   6955  O  "O4'" . DT  I 5 47  ? -16.104 25.003 -27.981 1.00 128.05 ? -26 DT  I "O4'" 1 
ATOM   6956  C  "C3'" . DT  I 5 47  ? -15.514 26.324 -29.865 1.00 127.52 ? -26 DT  I "C3'" 1 
ATOM   6957  O  "O3'" . DT  I 5 47  ? -14.177 26.522 -30.251 1.00 126.79 ? -26 DT  I "O3'" 1 
ATOM   6958  C  "C2'" . DT  I 5 47  ? -16.027 24.928 -30.284 1.00 127.66 ? -26 DT  I "C2'" 1 
ATOM   6959  C  "C1'" . DT  I 5 47  ? -15.793 24.117 -29.024 1.00 127.80 ? -26 DT  I "C1'" 1 
ATOM   6960  N  N1    . DT  I 5 47  ? -16.650 22.878 -28.899 1.00 127.70 ? -26 DT  I N1    1 
ATOM   6961  C  C2    . DT  I 5 47  ? -16.039 21.644 -28.779 1.00 127.65 ? -26 DT  I C2    1 
ATOM   6962  O  O2    . DT  I 5 47  ? -14.829 21.491 -28.787 1.00 127.67 ? -26 DT  I O2    1 
ATOM   6963  N  N3    . DT  I 5 47  ? -16.900 20.590 -28.617 1.00 127.56 ? -26 DT  I N3    1 
ATOM   6964  C  C4    . DT  I 5 47  ? -18.280 20.639 -28.564 1.00 127.50 ? -26 DT  I C4    1 
ATOM   6965  O  O4    . DT  I 5 47  ? -18.914 19.597 -28.437 1.00 127.37 ? -26 DT  I O4    1 
ATOM   6966  C  C5    . DT  I 5 47  ? -18.859 21.954 -28.724 1.00 127.60 ? -26 DT  I C5    1 
ATOM   6967  C  C7    . DT  I 5 47  ? -20.351 22.129 -28.707 1.00 127.59 ? -26 DT  I C7    1 
ATOM   6968  C  C6    . DT  I 5 47  ? -18.025 22.999 -28.880 1.00 127.65 ? -26 DT  I C6    1 
ATOM   6969  P  P     . DA  I 5 48  ? -13.825 27.172 -31.664 1.00 126.10 ? -25 DA  I P     1 
ATOM   6970  O  OP1   . DA  I 5 48  ? -13.176 28.481 -31.420 1.00 126.06 ? -25 DA  I OP1   1 
ATOM   6971  O  OP2   . DA  I 5 48  ? -15.028 27.090 -32.522 1.00 126.07 ? -25 DA  I OP2   1 
ATOM   6972  O  "O5'" . DA  I 5 48  ? -12.735 26.159 -32.246 1.00 125.51 ? -25 DA  I "O5'" 1 
ATOM   6973  C  "C5'" . DA  I 5 48  ? -12.408 24.952 -31.532 1.00 124.74 ? -25 DA  I "C5'" 1 
ATOM   6974  C  "C4'" . DA  I 5 48  ? -12.524 23.728 -32.429 1.00 123.92 ? -25 DA  I "C4'" 1 
ATOM   6975  O  "O4'" . DA  I 5 48  ? -13.781 23.045 -32.169 1.00 124.03 ? -25 DA  I "O4'" 1 
ATOM   6976  C  "C3'" . DA  I 5 48  ? -12.487 24.008 -33.936 1.00 122.97 ? -25 DA  I "C3'" 1 
ATOM   6977  O  "O3'" . DA  I 5 48  ? -11.641 23.080 -34.565 1.00 121.51 ? -25 DA  I "O3'" 1 
ATOM   6978  C  "C2'" . DA  I 5 48  ? -13.943 23.820 -34.365 1.00 123.54 ? -25 DA  I "C2'" 1 
ATOM   6979  C  "C1'" . DA  I 5 48  ? -14.407 22.745 -33.395 1.00 124.12 ? -25 DA  I "C1'" 1 
ATOM   6980  N  N9    . DA  I 5 48  ? -15.857 22.719 -33.197 1.00 124.76 ? -25 DA  I N9    1 
ATOM   6981  C  C8    . DA  I 5 48  ? -16.761 23.672 -33.586 1.00 124.91 ? -25 DA  I C8    1 
ATOM   6982  N  N7    . DA  I 5 48  ? -18.010 23.363 -33.314 1.00 125.05 ? -25 DA  I N7    1 
ATOM   6983  C  C5    . DA  I 5 48  ? -17.924 22.112 -32.721 1.00 125.15 ? -25 DA  I C5    1 
ATOM   6984  C  C6    . DA  I 5 48  ? -18.903 21.229 -32.213 1.00 125.22 ? -25 DA  I C6    1 
ATOM   6985  N  N6    . DA  I 5 48  ? -20.214 21.497 -32.222 1.00 125.15 ? -25 DA  I N6    1 
ATOM   6986  N  N1    . DA  I 5 48  ? -18.479 20.053 -31.703 1.00 125.34 ? -25 DA  I N1    1 
ATOM   6987  C  C2    . DA  I 5 48  ? -17.166 19.781 -31.712 1.00 125.37 ? -25 DA  I C2    1 
ATOM   6988  N  N3    . DA  I 5 48  ? -16.153 20.531 -32.150 1.00 125.30 ? -25 DA  I N3    1 
ATOM   6989  C  C4    . DA  I 5 48  ? -16.604 21.695 -32.649 1.00 125.11 ? -25 DA  I C4    1 
ATOM   6990  P  P     . DG  I 5 49  ? -10.548 23.558 -35.625 1.00 120.10 ? -24 DG  I P     1 
ATOM   6991  O  OP1   . DG  I 5 49  ? -9.467  24.242 -34.886 1.00 120.06 ? -24 DG  I OP1   1 
ATOM   6992  O  OP2   . DG  I 5 49  ? -11.243 24.250 -36.735 1.00 119.81 ? -24 DG  I OP2   1 
ATOM   6993  O  "O5'" . DG  I 5 49  ? -10.002 22.157 -36.170 1.00 119.40 ? -24 DG  I "O5'" 1 
ATOM   6994  C  "C5'" . DG  I 5 49  ? -9.918  21.034 -35.277 1.00 118.63 ? -24 DG  I "C5'" 1 
ATOM   6995  C  "C4'" . DG  I 5 49  ? -10.618 19.798 -35.836 1.00 117.94 ? -24 DG  I "C4'" 1 
ATOM   6996  O  "O4'" . DG  I 5 49  ? -12.042 19.853 -35.547 1.00 117.91 ? -24 DG  I "O4'" 1 
ATOM   6997  C  "C3'" . DG  I 5 49  ? -10.507 19.584 -37.349 1.00 117.38 ? -24 DG  I "C3'" 1 
ATOM   6998  O  "O3'" . DG  I 5 49  ? -10.361 18.209 -37.608 1.00 116.62 ? -24 DG  I "O3'" 1 
ATOM   6999  C  "C2'" . DG  I 5 49  ? -11.855 20.085 -37.855 1.00 117.67 ? -24 DG  I "C2'" 1 
ATOM   7000  C  "C1'" . DG  I 5 49  ? -12.759 19.610 -36.738 1.00 117.93 ? -24 DG  I "C1'" 1 
ATOM   7001  N  N9    . DG  I 5 49  ? -14.043 20.303 -36.678 1.00 118.20 ? -24 DG  I N9    1 
ATOM   7002  C  C8    . DG  I 5 49  ? -14.379 21.501 -37.270 1.00 118.27 ? -24 DG  I C8    1 
ATOM   7003  N  N7    . DG  I 5 49  ? -15.619 21.850 -37.068 1.00 118.31 ? -24 DG  I N7    1 
ATOM   7004  C  C5    . DG  I 5 49  ? -16.141 20.808 -36.313 1.00 118.47 ? -24 DG  I C5    1 
ATOM   7005  C  C6    . DG  I 5 49  ? -17.449 20.607 -35.819 1.00 118.79 ? -24 DG  I C6    1 
ATOM   7006  O  O6    . DG  I 5 49  ? -18.435 21.355 -35.923 1.00 118.90 ? -24 DG  I O6    1 
ATOM   7007  N  N1    . DG  I 5 49  ? -17.552 19.402 -35.121 1.00 118.82 ? -24 DG  I N1    1 
ATOM   7008  C  C2    . DG  I 5 49  ? -16.528 18.494 -34.958 1.00 118.85 ? -24 DG  I C2    1 
ATOM   7009  N  N2    . DG  I 5 49  ? -16.811 17.389 -34.251 1.00 119.02 ? -24 DG  I N2    1 
ATOM   7010  N  N3    . DG  I 5 49  ? -15.305 18.670 -35.423 1.00 118.63 ? -24 DG  I N3    1 
ATOM   7011  C  C4    . DG  I 5 49  ? -15.187 19.838 -36.093 1.00 118.47 ? -24 DG  I C4    1 
ATOM   7012  P  P     . DG  I 5 50  ? -9.740  17.703 -38.982 1.00 116.24 ? -23 DG  I P     1 
ATOM   7013  O  OP1   . DG  I 5 50  ? -8.292  17.519 -38.785 1.00 116.11 ? -23 DG  I OP1   1 
ATOM   7014  O  OP2   . DG  I 5 50  ? -10.230 18.571 -40.073 1.00 115.71 ? -23 DG  I OP2   1 
ATOM   7015  O  "O5'" . DG  I 5 50  ? -10.405 16.271 -39.162 1.00 117.52 ? -23 DG  I "O5'" 1 
ATOM   7016  C  "C5'" . DG  I 5 50  ? -11.138 15.665 -38.090 1.00 118.79 ? -23 DG  I "C5'" 1 
ATOM   7017  C  "C4'" . DG  I 5 50  ? -12.266 14.785 -38.616 1.00 120.07 ? -23 DG  I "C4'" 1 
ATOM   7018  O  "O4'" . DG  I 5 50  ? -13.536 15.473 -38.451 1.00 120.31 ? -23 DG  I "O4'" 1 
ATOM   7019  C  "C3'" . DG  I 5 50  ? -12.170 14.404 -40.097 1.00 121.21 ? -23 DG  I "C3'" 1 
ATOM   7020  O  "O3'" . DG  I 5 50  ? -12.494 13.030 -40.275 1.00 122.65 ? -23 DG  I "O3'" 1 
ATOM   7021  C  "C2'" . DG  I 5 50  ? -13.173 15.337 -40.777 1.00 120.95 ? -23 DG  I "C2'" 1 
ATOM   7022  C  "C1'" . DG  I 5 50  ? -14.214 15.554 -39.692 1.00 120.69 ? -23 DG  I "C1'" 1 
ATOM   7023  N  N9    . DG  I 5 50  ? -14.870 16.860 -39.786 1.00 120.76 ? -23 DG  I N9    1 
ATOM   7024  C  C8    . DG  I 5 50  ? -14.466 17.941 -40.540 1.00 120.78 ? -23 DG  I C8    1 
ATOM   7025  N  N7    . DG  I 5 50  ? -15.255 18.975 -40.436 1.00 120.74 ? -23 DG  I N7    1 
ATOM   7026  C  C5    . DG  I 5 50  ? -16.261 18.544 -39.580 1.00 120.76 ? -23 DG  I C5    1 
ATOM   7027  C  C6    . DG  I 5 50  ? -17.397 19.231 -39.094 1.00 120.73 ? -23 DG  I C6    1 
ATOM   7028  O  O6    . DG  I 5 50  ? -17.761 20.391 -39.348 1.00 120.59 ? -23 DG  I O6    1 
ATOM   7029  N  N1    . DG  I 5 50  ? -18.177 18.415 -38.270 1.00 120.78 ? -23 DG  I N1    1 
ATOM   7030  C  C2    . DG  I 5 50  ? -17.873 17.113 -37.934 1.00 120.79 ? -23 DG  I C2    1 
ATOM   7031  N  N2    . DG  I 5 50  ? -18.739 16.487 -37.126 1.00 120.72 ? -23 DG  I N2    1 
ATOM   7032  N  N3    . DG  I 5 50  ? -16.798 16.470 -38.361 1.00 120.78 ? -23 DG  I N3    1 
ATOM   7033  C  C4    . DG  I 5 50  ? -16.043 17.241 -39.181 1.00 120.78 ? -23 DG  I C4    1 
ATOM   7034  P  P     . DG  I 5 51  ? -12.357 12.330 -41.717 1.00 124.07 ? -22 DG  I P     1 
ATOM   7035  O  OP1   . DG  I 5 51  ? -11.630 11.052 -41.543 1.00 124.08 ? -22 DG  I OP1   1 
ATOM   7036  O  OP2   . DG  I 5 51  ? -11.862 13.332 -42.695 1.00 123.99 ? -22 DG  I OP2   1 
ATOM   7037  O  "O5'" . DG  I 5 51  ? -13.882 12.012 -42.064 1.00 125.46 ? -22 DG  I "O5'" 1 
ATOM   7038  C  "C5'" . DG  I 5 51  ? -14.823 11.798 -41.000 1.00 126.78 ? -22 DG  I "C5'" 1 
ATOM   7039  C  "C4'" . DG  I 5 51  ? -16.259 11.854 -41.500 1.00 128.16 ? -22 DG  I "C4'" 1 
ATOM   7040  O  "O4'" . DG  I 5 51  ? -16.824 13.162 -41.215 1.00 128.60 ? -22 DG  I "O4'" 1 
ATOM   7041  C  "C3'" . DG  I 5 51  ? -16.448 11.633 -43.011 1.00 129.15 ? -22 DG  I "C3'" 1 
ATOM   7042  O  "O3'" . DG  I 5 51  ? -17.606 10.839 -43.238 1.00 130.14 ? -22 DG  I "O3'" 1 
ATOM   7043  C  "C2'" . DG  I 5 51  ? -16.640 13.052 -43.530 1.00 129.13 ? -22 DG  I "C2'" 1 
ATOM   7044  C  "C1'" . DG  I 5 51  ? -17.431 13.649 -42.388 1.00 129.11 ? -22 DG  I "C1'" 1 
ATOM   7045  N  N9    . DG  I 5 51  ? -17.446 15.108 -42.378 1.00 129.55 ? -22 DG  I N9    1 
ATOM   7046  C  C8    . DG  I 5 51  ? -16.545 15.956 -42.991 1.00 129.66 ? -22 DG  I C8    1 
ATOM   7047  N  N7    . DG  I 5 51  ? -16.881 17.217 -42.908 1.00 129.73 ? -22 DG  I N7    1 
ATOM   7048  C  C5    . DG  I 5 51  ? -18.111 17.195 -42.251 1.00 129.91 ? -22 DG  I C5    1 
ATOM   7049  C  C6    . DG  I 5 51  ? -18.975 18.259 -41.885 1.00 129.90 ? -22 DG  I C6    1 
ATOM   7050  O  O6    . DG  I 5 51  ? -18.832 19.473 -42.100 1.00 130.02 ? -22 DG  I O6    1 
ATOM   7051  N  N1    . DG  I 5 51  ? -20.122 17.791 -41.231 1.00 129.95 ? -22 DG  I N1    1 
ATOM   7052  C  C2    . DG  I 5 51  ? -20.394 16.464 -40.965 1.00 129.77 ? -22 DG  I C2    1 
ATOM   7053  N  N2    . DG  I 5 51  ? -21.551 16.202 -40.344 1.00 129.72 ? -22 DG  I N2    1 
ATOM   7054  N  N3    . DG  I 5 51  ? -19.596 15.465 -41.304 1.00 129.78 ? -22 DG  I N3    1 
ATOM   7055  C  C4    . DG  I 5 51  ? -18.477 15.902 -41.940 1.00 129.72 ? -22 DG  I C4    1 
ATOM   7056  P  P     . DT  I 5 52  ? -17.794 10.029 -44.612 1.00 131.06 ? -21 DT  I P     1 
ATOM   7057  O  OP1   . DT  I 5 52  ? -17.530 8.600  -44.333 1.00 131.01 ? -21 DT  I OP1   1 
ATOM   7058  O  OP2   . DT  I 5 52  ? -17.041 10.722 -45.685 1.00 131.01 ? -21 DT  I OP2   1 
ATOM   7059  O  "O5'" . DT  I 5 52  ? -19.355 10.226 -44.897 1.00 132.04 ? -21 DT  I "O5'" 1 
ATOM   7060  C  "C5'" . DT  I 5 52  ? -20.272 10.148 -43.816 1.00 133.03 ? -21 DT  I "C5'" 1 
ATOM   7061  C  "C4'" . DT  I 5 52  ? -21.420 11.135 -43.972 1.00 134.14 ? -21 DT  I "C4'" 1 
ATOM   7062  O  "O4'" . DT  I 5 52  ? -21.077 12.408 -43.356 1.00 134.37 ? -21 DT  I "O4'" 1 
ATOM   7063  C  "C3'" . DT  I 5 52  ? -21.783 11.547 -45.389 1.00 134.84 ? -21 DT  I "C3'" 1 
ATOM   7064  O  "O3'" . DT  I 5 52  ? -22.504 10.521 -46.100 1.00 135.65 ? -21 DT  I "O3'" 1 
ATOM   7065  C  "C2'" . DT  I 5 52  ? -22.668 12.751 -45.085 1.00 134.90 ? -21 DT  I "C2'" 1 
ATOM   7066  C  "C1'" . DT  I 5 52  ? -21.918 13.415 -43.923 1.00 134.61 ? -21 DT  I "C1'" 1 
ATOM   7067  N  N1    . DT  I 5 52  ? -21.102 14.608 -44.375 1.00 134.70 ? -21 DT  I N1    1 
ATOM   7068  C  C2    . DT  I 5 52  ? -21.650 15.871 -44.252 1.00 134.62 ? -21 DT  I C2    1 
ATOM   7069  O  O2    . DT  I 5 52  ? -22.696 16.094 -43.660 1.00 134.63 ? -21 DT  I O2    1 
ATOM   7070  N  N3    . DT  I 5 52  ? -20.893 16.879 -44.796 1.00 134.64 ? -21 DT  I N3    1 
ATOM   7071  C  C4    . DT  I 5 52  ? -19.690 16.753 -45.471 1.00 134.55 ? -21 DT  I C4    1 
ATOM   7072  O  O4    . DT  I 5 52  ? -19.132 17.756 -45.906 1.00 134.60 ? -21 DT  I O4    1 
ATOM   7073  C  C5    . DT  I 5 52  ? -19.215 15.400 -45.641 1.00 134.62 ? -21 DT  I C5    1 
ATOM   7074  C  C7    . DT  I 5 52  ? -17.932 15.138 -46.373 1.00 134.53 ? -21 DT  I C7    1 
ATOM   7075  C  C6    . DT  I 5 52  ? -19.948 14.404 -45.117 1.00 134.63 ? -21 DT  I C6    1 
ATOM   7076  P  P     . DT  I 5 53  ? -22.573 10.569 -47.717 1.00 136.23 ? -20 DT  I P     1 
ATOM   7077  O  OP1   . DT  I 5 53  ? -23.044 9.247  -48.192 1.00 136.23 ? -20 DT  I OP1   1 
ATOM   7078  O  OP2   . DT  I 5 53  ? -21.281 11.105 -48.215 1.00 136.19 ? -20 DT  I OP2   1 
ATOM   7079  O  "O5'" . DT  I 5 53  ? -23.705 11.684 -48.013 1.00 136.63 ? -20 DT  I "O5'" 1 
ATOM   7080  C  "C5'" . DT  I 5 53  ? -25.102 11.357 -47.948 1.00 137.04 ? -20 DT  I "C5'" 1 
ATOM   7081  C  "C4'" . DT  I 5 53  ? -25.949 12.579 -47.596 1.00 137.43 ? -20 DT  I "C4'" 1 
ATOM   7082  O  "O4'" . DT  I 5 53  ? -25.218 13.445 -46.691 1.00 137.54 ? -20 DT  I "O4'" 1 
ATOM   7083  C  "C3'" . DT  I 5 53  ? -26.309 13.491 -48.757 1.00 137.86 ? -20 DT  I "C3'" 1 
ATOM   7084  O  "O3'" . DT  I 5 53  ? -27.431 12.983 -49.477 1.00 138.11 ? -20 DT  I "O3'" 1 
ATOM   7085  C  "C2'" . DT  I 5 53  ? -26.653 14.785 -48.023 1.00 137.75 ? -20 DT  I "C2'" 1 
ATOM   7086  C  "C1'" . DT  I 5 53  ? -25.621 14.794 -46.892 1.00 137.81 ? -20 DT  I "C1'" 1 
ATOM   7087  N  N1    . DT  I 5 53  ? -24.412 15.648 -47.197 1.00 137.91 ? -20 DT  I N1    1 
ATOM   7088  C  C2    . DT  I 5 53  ? -24.471 17.001 -46.942 1.00 138.15 ? -20 DT  I C2    1 
ATOM   7089  O  O2    . DT  I 5 53  ? -25.428 17.539 -46.410 1.00 138.05 ? -20 DT  I O2    1 
ATOM   7090  N  N3    . DT  I 5 53  ? -23.346 17.702 -47.299 1.00 138.08 ? -20 DT  I N3    1 
ATOM   7091  C  C4    . DT  I 5 53  ? -22.202 17.204 -47.903 1.00 138.12 ? -20 DT  I C4    1 
ATOM   7092  O  O4    . DT  I 5 53  ? -21.277 17.967 -48.171 1.00 138.03 ? -20 DT  I O4    1 
ATOM   7093  C  C5    . DT  I 5 53  ? -22.214 15.785 -48.169 1.00 137.96 ? -20 DT  I C5    1 
ATOM   7094  C  C7    . DT  I 5 53  ? -21.032 15.129 -48.817 1.00 137.99 ? -20 DT  I C7    1 
ATOM   7095  C  C6    . DT  I 5 53  ? -23.308 15.087 -47.820 1.00 138.07 ? -20 DT  I C6    1 
ATOM   7096  P  P     . DA  I 5 54  ? -27.480 13.107 -51.077 1.00 138.42 ? -19 DA  I P     1 
ATOM   7097  O  OP1   . DA  I 5 54  ? -28.737 12.478 -51.544 1.00 138.51 ? -19 DA  I OP1   1 
ATOM   7098  O  OP2   . DA  I 5 54  ? -26.182 12.643 -51.611 1.00 138.46 ? -19 DA  I OP2   1 
ATOM   7099  O  "O5'" . DA  I 5 54  ? -27.564 14.682 -51.322 1.00 138.57 ? -19 DA  I "O5'" 1 
ATOM   7100  C  "C5'" . DA  I 5 54  ? -28.746 15.396 -50.991 1.00 138.81 ? -19 DA  I "C5'" 1 
ATOM   7101  C  "C4'" . DA  I 5 54  ? -28.550 16.876 -51.240 1.00 139.01 ? -19 DA  I "C4'" 1 
ATOM   7102  O  "O4'" . DA  I 5 54  ? -27.566 17.397 -50.293 1.00 139.08 ? -19 DA  I "O4'" 1 
ATOM   7103  C  "C3'" . DA  I 5 54  ? -27.973 17.212 -52.607 1.00 139.07 ? -19 DA  I "C3'" 1 
ATOM   7104  O  "O3'" . DA  I 5 54  ? -29.028 17.287 -53.602 1.00 138.92 ? -19 DA  I "O3'" 1 
ATOM   7105  C  "C2'" . DA  I 5 54  ? -27.330 18.574 -52.335 1.00 139.14 ? -19 DA  I "C2'" 1 
ATOM   7106  C  "C1'" . DA  I 5 54  ? -26.746 18.371 -50.932 1.00 139.11 ? -19 DA  I "C1'" 1 
ATOM   7107  N  N9    . DA  I 5 54  ? -25.352 17.898 -50.938 1.00 139.12 ? -19 DA  I N9    1 
ATOM   7108  C  C8    . DA  I 5 54  ? -24.911 16.628 -50.678 1.00 139.12 ? -19 DA  I C8    1 
ATOM   7109  N  N7    . DA  I 5 54  ? -23.614 16.477 -50.815 1.00 139.09 ? -19 DA  I N7    1 
ATOM   7110  C  C5    . DA  I 5 54  ? -23.175 17.729 -51.207 1.00 139.11 ? -19 DA  I C5    1 
ATOM   7111  C  C6    . DA  I 5 54  ? -21.897 18.230 -51.520 1.00 139.11 ? -19 DA  I C6    1 
ATOM   7112  N  N6    . DA  I 5 54  ? -20.785 17.491 -51.464 1.00 139.07 ? -19 DA  I N6    1 
ATOM   7113  N  N1    . DA  I 5 54  ? -21.803 19.528 -51.877 1.00 139.12 ? -19 DA  I N1    1 
ATOM   7114  C  C2    . DA  I 5 54  ? -22.920 20.263 -51.923 1.00 139.13 ? -19 DA  I C2    1 
ATOM   7115  N  N3    . DA  I 5 54  ? -24.177 19.902 -51.665 1.00 139.12 ? -19 DA  I N3    1 
ATOM   7116  C  C4    . DA  I 5 54  ? -24.235 18.613 -51.303 1.00 139.11 ? -19 DA  I C4    1 
ATOM   7117  P  P     . DG  I 5 55  ? -28.812 16.661 -55.073 1.00 138.64 ? -18 DG  I P     1 
ATOM   7118  O  OP1   . DG  I 5 55  ? -30.144 16.294 -55.615 1.00 138.58 ? -18 DG  I OP1   1 
ATOM   7119  O  OP2   . DG  I 5 55  ? -27.744 15.633 -54.978 1.00 138.61 ? -18 DG  I OP2   1 
ATOM   7120  O  "O5'" . DG  I 5 55  ? -28.229 17.902 -55.915 1.00 138.30 ? -18 DG  I "O5'" 1 
ATOM   7121  C  "C5'" . DG  I 5 55  ? -29.080 19.011 -56.263 1.00 137.88 ? -18 DG  I "C5'" 1 
ATOM   7122  C  "C4'" . DG  I 5 55  ? -28.302 20.323 -56.278 1.00 137.38 ? -18 DG  I "C4'" 1 
ATOM   7123  O  "O4'" . DG  I 5 55  ? -27.380 20.348 -55.156 1.00 137.25 ? -18 DG  I "O4'" 1 
ATOM   7124  C  "C3'" . DG  I 5 55  ? -27.444 20.546 -57.514 1.00 137.02 ? -18 DG  I "C3'" 1 
ATOM   7125  O  "O3'" . DG  I 5 55  ? -28.178 21.286 -58.476 1.00 136.71 ? -18 DG  I "O3'" 1 
ATOM   7126  C  "C2'" . DG  I 5 55  ? -26.266 21.363 -56.984 1.00 137.03 ? -18 DG  I "C2'" 1 
ATOM   7127  C  "C1'" . DG  I 5 55  ? -26.125 20.874 -55.550 1.00 137.13 ? -18 DG  I "C1'" 1 
ATOM   7128  N  N9    . DG  I 5 55  ? -25.098 19.846 -55.371 1.00 137.12 ? -18 DG  I N9    1 
ATOM   7129  C  C8    . DG  I 5 55  ? -25.302 18.499 -55.205 1.00 137.17 ? -18 DG  I C8    1 
ATOM   7130  N  N7    . DG  I 5 55  ? -24.202 17.825 -55.042 1.00 137.21 ? -18 DG  I N7    1 
ATOM   7131  C  C5    . DG  I 5 55  ? -23.202 18.781 -55.132 1.00 137.19 ? -18 DG  I C5    1 
ATOM   7132  C  C6    . DG  I 5 55  ? -21.799 18.641 -55.040 1.00 137.30 ? -18 DG  I C6    1 
ATOM   7133  O  O6    . DG  I 5 55  ? -21.141 17.607 -54.857 1.00 137.39 ? -18 DG  I O6    1 
ATOM   7134  N  N1    . DG  I 5 55  ? -21.151 19.861 -55.181 1.00 137.23 ? -18 DG  I N1    1 
ATOM   7135  C  C2    . DG  I 5 55  ? -21.777 21.063 -55.385 1.00 137.25 ? -18 DG  I C2    1 
ATOM   7136  N  N2    . DG  I 5 55  ? -20.980 22.132 -55.498 1.00 137.32 ? -18 DG  I N2    1 
ATOM   7137  N  N3    . DG  I 5 55  ? -23.091 21.209 -55.472 1.00 137.18 ? -18 DG  I N3    1 
ATOM   7138  C  C4    . DG  I 5 55  ? -23.737 20.030 -55.341 1.00 137.16 ? -18 DG  I C4    1 
ATOM   7139  P  P     . DG  I 5 56  ? -27.941 21.025 -60.037 1.00 136.48 ? -17 DG  I P     1 
ATOM   7140  O  OP1   . DG  I 5 56  ? -29.205 21.326 -60.745 1.00 136.64 ? -17 DG  I OP1   1 
ATOM   7141  O  OP2   . DG  I 5 56  ? -27.308 19.689 -60.182 1.00 136.49 ? -17 DG  I OP2   1 
ATOM   7142  O  "O5'" . DG  I 5 56  ? -26.855 22.132 -60.438 1.00 135.78 ? -17 DG  I "O5'" 1 
ATOM   7143  C  "C5'" . DG  I 5 56  ? -26.925 23.448 -59.890 1.00 134.97 ? -17 DG  I "C5'" 1 
ATOM   7144  C  "C4'" . DG  I 5 56  ? -25.559 24.118 -59.915 1.00 134.16 ? -17 DG  I "C4'" 1 
ATOM   7145  O  "O4'" . DG  I 5 56  ? -24.604 23.346 -59.133 1.00 134.00 ? -17 DG  I "O4'" 1 
ATOM   7146  C  "C3'" . DG  I 5 56  ? -24.944 24.276 -61.302 1.00 133.42 ? -17 DG  I "C3'" 1 
ATOM   7147  O  "O3'" . DG  I 5 56  ? -24.353 25.550 -61.417 1.00 132.51 ? -17 DG  I "O3'" 1 
ATOM   7148  C  "C2'" . DG  I 5 56  ? -23.893 23.166 -61.362 1.00 133.55 ? -17 DG  I "C2'" 1 
ATOM   7149  C  "C1'" . DG  I 5 56  ? -23.452 23.069 -59.909 1.00 133.65 ? -17 DG  I "C1'" 1 
ATOM   7150  N  N9    . DG  I 5 56  ? -22.962 21.739 -59.548 1.00 133.32 ? -17 DG  I N9    1 
ATOM   7151  C  C8    . DG  I 5 56  ? -23.680 20.566 -59.561 1.00 133.24 ? -17 DG  I C8    1 
ATOM   7152  N  N7    . DG  I 5 56  ? -22.983 19.526 -59.206 1.00 133.11 ? -17 DG  I N7    1 
ATOM   7153  C  C5    . DG  I 5 56  ? -21.720 20.036 -58.947 1.00 132.99 ? -17 DG  I C5    1 
ATOM   7154  C  C6    . DG  I 5 56  ? -20.551 19.376 -58.522 1.00 132.85 ? -17 DG  I C6    1 
ATOM   7155  O  O6    . DG  I 5 56  ? -20.397 18.170 -58.285 1.00 132.78 ? -17 DG  I O6    1 
ATOM   7156  N  N1    . DG  I 5 56  ? -19.483 20.262 -58.381 1.00 132.79 ? -17 DG  I N1    1 
ATOM   7157  C  C2    . DG  I 5 56  ? -19.543 21.612 -58.623 1.00 132.70 ? -17 DG  I C2    1 
ATOM   7158  N  N2    . DG  I 5 56  ? -18.409 22.298 -58.435 1.00 132.57 ? -17 DG  I N2    1 
ATOM   7159  N  N3    . DG  I 5 56  ? -20.638 22.245 -59.025 1.00 132.82 ? -17 DG  I N3    1 
ATOM   7160  C  C4    . DG  I 5 56  ? -21.684 21.396 -59.167 1.00 133.04 ? -17 DG  I C4    1 
ATOM   7161  P  P     . DG  I 5 57  ? -24.494 26.364 -62.782 1.00 131.51 ? -16 DG  I P     1 
ATOM   7162  O  OP1   . DG  I 5 57  ? -25.785 27.088 -62.739 1.00 131.72 ? -16 DG  I OP1   1 
ATOM   7163  O  OP2   . DG  I 5 57  ? -24.209 25.430 -63.900 1.00 131.58 ? -16 DG  I OP2   1 
ATOM   7164  O  "O5'" . DG  I 5 57  ? -23.291 27.429 -62.703 1.00 129.91 ? -16 DG  I "O5'" 1 
ATOM   7165  C  "C5'" . DG  I 5 57  ? -22.496 27.535 -61.520 1.00 128.21 ? -16 DG  I "C5'" 1 
ATOM   7166  C  "C4'" . DG  I 5 57  ? -21.010 27.386 -61.826 1.00 126.53 ? -16 DG  I "C4'" 1 
ATOM   7167  O  "O4'" . DG  I 5 57  ? -20.599 25.999 -61.664 1.00 126.13 ? -16 DG  I "O4'" 1 
ATOM   7168  C  "C3'" . DG  I 5 57  ? -20.551 27.787 -63.233 1.00 125.21 ? -16 DG  I "C3'" 1 
ATOM   7169  O  "O3'" . DG  I 5 57  ? -19.250 28.302 -63.122 1.00 123.71 ? -16 DG  I "O3'" 1 
ATOM   7170  C  "C2'" . DG  I 5 57  ? -20.521 26.439 -63.952 1.00 125.40 ? -16 DG  I "C2'" 1 
ATOM   7171  C  "C1'" . DG  I 5 57  ? -19.951 25.568 -62.847 1.00 125.58 ? -16 DG  I "C1'" 1 
ATOM   7172  N  N9    . DG  I 5 57  ? -20.198 24.143 -63.018 1.00 125.19 ? -16 DG  I N9    1 
ATOM   7173  C  C8    . DG  I 5 57  ? -21.221 23.554 -63.720 1.00 125.12 ? -16 DG  I C8    1 
ATOM   7174  N  N7    . DG  I 5 57  ? -21.210 22.253 -63.656 1.00 125.07 ? -16 DG  I N7    1 
ATOM   7175  C  C5    . DG  I 5 57  ? -20.109 21.963 -62.860 1.00 124.91 ? -16 DG  I C5    1 
ATOM   7176  C  C6    . DG  I 5 57  ? -19.588 20.717 -62.445 1.00 124.88 ? -16 DG  I C6    1 
ATOM   7177  O  O6    . DG  I 5 57  ? -20.012 19.582 -62.707 1.00 124.76 ? -16 DG  I O6    1 
ATOM   7178  N  N1    . DG  I 5 57  ? -18.455 20.873 -61.649 1.00 124.73 ? -16 DG  I N1    1 
ATOM   7179  C  C2    . DG  I 5 57  ? -17.891 22.078 -61.312 1.00 124.63 ? -16 DG  I C2    1 
ATOM   7180  N  N2    . DG  I 5 57  ? -16.787 22.025 -60.558 1.00 124.44 ? -16 DG  I N2    1 
ATOM   7181  N  N3    . DG  I 5 57  ? -18.366 23.250 -61.697 1.00 124.70 ? -16 DG  I N3    1 
ATOM   7182  C  C4    . DG  I 5 57  ? -19.475 23.116 -62.464 1.00 124.95 ? -16 DG  I C4    1 
ATOM   7183  P  P     . DT  I 5 58  ? -18.641 29.308 -64.193 1.00 122.26 ? -15 DT  I P     1 
ATOM   7184  O  OP1   . DT  I 5 58  ? -19.435 30.549 -64.148 1.00 122.31 ? -15 DT  I OP1   1 
ATOM   7185  O  OP2   . DT  I 5 58  ? -18.458 28.590 -65.477 1.00 122.03 ? -15 DT  I OP2   1 
ATOM   7186  O  "O5'" . DT  I 5 58  ? -17.195 29.578 -63.555 1.00 121.35 ? -15 DT  I "O5'" 1 
ATOM   7187  C  "C5'" . DT  I 5 58  ? -17.053 29.593 -62.108 1.00 120.40 ? -15 DT  I "C5'" 1 
ATOM   7188  C  "C4'" . DT  I 5 58  ? -16.021 28.576 -61.604 1.00 119.35 ? -15 DT  I "C4'" 1 
ATOM   7189  O  "O4'" . DT  I 5 58  ? -16.436 27.212 -61.912 1.00 119.46 ? -15 DT  I "O4'" 1 
ATOM   7190  C  "C3'" . DT  I 5 58  ? -14.607 28.724 -62.164 1.00 118.11 ? -15 DT  I "C3'" 1 
ATOM   7191  O  "O3'" . DT  I 5 58  ? -13.660 28.532 -61.127 1.00 116.12 ? -15 DT  I "O3'" 1 
ATOM   7192  C  "C2'" . DT  I 5 58  ? -14.527 27.604 -63.194 1.00 118.82 ? -15 DT  I "C2'" 1 
ATOM   7193  C  "C1'" . DT  I 5 58  ? -15.361 26.522 -62.524 1.00 119.54 ? -15 DT  I "C1'" 1 
ATOM   7194  N  N1    . DT  I 5 58  ? -15.918 25.547 -63.496 1.00 120.33 ? -15 DT  I N1    1 
ATOM   7195  C  C2    . DT  I 5 58  ? -15.646 24.200 -63.356 1.00 120.72 ? -15 DT  I C2    1 
ATOM   7196  O  O2    . DT  I 5 58  ? -15.013 23.730 -62.424 1.00 120.69 ? -15 DT  I O2    1 
ATOM   7197  N  N3    . DT  I 5 58  ? -16.188 23.411 -64.335 1.00 121.05 ? -15 DT  I N3    1 
ATOM   7198  C  C4    . DT  I 5 58  ? -16.925 23.830 -65.434 1.00 121.30 ? -15 DT  I C4    1 
ATOM   7199  O  O4    . DT  I 5 58  ? -17.353 23.010 -66.226 1.00 121.54 ? -15 DT  I O4    1 
ATOM   7200  C  C5    . DT  I 5 58  ? -17.145 25.247 -65.532 1.00 121.13 ? -15 DT  I C5    1 
ATOM   7201  C  C7    . DT  I 5 58  ? -17.938 25.812 -66.678 1.00 121.18 ? -15 DT  I C7    1 
ATOM   7202  C  C6    . DT  I 5 58  ? -16.618 26.028 -64.584 1.00 120.82 ? -15 DT  I C6    1 
ATOM   7203  P  P     . DT  I 5 59  ? -12.122 28.865 -61.391 1.00 114.20 ? -14 DT  I P     1 
ATOM   7204  O  OP1   . DT  I 5 59  ? -11.522 29.275 -60.101 1.00 114.11 ? -14 DT  I OP1   1 
ATOM   7205  O  OP2   . DT  I 5 59  ? -12.045 29.757 -62.570 1.00 114.21 ? -14 DT  I OP2   1 
ATOM   7206  O  "O5'" . DT  I 5 59  ? -11.503 27.457 -61.834 1.00 112.51 ? -14 DT  I "O5'" 1 
ATOM   7207  C  "C5'" . DT  I 5 59  ? -11.549 26.320 -60.968 1.00 110.52 ? -14 DT  I "C5'" 1 
ATOM   7208  C  "C4'" . DT  I 5 59  ? -10.975 25.098 -61.668 1.00 108.47 ? -14 DT  I "C4'" 1 
ATOM   7209  O  "O4'" . DT  I 5 59  ? -11.917 24.632 -62.672 1.00 108.03 ? -14 DT  I "O4'" 1 
ATOM   7210  C  "C3'" . DT  I 5 59  ? -9.640  25.322 -62.399 1.00 107.09 ? -14 DT  I "C3'" 1 
ATOM   7211  O  "O3'" . DT  I 5 59  ? -8.770  24.212 -62.163 1.00 105.52 ? -14 DT  I "O3'" 1 
ATOM   7212  C  "C2'" . DT  I 5 59  ? -10.059 25.414 -63.869 1.00 107.40 ? -14 DT  I "C2'" 1 
ATOM   7213  C  "C1'" . DT  I 5 59  ? -11.250 24.463 -63.904 1.00 107.78 ? -14 DT  I "C1'" 1 
ATOM   7214  N  N1    . DT  I 5 59  ? -12.228 24.718 -65.032 1.00 107.92 ? -14 DT  I N1    1 
ATOM   7215  C  C2    . DT  I 5 59  ? -13.009 23.679 -65.490 1.00 107.87 ? -14 DT  I C2    1 
ATOM   7216  O  O2    . DT  I 5 59  ? -12.927 22.546 -65.059 1.00 107.81 ? -14 DT  I O2    1 
ATOM   7217  N  N3    . DT  I 5 59  ? -13.855 24.004 -66.518 1.00 107.87 ? -14 DT  I N3    1 
ATOM   7218  C  C4    . DT  I 5 59  ? -14.016 25.244 -67.106 1.00 107.87 ? -14 DT  I C4    1 
ATOM   7219  O  O4    . DT  I 5 59  ? -14.819 25.375 -68.027 1.00 107.77 ? -14 DT  I O4    1 
ATOM   7220  C  C5    . DT  I 5 59  ? -13.177 26.297 -66.568 1.00 107.97 ? -14 DT  I C5    1 
ATOM   7221  C  C7    . DT  I 5 59  ? -13.261 27.689 -67.114 1.00 108.01 ? -14 DT  I C7    1 
ATOM   7222  C  C6    . DT  I 5 59  ? -12.331 25.985 -65.578 1.00 107.99 ? -14 DT  I C6    1 
ATOM   7223  P  P     . DA  I 5 60  ? -7.187  24.303 -62.416 1.00 104.23 ? -13 DA  I P     1 
ATOM   7224  O  OP1   . DA  I 5 60  ? -6.549  24.756 -61.167 1.00 103.90 ? -13 DA  I OP1   1 
ATOM   7225  O  OP2   . DA  I 5 60  ? -6.945  25.031 -63.680 1.00 103.92 ? -13 DA  I OP2   1 
ATOM   7226  O  "O5'" . DA  I 5 60  ? -6.801  22.778 -62.658 1.00 104.50 ? -13 DA  I "O5'" 1 
ATOM   7227  C  "C5'" . DA  I 5 60  ? -7.624  21.747 -62.101 1.00 104.80 ? -13 DA  I "C5'" 1 
ATOM   7228  C  "C4'" . DA  I 5 60  ? -7.824  20.594 -63.075 1.00 105.08 ? -13 DA  I "C4'" 1 
ATOM   7229  O  "O4'" . DA  I 5 60  ? -8.957  20.865 -63.944 1.00 105.10 ? -13 DA  I "O4'" 1 
ATOM   7230  C  "C3'" . DA  I 5 60  ? -6.630  20.263 -63.981 1.00 105.35 ? -13 DA  I "C3'" 1 
ATOM   7231  O  "O3'" . DA  I 5 60  ? -6.383  18.842 -63.943 1.00 105.52 ? -13 DA  I "O3'" 1 
ATOM   7232  C  "C2'" . DA  I 5 60  ? -7.091  20.743 -65.366 1.00 105.35 ? -13 DA  I "C2'" 1 
ATOM   7233  C  "C1'" . DA  I 5 60  ? -8.607  20.605 -65.284 1.00 105.45 ? -13 DA  I "C1'" 1 
ATOM   7234  N  N9    . DA  I 5 60  ? -9.323  21.554 -66.137 1.00 106.00 ? -13 DA  I N9    1 
ATOM   7235  C  C8    . DA  I 5 60  ? -9.193  22.918 -66.145 1.00 106.25 ? -13 DA  I C8    1 
ATOM   7236  N  N7    . DA  I 5 60  ? -9.977  23.525 -67.003 1.00 106.33 ? -13 DA  I N7    1 
ATOM   7237  C  C5    . DA  I 5 60  ? -10.639 22.484 -67.632 1.00 106.51 ? -13 DA  I C5    1 
ATOM   7238  C  C6    . DA  I 5 60  ? -11.614 22.459 -68.647 1.00 106.79 ? -13 DA  I C6    1 
ATOM   7239  N  N6    . DA  I 5 60  ? -12.082 23.564 -69.243 1.00 106.86 ? -13 DA  I N6    1 
ATOM   7240  N  N1    . DA  I 5 60  ? -12.078 21.250 -69.039 1.00 106.78 ? -13 DA  I N1    1 
ATOM   7241  C  C2    . DA  I 5 60  ? -11.584 20.152 -68.454 1.00 106.67 ? -13 DA  I C2    1 
ATOM   7242  N  N3    . DA  I 5 60  ? -10.695 20.052 -67.469 1.00 106.50 ? -13 DA  I N3    1 
ATOM   7243  C  C4    . DA  I 5 60  ? -10.254 21.263 -67.102 1.00 106.34 ? -13 DA  I C4    1 
ATOM   7244  P  P     . DG  I 5 61  ? -4.982  18.192 -64.406 1.00 105.93 ? -12 DG  I P     1 
ATOM   7245  O  OP1   . DG  I 5 61  ? -4.326  17.620 -63.211 1.00 105.90 ? -12 DG  I OP1   1 
ATOM   7246  O  OP2   . DG  I 5 61  ? -4.249  19.149 -65.265 1.00 105.66 ? -12 DG  I OP2   1 
ATOM   7247  O  "O5'" . DG  I 5 61  ? -5.472  16.997 -65.331 1.00 107.29 ? -12 DG  I "O5'" 1 
ATOM   7248  C  "C5'" . DG  I 5 61  ? -6.869  16.647 -65.369 1.00 108.57 ? -12 DG  I "C5'" 1 
ATOM   7249  C  "C4'" . DG  I 5 61  ? -7.235  15.943 -66.664 1.00 109.81 ? -12 DG  I "C4'" 1 
ATOM   7250  O  "O4'" . DG  I 5 61  ? -7.830  16.878 -67.596 1.00 109.98 ? -12 DG  I "O4'" 1 
ATOM   7251  C  "C3'" . DG  I 5 61  ? -6.083  15.292 -67.402 1.00 110.95 ? -12 DG  I "C3'" 1 
ATOM   7252  O  "O3'" . DG  I 5 61  ? -6.526  14.113 -68.002 1.00 112.45 ? -12 DG  I "O3'" 1 
ATOM   7253  C  "C2'" . DG  I 5 61  ? -5.670  16.343 -68.433 1.00 110.61 ? -12 DG  I "C2'" 1 
ATOM   7254  C  "C1'" . DG  I 5 61  ? -6.969  17.097 -68.703 1.00 110.33 ? -12 DG  I "C1'" 1 
ATOM   7255  N  N9    . DG  I 5 61  ? -6.774  18.538 -68.847 1.00 110.49 ? -12 DG  I N9    1 
ATOM   7256  C  C8    . DG  I 5 61  ? -5.809  19.307 -68.235 1.00 110.63 ? -12 DG  I C8    1 
ATOM   7257  N  N7    . DG  I 5 61  ? -5.927  20.583 -68.482 1.00 110.63 ? -12 DG  I N7    1 
ATOM   7258  C  C5    . DG  I 5 61  ? -7.020  20.660 -69.339 1.00 110.57 ? -12 DG  I C5    1 
ATOM   7259  C  C6    . DG  I 5 61  ? -7.597  21.780 -69.979 1.00 110.49 ? -12 DG  I C6    1 
ATOM   7260  O  O6    . DG  I 5 61  ? -7.251  22.969 -69.907 1.00 110.44 ? -12 DG  I O6    1 
ATOM   7261  N  N1    . DG  I 5 61  ? -8.683  21.413 -70.774 1.00 110.39 ? -12 DG  I N1    1 
ATOM   7262  C  C2    . DG  I 5 61  ? -9.136  20.126 -70.939 1.00 110.25 ? -12 DG  I C2    1 
ATOM   7263  N  N2    . DG  I 5 61  ? -10.214 19.973 -71.710 1.00 110.15 ? -12 DG  I N2    1 
ATOM   7264  N  N3    . DG  I 5 61  ? -8.615  19.072 -70.334 1.00 110.29 ? -12 DG  I N3    1 
ATOM   7265  C  C4    . DG  I 5 61  ? -7.555  19.409 -69.566 1.00 110.43 ? -12 DG  I C4    1 
ATOM   7266  P  P     . DG  I 5 62  ? -5.476  13.010 -68.457 1.00 113.78 ? -11 DG  I P     1 
ATOM   7267  O  OP1   . DG  I 5 62  ? -6.043  11.688 -68.102 1.00 113.83 ? -11 DG  I OP1   1 
ATOM   7268  O  OP2   . DG  I 5 62  ? -4.131  13.407 -67.964 1.00 113.72 ? -11 DG  I OP2   1 
ATOM   7269  O  "O5'" . DG  I 5 62  ? -5.492  13.178 -70.041 1.00 114.96 ? -11 DG  I "O5'" 1 
ATOM   7270  C  "C5'" . DG  I 5 62  ? -6.735  13.229 -70.727 1.00 116.15 ? -11 DG  I "C5'" 1 
ATOM   7271  C  "C4'" . DG  I 5 62  ? -6.553  13.721 -72.146 1.00 117.47 ? -11 DG  I "C4'" 1 
ATOM   7272  O  "O4'" . DG  I 5 62  ? -6.722  15.161 -72.185 1.00 117.91 ? -11 DG  I "O4'" 1 
ATOM   7273  C  "C3'" . DG  I 5 62  ? -5.180  13.437 -72.776 1.00 118.50 ? -11 DG  I "C3'" 1 
ATOM   7274  O  "O3'" . DG  I 5 62  ? -5.364  12.969 -74.107 1.00 119.67 ? -11 DG  I "O3'" 1 
ATOM   7275  C  "C2'" . DG  I 5 62  ? -4.506  14.811 -72.754 1.00 118.41 ? -11 DG  I "C2'" 1 
ATOM   7276  C  "C1'" . DG  I 5 62  ? -5.707  15.705 -72.992 1.00 118.37 ? -11 DG  I "C1'" 1 
ATOM   7277  N  N9    . DG  I 5 62  ? -5.493  17.113 -72.643 1.00 118.68 ? -11 DG  I N9    1 
ATOM   7278  C  C8    . DG  I 5 62  ? -4.737  17.606 -71.601 1.00 118.74 ? -11 DG  I C8    1 
ATOM   7279  N  N7    . DG  I 5 62  ? -4.670  18.909 -71.575 1.00 118.71 ? -11 DG  I N7    1 
ATOM   7280  C  C5    . DG  I 5 62  ? -5.393  19.310 -72.695 1.00 118.70 ? -11 DG  I C5    1 
ATOM   7281  C  C6    . DG  I 5 62  ? -5.656  20.607 -73.191 1.00 118.63 ? -11 DG  I C6    1 
ATOM   7282  O  O6    . DG  I 5 62  ? -5.292  21.695 -72.722 1.00 118.59 ? -11 DG  I O6    1 
ATOM   7283  N  N1    . DG  I 5 62  ? -6.422  20.569 -74.356 1.00 118.61 ? -11 DG  I N1    1 
ATOM   7284  C  C2    . DG  I 5 62  ? -6.872  19.422 -74.968 1.00 118.57 ? -11 DG  I C2    1 
ATOM   7285  N  N2    . DG  I 5 62  ? -7.591  19.591 -76.087 1.00 118.54 ? -11 DG  I N2    1 
ATOM   7286  N  N3    . DG  I 5 62  ? -6.635  18.197 -74.513 1.00 118.57 ? -11 DG  I N3    1 
ATOM   7287  C  C4    . DG  I 5 62  ? -5.890  18.217 -73.375 1.00 118.69 ? -11 DG  I C4    1 
ATOM   7288  P  P     . DG  I 5 63  ? -4.270  12.038 -74.813 1.00 120.71 ? -10 DG  I P     1 
ATOM   7289  O  OP1   . DG  I 5 63  ? -4.801  10.655 -74.820 1.00 120.66 ? -10 DG  I OP1   1 
ATOM   7290  O  OP2   . DG  I 5 63  ? -2.950  12.321 -74.200 1.00 120.59 ? -10 DG  I OP2   1 
ATOM   7291  O  "O5'" . DG  I 5 63  ? -4.249  12.605 -76.319 1.00 121.88 ? -10 DG  I "O5'" 1 
ATOM   7292  C  "C5'" . DG  I 5 63  ? -5.445  12.574 -77.114 1.00 123.09 ? -10 DG  I "C5'" 1 
ATOM   7293  C  "C4'" . DG  I 5 63  ? -5.566  13.805 -78.010 1.00 124.35 ? -10 DG  I "C4'" 1 
ATOM   7294  O  "O4'" . DG  I 5 63  ? -5.451  15.023 -77.220 1.00 124.59 ? -10 DG  I "O4'" 1 
ATOM   7295  C  "C3'" . DG  I 5 63  ? -4.526  13.923 -79.130 1.00 125.38 ? -10 DG  I "C3'" 1 
ATOM   7296  O  "O3'" . DG  I 5 63  ? -5.169  14.311 -80.340 1.00 126.83 ? -10 DG  I "O3'" 1 
ATOM   7297  C  "C2'" . DG  I 5 63  ? -3.597  15.025 -78.623 1.00 125.02 ? -10 DG  I "C2'" 1 
ATOM   7298  C  "C1'" . DG  I 5 63  ? -4.574  15.918 -77.877 1.00 124.64 ? -10 DG  I "C1'" 1 
ATOM   7299  N  N9    . DG  I 5 63  ? -3.932  16.792 -76.882 1.00 124.10 ? -10 DG  I N9    1 
ATOM   7300  C  C8    . DG  I 5 63  ? -3.042  16.413 -75.901 1.00 123.93 ? -10 DG  I C8    1 
ATOM   7301  N  N7    . DG  I 5 63  ? -2.593  17.408 -75.188 1.00 123.71 ? -10 DG  I N7    1 
ATOM   7302  C  C5    . DG  I 5 63  ? -3.202  18.525 -75.742 1.00 123.59 ? -10 DG  I C5    1 
ATOM   7303  C  C6    . DG  I 5 63  ? -3.093  19.887 -75.384 1.00 123.32 ? -10 DG  I C6    1 
ATOM   7304  O  O6    . DG  I 5 63  ? -2.415  20.386 -74.473 1.00 123.28 ? -10 DG  I O6    1 
ATOM   7305  N  N1    . DG  I 5 63  ? -3.871  20.700 -76.207 1.00 123.12 ? -10 DG  I N1    1 
ATOM   7306  C  C2    . DG  I 5 63  ? -4.658  20.250 -77.239 1.00 123.04 ? -10 DG  I C2    1 
ATOM   7307  N  N2    . DG  I 5 63  ? -5.336  21.184 -77.916 1.00 122.87 ? -10 DG  I N2    1 
ATOM   7308  N  N3    . DG  I 5 63  ? -4.773  18.975 -77.586 1.00 123.33 ? -10 DG  I N3    1 
ATOM   7309  C  C4    . DG  I 5 63  ? -4.017  18.169 -76.798 1.00 123.68 ? -10 DG  I C4    1 
ATOM   7310  P  P     . DT  I 5 64  ? -4.426  14.135 -81.752 1.00 128.29 ? -9  DT  I P     1 
ATOM   7311  O  OP1   . DT  I 5 64  ? -5.290  13.300 -82.618 1.00 128.44 ? -9  DT  I OP1   1 
ATOM   7312  O  OP2   . DT  I 5 64  ? -3.024  13.724 -81.497 1.00 128.33 ? -9  DT  I OP2   1 
ATOM   7313  O  "O5'" . DT  I 5 64  ? -4.400  15.628 -82.331 1.00 129.27 ? -9  DT  I "O5'" 1 
ATOM   7314  C  "C5'" . DT  I 5 64  ? -5.617  16.348 -82.512 1.00 130.20 ? -9  DT  I "C5'" 1 
ATOM   7315  C  "C4'" . DT  I 5 64  ? -5.359  17.847 -82.552 1.00 131.17 ? -9  DT  I "C4'" 1 
ATOM   7316  O  "O4'" . DT  I 5 64  ? -4.818  18.274 -81.286 1.00 131.46 ? -9  DT  I "O4'" 1 
ATOM   7317  C  "C3'" . DT  I 5 64  ? -4.327  18.307 -83.581 1.00 131.82 ? -9  DT  I "C3'" 1 
ATOM   7318  O  "O3'" . DT  I 5 64  ? -4.963  18.578 -84.850 1.00 132.37 ? -9  DT  I "O3'" 1 
ATOM   7319  C  "C2'" . DT  I 5 64  ? -3.750  19.592 -82.954 1.00 131.78 ? -9  DT  I "C2'" 1 
ATOM   7320  C  "C1'" . DT  I 5 64  ? -4.160  19.509 -81.473 1.00 131.68 ? -9  DT  I "C1'" 1 
ATOM   7321  N  N1    . DT  I 5 64  ? -3.007  19.598 -80.526 1.00 131.76 ? -9  DT  I N1    1 
ATOM   7322  C  C2    . DT  I 5 64  ? -2.540  20.837 -80.156 1.00 131.78 ? -9  DT  I C2    1 
ATOM   7323  O  O2    . DT  I 5 64  ? -3.030  21.881 -80.548 1.00 131.72 ? -9  DT  I O2    1 
ATOM   7324  N  N3    . DT  I 5 64  ? -1.483  20.813 -79.290 1.00 131.88 ? -9  DT  I N3    1 
ATOM   7325  C  C4    . DT  I 5 64  ? -0.862  19.697 -78.757 1.00 131.98 ? -9  DT  I C4    1 
ATOM   7326  O  O4    . DT  I 5 64  ? 0.096   19.839 -78.001 1.00 132.08 ? -9  DT  I O4    1 
ATOM   7327  C  C5    . DT  I 5 64  ? -1.378  18.429 -79.212 1.00 131.87 ? -9  DT  I C5    1 
ATOM   7328  C  C7    . DT  I 5 64  ? -0.756  17.152 -78.730 1.00 131.82 ? -9  DT  I C7    1 
ATOM   7329  C  C6    . DT  I 5 64  ? -2.422  18.439 -80.054 1.00 131.80 ? -9  DT  I C6    1 
ATOM   7330  P  P     . DT  I 5 65  ? -4.145  18.427 -86.229 1.00 132.91 ? -8  DT  I P     1 
ATOM   7331  O  OP1   . DT  I 5 65  ? -5.130  18.444 -87.340 1.00 132.83 ? -8  DT  I OP1   1 
ATOM   7332  O  OP2   . DT  I 5 65  ? -3.220  17.278 -86.086 1.00 132.99 ? -8  DT  I OP2   1 
ATOM   7333  O  "O5'" . DT  I 5 65  ? -3.249  19.767 -86.283 1.00 133.40 ? -8  DT  I "O5'" 1 
ATOM   7334  C  "C5'" . DT  I 5 65  ? -3.764  20.977 -86.869 1.00 133.77 ? -8  DT  I "C5'" 1 
ATOM   7335  C  "C4'" . DT  I 5 65  ? -2.910  22.184 -86.500 1.00 134.00 ? -8  DT  I "C4'" 1 
ATOM   7336  O  "O4'" . DT  I 5 65  ? -2.427  22.055 -85.136 1.00 134.08 ? -8  DT  I "O4'" 1 
ATOM   7337  C  "C3'" . DT  I 5 65  ? -1.668  22.410 -87.380 1.00 134.14 ? -8  DT  I "C3'" 1 
ATOM   7338  O  "O3'" . DT  I 5 65  ? -1.689  23.738 -87.926 1.00 134.30 ? -8  DT  I "O3'" 1 
ATOM   7339  C  "C2'" . DT  I 5 65  ? -0.496  22.214 -86.409 1.00 134.16 ? -8  DT  I "C2'" 1 
ATOM   7340  C  "C1'" . DT  I 5 65  ? -1.129  22.586 -85.077 1.00 134.14 ? -8  DT  I "C1'" 1 
ATOM   7341  N  N1    . DT  I 5 65  ? -0.411  22.015 -83.887 1.00 134.06 ? -8  DT  I N1    1 
ATOM   7342  C  C2    . DT  I 5 65  ? 0.276   22.864 -83.048 1.00 134.04 ? -8  DT  I C2    1 
ATOM   7343  O  O2    . DT  I 5 65  ? 0.293   24.078 -83.186 1.00 134.05 ? -8  DT  I O2    1 
ATOM   7344  N  N3    . DT  I 5 65  ? 0.936   22.241 -82.023 1.00 133.96 ? -8  DT  I N3    1 
ATOM   7345  C  C4    . DT  I 5 65  ? 0.992   20.884 -81.766 1.00 133.85 ? -8  DT  I C4    1 
ATOM   7346  O  O4    . DT  I 5 65  ? 1.642   20.475 -80.811 1.00 133.76 ? -8  DT  I O4    1 
ATOM   7347  C  C5    . DT  I 5 65  ? 0.279   20.051 -82.699 1.00 133.87 ? -8  DT  I C5    1 
ATOM   7348  C  C7    . DT  I 5 65  ? 0.285   18.563 -82.531 1.00 133.85 ? -8  DT  I C7    1 
ATOM   7349  C  C6    . DT  I 5 65  ? -0.368  20.647 -83.711 1.00 133.96 ? -8  DT  I C6    1 
ATOM   7350  P  P     . DA  I 5 66  ? -0.743  24.135 -89.164 1.00 134.53 ? -7  DA  I P     1 
ATOM   7351  O  OP1   . DA  I 5 66  ? -1.562  24.879 -90.150 1.00 134.47 ? -7  DA  I OP1   1 
ATOM   7352  O  OP2   . DA  I 5 66  ? 0.009   22.931 -89.586 1.00 134.38 ? -7  DA  I OP2   1 
ATOM   7353  O  "O5'" . DA  I 5 66  ? 0.298   25.149 -88.503 1.00 135.00 ? -7  DA  I "O5'" 1 
ATOM   7354  C  "C5'" . DA  I 5 66  ? -0.002  25.787 -87.247 1.00 135.35 ? -7  DA  I "C5'" 1 
ATOM   7355  C  "C4'" . DA  I 5 66  ? 1.272   26.188 -86.509 1.00 135.56 ? -7  DA  I "C4'" 1 
ATOM   7356  O  "O4'" . DA  I 5 66  ? 1.628   25.161 -85.542 1.00 135.65 ? -7  DA  I "O4'" 1 
ATOM   7357  C  "C3'" . DA  I 5 66  ? 2.511   26.391 -87.396 1.00 135.60 ? -7  DA  I "C3'" 1 
ATOM   7358  O  "O3'" . DA  I 5 66  ? 3.239   27.507 -86.955 1.00 135.44 ? -7  DA  I "O3'" 1 
ATOM   7359  C  "C2'" . DA  I 5 66  ? 3.305   25.110 -87.168 1.00 135.69 ? -7  DA  I "C2'" 1 
ATOM   7360  C  "C1'" . DA  I 5 66  ? 2.987   24.819 -85.711 1.00 135.72 ? -7  DA  I "C1'" 1 
ATOM   7361  N  N9    . DA  I 5 66  ? 3.165   23.421 -85.367 1.00 135.76 ? -7  DA  I N9    1 
ATOM   7362  C  C8    . DA  I 5 66  ? 3.110   22.358 -86.222 1.00 135.84 ? -7  DA  I C8    1 
ATOM   7363  N  N7    . DA  I 5 66  ? 3.357   21.209 -85.650 1.00 135.92 ? -7  DA  I N7    1 
ATOM   7364  C  C5    . DA  I 5 66  ? 3.630   21.546 -84.337 1.00 135.93 ? -7  DA  I C5    1 
ATOM   7365  C  C6    . DA  I 5 66  ? 3.992   20.775 -83.221 1.00 136.05 ? -7  DA  I C6    1 
ATOM   7366  N  N6    . DA  I 5 66  ? 4.107   19.444 -83.255 1.00 136.13 ? -7  DA  I N6    1 
ATOM   7367  N  N1    . DA  I 5 66  ? 4.188   21.420 -82.052 1.00 136.02 ? -7  DA  I N1    1 
ATOM   7368  C  C2    . DA  I 5 66  ? 4.059   22.749 -82.024 1.00 135.98 ? -7  DA  I C2    1 
ATOM   7369  N  N3    . DA  I 5 66  ? 3.733   23.581 -83.011 1.00 135.91 ? -7  DA  I N3    1 
ATOM   7370  C  C4    . DA  I 5 66  ? 3.545   22.909 -84.154 1.00 135.85 ? -7  DA  I C4    1 
ATOM   7371  P  P     . DG  I 5 67  ? 3.218   28.869 -87.780 1.00 135.27 ? -6  DG  I P     1 
ATOM   7372  O  OP1   . DG  I 5 67  ? 1.911   28.966 -88.472 1.00 135.13 ? -6  DG  I OP1   1 
ATOM   7373  O  OP2   . DG  I 5 67  ? 4.482   28.956 -88.553 1.00 135.15 ? -6  DG  I OP2   1 
ATOM   7374  O  "O5'" . DG  I 5 67  ? 3.274   29.960 -86.603 1.00 135.47 ? -6  DG  I "O5'" 1 
ATOM   7375  C  "C5'" . DG  I 5 67  ? 2.740   29.634 -85.295 1.00 135.46 ? -6  DG  I "C5'" 1 
ATOM   7376  C  "C4'" . DG  I 5 67  ? 3.706   29.998 -84.165 1.00 135.33 ? -6  DG  I "C4'" 1 
ATOM   7377  O  "O4'" . DG  I 5 67  ? 4.390   28.813 -83.678 1.00 135.45 ? -6  DG  I "O4'" 1 
ATOM   7378  C  "C3'" . DG  I 5 67  ? 4.786   31.013 -84.505 1.00 135.13 ? -6  DG  I "C3'" 1 
ATOM   7379  O  "O3'" . DG  I 5 67  ? 4.919   31.946 -83.449 1.00 134.64 ? -6  DG  I "O3'" 1 
ATOM   7380  C  "C2'" . DG  I 5 67  ? 6.055   30.175 -84.698 1.00 135.36 ? -6  DG  I "C2'" 1 
ATOM   7381  C  "C1'" . DG  I 5 67  ? 5.788   28.905 -83.893 1.00 135.63 ? -6  DG  I "C1'" 1 
ATOM   7382  N  N9    . DG  I 5 67  ? 6.215   27.700 -84.596 1.00 136.19 ? -6  DG  I N9    1 
ATOM   7383  C  C8    . DG  I 5 67  ? 6.321   27.539 -85.957 1.00 136.42 ? -6  DG  I C8    1 
ATOM   7384  N  N7    . DG  I 5 67  ? 6.673   26.337 -86.314 1.00 136.60 ? -6  DG  I N7    1 
ATOM   7385  C  C5    . DG  I 5 67  ? 6.806   25.653 -85.113 1.00 136.72 ? -6  DG  I C5    1 
ATOM   7386  C  C6    . DG  I 5 67  ? 7.179   24.309 -84.868 1.00 136.93 ? -6  DG  I C6    1 
ATOM   7387  O  O6    . DG  I 5 67  ? 7.470   23.433 -85.692 1.00 136.93 ? -6  DG  I O6    1 
ATOM   7388  N  N1    . DG  I 5 67  ? 7.192   24.017 -83.508 1.00 137.06 ? -6  DG  I N1    1 
ATOM   7389  C  C2    . DG  I 5 67  ? 6.895   24.915 -82.509 1.00 137.13 ? -6  DG  I C2    1 
ATOM   7390  N  N2    . DG  I 5 67  ? 6.960   24.447 -81.251 1.00 137.26 ? -6  DG  I N2    1 
ATOM   7391  N  N3    . DG  I 5 67  ? 6.540   26.180 -82.726 1.00 136.92 ? -6  DG  I N3    1 
ATOM   7392  C  C4    . DG  I 5 67  ? 6.522   26.478 -84.046 1.00 136.60 ? -6  DG  I C4    1 
ATOM   7393  P  P     . DG  I 5 68  ? 5.803   33.264 -83.644 1.00 134.07 ? -5  DG  I P     1 
ATOM   7394  O  OP1   . DG  I 5 68  ? 5.195   34.339 -82.820 1.00 134.12 ? -5  DG  I OP1   1 
ATOM   7395  O  OP2   . DG  I 5 68  ? 6.010   33.473 -85.098 1.00 134.13 ? -5  DG  I OP2   1 
ATOM   7396  O  "O5'" . DG  I 5 68  ? 7.208   32.834 -82.999 1.00 133.08 ? -5  DG  I "O5'" 1 
ATOM   7397  C  "C5'" . DG  I 5 68  ? 7.297   32.629 -81.596 1.00 131.96 ? -5  DG  I "C5'" 1 
ATOM   7398  C  "C4'" . DG  I 5 68  ? 8.379   31.633 -81.241 1.00 130.82 ? -5  DG  I "C4'" 1 
ATOM   7399  O  "O4'" . DG  I 5 68  ? 8.316   30.466 -82.100 1.00 130.35 ? -5  DG  I "O4'" 1 
ATOM   7400  C  "C3'" . DG  I 5 68  ? 9.815   32.165 -81.352 1.00 130.18 ? -5  DG  I "C3'" 1 
ATOM   7401  O  "O3'" . DG  I 5 68  ? 10.501  31.885 -80.151 1.00 129.59 ? -5  DG  I "O3'" 1 
ATOM   7402  C  "C2'" . DG  I 5 68  ? 10.393  31.344 -82.508 1.00 130.12 ? -5  DG  I "C2'" 1 
ATOM   7403  C  "C1'" . DG  I 5 68  ? 9.634   30.056 -82.303 1.00 130.06 ? -5  DG  I "C1'" 1 
ATOM   7404  N  N9    . DG  I 5 68  ? 9.713   29.119 -83.408 1.00 129.80 ? -5  DG  I N9    1 
ATOM   7405  C  C8    . DG  I 5 68  ? 9.596   29.390 -84.748 1.00 129.74 ? -5  DG  I C8    1 
ATOM   7406  N  N7    . DG  I 5 68  ? 9.806   28.348 -85.506 1.00 129.66 ? -5  DG  I N7    1 
ATOM   7407  C  C5    . DG  I 5 68  ? 10.133  27.338 -84.608 1.00 129.59 ? -5  DG  I C5    1 
ATOM   7408  C  C6    . DG  I 5 68  ? 10.470  25.981 -84.835 1.00 129.52 ? -5  DG  I C6    1 
ATOM   7409  O  O6    . DG  I 5 68  ? 10.551  25.379 -85.916 1.00 129.46 ? -5  DG  I O6    1 
ATOM   7410  N  N1    . DG  I 5 68  ? 10.727  25.307 -83.640 1.00 129.45 ? -5  DG  I N1    1 
ATOM   7411  C  C2    . DG  I 5 68  ? 10.666  25.875 -82.388 1.00 129.39 ? -5  DG  I C2    1 
ATOM   7412  N  N2    . DG  I 5 68  ? 10.946  25.072 -81.350 1.00 129.22 ? -5  DG  I N2    1 
ATOM   7413  N  N3    . DG  I 5 68  ? 10.360  27.143 -82.168 1.00 129.52 ? -5  DG  I N3    1 
ATOM   7414  C  C4    . DG  I 5 68  ? 10.103  27.809 -83.318 1.00 129.65 ? -5  DG  I C4    1 
ATOM   7415  P  P     . DG  I 5 69  ? 10.746  33.032 -79.070 1.00 128.93 ? -4  DG  I P     1 
ATOM   7416  O  OP1   . DG  I 5 69  ? 9.429   33.407 -78.496 1.00 128.79 ? -4  DG  I OP1   1 
ATOM   7417  O  OP2   . DG  I 5 69  ? 11.604  34.065 -79.692 1.00 128.85 ? -4  DG  I OP2   1 
ATOM   7418  O  "O5'" . DG  I 5 69  ? 11.619  32.271 -77.953 1.00 128.63 ? -4  DG  I "O5'" 1 
ATOM   7419  C  "C5'" . DG  I 5 69  ? 11.001  31.320 -77.063 1.00 128.13 ? -4  DG  I "C5'" 1 
ATOM   7420  C  "C4'" . DG  I 5 69  ? 11.870  30.081 -76.863 1.00 127.60 ? -4  DG  I "C4'" 1 
ATOM   7421  O  "O4'" . DG  I 5 69  ? 11.953  29.328 -78.100 1.00 127.64 ? -4  DG  I "O4'" 1 
ATOM   7422  C  "C3'" . DG  I 5 69  ? 13.311  30.327 -76.417 1.00 127.09 ? -4  DG  I "C3'" 1 
ATOM   7423  O  "O3'" . DG  I 5 69  ? 13.663  29.356 -75.437 1.00 126.35 ? -4  DG  I "O3'" 1 
ATOM   7424  C  "C2'" . DG  I 5 69  ? 14.110  30.153 -77.715 1.00 127.39 ? -4  DG  I "C2'" 1 
ATOM   7425  C  "C1'" . DG  I 5 69  ? 13.306  29.082 -78.430 1.00 127.74 ? -4  DG  I "C1'" 1 
ATOM   7426  N  N9    . DG  I 5 69  ? 13.433  29.132 -79.886 1.00 128.12 ? -4  DG  I N9    1 
ATOM   7427  C  C8    . DG  I 5 69  ? 13.302  30.241 -80.686 1.00 128.33 ? -4  DG  I C8    1 
ATOM   7428  N  N7    . DG  I 5 69  ? 13.383  29.977 -81.961 1.00 128.42 ? -4  DG  I N7    1 
ATOM   7429  C  C5    . DG  I 5 69  ? 13.586  28.606 -82.012 1.00 128.41 ? -4  DG  I C5    1 
ATOM   7430  C  C6    . DG  I 5 69  ? 13.759  27.753 -83.128 1.00 128.52 ? -4  DG  I C6    1 
ATOM   7431  O  O6    . DG  I 5 69  ? 13.767  28.055 -84.333 1.00 128.45 ? -4  DG  I O6    1 
ATOM   7432  N  N1    . DG  I 5 69  ? 13.939  26.424 -82.738 1.00 128.57 ? -4  DG  I N1    1 
ATOM   7433  C  C2    . DG  I 5 69  ? 13.950  25.980 -81.434 1.00 128.56 ? -4  DG  I C2    1 
ATOM   7434  N  N2    . DG  I 5 69  ? 14.137  24.661 -81.255 1.00 128.49 ? -4  DG  I N2    1 
ATOM   7435  N  N3    . DG  I 5 69  ? 13.787  26.772 -80.380 1.00 128.46 ? -4  DG  I N3    1 
ATOM   7436  C  C4    . DG  I 5 69  ? 13.616  28.068 -80.742 1.00 128.36 ? -4  DG  I C4    1 
ATOM   7437  P  P     . DT  I 5 70  ? 15.099  29.369 -74.730 1.00 125.84 ? -3  DT  I P     1 
ATOM   7438  O  OP1   . DT  I 5 70  ? 14.882  29.355 -73.267 1.00 125.71 ? -3  DT  I OP1   1 
ATOM   7439  O  OP2   . DT  I 5 70  ? 15.930  30.426 -75.342 1.00 125.64 ? -3  DT  I OP2   1 
ATOM   7440  O  "O5'" . DT  I 5 70  ? 15.702  27.967 -75.178 1.00 126.05 ? -3  DT  I "O5'" 1 
ATOM   7441  C  "C5'" . DT  I 5 70  ? 14.843  26.841 -75.311 1.00 126.30 ? -3  DT  I "C5'" 1 
ATOM   7442  C  "C4'" . DT  I 5 70  ? 15.561  25.681 -75.974 1.00 126.57 ? -3  DT  I "C4'" 1 
ATOM   7443  O  "O4'" . DT  I 5 70  ? 15.504  25.847 -77.413 1.00 126.55 ? -3  DT  I "O4'" 1 
ATOM   7444  C  "C3'" . DT  I 5 70  ? 17.046  25.542 -75.615 1.00 127.04 ? -3  DT  I "C3'" 1 
ATOM   7445  O  "O3'" . DT  I 5 70  ? 17.341  24.209 -75.224 1.00 127.85 ? -3  DT  I "O3'" 1 
ATOM   7446  C  "C2'" . DT  I 5 70  ? 17.771  25.922 -76.905 1.00 126.75 ? -3  DT  I "C2'" 1 
ATOM   7447  C  "C1'" . DT  I 5 70  ? 16.755  25.522 -77.962 1.00 126.52 ? -3  DT  I "C1'" 1 
ATOM   7448  N  N1    . DT  I 5 70  ? 16.934  26.258 -79.257 1.00 126.12 ? -3  DT  I N1    1 
ATOM   7449  C  C2    . DT  I 5 70  ? 17.281  25.552 -80.387 1.00 125.90 ? -3  DT  I C2    1 
ATOM   7450  O  O2    . DT  I 5 70  ? 17.367  24.337 -80.420 1.00 125.86 ? -3  DT  I O2    1 
ATOM   7451  N  N3    . DT  I 5 70  ? 17.515  26.323 -81.490 1.00 125.67 ? -3  DT  I N3    1 
ATOM   7452  C  C4    . DT  I 5 70  ? 17.444  27.697 -81.577 1.00 125.57 ? -3  DT  I C4    1 
ATOM   7453  O  O4    . DT  I 5 70  ? 17.672  28.242 -82.645 1.00 125.52 ? -3  DT  I O4    1 
ATOM   7454  C  C5    . DT  I 5 70  ? 17.095  28.378 -80.356 1.00 125.60 ? -3  DT  I C5    1 
ATOM   7455  C  C7    . DT  I 5 70  ? 16.987  29.872 -80.330 1.00 125.56 ? -3  DT  I C7    1 
ATOM   7456  C  C6    . DT  I 5 70  ? 16.880  27.637 -79.263 1.00 125.88 ? -3  DT  I C6    1 
ATOM   7457  P  P     . DT  I 5 71  ? 18.753  23.864 -74.550 1.00 129.01 ? -2  DT  I P     1 
ATOM   7458  O  OP1   . DT  I 5 71  ? 18.578  22.642 -73.735 1.00 128.97 ? -2  DT  I OP1   1 
ATOM   7459  O  OP2   . DT  I 5 71  ? 19.282  25.094 -73.927 1.00 128.92 ? -2  DT  I OP2   1 
ATOM   7460  O  "O5'" . DT  I 5 71  ? 19.686  23.523 -75.810 1.00 130.56 ? -2  DT  I "O5'" 1 
ATOM   7461  C  "C5'" . DT  I 5 71  ? 19.438  22.343 -76.587 1.00 132.01 ? -2  DT  I "C5'" 1 
ATOM   7462  C  "C4'" . DT  I 5 71  ? 20.259  22.325 -77.875 1.00 133.27 ? -2  DT  I "C4'" 1 
ATOM   7463  O  "O4'" . DT  I 5 71  ? 19.949  23.488 -78.682 1.00 133.45 ? -2  DT  I "O4'" 1 
ATOM   7464  C  "C3'" . DT  I 5 71  ? 21.781  22.310 -77.696 1.00 134.29 ? -2  DT  I "C3'" 1 
ATOM   7465  O  "O3'" . DT  I 5 71  ? 22.329  21.175 -78.362 1.00 135.72 ? -2  DT  I "O3'" 1 
ATOM   7466  C  "C2'" . DT  I 5 71  ? 22.248  23.628 -78.331 1.00 133.92 ? -2  DT  I "C2'" 1 
ATOM   7467  C  "C1'" . DT  I 5 71  ? 21.121  23.938 -79.308 1.00 133.60 ? -2  DT  I "C1'" 1 
ATOM   7468  N  N1    . DT  I 5 71  ? 20.958  25.399 -79.615 1.00 133.48 ? -2  DT  I N1    1 
ATOM   7469  C  C2    . DT  I 5 71  ? 20.534  25.779 -80.869 1.00 133.44 ? -2  DT  I C2    1 
ATOM   7470  O  O2    . DT  I 5 71  ? 20.318  24.991 -81.769 1.00 133.44 ? -2  DT  I O2    1 
ATOM   7471  N  N3    . DT  I 5 71  ? 20.401  27.129 -81.042 1.00 133.42 ? -2  DT  I N3    1 
ATOM   7472  C  C4    . DT  I 5 71  ? 20.635  28.117 -80.106 1.00 133.42 ? -2  DT  I C4    1 
ATOM   7473  O  O4    . DT  I 5 71  ? 20.467  29.289 -80.412 1.00 133.47 ? -2  DT  I O4    1 
ATOM   7474  C  C5    . DT  I 5 71  ? 21.063  27.653 -78.810 1.00 133.37 ? -2  DT  I C5    1 
ATOM   7475  C  C7    . DT  I 5 71  ? 21.340  28.636 -77.712 1.00 133.33 ? -2  DT  I C7    1 
ATOM   7476  C  C6    . DT  I 5 71  ? 21.191  26.334 -78.624 1.00 133.43 ? -2  DT  I C6    1 
ATOM   7477  P  P     . DA  I 5 72  ? 23.808  20.669 -78.021 1.00 137.28 ? -1  DA  I P     1 
ATOM   7478  O  OP1   . DA  I 5 72  ? 23.722  19.248 -77.606 1.00 137.15 ? -1  DA  I OP1   1 
ATOM   7479  O  OP2   . DA  I 5 72  ? 24.438  21.657 -77.118 1.00 137.19 ? -1  DA  I OP2   1 
ATOM   7480  O  "O5'" . DA  I 5 72  ? 24.544  20.770 -79.448 1.00 139.23 ? -1  DA  I "O5'" 1 
ATOM   7481  C  "C5'" . DA  I 5 72  ? 24.432  19.708 -80.416 1.00 141.02 ? -1  DA  I "C5'" 1 
ATOM   7482  C  "C4'" . DA  I 5 72  ? 24.454  20.244 -81.845 1.00 142.71 ? -1  DA  I "C4'" 1 
ATOM   7483  O  "O4'" . DA  I 5 72  ? 23.509  21.327 -81.968 1.00 143.12 ? -1  DA  I "O4'" 1 
ATOM   7484  C  "C3'" . DA  I 5 72  ? 25.772  20.845 -82.307 1.00 144.03 ? -1  DA  I "C3'" 1 
ATOM   7485  O  "O3'" . DA  I 5 72  ? 26.656  19.820 -82.784 1.00 145.63 ? -1  DA  I "O3'" 1 
ATOM   7486  C  "C2'" . DA  I 5 72  ? 25.321  21.757 -83.447 1.00 143.77 ? -1  DA  I "C2'" 1 
ATOM   7487  C  "C1'" . DA  I 5 72  ? 23.917  22.188 -83.016 1.00 143.46 ? -1  DA  I "C1'" 1 
ATOM   7488  N  N9    . DA  I 5 72  ? 23.849  23.571 -82.553 1.00 143.63 ? -1  DA  I N9    1 
ATOM   7489  C  C8    . DA  I 5 72  ? 24.145  24.044 -81.303 1.00 143.61 ? -1  DA  I C8    1 
ATOM   7490  N  N7    . DA  I 5 72  ? 23.994  25.342 -81.178 1.00 143.63 ? -1  DA  I N7    1 
ATOM   7491  C  C5    . DA  I 5 72  ? 23.608  25.753 -82.445 1.00 143.69 ? -1  DA  I C5    1 
ATOM   7492  C  C6    . DA  I 5 72  ? 23.296  27.020 -82.980 1.00 143.71 ? -1  DA  I C6    1 
ATOM   7493  N  N6    . DA  I 5 72  ? 23.332  28.148 -82.266 1.00 143.69 ? -1  DA  I N6    1 
ATOM   7494  N  N1    . DA  I 5 72  ? 22.949  27.080 -84.285 1.00 143.79 ? -1  DA  I N1    1 
ATOM   7495  C  C2    . DA  I 5 72  ? 22.929  25.947 -85.000 1.00 143.85 ? -1  DA  I C2    1 
ATOM   7496  N  N3    . DA  I 5 72  ? 23.173  24.700 -84.601 1.00 143.84 ? -1  DA  I N3    1 
ATOM   7497  C  C4    . DA  I 5 72  ? 23.519  24.673 -83.304 1.00 143.71 ? -1  DA  I C4    1 
ATOM   7498  P  P     . DG  I 5 73  ? 28.247  20.065 -82.789 1.00 147.23 ? 0   DG  I P     1 
ATOM   7499  O  OP1   . DG  I 5 73  ? 28.917  18.753 -82.943 1.00 147.24 ? 0   DG  I OP1   1 
ATOM   7500  O  OP2   . DG  I 5 73  ? 28.577  20.926 -81.627 1.00 147.32 ? 0   DG  I OP2   1 
ATOM   7501  O  "O5'" . DG  I 5 73  ? 28.485  20.929 -84.124 1.00 148.63 ? 0   DG  I "O5'" 1 
ATOM   7502  C  "C5'" . DG  I 5 73  ? 28.252  20.350 -85.418 1.00 149.93 ? 0   DG  I "C5'" 1 
ATOM   7503  C  "C4'" . DG  I 5 73  ? 28.142  21.430 -86.493 1.00 151.17 ? 0   DG  I "C4'" 1 
ATOM   7504  O  "O4'" . DG  I 5 73  ? 27.116  22.391 -86.105 1.00 151.44 ? 0   DG  I "O4'" 1 
ATOM   7505  C  "C3'" . DG  I 5 73  ? 29.414  22.248 -86.721 1.00 152.05 ? 0   DG  I "C3'" 1 
ATOM   7506  O  "O3'" . DG  I 5 73  ? 30.207  21.654 -87.782 1.00 152.97 ? 0   DG  I "O3'" 1 
ATOM   7507  C  "C2'" . DG  I 5 73  ? 28.869  23.623 -87.128 1.00 151.91 ? 0   DG  I "C2'" 1 
ATOM   7508  C  "C1'" . DG  I 5 73  ? 27.549  23.719 -86.360 1.00 151.74 ? 0   DG  I "C1'" 1 
ATOM   7509  N  N9    . DG  I 5 73  ? 27.643  24.455 -85.087 1.00 151.86 ? 0   DG  I N9    1 
ATOM   7510  C  C8    . DG  I 5 73  ? 28.154  23.988 -83.896 1.00 151.91 ? 0   DG  I C8    1 
ATOM   7511  N  N7    . DG  I 5 73  ? 28.108  24.859 -82.929 1.00 151.95 ? 0   DG  I N7    1 
ATOM   7512  C  C5    . DG  I 5 73  ? 27.527  25.979 -83.508 1.00 152.00 ? 0   DG  I C5    1 
ATOM   7513  C  C6    . DG  I 5 73  ? 27.220  27.236 -82.941 1.00 152.07 ? 0   DG  I C6    1 
ATOM   7514  O  O6    . DG  I 5 73  ? 27.407  27.615 -81.775 1.00 152.18 ? 0   DG  I O6    1 
ATOM   7515  N  N1    . DG  I 5 73  ? 26.637  28.095 -83.871 1.00 151.95 ? 0   DG  I N1    1 
ATOM   7516  C  C2    . DG  I 5 73  ? 26.374  27.773 -85.180 1.00 151.84 ? 0   DG  I C2    1 
ATOM   7517  N  N2    . DG  I 5 73  ? 25.804  28.732 -85.919 1.00 151.76 ? 0   DG  I N2    1 
ATOM   7518  N  N3    . DG  I 5 73  ? 26.656  26.595 -85.729 1.00 151.86 ? 0   DG  I N3    1 
ATOM   7519  C  C4    . DG  I 5 73  ? 27.236  25.751 -84.838 1.00 151.90 ? 0   DG  I C4    1 
ATOM   7520  P  P     . DG  I 5 74  ? 31.817  21.629 -87.697 1.00 153.75 ? 1   DG  I P     1 
ATOM   7521  O  OP1   . DG  I 5 74  ? 32.320  20.695 -88.735 1.00 153.69 ? 1   DG  I OP1   1 
ATOM   7522  O  OP2   . DG  I 5 74  ? 32.200  21.431 -86.278 1.00 153.81 ? 1   DG  I OP2   1 
ATOM   7523  O  "O5'" . DG  I 5 74  ? 32.226  23.121 -88.105 1.00 154.38 ? 1   DG  I "O5'" 1 
ATOM   7524  C  "C5'" . DG  I 5 74  ? 31.825  23.659 -89.363 1.00 154.92 ? 1   DG  I "C5'" 1 
ATOM   7525  C  "C4'" . DG  I 5 74  ? 31.867  25.178 -89.333 1.00 155.44 ? 1   DG  I "C4'" 1 
ATOM   7526  O  "O4'" . DG  I 5 74  ? 31.273  25.659 -88.094 1.00 155.57 ? 1   DG  I "O4'" 1 
ATOM   7527  C  "C3'" . DG  I 5 74  ? 33.270  25.783 -89.400 1.00 155.83 ? 1   DG  I "C3'" 1 
ATOM   7528  O  "O3'" . DG  I 5 74  ? 33.268  26.929 -90.251 1.00 156.19 ? 1   DG  I "O3'" 1 
ATOM   7529  C  "C2'" . DG  I 5 74  ? 33.560  26.157 -87.945 1.00 155.80 ? 1   DG  I "C2'" 1 
ATOM   7530  C  "C1'" . DG  I 5 74  ? 32.174  26.519 -87.430 1.00 155.73 ? 1   DG  I "C1'" 1 
ATOM   7531  N  N9    . DG  I 5 74  ? 32.026  26.340 -85.981 1.00 155.79 ? 1   DG  I N9    1 
ATOM   7532  C  C8    . DG  I 5 74  ? 32.567  25.335 -85.207 1.00 155.80 ? 1   DG  I C8    1 
ATOM   7533  N  N7    . DG  I 5 74  ? 32.305  25.458 -83.933 1.00 155.76 ? 1   DG  I N7    1 
ATOM   7534  C  C5    . DG  I 5 74  ? 31.564  26.633 -83.851 1.00 155.75 ? 1   DG  I C5    1 
ATOM   7535  C  C6    . DG  I 5 74  ? 30.999  27.278 -82.724 1.00 155.64 ? 1   DG  I C6    1 
ATOM   7536  O  O6    . DG  I 5 74  ? 31.042  26.924 -81.534 1.00 155.56 ? 1   DG  I O6    1 
ATOM   7537  N  N1    . DG  I 5 74  ? 30.325  28.449 -83.085 1.00 155.63 ? 1   DG  I N1    1 
ATOM   7538  C  C2    . DG  I 5 74  ? 30.213  28.931 -84.373 1.00 155.56 ? 1   DG  I C2    1 
ATOM   7539  N  N2    . DG  I 5 74  ? 29.525  30.072 -84.527 1.00 155.47 ? 1   DG  I N2    1 
ATOM   7540  N  N3    . DG  I 5 74  ? 30.737  28.335 -85.435 1.00 155.63 ? 1   DG  I N3    1 
ATOM   7541  C  C4    . DG  I 5 74  ? 31.397  27.196 -85.102 1.00 155.74 ? 1   DG  I C4    1 
ATOM   7542  P  P     . DG  I 5 75  ? 34.572  27.316 -91.107 1.00 156.39 ? 2   DG  I P     1 
ATOM   7543  O  OP1   . DG  I 5 75  ? 34.353  26.858 -92.498 1.00 156.40 ? 2   DG  I OP1   1 
ATOM   7544  O  OP2   . DG  I 5 75  ? 35.773  26.865 -90.362 1.00 156.38 ? 2   DG  I OP2   1 
ATOM   7545  O  "O5'" . DG  I 5 75  ? 34.550  28.918 -91.078 1.00 156.39 ? 2   DG  I "O5'" 1 
ATOM   7546  C  "C5'" . DG  I 5 75  ? 33.393  29.607 -90.602 1.00 156.35 ? 2   DG  I "C5'" 1 
ATOM   7547  C  "C4'" . DG  I 5 75  ? 33.760  30.654 -89.561 1.00 156.34 ? 2   DG  I "C4'" 1 
ATOM   7548  O  "O4'" . DG  I 5 75  ? 33.652  30.095 -88.224 1.00 156.49 ? 2   DG  I "O4'" 1 
ATOM   7549  C  "C3'" . DG  I 5 75  ? 35.181  31.234 -89.660 1.00 156.29 ? 2   DG  I "C3'" 1 
ATOM   7550  O  "O3'" . DG  I 5 75  ? 35.115  32.643 -89.514 1.00 156.02 ? 2   DG  I "O3'" 1 
ATOM   7551  C  "C2'" . DG  I 5 75  ? 35.896  30.594 -88.465 1.00 156.37 ? 2   DG  I "C2'" 1 
ATOM   7552  C  "C1'" . DG  I 5 75  ? 34.753  30.550 -87.473 1.00 156.50 ? 2   DG  I "C1'" 1 
ATOM   7553  N  N9    . DG  I 5 75  ? 34.970  29.665 -86.327 1.00 156.56 ? 2   DG  I N9    1 
ATOM   7554  C  C8    . DG  I 5 75  ? 35.693  28.495 -86.299 1.00 156.51 ? 2   DG  I C8    1 
ATOM   7555  N  N7    . DG  I 5 75  ? 35.712  27.925 -85.124 1.00 156.51 ? 2   DG  I N7    1 
ATOM   7556  C  C5    . DG  I 5 75  ? 34.989  28.793 -84.310 1.00 156.57 ? 2   DG  I C5    1 
ATOM   7557  C  C6    . DG  I 5 75  ? 34.676  28.709 -82.929 1.00 156.57 ? 2   DG  I C6    1 
ATOM   7558  O  O6    . DG  I 5 75  ? 34.994  27.825 -82.122 1.00 156.59 ? 2   DG  I O6    1 
ATOM   7559  N  N1    . DG  I 5 75  ? 33.924  29.803 -82.501 1.00 156.54 ? 2   DG  I N1    1 
ATOM   7560  C  C2    . DG  I 5 75  ? 33.516  30.840 -83.307 1.00 156.52 ? 2   DG  I C2    1 
ATOM   7561  N  N2    . DG  I 5 75  ? 32.794  31.804 -82.718 1.00 156.49 ? 2   DG  I N2    1 
ATOM   7562  N  N3    . DG  I 5 75  ? 33.794  30.928 -84.601 1.00 156.56 ? 2   DG  I N3    1 
ATOM   7563  C  C4    . DG  I 5 75  ? 34.536  29.874 -85.033 1.00 156.58 ? 2   DG  I C4    1 
ATOM   7564  P  P     . DT  I 5 76  ? 36.136  33.588 -90.296 1.00 155.76 ? 3   DT  I P     1 
ATOM   7565  O  OP1   . DT  I 5 76  ? 35.427  34.142 -91.473 1.00 155.77 ? 3   DT  I OP1   1 
ATOM   7566  O  OP2   . DT  I 5 76  ? 37.406  32.845 -90.471 1.00 155.73 ? 3   DT  I OP2   1 
ATOM   7567  O  "O5'" . DT  I 5 76  ? 36.394  34.766 -89.247 1.00 155.25 ? 3   DT  I "O5'" 1 
ATOM   7568  C  "C5'" . DT  I 5 76  ? 35.304  35.537 -88.768 1.00 154.72 ? 3   DT  I "C5'" 1 
ATOM   7569  C  "C4'" . DT  I 5 76  ? 35.667  36.242 -87.476 1.00 154.21 ? 3   DT  I "C4'" 1 
ATOM   7570  O  "O4'" . DT  I 5 76  ? 35.460  35.350 -86.349 1.00 154.21 ? 3   DT  I "O4'" 1 
ATOM   7571  C  "C3'" . DT  I 5 76  ? 37.122  36.728 -87.373 1.00 153.75 ? 3   DT  I "C3'" 1 
ATOM   7572  O  "O3'" . DT  I 5 76  ? 37.131  38.078 -86.919 1.00 153.04 ? 3   DT  I "O3'" 1 
ATOM   7573  C  "C2'" . DT  I 5 76  ? 37.730  35.784 -86.333 1.00 153.99 ? 3   DT  I "C2'" 1 
ATOM   7574  C  "C1'" . DT  I 5 76  ? 36.528  35.515 -85.451 1.00 154.26 ? 3   DT  I "C1'" 1 
ATOM   7575  N  N1    . DT  I 5 76  ? 36.662  34.286 -84.606 1.00 154.58 ? 3   DT  I N1    1 
ATOM   7576  C  C2    . DT  I 5 76  ? 36.431  34.373 -83.248 1.00 154.64 ? 3   DT  I C2    1 
ATOM   7577  O  O2    . DT  I 5 76  ? 36.056  35.395 -82.696 1.00 154.58 ? 3   DT  I O2    1 
ATOM   7578  N  N3    . DT  I 5 76  ? 36.609  33.199 -82.562 1.00 154.72 ? 3   DT  I N3    1 
ATOM   7579  C  C4    . DT  I 5 76  ? 37.020  31.982 -83.081 1.00 154.78 ? 3   DT  I C4    1 
ATOM   7580  O  O4    . DT  I 5 76  ? 37.141  31.016 -82.336 1.00 154.77 ? 3   DT  I O4    1 
ATOM   7581  C  C5    . DT  I 5 76  ? 37.277  31.969 -84.501 1.00 154.76 ? 3   DT  I C5    1 
ATOM   7582  C  C7    . DT  I 5 76  ? 37.736  30.707 -85.172 1.00 154.76 ? 3   DT  I C7    1 
ATOM   7583  C  C6    . DT  I 5 76  ? 37.098  33.110 -85.186 1.00 154.69 ? 3   DT  I C6    1 
ATOM   7584  P  P     . DT  I 5 77  ? 38.461  38.976 -86.986 1.00 152.26 ? 4   DT  I P     1 
ATOM   7585  O  OP1   . DT  I 5 77  ? 38.218  40.071 -87.957 1.00 152.27 ? 4   DT  I OP1   1 
ATOM   7586  O  OP2   . DT  I 5 77  ? 39.635  38.082 -87.152 1.00 152.24 ? 4   DT  I OP2   1 
ATOM   7587  O  "O5'" . DT  I 5 77  ? 38.530  39.597 -85.514 1.00 151.34 ? 4   DT  I "O5'" 1 
ATOM   7588  C  "C5'" . DT  I 5 77  ? 37.375  39.574 -84.675 1.00 150.32 ? 4   DT  I "C5'" 1 
ATOM   7589  C  "C4'" . DT  I 5 77  ? 37.753  39.227 -83.249 1.00 149.26 ? 4   DT  I "C4'" 1 
ATOM   7590  O  "O4'" . DT  I 5 77  ? 37.873  37.795 -83.108 1.00 149.02 ? 4   DT  I "O4'" 1 
ATOM   7591  C  "C3'" . DT  I 5 77  ? 39.083  39.812 -82.774 1.00 148.42 ? 4   DT  I "C3'" 1 
ATOM   7592  O  "O3'" . DT  I 5 77  ? 38.835  40.770 -81.765 1.00 147.47 ? 4   DT  I "O3'" 1 
ATOM   7593  C  "C2'" . DT  I 5 77  ? 39.875  38.603 -82.240 1.00 148.59 ? 4   DT  I "C2'" 1 
ATOM   7594  C  "C1'" . DT  I 5 77  ? 38.809  37.527 -82.100 1.00 148.75 ? 4   DT  I "C1'" 1 
ATOM   7595  N  N1    . DT  I 5 77  ? 39.338  36.141 -82.288 1.00 148.60 ? 4   DT  I N1    1 
ATOM   7596  C  C2    . DT  I 5 77  ? 39.299  35.262 -81.234 1.00 148.57 ? 4   DT  I C2    1 
ATOM   7597  O  O2    . DT  I 5 77  ? 38.815  35.539 -80.154 1.00 148.70 ? 4   DT  I O2    1 
ATOM   7598  N  N3    . DT  I 5 77  ? 39.829  34.027 -81.495 1.00 148.42 ? 4   DT  I N3    1 
ATOM   7599  C  C4    . DT  I 5 77  ? 40.407  33.601 -82.673 1.00 148.34 ? 4   DT  I C4    1 
ATOM   7600  O  O4    . DT  I 5 77  ? 40.842  32.456 -82.750 1.00 148.23 ? 4   DT  I O4    1 
ATOM   7601  C  C5    . DT  I 5 77  ? 40.439  34.583 -83.734 1.00 148.42 ? 4   DT  I C5    1 
ATOM   7602  C  C7    . DT  I 5 77  ? 41.038  34.241 -85.066 1.00 148.45 ? 4   DT  I C7    1 
ATOM   7603  C  C6    . DT  I 5 77  ? 39.925  35.797 -83.485 1.00 148.50 ? 4   DT  I C6    1 
ATOM   7604  P  P     . DA  I 5 78  ? 40.000  41.734 -81.247 1.00 146.50 ? 5   DA  I P     1 
ATOM   7605  O  OP1   . DA  I 5 78  ? 39.474  43.116 -81.241 1.00 146.42 ? 5   DA  I OP1   1 
ATOM   7606  O  OP2   . DA  I 5 78  ? 41.243  41.419 -81.990 1.00 146.42 ? 5   DA  I OP2   1 
ATOM   7607  O  "O5'" . DA  I 5 78  ? 40.193  41.250 -79.740 1.00 145.78 ? 5   DA  I "O5'" 1 
ATOM   7608  C  "C5'" . DA  I 5 78  ? 39.136  40.566 -79.071 1.00 145.05 ? 5   DA  I "C5'" 1 
ATOM   7609  C  "C4'" . DA  I 5 78  ? 39.687  39.682 -77.977 1.00 144.31 ? 5   DA  I "C4'" 1 
ATOM   7610  O  "O4'" . DA  I 5 78  ? 40.203  38.459 -78.558 1.00 144.18 ? 5   DA  I "O4'" 1 
ATOM   7611  C  "C3'" . DA  I 5 78  ? 40.838  40.300 -77.182 1.00 143.88 ? 5   DA  I "C3'" 1 
ATOM   7612  O  "O3'" . DA  I 5 78  ? 40.620  40.114 -75.805 1.00 143.45 ? 5   DA  I "O3'" 1 
ATOM   7613  C  "C2'" . DA  I 5 78  ? 42.063  39.529 -77.663 1.00 143.99 ? 5   DA  I "C2'" 1 
ATOM   7614  C  "C1'" . DA  I 5 78  ? 41.457  38.179 -77.995 1.00 144.04 ? 5   DA  I "C1'" 1 
ATOM   7615  N  N9    . DA  I 5 78  ? 42.245  37.418 -78.953 1.00 144.21 ? 5   DA  I N9    1 
ATOM   7616  C  C8    . DA  I 5 78  ? 43.204  37.904 -79.798 1.00 144.26 ? 5   DA  I C8    1 
ATOM   7617  N  N7    . DA  I 5 78  ? 43.788  36.980 -80.523 1.00 144.26 ? 5   DA  I N7    1 
ATOM   7618  C  C5    . DA  I 5 78  ? 43.174  35.804 -80.123 1.00 144.27 ? 5   DA  I C5    1 
ATOM   7619  C  C6    . DA  I 5 78  ? 43.355  34.458 -80.506 1.00 144.17 ? 5   DA  I C6    1 
ATOM   7620  N  N6    . DA  I 5 78  ? 44.232  34.068 -81.434 1.00 144.19 ? 5   DA  I N6    1 
ATOM   7621  N  N1    . DA  I 5 78  ? 42.598  33.527 -79.891 1.00 144.24 ? 5   DA  I N1    1 
ATOM   7622  C  C2    . DA  I 5 78  ? 41.730  33.919 -78.953 1.00 144.15 ? 5   DA  I C2    1 
ATOM   7623  N  N3    . DA  I 5 78  ? 41.468  35.150 -78.511 1.00 144.20 ? 5   DA  I N3    1 
ATOM   7624  C  C4    . DA  I 5 78  ? 42.238  36.053 -79.136 1.00 144.22 ? 5   DA  I C4    1 
ATOM   7625  P  P     . DG  I 5 79  ? 40.448  41.379 -74.847 1.00 143.04 ? 6   DG  I P     1 
ATOM   7626  O  OP1   . DG  I 5 79  ? 39.661  42.399 -75.572 1.00 143.01 ? 6   DG  I OP1   1 
ATOM   7627  O  OP2   . DG  I 5 79  ? 41.778  41.721 -74.300 1.00 142.96 ? 6   DG  I OP2   1 
ATOM   7628  O  "O5'" . DG  I 5 79  ? 39.557  40.788 -73.662 1.00 142.92 ? 6   DG  I "O5'" 1 
ATOM   7629  C  "C5'" . DG  I 5 79  ? 38.595  39.777 -73.941 1.00 142.82 ? 6   DG  I "C5'" 1 
ATOM   7630  C  "C4'" . DG  I 5 79  ? 38.920  38.481 -73.211 1.00 142.79 ? 6   DG  I "C4'" 1 
ATOM   7631  O  "O4'" . DG  I 5 79  ? 39.892  37.714 -73.963 1.00 142.88 ? 6   DG  I "O4'" 1 
ATOM   7632  C  "C3'" . DG  I 5 79  ? 39.497  38.633 -71.808 1.00 142.61 ? 6   DG  I "C3'" 1 
ATOM   7633  O  "O3'" . DG  I 5 79  ? 38.991  37.601 -70.980 1.00 142.18 ? 6   DG  I "O3'" 1 
ATOM   7634  C  "C2'" . DG  I 5 79  ? 40.999  38.470 -72.036 1.00 142.79 ? 6   DG  I "C2'" 1 
ATOM   7635  C  "C1'" . DG  I 5 79  ? 41.023  37.447 -73.160 1.00 143.03 ? 6   DG  I "C1'" 1 
ATOM   7636  N  N9    . DG  I 5 79  ? 42.200  37.543 -74.009 1.00 143.42 ? 6   DG  I N9    1 
ATOM   7637  C  C8    . DG  I 5 79  ? 42.912  38.680 -74.312 1.00 143.59 ? 6   DG  I C8    1 
ATOM   7638  N  N7    . DG  I 5 79  ? 43.876  38.476 -75.168 1.00 143.71 ? 6   DG  I N7    1 
ATOM   7639  C  C5    . DG  I 5 79  ? 43.788  37.119 -75.461 1.00 143.80 ? 6   DG  I C5    1 
ATOM   7640  C  C6    . DG  I 5 79  ? 44.583  36.315 -76.315 1.00 143.89 ? 6   DG  I C6    1 
ATOM   7641  O  O6    . DG  I 5 79  ? 45.549  36.657 -77.018 1.00 143.82 ? 6   DG  I O6    1 
ATOM   7642  N  N1    . DG  I 5 79  ? 44.153  34.986 -76.314 1.00 143.98 ? 6   DG  I N1    1 
ATOM   7643  C  C2    . DG  I 5 79  ? 43.090  34.502 -75.581 1.00 143.92 ? 6   DG  I C2    1 
ATOM   7644  N  N2    . DG  I 5 79  ? 42.823  33.194 -75.710 1.00 143.92 ? 6   DG  I N2    1 
ATOM   7645  N  N3    . DG  I 5 79  ? 42.346  35.244 -74.775 1.00 143.80 ? 6   DG  I N3    1 
ATOM   7646  C  C4    . DG  I 5 79  ? 42.754  36.535 -74.760 1.00 143.70 ? 6   DG  I C4    1 
ATOM   7647  P  P     . DG  I 5 80  ? 38.373  37.948 -69.553 1.00 141.73 ? 7   DG  I P     1 
ATOM   7648  O  OP1   . DG  I 5 80  ? 36.961  37.502 -69.552 1.00 141.59 ? 7   DG  I OP1   1 
ATOM   7649  O  OP2   . DG  I 5 80  ? 38.703  39.355 -69.238 1.00 141.65 ? 7   DG  I OP2   1 
ATOM   7650  O  "O5'" . DG  I 5 80  ? 39.220  37.009 -68.573 1.00 141.74 ? 7   DG  I "O5'" 1 
ATOM   7651  C  "C5'" . DG  I 5 80  ? 40.643  37.109 -68.532 1.00 141.72 ? 7   DG  I "C5'" 1 
ATOM   7652  C  "C4'" . DG  I 5 80  ? 41.281  35.736 -68.659 1.00 141.81 ? 7   DG  I "C4'" 1 
ATOM   7653  O  "O4'" . DG  I 5 80  ? 42.026  35.673 -69.899 1.00 141.84 ? 7   DG  I "O4'" 1 
ATOM   7654  C  "C3'" . DG  I 5 80  ? 42.286  35.390 -67.568 1.00 141.89 ? 7   DG  I "C3'" 1 
ATOM   7655  O  "O3'" . DG  I 5 80  ? 42.367  33.974 -67.405 1.00 141.96 ? 7   DG  I "O3'" 1 
ATOM   7656  C  "C2'" . DG  I 5 80  ? 43.573  35.960 -68.139 1.00 141.95 ? 7   DG  I "C2'" 1 
ATOM   7657  C  "C1'" . DG  I 5 80  ? 43.416  35.643 -69.622 1.00 142.06 ? 7   DG  I "C1'" 1 
ATOM   7658  N  N9    . DG  I 5 80  ? 44.095  36.609 -70.486 1.00 142.18 ? 7   DG  I N9    1 
ATOM   7659  C  C8    . DG  I 5 80  ? 44.169  37.971 -70.301 1.00 142.26 ? 7   DG  I C8    1 
ATOM   7660  N  N7    . DG  I 5 80  ? 44.901  38.578 -71.193 1.00 142.24 ? 7   DG  I N7    1 
ATOM   7661  C  C5    . DG  I 5 80  ? 45.372  37.551 -72.003 1.00 142.20 ? 7   DG  I C5    1 
ATOM   7662  C  C6    . DG  I 5 80  ? 46.226  37.599 -73.131 1.00 142.21 ? 7   DG  I C6    1 
ATOM   7663  O  O6    . DG  I 5 80  ? 46.728  38.594 -73.675 1.00 142.20 ? 7   DG  I O6    1 
ATOM   7664  N  N1    . DG  I 5 80  ? 46.445  36.331 -73.663 1.00 142.14 ? 7   DG  I N1    1 
ATOM   7665  C  C2    . DG  I 5 80  ? 45.925  35.164 -73.157 1.00 142.09 ? 7   DG  I C2    1 
ATOM   7666  N  N2    . DG  I 5 80  ? 46.260  34.038 -73.801 1.00 142.12 ? 7   DG  I N2    1 
ATOM   7667  N  N3    . DG  I 5 80  ? 45.133  35.103 -72.096 1.00 142.08 ? 7   DG  I N3    1 
ATOM   7668  C  C4    . DG  I 5 80  ? 44.904  36.330 -71.568 1.00 142.18 ? 7   DG  I C4    1 
ATOM   7669  P  P     . DG  I 5 81  ? 43.061  33.343 -66.102 1.00 142.25 ? 8   DG  I P     1 
ATOM   7670  O  OP1   . DG  I 5 81  ? 42.115  32.374 -65.504 1.00 142.16 ? 8   DG  I OP1   1 
ATOM   7671  O  OP2   . DG  I 5 81  ? 43.603  34.448 -65.276 1.00 142.15 ? 8   DG  I OP2   1 
ATOM   7672  O  "O5'" . DG  I 5 81  ? 44.300  32.543 -66.720 1.00 143.03 ? 8   DG  I "O5'" 1 
ATOM   7673  C  "C5'" . DG  I 5 81  ? 44.076  31.348 -67.476 1.00 143.74 ? 8   DG  I "C5'" 1 
ATOM   7674  C  "C4'" . DG  I 5 81  ? 45.376  30.807 -68.055 1.00 144.37 ? 8   DG  I "C4'" 1 
ATOM   7675  O  "O4'" . DG  I 5 81  ? 45.878  31.721 -69.060 1.00 144.46 ? 8   DG  I "O4'" 1 
ATOM   7676  C  "C3'" . DG  I 5 81  ? 46.516  30.597 -67.047 1.00 144.82 ? 8   DG  I "C3'" 1 
ATOM   7677  O  "O3'" . DG  I 5 81  ? 47.125  29.324 -67.264 1.00 145.44 ? 8   DG  I "O3'" 1 
ATOM   7678  C  "C2'" . DG  I 5 81  ? 47.479  31.742 -67.359 1.00 144.79 ? 8   DG  I "C2'" 1 
ATOM   7679  C  "C1'" . DG  I 5 81  ? 47.252  31.936 -68.850 1.00 144.75 ? 8   DG  I "C1'" 1 
ATOM   7680  N  N9    . DG  I 5 81  ? 47.594  33.275 -69.329 1.00 145.03 ? 8   DG  I N9    1 
ATOM   7681  C  C8    . DG  I 5 81  ? 47.266  34.476 -68.746 1.00 145.13 ? 8   DG  I C8    1 
ATOM   7682  N  N7    . DG  I 5 81  ? 47.718  35.513 -69.401 1.00 145.21 ? 8   DG  I N7    1 
ATOM   7683  C  C5    . DG  I 5 81  ? 48.396  34.963 -70.482 1.00 145.24 ? 8   DG  I C5    1 
ATOM   7684  C  C6    . DG  I 5 81  ? 49.090  35.594 -71.542 1.00 145.31 ? 8   DG  I C6    1 
ATOM   7685  O  O6    . DG  I 5 81  ? 49.259  36.808 -71.736 1.00 145.34 ? 8   DG  I O6    1 
ATOM   7686  N  N1    . DG  I 5 81  ? 49.628  34.664 -72.432 1.00 145.31 ? 8   DG  I N1    1 
ATOM   7687  C  C2    . DG  I 5 81  ? 49.509  33.298 -72.310 1.00 145.29 ? 8   DG  I C2    1 
ATOM   7688  N  N2    . DG  I 5 81  ? 50.084  32.559 -73.270 1.00 145.28 ? 8   DG  I N2    1 
ATOM   7689  N  N3    . DG  I 5 81  ? 48.869  32.697 -71.319 1.00 145.25 ? 8   DG  I N3    1 
ATOM   7690  C  C4    . DG  I 5 81  ? 48.336  33.587 -70.447 1.00 145.19 ? 8   DG  I C4    1 
ATOM   7691  P  P     . DT  I 5 82  ? 47.991  28.616 -66.115 1.00 146.05 ? 9   DT  I P     1 
ATOM   7692  O  OP1   . DT  I 5 82  ? 47.550  27.207 -66.023 1.00 146.01 ? 9   DT  I OP1   1 
ATOM   7693  O  OP2   . DT  I 5 82  ? 47.971  29.480 -64.911 1.00 145.85 ? 9   DT  I OP2   1 
ATOM   7694  O  "O5'" . DT  I 5 82  ? 49.470  28.652 -66.727 1.00 147.24 ? 9   DT  I "O5'" 1 
ATOM   7695  C  "C5'" . DT  I 5 82  ? 49.704  28.180 -68.064 1.00 148.32 ? 9   DT  I "C5'" 1 
ATOM   7696  C  "C4'" . DT  I 5 82  ? 51.003  28.742 -68.640 1.00 149.34 ? 9   DT  I "C4'" 1 
ATOM   7697  O  "O4'" . DT  I 5 82  ? 50.829  30.134 -69.003 1.00 149.50 ? 9   DT  I "O4'" 1 
ATOM   7698  C  "C3'" . DT  I 5 82  ? 52.223  28.695 -67.705 1.00 150.19 ? 9   DT  I "C3'" 1 
ATOM   7699  O  "O3'" . DT  I 5 82  ? 53.231  27.849 -68.256 1.00 151.23 ? 9   DT  I "O3'" 1 
ATOM   7700  C  "C2'" . DT  I 5 82  ? 52.695  30.159 -67.615 1.00 149.89 ? 9   DT  I "C2'" 1 
ATOM   7701  C  "C1'" . DT  I 5 82  ? 52.062  30.790 -68.846 1.00 149.59 ? 9   DT  I "C1'" 1 
ATOM   7702  N  N1    . DT  I 5 82  ? 51.816  32.264 -68.710 1.00 149.36 ? 9   DT  I N1    1 
ATOM   7703  C  C2    . DT  I 5 82  ? 52.439  33.130 -69.576 1.00 149.31 ? 9   DT  I C2    1 
ATOM   7704  O  O2    . DT  I 5 82  ? 53.170  32.762 -70.476 1.00 149.34 ? 9   DT  I O2    1 
ATOM   7705  N  N3    . DT  I 5 82  ? 52.161  34.452 -69.364 1.00 149.21 ? 9   DT  I N3    1 
ATOM   7706  C  C4    . DT  I 5 82  ? 51.331  34.985 -68.399 1.00 149.09 ? 9   DT  I C4    1 
ATOM   7707  O  O4    . DT  I 5 82  ? 51.203  36.204 -68.320 1.00 149.00 ? 9   DT  I O4    1 
ATOM   7708  C  C5    . DT  I 5 82  ? 50.747  34.027 -67.492 1.00 149.14 ? 9   DT  I C5    1 
ATOM   7709  C  C7    . DT  I 5 82  ? 49.856  34.490 -66.379 1.00 149.14 ? 9   DT  I C7    1 
ATOM   7710  C  C6    . DT  I 5 82  ? 51.011  32.728 -67.692 1.00 149.22 ? 9   DT  I C6    1 
ATOM   7711  P  P     . DT  I 5 83  ? 54.451  27.351 -67.345 1.00 152.32 ? 10  DT  I P     1 
ATOM   7712  O  OP1   . DT  I 5 83  ? 54.863  26.013 -67.824 1.00 152.31 ? 10  DT  I OP1   1 
ATOM   7713  O  OP2   . DT  I 5 83  ? 54.079  27.541 -65.927 1.00 152.31 ? 10  DT  I OP2   1 
ATOM   7714  O  "O5'" . DT  I 5 83  ? 55.602  28.406 -67.692 1.00 153.50 ? 10  DT  I "O5'" 1 
ATOM   7715  C  "C5'" . DT  I 5 83  ? 55.877  28.755 -69.051 1.00 154.54 ? 10  DT  I "C5'" 1 
ATOM   7716  C  "C4'" . DT  I 5 83  ? 56.859  29.914 -69.126 1.00 155.55 ? 10  DT  I "C4'" 1 
ATOM   7717  O  "O4'" . DT  I 5 83  ? 56.136  31.170 -69.063 1.00 155.66 ? 10  DT  I "O4'" 1 
ATOM   7718  C  "C3'" . DT  I 5 83  ? 57.902  29.963 -67.998 1.00 156.40 ? 10  DT  I "C3'" 1 
ATOM   7719  O  "O3'" . DT  I 5 83  ? 59.220  30.017 -68.542 1.00 157.49 ? 10  DT  I "O3'" 1 
ATOM   7720  C  "C2'" . DT  I 5 83  ? 57.553  31.240 -67.229 1.00 156.10 ? 10  DT  I "C2'" 1 
ATOM   7721  C  "C1'" . DT  I 5 83  ? 56.883  32.079 -68.299 1.00 155.83 ? 10  DT  I "C1'" 1 
ATOM   7722  N  N1    . DT  I 5 83  ? 55.969  33.116 -67.750 1.00 155.71 ? 10  DT  I N1    1 
ATOM   7723  C  C2    . DT  I 5 83  ? 56.022  34.390 -68.260 1.00 155.70 ? 10  DT  I C2    1 
ATOM   7724  O  O2    . DT  I 5 83  ? 56.747  34.710 -69.189 1.00 155.67 ? 10  DT  I O2    1 
ATOM   7725  N  N3    . DT  I 5 83  ? 55.163  35.278 -67.664 1.00 155.69 ? 10  DT  I N3    1 
ATOM   7726  C  C4    . DT  I 5 83  ? 54.297  35.024 -66.615 1.00 155.65 ? 10  DT  I C4    1 
ATOM   7727  O  O4    . DT  I 5 83  ? 53.595  35.927 -66.173 1.00 155.64 ? 10  DT  I O4    1 
ATOM   7728  C  C5    . DT  I 5 83  ? 54.321  33.678 -66.107 1.00 155.64 ? 10  DT  I C5    1 
ATOM   7729  C  C7    . DT  I 5 83  ? 53.435  33.291 -64.965 1.00 155.68 ? 10  DT  I C7    1 
ATOM   7730  C  C6    . DT  I 5 83  ? 55.145  32.800 -66.689 1.00 155.63 ? 10  DT  I C6    1 
ATOM   7731  P  P     . DA  I 5 84  ? 60.507  29.927 -67.583 1.00 158.54 ? 11  DA  I P     1 
ATOM   7732  O  OP1   . DA  I 5 84  ? 61.576  29.224 -68.327 1.00 158.56 ? 11  DA  I OP1   1 
ATOM   7733  O  OP2   . DA  I 5 84  ? 60.074  29.411 -66.262 1.00 158.51 ? 11  DA  I OP2   1 
ATOM   7734  O  "O5'" . DA  I 5 84  ? 60.921  31.471 -67.403 1.00 159.52 ? 11  DA  I "O5'" 1 
ATOM   7735  C  "C5'" . DA  I 5 84  ? 60.892  32.358 -68.537 1.00 160.45 ? 11  DA  I "C5'" 1 
ATOM   7736  C  "C4'" . DA  I 5 84  ? 61.135  33.808 -68.130 1.00 161.30 ? 11  DA  I "C4'" 1 
ATOM   7737  O  "O4'" . DA  I 5 84  ? 59.883  34.421 -67.726 1.00 161.63 ? 11  DA  I "O4'" 1 
ATOM   7738  C  "C3'" . DA  I 5 84  ? 62.121  34.015 -66.970 1.00 161.76 ? 11  DA  I "C3'" 1 
ATOM   7739  O  "O3'" . DA  I 5 84  ? 63.112  34.997 -67.322 1.00 162.05 ? 11  DA  I "O3'" 1 
ATOM   7740  C  "C2'" . DA  I 5 84  ? 61.233  34.495 -65.818 1.00 161.85 ? 11  DA  I "C2'" 1 
ATOM   7741  C  "C1'" . DA  I 5 84  ? 60.090  35.176 -66.557 1.00 161.91 ? 11  DA  I "C1'" 1 
ATOM   7742  N  N9    . DA  I 5 84  ? 58.846  35.199 -65.795 1.00 162.24 ? 11  DA  I N9    1 
ATOM   7743  C  C8    . DA  I 5 84  ? 58.187  34.126 -65.263 1.00 162.31 ? 11  DA  I C8    1 
ATOM   7744  N  N7    . DA  I 5 84  ? 57.098  34.445 -64.605 1.00 162.41 ? 11  DA  I N7    1 
ATOM   7745  C  C5    . DA  I 5 84  ? 57.055  35.827 -64.685 1.00 162.52 ? 11  DA  I C5    1 
ATOM   7746  C  C6    . DA  I 5 84  ? 56.155  36.781 -64.168 1.00 162.59 ? 11  DA  I C6    1 
ATOM   7747  N  N6    . DA  I 5 84  ? 55.064  36.455 -63.467 1.00 162.57 ? 11  DA  I N6    1 
ATOM   7748  N  N1    . DA  I 5 84  ? 56.386  38.081 -64.456 1.00 162.64 ? 11  DA  I N1    1 
ATOM   7749  C  C2    . DA  I 5 84  ? 57.473  38.400 -65.171 1.00 162.63 ? 11  DA  I C2    1 
ATOM   7750  N  N3    . DA  I 5 84  ? 58.397  37.596 -65.696 1.00 162.62 ? 11  DA  I N3    1 
ATOM   7751  C  C4    . DA  I 5 84  ? 58.128  36.309 -65.411 1.00 162.48 ? 11  DA  I C4    1 
ATOM   7752  P  P     . DG  I 5 85  ? 64.616  34.859 -66.772 1.00 162.27 ? 12  DG  I P     1 
ATOM   7753  O  OP1   . DG  I 5 85  ? 65.530  34.819 -67.936 1.00 162.26 ? 12  DG  I OP1   1 
ATOM   7754  O  OP2   . DG  I 5 85  ? 64.639  33.764 -65.774 1.00 162.24 ? 12  DG  I OP2   1 
ATOM   7755  O  "O5'" . DG  I 5 85  ? 64.841  36.230 -65.992 1.00 162.53 ? 12  DG  I "O5'" 1 
ATOM   7756  C  "C5'" . DG  I 5 85  ? 64.877  37.458 -66.703 1.00 162.82 ? 12  DG  I "C5'" 1 
ATOM   7757  C  "C4'" . DG  I 5 85  ? 64.498  38.611 -65.793 1.00 163.12 ? 12  DG  I "C4'" 1 
ATOM   7758  O  "O4'" . DG  I 5 85  ? 63.261  38.294 -65.099 1.00 163.13 ? 12  DG  I "O4'" 1 
ATOM   7759  C  "C3'" . DG  I 5 85  ? 65.519  38.943 -64.702 1.00 163.41 ? 12  DG  I "C3'" 1 
ATOM   7760  O  "O3'" . DG  I 5 85  ? 65.573  40.353 -64.510 1.00 163.80 ? 12  DG  I "O3'" 1 
ATOM   7761  C  "C2'" . DG  I 5 85  ? 64.943  38.238 -63.476 1.00 163.28 ? 12  DG  I "C2'" 1 
ATOM   7762  C  "C1'" . DG  I 5 85  ? 63.454  38.429 -63.707 1.00 163.11 ? 12  DG  I "C1'" 1 
ATOM   7763  N  N9    . DG  I 5 85  ? 62.617  37.450 -63.016 1.00 162.86 ? 12  DG  I N9    1 
ATOM   7764  C  C8    . DG  I 5 85  ? 62.953  36.161 -62.671 1.00 162.78 ? 12  DG  I C8    1 
ATOM   7765  N  N7    . DG  I 5 85  ? 62.000  35.527 -62.046 1.00 162.69 ? 12  DG  I N7    1 
ATOM   7766  C  C5    . DG  I 5 85  ? 60.973  36.460 -61.958 1.00 162.63 ? 12  DG  I C5    1 
ATOM   7767  C  C6    . DG  I 5 85  ? 59.686  36.348 -61.384 1.00 162.54 ? 12  DG  I C6    1 
ATOM   7768  O  O6    . DG  I 5 85  ? 59.182  35.374 -60.812 1.00 162.50 ? 12  DG  I O6    1 
ATOM   7769  N  N1    . DG  I 5 85  ? 58.962  37.531 -61.511 1.00 162.54 ? 12  DG  I N1    1 
ATOM   7770  C  C2    . DG  I 5 85  ? 59.417  38.667 -62.137 1.00 162.52 ? 12  DG  I C2    1 
ATOM   7771  N  N2    . DG  I 5 85  ? 58.576  39.707 -62.163 1.00 162.49 ? 12  DG  I N2    1 
ATOM   7772  N  N3    . DG  I 5 85  ? 60.623  38.789 -62.664 1.00 162.57 ? 12  DG  I N3    1 
ATOM   7773  C  C4    . DG  I 5 85  ? 61.343  37.649 -62.542 1.00 162.68 ? 12  DG  I C4    1 
ATOM   7774  P  P     . DG  I 5 86  ? 66.921  41.060 -64.009 1.00 164.10 ? 13  DG  I P     1 
ATOM   7775  O  OP1   . DG  I 5 86  ? 67.892  41.038 -65.128 1.00 164.13 ? 13  DG  I OP1   1 
ATOM   7776  O  OP2   . DG  I 5 86  ? 67.292  40.476 -62.696 1.00 164.09 ? 13  DG  I OP2   1 
ATOM   7777  O  "O5'" . DG  I 5 86  ? 66.446  42.569 -63.760 1.00 164.24 ? 13  DG  I "O5'" 1 
ATOM   7778  C  "C5'" . DG  I 5 86  ? 65.302  43.081 -64.453 1.00 164.32 ? 13  DG  I "C5'" 1 
ATOM   7779  C  "C4'" . DG  I 5 86  ? 64.375  43.856 -63.521 1.00 164.40 ? 13  DG  I "C4'" 1 
ATOM   7780  O  "O4'" . DG  I 5 86  ? 63.299  42.993 -63.060 1.00 164.55 ? 13  DG  I "O4'" 1 
ATOM   7781  C  "C3'" . DG  I 5 86  ? 65.019  44.433 -62.257 1.00 164.29 ? 13  DG  I "C3'" 1 
ATOM   7782  O  "O3'" . DG  I 5 86  ? 64.482  45.717 -62.002 1.00 164.10 ? 13  DG  I "O3'" 1 
ATOM   7783  C  "C2'" . DG  I 5 86  ? 64.598  43.438 -61.183 1.00 164.43 ? 13  DG  I "C2'" 1 
ATOM   7784  C  "C1'" . DG  I 5 86  ? 63.200  43.088 -61.657 1.00 164.69 ? 13  DG  I "C1'" 1 
ATOM   7785  N  N9    . DG  I 5 86  ? 62.712  41.817 -61.133 1.00 165.02 ? 13  DG  I N9    1 
ATOM   7786  C  C8    . DG  I 5 86  ? 63.265  40.576 -61.331 1.00 165.15 ? 13  DG  I C8    1 
ATOM   7787  N  N7    . DG  I 5 86  ? 62.631  39.619 -60.713 1.00 165.21 ? 13  DG  I N7    1 
ATOM   7788  C  C5    . DG  I 5 86  ? 61.610  40.271 -60.035 1.00 165.28 ? 13  DG  I C5    1 
ATOM   7789  C  C6    . DG  I 5 86  ? 60.597  39.748 -59.200 1.00 165.37 ? 13  DG  I C6    1 
ATOM   7790  O  O6    . DG  I 5 86  ? 60.413  38.568 -58.866 1.00 165.39 ? 13  DG  I O6    1 
ATOM   7791  N  N1    . DG  I 5 86  ? 59.755  40.753 -58.717 1.00 165.41 ? 13  DG  I N1    1 
ATOM   7792  C  C2    . DG  I 5 86  ? 59.874  42.093 -59.015 1.00 165.39 ? 13  DG  I C2    1 
ATOM   7793  N  N2    . DG  I 5 86  ? 58.969  42.912 -58.452 1.00 165.35 ? 13  DG  I N2    1 
ATOM   7794  N  N3    . DG  I 5 86  ? 60.817  42.594 -59.806 1.00 165.35 ? 13  DG  I N3    1 
ATOM   7795  C  C4    . DG  I 5 86  ? 61.646  41.627 -60.280 1.00 165.25 ? 13  DG  I C4    1 
ATOM   7796  P  P     . DG  I 5 87  ? 65.132  46.656 -60.887 1.00 164.00 ? 14  DG  I P     1 
ATOM   7797  O  OP1   . DG  I 5 87  ? 65.000  48.054 -61.346 1.00 163.95 ? 14  DG  I OP1   1 
ATOM   7798  O  OP2   . DG  I 5 87  ? 66.465  46.112 -60.543 1.00 163.95 ? 14  DG  I OP2   1 
ATOM   7799  O  "O5'" . DG  I 5 87  ? 64.171  46.431 -59.629 1.00 164.06 ? 14  DG  I "O5'" 1 
ATOM   7800  C  "C5'" . DG  I 5 87  ? 62.755  46.413 -59.804 1.00 164.04 ? 14  DG  I "C5'" 1 
ATOM   7801  C  "C4'" . DG  I 5 87  ? 62.056  45.987 -58.524 1.00 163.98 ? 14  DG  I "C4'" 1 
ATOM   7802  O  "O4'" . DG  I 5 87  ? 62.079  44.542 -58.416 1.00 163.95 ? 14  DG  I "O4'" 1 
ATOM   7803  C  "C3'" . DG  I 5 87  ? 62.677  46.530 -57.235 1.00 163.96 ? 14  DG  I "C3'" 1 
ATOM   7804  O  "O3'" . DG  I 5 87  ? 61.669  47.115 -56.416 1.00 163.98 ? 14  DG  I "O3'" 1 
ATOM   7805  C  "C2'" . DG  I 5 87  ? 63.305  45.297 -56.574 1.00 163.94 ? 14  DG  I "C2'" 1 
ATOM   7806  C  "C1'" . DG  I 5 87  ? 62.435  44.170 -57.106 1.00 163.97 ? 14  DG  I "C1'" 1 
ATOM   7807  N  N9    . DG  I 5 87  ? 63.118  42.875 -57.165 1.00 164.06 ? 14  DG  I N9    1 
ATOM   7808  C  C8    . DG  I 5 87  ? 64.279  42.580 -57.840 1.00 164.10 ? 14  DG  I C8    1 
ATOM   7809  N  N7    . DG  I 5 87  ? 64.639  41.328 -57.739 1.00 164.11 ? 14  DG  I N7    1 
ATOM   7810  C  C5    . DG  I 5 87  ? 63.664  40.757 -56.929 1.00 164.06 ? 14  DG  I C5    1 
ATOM   7811  C  C6    . DG  I 5 87  ? 63.529  39.425 -56.456 1.00 163.94 ? 14  DG  I C6    1 
ATOM   7812  O  O6    . DG  I 5 87  ? 64.269  38.454 -56.668 1.00 163.80 ? 14  DG  I O6    1 
ATOM   7813  N  N1    . DG  I 5 87  ? 62.397  39.275 -55.661 1.00 163.98 ? 14  DG  I N1    1 
ATOM   7814  C  C2    . DG  I 5 87  ? 61.495  40.277 -55.379 1.00 164.04 ? 14  DG  I C2    1 
ATOM   7815  N  N2    . DG  I 5 87  ? 60.469  39.946 -54.583 1.00 164.05 ? 14  DG  I N2    1 
ATOM   7816  N  N3    . DG  I 5 87  ? 61.616  41.527 -55.802 1.00 164.09 ? 14  DG  I N3    1 
ATOM   7817  C  C4    . DG  I 5 87  ? 62.720  41.696 -56.568 1.00 164.08 ? 14  DG  I C4    1 
ATOM   7818  P  P     . DT  I 5 88  ? 61.915  48.545 -55.732 1.00 163.96 ? 15  DT  I P     1 
ATOM   7819  O  OP1   . DT  I 5 88  ? 61.877  49.574 -56.797 1.00 163.98 ? 15  DT  I OP1   1 
ATOM   7820  O  OP2   . DT  I 5 88  ? 63.101  48.428 -54.853 1.00 163.91 ? 15  DT  I OP2   1 
ATOM   7821  O  "O5'" . DT  I 5 88  ? 60.631  48.727 -54.797 1.00 163.94 ? 15  DT  I "O5'" 1 
ATOM   7822  C  "C5'" . DT  I 5 88  ? 59.343  48.894 -55.378 1.00 163.88 ? 15  DT  I "C5'" 1 
ATOM   7823  C  "C4'" . DT  I 5 88  ? 58.339  47.941 -54.751 1.00 163.82 ? 15  DT  I "C4'" 1 
ATOM   7824  O  "O4'" . DT  I 5 88  ? 58.830  46.578 -54.844 1.00 163.84 ? 15  DT  I "O4'" 1 
ATOM   7825  C  "C3'" . DT  I 5 88  ? 58.028  48.192 -53.277 1.00 163.73 ? 15  DT  I "C3'" 1 
ATOM   7826  O  "O3'" . DT  I 5 88  ? 56.634  48.092 -53.063 1.00 163.65 ? 15  DT  I "O3'" 1 
ATOM   7827  C  "C2'" . DT  I 5 88  ? 58.789  47.083 -52.551 1.00 163.75 ? 15  DT  I "C2'" 1 
ATOM   7828  C  "C1'" . DT  I 5 88  ? 58.776  45.957 -53.580 1.00 163.78 ? 15  DT  I "C1'" 1 
ATOM   7829  N  N1    . DT  I 5 88  ? 59.940  45.008 -53.474 1.00 163.74 ? 15  DT  I N1    1 
ATOM   7830  C  C2    . DT  I 5 88  ? 59.800  43.726 -53.950 1.00 163.72 ? 15  DT  I C2    1 
ATOM   7831  O  O2    . DT  I 5 88  ? 58.764  43.301 -54.434 1.00 163.63 ? 15  DT  I O2    1 
ATOM   7832  N  N3    . DT  I 5 88  ? 60.924  42.950 -53.837 1.00 163.83 ? 15  DT  I N3    1 
ATOM   7833  C  C4    . DT  I 5 88  ? 62.155  43.324 -53.321 1.00 163.83 ? 15  DT  I C4    1 
ATOM   7834  O  O4    . DT  I 5 88  ? 63.075  42.511 -53.294 1.00 163.85 ? 15  DT  I O4    1 
ATOM   7835  C  C5    . DT  I 5 88  ? 62.240  44.686 -52.856 1.00 163.75 ? 15  DT  I C5    1 
ATOM   7836  C  C7    . DT  I 5 88  ? 63.521  45.208 -52.279 1.00 163.71 ? 15  DT  I C7    1 
ATOM   7837  C  C6    . DT  I 5 88  ? 61.148  45.457 -52.965 1.00 163.74 ? 15  DT  I C6    1 
ATOM   7838  P  P     . DT  I 5 89  ? 55.943  48.898 -51.871 1.00 163.59 ? 16  DT  I P     1 
ATOM   7839  O  OP1   . DT  I 5 89  ? 54.922  49.793 -52.462 1.00 163.52 ? 16  DT  I OP1   1 
ATOM   7840  O  OP2   . DT  I 5 89  ? 57.011  49.458 -51.011 1.00 163.51 ? 16  DT  I OP2   1 
ATOM   7841  O  "O5'" . DT  I 5 89  ? 55.208  47.740 -51.045 1.00 163.71 ? 16  DT  I "O5'" 1 
ATOM   7842  C  "C5'" . DT  I 5 89  ? 55.044  46.443 -51.619 1.00 163.75 ? 16  DT  I "C5'" 1 
ATOM   7843  C  "C4'" . DT  I 5 89  ? 55.387  45.358 -50.614 1.00 163.83 ? 16  DT  I "C4'" 1 
ATOM   7844  O  "O4'" . DT  I 5 89  ? 56.812  45.104 -50.640 1.00 163.85 ? 16  DT  I "O4'" 1 
ATOM   7845  C  "C3'" . DT  I 5 89  ? 55.032  45.684 -49.154 1.00 163.82 ? 16  DT  I "C3'" 1 
ATOM   7846  O  "O3'" . DT  I 5 89  ? 54.166  44.684 -48.635 1.00 163.77 ? 16  DT  I "O3'" 1 
ATOM   7847  C  "C2'" . DT  I 5 89  ? 56.386  45.687 -48.430 1.00 163.92 ? 16  DT  I "C2'" 1 
ATOM   7848  C  "C1'" . DT  I 5 89  ? 57.240  44.813 -49.337 1.00 163.89 ? 16  DT  I "C1'" 1 
ATOM   7849  N  N1    . DT  I 5 89  ? 58.713  45.086 -49.236 1.00 163.96 ? 16  DT  I N1    1 
ATOM   7850  C  C2    . DT  I 5 89  ? 59.599  44.035 -49.325 1.00 163.95 ? 16  DT  I C2    1 
ATOM   7851  O  O2    . DT  I 5 89  ? 59.252  42.881 -49.511 1.00 163.96 ? 16  DT  I O2    1 
ATOM   7852  N  N3    . DT  I 5 89  ? 60.917  44.387 -49.211 1.00 164.00 ? 16  DT  I N3    1 
ATOM   7853  C  C4    . DT  I 5 89  ? 61.429  45.657 -49.011 1.00 163.93 ? 16  DT  I C4    1 
ATOM   7854  O  O4    . DT  I 5 89  ? 62.644  45.808 -48.904 1.00 163.95 ? 16  DT  I O4    1 
ATOM   7855  C  C5    . DT  I 5 89  ? 60.444  46.710 -48.900 1.00 163.94 ? 16  DT  I C5    1 
ATOM   7856  C  C7    . DT  I 5 89  ? 60.874  48.127 -48.672 1.00 163.88 ? 16  DT  I C7    1 
ATOM   7857  C  C6    . DT  I 5 89  ? 59.153  46.378 -49.016 1.00 163.90 ? 16  DT  I C6    1 
ATOM   7858  P  P     . DA  I 5 90  ? 53.109  45.034 -47.483 1.00 163.56 ? 17  DA  I P     1 
ATOM   7859  O  OP1   . DA  I 5 90  ? 51.865  45.499 -48.136 1.00 163.49 ? 17  DA  I OP1   1 
ATOM   7860  O  OP2   . DA  I 5 90  ? 53.777  45.887 -46.473 1.00 163.47 ? 17  DA  I OP2   1 
ATOM   7861  O  "O5'" . DA  I 5 90  ? 52.849  43.601 -46.822 1.00 163.82 ? 17  DA  I "O5'" 1 
ATOM   7862  C  "C5'" . DA  I 5 90  ? 52.774  42.436 -47.654 1.00 164.03 ? 17  DA  I "C5'" 1 
ATOM   7863  C  "C4'" . DA  I 5 90  ? 53.490  41.243 -47.029 1.00 164.27 ? 17  DA  I "C4'" 1 
ATOM   7864  O  "O4'" . DA  I 5 90  ? 54.922  41.461 -47.037 1.00 164.35 ? 17  DA  I "O4'" 1 
ATOM   7865  C  "C3'" . DA  I 5 90  ? 53.120  40.914 -45.584 1.00 164.36 ? 17  DA  I "C3'" 1 
ATOM   7866  O  "O3'" . DA  I 5 90  ? 53.098  39.506 -45.414 1.00 164.47 ? 17  DA  I "O3'" 1 
ATOM   7867  C  "C2'" . DA  I 5 90  ? 54.255  41.552 -44.785 1.00 164.42 ? 17  DA  I "C2'" 1 
ATOM   7868  C  "C1'" . DA  I 5 90  ? 55.435  41.360 -45.723 1.00 164.42 ? 17  DA  I "C1'" 1 
ATOM   7869  N  N9    . DA  I 5 90  ? 56.470  42.372 -45.569 1.00 164.40 ? 17  DA  I N9    1 
ATOM   7870  C  C8    . DA  I 5 90  ? 56.304  43.675 -45.186 1.00 164.38 ? 17  DA  I C8    1 
ATOM   7871  N  N7    . DA  I 5 90  ? 57.414  44.372 -45.195 1.00 164.35 ? 17  DA  I N7    1 
ATOM   7872  C  C5    . DA  I 5 90  ? 58.369  43.466 -45.626 1.00 164.42 ? 17  DA  I C5    1 
ATOM   7873  C  C6    . DA  I 5 90  ? 59.752  43.580 -45.851 1.00 164.48 ? 17  DA  I C6    1 
ATOM   7874  N  N6    . DA  I 5 90  ? 60.437  44.711 -45.656 1.00 164.53 ? 17  DA  I N6    1 
ATOM   7875  N  N1    . DA  I 5 90  ? 60.408  42.482 -46.284 1.00 164.45 ? 17  DA  I N1    1 
ATOM   7876  C  C2    . DA  I 5 90  ? 59.719  41.352 -46.470 1.00 164.47 ? 17  DA  I C2    1 
ATOM   7877  N  N3    . DA  I 5 90  ? 58.420  41.127 -46.305 1.00 164.36 ? 17  DA  I N3    1 
ATOM   7878  C  C4    . DA  I 5 90  ? 57.799  42.233 -45.870 1.00 164.42 ? 17  DA  I C4    1 
ATOM   7879  P  P     . DG  I 5 91  ? 52.358  38.852 -44.158 1.00 164.57 ? 18  DG  I P     1 
ATOM   7880  O  OP1   . DG  I 5 91  ? 51.435  37.815 -44.669 1.00 164.52 ? 18  DG  I OP1   1 
ATOM   7881  O  OP2   . DG  I 5 91  ? 51.850  39.940 -43.293 1.00 164.49 ? 18  DG  I OP2   1 
ATOM   7882  O  "O5'" . DG  I 5 91  ? 53.553  38.139 -43.392 1.00 164.99 ? 18  DG  I "O5'" 1 
ATOM   7883  C  "C5'" . DG  I 5 91  ? 54.448  37.306 -44.109 1.00 165.47 ? 18  DG  I "C5'" 1 
ATOM   7884  C  "C4'" . DG  I 5 91  ? 55.755  37.171 -43.360 1.00 165.97 ? 18  DG  I "C4'" 1 
ATOM   7885  O  "O4'" . DG  I 5 91  ? 56.538  38.366 -43.568 1.00 166.02 ? 18  DG  I "O4'" 1 
ATOM   7886  C  "C3'" . DG  I 5 91  ? 55.601  37.021 -41.841 1.00 166.37 ? 18  DG  I "C3'" 1 
ATOM   7887  O  "O3'" . DG  I 5 91  ? 56.054  35.736 -41.413 1.00 166.83 ? 18  DG  I "O3'" 1 
ATOM   7888  C  "C2'" . DG  I 5 91  ? 56.446  38.158 -41.247 1.00 166.25 ? 18  DG  I "C2'" 1 
ATOM   7889  C  "C1'" . DG  I 5 91  ? 57.303  38.607 -42.421 1.00 166.14 ? 18  DG  I "C1'" 1 
ATOM   7890  N  N9    . DG  I 5 91  ? 57.644  40.024 -42.375 1.00 166.10 ? 18  DG  I N9    1 
ATOM   7891  C  C8    . DG  I 5 91  ? 56.822  41.064 -42.009 1.00 166.08 ? 18  DG  I C8    1 
ATOM   7892  N  N7    . DG  I 5 91  ? 57.420  42.223 -42.006 1.00 166.05 ? 18  DG  I N7    1 
ATOM   7893  C  C5    . DG  I 5 91  ? 58.728  41.930 -42.367 1.00 166.04 ? 18  DG  I C5    1 
ATOM   7894  C  C6    . DG  I 5 91  ? 59.843  42.785 -42.523 1.00 166.03 ? 18  DG  I C6    1 
ATOM   7895  O  O6    . DG  I 5 91  ? 59.895  44.012 -42.365 1.00 165.95 ? 18  DG  I O6    1 
ATOM   7896  N  N1    . DG  I 5 91  ? 60.986  42.078 -42.901 1.00 166.06 ? 18  DG  I N1    1 
ATOM   7897  C  C2    . DG  I 5 91  ? 61.040  40.716 -43.098 1.00 166.10 ? 18  DG  I C2    1 
ATOM   7898  N  N2    . DG  I 5 91  ? 62.228  40.211 -43.463 1.00 166.02 ? 18  DG  I N2    1 
ATOM   7899  N  N3    . DG  I 5 91  ? 60.003  39.905 -42.949 1.00 166.10 ? 18  DG  I N3    1 
ATOM   7900  C  C4    . DG  I 5 91  ? 58.885  40.578 -42.582 1.00 166.12 ? 18  DG  I C4    1 
ATOM   7901  P  P     . DG  I 5 92  ? 55.284  34.968 -40.232 1.00 167.26 ? 19  DG  I P     1 
ATOM   7902  O  OP1   . DG  I 5 92  ? 55.767  33.564 -40.218 1.00 167.24 ? 19  DG  I OP1   1 
ATOM   7903  O  OP2   . DG  I 5 92  ? 53.837  35.241 -40.381 1.00 167.23 ? 19  DG  I OP2   1 
ATOM   7904  O  "O5'" . DG  I 5 92  ? 55.788  35.746 -38.914 1.00 167.75 ? 19  DG  I "O5'" 1 
ATOM   7905  C  "C5'" . DG  I 5 92  ? 56.615  35.103 -37.940 1.00 168.20 ? 19  DG  I "C5'" 1 
ATOM   7906  C  "C4'" . DG  I 5 92  ? 58.079  35.374 -38.225 1.00 168.67 ? 19  DG  I "C4'" 1 
ATOM   7907  O  "O4'" . DG  I 5 92  ? 58.221  36.657 -38.892 1.00 168.66 ? 19  DG  I "O4'" 1 
ATOM   7908  C  "C3'" . DG  I 5 92  ? 58.980  35.438 -36.992 1.00 169.15 ? 19  DG  I "C3'" 1 
ATOM   7909  O  "O3'" . DG  I 5 92  ? 60.204  34.778 -37.262 1.00 169.84 ? 19  DG  I "O3'" 1 
ATOM   7910  C  "C2'" . DG  I 5 92  ? 59.192  36.934 -36.805 1.00 168.94 ? 19  DG  I "C2'" 1 
ATOM   7911  C  "C1'" . DG  I 5 92  ? 59.227  37.396 -38.247 1.00 168.77 ? 19  DG  I "C1'" 1 
ATOM   7912  N  N9    . DG  I 5 92  ? 58.953  38.819 -38.410 1.00 168.73 ? 19  DG  I N9    1 
ATOM   7913  C  C8    . DG  I 5 92  ? 57.766  39.472 -38.173 1.00 168.69 ? 19  DG  I C8    1 
ATOM   7914  N  N7    . DG  I 5 92  ? 57.838  40.762 -38.359 1.00 168.69 ? 19  DG  I N7    1 
ATOM   7915  C  C5    . DG  I 5 92  ? 59.166  40.981 -38.712 1.00 168.73 ? 19  DG  I C5    1 
ATOM   7916  C  C6    . DG  I 5 92  ? 59.843  42.186 -39.029 1.00 168.70 ? 19  DG  I C6    1 
ATOM   7917  O  O6    . DG  I 5 92  ? 59.386  43.337 -39.069 1.00 168.67 ? 19  DG  I O6    1 
ATOM   7918  N  N1    . DG  I 5 92  ? 61.187  41.959 -39.324 1.00 168.70 ? 19  DG  I N1    1 
ATOM   7919  C  C2    . DG  I 5 92  ? 61.799  40.726 -39.314 1.00 168.71 ? 19  DG  I C2    1 
ATOM   7920  N  N2    . DG  I 5 92  ? 63.104  40.705 -39.626 1.00 168.70 ? 19  DG  I N2    1 
ATOM   7921  N  N3    . DG  I 5 92  ? 61.177  39.593 -39.021 1.00 168.72 ? 19  DG  I N3    1 
ATOM   7922  C  C4    . DG  I 5 92  ? 59.867  39.796 -38.730 1.00 168.76 ? 19  DG  I C4    1 
ATOM   7923  P  P     . DG  I 5 93  ? 61.007  34.070 -36.076 1.00 170.51 ? 20  DG  I P     1 
ATOM   7924  O  OP1   . DG  I 5 93  ? 61.999  33.150 -36.683 1.00 170.53 ? 20  DG  I OP1   1 
ATOM   7925  O  OP2   . DG  I 5 93  ? 60.015  33.552 -35.104 1.00 170.57 ? 20  DG  I OP2   1 
ATOM   7926  O  "O5'" . DG  I 5 93  ? 61.781  35.295 -35.384 1.00 170.82 ? 20  DG  I "O5'" 1 
ATOM   7927  C  "C5'" . DG  I 5 93  ? 62.886  35.929 -36.047 1.00 171.09 ? 20  DG  I "C5'" 1 
ATOM   7928  C  "C4'" . DG  I 5 93  ? 63.538  36.990 -35.163 1.00 171.34 ? 20  DG  I "C4'" 1 
ATOM   7929  O  "O4'" . DG  I 5 93  ? 63.118  38.314 -35.595 1.00 171.42 ? 20  DG  I "O4'" 1 
ATOM   7930  C  "C3'" . DG  I 5 93  ? 63.209  36.904 -33.662 1.00 171.56 ? 20  DG  I "C3'" 1 
ATOM   7931  O  "O3'" . DG  I 5 93  ? 64.403  36.972 -32.881 1.00 171.77 ? 20  DG  I "O3'" 1 
ATOM   7932  C  "C2'" . DG  I 5 93  ? 62.312  38.117 -33.419 1.00 171.56 ? 20  DG  I "C2'" 1 
ATOM   7933  C  "C1'" . DG  I 5 93  ? 62.829  39.096 -34.460 1.00 171.52 ? 20  DG  I "C1'" 1 
ATOM   7934  N  N9    . DG  I 5 93  ? 61.849  40.119 -34.818 1.00 171.53 ? 20  DG  I N9    1 
ATOM   7935  C  C8    . DG  I 5 93  ? 60.495  39.943 -34.970 1.00 171.57 ? 20  DG  I C8    1 
ATOM   7936  N  N7    . DG  I 5 93  ? 59.849  41.048 -35.215 1.00 171.55 ? 20  DG  I N7    1 
ATOM   7937  C  C5    . DG  I 5 93  ? 60.830  42.029 -35.184 1.00 171.51 ? 20  DG  I C5    1 
ATOM   7938  C  C6    . DG  I 5 93  ? 60.726  43.423 -35.382 1.00 171.50 ? 20  DG  I C6    1 
ATOM   7939  O  O6    . DG  I 5 93  ? 59.709  44.087 -35.627 1.00 171.48 ? 20  DG  I O6    1 
ATOM   7940  N  N1    . DG  I 5 93  ? 61.962  44.054 -35.264 1.00 171.42 ? 20  DG  I N1    1 
ATOM   7941  C  C2    . DG  I 5 93  ? 63.148  43.415 -34.990 1.00 171.48 ? 20  DG  I C2    1 
ATOM   7942  N  N2    . DG  I 5 93  ? 64.238  44.192 -34.912 1.00 171.43 ? 20  DG  I N2    1 
ATOM   7943  N  N3    . DG  I 5 93  ? 63.260  42.106 -34.804 1.00 171.43 ? 20  DG  I N3    1 
ATOM   7944  C  C4    . DG  I 5 93  ? 62.064  41.478 -34.913 1.00 171.51 ? 20  DG  I C4    1 
ATOM   7945  P  P     . DT  I 5 94  ? 64.384  36.530 -31.337 1.00 171.85 ? 21  DT  I P     1 
ATOM   7946  O  OP1   . DT  I 5 94  ? 65.698  35.917 -31.024 1.00 171.88 ? 21  DT  I OP1   1 
ATOM   7947  O  OP2   . DT  I 5 94  ? 63.136  35.765 -31.095 1.00 171.88 ? 21  DT  I OP2   1 
ATOM   7948  O  "O5'" . DT  I 5 94  ? 64.260  37.930 -30.558 1.00 171.64 ? 21  DT  I "O5'" 1 
ATOM   7949  C  "C5'" . DT  I 5 94  ? 65.159  39.002 -30.855 1.00 171.38 ? 21  DT  I "C5'" 1 
ATOM   7950  C  "C4'" . DT  I 5 94  ? 64.656  40.315 -30.274 1.00 171.13 ? 21  DT  I "C4'" 1 
ATOM   7951  O  "O4'" . DT  I 5 94  ? 63.630  40.867 -31.134 1.00 171.14 ? 21  DT  I "O4'" 1 
ATOM   7952  C  "C3'" . DT  I 5 94  ? 64.031  40.216 -28.874 1.00 170.89 ? 21  DT  I "C3'" 1 
ATOM   7953  O  "O3'" . DT  I 5 94  ? 64.834  40.929 -27.920 1.00 170.50 ? 21  DT  I "O3'" 1 
ATOM   7954  C  "C2'" . DT  I 5 94  ? 62.636  40.848 -29.026 1.00 171.01 ? 21  DT  I "C2'" 1 
ATOM   7955  C  "C1'" . DT  I 5 94  ? 62.740  41.610 -30.342 1.00 171.09 ? 21  DT  I "C1'" 1 
ATOM   7956  N  N1    . DT  I 5 94  ? 61.418  41.747 -31.065 1.00 171.03 ? 21  DT  I N1    1 
ATOM   7957  C  C2    . DT  I 5 94  ? 61.026  42.985 -31.531 1.00 171.00 ? 21  DT  I C2    1 
ATOM   7958  O  O2    . DT  I 5 94  ? 61.730  43.976 -31.467 1.00 171.00 ? 21  DT  I O2    1 
ATOM   7959  N  N3    . DT  I 5 94  ? 59.795  43.009 -32.130 1.00 170.95 ? 21  DT  I N3    1 
ATOM   7960  C  C4    . DT  I 5 94  ? 58.918  41.951 -32.281 1.00 170.92 ? 21  DT  I C4    1 
ATOM   7961  O  O4    . DT  I 5 94  ? 57.844  42.132 -32.846 1.00 170.93 ? 21  DT  I O4    1 
ATOM   7962  C  C5    . DT  I 5 94  ? 59.374  40.691 -31.742 1.00 170.90 ? 21  DT  I C5    1 
ATOM   7963  C  C7    . DT  I 5 94  ? 58.513  39.469 -31.848 1.00 170.88 ? 21  DT  I C7    1 
ATOM   7964  C  C6    . DT  I 5 94  ? 60.579  40.653 -31.157 1.00 170.96 ? 21  DT  I C6    1 
ATOM   7965  P  P     . DT  I 5 95  ? 64.542  40.800 -26.344 1.00 169.98 ? 22  DT  I P     1 
ATOM   7966  O  OP1   . DT  I 5 95  ? 65.849  40.837 -25.637 1.00 169.96 ? 22  DT  I OP1   1 
ATOM   7967  O  OP2   . DT  I 5 95  ? 63.634  39.649 -26.137 1.00 169.96 ? 22  DT  I OP2   1 
ATOM   7968  O  "O5'" . DT  I 5 95  ? 63.710  42.143 -26.033 1.00 169.40 ? 22  DT  I "O5'" 1 
ATOM   7969  C  "C5'" . DT  I 5 95  ? 64.272  43.189 -25.246 1.00 168.90 ? 22  DT  I "C5'" 1 
ATOM   7970  C  "C4'" . DT  I 5 95  ? 64.293  44.503 -26.012 1.00 168.39 ? 22  DT  I "C4'" 1 
ATOM   7971  O  "O4'" . DT  I 5 95  ? 63.734  44.316 -27.331 1.00 168.19 ? 22  DT  I "O4'" 1 
ATOM   7972  C  "C3'" . DT  I 5 95  ? 63.448  45.602 -25.408 1.00 168.25 ? 22  DT  I "C3'" 1 
ATOM   7973  O  "O3'" . DT  I 5 95  ? 64.168  46.266 -24.361 1.00 168.19 ? 22  DT  I "O3'" 1 
ATOM   7974  C  "C2'" . DT  I 5 95  ? 63.227  46.524 -26.605 1.00 168.08 ? 22  DT  I "C2'" 1 
ATOM   7975  C  "C1'" . DT  I 5 95  ? 63.161  45.538 -27.776 1.00 167.95 ? 22  DT  I "C1'" 1 
ATOM   7976  N  N1    . DT  I 5 95  ? 61.764  45.274 -28.277 1.00 167.75 ? 22  DT  I N1    1 
ATOM   7977  C  C2    . DT  I 5 95  ? 61.104  46.248 -28.998 1.00 167.57 ? 22  DT  I C2    1 
ATOM   7978  O  O2    . DT  I 5 95  ? 61.584  47.339 -29.248 1.00 167.57 ? 22  DT  I O2    1 
ATOM   7979  N  N3    . DT  I 5 95  ? 59.853  45.890 -29.432 1.00 167.44 ? 22  DT  I N3    1 
ATOM   7980  C  C4    . DT  I 5 95  ? 59.208  44.685 -29.219 1.00 167.34 ? 22  DT  I C4    1 
ATOM   7981  O  O4    . DT  I 5 95  ? 58.084  44.512 -29.669 1.00 167.22 ? 22  DT  I O4    1 
ATOM   7982  C  C5    . DT  I 5 95  ? 59.949  43.713 -28.458 1.00 167.45 ? 22  DT  I C5    1 
ATOM   7983  C  C7    . DT  I 5 95  ? 59.343  42.374 -28.160 1.00 167.38 ? 22  DT  I C7    1 
ATOM   7984  C  C6    . DT  I 5 95  ? 61.177  44.049 -28.028 1.00 167.62 ? 22  DT  I C6    1 
ATOM   7985  P  P     . DA  I 5 96  ? 63.563  46.314 -22.873 1.00 167.98 ? 23  DA  I P     1 
ATOM   7986  O  OP1   . DA  I 5 96  ? 64.695  46.342 -21.915 1.00 167.98 ? 23  DA  I OP1   1 
ATOM   7987  O  OP2   . DA  I 5 96  ? 62.538  45.246 -22.769 1.00 168.03 ? 23  DA  I OP2   1 
ATOM   7988  O  "O5'" . DA  I 5 96  ? 62.806  47.731 -22.828 1.00 167.39 ? 23  DA  I "O5'" 1 
ATOM   7989  C  "C5'" . DA  I 5 96  ? 63.156  48.780 -23.746 1.00 166.68 ? 23  DA  I "C5'" 1 
ATOM   7990  C  "C4'" . DA  I 5 96  ? 61.995  49.739 -23.940 1.00 165.96 ? 23  DA  I "C4'" 1 
ATOM   7991  O  "O4'" . DA  I 5 96  ? 60.938  49.093 -24.712 1.00 165.85 ? 23  DA  I "O4'" 1 
ATOM   7992  C  "C3'" . DA  I 5 96  ? 61.336  50.222 -22.642 1.00 165.41 ? 23  DA  I "C3'" 1 
ATOM   7993  O  "O3'" . DA  I 5 96  ? 61.163  51.628 -22.680 1.00 164.69 ? 23  DA  I "O3'" 1 
ATOM   7994  C  "C2'" . DA  I 5 96  ? 59.993  49.495 -22.637 1.00 165.56 ? 23  DA  I "C2'" 1 
ATOM   7995  C  "C1'" . DA  I 5 96  ? 59.699  49.404 -24.119 1.00 165.69 ? 23  DA  I "C1'" 1 
ATOM   7996  N  N9    . DA  I 5 96  ? 58.717  48.371 -24.448 1.00 165.64 ? 23  DA  I N9    1 
ATOM   7997  C  C8    . DA  I 5 96  ? 58.506  47.194 -23.782 1.00 165.58 ? 23  DA  I C8    1 
ATOM   7998  N  N7    . DA  I 5 96  ? 57.489  46.500 -24.237 1.00 165.57 ? 23  DA  I N7    1 
ATOM   7999  C  C5    . DA  I 5 96  ? 56.968  47.297 -25.243 1.00 165.65 ? 23  DA  I C5    1 
ATOM   8000  C  C6    . DA  I 5 96  ? 55.878  47.127 -26.123 1.00 165.68 ? 23  DA  I C6    1 
ATOM   8001  N  N6    . DA  I 5 96  ? 55.091  46.045 -26.122 1.00 165.68 ? 23  DA  I N6    1 
ATOM   8002  N  N1    . DA  I 5 96  ? 55.629  48.114 -27.009 1.00 165.71 ? 23  DA  I N1    1 
ATOM   8003  C  C2    . DA  I 5 96  ? 56.411  49.201 -26.998 1.00 165.73 ? 23  DA  I C2    1 
ATOM   8004  N  N3    . DA  I 5 96  ? 57.476  49.463 -26.240 1.00 165.71 ? 23  DA  I N3    1 
ATOM   8005  C  C4    . DA  I 5 96  ? 57.695  48.468 -25.366 1.00 165.67 ? 23  DA  I C4    1 
ATOM   8006  P  P     . DG  I 5 97  ? 60.762  52.432 -21.352 1.00 163.98 ? 24  DG  I P     1 
ATOM   8007  O  OP1   . DG  I 5 97  ? 61.772  53.494 -21.140 1.00 164.11 ? 24  DG  I OP1   1 
ATOM   8008  O  OP2   . DG  I 5 97  ? 60.483  51.453 -20.273 1.00 163.95 ? 24  DG  I OP2   1 
ATOM   8009  O  "O5'" . DG  I 5 97  ? 59.382  53.119 -21.767 1.00 163.04 ? 24  DG  I "O5'" 1 
ATOM   8010  C  "C5'" . DG  I 5 97  ? 59.273  53.782 -23.019 1.00 162.05 ? 24  DG  I "C5'" 1 
ATOM   8011  C  "C4'" . DG  I 5 97  ? 57.828  54.117 -23.324 1.00 161.12 ? 24  DG  I "C4'" 1 
ATOM   8012  O  "O4'" . DG  I 5 97  ? 57.132  52.920 -23.759 1.00 161.11 ? 24  DG  I "O4'" 1 
ATOM   8013  C  "C3'" . DG  I 5 97  ? 57.032  54.672 -22.147 1.00 160.26 ? 24  DG  I "C3'" 1 
ATOM   8014  O  "O3'" . DG  I 5 97  ? 56.210  55.740 -22.589 1.00 159.05 ? 24  DG  I "O3'" 1 
ATOM   8015  C  "C2'" . DG  I 5 97  ? 56.202  53.476 -21.681 1.00 160.67 ? 24  DG  I "C2'" 1 
ATOM   8016  C  "C1'" . DG  I 5 97  ? 55.962  52.735 -22.987 1.00 161.10 ? 24  DG  I "C1'" 1 
ATOM   8017  N  N9    . DG  I 5 97  ? 55.748  51.296 -22.815 1.00 161.42 ? 24  DG  I N9    1 
ATOM   8018  C  C8    . DG  I 5 97  ? 56.699  50.356 -22.507 1.00 161.48 ? 24  DG  I C8    1 
ATOM   8019  N  N7    . DG  I 5 97  ? 56.234  49.139 -22.448 1.00 161.54 ? 24  DG  I N7    1 
ATOM   8020  C  C5    . DG  I 5 97  ? 54.881  49.279 -22.724 1.00 161.61 ? 24  DG  I C5    1 
ATOM   8021  C  C6    . DG  I 5 97  ? 53.863  48.301 -22.791 1.00 161.68 ? 24  DG  I C6    1 
ATOM   8022  O  O6    . DG  I 5 97  ? 53.962  47.079 -22.612 1.00 161.71 ? 24  DG  I O6    1 
ATOM   8023  N  N1    . DG  I 5 97  ? 52.628  48.863 -23.115 1.00 161.68 ? 24  DG  I N1    1 
ATOM   8024  C  C2    . DG  I 5 97  ? 52.405  50.202 -23.335 1.00 161.68 ? 24  DG  I C2    1 
ATOM   8025  N  N2    . DG  I 5 97  ? 51.139  50.557 -23.615 1.00 161.64 ? 24  DG  I N2    1 
ATOM   8026  N  N3    . DG  I 5 97  ? 53.349  51.134 -23.256 1.00 161.68 ? 24  DG  I N3    1 
ATOM   8027  C  C4    . DG  I 5 97  ? 54.561  50.601 -22.952 1.00 161.61 ? 24  DG  I C4    1 
ATOM   8028  P  P     . DG  I 5 98  ? 55.688  56.842 -21.552 1.00 157.83 ? 25  DG  I P     1 
ATOM   8029  O  OP1   . DG  I 5 98  ? 55.942  58.178 -22.140 1.00 157.80 ? 25  DG  I OP1   1 
ATOM   8030  O  OP2   . DG  I 5 98  ? 56.225  56.506 -20.211 1.00 157.89 ? 25  DG  I OP2   1 
ATOM   8031  O  "O5'" . DG  I 5 98  ? 54.113  56.581 -21.525 1.00 156.42 ? 25  DG  I "O5'" 1 
ATOM   8032  C  "C5'" . DG  I 5 98  ? 53.471  55.960 -22.640 1.00 154.89 ? 25  DG  I "C5'" 1 
ATOM   8033  C  "C4'" . DG  I 5 98  ? 52.189  55.266 -22.215 1.00 153.31 ? 25  DG  I "C4'" 1 
ATOM   8034  O  "O4'" . DG  I 5 98  ? 52.471  53.888 -21.878 1.00 152.94 ? 25  DG  I "O4'" 1 
ATOM   8035  C  "C3'" . DG  I 5 98  ? 51.492  55.875 -21.000 1.00 152.14 ? 25  DG  I "C3'" 1 
ATOM   8036  O  "O3'" . DG  I 5 98  ? 50.121  55.997 -21.254 1.00 150.87 ? 25  DG  I "O3'" 1 
ATOM   8037  C  "C2'" . DG  I 5 98  ? 51.775  54.879 -19.878 1.00 152.36 ? 25  DG  I "C2'" 1 
ATOM   8038  C  "C1'" . DG  I 5 98  ? 51.874  53.571 -20.644 1.00 152.65 ? 25  DG  I "C1'" 1 
ATOM   8039  N  N9    . DG  I 5 98  ? 52.702  52.569 -19.984 1.00 152.69 ? 25  DG  I N9    1 
ATOM   8040  C  C8    . DG  I 5 98  ? 53.801  52.793 -19.190 1.00 152.75 ? 25  DG  I C8    1 
ATOM   8041  N  N7    . DG  I 5 98  ? 54.357  51.697 -18.752 1.00 152.75 ? 25  DG  I N7    1 
ATOM   8042  C  C5    . DG  I 5 98  ? 53.565  50.682 -19.276 1.00 152.72 ? 25  DG  I C5    1 
ATOM   8043  C  C6    . DG  I 5 98  ? 53.667  49.277 -19.132 1.00 152.67 ? 25  DG  I C6    1 
ATOM   8044  O  O6    . DG  I 5 98  ? 54.507  48.629 -18.492 1.00 152.69 ? 25  DG  I O6    1 
ATOM   8045  N  N1    . DG  I 5 98  ? 52.659  48.613 -19.829 1.00 152.62 ? 25  DG  I N1    1 
ATOM   8046  C  C2    . DG  I 5 98  ? 51.670  49.230 -20.557 1.00 152.57 ? 25  DG  I C2    1 
ATOM   8047  N  N2    . DG  I 5 98  ? 50.794  48.425 -21.173 1.00 152.57 ? 25  DG  I N2    1 
ATOM   8048  N  N3    . DG  I 5 98  ? 51.571  50.543 -20.708 1.00 152.61 ? 25  DG  I N3    1 
ATOM   8049  C  C4    . DG  I 5 98  ? 52.541  51.204 -20.034 1.00 152.66 ? 25  DG  I C4    1 
ATOM   8050  P  P     . DG  I 5 99  ? 49.386  57.376 -20.949 1.00 149.64 ? 26  DG  I P     1 
ATOM   8051  O  OP1   . DG  I 5 99  ? 50.147  58.454 -21.619 1.00 149.59 ? 26  DG  I OP1   1 
ATOM   8052  O  OP2   . DG  I 5 99  ? 49.136  57.437 -19.489 1.00 149.61 ? 26  DG  I OP2   1 
ATOM   8053  O  "O5'" . DG  I 5 99  ? 47.979  57.202 -21.689 1.00 148.47 ? 26  DG  I "O5'" 1 
ATOM   8054  C  "C5'" . DG  I 5 99  ? 47.927  57.016 -23.104 1.00 147.21 ? 26  DG  I "C5'" 1 
ATOM   8055  C  "C4'" . DG  I 5 99  ? 47.176  55.741 -23.461 1.00 146.03 ? 26  DG  I "C4'" 1 
ATOM   8056  O  "O4'" . DG  I 5 99  ? 47.830  54.604 -22.839 1.00 145.84 ? 26  DG  I "O4'" 1 
ATOM   8057  C  "C3'" . DG  I 5 99  ? 45.712  55.684 -23.009 1.00 144.98 ? 26  DG  I "C3'" 1 
ATOM   8058  O  "O3'" . DG  I 5 99  ? 44.924  55.024 -24.003 1.00 143.53 ? 26  DG  I "O3'" 1 
ATOM   8059  C  "C2'" . DG  I 5 99  ? 45.784  54.867 -21.722 1.00 145.38 ? 26  DG  I "C2'" 1 
ATOM   8060  C  "C1'" . DG  I 5 99  ? 46.901  53.893 -22.048 1.00 145.74 ? 26  DG  I "C1'" 1 
ATOM   8061  N  N9    . DG  I 5 99  ? 47.586  53.383 -20.867 1.00 145.98 ? 26  DG  I N9    1 
ATOM   8062  C  C8    . DG  I 5 99  ? 47.904  54.078 -19.723 1.00 146.03 ? 26  DG  I C8    1 
ATOM   8063  N  N7    . DG  I 5 99  ? 48.505  53.348 -18.823 1.00 146.09 ? 26  DG  I N7    1 
ATOM   8064  C  C5    . DG  I 5 99  ? 48.581  52.087 -19.407 1.00 146.17 ? 26  DG  I C5    1 
ATOM   8065  C  C6    . DG  I 5 99  ? 49.104  50.877 -18.898 1.00 146.24 ? 26  DG  I C6    1 
ATOM   8066  O  O6    . DG  I 5 99  ? 49.677  50.686 -17.818 1.00 146.22 ? 26  DG  I O6    1 
ATOM   8067  N  N1    . DG  I 5 99  ? 48.959  49.827 -19.808 1.00 146.32 ? 26  DG  I N1    1 
ATOM   8068  C  C2    . DG  I 5 99  ? 48.371  49.936 -21.049 1.00 146.27 ? 26  DG  I C2    1 
ATOM   8069  N  N2    . DG  I 5 99  ? 48.322  48.817 -21.788 1.00 146.26 ? 26  DG  I N2    1 
ATOM   8070  N  N3    . DG  I 5 99  ? 47.868  51.062 -21.532 1.00 146.21 ? 26  DG  I N3    1 
ATOM   8071  C  C4    . DG  I 5 99  ? 47.995  52.089 -20.654 1.00 146.14 ? 26  DG  I C4    1 
ATOM   8072  P  P     . DT  I 5 100 ? 43.325  54.965 -23.884 1.00 142.01 ? 27  DT  I P     1 
ATOM   8073  O  OP1   . DT  I 5 100 ? 42.770  55.136 -25.243 1.00 141.97 ? 27  DT  I OP1   1 
ATOM   8074  O  OP2   . DT  I 5 100 ? 42.895  55.873 -22.796 1.00 141.90 ? 27  DT  I OP2   1 
ATOM   8075  O  "O5'" . DT  I 5 100 ? 43.065  53.462 -23.403 1.00 140.81 ? 27  DT  I "O5'" 1 
ATOM   8076  C  "C5'" . DT  I 5 100 ? 43.500  52.376 -24.216 1.00 139.64 ? 27  DT  I "C5'" 1 
ATOM   8077  C  "C4'" . DT  I 5 100 ? 43.262  51.044 -23.531 1.00 138.51 ? 27  DT  I "C4'" 1 
ATOM   8078  O  "O4'" . DT  I 5 100 ? 44.232  50.866 -22.465 1.00 138.25 ? 27  DT  I "O4'" 1 
ATOM   8079  C  "C3'" . DT  I 5 100 ? 41.876  50.875 -22.891 1.00 137.68 ? 27  DT  I "C3'" 1 
ATOM   8080  O  "O3'" . DT  I 5 100 ? 41.268  49.653 -23.345 1.00 136.63 ? 27  DT  I "O3'" 1 
ATOM   8081  C  "C2'" . DT  I 5 100 ? 42.178  50.841 -21.386 1.00 137.93 ? 27  DT  I "C2'" 1 
ATOM   8082  C  "C1'" . DT  I 5 100 ? 43.591  50.279 -21.362 1.00 138.07 ? 27  DT  I "C1'" 1 
ATOM   8083  N  N1    . DT  I 5 100 ? 44.358  50.614 -20.107 1.00 137.99 ? 27  DT  I N1    1 
ATOM   8084  C  C2    . DT  I 5 100 ? 44.997  49.605 -19.411 1.00 137.95 ? 27  DT  I C2    1 
ATOM   8085  O  O2    . DT  I 5 100 ? 45.019  48.445 -19.780 1.00 137.81 ? 27  DT  I O2    1 
ATOM   8086  N  N3    . DT  I 5 100 ? 45.645  50.015 -18.277 1.00 137.93 ? 27  DT  I N3    1 
ATOM   8087  C  C4    . DT  I 5 100 ? 45.697  51.296 -17.760 1.00 138.04 ? 27  DT  I C4    1 
ATOM   8088  O  O4    . DT  I 5 100 ? 46.328  51.506 -16.729 1.00 138.03 ? 27  DT  I O4    1 
ATOM   8089  C  C5    . DT  I 5 100 ? 44.992  52.302 -18.523 1.00 137.95 ? 27  DT  I C5    1 
ATOM   8090  C  C7    . DT  I 5 100 ? 44.987  53.731 -18.067 1.00 137.95 ? 27  DT  I C7    1 
ATOM   8091  C  C6    . DT  I 5 100 ? 44.351  51.914 -19.637 1.00 138.03 ? 27  DT  I C6    1 
ATOM   8092  P  P     . DT  I 5 101 ? 39.686  49.419 -23.208 1.00 135.66 ? 28  DT  I P     1 
ATOM   8093  O  OP1   . DT  I 5 101 ? 39.161  49.082 -24.545 1.00 135.45 ? 28  DT  I OP1   1 
ATOM   8094  O  OP2   . DT  I 5 101 ? 39.104  50.548 -22.450 1.00 135.49 ? 28  DT  I OP2   1 
ATOM   8095  O  "O5'" . DT  I 5 101 ? 39.610  48.124 -22.287 1.00 135.60 ? 28  DT  I "O5'" 1 
ATOM   8096  C  "C5'" . DT  I 5 101 ? 40.533  47.074 -22.491 1.00 135.75 ? 28  DT  I "C5'" 1 
ATOM   8097  C  "C4'" . DT  I 5 101 ? 40.776  46.307 -21.206 1.00 136.07 ? 28  DT  I "C4'" 1 
ATOM   8098  O  "O4'" . DT  I 5 101 ? 41.612  47.087 -20.312 1.00 136.09 ? 28  DT  I "O4'" 1 
ATOM   8099  C  "C3'" . DT  I 5 101 ? 39.519  45.942 -20.405 1.00 136.44 ? 28  DT  I "C3'" 1 
ATOM   8100  O  "O3'" . DT  I 5 101 ? 39.579  44.565 -20.030 1.00 136.93 ? 28  DT  I "O3'" 1 
ATOM   8101  C  "C2'" . DT  I 5 101 ? 39.604  46.858 -19.180 1.00 136.34 ? 28  DT  I "C2'" 1 
ATOM   8102  C  "C1'" . DT  I 5 101 ? 41.107  46.965 -19.005 1.00 136.17 ? 28  DT  I "C1'" 1 
ATOM   8103  N  N1    . DT  I 5 101 ? 41.555  48.146 -18.193 1.00 136.10 ? 28  DT  I N1    1 
ATOM   8104  C  C2    . DT  I 5 101 ? 42.592  47.991 -17.304 1.00 136.10 ? 28  DT  I C2    1 
ATOM   8105  O  O2    . DT  I 5 101 ? 43.185  46.936 -17.145 1.00 136.18 ? 28  DT  I O2    1 
ATOM   8106  N  N3    . DT  I 5 101 ? 42.933  49.128 -16.621 1.00 135.99 ? 28  DT  I N3    1 
ATOM   8107  C  C4    . DT  I 5 101 ? 42.342  50.373 -16.721 1.00 135.90 ? 28  DT  I C4    1 
ATOM   8108  O  O4    . DT  I 5 101 ? 42.753  51.296 -16.028 1.00 135.87 ? 28  DT  I O4    1 
ATOM   8109  C  C5    . DT  I 5 101 ? 41.252  50.464 -17.658 1.00 135.91 ? 28  DT  I C5    1 
ATOM   8110  C  C7    . DT  I 5 101 ? 40.541  51.767 -17.861 1.00 135.87 ? 28  DT  I C7    1 
ATOM   8111  C  C6    . DT  I 5 101 ? 40.908  49.358 -18.333 1.00 136.01 ? 28  DT  I C6    1 
ATOM   8112  P  P     . DA  I 5 102 ? 38.297  43.832 -19.413 1.00 137.39 ? 29  DA  I P     1 
ATOM   8113  O  OP1   . DA  I 5 102 ? 38.326  42.417 -19.856 1.00 137.25 ? 29  DA  I OP1   1 
ATOM   8114  O  OP2   . DA  I 5 102 ? 37.110  44.671 -19.696 1.00 137.29 ? 29  DA  I OP2   1 
ATOM   8115  O  "O5'" . DA  I 5 102 ? 38.576  43.894 -17.834 1.00 138.21 ? 29  DA  I "O5'" 1 
ATOM   8116  C  "C5'" . DA  I 5 102 ? 39.875  43.590 -17.316 1.00 138.98 ? 29  DA  I "C5'" 1 
ATOM   8117  C  "C4'" . DA  I 5 102 ? 39.983  43.984 -15.852 1.00 139.74 ? 29  DA  I "C4'" 1 
ATOM   8118  O  "O4'" . DA  I 5 102 ? 40.216  45.410 -15.751 1.00 139.78 ? 29  DA  I "O4'" 1 
ATOM   8119  C  "C3'" . DA  I 5 102 ? 38.739  43.685 -15.006 1.00 140.54 ? 29  DA  I "C3'" 1 
ATOM   8120  O  "O3'" . DA  I 5 102 ? 39.077  42.832 -13.909 1.00 141.65 ? 29  DA  I "O3'" 1 
ATOM   8121  C  "C2'" . DA  I 5 102 ? 38.262  45.060 -14.527 1.00 140.25 ? 29  DA  I "C2'" 1 
ATOM   8122  C  "C1'" . DA  I 5 102 ? 39.512  45.916 -14.650 1.00 140.01 ? 29  DA  I "C1'" 1 
ATOM   8123  N  N9    . DA  I 5 102 ? 39.205  47.313 -14.908 1.00 140.14 ? 29  DA  I N9    1 
ATOM   8124  C  C8    . DA  I 5 102 ? 38.275  47.794 -15.781 1.00 140.19 ? 29  DA  I C8    1 
ATOM   8125  N  N7    . DA  I 5 102 ? 38.167  49.100 -15.775 1.00 140.32 ? 29  DA  I N7    1 
ATOM   8126  C  C5    . DA  I 5 102 ? 39.069  49.505 -14.809 1.00 140.41 ? 29  DA  I C5    1 
ATOM   8127  C  C6    . DA  I 5 102 ? 39.428  50.779 -14.315 1.00 140.56 ? 29  DA  I C6    1 
ATOM   8128  N  N6    . DA  I 5 102 ? 38.885  51.923 -14.753 1.00 140.45 ? 29  DA  I N6    1 
ATOM   8129  N  N1    . DA  I 5 102 ? 40.363  50.830 -13.343 1.00 140.63 ? 29  DA  I N1    1 
ATOM   8130  C  C2    . DA  I 5 102 ? 40.902  49.682 -12.909 1.00 140.64 ? 29  DA  I C2    1 
ATOM   8131  N  N3    . DA  I 5 102 ? 40.637  48.429 -13.286 1.00 140.52 ? 29  DA  I N3    1 
ATOM   8132  C  C4    . DA  I 5 102 ? 39.705  48.410 -14.249 1.00 140.37 ? 29  DA  I C4    1 
ATOM   8133  P  P     . DG  I 5 103 ? 37.967  41.877 -13.241 1.00 142.68 ? 30  DG  I P     1 
ATOM   8134  O  OP1   . DG  I 5 103 ? 37.315  41.105 -14.319 1.00 142.73 ? 30  DG  I OP1   1 
ATOM   8135  O  OP2   . DG  I 5 103 ? 37.143  42.700 -12.321 1.00 142.63 ? 30  DG  I OP2   1 
ATOM   8136  O  "O5'" . DG  I 5 103 ? 38.841  40.871 -12.351 1.00 143.75 ? 30  DG  I "O5'" 1 
ATOM   8137  C  "C5'" . DG  I 5 103 ? 40.269  40.998 -12.302 1.00 144.76 ? 30  DG  I "C5'" 1 
ATOM   8138  C  "C4'" . DG  I 5 103 ? 40.739  41.455 -10.925 1.00 145.76 ? 30  DG  I "C4'" 1 
ATOM   8139  O  "O4'" . DG  I 5 103 ? 40.859  42.906 -10.909 1.00 146.05 ? 30  DG  I "O4'" 1 
ATOM   8140  C  "C3'" . DG  I 5 103 ? 39.810  41.103 -9.752  1.00 146.44 ? 30  DG  I "C3'" 1 
ATOM   8141  O  "O3'" . DG  I 5 103 ? 40.582  40.749 -8.609  1.00 147.17 ? 30  DG  I "O3'" 1 
ATOM   8142  C  "C2'" . DG  I 5 103 ? 39.064  42.411 -9.521  1.00 146.38 ? 30  DG  I "C2'" 1 
ATOM   8143  C  "C1'" . DG  I 5 103 ? 40.178  43.402 -9.779  1.00 146.33 ? 30  DG  I "C1'" 1 
ATOM   8144  N  N9    . DG  I 5 103 ? 39.715  44.759 -10.045 1.00 146.55 ? 30  DG  I N9    1 
ATOM   8145  C  C8    . DG  I 5 103 ? 38.547  45.132 -10.667 1.00 146.63 ? 30  DG  I C8    1 
ATOM   8146  N  N7    . DG  I 5 103 ? 38.368  46.423 -10.701 1.00 146.65 ? 30  DG  I N7    1 
ATOM   8147  C  C5    . DG  I 5 103 ? 39.474  46.936 -10.033 1.00 146.80 ? 30  DG  I C5    1 
ATOM   8148  C  C6    . DG  I 5 103 ? 39.818  48.276 -9.736  1.00 146.84 ? 30  DG  I C6    1 
ATOM   8149  O  O6    . DG  I 5 103 ? 39.200  49.309 -10.030 1.00 146.88 ? 30  DG  I O6    1 
ATOM   8150  N  N1    . DG  I 5 103 ? 41.022  48.355 -9.030  1.00 146.99 ? 30  DG  I N1    1 
ATOM   8151  C  C2    . DG  I 5 103 ? 41.779  47.271 -8.638  1.00 146.93 ? 30  DG  I C2    1 
ATOM   8152  N  N2    . DG  I 5 103 ? 42.911  47.540 -7.963  1.00 146.90 ? 30  DG  I N2    1 
ATOM   8153  N  N3    . DG  I 5 103 ? 41.459  46.012 -8.905  1.00 146.87 ? 30  DG  I N3    1 
ATOM   8154  C  C4    . DG  I 5 103 ? 40.294  45.921 -9.597  1.00 146.72 ? 30  DG  I C4    1 
ATOM   8155  P  P     . DG  I 5 104 ? 39.873  40.104 -7.328  1.00 147.82 ? 31  DG  I P     1 
ATOM   8156  O  OP1   . DG  I 5 104 ? 40.900  39.321 -6.596  1.00 147.85 ? 31  DG  I OP1   1 
ATOM   8157  O  OP2   . DG  I 5 104 ? 38.634  39.438 -7.788  1.00 147.80 ? 31  DG  I OP2   1 
ATOM   8158  O  "O5'" . DG  I 5 104 ? 39.440  41.391 -6.457  1.00 148.47 ? 31  DG  I "O5'" 1 
ATOM   8159  C  "C5'" . DG  I 5 104 ? 40.289  41.912 -5.419  1.00 149.14 ? 31  DG  I "C5'" 1 
ATOM   8160  C  "C4'" . DG  I 5 104 ? 39.661  43.127 -4.744  1.00 149.83 ? 31  DG  I "C4'" 1 
ATOM   8161  O  "O4'" . DG  I 5 104 ? 39.249  44.099 -5.748  1.00 149.96 ? 31  DG  I "O4'" 1 
ATOM   8162  C  "C3'" . DG  I 5 104 ? 38.410  42.849 -3.890  1.00 150.35 ? 31  DG  I "C3'" 1 
ATOM   8163  O  "O3'" . DG  I 5 104 ? 38.436  43.687 -2.705  1.00 150.86 ? 31  DG  I "O3'" 1 
ATOM   8164  C  "C2'" . DG  I 5 104 ? 37.280  43.270 -4.835  1.00 150.22 ? 31  DG  I "C2'" 1 
ATOM   8165  C  "C1'" . DG  I 5 104 ? 37.920  44.489 -5.482  1.00 150.11 ? 31  DG  I "C1'" 1 
ATOM   8166  N  N9    . DG  I 5 104 ? 37.291  44.923 -6.729  1.00 150.10 ? 31  DG  I N9    1 
ATOM   8167  C  C8    . DG  I 5 104 ? 36.730  44.127 -7.701  1.00 150.16 ? 31  DG  I C8    1 
ATOM   8168  N  N7    . DG  I 5 104 ? 36.267  44.798 -8.722  1.00 150.17 ? 31  DG  I N7    1 
ATOM   8169  C  C5    . DG  I 5 104 ? 36.508  46.128 -8.392  1.00 150.10 ? 31  DG  I C5    1 
ATOM   8170  C  C6    . DG  I 5 104 ? 36.201  47.317 -9.103  1.00 150.11 ? 31  DG  I C6    1 
ATOM   8171  O  O6    . DG  I 5 104 ? 35.645  47.433 -10.205 1.00 150.11 ? 31  DG  I O6    1 
ATOM   8172  N  N1    . DG  I 5 104 ? 36.617  48.453 -8.411  1.00 150.00 ? 31  DG  I N1    1 
ATOM   8173  C  C2    . DG  I 5 104 ? 37.241  48.443 -7.186  1.00 149.92 ? 31  DG  I C2    1 
ATOM   8174  N  N2    . DG  I 5 104 ? 37.564  49.640 -6.676  1.00 149.88 ? 31  DG  I N2    1 
ATOM   8175  N  N3    . DG  I 5 104 ? 37.530  47.339 -6.508  1.00 149.95 ? 31  DG  I N3    1 
ATOM   8176  C  C4    . DG  I 5 104 ? 37.135  46.222 -7.168  1.00 150.06 ? 31  DG  I C4    1 
ATOM   8177  P  P     . DG  I 5 105 ? 38.025  43.113 -1.255  1.00 151.08 ? 32  DG  I P     1 
ATOM   8178  O  OP1   . DG  I 5 105 ? 39.207  42.421 -0.687  1.00 151.08 ? 32  DG  I OP1   1 
ATOM   8179  O  OP2   . DG  I 5 105 ? 36.735  42.390 -1.387  1.00 151.08 ? 32  DG  I OP2   1 
ATOM   8180  O  "O5'" . DG  I 5 105 ? 37.752  44.452 -0.411  1.00 150.97 ? 32  DG  I "O5'" 1 
ATOM   8181  C  "C5'" . DG  I 5 105 ? 38.695  45.532 -0.452  1.00 150.83 ? 32  DG  I "C5'" 1 
ATOM   8182  C  "C4'" . DG  I 5 105 ? 38.012  46.880 -0.261  1.00 150.73 ? 32  DG  I "C4'" 1 
ATOM   8183  O  "O4'" . DG  I 5 105 ? 37.715  47.466 -1.552  1.00 150.77 ? 32  DG  I "O4'" 1 
ATOM   8184  C  "C3'" . DG  I 5 105 ? 36.703  46.856 0.524   1.00 150.61 ? 32  DG  I "C3'" 1 
ATOM   8185  O  "O3'" . DG  I 5 105 ? 36.689  47.900 1.481   1.00 150.43 ? 32  DG  I "O3'" 1 
ATOM   8186  C  "C2'" . DG  I 5 105 ? 35.622  47.046 -0.537  1.00 150.69 ? 32  DG  I "C2'" 1 
ATOM   8187  C  "C1'" . DG  I 5 105 ? 36.344  47.798 -1.650  1.00 150.85 ? 32  DG  I "C1'" 1 
ATOM   8188  N  N9    . DG  I 5 105 ? 35.879  47.393 -2.971  1.00 151.02 ? 32  DG  I N9    1 
ATOM   8189  C  C8    . DG  I 5 105 ? 36.146  46.201 -3.590  1.00 151.10 ? 32  DG  I C8    1 
ATOM   8190  N  N7    . DG  I 5 105 ? 35.533  46.053 -4.729  1.00 151.11 ? 32  DG  I N7    1 
ATOM   8191  C  C5    . DG  I 5 105 ? 34.773  47.205 -4.858  1.00 151.17 ? 32  DG  I C5    1 
ATOM   8192  C  C6    . DG  I 5 105 ? 33.895  47.601 -5.891  1.00 151.14 ? 32  DG  I C6    1 
ATOM   8193  O  O6    . DG  I 5 105 ? 33.598  46.986 -6.922  1.00 151.21 ? 32  DG  I O6    1 
ATOM   8194  N  N1    . DG  I 5 105 ? 33.324  48.841 -5.635  1.00 151.16 ? 32  DG  I N1    1 
ATOM   8195  C  C2    . DG  I 5 105 ? 33.564  49.598 -4.519  1.00 151.15 ? 32  DG  I C2    1 
ATOM   8196  N  N2    . DG  I 5 105 ? 32.916  50.767 -4.452  1.00 151.15 ? 32  DG  I N2    1 
ATOM   8197  N  N3    . DG  I 5 105 ? 34.386  49.240 -3.537  1.00 151.15 ? 32  DG  I N3    1 
ATOM   8198  C  C4    . DG  I 5 105 ? 34.951  48.032 -3.771  1.00 151.11 ? 32  DG  I C4    1 
ATOM   8199  P  P     . DT  I 5 106 ? 35.590  47.906 2.648   1.00 150.21 ? 33  DT  I P     1 
ATOM   8200  O  OP1   . DT  I 5 106 ? 36.262  48.315 3.904   1.00 150.26 ? 33  DT  I OP1   1 
ATOM   8201  O  OP2   . DT  I 5 106 ? 34.850  46.620 2.595   1.00 150.20 ? 33  DT  I OP2   1 
ATOM   8202  O  "O5'" . DT  I 5 106 ? 34.592  49.077 2.182   1.00 149.69 ? 33  DT  I "O5'" 1 
ATOM   8203  C  "C5'" . DT  I 5 106 ? 35.021  50.444 2.227   1.00 148.99 ? 33  DT  I "C5'" 1 
ATOM   8204  C  "C4'" . DT  I 5 106 ? 34.048  51.362 1.498   1.00 148.34 ? 33  DT  I "C4'" 1 
ATOM   8205  O  "O4'" . DT  I 5 106 ? 33.750  50.830 0.183   1.00 148.14 ? 33  DT  I "O4'" 1 
ATOM   8206  C  "C3'" . DT  I 5 106 ? 32.693  51.584 2.189   1.00 147.88 ? 33  DT  I "C3'" 1 
ATOM   8207  O  "O3'" . DT  I 5 106 ? 32.464  52.988 2.371   1.00 147.39 ? 33  DT  I "O3'" 1 
ATOM   8208  C  "C2'" . DT  I 5 106 ? 31.680  50.969 1.214   1.00 147.89 ? 33  DT  I "C2'" 1 
ATOM   8209  C  "C1'" . DT  I 5 106 ? 32.406  51.114 -0.113  1.00 147.92 ? 33  DT  I "C1'" 1 
ATOM   8210  N  N1    . DT  I 5 106 ? 31.924  50.169 -1.182  1.00 147.65 ? 33  DT  I N1    1 
ATOM   8211  C  C2    . DT  I 5 106 ? 31.238  50.671 -2.270  1.00 147.44 ? 33  DT  I C2    1 
ATOM   8212  O  O2    . DT  I 5 106 ? 31.026  51.860 -2.438  1.00 147.36 ? 33  DT  I O2    1 
ATOM   8213  N  N3    . DT  I 5 106 ? 30.851  49.731 -3.187  1.00 147.34 ? 33  DT  I N3    1 
ATOM   8214  C  C4    . DT  I 5 106 ? 31.048  48.365 -3.116  1.00 147.33 ? 33  DT  I C4    1 
ATOM   8215  O  O4    . DT  I 5 106 ? 30.629  47.648 -4.015  1.00 147.29 ? 33  DT  I O4    1 
ATOM   8216  C  C5    . DT  I 5 106 ? 31.749  47.901 -1.942  1.00 147.43 ? 33  DT  I C5    1 
ATOM   8217  C  C7    . DT  I 5 106 ? 32.017  46.437 -1.755  1.00 147.42 ? 33  DT  I C7    1 
ATOM   8218  C  C6    . DT  I 5 106 ? 32.146  48.813 -1.041  1.00 147.52 ? 33  DT  I C6    1 
ATOM   8219  P  P     . DT  I 5 107 ? 31.280  53.507 3.324   1.00 146.86 ? 34  DT  I P     1 
ATOM   8220  O  OP1   . DT  I 5 107 ? 31.711  54.783 3.939   1.00 146.82 ? 34  DT  I OP1   1 
ATOM   8221  O  OP2   . DT  I 5 107 ? 30.846  52.379 4.185   1.00 146.79 ? 34  DT  I OP2   1 
ATOM   8222  O  "O5'" . DT  I 5 107 ? 30.104  53.814 2.287   1.00 146.27 ? 34  DT  I "O5'" 1 
ATOM   8223  C  "C5'" . DT  I 5 107 ? 30.345  54.654 1.160   1.00 145.53 ? 34  DT  I "C5'" 1 
ATOM   8224  C  "C4'" . DT  I 5 107 ? 29.092  54.800 0.314   1.00 144.80 ? 34  DT  I "C4'" 1 
ATOM   8225  O  "O4'" . DT  I 5 107 ? 29.010  53.703 -0.635  1.00 144.65 ? 34  DT  I "O4'" 1 
ATOM   8226  C  "C3'" . DT  I 5 107 ? 27.768  54.800 1.091   1.00 144.29 ? 34  DT  I "C3'" 1 
ATOM   8227  O  "O3'" . DT  I 5 107 ? 26.923  55.824 0.581   1.00 143.72 ? 34  DT  I "O3'" 1 
ATOM   8228  C  "C2'" . DT  I 5 107 ? 27.199  53.409 0.806   1.00 144.38 ? 34  DT  I "C2'" 1 
ATOM   8229  C  "C1'" . DT  I 5 107 ? 27.710  53.155 -0.604  1.00 144.54 ? 34  DT  I "C1'" 1 
ATOM   8230  N  N1    . DT  I 5 107 ? 27.782  51.689 -0.969  1.00 144.53 ? 34  DT  I N1    1 
ATOM   8231  C  C2    . DT  I 5 107 ? 27.349  51.274 -2.214  1.00 144.43 ? 34  DT  I C2    1 
ATOM   8232  O  O2    . DT  I 5 107 ? 26.931  52.039 -3.071  1.00 144.32 ? 34  DT  I O2    1 
ATOM   8233  N  N3    . DT  I 5 107 ? 27.435  49.920 -2.427  1.00 144.41 ? 34  DT  I N3    1 
ATOM   8234  C  C4    . DT  I 5 107 ? 27.887  48.958 -1.536  1.00 144.36 ? 34  DT  I C4    1 
ATOM   8235  O  O4    . DT  I 5 107 ? 27.903  47.778 -1.872  1.00 144.27 ? 34  DT  I O4    1 
ATOM   8236  C  C5    . DT  I 5 107 ? 28.308  49.457 -0.250  1.00 144.39 ? 34  DT  I C5    1 
ATOM   8237  C  C7    . DT  I 5 107 ? 28.823  48.512 0.793   1.00 144.34 ? 34  DT  I C7    1 
ATOM   8238  C  C6    . DT  I 5 107 ? 28.225  50.777 -0.027  1.00 144.52 ? 34  DT  I C6    1 
ATOM   8239  P  P     . DA  I 5 108 ? 25.698  56.417 1.444   1.00 143.13 ? 35  DA  I P     1 
ATOM   8240  O  OP1   . DA  I 5 108 ? 26.184  57.606 2.182   1.00 143.15 ? 35  DA  I OP1   1 
ATOM   8241  O  OP2   . DA  I 5 108 ? 25.047  55.303 2.178   1.00 143.11 ? 35  DA  I OP2   1 
ATOM   8242  O  "O5'" . DA  I 5 108 ? 24.696  56.903 0.295   1.00 142.37 ? 35  DA  I "O5'" 1 
ATOM   8243  C  "C5'" . DA  I 5 108 ? 25.215  57.212 -1.002  1.00 141.54 ? 35  DA  I "C5'" 1 
ATOM   8244  C  "C4'" . DA  I 5 108 ? 24.605  56.316 -2.068  1.00 140.65 ? 35  DA  I "C4'" 1 
ATOM   8245  O  "O4'" . DA  I 5 108 ? 24.934  54.935 -1.814  1.00 140.58 ? 35  DA  I "O4'" 1 
ATOM   8246  C  "C3'" . DA  I 5 108 ? 23.090  56.383 -2.165  1.00 139.77 ? 35  DA  I "C3'" 1 
ATOM   8247  O  "O3'" . DA  I 5 108 ? 22.742  57.039 -3.357  1.00 138.64 ? 35  DA  I "O3'" 1 
ATOM   8248  C  "C2'" . DA  I 5 108 ? 22.619  54.915 -2.158  1.00 140.08 ? 35  DA  I "C2'" 1 
ATOM   8249  C  "C1'" . DA  I 5 108 ? 23.908  54.120 -2.323  1.00 140.47 ? 35  DA  I "C1'" 1 
ATOM   8250  N  N9    . DA  I 5 108 ? 23.908  52.859 -1.576  1.00 140.74 ? 35  DA  I N9    1 
ATOM   8251  C  C8    . DA  I 5 108 ? 23.869  52.708 -0.215  1.00 140.86 ? 35  DA  I C8    1 
ATOM   8252  N  N7    . DA  I 5 108 ? 23.895  51.457 0.184   1.00 140.87 ? 35  DA  I N7    1 
ATOM   8253  C  C5    . DA  I 5 108 ? 23.921  50.732 -0.995  1.00 140.82 ? 35  DA  I C5    1 
ATOM   8254  C  C6    . DA  I 5 108 ? 23.940  49.346 -1.255  1.00 140.74 ? 35  DA  I C6    1 
ATOM   8255  N  N6    . DA  I 5 108 ? 23.931  48.414 -0.296  1.00 140.61 ? 35  DA  I N6    1 
ATOM   8256  N  N1    . DA  I 5 108 ? 23.967  48.955 -2.545  1.00 140.83 ? 35  DA  I N1    1 
ATOM   8257  C  C2    . DA  I 5 108 ? 23.963  49.892 -3.502  1.00 140.88 ? 35  DA  I C2    1 
ATOM   8258  N  N3    . DA  I 5 108 ? 23.961  51.221 -3.383  1.00 140.87 ? 35  DA  I N3    1 
ATOM   8259  C  C4    . DA  I 5 108 ? 23.920  51.580 -2.092  1.00 140.83 ? 35  DA  I C4    1 
ATOM   8260  P  P     . DG  I 5 109 ? 21.315  57.733 -3.507  1.00 137.53 ? 36  DG  I P     1 
ATOM   8261  O  OP1   . DG  I 5 109 ? 21.537  59.145 -3.896  1.00 137.50 ? 36  DG  I OP1   1 
ATOM   8262  O  OP2   . DG  I 5 109 ? 20.511  57.412 -2.303  1.00 137.41 ? 36  DG  I OP2   1 
ATOM   8263  O  "O5'" . DG  I 5 109 ? 20.680  56.946 -4.750  1.00 136.48 ? 36  DG  I "O5'" 1 
ATOM   8264  C  "C5'" . DG  I 5 109 ? 21.501  56.074 -5.565  1.00 135.16 ? 36  DG  I "C5'" 1 
ATOM   8265  C  "C4'" . DG  I 5 109 ? 20.682  54.947 -6.185  1.00 133.75 ? 36  DG  I "C4'" 1 
ATOM   8266  O  "O4'" . DG  I 5 109 ? 20.814  53.743 -5.383  1.00 133.53 ? 36  DG  I "O4'" 1 
ATOM   8267  C  "C3'" . DG  I 5 109 ? 19.184  55.219 -6.306  1.00 132.59 ? 36  DG  I "C3'" 1 
ATOM   8268  O  "O3'" . DG  I 5 109 ? 18.700  54.711 -7.523  1.00 131.04 ? 36  DG  I "O3'" 1 
ATOM   8269  C  "C2'" . DG  I 5 109 ? 18.595  54.473 -5.115  1.00 132.99 ? 36  DG  I "C2'" 1 
ATOM   8270  C  "C1'" . DG  I 5 109 ? 19.536  53.284 -4.994  1.00 133.37 ? 36  DG  I "C1'" 1 
ATOM   8271  N  N9    . DG  I 5 109 ? 19.623  52.775 -3.636  1.00 133.59 ? 36  DG  I N9    1 
ATOM   8272  C  C8    . DG  I 5 109 ? 19.359  53.466 -2.479  1.00 133.67 ? 36  DG  I C8    1 
ATOM   8273  N  N7    . DG  I 5 109 ? 19.486  52.744 -1.404  1.00 133.74 ? 36  DG  I N7    1 
ATOM   8274  C  C5    . DG  I 5 109 ? 19.819  51.484 -1.880  1.00 133.81 ? 36  DG  I C5    1 
ATOM   8275  C  C6    . DG  I 5 109 ? 20.072  50.284 -1.177  1.00 133.95 ? 36  DG  I C6    1 
ATOM   8276  O  O6    . DG  I 5 109 ? 20.043  50.090 0.047   1.00 133.98 ? 36  DG  I O6    1 
ATOM   8277  N  N1    . DG  I 5 109 ? 20.384  49.236 -2.042  1.00 134.02 ? 36  DG  I N1    1 
ATOM   8278  C  C2    . DG  I 5 109 ? 20.436  49.338 -3.415  1.00 134.01 ? 36  DG  I C2    1 
ATOM   8279  N  N2    . DG  I 5 109 ? 20.770  48.221 -4.083  1.00 134.02 ? 36  DG  I N2    1 
ATOM   8280  N  N3    . DG  I 5 109 ? 20.206  50.462 -4.084  1.00 133.88 ? 36  DG  I N3    1 
ATOM   8281  C  C4    . DG  I 5 109 ? 19.898  51.487 -3.255  1.00 133.75 ? 36  DG  I C4    1 
ATOM   8282  P  P     . DG  I 5 110 ? 17.757  55.610 -8.444  1.00 129.39 ? 37  DG  I P     1 
ATOM   8283  O  OP1   . DG  I 5 110 ? 18.461  56.884 -8.705  1.00 129.33 ? 37  DG  I OP1   1 
ATOM   8284  O  OP2   . DG  I 5 110 ? 16.401  55.616 -7.843  1.00 129.26 ? 37  DG  I OP2   1 
ATOM   8285  O  "O5'" . DG  I 5 110 ? 17.700  54.764 -9.798  1.00 127.99 ? 37  DG  I "O5'" 1 
ATOM   8286  C  "C5'" . DG  I 5 110 ? 18.819  53.965 -10.178 1.00 126.49 ? 37  DG  I "C5'" 1 
ATOM   8287  C  "C4'" . DG  I 5 110 ? 18.472  52.484 -10.159 1.00 124.95 ? 37  DG  I "C4'" 1 
ATOM   8288  O  "O4'" . DG  I 5 110 ? 18.413  51.999 -8.790  1.00 124.73 ? 37  DG  I "O4'" 1 
ATOM   8289  C  "C3'" . DG  I 5 110 ? 17.133  52.113 -10.796 1.00 123.74 ? 37  DG  I "C3'" 1 
ATOM   8290  O  "O3'" . DG  I 5 110 ? 17.290  50.928 -11.553 1.00 122.17 ? 37  DG  I "O3'" 1 
ATOM   8291  C  "C2'" . DG  I 5 110 ? 16.229  51.881 -9.589  1.00 124.15 ? 37  DG  I "C2'" 1 
ATOM   8292  C  "C1'" . DG  I 5 110 ? 17.215  51.278 -8.609  1.00 124.65 ? 37  DG  I "C1'" 1 
ATOM   8293  N  N9    . DG  I 5 110 ? 16.805  51.382 -7.211  1.00 125.15 ? 37  DG  I N9    1 
ATOM   8294  C  C8    . DG  I 5 110 ? 16.156  52.435 -6.606  1.00 125.32 ? 37  DG  I C8    1 
ATOM   8295  N  N7    . DG  I 5 110 ? 15.927  52.242 -5.334  1.00 125.39 ? 37  DG  I N7    1 
ATOM   8296  C  C5    . DG  I 5 110 ? 16.424  50.965 -5.092  1.00 125.47 ? 37  DG  I C5    1 
ATOM   8297  C  C6    . DG  I 5 110 ? 16.464  50.213 -3.894  1.00 125.56 ? 37  DG  I C6    1 
ATOM   8298  O  O6    . DG  I 5 110 ? 16.005  50.515 -2.785  1.00 125.63 ? 37  DG  I O6    1 
ATOM   8299  N  N1    . DG  I 5 110 ? 17.022  48.953 -4.094  1.00 125.61 ? 37  DG  I N1    1 
ATOM   8300  C  C2    . DG  I 5 110 ? 17.535  48.501 -5.289  1.00 125.63 ? 37  DG  I C2    1 
ATOM   8301  N  N2    . DG  I 5 110 ? 18.069  47.270 -5.281  1.00 125.68 ? 37  DG  I N2    1 
ATOM   8302  N  N3    . DG  I 5 110 ? 17.529  49.206 -6.411  1.00 125.54 ? 37  DG  I N3    1 
ATOM   8303  C  C4    . DG  I 5 110 ? 16.954  50.421 -6.241  1.00 125.39 ? 37  DG  I C4    1 
ATOM   8304  P  P     . DG  I 5 111 ? 16.326  50.629 -12.782 1.00 120.57 ? 38  DG  I P     1 
ATOM   8305  O  OP1   . DG  I 5 111 ? 17.179  50.282 -13.944 1.00 120.30 ? 38  DG  I OP1   1 
ATOM   8306  O  OP2   . DG  I 5 111 ? 15.358  51.744 -12.885 1.00 120.44 ? 38  DG  I OP2   1 
ATOM   8307  O  "O5'" . DG  I 5 111 ? 15.523  49.335 -12.287 1.00 119.72 ? 38  DG  I "O5'" 1 
ATOM   8308  C  "C5'" . DG  I 5 111 ? 16.101  48.042 -12.400 1.00 119.04 ? 38  DG  I "C5'" 1 
ATOM   8309  C  "C4'" . DG  I 5 111 ? 15.453  47.069 -11.438 1.00 118.37 ? 38  DG  I "C4'" 1 
ATOM   8310  O  "O4'" . DG  I 5 111 ? 15.469  47.627 -10.102 1.00 118.13 ? 38  DG  I "O4'" 1 
ATOM   8311  C  "C3'" . DG  I 5 111 ? 13.984  46.714 -11.735 1.00 118.17 ? 38  DG  I "C3'" 1 
ATOM   8312  O  "O3'" . DG  I 5 111 ? 13.815  45.283 -11.661 1.00 118.05 ? 38  DG  I "O3'" 1 
ATOM   8313  C  "C2'" . DG  I 5 111 ? 13.233  47.434 -10.617 1.00 118.13 ? 38  DG  I "C2'" 1 
ATOM   8314  C  "C1'" . DG  I 5 111 ? 14.241  47.341 -9.498  1.00 118.13 ? 38  DG  I "C1'" 1 
ATOM   8315  N  N9    . DG  I 5 111 ? 13.998  48.279 -8.414  1.00 118.24 ? 38  DG  I N9    1 
ATOM   8316  C  C8    . DG  I 5 111 ? 13.640  49.598 -8.526  1.00 118.31 ? 38  DG  I C8    1 
ATOM   8317  N  N7    . DG  I 5 111 ? 13.422  50.175 -7.377  1.00 118.35 ? 38  DG  I N7    1 
ATOM   8318  C  C5    . DG  I 5 111 ? 13.593  49.158 -6.451  1.00 118.34 ? 38  DG  I C5    1 
ATOM   8319  C  C6    . DG  I 5 111 ? 13.472  49.180 -5.045  1.00 118.44 ? 38  DG  I C6    1 
ATOM   8320  O  O6    . DG  I 5 111 ? 13.163  50.136 -4.318  1.00 118.44 ? 38  DG  I O6    1 
ATOM   8321  N  N1    . DG  I 5 111 ? 13.735  47.928 -4.488  1.00 118.48 ? 38  DG  I N1    1 
ATOM   8322  C  C2    . DG  I 5 111 ? 14.057  46.799 -5.209  1.00 118.54 ? 38  DG  I C2    1 
ATOM   8323  N  N2    . DG  I 5 111 ? 14.270  45.678 -4.504  1.00 118.61 ? 38  DG  I N2    1 
ATOM   8324  N  N3    . DG  I 5 111 ? 14.163  46.769 -6.527  1.00 118.42 ? 38  DG  I N3    1 
ATOM   8325  C  C4    . DG  I 5 111 ? 13.923  47.980 -7.078  1.00 118.33 ? 38  DG  I C4    1 
ATOM   8326  P  P     . DT  I 5 112 ? 12.392  44.568 -11.909 1.00 118.06 ? 39  DT  I P     1 
ATOM   8327  O  OP1   . DT  I 5 112 ? 12.582  43.518 -12.929 1.00 117.96 ? 39  DT  I OP1   1 
ATOM   8328  O  OP2   . DT  I 5 112 ? 11.349  45.598 -12.104 1.00 117.76 ? 39  DT  I OP2   1 
ATOM   8329  O  "O5'" . DT  I 5 112 ? 12.133  43.865 -10.506 1.00 119.06 ? 39  DT  I "O5'" 1 
ATOM   8330  C  "C5'" . DT  I 5 112 ? 13.229  43.266 -9.794  1.00 120.09 ? 39  DT  I "C5'" 1 
ATOM   8331  C  "C4'" . DT  I 5 112 ? 12.762  42.666 -8.476  1.00 121.11 ? 39  DT  I "C4'" 1 
ATOM   8332  O  "O4'" . DT  I 5 112 ? 12.797  43.692 -7.447  1.00 121.19 ? 39  DT  I "O4'" 1 
ATOM   8333  C  "C3'" . DT  I 5 112 ? 11.331  42.117 -8.499  1.00 122.09 ? 39  DT  I "C3'" 1 
ATOM   8334  O  "O3'" . DT  I 5 112 ? 11.275  40.787 -8.006  1.00 123.50 ? 39  DT  I "O3'" 1 
ATOM   8335  C  "C2'" . DT  I 5 112 ? 10.539  43.078 -7.624  1.00 121.70 ? 39  DT  I "C2'" 1 
ATOM   8336  C  "C1'" . DT  I 5 112 ? 11.601  43.665 -6.704  1.00 121.34 ? 39  DT  I "C1'" 1 
ATOM   8337  N  N1    . DT  I 5 112 ? 11.265  45.051 -6.274  1.00 121.07 ? 39  DT  I N1    1 
ATOM   8338  C  C2    . DT  I 5 112 ? 11.097  45.318 -4.936  1.00 121.00 ? 39  DT  I C2    1 
ATOM   8339  O  O2    . DT  I 5 112 ? 11.339  44.509 -4.054  1.00 120.91 ? 39  DT  I O2    1 
ATOM   8340  N  N3    . DT  I 5 112 ? 10.697  46.601 -4.659  1.00 120.98 ? 39  DT  I N3    1 
ATOM   8341  C  C4    . DT  I 5 112 ? 10.403  47.602 -5.571  1.00 120.93 ? 39  DT  I C4    1 
ATOM   8342  O  O4    . DT  I 5 112 ? 10.046  48.702 -5.172  1.00 120.93 ? 39  DT  I O4    1 
ATOM   8343  C  C5    . DT  I 5 112 ? 10.541  47.236 -6.956  1.00 120.85 ? 39  DT  I C5    1 
ATOM   8344  C  C7    . DT  I 5 112 ? 10.248  48.238 -8.034  1.00 120.71 ? 39  DT  I C7    1 
ATOM   8345  C  C6    . DT  I 5 112 ? 10.941  45.989 -7.237  1.00 120.97 ? 39  DT  I C6    1 
ATOM   8346  P  P     . DT  I 5 113 ? 9.958   39.905 -8.261  1.00 124.89 ? 40  DT  I P     1 
ATOM   8347  O  OP1   . DT  I 5 113 ? 10.372  38.485 -8.367  1.00 124.87 ? 40  DT  I OP1   1 
ATOM   8348  O  OP2   . DT  I 5 113 ? 9.198   40.532 -9.368  1.00 124.87 ? 40  DT  I OP2   1 
ATOM   8349  O  "O5'" . DT  I 5 113 ? 9.108   40.117 -6.912  1.00 126.24 ? 40  DT  I "O5'" 1 
ATOM   8350  C  "C5'" . DT  I 5 113 ? 9.424   39.381 -5.728  1.00 127.51 ? 40  DT  I "C5'" 1 
ATOM   8351  C  "C4'" . DT  I 5 113 ? 8.938   40.108 -4.484  1.00 128.73 ? 40  DT  I "C4'" 1 
ATOM   8352  O  "O4'" . DT  I 5 113 ? 9.288   41.507 -4.565  1.00 128.84 ? 40  DT  I "O4'" 1 
ATOM   8353  C  "C3'" . DT  I 5 113 ? 7.436   40.152 -4.285  1.00 129.99 ? 40  DT  I "C3'" 1 
ATOM   8354  O  "O3'" . DT  I 5 113 ? 6.949   38.932 -3.744  1.00 131.68 ? 40  DT  I "O3'" 1 
ATOM   8355  C  "C2'" . DT  I 5 113 ? 7.314   41.286 -3.275  1.00 129.49 ? 40  DT  I "C2'" 1 
ATOM   8356  C  "C1'" . DT  I 5 113 ? 8.432   42.232 -3.696  1.00 129.04 ? 40  DT  I "C1'" 1 
ATOM   8357  N  N1    . DT  I 5 113 ? 7.930   43.452 -4.378  1.00 128.82 ? 40  DT  I N1    1 
ATOM   8358  C  C2    . DT  I 5 113 ? 7.617   44.549 -3.617  1.00 128.69 ? 40  DT  I C2    1 
ATOM   8359  O  O2    . DT  I 5 113 ? 7.793   44.595 -2.413  1.00 128.64 ? 40  DT  I O2    1 
ATOM   8360  N  N3    . DT  I 5 113 ? 7.136   45.616 -4.324  1.00 128.59 ? 40  DT  I N3    1 
ATOM   8361  C  C4    . DT  I 5 113 ? 6.914   45.680 -5.685  1.00 128.54 ? 40  DT  I C4    1 
ATOM   8362  O  O4    . DT  I 5 113 ? 6.494   46.718 -6.181  1.00 128.50 ? 40  DT  I O4    1 
ATOM   8363  C  C5    . DT  I 5 113 ? 7.220   44.477 -6.416  1.00 128.64 ? 40  DT  I C5    1 
ATOM   8364  C  C7    . DT  I 5 113 ? 7.018   44.423 -7.900  1.00 128.68 ? 40  DT  I C7    1 
ATOM   8365  C  C6    . DT  I 5 113 ? 7.673   43.422 -5.729  1.00 128.71 ? 40  DT  I C6    1 
ATOM   8366  P  P     . DA  I 5 114 ? 5.421   38.508 -3.995  1.00 133.39 ? 41  DA  I P     1 
ATOM   8367  O  OP1   . DA  I 5 114 ? 5.234   37.150 -3.437  1.00 133.45 ? 41  DA  I OP1   1 
ATOM   8368  O  OP2   . DA  I 5 114 ? 5.108   38.769 -5.419  1.00 133.45 ? 41  DA  I OP2   1 
ATOM   8369  O  "O5'" . DA  I 5 114 ? 4.581   39.558 -3.112  1.00 134.95 ? 41  DA  I "O5'" 1 
ATOM   8370  C  "C5'" . DA  I 5 114 ? 4.602   39.487 -1.684  1.00 136.48 ? 41  DA  I "C5'" 1 
ATOM   8371  C  "C4'" . DA  I 5 114 ? 3.955   40.719 -1.067  1.00 138.03 ? 41  DA  I "C4'" 1 
ATOM   8372  O  "O4'" . DA  I 5 114 ? 4.680   41.905 -1.470  1.00 138.48 ? 41  DA  I "O4'" 1 
ATOM   8373  C  "C3'" . DA  I 5 114 ? 2.534   40.989 -1.514  1.00 139.16 ? 41  DA  I "C3'" 1 
ATOM   8374  O  "O3'" . DA  I 5 114 ? 1.628   40.229 -0.748  1.00 140.42 ? 41  DA  I "O3'" 1 
ATOM   8375  C  "C2'" . DA  I 5 114 ? 2.388   42.480 -1.227  1.00 139.03 ? 41  DA  I "C2'" 1 
ATOM   8376  C  "C1'" . DA  I 5 114 ? 3.786   43.006 -1.552  1.00 138.89 ? 41  DA  I "C1'" 1 
ATOM   8377  N  N9    . DA  I 5 114 ? 3.885   43.613 -2.879  1.00 139.08 ? 41  DA  I N9    1 
ATOM   8378  C  C8    . DA  I 5 114 ? 4.432   43.064 -4.006  1.00 139.14 ? 41  DA  I C8    1 
ATOM   8379  N  N7    . DA  I 5 114 ? 4.373   43.846 -5.057  1.00 139.20 ? 41  DA  I N7    1 
ATOM   8380  C  C5    . DA  I 5 114 ? 3.711   44.971 -4.595  1.00 139.28 ? 41  DA  I C5    1 
ATOM   8381  C  C6    . DA  I 5 114 ? 3.324   46.174 -5.222  1.00 139.35 ? 41  DA  I C6    1 
ATOM   8382  N  N6    . DA  I 5 114 ? 3.562   46.442 -6.511  1.00 139.35 ? 41  DA  I N6    1 
ATOM   8383  N  N1    . DA  I 5 114 ? 2.695   47.099 -4.468  1.00 139.37 ? 41  DA  I N1    1 
ATOM   8384  C  C2    . DA  I 5 114 ? 2.469   46.829 -3.177  1.00 139.35 ? 41  DA  I C2    1 
ATOM   8385  N  N3    . DA  I 5 114 ? 2.767   45.733 -2.485  1.00 139.30 ? 41  DA  I N3    1 
ATOM   8386  C  C4    . DA  I 5 114 ? 3.400   44.839 -3.256  1.00 139.22 ? 41  DA  I C4    1 
ATOM   8387  P  P     . DG  I 5 115 ? 0.251   39.768 -1.406  1.00 141.59 ? 42  DG  I P     1 
ATOM   8388  O  OP1   . DG  I 5 115 ? -0.307  38.670 -0.580  1.00 141.60 ? 42  DG  I OP1   1 
ATOM   8389  O  OP2   . DG  I 5 115 ? 0.499   39.551 -2.851  1.00 141.60 ? 42  DG  I OP2   1 
ATOM   8390  O  "O5'" . DG  I 5 115 ? -0.669  41.077 -1.252  1.00 142.59 ? 42  DG  I "O5'" 1 
ATOM   8391  C  "C5'" . DG  I 5 115 ? -1.244  41.428 0.019   1.00 143.55 ? 42  DG  I "C5'" 1 
ATOM   8392  C  "C4'" . DG  I 5 115 ? -2.222  42.589 -0.120  1.00 144.53 ? 42  DG  I "C4'" 1 
ATOM   8393  O  "O4'" . DG  I 5 115 ? -1.702  43.545 -1.084  1.00 144.98 ? 42  DG  I "O4'" 1 
ATOM   8394  C  "C3'" . DG  I 5 115 ? -3.625  42.215 -0.623  1.00 145.05 ? 42  DG  I "C3'" 1 
ATOM   8395  O  "O3'" . DG  I 5 115 ? -4.612  43.113 -0.059  1.00 145.27 ? 42  DG  I "O3'" 1 
ATOM   8396  C  "C2'" . DG  I 5 115 ? -3.482  42.421 -2.126  1.00 145.27 ? 42  DG  I "C2'" 1 
ATOM   8397  C  "C1'" . DG  I 5 115 ? -2.612  43.668 -2.164  1.00 145.49 ? 42  DG  I "C1'" 1 
ATOM   8398  N  N9    . DG  I 5 115 ? -1.854  43.807 -3.403  1.00 146.16 ? 42  DG  I N9    1 
ATOM   8399  C  C8    . DG  I 5 115 ? -1.538  42.810 -4.298  1.00 146.36 ? 42  DG  I C8    1 
ATOM   8400  N  N7    . DG  I 5 115 ? -0.860  43.233 -5.330  1.00 146.50 ? 42  DG  I N7    1 
ATOM   8401  C  C5    . DG  I 5 115 ? -0.720  44.599 -5.108  1.00 146.54 ? 42  DG  I C5    1 
ATOM   8402  C  C6    . DG  I 5 115 ? -0.091  45.589 -5.896  1.00 146.58 ? 42  DG  I C6    1 
ATOM   8403  O  O6    . DG  I 5 115 ? 0.507   45.444 -6.971  1.00 146.55 ? 42  DG  I O6    1 
ATOM   8404  N  N1    . DG  I 5 115 ? -0.194  46.854 -5.314  1.00 146.58 ? 42  DG  I N1    1 
ATOM   8405  C  C2    . DG  I 5 115 ? -0.856  47.130 -4.138  1.00 146.55 ? 42  DG  I C2    1 
ATOM   8406  N  N2    . DG  I 5 115 ? -0.838  48.408 -3.729  1.00 146.56 ? 42  DG  I N2    1 
ATOM   8407  N  N3    . DG  I 5 115 ? -1.438  46.209 -3.383  1.00 146.51 ? 42  DG  I N3    1 
ATOM   8408  C  C4    . DG  I 5 115 ? -1.346  44.972 -3.936  1.00 146.47 ? 42  DG  I C4    1 
ATOM   8409  P  P     . DG  I 5 116 ? -6.184  42.739 -0.038  1.00 145.28 ? 43  DG  I P     1 
ATOM   8410  O  OP1   . DG  I 5 116 ? -6.505  42.186 1.298   1.00 145.30 ? 43  DG  I OP1   1 
ATOM   8411  O  OP2   . DG  I 5 116 ? -6.509  41.958 -1.257  1.00 145.21 ? 43  DG  I OP2   1 
ATOM   8412  O  "O5'" . DG  I 5 116 ? -6.881  44.175 -0.182  1.00 145.24 ? 43  DG  I "O5'" 1 
ATOM   8413  C  "C5'" . DG  I 5 116 ? -6.325  45.317 0.487   1.00 145.12 ? 43  DG  I "C5'" 1 
ATOM   8414  C  "C4'" . DG  I 5 116 ? -6.308  46.537 -0.425  1.00 144.99 ? 43  DG  I "C4'" 1 
ATOM   8415  O  "O4'" . DG  I 5 116 ? -5.357  46.325 -1.507  1.00 145.11 ? 43  DG  I "O4'" 1 
ATOM   8416  C  "C3'" . DG  I 5 116 ? -7.647  46.881 -1.098  1.00 144.74 ? 43  DG  I "C3'" 1 
ATOM   8417  O  "O3'" . DG  I 5 116 ? -7.865  48.301 -1.058  1.00 144.19 ? 43  DG  I "O3'" 1 
ATOM   8418  C  "C2'" . DG  I 5 116 ? -7.452  46.381 -2.532  1.00 144.95 ? 43  DG  I "C2'" 1 
ATOM   8419  C  "C1'" . DG  I 5 116 ? -5.973  46.653 -2.736  1.00 145.15 ? 43  DG  I "C1'" 1 
ATOM   8420  N  N9    . DG  I 5 116 ? -5.369  45.860 -3.809  1.00 145.25 ? 43  DG  I N9    1 
ATOM   8421  C  C8    . DG  I 5 116 ? -5.477  44.502 -4.000  1.00 145.27 ? 43  DG  I C8    1 
ATOM   8422  N  N7    . DG  I 5 116 ? -4.843  44.072 -5.058  1.00 145.28 ? 43  DG  I N7    1 
ATOM   8423  C  C5    . DG  I 5 116 ? -4.327  45.228 -5.638  1.00 145.28 ? 43  DG  I C5    1 
ATOM   8424  C  C6    . DG  I 5 116 ? -3.578  45.397 -6.829  1.00 145.24 ? 43  DG  I C6    1 
ATOM   8425  O  O6    . DG  I 5 116 ? -3.172  44.524 -7.611  1.00 145.21 ? 43  DG  I O6    1 
ATOM   8426  N  N1    . DG  I 5 116 ? -3.259  46.737 -7.050  1.00 145.21 ? 43  DG  I N1    1 
ATOM   8427  C  C2    . DG  I 5 116 ? -3.637  47.783 -6.238  1.00 145.18 ? 43  DG  I C2    1 
ATOM   8428  N  N2    . DG  I 5 116 ? -3.245  49.008 -6.621  1.00 145.15 ? 43  DG  I N2    1 
ATOM   8429  N  N3    . DG  I 5 116 ? -4.344  47.639 -5.124  1.00 145.20 ? 43  DG  I N3    1 
ATOM   8430  C  C4    . DG  I 5 116 ? -4.661  46.340 -4.892  1.00 145.26 ? 43  DG  I C4    1 
ATOM   8431  P  P     . DG  I 5 117 ? -9.244  48.939 -1.586  1.00 143.73 ? 44  DG  I P     1 
ATOM   8432  O  OP1   . DG  I 5 117 ? -9.559  50.102 -0.727  1.00 143.69 ? 44  DG  I OP1   1 
ATOM   8433  O  OP2   . DG  I 5 117 ? -10.236 47.849 -1.752  1.00 143.64 ? 44  DG  I OP2   1 
ATOM   8434  O  "O5'" . DG  I 5 117 ? -8.861  49.470 -3.042  1.00 143.28 ? 44  DG  I "O5'" 1 
ATOM   8435  C  "C5'" . DG  I 5 117 ? -7.646  50.205 -3.238  1.00 142.78 ? 44  DG  I "C5'" 1 
ATOM   8436  C  "C4'" . DG  I 5 117 ? -7.658  50.967 -4.558  1.00 142.16 ? 44  DG  I "C4'" 1 
ATOM   8437  O  "O4'" . DG  I 5 117 ? -6.896  50.244 -5.558  1.00 142.01 ? 44  DG  I "O4'" 1 
ATOM   8438  C  "C3'" . DG  I 5 117 ? -9.033  51.244 -5.152  1.00 141.62 ? 44  DG  I "C3'" 1 
ATOM   8439  O  "O3'" . DG  I 5 117 ? -9.127  52.610 -5.539  1.00 140.95 ? 44  DG  I "O3'" 1 
ATOM   8440  C  "C2'" . DG  I 5 117 ? -9.147  50.284 -6.343  1.00 141.74 ? 44  DG  I "C2'" 1 
ATOM   8441  C  "C1'" . DG  I 5 117 ? -7.708  49.877 -6.655  1.00 141.84 ? 44  DG  I "C1'" 1 
ATOM   8442  N  N9    . DG  I 5 117 ? -7.570  48.438 -6.865  1.00 141.85 ? 44  DG  I N9    1 
ATOM   8443  C  C8    . DG  I 5 117 ? -8.240  47.443 -6.192  1.00 141.88 ? 44  DG  I C8    1 
ATOM   8444  N  N7    . DG  I 5 117 ? -7.939  46.242 -6.598  1.00 141.85 ? 44  DG  I N7    1 
ATOM   8445  C  C5    . DG  I 5 117 ? -7.023  46.450 -7.618  1.00 141.85 ? 44  DG  I C5    1 
ATOM   8446  C  C6    . DG  I 5 117 ? -6.351  45.515 -8.439  1.00 141.82 ? 44  DG  I C6    1 
ATOM   8447  O  O6    . DG  I 5 117 ? -6.428  44.274 -8.414  1.00 141.70 ? 44  DG  I O6    1 
ATOM   8448  N  N1    . DG  I 5 117 ? -5.502  46.149 -9.346  1.00 141.88 ? 44  DG  I N1    1 
ATOM   8449  C  C2    . DG  I 5 117 ? -5.332  47.513 -9.447  1.00 141.86 ? 44  DG  I C2    1 
ATOM   8450  N  N2    . DG  I 5 117 ? -4.482  47.936 -10.391 1.00 141.88 ? 44  DG  I N2    1 
ATOM   8451  N  N3    . DG  I 5 117 ? -5.966  48.401 -8.691  1.00 141.81 ? 44  DG  I N3    1 
ATOM   8452  C  C4    . DG  I 5 117 ? -6.791  47.801 -7.802  1.00 141.84 ? 44  DG  I C4    1 
ATOM   8453  P  P     . DT  I 5 118 ? -10.510 53.225 -6.072  1.00 140.21 ? 45  DT  I P     1 
ATOM   8454  O  OP1   . DT  I 5 118 ? -10.648 54.588 -5.503  1.00 140.20 ? 45  DT  I OP1   1 
ATOM   8455  O  OP2   . DT  I 5 118 ? -11.587 52.225 -5.871  1.00 140.23 ? 45  DT  I OP2   1 
ATOM   8456  O  "O5'" . DT  I 5 118 ? -10.227 53.343 -7.641  1.00 139.23 ? 45  DT  I "O5'" 1 
ATOM   8457  C  "C5'" . DT  I 5 118 ? -8.900  53.634 -8.086  1.00 138.12 ? 45  DT  I "C5'" 1 
ATOM   8458  C  "C4'" . DT  I 5 118 ? -8.679  53.147 -9.500  1.00 136.87 ? 45  DT  I "C4'" 1 
ATOM   8459  O  "O4'" . DT  I 5 118 ? -8.392  51.725 -9.496  1.00 136.80 ? 45  DT  I "O4'" 1 
ATOM   8460  C  "C3'" . DT  I 5 118 ? -9.866  53.344 -10.446 1.00 135.83 ? 45  DT  I "C3'" 1 
ATOM   8461  O  "O3'" . DT  I 5 118 ? -9.409  53.930 -11.642 1.00 134.48 ? 45  DT  I "O3'" 1 
ATOM   8462  C  "C2'" . DT  I 5 118 ? -10.364 51.920 -10.688 1.00 136.25 ? 45  DT  I "C2'" 1 
ATOM   8463  C  "C1'" . DT  I 5 118 ? -9.062  51.144 -10.582 1.00 136.69 ? 45  DT  I "C1'" 1 
ATOM   8464  N  N1    . DT  I 5 118 ? -9.223  49.678 -10.335 1.00 137.12 ? 45  DT  I N1    1 
ATOM   8465  C  C2    . DT  I 5 118 ? -8.340  48.800 -10.924 1.00 137.20 ? 45  DT  I C2    1 
ATOM   8466  O  O2    . DT  I 5 118 ? -7.405  49.156 -11.621 1.00 137.12 ? 45  DT  I O2    1 
ATOM   8467  N  N3    . DT  I 5 118 ? -8.585  47.480 -10.657 1.00 137.45 ? 45  DT  I N3    1 
ATOM   8468  C  C4    . DT  I 5 118 ? -9.609  46.957 -9.887  1.00 137.64 ? 45  DT  I C4    1 
ATOM   8469  O  O4    . DT  I 5 118 ? -9.695  45.738 -9.735  1.00 137.78 ? 45  DT  I O4    1 
ATOM   8470  C  C5    . DT  I 5 118 ? -10.508 47.931 -9.313  1.00 137.65 ? 45  DT  I C5    1 
ATOM   8471  C  C7    . DT  I 5 118 ? -11.660 47.485 -8.459  1.00 137.78 ? 45  DT  I C7    1 
ATOM   8472  C  C6    . DT  I 5 118 ? -10.281 49.227 -9.571  1.00 137.39 ? 45  DT  I C6    1 
ATOM   8473  P  P     . DT  I 5 119 ? -10.195 55.156 -12.287 1.00 133.12 ? 46  DT  I P     1 
ATOM   8474  O  OP1   . DT  I 5 119 ? -9.619  56.401 -11.728 1.00 133.06 ? 46  DT  I OP1   1 
ATOM   8475  O  OP2   . DT  I 5 119 ? -11.644 54.882 -12.165 1.00 133.13 ? 46  DT  I OP2   1 
ATOM   8476  O  "O5'" . DT  I 5 119 ? -9.804  55.050 -13.831 1.00 131.88 ? 46  DT  I "O5'" 1 
ATOM   8477  C  "C5'" . DT  I 5 119 ? -8.460  55.257 -14.227 1.00 130.70 ? 46  DT  I "C5'" 1 
ATOM   8478  C  "C4'" . DT  I 5 119 ? -8.002  54.173 -15.182 1.00 129.51 ? 46  DT  I "C4'" 1 
ATOM   8479  O  "O4'" . DT  I 5 119 ? -8.222  52.871 -14.590 1.00 129.34 ? 46  DT  I "O4'" 1 
ATOM   8480  C  "C3'" . DT  I 5 119 ? -8.707  54.162 -16.534 1.00 128.57 ? 46  DT  I "C3'" 1 
ATOM   8481  O  "O3'" . DT  I 5 119 ? -7.750  54.108 -17.555 1.00 127.41 ? 46  DT  I "O3'" 1 
ATOM   8482  C  "C2'" . DT  I 5 119 ? -9.560  52.894 -16.495 1.00 128.88 ? 46  DT  I "C2'" 1 
ATOM   8483  C  "C1'" . DT  I 5 119 ? -8.766  52.004 -15.553 1.00 129.26 ? 46  DT  I "C1'" 1 
ATOM   8484  N  N1    . DT  I 5 119 ? -9.605  50.978 -14.847 1.00 129.57 ? 46  DT  I N1    1 
ATOM   8485  C  C2    . DT  I 5 119 ? -9.127  49.690 -14.705 1.00 129.75 ? 46  DT  I C2    1 
ATOM   8486  O  O2    . DT  I 5 119 ? -8.032  49.331 -15.112 1.00 129.77 ? 46  DT  I O2    1 
ATOM   8487  N  N3    . DT  I 5 119 ? -9.977  48.836 -14.042 1.00 129.81 ? 46  DT  I N3    1 
ATOM   8488  C  C4    . DT  I 5 119 ? -11.228 49.134 -13.524 1.00 129.74 ? 46  DT  I C4    1 
ATOM   8489  O  O4    . DT  I 5 119 ? -11.872 48.259 -12.953 1.00 129.71 ? 46  DT  I O4    1 
ATOM   8490  C  C5    . DT  I 5 119 ? -11.667 50.498 -13.714 1.00 129.61 ? 46  DT  I C5    1 
ATOM   8491  C  C7    . DT  I 5 119 ? -13.000 50.942 -13.194 1.00 129.53 ? 46  DT  I C7    1 
ATOM   8492  C  C6    . DT  I 5 119 ? -10.844 51.342 -14.350 1.00 129.61 ? 46  DT  I C6    1 
ATOM   8493  P  P     . DA  I 5 120 ? -8.059  54.747 -18.983 1.00 126.39 ? 47  DA  I P     1 
ATOM   8494  O  OP1   . DA  I 5 120 ? -7.305  56.016 -19.087 1.00 126.30 ? 47  DA  I OP1   1 
ATOM   8495  O  OP2   . DA  I 5 120 ? -9.526  54.737 -19.189 1.00 126.20 ? 47  DA  I OP2   1 
ATOM   8496  O  "O5'" . DA  I 5 120 ? -7.412  53.672 -19.978 1.00 125.79 ? 47  DA  I "O5'" 1 
ATOM   8497  C  "C5'" . DA  I 5 120 ? -6.191  53.008 -19.613 1.00 124.92 ? 47  DA  I "C5'" 1 
ATOM   8498  C  "C4'" . DA  I 5 120 ? -6.217  51.525 -19.978 1.00 123.88 ? 47  DA  I "C4'" 1 
ATOM   8499  O  "O4'" . DA  I 5 120 ? -7.221  50.828 -19.196 1.00 123.63 ? 47  DA  I "O4'" 1 
ATOM   8500  C  "C3'" . DA  I 5 120 ? -6.513  51.201 -21.442 1.00 123.06 ? 47  DA  I "C3'" 1 
ATOM   8501  O  "O3'" . DA  I 5 120 ? -5.630  50.193 -21.882 1.00 122.09 ? 47  DA  I "O3'" 1 
ATOM   8502  C  "C2'" . DA  I 5 120 ? -7.957  50.700 -21.407 1.00 123.22 ? 47  DA  I "C2'" 1 
ATOM   8503  C  "C1'" . DA  I 5 120 ? -8.009  50.027 -20.048 1.00 123.39 ? 47  DA  I "C1'" 1 
ATOM   8504  N  N9    . DA  I 5 120 ? -9.349  49.951 -19.480 1.00 123.36 ? 47  DA  I N9    1 
ATOM   8505  C  C8    . DA  I 5 120 ? -10.270 50.959 -19.394 1.00 123.35 ? 47  DA  I C8    1 
ATOM   8506  N  N7    . DA  I 5 120 ? -11.370 50.617 -18.766 1.00 123.33 ? 47  DA  I N7    1 
ATOM   8507  C  C5    . DA  I 5 120 ? -11.152 49.298 -18.411 1.00 123.29 ? 47  DA  I C5    1 
ATOM   8508  C  C6    . DA  I 5 120 ? -11.942 48.357 -17.722 1.00 123.31 ? 47  DA  I C6    1 
ATOM   8509  N  N6    . DA  I 5 120 ? -13.167 48.623 -17.254 1.00 123.23 ? 47  DA  I N6    1 
ATOM   8510  N  N1    . DA  I 5 120 ? -11.424 47.124 -17.540 1.00 123.39 ? 47  DA  I N1    1 
ATOM   8511  C  C2    . DA  I 5 120 ? -10.205 46.858 -18.028 1.00 123.37 ? 47  DA  I C2    1 
ATOM   8512  N  N3    . DA  I 5 120 ? -9.367  47.663 -18.676 1.00 123.32 ? 47  DA  I N3    1 
ATOM   8513  C  C4    . DA  I 5 120 ? -9.909  48.875 -18.842 1.00 123.30 ? 47  DA  I C4    1 
ATOM   8514  P  P     . DG  I 5 121 ? -5.287  50.047 -23.428 1.00 121.21 ? 48  DG  I P     1 
ATOM   8515  O  OP1   . DG  I 5 121 ? -3.818  50.074 -23.563 1.00 121.08 ? 48  DG  I OP1   1 
ATOM   8516  O  OP2   . DG  I 5 121 ? -6.118  51.008 -24.182 1.00 121.13 ? 48  DG  I OP2   1 
ATOM   8517  O  "O5'" . DG  I 5 121 ? -5.816  48.581 -23.750 1.00 120.92 ? 48  DG  I "O5'" 1 
ATOM   8518  C  "C5'" . DG  I 5 121 ? -5.769  47.587 -22.738 1.00 120.72 ? 48  DG  I "C5'" 1 
ATOM   8519  C  "C4'" . DG  I 5 121 ? -6.837  46.533 -22.955 1.00 120.55 ? 48  DG  I "C4'" 1 
ATOM   8520  O  "O4'" . DG  I 5 121 ? -8.081  46.964 -22.347 1.00 120.60 ? 48  DG  I "O4'" 1 
ATOM   8521  C  "C3'" . DG  I 5 121 ? -7.165  46.202 -24.419 1.00 120.40 ? 48  DG  I "C3'" 1 
ATOM   8522  O  "O3'" . DG  I 5 121 ? -7.326  44.792 -24.548 1.00 120.15 ? 48  DG  I "O3'" 1 
ATOM   8523  C  "C2'" . DG  I 5 121 ? -8.495  46.926 -24.635 1.00 120.54 ? 48  DG  I "C2'" 1 
ATOM   8524  C  "C1'" . DG  I 5 121 ? -9.128  46.752 -23.263 1.00 120.75 ? 48  DG  I "C1'" 1 
ATOM   8525  N  N9    . DG  I 5 121 ? -10.221 47.687 -22.972 1.00 121.09 ? 48  DG  I N9    1 
ATOM   8526  C  C8    . DG  I 5 121 ? -10.374 48.968 -23.451 1.00 121.14 ? 48  DG  I C8    1 
ATOM   8527  N  N7    . DG  I 5 121 ? -11.457 49.559 -23.021 1.00 121.15 ? 48  DG  I N7    1 
ATOM   8528  C  C5    . DG  I 5 121 ? -12.077 48.600 -22.228 1.00 121.30 ? 48  DG  I C5    1 
ATOM   8529  C  C6    . DG  I 5 121 ? -13.294 48.661 -21.501 1.00 121.47 ? 48  DG  I C6    1 
ATOM   8530  O  O6    . DG  I 5 121 ? -14.098 49.605 -21.421 1.00 121.50 ? 48  DG  I O6    1 
ATOM   8531  N  N1    . DG  I 5 121 ? -13.552 47.465 -20.827 1.00 121.54 ? 48  DG  I N1    1 
ATOM   8532  C  C2    . DG  I 5 121 ? -12.737 46.354 -20.850 1.00 121.43 ? 48  DG  I C2    1 
ATOM   8533  N  N2    . DG  I 5 121 ? -13.147 45.298 -20.127 1.00 121.37 ? 48  DG  I N2    1 
ATOM   8534  N  N3    . DG  I 5 121 ? -11.597 46.285 -21.528 1.00 121.33 ? 48  DG  I N3    1 
ATOM   8535  C  C4    . DG  I 5 121 ? -11.331 47.440 -22.191 1.00 121.25 ? 48  DG  I C4    1 
ATOM   8536  P  P     . DG  I 5 122 ? -6.861  44.011 -25.864 1.00 119.98 ? 49  DG  I P     1 
ATOM   8537  O  OP1   . DG  I 5 122 ? -5.394  43.866 -25.813 1.00 119.63 ? 49  DG  I OP1   1 
ATOM   8538  O  OP2   . DG  I 5 122 ? -7.504  44.646 -27.034 1.00 119.58 ? 49  DG  I OP2   1 
ATOM   8539  O  "O5'" . DG  I 5 122 ? -7.529  42.572 -25.646 1.00 120.98 ? 49  DG  I "O5'" 1 
ATOM   8540  C  "C5'" . DG  I 5 122 ? -7.514  41.962 -24.337 1.00 122.08 ? 49  DG  I "C5'" 1 
ATOM   8541  C  "C4'" . DG  I 5 122 ? -8.814  41.214 -24.039 1.00 123.04 ? 49  DG  I "C4'" 1 
ATOM   8542  O  "O4'" . DG  I 5 122 ? -9.791  42.131 -23.480 1.00 123.20 ? 49  DG  I "O4'" 1 
ATOM   8543  C  "C3'" . DG  I 5 122 ? -9.485  40.552 -25.241 1.00 124.07 ? 49  DG  I "C3'" 1 
ATOM   8544  O  "O3'" . DG  I 5 122 ? -9.931  39.249 -24.910 1.00 125.53 ? 49  DG  I "O3'" 1 
ATOM   8545  C  "C2'" . DG  I 5 122 ? -10.655 41.471 -25.554 1.00 123.68 ? 49  DG  I "C2'" 1 
ATOM   8546  C  "C1'" . DG  I 5 122 ? -11.008 42.026 -24.187 1.00 123.51 ? 49  DG  I "C1'" 1 
ATOM   8547  N  N9    . DG  I 5 122 ? -11.618 43.352 -24.268 1.00 123.69 ? 49  DG  I N9    1 
ATOM   8548  C  C8    . DG  I 5 122 ? -11.104 44.452 -24.910 1.00 123.81 ? 49  DG  I C8    1 
ATOM   8549  N  N7    . DG  I 5 122 ? -11.901 45.483 -24.904 1.00 123.83 ? 49  DG  I N7    1 
ATOM   8550  C  C5    . DG  I 5 122 ? -13.041 45.027 -24.261 1.00 123.78 ? 49  DG  I C5    1 
ATOM   8551  C  C6    . DG  I 5 122 ? -14.250 45.701 -23.966 1.00 123.79 ? 49  DG  I C6    1 
ATOM   8552  O  O6    . DG  I 5 122 ? -14.555 46.880 -24.214 1.00 123.55 ? 49  DG  I O6    1 
ATOM   8553  N  N1    . DG  I 5 122 ? -15.150 44.870 -23.301 1.00 123.99 ? 49  DG  I N1    1 
ATOM   8554  C  C2    . DG  I 5 122 ? -14.912 43.551 -22.967 1.00 124.16 ? 49  DG  I C2    1 
ATOM   8555  N  N2    . DG  I 5 122 ? -15.902 42.907 -22.322 1.00 124.20 ? 49  DG  I N2    1 
ATOM   8556  N  N3    . DG  I 5 122 ? -13.780 42.910 -23.239 1.00 124.06 ? 49  DG  I N3    1 
ATOM   8557  C  C4    . DG  I 5 122 ? -12.895 43.705 -23.889 1.00 123.91 ? 49  DG  I C4    1 
ATOM   8558  P  P     . DG  I 5 123 ? -10.374 38.239 -26.076 1.00 127.13 ? 50  DG  I P     1 
ATOM   8559  O  OP1   . DG  I 5 123 ? -10.014 36.870 -25.649 1.00 127.15 ? 50  DG  I OP1   1 
ATOM   8560  O  OP2   . DG  I 5 123 ? -9.866  38.762 -27.364 1.00 127.03 ? 50  DG  I OP2   1 
ATOM   8561  O  "O5'" . DG  I 5 123 ? -11.966 38.384 -26.094 1.00 128.88 ? 50  DG  I "O5'" 1 
ATOM   8562  C  "C5'" . DG  I 5 123 ? -12.753 37.794 -25.070 1.00 130.67 ? 50  DG  I "C5'" 1 
ATOM   8563  C  "C4'" . DG  I 5 123 ? -14.170 38.336 -25.096 1.00 132.40 ? 50  DG  I "C4'" 1 
ATOM   8564  O  "O4'" . DG  I 5 123 ? -14.145 39.785 -25.119 1.00 132.74 ? 50  DG  I "O4'" 1 
ATOM   8565  C  "C3'" . DG  I 5 123 ? -15.017 37.904 -26.301 1.00 133.80 ? 50  DG  I "C3'" 1 
ATOM   8566  O  "O3'" . DG  I 5 123 ? -16.197 37.244 -25.843 1.00 135.49 ? 50  DG  I "O3'" 1 
ATOM   8567  C  "C2'" . DG  I 5 123 ? -15.342 39.224 -27.020 1.00 133.42 ? 50  DG  I "C2'" 1 
ATOM   8568  C  "C1'" . DG  I 5 123 ? -15.225 40.233 -25.893 1.00 133.06 ? 50  DG  I "C1'" 1 
ATOM   8569  N  N9    . DG  I 5 123 ? -14.950 41.597 -26.342 1.00 133.06 ? 50  DG  I N9    1 
ATOM   8570  C  C8    . DG  I 5 123 ? -13.807 42.054 -26.948 1.00 133.11 ? 50  DG  I C8    1 
ATOM   8571  N  N7    . DG  I 5 123 ? -13.833 43.331 -27.214 1.00 133.14 ? 50  DG  I N7    1 
ATOM   8572  C  C5    . DG  I 5 123 ? -15.082 43.745 -26.771 1.00 133.14 ? 50  DG  I C5    1 
ATOM   8573  C  C6    . DG  I 5 123 ? -15.687 45.025 -26.817 1.00 133.19 ? 50  DG  I C6    1 
ATOM   8574  O  O6    . DG  I 5 123 ? -15.212 46.088 -27.249 1.00 133.19 ? 50  DG  I O6    1 
ATOM   8575  N  N1    . DG  I 5 123 ? -16.962 45.009 -26.256 1.00 133.23 ? 50  DG  I N1    1 
ATOM   8576  C  C2    . DG  I 5 123 ? -17.580 43.895 -25.737 1.00 133.20 ? 50  DG  I C2    1 
ATOM   8577  N  N2    . DG  I 5 123 ? -18.815 44.075 -25.245 1.00 133.23 ? 50  DG  I N2    1 
ATOM   8578  N  N3    . DG  I 5 123 ? -17.027 42.691 -25.697 1.00 133.13 ? 50  DG  I N3    1 
ATOM   8579  C  C4    . DG  I 5 123 ? -15.783 42.689 -26.234 1.00 133.09 ? 50  DG  I C4    1 
ATOM   8580  P  P     . DT  I 5 124 ? -17.113 36.405 -26.856 1.00 137.05 ? 51  DT  I P     1 
ATOM   8581  O  OP1   . DT  I 5 124 ? -17.504 35.150 -26.175 1.00 137.17 ? 51  DT  I OP1   1 
ATOM   8582  O  OP2   . DT  I 5 124 ? -16.430 36.350 -28.172 1.00 137.08 ? 51  DT  I OP2   1 
ATOM   8583  O  "O5'" . DT  I 5 124 ? -18.404 37.340 -27.003 1.00 138.28 ? 51  DT  I "O5'" 1 
ATOM   8584  C  "C5'" . DT  I 5 124 ? -18.927 37.997 -25.858 1.00 139.57 ? 51  DT  I "C5'" 1 
ATOM   8585  C  "C4'" . DT  I 5 124 ? -19.754 39.209 -26.251 1.00 140.99 ? 51  DT  I "C4'" 1 
ATOM   8586  O  "O4'" . DT  I 5 124 ? -18.886 40.307 -26.587 1.00 141.18 ? 51  DT  I "O4'" 1 
ATOM   8587  C  "C3'" . DT  I 5 124 ? -20.616 39.039 -27.491 1.00 142.22 ? 51  DT  I "C3'" 1 
ATOM   8588  O  "O3'" . DT  I 5 124 ? -21.877 38.429 -27.144 1.00 143.63 ? 51  DT  I "O3'" 1 
ATOM   8589  C  "C2'" . DT  I 5 124 ? -20.803 40.490 -27.971 1.00 141.87 ? 51  DT  I "C2'" 1 
ATOM   8590  C  "C1'" . DT  I 5 124 ? -19.637 41.248 -27.328 1.00 141.47 ? 51  DT  I "C1'" 1 
ATOM   8591  N  N1    . DT  I 5 124 ? -18.753 41.911 -28.322 1.00 141.25 ? 51  DT  I N1    1 
ATOM   8592  C  C2    . DT  I 5 124 ? -19.029 43.201 -28.704 1.00 141.15 ? 51  DT  I C2    1 
ATOM   8593  O  O2    . DT  I 5 124 ? -19.941 43.855 -28.232 1.00 140.98 ? 51  DT  I O2    1 
ATOM   8594  N  N3    . DT  I 5 124 ? -18.175 43.712 -29.644 1.00 141.22 ? 51  DT  I N3    1 
ATOM   8595  C  C4    . DT  I 5 124 ? -17.101 43.070 -30.239 1.00 141.32 ? 51  DT  I C4    1 
ATOM   8596  O  O4    . DT  I 5 124 ? -16.427 43.666 -31.080 1.00 141.39 ? 51  DT  I O4    1 
ATOM   8597  C  C5    . DT  I 5 124 ? -16.896 41.701 -29.823 1.00 141.36 ? 51  DT  I C5    1 
ATOM   8598  C  C7    . DT  I 5 124 ? -15.771 40.893 -30.406 1.00 141.33 ? 51  DT  I C7    1 
ATOM   8599  C  C6    . DT  I 5 124 ? -17.733 41.191 -28.907 1.00 141.34 ? 51  DT  I C6    1 
ATOM   8600  P  P     . DT  I 5 125 ? -22.820 37.777 -28.278 1.00 144.79 ? 52  DT  I P     1 
ATOM   8601  O  OP1   . DT  I 5 125 ? -23.801 36.903 -27.595 1.00 144.94 ? 52  DT  I OP1   1 
ATOM   8602  O  OP2   . DT  I 5 125 ? -21.951 37.214 -29.341 1.00 144.86 ? 52  DT  I OP2   1 
ATOM   8603  O  "O5'" . DT  I 5 125 ? -23.594 39.047 -28.886 1.00 145.61 ? 52  DT  I "O5'" 1 
ATOM   8604  C  "C5'" . DT  I 5 125 ? -24.425 39.830 -28.043 1.00 146.45 ? 52  DT  I "C5'" 1 
ATOM   8605  C  "C4'" . DT  I 5 125 ? -24.759 41.165 -28.680 1.00 147.35 ? 52  DT  I "C4'" 1 
ATOM   8606  O  "O4'" . DT  I 5 125 ? -23.547 41.906 -28.983 1.00 147.54 ? 52  DT  I "O4'" 1 
ATOM   8607  C  "C3'" . DT  I 5 125 ? -25.552 41.094 -29.994 1.00 148.11 ? 52  DT  I "C3'" 1 
ATOM   8608  O  "O3'" . DT  I 5 125 ? -26.714 41.913 -29.883 1.00 149.07 ? 52  DT  I "O3'" 1 
ATOM   8609  C  "C2'" . DT  I 5 125 ? -24.572 41.659 -31.025 1.00 147.93 ? 52  DT  I "C2'" 1 
ATOM   8610  C  "C1'" . DT  I 5 125 ? -23.783 42.621 -30.161 1.00 147.83 ? 52  DT  I "C1'" 1 
ATOM   8611  N  N1    . DT  I 5 125 ? -22.491 43.069 -30.762 1.00 147.98 ? 52  DT  I N1    1 
ATOM   8612  C  C2    . DT  I 5 125 ? -22.226 44.418 -30.827 1.00 148.04 ? 52  DT  I C2    1 
ATOM   8613  O  O2    . DT  I 5 125 ? -22.949 45.262 -30.328 1.00 148.08 ? 52  DT  I O2    1 
ATOM   8614  N  N3    . DT  I 5 125 ? -21.058 44.743 -31.464 1.00 148.04 ? 52  DT  I N3    1 
ATOM   8615  C  C4    . DT  I 5 125 ? -20.160 43.875 -32.058 1.00 148.04 ? 52  DT  I C4    1 
ATOM   8616  O  O4    . DT  I 5 125 ? -19.156 44.323 -32.602 1.00 147.96 ? 52  DT  I O4    1 
ATOM   8617  C  C5    . DT  I 5 125 ? -20.524 42.476 -31.999 1.00 148.07 ? 52  DT  I C5    1 
ATOM   8618  C  C7    . DT  I 5 125 ? -19.636 41.437 -32.617 1.00 148.06 ? 52  DT  I C7    1 
ATOM   8619  C  C6    . DT  I 5 125 ? -21.666 42.147 -31.375 1.00 148.07 ? 52  DT  I C6    1 
ATOM   8620  P  P     . DA  I 5 126 ? -27.838 41.898 -31.022 1.00 149.97 ? 53  DA  I P     1 
ATOM   8621  O  OP1   . DA  I 5 126 ? -29.146 42.131 -30.367 1.00 150.03 ? 53  DA  I OP1   1 
ATOM   8622  O  OP2   . DA  I 5 126 ? -27.636 40.689 -31.853 1.00 150.00 ? 53  DA  I OP2   1 
ATOM   8623  O  "O5'" . DA  I 5 126 ? -27.463 43.183 -31.909 1.00 150.78 ? 53  DA  I "O5'" 1 
ATOM   8624  C  "C5'" . DA  I 5 126 ? -27.078 44.410 -31.271 1.00 151.56 ? 53  DA  I "C5'" 1 
ATOM   8625  C  "C4'" . DA  I 5 126 ? -26.752 45.497 -32.290 1.00 152.45 ? 53  DA  I "C4'" 1 
ATOM   8626  O  "O4'" . DA  I 5 126 ? -25.330 45.493 -32.587 1.00 152.71 ? 53  DA  I "O4'" 1 
ATOM   8627  C  "C3'" . DA  I 5 126 ? -27.461 45.379 -33.641 1.00 153.07 ? 53  DA  I "C3'" 1 
ATOM   8628  O  "O3'" . DA  I 5 126 ? -27.834 46.669 -34.091 1.00 153.75 ? 53  DA  I "O3'" 1 
ATOM   8629  C  "C2'" . DA  I 5 126 ? -26.383 44.779 -34.538 1.00 153.02 ? 53  DA  I "C2'" 1 
ATOM   8630  C  "C1'" . DA  I 5 126 ? -25.150 45.467 -33.989 1.00 152.91 ? 53  DA  I "C1'" 1 
ATOM   8631  N  N9    . DA  I 5 126 ? -23.914 44.761 -34.290 1.00 152.96 ? 53  DA  I N9    1 
ATOM   8632  C  C8    . DA  I 5 126 ? -23.626 43.454 -34.027 1.00 153.00 ? 53  DA  I C8    1 
ATOM   8633  N  N7    . DA  I 5 126 ? -22.432 43.088 -34.418 1.00 153.03 ? 53  DA  I N7    1 
ATOM   8634  C  C5    . DA  I 5 126 ? -21.913 44.226 -35.003 1.00 153.09 ? 53  DA  I C5    1 
ATOM   8635  C  C6    . DA  I 5 126 ? -20.678 44.494 -35.619 1.00 153.25 ? 53  DA  I C6    1 
ATOM   8636  N  N6    . DA  I 5 126 ? -19.701 43.589 -35.732 1.00 153.26 ? 53  DA  I N6    1 
ATOM   8637  N  N1    . DA  I 5 126 ? -20.469 45.743 -36.078 1.00 153.34 ? 53  DA  I N1    1 
ATOM   8638  C  C2    . DA  I 5 126 ? -21.452 46.645 -35.960 1.00 153.31 ? 53  DA  I C2    1 
ATOM   8639  N  N3    . DA  I 5 126 ? -22.649 46.510 -35.393 1.00 153.17 ? 53  DA  I N3    1 
ATOM   8640  C  C4    . DA  I 5 126 ? -22.818 45.264 -34.937 1.00 153.03 ? 53  DA  I C4    1 
ATOM   8641  P  P     . DG  I 5 127 ? -29.088 46.847 -35.064 1.00 154.40 ? 54  DG  I P     1 
ATOM   8642  O  OP1   . DG  I 5 127 ? -30.163 47.517 -34.287 1.00 154.50 ? 54  DG  I OP1   1 
ATOM   8643  O  OP2   . DG  I 5 127 ? -29.353 45.539 -35.709 1.00 154.39 ? 54  DG  I OP2   1 
ATOM   8644  O  "O5'" . DG  I 5 127 ? -28.523 47.842 -36.198 1.00 154.78 ? 54  DG  I "O5'" 1 
ATOM   8645  C  "C5'" . DG  I 5 127 ? -28.933 49.219 -36.264 1.00 155.07 ? 54  DG  I "C5'" 1 
ATOM   8646  C  "C4'" . DG  I 5 127 ? -27.882 50.056 -36.968 1.00 155.34 ? 54  DG  I "C4'" 1 
ATOM   8647  O  "O4'" . DG  I 5 127 ? -26.607 49.352 -36.955 1.00 155.62 ? 54  DG  I "O4'" 1 
ATOM   8648  C  "C3'" . DG  I 5 127 ? -28.160 50.355 -38.436 1.00 155.36 ? 54  DG  I "C3'" 1 
ATOM   8649  O  "O3'" . DG  I 5 127 ? -27.568 51.633 -38.766 1.00 155.15 ? 54  DG  I "O3'" 1 
ATOM   8650  C  "C2'" . DG  I 5 127 ? -27.467 49.179 -39.131 1.00 155.55 ? 54  DG  I "C2'" 1 
ATOM   8651  C  "C1'" . DG  I 5 127 ? -26.218 49.027 -38.281 1.00 155.77 ? 54  DG  I "C1'" 1 
ATOM   8652  N  N9    . DG  I 5 127 ? -25.677 47.669 -38.289 1.00 156.10 ? 54  DG  I N9    1 
ATOM   8653  C  C8    . DG  I 5 127 ? -26.315 46.523 -37.873 1.00 156.27 ? 54  DG  I C8    1 
ATOM   8654  N  N7    . DG  I 5 127 ? -25.585 45.447 -37.991 1.00 156.34 ? 54  DG  I N7    1 
ATOM   8655  C  C5    . DG  I 5 127 ? -24.395 45.903 -38.545 1.00 156.31 ? 54  DG  I C5    1 
ATOM   8656  C  C6    . DG  I 5 127 ? -23.228 45.189 -38.911 1.00 156.27 ? 54  DG  I C6    1 
ATOM   8657  O  O6    . DG  I 5 127 ? -23.005 43.973 -38.805 1.00 156.18 ? 54  DG  I O6    1 
ATOM   8658  N  N1    . DG  I 5 127 ? -22.255 46.035 -39.439 1.00 156.34 ? 54  DG  I N1    1 
ATOM   8659  C  C2    . DG  I 5 127 ? -22.388 47.399 -39.583 1.00 156.33 ? 54  DG  I C2    1 
ATOM   8660  N  N2    . DG  I 5 127 ? -21.334 48.048 -40.098 1.00 156.37 ? 54  DG  I N2    1 
ATOM   8661  N  N3    . DG  I 5 127 ? -23.476 48.081 -39.243 1.00 156.26 ? 54  DG  I N3    1 
ATOM   8662  C  C4    . DG  I 5 127 ? -24.439 47.270 -38.742 1.00 156.22 ? 54  DG  I C4    1 
ATOM   8663  P  P     . DG  I 5 128 ? -27.388 52.135 -40.285 1.00 154.79 ? 55  DG  I P     1 
ATOM   8664  O  OP1   . DG  I 5 128 ? -27.581 53.610 -40.303 1.00 154.86 ? 55  DG  I OP1   1 
ATOM   8665  O  OP2   . DG  I 5 128 ? -28.217 51.280 -41.174 1.00 154.72 ? 55  DG  I OP2   1 
ATOM   8666  O  "O5'" . DG  I 5 128 ? -25.842 51.785 -40.560 1.00 154.17 ? 55  DG  I "O5'" 1 
ATOM   8667  C  "C5'" . DG  I 5 128 ? -24.818 52.788 -40.465 1.00 153.44 ? 55  DG  I "C5'" 1 
ATOM   8668  C  "C4'" . DG  I 5 128 ? -23.828 52.655 -41.611 1.00 152.76 ? 55  DG  I "C4'" 1 
ATOM   8669  O  "O4'" . DG  I 5 128 ? -23.512 51.256 -41.820 1.00 152.63 ? 55  DG  I "O4'" 1 
ATOM   8670  C  "C3'" . DG  I 5 128 ? -24.329 53.153 -42.960 1.00 152.22 ? 55  DG  I "C3'" 1 
ATOM   8671  O  "O3'" . DG  I 5 128 ? -23.218 53.495 -43.777 1.00 151.54 ? 55  DG  I "O3'" 1 
ATOM   8672  C  "C2'" . DG  I 5 128 ? -25.043 51.916 -43.500 1.00 152.38 ? 55  DG  I "C2'" 1 
ATOM   8673  C  "C1'" . DG  I 5 128 ? -24.102 50.802 -43.031 1.00 152.49 ? 55  DG  I "C1'" 1 
ATOM   8674  N  N9    . DG  I 5 128 ? -24.777 49.535 -42.752 1.00 152.40 ? 55  DG  I N9    1 
ATOM   8675  C  C8    . DG  I 5 128 ? -26.102 49.355 -42.439 1.00 152.39 ? 55  DG  I C8    1 
ATOM   8676  N  N7    . DG  I 5 128 ? -26.408 48.117 -42.168 1.00 152.41 ? 55  DG  I N7    1 
ATOM   8677  C  C5    . DG  I 5 128 ? -25.205 47.431 -42.302 1.00 152.42 ? 55  DG  I C5    1 
ATOM   8678  C  C6    . DG  I 5 128 ? -24.912 46.052 -42.140 1.00 152.42 ? 55  DG  I C6    1 
ATOM   8679  O  O6    . DG  I 5 128 ? -25.686 45.133 -41.843 1.00 152.51 ? 55  DG  I O6    1 
ATOM   8680  N  N1    . DG  I 5 128 ? -23.567 45.778 -42.368 1.00 152.29 ? 55  DG  I N1    1 
ATOM   8681  C  C2    . DG  I 5 128 ? -22.625 46.713 -42.712 1.00 152.23 ? 55  DG  I C2    1 
ATOM   8682  N  N2    . DG  I 5 128 ? -21.378 46.258 -42.889 1.00 152.15 ? 55  DG  I N2    1 
ATOM   8683  N  N3    . DG  I 5 128 ? -22.883 48.005 -42.869 1.00 152.29 ? 55  DG  I N3    1 
ATOM   8684  C  C4    . DG  I 5 128 ? -24.190 48.291 -42.650 1.00 152.38 ? 55  DG  I C4    1 
ATOM   8685  P  P     . DG  I 5 129 ? -22.992 55.002 -44.265 1.00 150.76 ? 56  DG  I P     1 
ATOM   8686  O  OP1   . DG  I 5 129 ? -23.562 55.907 -43.242 1.00 150.68 ? 56  DG  I OP1   1 
ATOM   8687  O  OP2   . DG  I 5 129 ? -23.440 55.097 -45.674 1.00 150.68 ? 56  DG  I OP2   1 
ATOM   8688  O  "O5'" . DG  I 5 129 ? -21.393 55.127 -44.245 1.00 150.18 ? 56  DG  I "O5'" 1 
ATOM   8689  C  "C5'" . DG  I 5 129 ? -20.620 54.288 -43.363 1.00 149.56 ? 56  DG  I "C5'" 1 
ATOM   8690  C  "C4'" . DG  I 5 129 ? -19.702 53.340 -44.130 1.00 148.87 ? 56  DG  I "C4'" 1 
ATOM   8691  O  "O4'" . DG  I 5 129 ? -20.256 51.991 -44.121 1.00 148.68 ? 56  DG  I "O4'" 1 
ATOM   8692  C  "C3'" . DG  I 5 129 ? -19.463 53.685 -45.602 1.00 148.47 ? 56  DG  I "C3'" 1 
ATOM   8693  O  "O3'" . DG  I 5 129 ? -18.117 53.464 -45.919 1.00 148.11 ? 56  DG  I "O3'" 1 
ATOM   8694  C  "C2'" . DG  I 5 129 ? -20.365 52.696 -46.332 1.00 148.49 ? 56  DG  I "C2'" 1 
ATOM   8695  C  "C1'" . DG  I 5 129 ? -20.242 51.478 -45.438 1.00 148.58 ? 56  DG  I "C1'" 1 
ATOM   8696  N  N9    . DG  I 5 129 ? -21.346 50.527 -45.600 1.00 148.57 ? 56  DG  I N9    1 
ATOM   8697  C  C8    . DG  I 5 129 ? -22.682 50.827 -45.664 1.00 148.60 ? 56  DG  I C8    1 
ATOM   8698  N  N7    . DG  I 5 129 ? -23.446 49.785 -45.846 1.00 148.59 ? 56  DG  I N7    1 
ATOM   8699  C  C5    . DG  I 5 129 ? -22.555 48.732 -45.994 1.00 148.52 ? 56  DG  I C5    1 
ATOM   8700  C  C6    . DG  I 5 129 ? -22.801 47.358 -46.237 1.00 148.47 ? 56  DG  I C6    1 
ATOM   8701  O  O6    . DG  I 5 129 ? -23.894 46.784 -46.367 1.00 148.41 ? 56  DG  I O6    1 
ATOM   8702  N  N1    . DG  I 5 129 ? -21.615 46.631 -46.317 1.00 148.46 ? 56  DG  I N1    1 
ATOM   8703  C  C2    . DG  I 5 129 ? -20.354 47.162 -46.160 1.00 148.47 ? 56  DG  I C2    1 
ATOM   8704  N  N2    . DG  I 5 129 ? -19.327 46.307 -46.287 1.00 148.40 ? 56  DG  I N2    1 
ATOM   8705  N  N3    . DG  I 5 129 ? -20.110 48.451 -45.948 1.00 148.51 ? 56  DG  I N3    1 
ATOM   8706  C  C4    . DG  I 5 129 ? -21.253 49.174 -45.870 1.00 148.55 ? 56  DG  I C4    1 
ATOM   8707  P  P     . DT  I 5 130 ? -17.422 54.263 -47.114 1.00 147.92 ? 57  DT  I P     1 
ATOM   8708  O  OP1   . DT  I 5 130 ? -17.030 55.589 -46.597 1.00 147.95 ? 57  DT  I OP1   1 
ATOM   8709  O  OP2   . DT  I 5 130 ? -18.281 54.161 -48.316 1.00 147.72 ? 57  DT  I OP2   1 
ATOM   8710  O  "O5'" . DT  I 5 130 ? -16.104 53.399 -47.383 1.00 148.07 ? 57  DT  I "O5'" 1 
ATOM   8711  C  "C5'" . DT  I 5 130 ? -15.612 52.517 -46.369 1.00 148.19 ? 57  DT  I "C5'" 1 
ATOM   8712  C  "C4'" . DT  I 5 130 ? -15.406 51.114 -46.915 1.00 148.21 ? 57  DT  I "C4'" 1 
ATOM   8713  O  "O4'" . DT  I 5 130 ? -16.690 50.451 -47.061 1.00 148.21 ? 57  DT  I "O4'" 1 
ATOM   8714  C  "C3'" . DT  I 5 130 ? -14.715 51.038 -48.279 1.00 148.36 ? 57  DT  I "C3'" 1 
ATOM   8715  O  "O3'" . DT  I 5 130 ? -13.586 50.165 -48.208 1.00 148.55 ? 57  DT  I "O3'" 1 
ATOM   8716  C  "C2'" . DT  I 5 130 ? -15.804 50.508 -49.218 1.00 148.35 ? 57  DT  I "C2'" 1 
ATOM   8717  C  "C1'" . DT  I 5 130 ? -16.716 49.741 -48.278 1.00 148.32 ? 57  DT  I "C1'" 1 
ATOM   8718  N  N1    . DT  I 5 130 ? -18.130 49.675 -48.777 1.00 148.39 ? 57  DT  I N1    1 
ATOM   8719  C  C2    . DT  I 5 130 ? -18.722 48.448 -48.975 1.00 148.35 ? 57  DT  I C2    1 
ATOM   8720  O  O2    . DT  I 5 130 ? -18.176 47.390 -48.713 1.00 148.25 ? 57  DT  I O2    1 
ATOM   8721  N  N3    . DT  I 5 130 ? -19.996 48.505 -49.481 1.00 148.38 ? 57  DT  I N3    1 
ATOM   8722  C  C4    . DT  I 5 130 ? -20.710 49.642 -49.829 1.00 148.40 ? 57  DT  I C4    1 
ATOM   8723  O  O4    . DT  I 5 130 ? -21.850 49.536 -50.259 1.00 148.39 ? 57  DT  I O4    1 
ATOM   8724  C  C5    . DT  I 5 130 ? -20.019 50.889 -49.636 1.00 148.43 ? 57  DT  I C5    1 
ATOM   8725  C  C7    . DT  I 5 130 ? -20.695 52.184 -49.985 1.00 148.39 ? 57  DT  I C7    1 
ATOM   8726  C  C6    . DT  I 5 130 ? -18.771 50.846 -49.142 1.00 148.49 ? 57  DT  I C6    1 
ATOM   8727  P  P     . DT  I 5 131 ? -12.670 49.888 -49.496 1.00 148.98 ? 58  DT  I P     1 
ATOM   8728  O  OP1   . DT  I 5 131 ? -11.279 49.713 -49.034 1.00 148.92 ? 58  DT  I OP1   1 
ATOM   8729  O  OP2   . DT  I 5 131 ? -12.977 50.902 -50.530 1.00 148.81 ? 58  DT  I OP2   1 
ATOM   8730  O  "O5'" . DT  I 5 131 ? -13.230 48.476 -49.994 1.00 150.06 ? 58  DT  I "O5'" 1 
ATOM   8731  C  "C5'" . DT  I 5 131 ? -13.536 47.473 -49.021 1.00 151.06 ? 58  DT  I "C5'" 1 
ATOM   8732  C  "C4'" . DT  I 5 131 ? -14.433 46.382 -49.584 1.00 151.99 ? 58  DT  I "C4'" 1 
ATOM   8733  O  "O4'" . DT  I 5 131 ? -15.729 46.918 -49.931 1.00 152.14 ? 58  DT  I "O4'" 1 
ATOM   8734  C  "C3'" . DT  I 5 131 ? -13.914 45.665 -50.830 1.00 152.81 ? 58  DT  I "C3'" 1 
ATOM   8735  O  "O3'" . DT  I 5 131 ? -13.874 44.276 -50.571 1.00 153.90 ? 58  DT  I "O3'" 1 
ATOM   8736  C  "C2'" . DT  I 5 131 ? -14.946 46.012 -51.911 1.00 152.53 ? 58  DT  I "C2'" 1 
ATOM   8737  C  "C1'" . DT  I 5 131 ? -16.188 46.269 -51.084 1.00 152.31 ? 58  DT  I "C1'" 1 
ATOM   8738  N  N1    . DT  I 5 131 ? -17.159 47.151 -51.751 1.00 152.35 ? 58  DT  I N1    1 
ATOM   8739  C  C2    . DT  I 5 131 ? -18.364 46.637 -52.152 1.00 152.44 ? 58  DT  I C2    1 
ATOM   8740  O  O2    . DT  I 5 131 ? -18.691 45.479 -51.964 1.00 152.43 ? 58  DT  I O2    1 
ATOM   8741  N  N3    . DT  I 5 131 ? -19.192 47.536 -52.764 1.00 152.52 ? 58  DT  I N3    1 
ATOM   8742  C  C4    . DT  I 5 131 ? -18.931 48.871 -53.017 1.00 152.57 ? 58  DT  I C4    1 
ATOM   8743  O  O4    . DT  I 5 131 ? -19.776 49.555 -53.583 1.00 152.74 ? 58  DT  I O4    1 
ATOM   8744  C  C5    . DT  I 5 131 ? -17.640 49.342 -52.579 1.00 152.35 ? 58  DT  I C5    1 
ATOM   8745  C  C7    . DT  I 5 131 ? -17.242 50.770 -52.800 1.00 152.25 ? 58  DT  I C7    1 
ATOM   8746  C  C6    . DT  I 5 131 ? -16.820 48.464 -51.992 1.00 152.34 ? 58  DT  I C6    1 
ATOM   8747  P  P     . DA  I 5 132 ? -13.227 43.265 -51.619 1.00 155.04 ? 59  DA  I P     1 
ATOM   8748  O  OP1   . DA  I 5 132 ? -12.491 42.241 -50.850 1.00 155.05 ? 59  DA  I OP1   1 
ATOM   8749  O  OP2   . DA  I 5 132 ? -12.533 44.046 -52.671 1.00 154.86 ? 59  DA  I OP2   1 
ATOM   8750  O  "O5'" . DA  I 5 132 ? -14.523 42.594 -52.261 1.00 156.56 ? 59  DA  I "O5'" 1 
ATOM   8751  C  "C5'" . DA  I 5 132 ? -15.636 42.299 -51.422 1.00 158.06 ? 59  DA  I "C5'" 1 
ATOM   8752  C  "C4'" . DA  I 5 132 ? -16.815 41.779 -52.225 1.00 159.57 ? 59  DA  I "C4'" 1 
ATOM   8753  O  "O4'" . DA  I 5 132 ? -17.644 42.885 -52.662 1.00 159.87 ? 59  DA  I "O4'" 1 
ATOM   8754  C  "C3'" . DA  I 5 132 ? -16.463 40.977 -53.489 1.00 160.69 ? 59  DA  I "C3'" 1 
ATOM   8755  O  "O3'" . DA  I 5 132 ? -17.123 39.702 -53.443 1.00 162.02 ? 59  DA  I "O3'" 1 
ATOM   8756  C  "C2'" . DA  I 5 132 ? -16.996 41.854 -54.633 1.00 160.38 ? 59  DA  I "C2'" 1 
ATOM   8757  C  "C1'" . DA  I 5 132 ? -18.132 42.589 -53.943 1.00 160.13 ? 59  DA  I "C1'" 1 
ATOM   8758  N  N9    . DA  I 5 132 ? -18.523 43.832 -54.597 1.00 160.09 ? 59  DA  I N9    1 
ATOM   8759  C  C8    . DA  I 5 132 ? -17.718 44.895 -54.896 1.00 160.11 ? 59  DA  I C8    1 
ATOM   8760  N  N7    . DA  I 5 132 ? -18.349 45.889 -55.475 1.00 160.15 ? 59  DA  I N7    1 
ATOM   8761  C  C5    . DA  I 5 132 ? -19.657 45.440 -55.576 1.00 160.23 ? 59  DA  I C5    1 
ATOM   8762  C  C6    . DA  I 5 132 ? -20.820 46.016 -56.129 1.00 160.32 ? 59  DA  I C6    1 
ATOM   8763  N  N6    . DA  I 5 132 ? -20.847 47.237 -56.681 1.00 160.34 ? 59  DA  I N6    1 
ATOM   8764  N  N1    . DA  I 5 132 ? -21.964 45.293 -56.073 1.00 160.26 ? 59  DA  I N1    1 
ATOM   8765  C  C2    . DA  I 5 132 ? -21.933 44.074 -55.521 1.00 160.17 ? 59  DA  I C2    1 
ATOM   8766  N  N3    . DA  I 5 132 ? -20.903 43.429 -54.976 1.00 160.14 ? 59  DA  I N3    1 
ATOM   8767  C  C4    . DA  I 5 132 ? -19.780 44.170 -55.048 1.00 160.18 ? 59  DA  I C4    1 
ATOM   8768  P  P     . DG  I 5 133 ? -16.683 38.510 -54.419 1.00 163.24 ? 60  DG  I P     1 
ATOM   8769  O  OP1   . DG  I 5 133 ? -16.810 37.241 -53.670 1.00 163.14 ? 60  DG  I OP1   1 
ATOM   8770  O  OP2   . DG  I 5 133 ? -15.388 38.874 -55.044 1.00 163.17 ? 60  DG  I OP2   1 
ATOM   8771  O  "O5'" . DG  I 5 133 ? -17.814 38.557 -55.554 1.00 164.68 ? 60  DG  I "O5'" 1 
ATOM   8772  C  "C5'" . DG  I 5 133 ? -19.194 38.623 -55.180 1.00 166.06 ? 60  DG  I "C5'" 1 
ATOM   8773  C  "C4'" . DG  I 5 133 ? -20.068 39.115 -56.329 1.00 167.46 ? 60  DG  I "C4'" 1 
ATOM   8774  O  "O4'" . DG  I 5 133 ? -19.771 40.500 -56.638 1.00 167.84 ? 60  DG  I "O4'" 1 
ATOM   8775  C  "C3'" . DG  I 5 133 ? -19.939 38.351 -57.650 1.00 168.48 ? 60  DG  I "C3'" 1 
ATOM   8776  O  "O3'" . DG  I 5 133 ? -21.236 38.128 -58.178 1.00 169.67 ? 60  DG  I "O3'" 1 
ATOM   8777  C  "C2'" . DG  I 5 133 ? -19.140 39.315 -58.532 1.00 168.33 ? 60  DG  I "C2'" 1 
ATOM   8778  C  "C1'" . DG  I 5 133 ? -19.662 40.646 -58.036 1.00 168.20 ? 60  DG  I "C1'" 1 
ATOM   8779  N  N9    . DG  I 5 133 ? -18.779 41.768 -58.310 1.00 168.43 ? 60  DG  I N9    1 
ATOM   8780  C  C8    . DG  I 5 133 ? -17.405 41.768 -58.295 1.00 168.53 ? 60  DG  I C8    1 
ATOM   8781  N  N7    . DG  I 5 133 ? -16.886 42.944 -58.511 1.00 168.64 ? 60  DG  I N7    1 
ATOM   8782  C  C5    . DG  I 5 133 ? -17.987 43.779 -58.663 1.00 168.66 ? 60  DG  I C5    1 
ATOM   8783  C  C6    . DG  I 5 133 ? -18.051 45.176 -58.875 1.00 168.79 ? 60  DG  I C6    1 
ATOM   8784  O  O6    . DG  I 5 133 ? -17.115 45.968 -59.062 1.00 168.81 ? 60  DG  I O6    1 
ATOM   8785  N  N1    . DG  I 5 133 ? -19.371 45.619 -58.991 1.00 168.76 ? 60  DG  I N1    1 
ATOM   8786  C  C2    . DG  I 5 133 ? -20.485 44.821 -58.855 1.00 168.65 ? 60  DG  I C2    1 
ATOM   8787  N  N2    . DG  I 5 133 ? -21.675 45.434 -58.951 1.00 168.68 ? 60  DG  I N2    1 
ATOM   8788  N  N3    . DG  I 5 133 ? -20.436 43.520 -58.606 1.00 168.65 ? 60  DG  I N3    1 
ATOM   8789  C  C4    . DG  I 5 133 ? -19.159 43.068 -58.534 1.00 168.58 ? 60  DG  I C4    1 
ATOM   8790  P  P     . DG  I 5 134 ? -21.483 36.994 -59.275 1.00 170.83 ? 61  DG  I P     1 
ATOM   8791  O  OP1   . DG  I 5 134 ? -22.476 36.038 -58.723 1.00 170.86 ? 61  DG  I OP1   1 
ATOM   8792  O  OP2   . DG  I 5 134 ? -20.163 36.502 -59.735 1.00 170.85 ? 61  DG  I OP2   1 
ATOM   8793  O  "O5'" . DG  I 5 134 ? -22.144 37.817 -60.487 1.00 171.83 ? 61  DG  I "O5'" 1 
ATOM   8794  C  "C5'" . DG  I 5 134 ? -23.543 38.144 -60.480 1.00 172.69 ? 61  DG  I "C5'" 1 
ATOM   8795  C  "C4'" . DG  I 5 134 ? -23.875 39.175 -61.552 1.00 173.48 ? 61  DG  I "C4'" 1 
ATOM   8796  O  "O4'" . DG  I 5 134 ? -23.131 40.401 -61.297 1.00 173.75 ? 61  DG  I "O4'" 1 
ATOM   8797  C  "C3'" . DG  I 5 134 ? -23.527 38.772 -63.002 1.00 173.95 ? 61  DG  I "C3'" 1 
ATOM   8798  O  "O3'" . DG  I 5 134 ? -24.571 39.213 -63.892 1.00 174.31 ? 61  DG  I "O3'" 1 
ATOM   8799  C  "C2'" . DG  I 5 134 ? -22.239 39.550 -63.247 1.00 173.99 ? 61  DG  I "C2'" 1 
ATOM   8800  C  "C1'" . DG  I 5 134 ? -22.584 40.824 -62.516 1.00 174.02 ? 61  DG  I "C1'" 1 
ATOM   8801  N  N9    . DG  I 5 134 ? -21.457 41.706 -62.288 1.00 174.29 ? 61  DG  I N9    1 
ATOM   8802  C  C8    . DG  I 5 134 ? -20.122 41.377 -62.333 1.00 174.38 ? 61  DG  I C8    1 
ATOM   8803  N  N7    . DG  I 5 134 ? -19.333 42.411 -62.236 1.00 174.48 ? 61  DG  I N7    1 
ATOM   8804  C  C5    . DG  I 5 134 ? -20.204 43.494 -62.165 1.00 174.54 ? 61  DG  I C5    1 
ATOM   8805  C  C6    . DG  I 5 134 ? -19.935 44.881 -62.089 1.00 174.63 ? 61  DG  I C6    1 
ATOM   8806  O  O6    . DG  I 5 134 ? -18.836 45.445 -62.063 1.00 174.64 ? 61  DG  I O6    1 
ATOM   8807  N  N1    . DG  I 5 134 ? -21.111 45.637 -62.072 1.00 174.61 ? 61  DG  I N1    1 
ATOM   8808  C  C2    . DG  I 5 134 ? -22.383 45.115 -62.143 1.00 174.53 ? 61  DG  I C2    1 
ATOM   8809  N  N2    . DG  I 5 134 ? -23.395 45.995 -62.108 1.00 174.46 ? 61  DG  I N2    1 
ATOM   8810  N  N3    . DG  I 5 134 ? -22.645 43.821 -62.234 1.00 174.50 ? 61  DG  I N3    1 
ATOM   8811  C  C4    . DG  I 5 134 ? -21.511 43.074 -62.245 1.00 174.47 ? 61  DG  I C4    1 
ATOM   8812  P  P     . DG  I 5 135 ? -24.631 38.720 -65.424 1.00 174.55 ? 62  DG  I P     1 
ATOM   8813  O  OP1   . DG  I 5 135 ? -25.875 37.937 -65.597 1.00 174.61 ? 62  DG  I OP1   1 
ATOM   8814  O  OP2   . DG  I 5 135 ? -23.330 38.115 -65.785 1.00 174.52 ? 62  DG  I OP2   1 
ATOM   8815  O  "O5'" . DG  I 5 135 ? -24.768 40.097 -66.231 1.00 174.97 ? 62  DG  I "O5'" 1 
ATOM   8816  C  "C5'" . DG  I 5 135 ? -25.955 40.875 -66.117 1.00 175.40 ? 62  DG  I "C5'" 1 
ATOM   8817  C  "C4'" . DG  I 5 135 ? -25.685 42.327 -66.462 1.00 175.89 ? 62  DG  I "C4'" 1 
ATOM   8818  O  "O4'" . DG  I 5 135 ? -24.844 42.918 -65.430 1.00 176.04 ? 62  DG  I "O4'" 1 
ATOM   8819  C  "C3'" . DG  I 5 135 ? -24.906 42.547 -67.747 1.00 176.28 ? 62  DG  I "C3'" 1 
ATOM   8820  O  "O3'" . DG  I 5 135 ? -25.786 42.551 -68.878 1.00 176.66 ? 62  DG  I "O3'" 1 
ATOM   8821  C  "C2'" . DG  I 5 135 ? -24.294 43.922 -67.497 1.00 176.24 ? 62  DG  I "C2'" 1 
ATOM   8822  C  "C1'" . DG  I 5 135 ? -23.937 43.847 -66.016 1.00 176.20 ? 62  DG  I "C1'" 1 
ATOM   8823  N  N9    . DG  I 5 135 ? -22.555 43.402 -65.764 1.00 176.37 ? 62  DG  I N9    1 
ATOM   8824  C  C8    . DG  I 5 135 ? -22.128 42.108 -65.566 1.00 176.39 ? 62  DG  I C8    1 
ATOM   8825  N  N7    . DG  I 5 135 ? -20.841 42.004 -65.375 1.00 176.40 ? 62  DG  I N7    1 
ATOM   8826  C  C5    . DG  I 5 135 ? -20.374 43.310 -65.472 1.00 176.38 ? 62  DG  I C5    1 
ATOM   8827  C  C6    . DG  I 5 135 ? -19.057 43.818 -65.352 1.00 176.25 ? 62  DG  I C6    1 
ATOM   8828  O  O6    . DG  I 5 135 ? -18.010 43.191 -65.124 1.00 176.18 ? 62  DG  I O6    1 
ATOM   8829  N  N1    . DG  I 5 135 ? -19.022 45.204 -65.511 1.00 176.18 ? 62  DG  I N1    1 
ATOM   8830  C  C2    . DG  I 5 135 ? -20.120 45.996 -65.762 1.00 176.21 ? 62  DG  I C2    1 
ATOM   8831  N  N2    . DG  I 5 135 ? -19.886 47.309 -65.891 1.00 176.17 ? 62  DG  I N2    1 
ATOM   8832  N  N3    . DG  I 5 135 ? -21.362 45.534 -65.876 1.00 176.28 ? 62  DG  I N3    1 
ATOM   8833  C  C4    . DG  I 5 135 ? -21.415 44.186 -65.721 1.00 176.36 ? 62  DG  I C4    1 
ATOM   8834  P  P     . DT  I 5 136 ? -25.230 42.165 -70.339 1.00 176.96 ? 63  DT  I P     1 
ATOM   8835  O  OP1   . DT  I 5 136 ? -26.392 41.877 -71.211 1.00 176.92 ? 63  DT  I OP1   1 
ATOM   8836  O  OP2   . DT  I 5 136 ? -24.164 41.149 -70.172 1.00 176.94 ? 63  DT  I OP2   1 
ATOM   8837  O  "O5'" . DT  I 5 136 ? -24.540 43.526 -70.829 1.00 177.23 ? 63  DT  I "O5'" 1 
ATOM   8838  C  "C5'" . DT  I 5 136 ? -25.339 44.684 -71.059 1.00 177.42 ? 63  DT  I "C5'" 1 
ATOM   8839  C  "C4'" . DT  I 5 136 ? -24.550 45.959 -70.803 1.00 177.63 ? 63  DT  I "C4'" 1 
ATOM   8840  O  "O4'" . DT  I 5 136 ? -23.491 45.708 -69.844 1.00 177.69 ? 63  DT  I "O4'" 1 
ATOM   8841  C  "C3'" . DT  I 5 136 ? -23.875 46.562 -72.038 1.00 177.68 ? 63  DT  I "C3'" 1 
ATOM   8842  O  "O3'" . DT  I 5 136 ? -24.302 47.903 -72.226 1.00 177.69 ? 63  DT  I "O3'" 1 
ATOM   8843  C  "C2'" . DT  I 5 136 ? -22.379 46.491 -71.720 1.00 177.77 ? 63  DT  I "C2'" 1 
ATOM   8844  C  "C1'" . DT  I 5 136 ? -22.368 46.466 -70.200 1.00 177.81 ? 63  DT  I "C1'" 1 
ATOM   8845  N  N1    . DT  I 5 136 ? -21.149 45.812 -69.650 1.00 177.92 ? 63  DT  I N1    1 
ATOM   8846  C  C2    . DT  I 5 136 ? -20.164 46.592 -69.084 1.00 177.91 ? 63  DT  I C2    1 
ATOM   8847  O  O2    . DT  I 5 136 ? -20.270 47.795 -68.926 1.00 177.87 ? 63  DT  I O2    1 
ATOM   8848  N  N3    . DT  I 5 136 ? -19.040 45.906 -68.707 1.00 178.02 ? 63  DT  I N3    1 
ATOM   8849  C  C4    . DT  I 5 136 ? -18.804 44.549 -68.846 1.00 178.03 ? 63  DT  I C4    1 
ATOM   8850  O  O4    . DT  I 5 136 ? -17.742 44.077 -68.460 1.00 178.14 ? 63  DT  I O4    1 
ATOM   8851  C  C5    . DT  I 5 136 ? -19.865 43.797 -69.473 1.00 178.00 ? 63  DT  I C5    1 
ATOM   8852  C  C7    . DT  I 5 136 ? -19.723 42.318 -69.679 1.00 177.93 ? 63  DT  I C7    1 
ATOM   8853  C  C6    . DT  I 5 136 ? -20.966 44.460 -69.853 1.00 177.93 ? 63  DT  I C6    1 
ATOM   8854  P  P     . DT  I 5 137 ? -24.038 48.633 -73.625 1.00 177.58 ? 64  DT  I P     1 
ATOM   8855  O  OP1   . DT  I 5 137 ? -25.135 49.605 -73.848 1.00 177.65 ? 64  DT  I OP1   1 
ATOM   8856  O  OP2   . DT  I 5 137 ? -23.763 47.585 -74.636 1.00 177.55 ? 64  DT  I OP2   1 
ATOM   8857  O  "O5'" . DT  I 5 137 ? -22.673 49.437 -73.362 1.00 177.32 ? 64  DT  I "O5'" 1 
ATOM   8858  C  "C5'" . DT  I 5 137 ? -22.502 50.205 -72.159 1.00 176.99 ? 64  DT  I "C5'" 1 
ATOM   8859  C  "C4'" . DT  I 5 137 ? -21.075 50.735 -72.028 1.00 176.67 ? 64  DT  I "C4'" 1 
ATOM   8860  O  "O4'" . DT  I 5 137 ? -20.286 49.828 -71.230 1.00 176.51 ? 64  DT  I "O4'" 1 
ATOM   8861  C  "C3'" . DT  I 5 137 ? -20.290 50.843 -73.321 1.00 176.52 ? 64  DT  I "C3'" 1 
ATOM   8862  O  "O3'" . DT  I 5 137 ? -20.611 52.041 -74.001 1.00 176.51 ? 64  DT  I "O3'" 1 
ATOM   8863  C  "C2'" . DT  I 5 137 ? -18.843 50.847 -72.826 1.00 176.39 ? 64  DT  I "C2'" 1 
ATOM   8864  C  "C1'" . DT  I 5 137 ? -18.915 50.034 -71.528 1.00 176.27 ? 64  DT  I "C1'" 1 
ATOM   8865  N  N1    . DT  I 5 137 ? -18.217 48.712 -71.605 1.00 175.86 ? 64  DT  I N1    1 
ATOM   8866  C  C2    . DT  I 5 137 ? -16.912 48.624 -71.195 1.00 175.62 ? 64  DT  I C2    1 
ATOM   8867  O  O2    . DT  I 5 137 ? -16.292 49.565 -70.736 1.00 175.57 ? 64  DT  I O2    1 
ATOM   8868  N  N3    . DT  I 5 137 ? -16.365 47.374 -71.292 1.00 175.56 ? 64  DT  I N3    1 
ATOM   8869  C  C4    . DT  I 5 137 ? -16.968 46.236 -71.792 1.00 175.45 ? 64  DT  I C4    1 
ATOM   8870  O  O4    . DT  I 5 137 ? -16.346 45.181 -71.817 1.00 175.43 ? 64  DT  I O4    1 
ATOM   8871  C  C5    . DT  I 5 137 ? -18.325 46.405 -72.239 1.00 175.57 ? 64  DT  I C5    1 
ATOM   8872  C  C7    . DT  I 5 137 ? -19.075 45.242 -72.810 1.00 175.46 ? 64  DT  I C7    1 
ATOM   8873  C  C6    . DT  I 5 137 ? -18.873 47.625 -72.144 1.00 175.68 ? 64  DT  I C6    1 
ATOM   8874  P  P     . DA  I 5 138 ? -20.516 52.086 -75.597 1.00 176.53 ? 65  DA  I P     1 
ATOM   8875  O  OP1   . DA  I 5 138 ? -21.335 53.228 -76.068 1.00 176.57 ? 65  DA  I OP1   1 
ATOM   8876  O  OP2   . DA  I 5 138 ? -20.796 50.725 -76.105 1.00 176.52 ? 65  DA  I OP2   1 
ATOM   8877  O  "O5'" . DA  I 5 138 ? -18.961 52.396 -75.857 1.00 176.50 ? 65  DA  I "O5'" 1 
ATOM   8878  C  "C5'" . DA  I 5 138 ? -18.455 53.724 -75.726 1.00 176.49 ? 65  DA  I "C5'" 1 
ATOM   8879  C  "C4'" . DA  I 5 138 ? -16.998 53.717 -75.300 1.00 176.47 ? 65  DA  I "C4'" 1 
ATOM   8880  O  "O4'" . DA  I 5 138 ? -16.719 52.526 -74.516 1.00 176.60 ? 65  DA  I "O4'" 1 
ATOM   8881  C  "C3'" . DA  I 5 138 ? -15.980 53.725 -76.448 1.00 176.35 ? 65  DA  I "C3'" 1 
ATOM   8882  O  "O3'" . DA  I 5 138 ? -15.004 54.743 -76.221 1.00 176.04 ? 65  DA  I "O3'" 1 
ATOM   8883  C  "C2'" . DA  I 5 138 ? -15.363 52.327 -76.382 1.00 176.54 ? 65  DA  I "C2'" 1 
ATOM   8884  C  "C1'" . DA  I 5 138 ? -15.472 52.014 -74.902 1.00 176.74 ? 65  DA  I "C1'" 1 
ATOM   8885  N  N9    . DA  I 5 138 ? -15.418 50.579 -74.611 1.00 177.02 ? 65  DA  I N9    1 
ATOM   8886  C  C8    . DA  I 5 138 ? -16.098 49.582 -75.258 1.00 177.11 ? 65  DA  I C8    1 
ATOM   8887  N  N7    . DA  I 5 138 ? -15.777 48.373 -74.858 1.00 177.14 ? 65  DA  I N7    1 
ATOM   8888  C  C5    . DA  I 5 138 ? -14.783 48.587 -73.920 1.00 177.21 ? 65  DA  I C5    1 
ATOM   8889  C  C6    . DA  I 5 138 ? -14.030 47.707 -73.122 1.00 177.31 ? 65  DA  I C6    1 
ATOM   8890  N  N6    . DA  I 5 138 ? -14.154 46.377 -73.177 1.00 177.32 ? 65  DA  I N6    1 
ATOM   8891  N  N1    . DA  I 5 138 ? -13.116 48.247 -72.284 1.00 177.37 ? 65  DA  I N1    1 
ATOM   8892  C  C2    . DA  I 5 138 ? -12.979 49.578 -72.248 1.00 177.34 ? 65  DA  I C2    1 
ATOM   8893  N  N3    . DA  I 5 138 ? -13.636 50.507 -72.943 1.00 177.27 ? 65  DA  I N3    1 
ATOM   8894  C  C4    . DA  I 5 138 ? -14.534 49.939 -73.768 1.00 177.20 ? 65  DA  I C4    1 
ATOM   8895  P  P     . DG  I 5 139 ? -13.971 55.173 -77.373 1.00 175.77 ? 66  DG  I P     1 
ATOM   8896  O  OP1   . DG  I 5 139 ? -14.056 56.642 -77.537 1.00 175.76 ? 66  DG  I OP1   1 
ATOM   8897  O  OP2   . DG  I 5 139 ? -14.173 54.291 -78.545 1.00 175.74 ? 66  DG  I OP2   1 
ATOM   8898  O  "O5'" . DG  I 5 139 ? -12.560 54.810 -76.714 1.00 175.57 ? 66  DG  I "O5'" 1 
ATOM   8899  C  "C5'" . DG  I 5 139 ? -12.406 54.884 -75.293 1.00 175.39 ? 66  DG  I "C5'" 1 
ATOM   8900  C  "C4'" . DG  I 5 139 ? -11.206 54.080 -74.814 1.00 175.23 ? 66  DG  I "C4'" 1 
ATOM   8901  O  "O4'" . DG  I 5 139 ? -11.579 52.684 -74.645 1.00 175.37 ? 66  DG  I "O4'" 1 
ATOM   8902  C  "C3'" . DG  I 5 139 ? -9.990  54.085 -75.742 1.00 174.95 ? 66  DG  I "C3'" 1 
ATOM   8903  O  "O3'" . DG  I 5 139 ? -8.795  54.160 -74.966 1.00 174.40 ? 66  DG  I "O3'" 1 
ATOM   8904  C  "C2'" . DG  I 5 139 ? -10.105 52.741 -76.456 1.00 175.22 ? 66  DG  I "C2'" 1 
ATOM   8905  C  "C1'" . DG  I 5 139 ? -10.666 51.866 -75.348 1.00 175.46 ? 66  DG  I "C1'" 1 
ATOM   8906  N  N9    . DG  I 5 139 ? -11.373 50.678 -75.832 1.00 175.70 ? 66  DG  I N9    1 
ATOM   8907  C  C8    . DG  I 5 139 ? -12.349 50.626 -76.799 1.00 175.76 ? 66  DG  I C8    1 
ATOM   8908  N  N7    . DG  I 5 139 ? -12.813 49.424 -77.010 1.00 175.80 ? 66  DG  I N7    1 
ATOM   8909  C  C5    . DG  I 5 139 ? -12.075 48.621 -76.149 1.00 175.85 ? 66  DG  I C5    1 
ATOM   8910  C  C6    . DG  I 5 139 ? -12.126 47.221 -75.938 1.00 175.92 ? 66  DG  I C6    1 
ATOM   8911  O  O6    . DG  I 5 139 ? -12.859 46.386 -76.489 1.00 175.88 ? 66  DG  I O6    1 
ATOM   8912  N  N1    . DG  I 5 139 ? -11.202 46.812 -74.976 1.00 175.91 ? 66  DG  I N1    1 
ATOM   8913  C  C2    . DG  I 5 139 ? -10.345 47.652 -74.299 1.00 175.93 ? 66  DG  I C2    1 
ATOM   8914  N  N2    . DG  I 5 139 ? -9.513  47.075 -73.424 1.00 175.85 ? 66  DG  I N2    1 
ATOM   8915  N  N3    . DG  I 5 139 ? -10.293 48.964 -74.482 1.00 175.87 ? 66  DG  I N3    1 
ATOM   8916  C  C4    . DG  I 5 139 ? -11.179 49.377 -75.422 1.00 175.83 ? 66  DG  I C4    1 
ATOM   8917  P  P     . DG  I 5 140 ? -7.427  54.661 -75.631 1.00 173.84 ? 67  DG  I P     1 
ATOM   8918  O  OP1   . DG  I 5 140 ? -6.807  55.643 -74.712 1.00 173.82 ? 67  DG  I OP1   1 
ATOM   8919  O  OP2   . DG  I 5 140 ? -7.706  55.033 -77.037 1.00 173.84 ? 67  DG  I OP2   1 
ATOM   8920  O  "O5'" . DG  I 5 140 ? -6.537  53.338 -75.645 1.00 173.28 ? 67  DG  I "O5'" 1 
ATOM   8921  C  "C5'" . DG  I 5 140 ? -6.410  52.560 -74.467 1.00 172.76 ? 67  DG  I "C5'" 1 
ATOM   8922  C  "C4'" . DG  I 5 140 ? -6.089  51.122 -74.815 1.00 172.25 ? 67  DG  I "C4'" 1 
ATOM   8923  O  "O4'" . DG  I 5 140 ? -7.284  50.472 -75.280 1.00 172.23 ? 67  DG  I "O4'" 1 
ATOM   8924  C  "C3'" . DG  I 5 140 ? -5.099  50.954 -75.952 1.00 171.80 ? 67  DG  I "C3'" 1 
ATOM   8925  O  "O3'" . DG  I 5 140 ? -3.766  50.939 -75.439 1.00 171.14 ? 67  DG  I "O3'" 1 
ATOM   8926  C  "C2'" . DG  I 5 140 ? -5.486  49.600 -76.561 1.00 172.02 ? 67  DG  I "C2'" 1 
ATOM   8927  C  "C1'" . DG  I 5 140 ? -6.926  49.375 -76.091 1.00 172.22 ? 67  DG  I "C1'" 1 
ATOM   8928  N  N9    . DG  I 5 140 ? -7.890  49.265 -77.185 1.00 172.40 ? 67  DG  I N9    1 
ATOM   8929  C  C8    . DG  I 5 140 ? -8.327  50.272 -78.010 1.00 172.46 ? 67  DG  I C8    1 
ATOM   8930  N  N7    . DG  I 5 140 ? -9.220  49.886 -78.879 1.00 172.50 ? 67  DG  I N7    1 
ATOM   8931  C  C5    . DG  I 5 140 ? -9.354  48.525 -78.644 1.00 172.52 ? 67  DG  I C5    1 
ATOM   8932  C  C6    . DG  I 5 140 ? -10.165 47.565 -79.294 1.00 172.53 ? 67  DG  I C6    1 
ATOM   8933  O  O6    . DG  I 5 140 ? -10.952 47.737 -80.235 1.00 172.44 ? 67  DG  I O6    1 
ATOM   8934  N  N1    . DG  I 5 140 ? -10.000 46.294 -78.742 1.00 172.63 ? 67  DG  I N1    1 
ATOM   8935  C  C2    . DG  I 5 140 ? -9.156  45.993 -77.693 1.00 172.67 ? 67  DG  I C2    1 
ATOM   8936  N  N2    . DG  I 5 140 ? -9.131  44.712 -77.296 1.00 172.71 ? 67  DG  I N2    1 
ATOM   8937  N  N3    . DG  I 5 140 ? -8.388  46.885 -77.079 1.00 172.60 ? 67  DG  I N3    1 
ATOM   8938  C  C4    . DG  I 5 140 ? -8.536  48.125 -77.607 1.00 172.52 ? 67  DG  I C4    1 
ATOM   8939  P  P     . DG  I 5 141 ? -2.522  51.205 -76.414 1.00 170.46 ? 68  DG  I P     1 
ATOM   8940  O  OP1   . DG  I 5 141 ? -1.401  51.724 -75.598 1.00 170.43 ? 68  DG  I OP1   1 
ATOM   8941  O  OP2   . DG  I 5 141 ? -3.010  51.982 -77.576 1.00 170.40 ? 68  DG  I OP2   1 
ATOM   8942  O  "O5'" . DG  I 5 141 ? -2.151  49.733 -76.924 1.00 169.97 ? 68  DG  I "O5'" 1 
ATOM   8943  C  "C5'" . DG  I 5 141 ? -1.919  48.682 -75.979 1.00 169.42 ? 68  DG  I "C5'" 1 
ATOM   8944  C  "C4'" . DG  I 5 141 ? -2.098  47.310 -76.620 1.00 168.85 ? 68  DG  I "C4'" 1 
ATOM   8945  O  "O4'" . DG  I 5 141 ? -3.402  47.225 -77.261 1.00 168.66 ? 68  DG  I "O4'" 1 
ATOM   8946  C  "C3'" . DG  I 5 141 ? -1.068  46.947 -77.696 1.00 168.40 ? 68  DG  I "C3'" 1 
ATOM   8947  O  "O3'" . DG  I 5 141 ? -0.686  45.578 -77.552 1.00 167.92 ? 68  DG  I "O3'" 1 
ATOM   8948  C  "C2'" . DG  I 5 141 ? -1.839  47.182 -78.995 1.00 168.50 ? 68  DG  I "C2'" 1 
ATOM   8949  C  "C1'" . DG  I 5 141 ? -3.244  46.774 -78.590 1.00 168.55 ? 68  DG  I "C1'" 1 
ATOM   8950  N  N9    . DG  I 5 141 ? -4.288  47.369 -79.427 1.00 168.44 ? 68  DG  I N9    1 
ATOM   8951  C  C8    . DG  I 5 141 ? -4.394  48.685 -79.807 1.00 168.43 ? 68  DG  I C8    1 
ATOM   8952  N  N7    . DG  I 5 141 ? -5.408  48.920 -80.591 1.00 168.38 ? 68  DG  I N7    1 
ATOM   8953  C  C5    . DG  I 5 141 ? -5.986  47.673 -80.783 1.00 168.39 ? 68  DG  I C5    1 
ATOM   8954  C  C6    . DG  I 5 141 ? -7.117  47.300 -81.548 1.00 168.33 ? 68  DG  I C6    1 
ATOM   8955  O  O6    . DG  I 5 141 ? -7.867  48.030 -82.214 1.00 168.38 ? 68  DG  I O6    1 
ATOM   8956  N  N1    . DG  I 5 141 ? -7.362  45.930 -81.472 1.00 168.28 ? 68  DG  I N1    1 
ATOM   8957  C  C2    . DG  I 5 141 ? -6.606  45.037 -80.751 1.00 168.21 ? 68  DG  I C2    1 
ATOM   8958  N  N2    . DG  I 5 141 ? -6.987  43.754 -80.807 1.00 168.18 ? 68  DG  I N2    1 
ATOM   8959  N  N3    . DG  I 5 141 ? -5.549  45.374 -80.026 1.00 168.29 ? 68  DG  I N3    1 
ATOM   8960  C  C4    . DG  I 5 141 ? -5.297  46.704 -80.090 1.00 168.35 ? 68  DG  I C4    1 
ATOM   8961  P  P     . DT  I 5 142 ? 0.646   45.010 -78.246 1.00 167.41 ? 69  DT  I P     1 
ATOM   8962  O  OP1   . DT  I 5 142 ? 1.636   44.746 -77.179 1.00 167.34 ? 69  DT  I OP1   1 
ATOM   8963  O  OP2   . DT  I 5 142 ? 1.004   45.892 -79.381 1.00 167.28 ? 69  DT  I OP2   1 
ATOM   8964  O  "O5'" . DT  I 5 142 ? 0.146   43.608 -78.843 1.00 167.24 ? 69  DT  I "O5'" 1 
ATOM   8965  C  "C5'" . DT  I 5 142 ? -0.716  42.770 -78.064 1.00 167.08 ? 69  DT  I "C5'" 1 
ATOM   8966  C  "C4'" . DT  I 5 142 ? -1.570  41.871 -78.947 1.00 166.97 ? 69  DT  I "C4'" 1 
ATOM   8967  O  "O4'" . DT  I 5 142 ? -2.571  42.666 -79.637 1.00 167.05 ? 69  DT  I "O4'" 1 
ATOM   8968  C  "C3'" . DT  I 5 142 ? -0.808  41.095 -80.023 1.00 166.84 ? 69  DT  I "C3'" 1 
ATOM   8969  O  "O3'" . DT  I 5 142 ? -1.185  39.723 -80.000 1.00 166.55 ? 69  DT  I "O3'" 1 
ATOM   8970  C  "C2'" . DT  I 5 142 ? -1.225  41.775 -81.331 1.00 167.05 ? 69  DT  I "C2'" 1 
ATOM   8971  C  "C1'" . DT  I 5 142 ? -2.620  42.293 -80.999 1.00 167.11 ? 69  DT  I "C1'" 1 
ATOM   8972  N  N1    . DT  I 5 142 ? -3.028  43.500 -81.823 1.00 167.13 ? 69  DT  I N1    1 
ATOM   8973  C  C2    . DT  I 5 142 ? -4.192  43.456 -82.563 1.00 166.97 ? 69  DT  I C2    1 
ATOM   8974  O  O2    . DT  I 5 142 ? -4.952  42.500 -82.565 1.00 166.84 ? 69  DT  I O2    1 
ATOM   8975  N  N3    . DT  I 5 142 ? -4.453  44.597 -83.280 1.00 167.05 ? 69  DT  I N3    1 
ATOM   8976  C  C4    . DT  I 5 142 ? -3.672  45.745 -83.352 1.00 167.07 ? 69  DT  I C4    1 
ATOM   8977  O  O4    . DT  I 5 142 ? -4.040  46.690 -84.045 1.00 167.12 ? 69  DT  I O4    1 
ATOM   8978  C  C5    . DT  I 5 142 ? -2.457  45.715 -82.579 1.00 167.04 ? 69  DT  I C5    1 
ATOM   8979  C  C7    . DT  I 5 142 ? -1.531  46.898 -82.584 1.00 166.92 ? 69  DT  I C7    1 
ATOM   8980  C  C6    . DT  I 5 142 ? -2.191  44.604 -81.869 1.00 167.13 ? 69  DT  I C6    1 
ATOM   8981  P  P     . DG  I 5 143 ? -0.208  38.618 -80.616 1.00 166.37 ? 70  DG  I P     1 
ATOM   8982  O  OP1   . DG  I 5 143 ? -0.450  37.350 -79.897 1.00 166.27 ? 70  DG  I OP1   1 
ATOM   8983  O  OP2   . DG  I 5 143 ? 1.155   39.193 -80.667 1.00 166.20 ? 70  DG  I OP2   1 
ATOM   8984  O  "O5'" . DG  I 5 143 ? -0.730  38.469 -82.123 1.00 166.74 ? 70  DG  I "O5'" 1 
ATOM   8985  C  "C5'" . DG  I 5 143 ? -2.127  38.295 -82.392 1.00 167.05 ? 70  DG  I "C5'" 1 
ATOM   8986  C  "C4'" . DG  I 5 143 ? -2.429  38.446 -83.880 1.00 167.32 ? 70  DG  I "C4'" 1 
ATOM   8987  O  "O4'" . DG  I 5 143 ? -2.586  39.853 -84.216 1.00 167.28 ? 70  DG  I "O4'" 1 
ATOM   8988  C  "C3'" . DG  I 5 143 ? -1.355  37.903 -84.830 1.00 167.63 ? 70  DG  I "C3'" 1 
ATOM   8989  O  "O3'" . DG  I 5 143 ? -1.976  37.225 -85.909 1.00 168.14 ? 70  DG  I "O3'" 1 
ATOM   8990  C  "C2'" . DG  I 5 143 ? -0.652  39.169 -85.310 1.00 167.45 ? 70  DG  I "C2'" 1 
ATOM   8991  C  "C1'" . DG  I 5 143 ? -1.813  40.137 -85.360 1.00 167.32 ? 70  DG  I "C1'" 1 
ATOM   8992  N  N9    . DG  I 5 143 ? -1.401  41.534 -85.329 1.00 167.25 ? 70  DG  I N9    1 
ATOM   8993  C  C8    . DG  I 5 143 ? -0.174  42.025 -84.954 1.00 167.19 ? 70  DG  I C8    1 
ATOM   8994  N  N7    . DG  I 5 143 ? -0.065  43.315 -85.096 1.00 167.18 ? 70  DG  I N7    1 
ATOM   8995  C  C5    . DG  I 5 143 ? -1.287  43.700 -85.630 1.00 167.28 ? 70  DG  I C5    1 
ATOM   8996  C  C6    . DG  I 5 143 ? -1.758  44.982 -85.994 1.00 167.39 ? 70  DG  I C6    1 
ATOM   8997  O  O6    . DG  I 5 143 ? -1.166  46.067 -85.917 1.00 167.41 ? 70  DG  I O6    1 
ATOM   8998  N  N1    . DG  I 5 143 ? -3.056  44.930 -86.499 1.00 167.45 ? 70  DG  I N1    1 
ATOM   8999  C  C2    . DG  I 5 143 ? -3.804  43.782 -86.633 1.00 167.45 ? 70  DG  I C2    1 
ATOM   9000  N  N2    . DG  I 5 143 ? -5.025  43.926 -87.168 1.00 167.44 ? 70  DG  I N2    1 
ATOM   9001  N  N3    . DG  I 5 143 ? -3.377  42.575 -86.284 1.00 167.40 ? 70  DG  I N3    1 
ATOM   9002  C  C4    . DG  I 5 143 ? -2.112  42.610 -85.797 1.00 167.31 ? 70  DG  I C4    1 
ATOM   9003  P  P     . DA  I 5 144 ? -1.158  36.155 -86.772 1.00 168.67 ? 71  DA  I P     1 
ATOM   9004  O  OP1   . DA  I 5 144 ? -1.535  34.806 -86.283 1.00 168.68 ? 71  DA  I OP1   1 
ATOM   9005  O  OP2   . DA  I 5 144 ? 0.267   36.561 -86.786 1.00 168.54 ? 71  DA  I OP2   1 
ATOM   9006  O  "O5'" . DA  I 5 144 ? -1.741  36.379 -88.256 1.00 169.46 ? 71  DA  I "O5'" 1 
ATOM   9007  C  "C5'" . DA  I 5 144 ? -2.922  35.694 -88.698 1.00 170.22 ? 71  DA  I "C5'" 1 
ATOM   9008  C  "C4'" . DA  I 5 144 ? -3.948  36.670 -89.255 1.00 170.98 ? 71  DA  I "C4'" 1 
ATOM   9009  O  "O4'" . DA  I 5 144 ? -3.635  38.018 -88.807 1.00 171.21 ? 71  DA  I "O4'" 1 
ATOM   9010  C  "C3'" . DA  I 5 144 ? -4.031  36.739 -90.786 1.00 171.48 ? 71  DA  I "C3'" 1 
ATOM   9011  O  "O3'" . DA  I 5 144 ? -5.406  36.843 -91.203 1.00 172.04 ? 71  DA  I "O3'" 1 
ATOM   9012  C  "C2'" . DA  I 5 144 ? -3.258  38.013 -91.104 1.00 171.49 ? 71  DA  I "C2'" 1 
ATOM   9013  C  "C1'" . DA  I 5 144 ? -3.629  38.884 -89.917 1.00 171.51 ? 71  DA  I "C1'" 1 
ATOM   9014  N  N9    . DA  I 5 144 ? -2.676  39.964 -89.671 1.00 171.85 ? 71  DA  I N9    1 
ATOM   9015  C  C8    . DA  I 5 144 ? -1.362  39.840 -89.306 1.00 172.00 ? 71  DA  I C8    1 
ATOM   9016  N  N7    . DA  I 5 144 ? -0.728  40.986 -89.202 1.00 172.06 ? 71  DA  I N7    1 
ATOM   9017  C  C5    . DA  I 5 144 ? -1.689  41.928 -89.537 1.00 172.06 ? 71  DA  I C5    1 
ATOM   9018  C  C6    . DA  I 5 144 ? -1.647  43.333 -89.632 1.00 172.10 ? 71  DA  I C6    1 
ATOM   9019  N  N6    . DA  I 5 144 ? -0.553  44.058 -89.362 1.00 172.08 ? 71  DA  I N6    1 
ATOM   9020  N  N1    . DA  I 5 144 ? -2.781  43.968 -90.007 1.00 172.10 ? 71  DA  I N1    1 
ATOM   9021  C  C2    . DA  I 5 144 ? -3.874  43.238 -90.272 1.00 172.04 ? 71  DA  I C2    1 
ATOM   9022  N  N3    . DA  I 5 144 ? -4.033  41.917 -90.220 1.00 171.99 ? 71  DA  I N3    1 
ATOM   9023  C  C4    . DA  I 5 144 ? -2.891  41.313 -89.849 1.00 171.98 ? 71  DA  I C4    1 
ATOM   9024  P  P     . DT  I 5 145 ? -5.823  36.599 -92.738 1.00 172.40 ? 72  DT  I P     1 
ATOM   9025  O  OP1   . DT  I 5 145 ? -7.243  36.174 -92.764 1.00 172.36 ? 72  DT  I OP1   1 
ATOM   9026  O  OP2   . DT  I 5 145 ? -4.787  35.742 -93.357 1.00 172.48 ? 72  DT  I OP2   1 
ATOM   9027  O  "O5'" . DT  I 5 145 ? -5.707  38.066 -93.385 1.00 172.75 ? 72  DT  I "O5'" 1 
ATOM   9028  C  "C5'" . DT  I 5 145 ? -6.354  38.373 -94.629 1.00 173.01 ? 72  DT  I "C5'" 1 
ATOM   9029  C  "C4'" . DT  I 5 145 ? -6.370  39.877 -94.872 1.00 173.32 ? 72  DT  I "C4'" 1 
ATOM   9030  O  "O4'" . DT  I 5 145 ? -5.424  40.519 -93.981 1.00 173.46 ? 72  DT  I "O4'" 1 
ATOM   9031  C  "C3'" . DT  I 5 145 ? -5.998  40.320 -96.295 1.00 173.34 ? 72  DT  I "C3'" 1 
ATOM   9032  O  "O3'" . DT  I 5 145 ? -7.042  41.113 -96.854 1.00 173.29 ? 72  DT  I "O3'" 1 
ATOM   9033  C  "C2'" . DT  I 5 145 ? -4.707  41.132 -96.116 1.00 173.50 ? 72  DT  I "C2'" 1 
ATOM   9034  C  "C1'" . DT  I 5 145 ? -4.782  41.568 -94.658 1.00 173.57 ? 72  DT  I "C1'" 1 
ATOM   9035  N  N1    . DT  I 5 145 ? -3.441  41.775 -94.031 1.00 173.75 ? 72  DT  I N1    1 
ATOM   9036  C  C2    . DT  I 5 145 ? -3.027  43.054 -93.729 1.00 173.86 ? 72  DT  I C2    1 
ATOM   9037  O  O2    . DT  I 5 145 ? -3.718  44.041 -93.914 1.00 173.90 ? 72  DT  I O2    1 
ATOM   9038  N  N3    . DT  I 5 145 ? -1.778  43.133 -93.166 1.00 173.91 ? 72  DT  I N3    1 
ATOM   9039  C  C4    . DT  I 5 145 ? -0.913  42.084 -92.896 1.00 173.87 ? 72  DT  I C4    1 
ATOM   9040  O  O4    . DT  I 5 145 ? 0.177   42.311 -92.380 1.00 173.87 ? 72  DT  I O4    1 
ATOM   9041  C  C5    . DT  I 5 145 ? -1.409  40.772 -93.235 1.00 173.82 ? 72  DT  I C5    1 
ATOM   9042  C  C7    . DT  I 5 145 ? -0.556  39.561 -92.989 1.00 173.80 ? 72  DT  I C7    1 
ATOM   9043  C  C6    . DT  I 5 145 ? -2.629  40.682 -93.792 1.00 173.76 ? 72  DT  I C6    1 
ATOM   9044  O  "O5'" . DA  J 6 1   ? 4.145   51.353 -91.026 1.00 181.46 ? -72 DA  J "O5'" 1 
ATOM   9045  C  "C5'" . DA  J 6 1   ? 3.673   52.504 -91.721 1.00 181.53 ? -72 DA  J "C5'" 1 
ATOM   9046  C  "C4'" . DA  J 6 1   ? 2.566   52.135 -92.695 1.00 181.61 ? -72 DA  J "C4'" 1 
ATOM   9047  O  "O4'" . DA  J 6 1   ? 2.784   50.786 -93.181 1.00 181.62 ? -72 DA  J "O4'" 1 
ATOM   9048  C  "C3'" . DA  J 6 1   ? 1.156   52.158 -92.105 1.00 181.73 ? -72 DA  J "C3'" 1 
ATOM   9049  O  "O3'" . DA  J 6 1   ? 0.217   52.681 -93.055 1.00 181.77 ? -72 DA  J "O3'" 1 
ATOM   9050  C  "C2'" . DA  J 6 1   ? 0.886   50.690 -91.789 1.00 181.73 ? -72 DA  J "C2'" 1 
ATOM   9051  C  "C1'" . DA  J 6 1   ? 1.668   49.973 -92.881 1.00 181.72 ? -72 DA  J "C1'" 1 
ATOM   9052  N  N9    . DA  J 6 1   ? 2.157   48.666 -92.459 1.00 181.81 ? -72 DA  J N9    1 
ATOM   9053  C  C8    . DA  J 6 1   ? 3.352   48.392 -91.853 1.00 181.84 ? -72 DA  J C8    1 
ATOM   9054  N  N7    . DA  J 6 1   ? 3.511   47.126 -91.545 1.00 181.86 ? -72 DA  J N7    1 
ATOM   9055  C  C5    . DA  J 6 1   ? 2.327   46.531 -91.958 1.00 181.85 ? -72 DA  J C5    1 
ATOM   9056  C  C6    . DA  J 6 1   ? 1.864   45.200 -91.910 1.00 181.80 ? -72 DA  J C6    1 
ATOM   9057  N  N6    . DA  J 6 1   ? 2.579   44.186 -91.407 1.00 181.75 ? -72 DA  J N6    1 
ATOM   9058  N  N1    . DA  J 6 1   ? 0.638   44.946 -92.415 1.00 181.77 ? -72 DA  J N1    1 
ATOM   9059  C  C2    . DA  J 6 1   ? -0.073  45.957 -92.929 1.00 181.76 ? -72 DA  J C2    1 
ATOM   9060  N  N3    . DA  J 6 1   ? 0.249   47.247 -93.018 1.00 181.79 ? -72 DA  J N3    1 
ATOM   9061  C  C4    . DA  J 6 1   ? 1.475   47.470 -92.511 1.00 181.83 ? -72 DA  J C4    1 
ATOM   9062  P  P     . DT  J 6 2   ? -1.093  53.475 -92.554 1.00 181.73 ? -71 DT  J P     1 
ATOM   9063  O  OP1   . DT  J 6 2   ? -0.969  54.887 -92.989 1.00 181.75 ? -71 DT  J OP1   1 
ATOM   9064  O  OP2   . DT  J 6 2   ? -1.305  53.160 -91.119 1.00 181.76 ? -71 DT  J OP2   1 
ATOM   9065  O  "O5'" . DT  J 6 2   ? -2.275  52.782 -93.386 1.00 181.38 ? -71 DT  J "O5'" 1 
ATOM   9066  C  "C5'" . DT  J 6 2   ? -3.632  52.963 -92.991 1.00 181.01 ? -71 DT  J "C5'" 1 
ATOM   9067  C  "C4'" . DT  J 6 2   ? -4.486  51.801 -93.461 1.00 180.62 ? -71 DT  J "C4'" 1 
ATOM   9068  O  "O4'" . DT  J 6 2   ? -3.736  50.564 -93.324 1.00 180.52 ? -71 DT  J "O4'" 1 
ATOM   9069  C  "C3'" . DT  J 6 2   ? -5.780  51.599 -92.684 1.00 180.44 ? -71 DT  J "C3'" 1 
ATOM   9070  O  "O3'" . DT  J 6 2   ? -6.816  51.154 -93.556 1.00 180.26 ? -71 DT  J "O3'" 1 
ATOM   9071  C  "C2'" . DT  J 6 2   ? -5.402  50.536 -91.652 1.00 180.42 ? -71 DT  J "C2'" 1 
ATOM   9072  C  "C1'" . DT  J 6 2   ? -4.376  49.696 -92.408 1.00 180.31 ? -71 DT  J "C1'" 1 
ATOM   9073  N  N1    . DT  J 6 2   ? -3.324  49.079 -91.521 1.00 180.10 ? -71 DT  J N1    1 
ATOM   9074  C  C2    . DT  J 6 2   ? -2.928  47.779 -91.745 1.00 179.96 ? -71 DT  J C2    1 
ATOM   9075  O  O2    . DT  J 6 2   ? -3.377  47.085 -92.640 1.00 179.99 ? -71 DT  J O2    1 
ATOM   9076  N  N3    . DT  J 6 2   ? -1.956  47.323 -90.896 1.00 179.86 ? -71 DT  J N3    1 
ATOM   9077  C  C4    . DT  J 6 2   ? -1.365  48.013 -89.856 1.00 179.75 ? -71 DT  J C4    1 
ATOM   9078  O  O4    . DT  J 6 2   ? -0.509  47.462 -89.175 1.00 179.73 ? -71 DT  J O4    1 
ATOM   9079  C  C5    . DT  J 6 2   ? -1.829  49.366 -89.670 1.00 179.84 ? -71 DT  J C5    1 
ATOM   9080  C  C7    . DT  J 6 2   ? -1.256  50.216 -88.577 1.00 179.81 ? -71 DT  J C7    1 
ATOM   9081  C  C6    . DT  J 6 2   ? -2.773  49.829 -90.500 1.00 179.93 ? -71 DT  J C6    1 
ATOM   9082  P  P     . DC  J 6 3   ? -8.354  51.357 -93.149 1.00 180.11 ? -70 DC  J P     1 
ATOM   9083  O  OP1   . DC  J 6 3   ? -9.155  51.365 -94.394 1.00 180.18 ? -70 DC  J OP1   1 
ATOM   9084  O  OP2   . DC  J 6 3   ? -8.434  52.505 -92.216 1.00 180.07 ? -70 DC  J OP2   1 
ATOM   9085  O  "O5'" . DC  J 6 3   ? -8.677  50.019 -92.323 1.00 179.90 ? -70 DC  J "O5'" 1 
ATOM   9086  C  "C5'" . DC  J 6 3   ? -10.013 49.528 -92.223 1.00 179.67 ? -70 DC  J "C5'" 1 
ATOM   9087  C  "C4'" . DC  J 6 3   ? -10.019 48.053 -91.848 1.00 179.47 ? -70 DC  J "C4'" 1 
ATOM   9088  O  "O4'" . DC  J 6 3   ? -8.687  47.648 -91.415 1.00 179.31 ? -70 DC  J "O4'" 1 
ATOM   9089  C  "C3'" . DC  J 6 3   ? -10.966 47.683 -90.705 1.00 179.45 ? -70 DC  J "C3'" 1 
ATOM   9090  O  "O3'" . DC  J 6 3   ? -11.624 46.452 -90.992 1.00 179.57 ? -70 DC  J "O3'" 1 
ATOM   9091  C  "C2'" . DC  J 6 3   ? -10.024 47.550 -89.512 1.00 179.31 ? -70 DC  J "C2'" 1 
ATOM   9092  C  "C1'" . DC  J 6 3   ? -8.780  46.982 -90.173 1.00 179.13 ? -70 DC  J "C1'" 1 
ATOM   9093  N  N1    . DC  J 6 3   ? -7.522  47.228 -89.390 1.00 178.72 ? -70 DC  J N1    1 
ATOM   9094  C  C2    . DC  J 6 3   ? -6.783  46.145 -88.896 1.00 178.47 ? -70 DC  J C2    1 
ATOM   9095  O  O2    . DC  J 6 3   ? -7.154  44.991 -89.152 1.00 178.35 ? -70 DC  J O2    1 
ATOM   9096  N  N3    . DC  J 6 3   ? -5.661  46.394 -88.176 1.00 178.40 ? -70 DC  J N3    1 
ATOM   9097  C  C4    . DC  J 6 3   ? -5.289  47.652 -87.928 1.00 178.33 ? -70 DC  J C4    1 
ATOM   9098  N  N4    . DC  J 6 3   ? -4.178  47.849 -87.213 1.00 178.29 ? -70 DC  J N4    1 
ATOM   9099  C  C5    . DC  J 6 3   ? -6.039  48.764 -88.402 1.00 178.42 ? -70 DC  J C5    1 
ATOM   9100  C  C6    . DC  J 6 3   ? -7.142  48.508 -89.111 1.00 178.56 ? -70 DC  J C6    1 
ATOM   9101  P  P     . DA  J 6 4   ? -13.065 46.144 -90.360 1.00 179.69 ? -69 DA  J P     1 
ATOM   9102  O  OP1   . DA  J 6 4   ? -13.986 45.817 -91.473 1.00 179.67 ? -69 DA  J OP1   1 
ATOM   9103  O  OP2   . DA  J 6 4   ? -13.397 47.243 -89.423 1.00 179.71 ? -69 DA  J OP2   1 
ATOM   9104  O  "O5'" . DA  J 6 4   ? -12.808 44.820 -89.491 1.00 179.75 ? -69 DA  J "O5'" 1 
ATOM   9105  C  "C5'" . DA  J 6 4   ? -11.814 43.867 -89.903 1.00 179.74 ? -69 DA  J "C5'" 1 
ATOM   9106  C  "C4'" . DA  J 6 4   ? -11.698 42.688 -88.931 1.00 179.61 ? -69 DA  J "C4'" 1 
ATOM   9107  O  "O4'" . DA  J 6 4   ? -10.493 42.821 -88.136 1.00 179.79 ? -69 DA  J "O4'" 1 
ATOM   9108  C  "C3'" . DA  J 6 4   ? -12.834 42.513 -87.931 1.00 179.33 ? -69 DA  J "C3'" 1 
ATOM   9109  O  "O3'" . DA  J 6 4   ? -13.036 41.127 -87.668 1.00 178.63 ? -69 DA  J "O3'" 1 
ATOM   9110  C  "C2'" . DA  J 6 4   ? -12.336 43.262 -86.690 1.00 179.63 ? -69 DA  J "C2'" 1 
ATOM   9111  C  "C1'" . DA  J 6 4   ? -10.814 43.152 -86.792 1.00 179.95 ? -69 DA  J "C1'" 1 
ATOM   9112  N  N9    . DA  J 6 4   ? -10.131 44.399 -86.453 1.00 180.40 ? -69 DA  J N9    1 
ATOM   9113  C  C8    . DA  J 6 4   ? -10.556 45.665 -86.736 1.00 180.54 ? -69 DA  J C8    1 
ATOM   9114  N  N7    . DA  J 6 4   ? -9.727  46.603 -86.351 1.00 180.65 ? -69 DA  J N7    1 
ATOM   9115  C  C5    . DA  J 6 4   ? -8.698  45.905 -85.744 1.00 180.79 ? -69 DA  J C5    1 
ATOM   9116  C  C6    . DA  J 6 4   ? -7.509  46.325 -85.121 1.00 180.92 ? -69 DA  J C6    1 
ATOM   9117  N  N6    . DA  J 6 4   ? -7.161  47.612 -84.988 1.00 180.95 ? -69 DA  J N6    1 
ATOM   9118  N  N1    . DA  J 6 4   ? -6.704  45.371 -84.607 1.00 181.00 ? -69 DA  J N1    1 
ATOM   9119  C  C2    . DA  J 6 4   ? -7.069  44.087 -84.721 1.00 180.92 ? -69 DA  J C2    1 
ATOM   9120  N  N3    . DA  J 6 4   ? -8.144  43.570 -85.313 1.00 180.83 ? -69 DA  J N3    1 
ATOM   9121  C  C4    . DA  J 6 4   ? -8.931  44.543 -85.799 1.00 180.68 ? -69 DA  J C4    1 
ATOM   9122  P  P     . DC  J 6 5   ? -14.309 40.635 -86.826 1.00 177.99 ? -68 DC  J P     1 
ATOM   9123  O  OP1   . DC  J 6 5   ? -14.814 39.393 -87.451 1.00 178.02 ? -68 DC  J OP1   1 
ATOM   9124  O  OP2   . DC  J 6 5   ? -15.219 41.789 -86.633 1.00 177.92 ? -68 DC  J OP2   1 
ATOM   9125  O  "O5'" . DC  J 6 5   ? -13.667 40.265 -85.411 1.00 177.32 ? -68 DC  J "O5'" 1 
ATOM   9126  C  "C5'" . DC  J 6 5   ? -12.676 39.244 -85.332 1.00 176.58 ? -68 DC  J "C5'" 1 
ATOM   9127  C  "C4'" . DC  J 6 5   ? -11.856 39.372 -84.061 1.00 175.75 ? -68 DC  J "C4'" 1 
ATOM   9128  O  "O4'" . DC  J 6 5   ? -11.235 40.683 -84.002 1.00 175.57 ? -68 DC  J "O4'" 1 
ATOM   9129  C  "C3'" . DC  J 6 5   ? -12.641 39.207 -82.757 1.00 175.16 ? -68 DC  J "C3'" 1 
ATOM   9130  O  "O3'" . DC  J 6 5   ? -11.932 38.346 -81.893 1.00 174.58 ? -68 DC  J "O3'" 1 
ATOM   9131  C  "C2'" . DC  J 6 5   ? -12.704 40.631 -82.196 1.00 175.24 ? -68 DC  J "C2'" 1 
ATOM   9132  C  "C1'" . DC  J 6 5   ? -11.389 41.202 -82.704 1.00 175.24 ? -68 DC  J "C1'" 1 
ATOM   9133  N  N1    . DC  J 6 5   ? -11.327 42.707 -82.768 1.00 175.10 ? -68 DC  J N1    1 
ATOM   9134  C  C2    . DC  J 6 5   ? -10.088 43.343 -82.635 1.00 175.02 ? -68 DC  J C2    1 
ATOM   9135  O  O2    . DC  J 6 5   ? -9.074  42.653 -82.466 1.00 175.03 ? -68 DC  J O2    1 
ATOM   9136  N  N3    . DC  J 6 5   ? -10.032 44.696 -82.694 1.00 174.94 ? -68 DC  J N3    1 
ATOM   9137  C  C4    . DC  J 6 5   ? -11.145 45.402 -82.879 1.00 174.89 ? -68 DC  J C4    1 
ATOM   9138  N  N4    . DC  J 6 5   ? -11.037 46.733 -82.935 1.00 174.82 ? -68 DC  J N4    1 
ATOM   9139  C  C5    . DC  J 6 5   ? -12.420 44.776 -83.017 1.00 174.90 ? -68 DC  J C5    1 
ATOM   9140  C  C6    . DC  J 6 5   ? -12.464 43.440 -82.960 1.00 174.95 ? -68 DC  J C6    1 
ATOM   9141  P  P     . DC  J 6 6   ? -12.711 37.255 -81.031 1.00 174.01 ? -67 DC  J P     1 
ATOM   9142  O  OP1   . DC  J 6 6   ? -12.772 36.009 -81.826 1.00 173.95 ? -67 DC  J OP1   1 
ATOM   9143  O  OP2   . DC  J 6 6   ? -13.957 37.878 -80.528 1.00 173.91 ? -67 DC  J OP2   1 
ATOM   9144  O  "O5'" . DC  J 6 6   ? -11.730 37.032 -79.789 1.00 173.72 ? -67 DC  J "O5'" 1 
ATOM   9145  C  "C5'" . DC  J 6 6   ? -10.315 37.035 -79.990 1.00 173.42 ? -67 DC  J "C5'" 1 
ATOM   9146  C  "C4'" . DC  J 6 6   ? -9.587  37.672 -78.812 1.00 173.14 ? -67 DC  J "C4'" 1 
ATOM   9147  O  "O4'" . DC  J 6 6   ? -9.412  39.092 -79.052 1.00 173.17 ? -67 DC  J "O4'" 1 
ATOM   9148  C  "C3'" . DC  J 6 6   ? -10.280 37.548 -77.450 1.00 172.83 ? -67 DC  J "C3'" 1 
ATOM   9149  O  "O3'" . DC  J 6 6   ? -9.326  37.207 -76.454 1.00 172.41 ? -67 DC  J "O3'" 1 
ATOM   9150  C  "C2'" . DC  J 6 6   ? -10.853 38.943 -77.218 1.00 172.98 ? -67 DC  J "C2'" 1 
ATOM   9151  C  "C1'" . DC  J 6 6   ? -9.819  39.818 -77.911 1.00 173.19 ? -67 DC  J "C1'" 1 
ATOM   9152  N  N1    . DC  J 6 6   ? -10.340 41.181 -78.347 1.00 173.41 ? -67 DC  J N1    1 
ATOM   9153  C  C2    . DC  J 6 6   ? -9.520  42.028 -79.112 1.00 173.53 ? -67 DC  J C2    1 
ATOM   9154  O  O2    . DC  J 6 6   ? -8.381  41.650 -79.429 1.00 173.53 ? -67 DC  J O2    1 
ATOM   9155  N  N3    . DC  J 6 6   ? -10.001 43.246 -79.485 1.00 173.57 ? -67 DC  J N3    1 
ATOM   9156  C  C4    . DC  J 6 6   ? -11.232 43.624 -79.121 1.00 173.54 ? -67 DC  J C4    1 
ATOM   9157  N  N4    . DC  J 6 6   ? -11.661 44.828 -79.518 1.00 173.51 ? -67 DC  J N4    1 
ATOM   9158  C  C5    . DC  J 6 6   ? -12.075 42.785 -78.336 1.00 173.49 ? -67 DC  J C5    1 
ATOM   9159  C  C6    . DC  J 6 6   ? -11.597 41.589 -77.976 1.00 173.44 ? -67 DC  J C6    1 
ATOM   9160  P  P     . DC  J 6 7   ? -9.802  36.727 -75.001 1.00 172.03 ? -66 DC  J P     1 
ATOM   9161  O  OP1   . DC  J 6 7   ? -9.038  35.509 -74.652 1.00 172.01 ? -66 DC  J OP1   1 
ATOM   9162  O  OP2   . DC  J 6 7   ? -11.283 36.698 -74.974 1.00 171.89 ? -66 DC  J OP2   1 
ATOM   9163  O  "O5'" . DC  J 6 7   ? -9.311  37.929 -74.070 1.00 171.87 ? -66 DC  J "O5'" 1 
ATOM   9164  C  "C5'" . DC  J 6 7   ? -7.918  38.154 -73.886 1.00 171.69 ? -66 DC  J "C5'" 1 
ATOM   9165  C  "C4'" . DC  J 6 7   ? -7.629  39.619 -73.612 1.00 171.50 ? -66 DC  J "C4'" 1 
ATOM   9166  O  "O4'" . DC  J 6 7   ? -8.381  40.446 -74.523 1.00 171.43 ? -66 DC  J "O4'" 1 
ATOM   9167  C  "C3'" . DC  J 6 7   ? -8.046  40.114 -72.241 1.00 171.39 ? -66 DC  J "C3'" 1 
ATOM   9168  O  "O3'" . DC  J 6 7   ? -7.034  39.798 -71.269 1.00 171.25 ? -66 DC  J "O3'" 1 
ATOM   9169  C  "C2'" . DC  J 6 7   ? -8.167  41.628 -72.466 1.00 171.40 ? -66 DC  J "C2'" 1 
ATOM   9170  C  "C1'" . DC  J 6 7   ? -8.495  41.744 -73.966 1.00 171.26 ? -66 DC  J "C1'" 1 
ATOM   9171  N  N1    . DC  J 6 7   ? -9.872  42.289 -74.246 1.00 170.95 ? -66 DC  J N1    1 
ATOM   9172  C  C2    . DC  J 6 7   ? -10.040 43.662 -74.454 1.00 170.70 ? -66 DC  J C2    1 
ATOM   9173  O  O2    . DC  J 6 7   ? -9.046  44.401 -74.430 1.00 170.56 ? -66 DC  J O2    1 
ATOM   9174  N  N3    . DC  J 6 7   ? -11.289 44.143 -74.689 1.00 170.66 ? -66 DC  J N3    1 
ATOM   9175  C  C4    . DC  J 6 7   ? -12.335 43.313 -74.705 1.00 170.61 ? -66 DC  J C4    1 
ATOM   9176  N  N4    . DC  J 6 7   ? -13.545 43.832 -74.936 1.00 170.51 ? -66 DC  J N4    1 
ATOM   9177  C  C5    . DC  J 6 7   ? -12.186 41.915 -74.474 1.00 170.66 ? -66 DC  J C5    1 
ATOM   9178  C  C6    . DC  J 6 7   ? -10.951 41.451 -74.252 1.00 170.79 ? -66 DC  J C6    1 
ATOM   9179  P  P     . DT  J 6 8   ? -7.425  39.617 -69.721 1.00 171.06 ? -65 DT  J P     1 
ATOM   9180  O  OP1   . DT  J 6 8   ? -6.353  38.827 -69.065 1.00 170.98 ? -65 DT  J OP1   1 
ATOM   9181  O  OP2   . DT  J 6 8   ? -8.830  39.155 -69.655 1.00 171.04 ? -65 DT  J OP2   1 
ATOM   9182  O  "O5'" . DT  J 6 8   ? -7.378  41.117 -69.167 1.00 170.95 ? -65 DT  J "O5'" 1 
ATOM   9183  C  "C5'" . DT  J 6 8   ? -6.134  41.797 -69.067 1.00 170.84 ? -65 DT  J "C5'" 1 
ATOM   9184  C  "C4'" . DT  J 6 8   ? -6.328  43.302 -69.084 1.00 170.65 ? -65 DT  J "C4'" 1 
ATOM   9185  O  "O4'" . DT  J 6 8   ? -7.436  43.651 -69.954 1.00 170.73 ? -65 DT  J "O4'" 1 
ATOM   9186  C  "C3'" . DT  J 6 8   ? -6.634  43.936 -67.731 1.00 170.42 ? -65 DT  J "C3'" 1 
ATOM   9187  O  "O3'" . DT  J 6 8   ? -5.930  45.159 -67.626 1.00 170.07 ? -65 DT  J "O3'" 1 
ATOM   9188  C  "C2'" . DT  J 6 8   ? -8.146  44.157 -67.791 1.00 170.60 ? -65 DT  J "C2'" 1 
ATOM   9189  C  "C1'" . DT  J 6 8   ? -8.335  44.489 -69.261 1.00 170.76 ? -65 DT  J "C1'" 1 
ATOM   9190  N  N1    . DT  J 6 8   ? -9.721  44.230 -69.779 1.00 170.96 ? -65 DT  J N1    1 
ATOM   9191  C  C2    . DT  J 6 8   ? -10.353 45.206 -70.518 1.00 171.00 ? -65 DT  J C2    1 
ATOM   9192  O  O2    . DT  J 6 8   ? -9.861  46.299 -70.740 1.00 170.97 ? -65 DT  J O2    1 
ATOM   9193  N  N3    . DT  J 6 8   ? -11.599 44.860 -70.977 1.00 171.03 ? -65 DT  J N3    1 
ATOM   9194  C  C4    . DT  J 6 8   ? -12.263 43.662 -70.776 1.00 170.98 ? -65 DT  J C4    1 
ATOM   9195  O  O4    . DT  J 6 8   ? -13.379 43.498 -71.265 1.00 170.99 ? -65 DT  J O4    1 
ATOM   9196  C  C5    . DT  J 6 8   ? -11.543 42.681 -69.993 1.00 170.94 ? -65 DT  J C5    1 
ATOM   9197  C  C7    . DT  J 6 8   ? -12.158 41.343 -69.708 1.00 170.87 ? -65 DT  J C7    1 
ATOM   9198  C  C6    . DT  J 6 8   ? -10.321 43.007 -69.541 1.00 170.95 ? -65 DT  J C6    1 
ATOM   9199  P  P     . DA  J 6 9   ? -5.718  45.855 -66.208 1.00 169.83 ? -64 DA  J P     1 
ATOM   9200  O  OP1   . DA  J 6 9   ? -4.294  46.244 -66.100 1.00 169.73 ? -64 DA  J OP1   1 
ATOM   9201  O  OP2   . DA  J 6 9   ? -6.331  44.996 -65.172 1.00 169.66 ? -64 DA  J OP2   1 
ATOM   9202  O  "O5'" . DA  J 6 9   ? -6.609  47.176 -66.344 1.00 170.04 ? -64 DA  J "O5'" 1 
ATOM   9203  C  "C5'" . DA  J 6 9   ? -6.868  47.740 -67.639 1.00 170.21 ? -64 DA  J "C5'" 1 
ATOM   9204  C  "C4'" . DA  J 6 9   ? -8.082  48.664 -67.617 1.00 170.40 ? -64 DA  J "C4'" 1 
ATOM   9205  O  "O4'" . DA  J 6 9   ? -9.244  47.970 -68.146 1.00 170.43 ? -64 DA  J "O4'" 1 
ATOM   9206  C  "C3'" . DA  J 6 9   ? -8.491  49.200 -66.239 1.00 170.55 ? -64 DA  J "C3'" 1 
ATOM   9207  O  "O3'" . DA  J 6 9   ? -8.728  50.589 -66.322 1.00 170.71 ? -64 DA  J "O3'" 1 
ATOM   9208  C  "C2'" . DA  J 6 9   ? -9.772  48.427 -65.918 1.00 170.49 ? -64 DA  J "C2'" 1 
ATOM   9209  C  "C1'" . DA  J 6 9   ? -10.351 48.191 -67.299 1.00 170.41 ? -64 DA  J "C1'" 1 
ATOM   9210  N  N9    . DA  J 6 9   ? -11.223 47.023 -67.358 1.00 170.28 ? -64 DA  J N9    1 
ATOM   9211  C  C8    . DA  J 6 9   ? -11.082 45.855 -66.661 1.00 170.20 ? -64 DA  J C8    1 
ATOM   9212  N  N7    . DA  J 6 9   ? -12.024 44.977 -66.905 1.00 170.18 ? -64 DA  J N7    1 
ATOM   9213  C  C5    . DA  J 6 9   ? -12.857 45.626 -67.799 1.00 170.23 ? -64 DA  J C5    1 
ATOM   9214  C  C6    . DA  J 6 9   ? -14.052 45.239 -68.433 1.00 170.28 ? -64 DA  J C6    1 
ATOM   9215  N  N6    . DA  J 6 9   ? -14.619 44.040 -68.263 1.00 170.30 ? -64 DA  J N6    1 
ATOM   9216  N  N1    . DA  J 6 9   ? -14.631 46.123 -69.271 1.00 170.31 ? -64 DA  J N1    1 
ATOM   9217  C  C2    . DA  J 6 9   ? -14.052 47.317 -69.447 1.00 170.33 ? -64 DA  J C2    1 
ATOM   9218  N  N3    . DA  J 6 9   ? -12.937 47.797 -68.900 1.00 170.31 ? -64 DA  J N3    1 
ATOM   9219  C  C4    . DA  J 6 9   ? -12.385 46.894 -68.077 1.00 170.27 ? -64 DA  J C4    1 
ATOM   9220  P  P     . DA  J 6 10  ? -8.790  51.490 -65.001 1.00 170.84 ? -63 DA  J P     1 
ATOM   9221  O  OP1   . DA  J 6 10  ? -7.685  52.472 -65.073 1.00 170.76 ? -63 DA  J OP1   1 
ATOM   9222  O  OP2   . DA  J 6 10  ? -8.911  50.600 -63.825 1.00 170.68 ? -63 DA  J OP2   1 
ATOM   9223  O  "O5'" . DA  J 6 10  ? -10.179 52.254 -65.180 1.00 171.39 ? -63 DA  J "O5'" 1 
ATOM   9224  C  "C5'" . DA  J 6 10  ? -10.816 52.283 -66.461 1.00 172.01 ? -63 DA  J "C5'" 1 
ATOM   9225  C  "C4'" . DA  J 6 10  ? -12.332 52.311 -66.334 1.00 172.69 ? -63 DA  J "C4'" 1 
ATOM   9226  O  "O4'" . DA  J 6 10  ? -12.879 51.017 -66.693 1.00 172.88 ? -63 DA  J "O4'" 1 
ATOM   9227  C  "C3'" . DA  J 6 10  ? -12.885 52.633 -64.932 1.00 173.19 ? -63 DA  J "C3'" 1 
ATOM   9228  O  "O3'" . DA  J 6 10  ? -13.754 53.759 -64.994 1.00 173.74 ? -63 DA  J "O3'" 1 
ATOM   9229  C  "C2'" . DA  J 6 10  ? -13.639 51.360 -64.541 1.00 173.13 ? -63 DA  J "C2'" 1 
ATOM   9230  C  "C1'" . DA  J 6 10  ? -14.009 50.797 -65.896 1.00 173.10 ? -63 DA  J "C1'" 1 
ATOM   9231  N  N9    . DA  J 6 10  ? -14.311 49.375 -65.857 1.00 173.29 ? -63 DA  J N9    1 
ATOM   9232  C  C8    . DA  J 6 10  ? -13.713 48.435 -65.068 1.00 173.37 ? -63 DA  J C8    1 
ATOM   9233  N  N7    . DA  J 6 10  ? -14.248 47.244 -65.165 1.00 173.45 ? -63 DA  J N7    1 
ATOM   9234  C  C5    . DA  J 6 10  ? -15.303 47.426 -66.043 1.00 173.51 ? -63 DA  J C5    1 
ATOM   9235  C  C6    . DA  J 6 10  ? -16.269 46.542 -66.561 1.00 173.61 ? -63 DA  J C6    1 
ATOM   9236  N  N6    . DA  J 6 10  ? -16.320 45.245 -66.243 1.00 173.71 ? -63 DA  J N6    1 
ATOM   9237  N  N1    . DA  J 6 10  ? -17.181 47.044 -67.419 1.00 173.55 ? -63 DA  J N1    1 
ATOM   9238  C  C2    . DA  J 6 10  ? -17.124 48.342 -67.729 1.00 173.47 ? -63 DA  J C2    1 
ATOM   9239  N  N3    . DA  J 6 10  ? -16.267 49.270 -67.307 1.00 173.43 ? -63 DA  J N3    1 
ATOM   9240  C  C4    . DA  J 6 10  ? -15.375 48.741 -66.456 1.00 173.41 ? -63 DA  J C4    1 
ATOM   9241  P  P     . DC  J 6 11  ? -14.131 54.575 -63.663 1.00 174.22 ? -62 DC  J P     1 
ATOM   9242  O  OP1   . DC  J 6 11  ? -13.671 55.973 -63.844 1.00 174.20 ? -62 DC  J OP1   1 
ATOM   9243  O  OP2   . DC  J 6 11  ? -13.666 53.799 -62.489 1.00 174.24 ? -62 DC  J OP2   1 
ATOM   9244  O  "O5'" . DC  J 6 11  ? -15.738 54.536 -63.674 1.00 174.61 ? -62 DC  J "O5'" 1 
ATOM   9245  C  "C5'" . DC  J 6 11  ? -16.465 55.385 -64.561 1.00 174.98 ? -62 DC  J "C5'" 1 
ATOM   9246  C  "C4'" . DC  J 6 11  ? -17.655 54.665 -65.190 1.00 175.34 ? -62 DC  J "C4'" 1 
ATOM   9247  O  "O4'" . DC  J 6 11  ? -17.258 53.356 -65.672 1.00 175.52 ? -62 DC  J "O4'" 1 
ATOM   9248  C  "C3'" . DC  J 6 11  ? -18.811 54.353 -64.263 1.00 175.51 ? -62 DC  J "C3'" 1 
ATOM   9249  O  "O3'" . DC  J 6 11  ? -19.615 55.511 -64.023 1.00 175.56 ? -62 DC  J "O3'" 1 
ATOM   9250  C  "C2'" . DC  J 6 11  ? -19.560 53.313 -65.090 1.00 175.59 ? -62 DC  J "C2'" 1 
ATOM   9251  C  "C1'" . DC  J 6 11  ? -18.416 52.526 -65.738 1.00 175.64 ? -62 DC  J "C1'" 1 
ATOM   9252  N  N1    . DC  J 6 11  ? -18.136 51.213 -65.055 1.00 175.79 ? -62 DC  J N1    1 
ATOM   9253  C  C2    . DC  J 6 11  ? -18.931 50.095 -65.347 1.00 175.80 ? -62 DC  J C2    1 
ATOM   9254  O  O2    . DC  J 6 11  ? -19.809 50.184 -66.214 1.00 175.76 ? -62 DC  J O2    1 
ATOM   9255  N  N3    . DC  J 6 11  ? -18.667 48.922 -64.716 1.00 175.88 ? -62 DC  J N3    1 
ATOM   9256  C  C4    . DC  J 6 11  ? -17.697 48.858 -63.803 1.00 175.97 ? -62 DC  J C4    1 
ATOM   9257  N  N4    . DC  J 6 11  ? -17.478 47.687 -63.202 1.00 175.92 ? -62 DC  J N4    1 
ATOM   9258  C  C5    . DC  J 6 11  ? -16.901 49.990 -63.472 1.00 175.95 ? -62 DC  J C5    1 
ATOM   9259  C  C6    . DC  J 6 11  ? -17.168 51.139 -64.098 1.00 175.88 ? -62 DC  J C6    1 
ATOM   9260  P  P     . DC  J 6 12  ? -20.335 55.692 -62.600 1.00 175.55 ? -61 DC  J P     1 
ATOM   9261  O  OP1   . DC  J 6 12  ? -20.856 57.077 -62.526 1.00 175.59 ? -61 DC  J OP1   1 
ATOM   9262  O  OP2   . DC  J 6 12  ? -19.408 55.196 -61.557 1.00 175.59 ? -61 DC  J OP2   1 
ATOM   9263  O  "O5'" . DC  J 6 12  ? -21.571 54.673 -62.685 1.00 175.36 ? -61 DC  J "O5'" 1 
ATOM   9264  C  "C5'" . DC  J 6 12  ? -22.566 54.837 -63.694 1.00 175.15 ? -61 DC  J "C5'" 1 
ATOM   9265  C  "C4'" . DC  J 6 12  ? -23.385 53.566 -63.866 1.00 174.93 ? -61 DC  J "C4'" 1 
ATOM   9266  O  "O4'" . DC  J 6 12  ? -22.521 52.482 -64.290 1.00 174.96 ? -61 DC  J "O4'" 1 
ATOM   9267  C  "C3'" . DC  J 6 12  ? -24.034 53.045 -62.602 1.00 174.67 ? -61 DC  J "C3'" 1 
ATOM   9268  O  "O3'" . DC  J 6 12  ? -25.256 53.722 -62.359 1.00 174.22 ? -61 DC  J "O3'" 1 
ATOM   9269  C  "C2'" . DC  J 6 12  ? -24.262 51.580 -62.959 1.00 174.83 ? -61 DC  J "C2'" 1 
ATOM   9270  C  "C1'" . DC  J 6 12  ? -23.012 51.252 -63.779 1.00 174.98 ? -61 DC  J "C1'" 1 
ATOM   9271  N  N1    . DC  J 6 12  ? -21.927 50.575 -62.980 1.00 175.08 ? -61 DC  J N1    1 
ATOM   9272  C  C2    . DC  J 6 12  ? -21.958 49.185 -62.820 1.00 175.16 ? -61 DC  J C2    1 
ATOM   9273  O  O2    . DC  J 6 12  ? -22.864 48.535 -63.362 1.00 175.17 ? -61 DC  J O2    1 
ATOM   9274  N  N3    . DC  J 6 12  ? -20.982 48.588 -62.086 1.00 175.11 ? -61 DC  J N3    1 
ATOM   9275  C  C4    . DC  J 6 12  ? -20.021 49.324 -61.523 1.00 175.05 ? -61 DC  J C4    1 
ATOM   9276  N  N4    . DC  J 6 12  ? -19.084 48.691 -60.809 1.00 174.98 ? -61 DC  J N4    1 
ATOM   9277  C  C5    . DC  J 6 12  ? -19.980 50.740 -61.664 1.00 175.02 ? -61 DC  J C5    1 
ATOM   9278  C  C6    . DC  J 6 12  ? -20.940 51.318 -62.393 1.00 175.06 ? -61 DC  J C6    1 
ATOM   9279  P  P     . DC  J 6 13  ? -25.538 54.345 -60.914 1.00 173.77 ? -60 DC  J P     1 
ATOM   9280  O  OP1   . DC  J 6 13  ? -26.533 55.431 -61.074 1.00 173.90 ? -60 DC  J OP1   1 
ATOM   9281  O  OP2   . DC  J 6 13  ? -24.230 54.626 -60.278 1.00 173.78 ? -60 DC  J OP2   1 
ATOM   9282  O  "O5'" . DC  J 6 13  ? -26.218 53.131 -60.128 1.00 173.03 ? -60 DC  J "O5'" 1 
ATOM   9283  C  "C5'" . DC  J 6 13  ? -27.246 52.371 -60.750 1.00 172.25 ? -60 DC  J "C5'" 1 
ATOM   9284  C  "C4'" . DC  J 6 13  ? -27.196 50.926 -60.294 1.00 171.43 ? -60 DC  J "C4'" 1 
ATOM   9285  O  "O4'" . DC  J 6 13  ? -25.824 50.438 -60.347 1.00 171.32 ? -60 DC  J "O4'" 1 
ATOM   9286  C  "C3'" . DC  J 6 13  ? -27.679 50.691 -58.863 1.00 170.73 ? -60 DC  J "C3'" 1 
ATOM   9287  O  "O3'" . DC  J 6 13  ? -28.526 49.561 -58.828 1.00 169.79 ? -60 DC  J "O3'" 1 
ATOM   9288  C  "C2'" . DC  J 6 13  ? -26.382 50.447 -58.093 1.00 170.97 ? -60 DC  J "C2'" 1 
ATOM   9289  C  "C1'" . DC  J 6 13  ? -25.526 49.767 -59.149 1.00 171.18 ? -60 DC  J "C1'" 1 
ATOM   9290  N  N1    . DC  J 6 13  ? -24.028 49.838 -58.888 1.00 171.13 ? -60 DC  J N1    1 
ATOM   9291  C  C2    . DC  J 6 13  ? -23.206 48.772 -59.284 1.00 171.13 ? -60 DC  J C2    1 
ATOM   9292  O  O2    . DC  J 6 13  ? -23.714 47.798 -59.858 1.00 171.13 ? -60 DC  J O2    1 
ATOM   9293  N  N3    . DC  J 6 13  ? -21.877 48.827 -59.009 1.00 171.01 ? -60 DC  J N3    1 
ATOM   9294  C  C4    . DC  J 6 13  ? -21.369 49.883 -58.374 1.00 170.95 ? -60 DC  J C4    1 
ATOM   9295  N  N4    . DC  J 6 13  ? -20.055 49.894 -58.136 1.00 170.84 ? -60 DC  J N4    1 
ATOM   9296  C  C5    . DC  J 6 13  ? -22.186 50.974 -57.954 1.00 170.97 ? -60 DC  J C5    1 
ATOM   9297  C  C6    . DC  J 6 13  ? -23.494 50.912 -58.227 1.00 171.08 ? -60 DC  J C6    1 
ATOM   9298  P  P     . DT  J 6 14  ? -29.740 49.489 -57.789 1.00 168.95 ? -59 DT  J P     1 
ATOM   9299  O  OP1   . DT  J 6 14  ? -30.937 50.052 -58.445 1.00 168.88 ? -59 DT  J OP1   1 
ATOM   9300  O  OP2   . DT  J 6 14  ? -29.278 50.040 -56.495 1.00 168.89 ? -59 DT  J OP2   1 
ATOM   9301  O  "O5'" . DT  J 6 14  ? -29.940 47.915 -57.611 1.00 168.42 ? -59 DT  J "O5'" 1 
ATOM   9302  C  "C5'" . DT  J 6 14  ? -29.482 47.023 -58.630 1.00 167.87 ? -59 DT  J "C5'" 1 
ATOM   9303  C  "C4'" . DT  J 6 14  ? -28.556 45.961 -58.054 1.00 167.28 ? -59 DT  J "C4'" 1 
ATOM   9304  O  "O4'" . DT  J 6 14  ? -27.249 46.537 -57.798 1.00 167.29 ? -59 DT  J "O4'" 1 
ATOM   9305  C  "C3'" . DT  J 6 14  ? -29.022 45.330 -56.741 1.00 166.64 ? -59 DT  J "C3'" 1 
ATOM   9306  O  "O3'" . DT  J 6 14  ? -28.892 43.918 -56.807 1.00 165.63 ? -59 DT  J "O3'" 1 
ATOM   9307  C  "C2'" . DT  J 6 14  ? -28.096 45.936 -55.686 1.00 166.96 ? -59 DT  J "C2'" 1 
ATOM   9308  C  "C1'" . DT  J 6 14  ? -26.830 46.219 -56.488 1.00 167.26 ? -59 DT  J "C1'" 1 
ATOM   9309  N  N1    . DT  J 6 14  ? -26.008 47.370 -55.963 1.00 167.46 ? -59 DT  J N1    1 
ATOM   9310  C  C2    . DT  J 6 14  ? -24.669 47.415 -56.265 1.00 167.55 ? -59 DT  J C2    1 
ATOM   9311  O  O2    . DT  J 6 14  ? -24.105 46.548 -56.911 1.00 167.52 ? -59 DT  J O2    1 
ATOM   9312  N  N3    . DT  J 6 14  ? -24.004 48.509 -55.769 1.00 167.57 ? -59 DT  J N3    1 
ATOM   9313  C  C4    . DT  J 6 14  ? -24.538 49.545 -55.015 1.00 167.59 ? -59 DT  J C4    1 
ATOM   9314  O  O4    . DT  J 6 14  ? -23.809 50.462 -54.646 1.00 167.56 ? -59 DT  J O4    1 
ATOM   9315  C  C5    . DT  J 6 14  ? -25.954 49.437 -54.731 1.00 167.54 ? -59 DT  J C5    1 
ATOM   9316  C  C7    . DT  J 6 14  ? -26.653 50.503 -53.936 1.00 167.50 ? -59 DT  J C7    1 
ATOM   9317  C  C6    . DT  J 6 14  ? -26.613 48.372 -55.217 1.00 167.55 ? -59 DT  J C6    1 
ATOM   9318  P  P     . DA  J 6 15  ? -29.769 42.984 -55.844 1.00 164.59 ? -58 DA  J P     1 
ATOM   9319  O  OP1   . DA  J 6 15  ? -30.360 41.904 -56.671 1.00 164.57 ? -58 DA  J OP1   1 
ATOM   9320  O  OP2   . DA  J 6 15  ? -30.648 43.854 -55.023 1.00 164.62 ? -58 DA  J OP2   1 
ATOM   9321  O  "O5'" . DA  J 6 15  ? -28.663 42.355 -54.879 1.00 163.33 ? -58 DA  J "O5'" 1 
ATOM   9322  C  "C5'" . DA  J 6 15  ? -27.470 41.805 -55.437 1.00 161.97 ? -58 DA  J "C5'" 1 
ATOM   9323  C  "C4'" . DA  J 6 15  ? -26.357 41.692 -54.400 1.00 160.57 ? -58 DA  J "C4'" 1 
ATOM   9324  O  "O4'" . DA  J 6 15  ? -25.445 42.815 -54.541 1.00 160.18 ? -58 DA  J "O4'" 1 
ATOM   9325  C  "C3'" . DA  J 6 15  ? -26.783 41.760 -52.941 1.00 159.46 ? -58 DA  J "C3'" 1 
ATOM   9326  O  "O3'" . DA  J 6 15  ? -27.279 40.496 -52.478 1.00 158.03 ? -58 DA  J "O3'" 1 
ATOM   9327  C  "C2'" . DA  J 6 15  ? -25.464 42.123 -52.275 1.00 159.64 ? -58 DA  J "C2'" 1 
ATOM   9328  C  "C1'" . DA  J 6 15  ? -24.838 43.082 -53.283 1.00 159.73 ? -58 DA  J "C1'" 1 
ATOM   9329  N  N9    . DA  J 6 15  ? -25.048 44.480 -52.926 1.00 159.38 ? -58 DA  J N9    1 
ATOM   9330  C  C8    . DA  J 6 15  ? -26.212 45.051 -52.490 1.00 159.26 ? -58 DA  J C8    1 
ATOM   9331  N  N7    . DA  J 6 15  ? -26.090 46.306 -52.149 1.00 159.20 ? -58 DA  J N7    1 
ATOM   9332  C  C5    . DA  J 6 15  ? -24.744 46.564 -52.324 1.00 159.14 ? -58 DA  J C5    1 
ATOM   9333  C  C6    . DA  J 6 15  ? -23.976 47.725 -52.147 1.00 159.09 ? -58 DA  J C6    1 
ATOM   9334  N  N6    . DA  J 6 15  ? -24.480 48.882 -51.707 1.00 159.09 ? -58 DA  J N6    1 
ATOM   9335  N  N1    . DA  J 6 15  ? -22.655 47.644 -52.408 1.00 159.06 ? -58 DA  J N1    1 
ATOM   9336  C  C2    . DA  J 6 15  ? -22.152 46.480 -52.830 1.00 159.05 ? -58 DA  J C2    1 
ATOM   9337  N  N3    . DA  J 6 15  ? -22.778 45.328 -53.051 1.00 159.09 ? -58 DA  J N3    1 
ATOM   9338  C  C4    . DA  J 6 15  ? -24.083 45.438 -52.769 1.00 159.18 ? -58 DA  J C4    1 
ATOM   9339  P  P     . DA  J 6 16  ? -27.974 40.390 -51.029 1.00 156.55 ? -57 DA  J P     1 
ATOM   9340  O  OP1   . DA  J 6 16  ? -29.039 39.365 -51.102 1.00 156.59 ? -57 DA  J OP1   1 
ATOM   9341  O  OP2   . DA  J 6 16  ? -28.301 41.764 -50.569 1.00 156.51 ? -57 DA  J OP2   1 
ATOM   9342  O  "O5'" . DA  J 6 16  ? -26.790 39.829 -50.111 1.00 154.98 ? -57 DA  J "O5'" 1 
ATOM   9343  C  "C5'" . DA  J 6 16  ? -25.950 38.791 -50.599 1.00 153.35 ? -57 DA  J "C5'" 1 
ATOM   9344  C  "C4'" . DA  J 6 16  ? -24.521 38.965 -50.112 1.00 151.76 ? -57 DA  J "C4'" 1 
ATOM   9345  O  "O4'" . DA  J 6 16  ? -24.052 40.318 -50.369 1.00 151.56 ? -57 DA  J "O4'" 1 
ATOM   9346  C  "C3'" . DA  J 6 16  ? -24.298 38.720 -48.624 1.00 150.35 ? -57 DA  J "C3'" 1 
ATOM   9347  O  "O3'" . DA  J 6 16  ? -23.067 38.054 -48.460 1.00 148.49 ? -57 DA  J "O3'" 1 
ATOM   9348  C  "C2'" . DA  J 6 16  ? -24.235 40.138 -48.057 1.00 150.82 ? -57 DA  J "C2'" 1 
ATOM   9349  C  "C1'" . DA  J 6 16  ? -23.516 40.861 -49.182 1.00 151.29 ? -57 DA  J "C1'" 1 
ATOM   9350  N  N9    . DA  J 6 16  ? -23.713 42.317 -49.177 1.00 151.66 ? -57 DA  J N9    1 
ATOM   9351  C  C8    . DA  J 6 16  ? -24.882 42.994 -48.945 1.00 151.72 ? -57 DA  J C8    1 
ATOM   9352  N  N7    . DA  J 6 16  ? -24.756 44.301 -48.974 1.00 151.77 ? -57 DA  J N7    1 
ATOM   9353  C  C5    . DA  J 6 16  ? -23.404 44.499 -49.193 1.00 151.80 ? -57 DA  J C5    1 
ATOM   9354  C  C6    . DA  J 6 16  ? -22.625 45.666 -49.313 1.00 151.85 ? -57 DA  J C6    1 
ATOM   9355  N  N6    . DA  J 6 16  ? -23.133 46.899 -49.212 1.00 151.85 ? -57 DA  J N6    1 
ATOM   9356  N  N1    . DA  J 6 16  ? -21.296 45.516 -49.513 1.00 151.84 ? -57 DA  J N1    1 
ATOM   9357  C  C2    . DA  J 6 16  ? -20.794 44.278 -49.611 1.00 151.79 ? -57 DA  J C2    1 
ATOM   9358  N  N3    . DA  J 6 16  ? -21.425 43.107 -49.521 1.00 151.77 ? -57 DA  J N3    1 
ATOM   9359  C  C4    . DA  J 6 16  ? -22.741 43.289 -49.307 1.00 151.73 ? -57 DA  J C4    1 
ATOM   9360  P  P     . DC  J 6 17  ? -22.806 37.127 -47.189 1.00 146.65 ? -56 DC  J P     1 
ATOM   9361  O  OP1   . DC  J 6 17  ? -22.869 35.719 -47.638 1.00 146.70 ? -56 DC  J OP1   1 
ATOM   9362  O  OP2   . DC  J 6 17  ? -23.684 37.591 -46.088 1.00 146.56 ? -56 DC  J OP2   1 
ATOM   9363  O  "O5'" . DC  J 6 17  ? -21.291 37.485 -46.807 1.00 144.91 ? -56 DC  J "O5'" 1 
ATOM   9364  C  "C5'" . DC  J 6 17  ? -20.463 38.209 -47.731 1.00 143.18 ? -56 DC  J "C5'" 1 
ATOM   9365  C  "C4'" . DC  J 6 17  ? -19.607 39.251 -47.018 1.00 141.49 ? -56 DC  J "C4'" 1 
ATOM   9366  O  "O4'" . DC  J 6 17  ? -20.300 40.530 -46.992 1.00 141.20 ? -56 DC  J "O4'" 1 
ATOM   9367  C  "C3'" . DC  J 6 17  ? -19.243 38.936 -45.563 1.00 140.13 ? -56 DC  J "C3'" 1 
ATOM   9368  O  "O3'" . DC  J 6 17  ? -17.911 39.344 -45.316 1.00 138.36 ? -56 DC  J "O3'" 1 
ATOM   9369  C  "C2'" . DC  J 6 17  ? -20.232 39.792 -44.774 1.00 140.54 ? -56 DC  J "C2'" 1 
ATOM   9370  C  "C1'" . DC  J 6 17  ? -20.333 41.020 -45.667 1.00 140.97 ? -56 DC  J "C1'" 1 
ATOM   9371  N  N1    . DC  J 6 17  ? -21.592 41.845 -45.475 1.00 141.19 ? -56 DC  J N1    1 
ATOM   9372  C  C2    . DC  J 6 17  ? -21.581 43.199 -45.827 1.00 141.45 ? -56 DC  J C2    1 
ATOM   9373  O  O2    . DC  J 6 17  ? -20.543 43.692 -46.290 1.00 141.60 ? -56 DC  J O2    1 
ATOM   9374  N  N3    . DC  J 6 17  ? -22.712 43.934 -45.662 1.00 141.37 ? -56 DC  J N3    1 
ATOM   9375  C  C4    . DC  J 6 17  ? -23.811 43.368 -45.164 1.00 141.27 ? -56 DC  J C4    1 
ATOM   9376  N  N4    . DC  J 6 17  ? -24.897 44.133 -45.022 1.00 141.17 ? -56 DC  J N4    1 
ATOM   9377  C  C5    . DC  J 6 17  ? -23.843 41.992 -44.789 1.00 141.18 ? -56 DC  J C5    1 
ATOM   9378  C  C6    . DC  J 6 17  ? -22.724 41.276 -44.956 1.00 141.20 ? -56 DC  J C6    1 
ATOM   9379  P  P     . DC  J 6 18  ? -16.998 38.582 -44.248 1.00 136.63 ? -55 DC  J P     1 
ATOM   9380  O  OP1   . DC  J 6 18  ? -16.378 37.427 -44.928 1.00 136.51 ? -55 DC  J OP1   1 
ATOM   9381  O  OP2   . DC  J 6 18  ? -17.783 38.383 -43.007 1.00 136.36 ? -55 DC  J OP2   1 
ATOM   9382  O  "O5'" . DC  J 6 18  ? -15.869 39.666 -43.945 1.00 135.54 ? -55 DC  J "O5'" 1 
ATOM   9383  C  "C5'" . DC  J 6 18  ? -15.545 40.642 -44.933 1.00 134.52 ? -55 DC  J "C5'" 1 
ATOM   9384  C  "C4'" . DC  J 6 18  ? -15.445 42.028 -44.321 1.00 133.48 ? -55 DC  J "C4'" 1 
ATOM   9385  O  "O4'" . DC  J 6 18  ? -16.771 42.611 -44.198 1.00 133.15 ? -55 DC  J "O4'" 1 
ATOM   9386  C  "C3'" . DC  J 6 18  ? -14.814 42.082 -42.926 1.00 132.88 ? -55 DC  J "C3'" 1 
ATOM   9387  O  "O3'" . DC  J 6 18  ? -13.837 43.114 -42.891 1.00 132.18 ? -55 DC  J "O3'" 1 
ATOM   9388  C  "C2'" . DC  J 6 18  ? -16.002 42.387 -42.008 1.00 132.94 ? -55 DC  J "C2'" 1 
ATOM   9389  C  "C1'" . DC  J 6 18  ? -16.908 43.193 -42.925 1.00 133.00 ? -55 DC  J "C1'" 1 
ATOM   9390  N  N1    . DC  J 6 18  ? -18.350 43.153 -42.530 1.00 133.00 ? -55 DC  J N1    1 
ATOM   9391  C  C2    . DC  J 6 18  ? -19.085 44.340 -42.488 1.00 133.08 ? -55 DC  J C2    1 
ATOM   9392  O  O2    . DC  J 6 18  ? -18.532 45.403 -42.805 1.00 133.06 ? -55 DC  J O2    1 
ATOM   9393  N  N3    . DC  J 6 18  ? -20.397 44.289 -42.124 1.00 133.12 ? -55 DC  J N3    1 
ATOM   9394  C  C4    . DC  J 6 18  ? -20.956 43.120 -41.794 1.00 133.08 ? -55 DC  J C4    1 
ATOM   9395  N  N4    . DC  J 6 18  ? -22.247 43.116 -41.443 1.00 132.93 ? -55 DC  J N4    1 
ATOM   9396  C  C5    . DC  J 6 18  ? -20.214 41.905 -41.811 1.00 133.05 ? -55 DC  J C5    1 
ATOM   9397  C  C6    . DC  J 6 18  ? -18.927 41.968 -42.175 1.00 133.07 ? -55 DC  J C6    1 
ATOM   9398  P  P     . DC  J 6 19  ? -12.689 43.138 -41.778 1.00 131.57 ? -54 DC  J P     1 
ATOM   9399  O  OP1   . DC  J 6 19  ? -11.418 42.773 -42.433 1.00 131.36 ? -54 DC  J OP1   1 
ATOM   9400  O  OP2   . DC  J 6 19  ? -13.155 42.387 -40.594 1.00 131.34 ? -54 DC  J OP2   1 
ATOM   9401  O  "O5'" . DC  J 6 19  ? -12.651 44.683 -41.390 1.00 132.05 ? -54 DC  J "O5'" 1 
ATOM   9402  C  "C5'" . DC  J 6 19  ? -12.960 45.660 -42.385 1.00 132.60 ? -54 DC  J "C5'" 1 
ATOM   9403  C  "C4'" . DC  J 6 19  ? -13.838 46.774 -41.830 1.00 133.17 ? -54 DC  J "C4'" 1 
ATOM   9404  O  "O4'" . DC  J 6 19  ? -15.165 46.281 -41.514 1.00 133.38 ? -54 DC  J "O4'" 1 
ATOM   9405  C  "C3'" . DC  J 6 19  ? -13.323 47.477 -40.579 1.00 133.56 ? -54 DC  J "C3'" 1 
ATOM   9406  O  "O3'" . DC  J 6 19  ? -13.271 48.866 -40.818 1.00 133.97 ? -54 DC  J "O3'" 1 
ATOM   9407  C  "C2'" . DC  J 6 19  ? -14.362 47.129 -39.502 1.00 133.53 ? -54 DC  J "C2'" 1 
ATOM   9408  C  "C1'" . DC  J 6 19  ? -15.617 46.905 -40.333 1.00 133.46 ? -54 DC  J "C1'" 1 
ATOM   9409  N  N1    . DC  J 6 19  ? -16.642 46.010 -39.674 1.00 133.32 ? -54 DC  J N1    1 
ATOM   9410  C  C2    . DC  J 6 19  ? -17.956 46.466 -39.497 1.00 133.21 ? -54 DC  J C2    1 
ATOM   9411  O  O2    . DC  J 6 19  ? -18.257 47.607 -39.865 1.00 133.19 ? -54 DC  J O2    1 
ATOM   9412  N  N3    . DC  J 6 19  ? -18.866 45.637 -38.931 1.00 133.12 ? -54 DC  J N3    1 
ATOM   9413  C  C4    . DC  J 6 19  ? -18.507 44.411 -38.548 1.00 133.13 ? -54 DC  J C4    1 
ATOM   9414  N  N4    . DC  J 6 19  ? -19.441 43.632 -37.999 1.00 133.12 ? -54 DC  J N4    1 
ATOM   9415  C  C5    . DC  J 6 19  ? -17.178 43.927 -38.721 1.00 133.18 ? -54 DC  J C5    1 
ATOM   9416  C  C6    . DC  J 6 19  ? -16.286 44.754 -39.273 1.00 133.27 ? -54 DC  J C6    1 
ATOM   9417  P  P     . DT  J 6 20  ? -12.139 49.748 -40.128 1.00 134.35 ? -53 DT  J P     1 
ATOM   9418  O  OP1   . DT  J 6 20  ? -11.812 50.859 -41.058 1.00 134.27 ? -53 DT  J OP1   1 
ATOM   9419  O  OP2   . DT  J 6 20  ? -11.071 48.836 -39.665 1.00 134.40 ? -53 DT  J OP2   1 
ATOM   9420  O  "O5'" . DT  J 6 20  ? -12.886 50.320 -38.830 1.00 134.84 ? -53 DT  J "O5'" 1 
ATOM   9421  C  "C5'" . DT  J 6 20  ? -13.795 51.397 -38.955 1.00 135.39 ? -53 DT  J "C5'" 1 
ATOM   9422  C  "C4'" . DT  J 6 20  ? -14.933 51.281 -37.962 1.00 135.95 ? -53 DT  J "C4'" 1 
ATOM   9423  O  "O4'" . DT  J 6 20  ? -15.413 49.919 -37.875 1.00 136.06 ? -53 DT  J "O4'" 1 
ATOM   9424  C  "C3'" . DT  J 6 20  ? -14.613 51.707 -36.521 1.00 136.47 ? -53 DT  J "C3'" 1 
ATOM   9425  O  "O3'" . DT  J 6 20  ? -15.455 52.795 -36.170 1.00 137.19 ? -53 DT  J "O3'" 1 
ATOM   9426  C  "C2'" . DT  J 6 20  ? -14.959 50.456 -35.695 1.00 136.35 ? -53 DT  J "C2'" 1 
ATOM   9427  C  "C1'" . DT  J 6 20  ? -15.971 49.787 -36.604 1.00 136.21 ? -53 DT  J "C1'" 1 
ATOM   9428  N  N1    . DT  J 6 20  ? -16.241 48.351 -36.301 1.00 136.51 ? -53 DT  J N1    1 
ATOM   9429  C  C2    . DT  J 6 20  ? -17.546 47.944 -36.125 1.00 136.51 ? -53 DT  J C2    1 
ATOM   9430  O  O2    . DT  J 6 20  ? -18.500 48.684 -36.274 1.00 136.35 ? -53 DT  J O2    1 
ATOM   9431  N  N3    . DT  J 6 20  ? -17.698 46.623 -35.801 1.00 136.70 ? -53 DT  J N3    1 
ATOM   9432  C  C4    . DT  J 6 20  ? -16.696 45.688 -35.607 1.00 136.82 ? -53 DT  J C4    1 
ATOM   9433  O  O4    . DT  J 6 20  ? -16.994 44.532 -35.320 1.00 136.82 ? -53 DT  J O4    1 
ATOM   9434  C  C5    . DT  J 6 20  ? -15.348 46.183 -35.778 1.00 136.82 ? -53 DT  J C5    1 
ATOM   9435  C  C7    . DT  J 6 20  ? -14.178 45.259 -35.598 1.00 136.85 ? -53 DT  J C7    1 
ATOM   9436  C  C6    . DT  J 6 20  ? -15.186 47.485 -36.084 1.00 136.69 ? -53 DT  J C6    1 
ATOM   9437  P  P     . DA  J 6 21  ? -14.908 54.019 -35.297 1.00 137.78 ? -52 DA  J P     1 
ATOM   9438  O  OP1   . DA  J 6 21  ? -14.068 54.863 -36.178 1.00 137.69 ? -52 DA  J OP1   1 
ATOM   9439  O  OP2   . DA  J 6 21  ? -14.352 53.473 -34.036 1.00 137.64 ? -52 DA  J OP2   1 
ATOM   9440  O  "O5'" . DA  J 6 21  ? -16.250 54.814 -34.934 1.00 138.68 ? -52 DA  J "O5'" 1 
ATOM   9441  C  "C5'" . DA  J 6 21  ? -17.483 54.464 -35.573 1.00 139.67 ? -52 DA  J "C5'" 1 
ATOM   9442  C  "C4'" . DA  J 6 21  ? -18.529 54.008 -34.562 1.00 140.68 ? -52 DA  J "C4'" 1 
ATOM   9443  O  "O4'" . DA  J 6 21  ? -18.486 52.560 -34.403 1.00 140.89 ? -52 DA  J "O4'" 1 
ATOM   9444  C  "C3'" . DA  J 6 21  ? -18.393 54.591 -33.154 1.00 141.51 ? -52 DA  J "C3'" 1 
ATOM   9445  O  "O3'" . DA  J 6 21  ? -19.670 55.003 -32.690 1.00 142.52 ? -52 DA  J "O3'" 1 
ATOM   9446  C  "C2'" . DA  J 6 21  ? -17.857 53.412 -32.340 1.00 141.26 ? -52 DA  J "C2'" 1 
ATOM   9447  C  "C1'" . DA  J 6 21  ? -18.548 52.250 -33.027 1.00 141.04 ? -52 DA  J "C1'" 1 
ATOM   9448  N  N9    . DA  J 6 21  ? -17.897 50.956 -32.791 1.00 140.96 ? -52 DA  J N9    1 
ATOM   9449  C  C8    . DA  J 6 21  ? -16.597 50.745 -32.415 1.00 140.94 ? -52 DA  J C8    1 
ATOM   9450  N  N7    . DA  J 6 21  ? -16.293 49.479 -32.243 1.00 140.90 ? -52 DA  J N7    1 
ATOM   9451  C  C5    . DA  J 6 21  ? -17.478 48.811 -32.511 1.00 140.82 ? -52 DA  J C5    1 
ATOM   9452  C  C6    . DA  J 6 21  ? -17.820 47.441 -32.509 1.00 140.68 ? -52 DA  J C6    1 
ATOM   9453  N  N6    . DA  J 6 21  ? -16.953 46.462 -32.222 1.00 140.66 ? -52 DA  J N6    1 
ATOM   9454  N  N1    . DA  J 6 21  ? -19.091 47.115 -32.816 1.00 140.58 ? -52 DA  J N1    1 
ATOM   9455  C  C2    . DA  J 6 21  ? -19.959 48.094 -33.089 1.00 140.57 ? -52 DA  J C2    1 
ATOM   9456  N  N3    . DA  J 6 21  ? -19.754 49.409 -33.138 1.00 140.67 ? -52 DA  J N3    1 
ATOM   9457  C  C4    . DA  J 6 21  ? -18.483 49.706 -32.831 1.00 140.82 ? -52 DA  J C4    1 
ATOM   9458  P  P     . DA  J 6 22  ? -19.798 55.996 -31.441 1.00 143.41 ? -51 DA  J P     1 
ATOM   9459  O  OP1   . DA  J 6 22  ? -21.159 56.592 -31.492 1.00 143.51 ? -51 DA  J OP1   1 
ATOM   9460  O  OP2   . DA  J 6 22  ? -18.604 56.880 -31.436 1.00 143.42 ? -51 DA  J OP2   1 
ATOM   9461  O  "O5'" . DA  J 6 22  ? -19.684 54.992 -30.181 1.00 143.91 ? -51 DA  J "O5'" 1 
ATOM   9462  C  "C5'" . DA  J 6 22  ? -20.618 55.052 -29.094 1.00 144.36 ? -51 DA  J "C5'" 1 
ATOM   9463  C  "C4'" . DA  J 6 22  ? -21.589 53.883 -29.149 1.00 144.83 ? -51 DA  J "C4'" 1 
ATOM   9464  O  "O4'" . DA  J 6 22  ? -21.166 52.945 -30.181 1.00 144.97 ? -51 DA  J "O4'" 1 
ATOM   9465  C  "C3'" . DA  J 6 22  ? -21.644 53.034 -27.893 1.00 145.04 ? -51 DA  J "C3'" 1 
ATOM   9466  O  "O3'" . DA  J 6 22  ? -22.505 53.625 -26.920 1.00 145.29 ? -51 DA  J "O3'" 1 
ATOM   9467  C  "C2'" . DA  J 6 22  ? -22.216 51.734 -28.444 1.00 145.11 ? -51 DA  J "C2'" 1 
ATOM   9468  C  "C1'" . DA  J 6 22  ? -21.463 51.613 -29.768 1.00 145.15 ? -51 DA  J "C1'" 1 
ATOM   9469  N  N9    . DA  J 6 22  ? -20.210 50.849 -29.658 1.00 145.37 ? -51 DA  J N9    1 
ATOM   9470  C  C8    . DA  J 6 22  ? -18.938 51.354 -29.607 1.00 145.43 ? -51 DA  J C8    1 
ATOM   9471  N  N7    . DA  J 6 22  ? -18.006 50.439 -29.473 1.00 145.42 ? -51 DA  J N7    1 
ATOM   9472  C  C5    . DA  J 6 22  ? -18.715 49.252 -29.408 1.00 145.44 ? -51 DA  J C5    1 
ATOM   9473  C  C6    . DA  J 6 22  ? -18.306 47.915 -29.262 1.00 145.43 ? -51 DA  J C6    1 
ATOM   9474  N  N6    . DA  J 6 22  ? -17.024 47.546 -29.157 1.00 145.43 ? -51 DA  J N6    1 
ATOM   9475  N  N1    . DA  J 6 22  ? -19.266 46.967 -29.233 1.00 145.42 ? -51 DA  J N1    1 
ATOM   9476  C  C2    . DA  J 6 22  ? -20.546 47.343 -29.341 1.00 145.43 ? -51 DA  J C2    1 
ATOM   9477  N  N3    . DA  J 6 22  ? -21.054 48.565 -29.490 1.00 145.45 ? -51 DA  J N3    1 
ATOM   9478  C  C4    . DA  J 6 22  ? -20.076 49.485 -29.511 1.00 145.45 ? -51 DA  J C4    1 
ATOM   9479  P  P     . DC  J 6 23  ? -21.984 53.835 -25.415 1.00 145.43 ? -50 DC  J P     1 
ATOM   9480  O  OP1   . DC  J 6 23  ? -22.676 55.017 -24.853 1.00 145.47 ? -50 DC  J OP1   1 
ATOM   9481  O  OP2   . DC  J 6 23  ? -20.502 53.789 -25.435 1.00 145.35 ? -50 DC  J OP2   1 
ATOM   9482  O  "O5'" . DC  J 6 23  ? -22.507 52.522 -24.657 1.00 145.47 ? -50 DC  J "O5'" 1 
ATOM   9483  C  "C5'" . DC  J 6 23  ? -23.778 51.962 -24.979 1.00 145.50 ? -50 DC  J "C5'" 1 
ATOM   9484  C  "C4'" . DC  J 6 23  ? -23.727 50.448 -24.887 1.00 145.59 ? -50 DC  J "C4'" 1 
ATOM   9485  O  "O4'" . DC  J 6 23  ? -22.822 49.944 -25.895 1.00 145.68 ? -50 DC  J "O4'" 1 
ATOM   9486  C  "C3'" . DC  J 6 23  ? -23.179 49.912 -23.577 1.00 145.57 ? -50 DC  J "C3'" 1 
ATOM   9487  O  "O3'" . DC  J 6 23  ? -24.223 49.785 -22.631 1.00 145.45 ? -50 DC  J "O3'" 1 
ATOM   9488  C  "C2'" . DC  J 6 23  ? -22.628 48.545 -23.981 1.00 145.68 ? -50 DC  J "C2'" 1 
ATOM   9489  C  "C1'" . DC  J 6 23  ? -22.173 48.775 -25.425 1.00 145.74 ? -50 DC  J "C1'" 1 
ATOM   9490  N  N1    . DC  J 6 23  ? -20.685 48.938 -25.574 1.00 145.77 ? -50 DC  J N1    1 
ATOM   9491  C  C2    . DC  J 6 23  ? -19.881 47.805 -25.743 1.00 145.79 ? -50 DC  J C2    1 
ATOM   9492  O  O2    . DC  J 6 23  ? -20.413 46.688 -25.778 1.00 145.84 ? -50 DC  J O2    1 
ATOM   9493  N  N3    . DC  J 6 23  ? -18.541 47.963 -25.872 1.00 145.79 ? -50 DC  J N3    1 
ATOM   9494  C  C4    . DC  J 6 23  ? -18.005 49.182 -25.830 1.00 145.79 ? -50 DC  J C4    1 
ATOM   9495  N  N4    . DC  J 6 23  ? -16.678 49.283 -25.954 1.00 145.79 ? -50 DC  J N4    1 
ATOM   9496  C  C5    . DC  J 6 23  ? -18.804 50.350 -25.659 1.00 145.74 ? -50 DC  J C5    1 
ATOM   9497  C  C6    . DC  J 6 23  ? -20.125 50.184 -25.534 1.00 145.79 ? -50 DC  J C6    1 
ATOM   9498  P  P     . DC  J 6 24  ? -23.987 50.254 -21.125 1.00 145.28 ? -49 DC  J P     1 
ATOM   9499  O  OP1   . DC  J 6 24  ? -25.304 50.294 -20.452 1.00 145.37 ? -49 DC  J OP1   1 
ATOM   9500  O  OP2   . DC  J 6 24  ? -23.132 51.462 -21.157 1.00 145.33 ? -49 DC  J OP2   1 
ATOM   9501  O  "O5'" . DC  J 6 24  ? -23.131 49.061 -20.506 1.00 144.93 ? -49 DC  J "O5'" 1 
ATOM   9502  C  "C5'" . DC  J 6 24  ? -23.690 47.770 -20.423 1.00 144.67 ? -49 DC  J "C5'" 1 
ATOM   9503  C  "C4'" . DC  J 6 24  ? -22.604 46.739 -20.221 1.00 144.49 ? -49 DC  J "C4'" 1 
ATOM   9504  O  "O4'" . DC  J 6 24  ? -21.568 46.917 -21.225 1.00 144.48 ? -49 DC  J "O4'" 1 
ATOM   9505  C  "C3'" . DC  J 6 24  ? -21.899 46.810 -18.862 1.00 144.35 ? -49 DC  J "C3'" 1 
ATOM   9506  O  "O3'" . DC  J 6 24  ? -21.806 45.509 -18.309 1.00 144.08 ? -49 DC  J "O3'" 1 
ATOM   9507  C  "C2'" . DC  J 6 24  ? -20.517 47.364 -19.209 1.00 144.46 ? -49 DC  J "C2'" 1 
ATOM   9508  C  "C1'" . DC  J 6 24  ? -20.319 46.788 -20.599 1.00 144.48 ? -49 DC  J "C1'" 1 
ATOM   9509  N  N1    . DC  J 6 24  ? -19.279 47.494 -21.405 1.00 144.51 ? -49 DC  J N1    1 
ATOM   9510  C  C2    . DC  J 6 24  ? -18.288 46.746 -22.043 1.00 144.49 ? -49 DC  J C2    1 
ATOM   9511  O  O2    . DC  J 6 24  ? -18.342 45.510 -21.988 1.00 144.46 ? -49 DC  J O2    1 
ATOM   9512  N  N3    . DC  J 6 24  ? -17.318 47.394 -22.739 1.00 144.51 ? -49 DC  J N3    1 
ATOM   9513  C  C4    . DC  J 6 24  ? -17.300 48.728 -22.776 1.00 144.49 ? -49 DC  J C4    1 
ATOM   9514  N  N4    . DC  J 6 24  ? -16.324 49.323 -23.471 1.00 144.37 ? -49 DC  J N4    1 
ATOM   9515  C  C5    . DC  J 6 24  ? -18.287 49.511 -22.107 1.00 144.50 ? -49 DC  J C5    1 
ATOM   9516  C  C6    . DC  J 6 24  ? -19.241 48.860 -21.430 1.00 144.52 ? -49 DC  J C6    1 
ATOM   9517  P  P     . DC  J 6 25  ? -21.883 45.294 -16.725 1.00 143.66 ? -48 DC  J P     1 
ATOM   9518  O  OP1   . DC  J 6 25  ? -23.310 45.141 -16.359 1.00 143.73 ? -48 DC  J OP1   1 
ATOM   9519  O  OP2   . DC  J 6 25  ? -21.056 46.343 -16.076 1.00 143.60 ? -48 DC  J OP2   1 
ATOM   9520  O  "O5'" . DC  J 6 25  ? -21.148 43.886 -16.520 1.00 142.98 ? -48 DC  J "O5'" 1 
ATOM   9521  C  "C5'" . DC  J 6 25  ? -20.902 43.036 -17.638 1.00 142.22 ? -48 DC  J "C5'" 1 
ATOM   9522  C  "C4'" . DC  J 6 25  ? -19.429 42.678 -17.730 1.00 141.42 ? -48 DC  J "C4'" 1 
ATOM   9523  O  "O4'" . DC  J 6 25  ? -18.700 43.760 -18.375 1.00 141.09 ? -48 DC  J "O4'" 1 
ATOM   9524  C  "C3'" . DC  J 6 25  ? -18.731 42.438 -16.380 1.00 140.90 ? -48 DC  J "C3'" 1 
ATOM   9525  O  "O3'" . DC  J 6 25  ? -17.978 41.222 -16.429 1.00 140.33 ? -48 DC  J "O3'" 1 
ATOM   9526  C  "C2'" . DC  J 6 25  ? -17.817 43.657 -16.232 1.00 140.88 ? -48 DC  J "C2'" 1 
ATOM   9527  C  "C1'" . DC  J 6 25  ? -17.492 43.948 -17.687 1.00 140.86 ? -48 DC  J "C1'" 1 
ATOM   9528  N  N1    . DC  J 6 25  ? -16.960 45.330 -17.964 1.00 140.58 ? -48 DC  J N1    1 
ATOM   9529  C  C2    . DC  J 6 25  ? -16.373 45.590 -19.203 1.00 140.44 ? -48 DC  J C2    1 
ATOM   9530  O  O2    . DC  J 6 25  ? -16.363 44.699 -20.060 1.00 140.43 ? -48 DC  J O2    1 
ATOM   9531  N  N3    . DC  J 6 25  ? -15.862 46.819 -19.445 1.00 140.31 ? -48 DC  J N3    1 
ATOM   9532  C  C4    . DC  J 6 25  ? -15.893 47.751 -18.497 1.00 140.27 ? -48 DC  J C4    1 
ATOM   9533  N  N4    . DC  J 6 25  ? -15.374 48.947 -18.784 1.00 140.24 ? -48 DC  J N4    1 
ATOM   9534  C  C5    . DC  J 6 25  ? -16.465 47.502 -17.216 1.00 140.33 ? -48 DC  J C5    1 
ATOM   9535  C  C6    . DC  J 6 25  ? -16.978 46.291 -16.992 1.00 140.43 ? -48 DC  J C6    1 
ATOM   9536  P  P     . DT  J 6 26  ? -17.706 40.376 -15.091 1.00 139.70 ? -47 DT  J P     1 
ATOM   9537  O  OP1   . DT  J 6 26  ? -18.792 39.377 -14.958 1.00 139.75 ? -47 DT  J OP1   1 
ATOM   9538  O  OP2   . DT  J 6 26  ? -17.438 41.329 -13.982 1.00 139.72 ? -47 DT  J OP2   1 
ATOM   9539  O  "O5'" . DT  J 6 26  ? -16.334 39.612 -15.423 1.00 138.80 ? -47 DT  J "O5'" 1 
ATOM   9540  C  "C5'" . DT  J 6 26  ? -15.922 39.437 -16.780 1.00 137.82 ? -47 DT  J "C5'" 1 
ATOM   9541  C  "C4'" . DT  J 6 26  ? -14.464 39.828 -16.962 1.00 136.83 ? -47 DT  J "C4'" 1 
ATOM   9542  O  "O4'" . DT  J 6 26  ? -14.359 41.264 -17.116 1.00 136.67 ? -47 DT  J "O4'" 1 
ATOM   9543  C  "C3'" . DT  J 6 26  ? -13.535 39.440 -15.813 1.00 135.99 ? -47 DT  J "C3'" 1 
ATOM   9544  O  "O3'" . DT  J 6 26  ? -12.504 38.596 -16.292 1.00 134.94 ? -47 DT  J "O3'" 1 
ATOM   9545  C  "C2'" . DT  J 6 26  ? -12.983 40.773 -15.288 1.00 136.21 ? -47 DT  J "C2'" 1 
ATOM   9546  C  "C1'" . DT  J 6 26  ? -13.213 41.730 -16.447 1.00 136.47 ? -47 DT  J "C1'" 1 
ATOM   9547  N  N1    . DT  J 6 26  ? -13.465 43.144 -16.005 1.00 136.57 ? -47 DT  J N1    1 
ATOM   9548  C  C2    . DT  J 6 26  ? -12.795 44.174 -16.625 1.00 136.52 ? -47 DT  J C2    1 
ATOM   9549  O  O2    . DT  J 6 26  ? -11.994 44.003 -17.527 1.00 136.44 ? -47 DT  J O2    1 
ATOM   9550  N  N3    . DT  J 6 26  ? -13.092 45.424 -16.139 1.00 136.56 ? -47 DT  J N3    1 
ATOM   9551  C  C4    . DT  J 6 26  ? -13.972 45.740 -15.115 1.00 136.52 ? -47 DT  J C4    1 
ATOM   9552  O  O4    . DT  J 6 26  ? -14.135 46.914 -14.798 1.00 136.49 ? -47 DT  J O4    1 
ATOM   9553  C  C5    . DT  J 6 26  ? -14.644 44.613 -14.507 1.00 136.55 ? -47 DT  J C5    1 
ATOM   9554  C  C7    . DT  J 6 26  ? -15.624 44.828 -13.389 1.00 136.47 ? -47 DT  J C7    1 
ATOM   9555  C  C6    . DT  J 6 26  ? -14.358 43.385 -14.972 1.00 136.57 ? -47 DT  J C6    1 
ATOM   9556  P  P     . DA  J 6 27  ? -11.527 37.853 -15.264 1.00 133.98 ? -46 DA  J P     1 
ATOM   9557  O  OP1   . DA  J 6 27  ? -11.266 36.494 -15.787 1.00 134.06 ? -46 DA  J OP1   1 
ATOM   9558  O  OP2   . DA  J 6 27  ? -12.068 38.023 -13.896 1.00 133.97 ? -46 DA  J OP2   1 
ATOM   9559  O  "O5'" . DA  J 6 27  ? -10.185 38.715 -15.374 1.00 132.92 ? -46 DA  J "O5'" 1 
ATOM   9560  C  "C5'" . DA  J 6 27  ? -9.407  38.666 -16.569 1.00 131.72 ? -46 DA  J "C5'" 1 
ATOM   9561  C  "C4'" . DA  J 6 27  ? -8.551  39.909 -16.711 1.00 130.47 ? -46 DA  J "C4'" 1 
ATOM   9562  O  "O4'" . DA  J 6 27  ? -9.310  41.074 -16.295 1.00 130.31 ? -46 DA  J "O4'" 1 
ATOM   9563  C  "C3'" . DA  J 6 27  ? -7.267  39.903 -15.888 1.00 129.36 ? -46 DA  J "C3'" 1 
ATOM   9564  O  "O3'" . DA  J 6 27  ? -6.194  40.402 -16.669 1.00 127.94 ? -46 DA  J "O3'" 1 
ATOM   9565  C  "C2'" . DA  J 6 27  ? -7.594  40.826 -14.713 1.00 129.76 ? -46 DA  J "C2'" 1 
ATOM   9566  C  "C1'" . DA  J 6 27  ? -8.586  41.805 -15.333 1.00 130.16 ? -46 DA  J "C1'" 1 
ATOM   9567  N  N9    . DA  J 6 27  ? -9.540  42.344 -14.371 1.00 130.48 ? -46 DA  J N9    1 
ATOM   9568  C  C8    . DA  J 6 27  ? -10.148 41.664 -13.354 1.00 130.66 ? -46 DA  J C8    1 
ATOM   9569  N  N7    . DA  J 6 27  ? -10.969 42.398 -12.640 1.00 130.77 ? -46 DA  J N7    1 
ATOM   9570  C  C5    . DA  J 6 27  ? -10.892 43.651 -13.227 1.00 130.79 ? -46 DA  J C5    1 
ATOM   9571  C  C6    . DA  J 6 27  ? -11.524 44.878 -12.933 1.00 130.82 ? -46 DA  J C6    1 
ATOM   9572  N  N6    . DA  J 6 27  ? -12.395 45.038 -11.927 1.00 130.88 ? -46 DA  J N6    1 
ATOM   9573  N  N1    . DA  J 6 27  ? -11.219 45.940 -13.711 1.00 130.69 ? -46 DA  J N1    1 
ATOM   9574  C  C2    . DA  J 6 27  ? -10.337 45.777 -14.705 1.00 130.64 ? -46 DA  J C2    1 
ATOM   9575  N  N3    . DA  J 6 27  ? -9.698  44.671 -15.092 1.00 130.61 ? -46 DA  J N3    1 
ATOM   9576  C  C4    . DA  J 6 27  ? -10.014 43.636 -14.298 1.00 130.64 ? -46 DA  J C4    1 
ATOM   9577  P  P     . DA  J 6 28  ? -4.835  39.573 -16.797 1.00 126.51 ? -45 DA  J P     1 
ATOM   9578  O  OP1   . DA  J 6 28  ? -5.016  38.561 -17.861 1.00 126.45 ? -45 DA  J OP1   1 
ATOM   9579  O  OP2   . DA  J 6 28  ? -4.425  39.159 -15.438 1.00 126.37 ? -45 DA  J OP2   1 
ATOM   9580  O  "O5'" . DA  J 6 28  ? -3.797  40.676 -17.306 1.00 125.56 ? -45 DA  J "O5'" 1 
ATOM   9581  C  "C5'" . DA  J 6 28  ? -4.216  41.670 -18.240 1.00 124.56 ? -45 DA  J "C5'" 1 
ATOM   9582  C  "C4'" . DA  J 6 28  ? -3.773  43.063 -17.811 1.00 123.56 ? -45 DA  J "C4'" 1 
ATOM   9583  O  "O4'" . DA  J 6 28  ? -4.669  43.573 -16.788 1.00 123.43 ? -45 DA  J "O4'" 1 
ATOM   9584  C  "C3'" . DA  J 6 28  ? -2.367  43.167 -17.215 1.00 122.79 ? -45 DA  J "C3'" 1 
ATOM   9585  O  "O3'" . DA  J 6 28  ? -1.808  44.418 -17.569 1.00 121.82 ? -45 DA  J "O3'" 1 
ATOM   9586  C  "C2'" . DA  J 6 28  ? -2.651  43.118 -15.721 1.00 123.06 ? -45 DA  J "C2'" 1 
ATOM   9587  C  "C1'" . DA  J 6 28  ? -3.908  43.963 -15.663 1.00 123.36 ? -45 DA  J "C1'" 1 
ATOM   9588  N  N9    . DA  J 6 28  ? -4.703  43.743 -14.468 1.00 123.61 ? -45 DA  J N9    1 
ATOM   9589  C  C8    . DA  J 6 28  ? -4.673  42.649 -13.652 1.00 123.75 ? -45 DA  J C8    1 
ATOM   9590  N  N7    . DA  J 6 28  ? -5.520  42.710 -12.654 1.00 123.81 ? -45 DA  J N7    1 
ATOM   9591  C  C5    . DA  J 6 28  ? -6.141  43.934 -12.821 1.00 123.81 ? -45 DA  J C5    1 
ATOM   9592  C  C6    . DA  J 6 28  ? -7.138  44.594 -12.083 1.00 123.77 ? -45 DA  J C6    1 
ATOM   9593  N  N6    . DA  J 6 28  ? -7.705  44.072 -10.986 1.00 123.65 ? -45 DA  J N6    1 
ATOM   9594  N  N1    . DA  J 6 28  ? -7.532  45.812 -12.518 1.00 123.90 ? -45 DA  J N1    1 
ATOM   9595  C  C2    . DA  J 6 28  ? -6.955  46.327 -13.615 1.00 123.84 ? -45 DA  J C2    1 
ATOM   9596  N  N3    . DA  J 6 28  ? -6.018  45.794 -14.397 1.00 123.79 ? -45 DA  J N3    1 
ATOM   9597  C  C4    . DA  J 6 28  ? -5.649  44.587 -13.936 1.00 123.71 ? -45 DA  J C4    1 
ATOM   9598  P  P     . DC  J 6 29  ? -0.227  44.602 -17.678 1.00 121.02 ? -44 DC  J P     1 
ATOM   9599  O  OP1   . DC  J 6 29  ? 0.159   44.242 -19.059 1.00 121.16 ? -44 DC  J OP1   1 
ATOM   9600  O  OP2   . DC  J 6 29  ? 0.411   43.927 -16.525 1.00 120.76 ? -44 DC  J OP2   1 
ATOM   9601  O  "O5'" . DC  J 6 29  ? -0.038  46.176 -17.479 1.00 120.56 ? -44 DC  J "O5'" 1 
ATOM   9602  C  "C5'" . DC  J 6 29  ? -0.947  47.093 -18.093 1.00 120.08 ? -44 DC  J "C5'" 1 
ATOM   9603  C  "C4'" . DC  J 6 29  ? -1.267  48.254 -17.158 1.00 119.55 ? -44 DC  J "C4'" 1 
ATOM   9604  O  "O4'" . DC  J 6 29  ? -2.193  47.806 -16.126 1.00 119.42 ? -44 DC  J "O4'" 1 
ATOM   9605  C  "C3'" . DC  J 6 29  ? -0.066  48.861 -16.423 1.00 119.13 ? -44 DC  J "C3'" 1 
ATOM   9606  O  "O3'" . DC  J 6 29  ? -0.166  50.282 -16.412 1.00 118.63 ? -44 DC  J "O3'" 1 
ATOM   9607  C  "C2'" . DC  J 6 29  ? -0.183  48.277 -15.017 1.00 119.14 ? -44 DC  J "C2'" 1 
ATOM   9608  C  "C1'" . DC  J 6 29  ? -1.693  48.153 -14.853 1.00 119.19 ? -44 DC  J "C1'" 1 
ATOM   9609  N  N1    . DC  J 6 29  ? -2.109  47.100 -13.855 1.00 118.94 ? -44 DC  J N1    1 
ATOM   9610  C  C2    . DC  J 6 29  ? -3.221  47.323 -13.035 1.00 118.79 ? -44 DC  J C2    1 
ATOM   9611  O  O2    . DC  J 6 29  ? -3.873  48.369 -13.169 1.00 118.72 ? -44 DC  J O2    1 
ATOM   9612  N  N3    . DC  J 6 29  ? -3.563  46.372 -12.127 1.00 118.74 ? -44 DC  J N3    1 
ATOM   9613  C  C4    . DC  J 6 29  ? -2.837  45.254 -12.018 1.00 118.72 ? -44 DC  J C4    1 
ATOM   9614  N  N4    . DC  J 6 29  ? -3.206  44.349 -11.109 1.00 118.67 ? -44 DC  J N4    1 
ATOM   9615  C  C5    . DC  J 6 29  ? -1.693  45.022 -12.826 1.00 118.79 ? -44 DC  J C5    1 
ATOM   9616  C  C6    . DC  J 6 29  ? -1.383  45.946 -13.739 1.00 118.91 ? -44 DC  J C6    1 
ATOM   9617  P  P     . DC  J 6 30  ? 1.105   51.190 -16.056 1.00 118.44 ? -43 DC  J P     1 
ATOM   9618  O  OP1   . DC  J 6 30  ? 1.317   52.128 -17.179 1.00 118.19 ? -43 DC  J OP1   1 
ATOM   9619  O  OP2   . DC  J 6 30  ? 2.208   50.312 -15.614 1.00 118.13 ? -43 DC  J OP2   1 
ATOM   9620  O  "O5'" . DC  J 6 30  ? 0.604   52.010 -14.774 1.00 119.50 ? -43 DC  J "O5'" 1 
ATOM   9621  C  "C5'" . DC  J 6 30  ? -0.799  52.268 -14.577 1.00 120.34 ? -43 DC  J "C5'" 1 
ATOM   9622  C  "C4'" . DC  J 6 30  ? -1.098  52.729 -13.148 1.00 121.04 ? -43 DC  J "C4'" 1 
ATOM   9623  O  "O4'" . DC  J 6 30  ? -1.541  51.601 -12.347 1.00 120.96 ? -43 DC  J "O4'" 1 
ATOM   9624  C  "C3'" . DC  J 6 30  ? 0.069   53.374 -12.386 1.00 121.84 ? -43 DC  J "C3'" 1 
ATOM   9625  O  "O3'" . DC  J 6 30  ? -0.379  54.583 -11.742 1.00 123.03 ? -43 DC  J "O3'" 1 
ATOM   9626  C  "C2'" . DC  J 6 30  ? 0.476   52.296 -11.375 1.00 121.45 ? -43 DC  J "C2'" 1 
ATOM   9627  C  "C1'" . DC  J 6 30  ? -0.845  51.584 -11.118 1.00 121.13 ? -43 DC  J "C1'" 1 
ATOM   9628  N  N1    . DC  J 6 30  ? -0.684  50.159 -10.695 1.00 121.09 ? -43 DC  J N1    1 
ATOM   9629  C  C2    . DC  J 6 30  ? -0.975  49.773 -9.377  1.00 121.12 ? -43 DC  J C2    1 
ATOM   9630  O  O2    . DC  J 6 30  ? -1.364  50.624 -8.566  1.00 121.19 ? -43 DC  J O2    1 
ATOM   9631  N  N3    . DC  J 6 30  ? -0.842  48.464 -9.033  1.00 121.05 ? -43 DC  J N3    1 
ATOM   9632  C  C4    . DC  J 6 30  ? -0.436  47.574 -9.940  1.00 120.98 ? -43 DC  J C4    1 
ATOM   9633  N  N4    . DC  J 6 30  ? -0.322  46.297 -9.564  1.00 120.91 ? -43 DC  J N4    1 
ATOM   9634  C  C5    . DC  J 6 30  ? -0.122  47.956 -11.271 1.00 121.04 ? -43 DC  J C5    1 
ATOM   9635  C  C6    . DC  J 6 30  ? -0.267  49.240 -11.603 1.00 121.08 ? -43 DC  J C6    1 
ATOM   9636  P  P     . DC  J 6 31  ? 0.666   55.629 -11.105 1.00 124.20 ? -42 DC  J P     1 
ATOM   9637  O  OP1   . DC  J 6 31  ? 0.173   56.997 -11.398 1.00 124.05 ? -42 DC  J OP1   1 
ATOM   9638  O  OP2   . DC  J 6 31  ? 2.038   55.236 -11.511 1.00 124.10 ? -42 DC  J OP2   1 
ATOM   9639  O  "O5'" . DC  J 6 31  ? 0.516   55.347 -9.530  1.00 125.58 ? -42 DC  J "O5'" 1 
ATOM   9640  C  "C5'" . DC  J 6 31  ? -0.771  55.484 -8.904  1.00 126.90 ? -42 DC  J "C5'" 1 
ATOM   9641  C  "C4'" . DC  J 6 31  ? -0.763  55.011 -7.452  1.00 128.14 ? -42 DC  J "C4'" 1 
ATOM   9642  O  "O4'" . DC  J 6 31  ? -0.609  53.573 -7.394  1.00 128.30 ? -42 DC  J "O4'" 1 
ATOM   9643  C  "C3'" . DC  J 6 31  ? 0.329   55.606 -6.551  1.00 129.32 ? -42 DC  J "C3'" 1 
ATOM   9644  O  "O3'" . DC  J 6 31  ? -0.262  56.135 -5.351  1.00 130.82 ? -42 DC  J "O3'" 1 
ATOM   9645  C  "C2'" . DC  J 6 31  ? 1.237   54.410 -6.252  1.00 128.90 ? -42 DC  J "C2'" 1 
ATOM   9646  C  "C1'" . DC  J 6 31  ? 0.261   53.249 -6.342  1.00 128.58 ? -42 DC  J "C1'" 1 
ATOM   9647  N  N1    . DC  J 6 31  ? 0.911   51.956 -6.654  1.00 128.57 ? -42 DC  J N1    1 
ATOM   9648  C  C2    . DC  J 6 31  ? 0.684   50.856 -5.826  1.00 128.59 ? -42 DC  J C2    1 
ATOM   9649  O  O2    . DC  J 6 31  ? -0.090  50.973 -4.868  1.00 128.50 ? -42 DC  J O2    1 
ATOM   9650  N  N3    . DC  J 6 31  ? 1.292   49.679 -6.120  1.00 128.67 ? -42 DC  J N3    1 
ATOM   9651  C  C4    . DC  J 6 31  ? 2.106   49.591 -7.176  1.00 128.67 ? -42 DC  J C4    1 
ATOM   9652  N  N4    . DC  J 6 31  ? 2.688   48.411 -7.421  1.00 128.63 ? -42 DC  J N4    1 
ATOM   9653  C  C5    . DC  J 6 31  ? 2.363   50.710 -8.022  1.00 128.61 ? -42 DC  J C5    1 
ATOM   9654  C  C6    . DC  J 6 31  ? 1.758   51.864 -7.722  1.00 128.62 ? -42 DC  J C6    1 
ATOM   9655  P  P     . DT  J 6 32  ? 0.479   57.279 -4.493  1.00 132.19 ? -41 DT  J P     1 
ATOM   9656  O  OP1   . DT  J 6 32  ? -0.568  58.174 -3.939  1.00 132.25 ? -41 DT  J OP1   1 
ATOM   9657  O  OP2   . DT  J 6 32  ? 1.579   57.845 -5.311  1.00 132.27 ? -41 DT  J OP2   1 
ATOM   9658  O  "O5'" . DT  J 6 32  ? 1.140   56.447 -3.297  1.00 133.05 ? -41 DT  J "O5'" 1 
ATOM   9659  C  "C5'" . DT  J 6 32  ? 0.396   55.415 -2.679  1.00 133.90 ? -41 DT  J "C5'" 1 
ATOM   9660  C  "C4'" . DT  J 6 32  ? 1.303   54.427 -1.969  1.00 134.80 ? -41 DT  J "C4'" 1 
ATOM   9661  O  "O4'" . DT  J 6 32  ? 1.735   53.401 -2.881  1.00 134.93 ? -41 DT  J "O4'" 1 
ATOM   9662  C  "C3'" . DT  J 6 32  ? 2.590   55.003 -1.363  1.00 135.53 ? -41 DT  J "C3'" 1 
ATOM   9663  O  "O3'" . DT  J 6 32  ? 2.420   55.159 0.068   1.00 136.45 ? -41 DT  J "O3'" 1 
ATOM   9664  C  "C2'" . DT  J 6 32  ? 3.668   53.945 -1.705  1.00 135.31 ? -41 DT  J "C2'" 1 
ATOM   9665  C  "C1'" . DT  J 6 32  ? 2.858   52.798 -2.308  1.00 135.00 ? -41 DT  J "C1'" 1 
ATOM   9666  N  N1    . DT  J 6 32  ? 3.591   52.020 -3.349  1.00 134.76 ? -41 DT  J N1    1 
ATOM   9667  C  C2    . DT  J 6 32  ? 3.637   50.654 -3.242  1.00 134.60 ? -41 DT  J C2    1 
ATOM   9668  O  O2    . DT  J 6 32  ? 3.059   50.038 -2.369  1.00 134.51 ? -41 DT  J O2    1 
ATOM   9669  N  N3    . DT  J 6 32  ? 4.366   50.027 -4.216  1.00 134.62 ? -41 DT  J N3    1 
ATOM   9670  C  C4    . DT  J 6 32  ? 5.065   50.625 -5.251  1.00 134.65 ? -41 DT  J C4    1 
ATOM   9671  O  O4    . DT  J 6 32  ? 5.679   49.925 -6.050  1.00 134.68 ? -41 DT  J O4    1 
ATOM   9672  C  C5    . DT  J 6 32  ? 4.999   52.066 -5.290  1.00 134.63 ? -41 DT  J C5    1 
ATOM   9673  C  C7    . DT  J 6 32  ? 5.712   52.823 -6.370  1.00 134.60 ? -41 DT  J C7    1 
ATOM   9674  C  C6    . DT  J 6 32  ? 4.284   52.688 -4.341  1.00 134.70 ? -41 DT  J C6    1 
ATOM   9675  P  P     . DA  J 6 33  ? 3.588   55.756 1.004   1.00 137.18 ? -40 DA  J P     1 
ATOM   9676  O  OP1   . DA  J 6 33  ? 2.946   56.541 2.083   1.00 137.20 ? -40 DA  J OP1   1 
ATOM   9677  O  OP2   . DA  J 6 33  ? 4.609   56.396 0.138   1.00 137.23 ? -40 DA  J OP2   1 
ATOM   9678  O  "O5'" . DA  J 6 33  ? 4.223   54.426 1.643   1.00 137.66 ? -40 DA  J "O5'" 1 
ATOM   9679  C  "C5'" . DA  J 6 33  ? 3.351   53.353 2.033   1.00 138.10 ? -40 DA  J "C5'" 1 
ATOM   9680  C  "C4'" . DA  J 6 33  ? 4.125   52.111 2.446   1.00 138.51 ? -40 DA  J "C4'" 1 
ATOM   9681  O  "O4'" . DA  J 6 33  ? 4.332   51.248 1.298   1.00 138.62 ? -40 DA  J "O4'" 1 
ATOM   9682  C  "C3'" . DA  J 6 33  ? 5.507   52.357 3.052   1.00 138.82 ? -40 DA  J "C3'" 1 
ATOM   9683  O  "O3'" . DA  J 6 33  ? 5.679   51.522 4.187   1.00 139.22 ? -40 DA  J "O3'" 1 
ATOM   9684  C  "C2'" . DA  J 6 33  ? 6.455   51.959 1.924   1.00 138.74 ? -40 DA  J "C2'" 1 
ATOM   9685  C  "C1'" . DA  J 6 33  ? 5.674   50.831 1.277   1.00 138.71 ? -40 DA  J "C1'" 1 
ATOM   9686  N  N9    . DA  J 6 33  ? 6.061   50.567 -0.101  1.00 138.82 ? -40 DA  J N9    1 
ATOM   9687  C  C8    . DA  J 6 33  ? 6.300   51.484 -1.086  1.00 138.89 ? -40 DA  J C8    1 
ATOM   9688  N  N7    . DA  J 6 33  ? 6.667   50.951 -2.227  1.00 138.96 ? -40 DA  J N7    1 
ATOM   9689  C  C5    . DA  J 6 33  ? 6.684   49.591 -1.965  1.00 138.99 ? -40 DA  J C5    1 
ATOM   9690  C  C6    . DA  J 6 33  ? 6.988   48.472 -2.765  1.00 139.11 ? -40 DA  J C6    1 
ATOM   9691  N  N6    . DA  J 6 33  ? 7.350   48.561 -4.050  1.00 139.16 ? -40 DA  J N6    1 
ATOM   9692  N  N1    . DA  J 6 33  ? 6.909   47.254 -2.188  1.00 139.07 ? -40 DA  J N1    1 
ATOM   9693  C  C2    . DA  J 6 33  ? 6.523   47.172 -0.909  1.00 139.04 ? -40 DA  J C2    1 
ATOM   9694  N  N3    . DA  J 6 33  ? 6.237   48.149 -0.057  1.00 138.98 ? -40 DA  J N3    1 
ATOM   9695  C  C4    . DA  J 6 33  ? 6.320   49.342 -0.658  1.00 138.95 ? -40 DA  J C4    1 
ATOM   9696  P  P     . DA  J 6 34  ? 6.742   51.911 5.318   1.00 139.52 ? -39 DA  J P     1 
ATOM   9697  O  OP1   . DA  J 6 34  ? 6.270   51.324 6.599   1.00 139.53 ? -39 DA  J OP1   1 
ATOM   9698  O  OP2   . DA  J 6 34  ? 6.987   53.371 5.221   1.00 139.52 ? -39 DA  J OP2   1 
ATOM   9699  O  "O5'" . DA  J 6 34  ? 8.072   51.147 4.820   1.00 139.52 ? -39 DA  J "O5'" 1 
ATOM   9700  C  "C5'" . DA  J 6 34  ? 8.818   50.294 5.703   1.00 139.46 ? -39 DA  J "C5'" 1 
ATOM   9701  C  "C4'" . DA  J 6 34  ? 8.825   48.865 5.185   1.00 139.40 ? -39 DA  J "C4'" 1 
ATOM   9702  O  "O4'" . DA  J 6 34  ? 8.524   48.862 3.760   1.00 139.57 ? -39 DA  J "O4'" 1 
ATOM   9703  C  "C3'" . DA  J 6 34  ? 10.161  48.136 5.314   1.00 139.05 ? -39 DA  J "C3'" 1 
ATOM   9704  O  "O3'" . DA  J 6 34  ? 9.928   46.727 5.441   1.00 138.38 ? -39 DA  J "O3'" 1 
ATOM   9705  C  "C2'" . DA  J 6 34  ? 10.811  48.461 3.980   1.00 139.34 ? -39 DA  J "C2'" 1 
ATOM   9706  C  "C1'" . DA  J 6 34  ? 9.613   48.293 3.058   1.00 139.66 ? -39 DA  J "C1'" 1 
ATOM   9707  N  N9    . DA  J 6 34  ? 9.759   48.973 1.774   1.00 140.01 ? -39 DA  J N9    1 
ATOM   9708  C  C8    . DA  J 6 34  ? 9.853   50.322 1.566   1.00 140.16 ? -39 DA  J C8    1 
ATOM   9709  N  N7    . DA  J 6 34  ? 9.994   50.656 0.306   1.00 140.20 ? -39 DA  J N7    1 
ATOM   9710  C  C5    . DA  J 6 34  ? 10.004  49.443 -0.361  1.00 140.13 ? -39 DA  J C5    1 
ATOM   9711  C  C6    . DA  J 6 34  ? 10.118  49.120 -1.721  1.00 140.06 ? -39 DA  J C6    1 
ATOM   9712  N  N6    . DA  J 6 34  ? 10.252  50.044 -2.678  1.00 140.00 ? -39 DA  J N6    1 
ATOM   9713  N  N1    . DA  J 6 34  ? 10.092  47.812 -2.059  1.00 140.04 ? -39 DA  J N1    1 
ATOM   9714  C  C2    . DA  J 6 34  ? 9.969   46.897 -1.089  1.00 139.98 ? -39 DA  J C2    1 
ATOM   9715  N  N3    . DA  J 6 34  ? 9.827   47.081 0.223   1.00 139.98 ? -39 DA  J N3    1 
ATOM   9716  C  C4    . DA  J 6 34  ? 9.843   48.392 0.523   1.00 140.05 ? -39 DA  J C4    1 
ATOM   9717  P  P     . DC  J 6 35  ? 11.114  45.747 5.890   1.00 137.70 ? -38 DC  J P     1 
ATOM   9718  O  OP1   . DC  J 6 35  ? 10.508  44.521 6.470   1.00 137.63 ? -38 DC  J OP1   1 
ATOM   9719  O  OP2   . DC  J 6 35  ? 12.077  46.543 6.686   1.00 137.78 ? -38 DC  J OP2   1 
ATOM   9720  O  "O5'" . DC  J 6 35  ? 11.828  45.375 4.500   1.00 136.81 ? -38 DC  J "O5'" 1 
ATOM   9721  C  "C5'" . DC  J 6 35  ? 11.238  44.433 3.598   1.00 135.70 ? -38 DC  J "C5'" 1 
ATOM   9722  C  "C4'" . DC  J 6 35  ? 12.106  44.253 2.363   1.00 134.57 ? -38 DC  J "C4'" 1 
ATOM   9723  O  "O4'" . DC  J 6 35  ? 11.848  45.327 1.440   1.00 134.06 ? -38 DC  J "O4'" 1 
ATOM   9724  C  "C3'" . DC  J 6 35  ? 13.600  44.334 2.614   1.00 133.90 ? -38 DC  J "C3'" 1 
ATOM   9725  O  "O3'" . DC  J 6 35  ? 14.112  43.061 2.983   1.00 133.49 ? -38 DC  J "O3'" 1 
ATOM   9726  C  "C2'" . DC  J 6 35  ? 14.154  44.788 1.263   1.00 133.78 ? -38 DC  J "C2'" 1 
ATOM   9727  C  "C1'" . DC  J 6 35  ? 12.965  45.477 0.590   1.00 133.67 ? -38 DC  J "C1'" 1 
ATOM   9728  N  N1    . DC  J 6 35  ? 13.188  46.922 0.335   1.00 133.19 ? -38 DC  J N1    1 
ATOM   9729  C  C2    . DC  J 6 35  ? 13.564  47.343 -0.937  1.00 132.92 ? -38 DC  J C2    1 
ATOM   9730  O  O2    . DC  J 6 35  ? 13.661  46.509 -1.836  1.00 132.85 ? -38 DC  J O2    1 
ATOM   9731  N  N3    . DC  J 6 35  ? 13.776  48.660 -1.157  1.00 132.82 ? -38 DC  J N3    1 
ATOM   9732  C  C4    . DC  J 6 35  ? 13.649  49.530 -0.157  1.00 132.82 ? -38 DC  J C4    1 
ATOM   9733  N  N4    . DC  J 6 35  ? 13.870  50.821 -0.418  1.00 132.77 ? -38 DC  J N4    1 
ATOM   9734  C  C5    . DC  J 6 35  ? 13.290  49.115 1.155   1.00 132.92 ? -38 DC  J C5    1 
ATOM   9735  C  C6    . DC  J 6 35  ? 13.107  47.809 1.360   1.00 133.05 ? -38 DC  J C6    1 
ATOM   9736  P  P     . DC  J 6 36  ? 15.495  42.965 3.783   1.00 133.14 ? -37 DC  J P     1 
ATOM   9737  O  OP1   . DC  J 6 36  ? 15.505  41.685 4.525   1.00 133.14 ? -37 DC  J OP1   1 
ATOM   9738  O  OP2   . DC  J 6 36  ? 15.683  44.240 4.511   1.00 133.10 ? -37 DC  J OP2   1 
ATOM   9739  O  "O5'" . DC  J 6 36  ? 16.592  42.906 2.611   1.00 132.82 ? -37 DC  J "O5'" 1 
ATOM   9740  C  "C5'" . DC  J 6 36  ? 16.790  41.706 1.866   1.00 132.45 ? -37 DC  J "C5'" 1 
ATOM   9741  C  "C4'" . DC  J 6 36  ? 17.206  42.006 0.435   1.00 132.14 ? -37 DC  J "C4'" 1 
ATOM   9742  O  "O4'" . DC  J 6 36  ? 16.704  43.305 0.023   1.00 132.12 ? -37 DC  J "O4'" 1 
ATOM   9743  C  "C3'" . DC  J 6 36  ? 18.713  42.043 0.186   1.00 131.90 ? -37 DC  J "C3'" 1 
ATOM   9744  O  "O3'" . DC  J 6 36  ? 18.998  41.389 -1.037  1.00 131.65 ? -37 DC  J "O3'" 1 
ATOM   9745  C  "C2'" . DC  J 6 36  ? 19.004  43.539 0.089   1.00 131.96 ? -37 DC  J "C2'" 1 
ATOM   9746  C  "C1'" . DC  J 6 36  ? 17.744  44.019 -0.603  1.00 132.01 ? -37 DC  J "C1'" 1 
ATOM   9747  N  N1    . DC  J 6 36  ? 17.482  45.498 -0.468  1.00 132.00 ? -37 DC  J N1    1 
ATOM   9748  C  C2    . DC  J 6 36  ? 17.195  46.259 -1.611  1.00 131.96 ? -37 DC  J C2    1 
ATOM   9749  O  O2    . DC  J 6 36  ? 17.152  45.700 -2.712  1.00 132.02 ? -37 DC  J O2    1 
ATOM   9750  N  N3    . DC  J 6 36  ? 16.947  47.583 -1.476  1.00 131.80 ? -37 DC  J N3    1 
ATOM   9751  C  C4    . DC  J 6 36  ? 16.993  48.149 -0.273  1.00 131.83 ? -37 DC  J C4    1 
ATOM   9752  N  N4    . DC  J 6 36  ? 16.750  49.460 -0.193  1.00 131.76 ? -37 DC  J N4    1 
ATOM   9753  C  C5    . DC  J 6 36  ? 17.291  47.398 0.902   1.00 131.82 ? -37 DC  J C5    1 
ATOM   9754  C  C6    . DC  J 6 36  ? 17.531  46.090 0.759   1.00 131.94 ? -37 DC  J C6    1 
ATOM   9755  P  P     . DC  J 6 37  ? 19.970  40.120 -1.055  1.00 131.38 ? -36 DC  J P     1 
ATOM   9756  O  OP1   . DC  J 6 37  ? 19.129  38.899 -1.150  1.00 131.47 ? -36 DC  J OP1   1 
ATOM   9757  O  OP2   . DC  J 6 37  ? 20.930  40.275 0.067   1.00 131.48 ? -36 DC  J OP2   1 
ATOM   9758  O  "O5'" . DC  J 6 37  ? 20.787  40.301 -2.425  1.00 130.37 ? -36 DC  J "O5'" 1 
ATOM   9759  C  "C5'" . DC  J 6 37  ? 20.163  40.057 -3.689  1.00 129.18 ? -36 DC  J "C5'" 1 
ATOM   9760  C  "C4'" . DC  J 6 37  ? 20.713  40.989 -4.756  1.00 127.85 ? -36 DC  J "C4'" 1 
ATOM   9761  O  "O4'" . DC  J 6 37  ? 20.453  42.368 -4.385  1.00 127.51 ? -36 DC  J "O4'" 1 
ATOM   9762  C  "C3'" . DC  J 6 37  ? 22.219  40.904 -4.997  1.00 127.15 ? -36 DC  J "C3'" 1 
ATOM   9763  O  "O3'" . DC  J 6 37  ? 22.475  41.222 -6.335  1.00 126.35 ? -36 DC  J "O3'" 1 
ATOM   9764  C  "C2'" . DC  J 6 37  ? 22.754  41.998 -4.084  1.00 127.08 ? -36 DC  J "C2'" 1 
ATOM   9765  C  "C1'" . DC  J 6 37  ? 21.677  43.065 -4.264  1.00 127.23 ? -36 DC  J "C1'" 1 
ATOM   9766  N  N1    . DC  J 6 37  ? 21.562  44.057 -3.128  1.00 127.20 ? -36 DC  J N1    1 
ATOM   9767  C  C2    . DC  J 6 37  ? 20.678  45.137 -3.248  1.00 127.26 ? -36 DC  J C2    1 
ATOM   9768  O  O2    . DC  J 6 37  ? 20.008  45.257 -4.282  1.00 127.35 ? -36 DC  J O2    1 
ATOM   9769  N  N3    . DC  J 6 37  ? 20.584  46.025 -2.228  1.00 127.16 ? -36 DC  J N3    1 
ATOM   9770  C  C4    . DC  J 6 37  ? 21.335  45.875 -1.140  1.00 127.08 ? -36 DC  J C4    1 
ATOM   9771  N  N4    . DC  J 6 37  ? 21.200  46.772 -0.161  1.00 127.07 ? -36 DC  J N4    1 
ATOM   9772  C  C5    . DC  J 6 37  ? 22.235  44.783 -0.993  1.00 127.07 ? -36 DC  J C5    1 
ATOM   9773  C  C6    . DC  J 6 37  ? 22.319  43.909 -1.999  1.00 127.13 ? -36 DC  J C6    1 
ATOM   9774  P  P     . DT  J 6 38  ? 23.598  40.457 -7.174  1.00 125.63 ? -35 DT  J P     1 
ATOM   9775  O  OP1   . DT  J 6 38  ? 23.270  39.016 -7.169  1.00 125.61 ? -35 DT  J OP1   1 
ATOM   9776  O  OP2   . DT  J 6 38  ? 24.927  40.920 -6.711  1.00 125.50 ? -35 DT  J OP2   1 
ATOM   9777  O  "O5'" . DT  J 6 38  ? 23.349  41.044 -8.639  1.00 125.11 ? -35 DT  J "O5'" 1 
ATOM   9778  C  "C5'" . DT  J 6 38  ? 22.033  41.499 -9.001  1.00 124.47 ? -35 DT  J "C5'" 1 
ATOM   9779  C  "C4'" . DT  J 6 38  ? 22.029  42.988 -9.308  1.00 123.82 ? -35 DT  J "C4'" 1 
ATOM   9780  O  "O4'" . DT  J 6 38  ? 22.105  43.751 -8.073  1.00 123.77 ? -35 DT  J "O4'" 1 
ATOM   9781  C  "C3'" . DT  J 6 38  ? 23.186  43.468 -10.184 1.00 123.16 ? -35 DT  J "C3'" 1 
ATOM   9782  O  "O3'" . DT  J 6 38  ? 22.681  44.151 -11.310 1.00 122.37 ? -35 DT  J "O3'" 1 
ATOM   9783  C  "C2'" . DT  J 6 38  ? 23.998  44.394 -9.268  1.00 123.50 ? -35 DT  J "C2'" 1 
ATOM   9784  C  "C1'" . DT  J 6 38  ? 22.950  44.862 -8.266  1.00 123.67 ? -35 DT  J "C1'" 1 
ATOM   9785  N  N1    . DT  J 6 38  ? 23.526  45.290 -6.921  1.00 123.91 ? -35 DT  J N1    1 
ATOM   9786  C  C2    . DT  J 6 38  ? 23.151  46.503 -6.372  1.00 123.92 ? -35 DT  J C2    1 
ATOM   9787  O  O2    . DT  J 6 38  ? 22.354  47.259 -6.897  1.00 123.98 ? -35 DT  J O2    1 
ATOM   9788  N  N3    . DT  J 6 38  ? 23.725  46.789 -5.159  1.00 123.96 ? -35 DT  J N3    1 
ATOM   9789  C  C4    . DT  J 6 38  ? 24.629  46.012 -4.455  1.00 124.01 ? -35 DT  J C4    1 
ATOM   9790  O  O4    . DT  J 6 38  ? 25.044  46.403 -3.366  1.00 123.89 ? -35 DT  J O4    1 
ATOM   9791  C  C5    . DT  J 6 38  ? 24.997  44.765 -5.091  1.00 124.13 ? -35 DT  J C5    1 
ATOM   9792  C  C7    . DT  J 6 38  ? 25.964  43.830 -4.419  1.00 124.23 ? -35 DT  J C7    1 
ATOM   9793  C  C6    . DT  J 6 38  ? 24.445  44.476 -6.285  1.00 124.07 ? -35 DT  J C6    1 
ATOM   9794  P  P     . DA  J 6 39  ? 23.606  44.364 -12.585 1.00 121.73 ? -34 DA  J P     1 
ATOM   9795  O  OP1   . DA  J 6 39  ? 22.737  44.362 -13.774 1.00 121.56 ? -34 DA  J OP1   1 
ATOM   9796  O  OP2   . DA  J 6 39  ? 24.747  43.426 -12.490 1.00 121.35 ? -34 DA  J OP2   1 
ATOM   9797  O  "O5'" . DA  J 6 39  ? 24.156  45.837 -12.367 1.00 122.30 ? -34 DA  J "O5'" 1 
ATOM   9798  C  "C5'" . DA  J 6 39  ? 23.244  46.927 -12.320 1.00 122.92 ? -34 DA  J "C5'" 1 
ATOM   9799  C  "C4'" . DA  J 6 39  ? 23.894  48.166 -11.720 1.00 123.50 ? -34 DA  J "C4'" 1 
ATOM   9800  O  "O4'" . DA  J 6 39  ? 24.275  47.909 -10.344 1.00 123.61 ? -34 DA  J "O4'" 1 
ATOM   9801  C  "C3'" . DA  J 6 39  ? 25.160  48.658 -12.429 1.00 123.98 ? -34 DA  J "C3'" 1 
ATOM   9802  O  "O3'" . DA  J 6 39  ? 25.086  50.053 -12.611 1.00 124.67 ? -34 DA  J "O3'" 1 
ATOM   9803  C  "C2'" . DA  J 6 39  ? 26.276  48.286 -11.455 1.00 123.84 ? -34 DA  J "C2'" 1 
ATOM   9804  C  "C1'" . DA  J 6 39  ? 25.563  48.426 -10.127 1.00 123.74 ? -34 DA  J "C1'" 1 
ATOM   9805  N  N9    . DA  J 6 39  ? 26.198  47.685 -9.042  1.00 123.87 ? -34 DA  J N9    1 
ATOM   9806  C  C8    . DA  J 6 39  ? 26.840  46.479 -9.125  1.00 123.90 ? -34 DA  J C8    1 
ATOM   9807  N  N7    . DA  J 6 39  ? 27.341  46.068 -7.985  1.00 123.93 ? -34 DA  J N7    1 
ATOM   9808  C  C5    . DA  J 6 39  ? 27.049  47.098 -7.108  1.00 124.01 ? -34 DA  J C5    1 
ATOM   9809  C  C6    . DA  J 6 39  ? 27.332  47.290 -5.745  1.00 124.15 ? -34 DA  J C6    1 
ATOM   9810  N  N6    . DA  J 6 39  ? 28.011  46.408 -5.004  1.00 124.28 ? -34 DA  J N6    1 
ATOM   9811  N  N1    . DA  J 6 39  ? 26.896  48.431 -5.172  1.00 124.12 ? -34 DA  J N1    1 
ATOM   9812  C  C2    . DA  J 6 39  ? 26.250  49.326 -5.927  1.00 124.03 ? -34 DA  J C2    1 
ATOM   9813  N  N3    . DA  J 6 39  ? 25.911  49.250 -7.206  1.00 123.97 ? -34 DA  J N3    1 
ATOM   9814  C  C4    . DA  J 6 39  ? 26.355  48.106 -7.747  1.00 123.93 ? -34 DA  J C4    1 
ATOM   9815  P  P     . DA  J 6 40  ? 25.919  50.761 -13.771 1.00 125.61 ? -33 DA  J P     1 
ATOM   9816  O  OP1   . DA  J 6 40  ? 24.951  51.313 -14.742 1.00 125.45 ? -33 DA  J OP1   1 
ATOM   9817  O  OP2   . DA  J 6 40  ? 26.979  49.834 -14.228 1.00 125.37 ? -33 DA  J OP2   1 
ATOM   9818  O  "O5'" . DA  J 6 40  ? 26.624  51.965 -12.992 1.00 127.24 ? -33 DA  J "O5'" 1 
ATOM   9819  C  "C5'" . DA  J 6 40  ? 25.833  53.030 -12.464 1.00 128.82 ? -33 DA  J "C5'" 1 
ATOM   9820  C  "C4'" . DA  J 6 40  ? 26.199  53.338 -11.017 1.00 130.35 ? -33 DA  J "C4'" 1 
ATOM   9821  O  "O4'" . DA  J 6 40  ? 26.349  52.103 -10.270 1.00 130.82 ? -33 DA  J "O4'" 1 
ATOM   9822  C  "C3'" . DA  J 6 40  ? 27.514  54.081 -10.813 1.00 131.29 ? -33 DA  J "C3'" 1 
ATOM   9823  O  "O3'" . DA  J 6 40  ? 27.302  55.501 -10.948 1.00 132.11 ? -33 DA  J "O3'" 1 
ATOM   9824  C  "C2'" . DA  J 6 40  ? 27.861  53.704 -9.368  1.00 131.31 ? -33 DA  J "C2'" 1 
ATOM   9825  C  "C1'" . DA  J 6 40  ? 27.319  52.275 -9.244  1.00 131.26 ? -33 DA  J "C1'" 1 
ATOM   9826  N  N9    . DA  J 6 40  ? 28.347  51.236 -9.384  1.00 131.52 ? -33 DA  J N9    1 
ATOM   9827  C  C8    . DA  J 6 40  ? 28.803  50.681 -10.551 1.00 131.69 ? -33 DA  J C8    1 
ATOM   9828  N  N7    . DA  J 6 40  ? 29.717  49.757 -10.380 1.00 131.68 ? -33 DA  J N7    1 
ATOM   9829  C  C5    . DA  J 6 40  ? 29.867  49.690 -9.007  1.00 131.66 ? -33 DA  J C5    1 
ATOM   9830  C  C6    . DA  J 6 40  ? 30.711  48.920 -8.191  1.00 131.73 ? -33 DA  J C6    1 
ATOM   9831  N  N6    . DA  J 6 40  ? 31.560  48.006 -8.674  1.00 131.65 ? -33 DA  J N6    1 
ATOM   9832  N  N1    . DA  J 6 40  ? 30.634  49.111 -6.856  1.00 131.78 ? -33 DA  J N1    1 
ATOM   9833  C  C2    . DA  J 6 40  ? 29.780  50.031 -6.382  1.00 131.74 ? -33 DA  J C2    1 
ATOM   9834  N  N3    . DA  J 6 40  ? 28.941  50.822 -7.053  1.00 131.64 ? -33 DA  J N3    1 
ATOM   9835  C  C4    . DA  J 6 40  ? 29.046  50.610 -8.375  1.00 131.63 ? -33 DA  J C4    1 
ATOM   9836  P  P     . DC  J 6 41  ? 28.405  56.446 -11.636 1.00 132.89 ? -32 DC  J P     1 
ATOM   9837  O  OP1   . DC  J 6 41  ? 28.275  57.790 -11.020 1.00 132.76 ? -32 DC  J OP1   1 
ATOM   9838  O  OP2   . DC  J 6 41  ? 28.287  56.294 -13.101 1.00 132.87 ? -32 DC  J OP2   1 
ATOM   9839  O  "O5'" . DC  J 6 41  ? 29.795  55.775 -11.195 1.00 133.99 ? -32 DC  J "O5'" 1 
ATOM   9840  C  "C5'" . DC  J 6 41  ? 30.901  56.583 -10.798 1.00 135.12 ? -32 DC  J "C5'" 1 
ATOM   9841  C  "C4'" . DC  J 6 41  ? 30.975  56.651 -9.286  1.00 136.30 ? -32 DC  J "C4'" 1 
ATOM   9842  O  "O4'" . DC  J 6 41  ? 30.455  55.415 -8.738  1.00 136.64 ? -32 DC  J "O4'" 1 
ATOM   9843  C  "C3'" . DC  J 6 41  ? 32.375  56.798 -8.719  1.00 137.08 ? -32 DC  J "C3'" 1 
ATOM   9844  O  "O3'" . DC  J 6 41  ? 32.670  58.176 -8.534  1.00 137.85 ? -32 DC  J "O3'" 1 
ATOM   9845  C  "C2'" . DC  J 6 41  ? 32.273  56.070 -7.380  1.00 137.03 ? -32 DC  J "C2'" 1 
ATOM   9846  C  "C1'" . DC  J 6 41  ? 31.263  54.963 -7.674  1.00 136.95 ? -32 DC  J "C1'" 1 
ATOM   9847  N  N1    . DC  J 6 41  ? 31.879  53.643 -8.060  1.00 137.18 ? -32 DC  J N1    1 
ATOM   9848  C  C2    . DC  J 6 41  ? 32.438  52.824 -7.071  1.00 137.32 ? -32 DC  J C2    1 
ATOM   9849  O  O2    . DC  J 6 41  ? 32.440  53.214 -5.897  1.00 137.39 ? -32 DC  J O2    1 
ATOM   9850  N  N3    . DC  J 6 41  ? 32.971  51.626 -7.432  1.00 137.28 ? -32 DC  J N3    1 
ATOM   9851  C  C4    . DC  J 6 41  ? 32.936  51.234 -8.708  1.00 137.25 ? -32 DC  J C4    1 
ATOM   9852  N  N4    . DC  J 6 41  ? 33.476  50.049 -9.014  1.00 137.15 ? -32 DC  J N4    1 
ATOM   9853  C  C5    . DC  J 6 41  ? 32.347  52.041 -9.726  1.00 137.29 ? -32 DC  J C5    1 
ATOM   9854  C  C6    . DC  J 6 41  ? 31.827  53.219 -9.359  1.00 137.29 ? -32 DC  J C6    1 
ATOM   9855  P  P     . DC  J 6 42  ? 34.088  58.758 -8.981  1.00 138.62 ? -31 DC  J P     1 
ATOM   9856  O  OP1   . DC  J 6 42  ? 34.094  60.204 -8.670  1.00 138.57 ? -31 DC  J OP1   1 
ATOM   9857  O  OP2   . DC  J 6 42  ? 34.358  58.300 -10.363 1.00 138.60 ? -31 DC  J OP2   1 
ATOM   9858  O  "O5'" . DC  J 6 42  ? 35.107  57.997 -8.002  1.00 139.55 ? -31 DC  J "O5'" 1 
ATOM   9859  C  "C5'" . DC  J 6 42  ? 35.143  58.321 -6.612  1.00 140.50 ? -31 DC  J "C5'" 1 
ATOM   9860  C  "C4'" . DC  J 6 42  ? 35.886  57.260 -5.814  1.00 141.42 ? -31 DC  J "C4'" 1 
ATOM   9861  O  "O4'" . DC  J 6 42  ? 35.182  55.997 -5.906  1.00 141.66 ? -31 DC  J "O4'" 1 
ATOM   9862  C  "C3'" . DC  J 6 42  ? 37.281  56.924 -6.306  1.00 142.13 ? -31 DC  J "C3'" 1 
ATOM   9863  O  "O3'" . DC  J 6 42  ? 38.235  57.888 -5.856  1.00 142.90 ? -31 DC  J "O3'" 1 
ATOM   9864  C  "C2'" . DC  J 6 42  ? 37.498  55.567 -5.645  1.00 142.01 ? -31 DC  J "C2'" 1 
ATOM   9865  C  "C1'" . DC  J 6 42  ? 36.112  54.930 -5.768  1.00 141.87 ? -31 DC  J "C1'" 1 
ATOM   9866  N  N1    . DC  J 6 42  ? 35.988  54.000 -6.947  1.00 141.90 ? -31 DC  J N1    1 
ATOM   9867  C  C2    . DC  J 6 42  ? 36.381  52.659 -6.814  1.00 141.90 ? -31 DC  J C2    1 
ATOM   9868  O  O2    . DC  J 6 42  ? 36.785  52.253 -5.714  1.00 141.83 ? -31 DC  J O2    1 
ATOM   9869  N  N3    . DC  J 6 42  ? 36.286  51.838 -7.890  1.00 141.89 ? -31 DC  J N3    1 
ATOM   9870  C  C4    . DC  J 6 42  ? 35.849  52.315 -9.059  1.00 141.85 ? -31 DC  J C4    1 
ATOM   9871  N  N4    . DC  J 6 42  ? 35.770  51.467 -10.090 1.00 141.80 ? -31 DC  J N4    1 
ATOM   9872  C  C5    . DC  J 6 42  ? 35.464  53.680 -9.219  1.00 141.84 ? -31 DC  J C5    1 
ATOM   9873  C  C6    . DC  J 6 42  ? 35.544  54.475 -8.150  1.00 141.86 ? -31 DC  J C6    1 
ATOM   9874  P  P     . DC  J 6 43  ? 39.469  58.289 -6.804  1.00 143.62 ? -30 DC  J P     1 
ATOM   9875  O  OP1   . DC  J 6 43  ? 40.012  59.584 -6.330  1.00 143.68 ? -30 DC  J OP1   1 
ATOM   9876  O  OP2   . DC  J 6 43  ? 39.025  58.148 -8.212  1.00 143.64 ? -30 DC  J OP2   1 
ATOM   9877  O  "O5'" . DC  J 6 43  ? 40.545  57.135 -6.512  1.00 144.10 ? -30 DC  J "O5'" 1 
ATOM   9878  C  "C5'" . DC  J 6 43  ? 40.926  56.819 -5.172  1.00 144.50 ? -30 DC  J "C5'" 1 
ATOM   9879  C  "C4'" . DC  J 6 43  ? 41.442  55.393 -5.082  1.00 144.95 ? -30 DC  J "C4'" 1 
ATOM   9880  O  "O4'" . DC  J 6 43  ? 40.536  54.496 -5.780  1.00 145.03 ? -30 DC  J "O4'" 1 
ATOM   9881  C  "C3'" . DC  J 6 43  ? 42.822  55.162 -5.697  1.00 145.27 ? -30 DC  J "C3'" 1 
ATOM   9882  O  "O3'" . DC  J 6 43  ? 43.579  54.304 -4.862  1.00 145.81 ? -30 DC  J "O3'" 1 
ATOM   9883  C  "C2'" . DC  J 6 43  ? 42.504  54.498 -7.034  1.00 145.20 ? -30 DC  J "C2'" 1 
ATOM   9884  C  "C1'" . DC  J 6 43  ? 41.266  53.690 -6.679  1.00 145.07 ? -30 DC  J "C1'" 1 
ATOM   9885  N  N1    . DC  J 6 43  ? 40.393  53.363 -7.863  1.00 144.98 ? -30 DC  J N1    1 
ATOM   9886  C  C2    . DC  J 6 43  ? 40.224  52.028 -8.252  1.00 144.86 ? -30 DC  J C2    1 
ATOM   9887  O  O2    . DC  J 6 43  ? 40.774  51.134 -7.599  1.00 144.84 ? -30 DC  J O2    1 
ATOM   9888  N  N3    . DC  J 6 43  ? 39.445  51.749 -9.326  1.00 144.83 ? -30 DC  J N3    1 
ATOM   9889  C  C4    . DC  J 6 43  ? 38.866  52.738 -10.006 1.00 144.81 ? -30 DC  J C4    1 
ATOM   9890  N  N4    . DC  J 6 43  ? 38.110  52.412 -11.059 1.00 144.82 ? -30 DC  J N4    1 
ATOM   9891  C  C5    . DC  J 6 43  ? 39.034  54.105 -9.634  1.00 144.88 ? -30 DC  J C5    1 
ATOM   9892  C  C6    . DC  J 6 43  ? 39.801  54.369 -8.570  1.00 144.91 ? -30 DC  J C6    1 
ATOM   9893  P  P     . DT  J 6 44  ? 45.161  54.489 -4.756  1.00 146.30 ? -29 DT  J P     1 
ATOM   9894  O  OP1   . DT  J 6 44  ? 45.535  54.391 -3.324  1.00 146.30 ? -29 DT  J OP1   1 
ATOM   9895  O  OP2   . DT  J 6 44  ? 45.529  55.689 -5.540  1.00 146.33 ? -29 DT  J OP2   1 
ATOM   9896  O  "O5'" . DT  J 6 44  ? 45.726  53.213 -5.534  1.00 146.67 ? -29 DT  J "O5'" 1 
ATOM   9897  C  "C5'" . DT  J 6 44  ? 45.201  51.926 -5.259  1.00 147.02 ? -29 DT  J "C5'" 1 
ATOM   9898  C  "C4'" . DT  J 6 44  ? 45.374  51.007 -6.454  1.00 147.33 ? -29 DT  J "C4'" 1 
ATOM   9899  O  "O4'" . DT  J 6 44  ? 44.344  51.287 -7.441  1.00 147.37 ? -29 DT  J "O4'" 1 
ATOM   9900  C  "C3'" . DT  J 6 44  ? 46.721  51.133 -7.196  1.00 147.51 ? -29 DT  J "C3'" 1 
ATOM   9901  O  "O3'" . DT  J 6 44  ? 47.330  49.839 -7.322  1.00 147.79 ? -29 DT  J "O3'" 1 
ATOM   9902  C  "C2'" . DT  J 6 44  ? 46.320  51.697 -8.569  1.00 147.43 ? -29 DT  J "C2'" 1 
ATOM   9903  C  "C1'" . DT  J 6 44  ? 44.916  51.131 -8.712  1.00 147.29 ? -29 DT  J "C1'" 1 
ATOM   9904  N  N1    . DT  J 6 44  ? 44.053  51.809 -9.750  1.00 146.94 ? -29 DT  J N1    1 
ATOM   9905  C  C2    . DT  J 6 44  ? 43.255  51.030 -10.555 1.00 146.72 ? -29 DT  J C2    1 
ATOM   9906  O  O2    . DT  J 6 44  ? 43.173  49.821 -10.440 1.00 146.60 ? -29 DT  J O2    1 
ATOM   9907  N  N3    . DT  J 6 44  ? 42.523  51.722 -11.482 1.00 146.60 ? -29 DT  J N3    1 
ATOM   9908  C  C4    . DT  J 6 44  ? 42.530  53.086 -11.701 1.00 146.57 ? -29 DT  J C4    1 
ATOM   9909  O  O4    . DT  J 6 44  ? 41.820  53.560 -12.581 1.00 146.55 ? -29 DT  J O4    1 
ATOM   9910  C  C5    . DT  J 6 44  ? 43.408  53.846 -10.842 1.00 146.62 ? -29 DT  J C5    1 
ATOM   9911  C  C7    . DT  J 6 44  ? 43.499  55.336 -10.987 1.00 146.57 ? -29 DT  J C7    1 
ATOM   9912  C  C6    . DT  J 6 44  ? 44.131  53.178 -9.928  1.00 146.77 ? -29 DT  J C6    1 
ATOM   9913  P  P     . DA  J 6 45  ? 48.924  49.679 -7.256  1.00 148.06 ? -28 DA  J P     1 
ATOM   9914  O  OP1   . DA  J 6 45  ? 49.345  49.937 -5.864  1.00 148.13 ? -28 DA  J OP1   1 
ATOM   9915  O  OP2   . DA  J 6 45  ? 49.513  50.461 -8.367  1.00 148.00 ? -28 DA  J OP2   1 
ATOM   9916  O  "O5'" . DA  J 6 45  ? 49.146  48.129 -7.581  1.00 148.37 ? -28 DA  J "O5'" 1 
ATOM   9917  C  "C5'" . DA  J 6 45  ? 48.281  47.151 -7.012  1.00 148.67 ? -28 DA  J "C5'" 1 
ATOM   9918  C  "C4'" . DA  J 6 45  ? 47.783  46.185 -8.073  1.00 148.98 ? -28 DA  J "C4'" 1 
ATOM   9919  O  "O4'" . DA  J 6 45  ? 46.836  46.863 -8.939  1.00 148.98 ? -28 DA  J "O4'" 1 
ATOM   9920  C  "C3'" . DA  J 6 45  ? 48.871  45.598 -8.976  1.00 149.24 ? -28 DA  J "C3'" 1 
ATOM   9921  O  "O3'" . DA  J 6 45  ? 48.725  44.176 -9.079  1.00 149.51 ? -28 DA  J "O3'" 1 
ATOM   9922  C  "C2'" . DA  J 6 45  ? 48.662  46.296 -10.321 1.00 149.17 ? -28 DA  J "C2'" 1 
ATOM   9923  C  "C1'" . DA  J 6 45  ? 47.183  46.670 -10.293 1.00 149.08 ? -28 DA  J "C1'" 1 
ATOM   9924  N  N9    . DA  J 6 45  ? 46.901  47.907 -11.022 1.00 149.02 ? -28 DA  J N9    1 
ATOM   9925  C  C8    . DA  J 6 45  ? 47.669  49.040 -11.043 1.00 149.03 ? -28 DA  J C8    1 
ATOM   9926  N  N7    . DA  J 6 45  ? 47.200  49.984 -11.825 1.00 148.98 ? -28 DA  J N7    1 
ATOM   9927  C  C5    . DA  J 6 45  ? 46.057  49.427 -12.366 1.00 148.91 ? -28 DA  J C5    1 
ATOM   9928  C  C6    . DA  J 6 45  ? 45.105  49.920 -13.275 1.00 148.81 ? -28 DA  J C6    1 
ATOM   9929  N  N6    . DA  J 6 45  ? 45.165  51.142 -13.811 1.00 148.75 ? -28 DA  J N6    1 
ATOM   9930  N  N1    . DA  J 6 45  ? 44.085  49.107 -13.610 1.00 148.85 ? -28 DA  J N1    1 
ATOM   9931  C  C2    . DA  J 6 45  ? 44.040  47.876 -13.084 1.00 148.84 ? -28 DA  J C2    1 
ATOM   9932  N  N3    . DA  J 6 45  ? 44.869  47.306 -12.214 1.00 148.86 ? -28 DA  J N3    1 
ATOM   9933  C  C4    . DA  J 6 45  ? 45.867  48.139 -11.896 1.00 148.88 ? -28 DA  J C4    1 
ATOM   9934  P  P     . DA  J 6 46  ? 49.995  43.250 -9.428  1.00 149.66 ? -27 DA  J P     1 
ATOM   9935  O  OP1   . DA  J 6 46  ? 50.065  42.166 -8.416  1.00 149.70 ? -27 DA  J OP1   1 
ATOM   9936  O  OP2   . DA  J 6 46  ? 51.167  44.133 -9.649  1.00 149.65 ? -27 DA  J OP2   1 
ATOM   9937  O  "O5'" . DA  J 6 46  ? 49.591  42.612 -10.841 1.00 149.48 ? -27 DA  J "O5'" 1 
ATOM   9938  C  "C5'" . DA  J 6 46  ? 48.235  42.669 -11.293 1.00 149.15 ? -27 DA  J "C5'" 1 
ATOM   9939  C  "C4'" . DA  J 6 46  ? 48.158  42.846 -12.803 1.00 148.76 ? -27 DA  J "C4'" 1 
ATOM   9940  O  "O4'" . DA  J 6 46  ? 47.955  44.246 -13.138 1.00 148.63 ? -27 DA  J "O4'" 1 
ATOM   9941  C  "C3'" . DA  J 6 46  ? 49.390  42.392 -13.597 1.00 148.55 ? -27 DA  J "C3'" 1 
ATOM   9942  O  "O3'" . DA  J 6 46  ? 48.964  41.644 -14.700 1.00 148.43 ? -27 DA  J "O3'" 1 
ATOM   9943  C  "C2'" . DA  J 6 46  ? 50.015  43.711 -14.044 1.00 148.53 ? -27 DA  J "C2'" 1 
ATOM   9944  C  "C1'" . DA  J 6 46  ? 48.777  44.562 -14.233 1.00 148.49 ? -27 DA  J "C1'" 1 
ATOM   9945  N  N9    . DA  J 6 46  ? 49.049  45.993 -14.231 1.00 148.48 ? -27 DA  J N9    1 
ATOM   9946  C  C8    . DA  J 6 46  ? 50.143  46.618 -13.706 1.00 148.43 ? -27 DA  J C8    1 
ATOM   9947  N  N7    . DA  J 6 46  ? 50.149  47.916 -13.887 1.00 148.45 ? -27 DA  J N7    1 
ATOM   9948  C  C5    . DA  J 6 46  ? 48.992  48.156 -14.604 1.00 148.47 ? -27 DA  J C5    1 
ATOM   9949  C  C6    . DA  J 6 46  ? 48.404  49.341 -15.078 1.00 148.50 ? -27 DA  J C6    1 
ATOM   9950  N  N6    . DA  J 6 46  ? 48.969  50.546 -14.945 1.00 148.51 ? -27 DA  J N6    1 
ATOM   9951  N  N1    . DA  J 6 46  ? 47.255  49.232 -15.776 1.00 148.53 ? -27 DA  J N1    1 
ATOM   9952  C  C2    . DA  J 6 46  ? 46.706  48.021 -15.929 1.00 148.53 ? -27 DA  J C2    1 
ATOM   9953  N  N3    . DA  J 6 46  ? 47.145  46.841 -15.493 1.00 148.52 ? -27 DA  J N3    1 
ATOM   9954  C  C4    . DA  J 6 46  ? 48.308  46.980 -14.837 1.00 148.46 ? -27 DA  J C4    1 
ATOM   9955  P  P     . DC  J 6 47  ? 49.886  40.506 -15.330 1.00 148.31 ? -26 DC  J P     1 
ATOM   9956  O  OP1   . DC  J 6 47  ? 49.657  39.258 -14.567 1.00 148.31 ? -26 DC  J OP1   1 
ATOM   9957  O  OP2   . DC  J 6 47  ? 51.258  41.043 -15.481 1.00 148.31 ? -26 DC  J OP2   1 
ATOM   9958  O  "O5'" . DC  J 6 47  ? 49.249  40.352 -16.789 1.00 148.16 ? -26 DC  J "O5'" 1 
ATOM   9959  C  "C5'" . DC  J 6 47  ? 47.822  40.317 -16.934 1.00 147.92 ? -26 DC  J "C5'" 1 
ATOM   9960  C  "C4'" . DC  J 6 47  ? 47.310  41.477 -17.781 1.00 147.62 ? -26 DC  J "C4'" 1 
ATOM   9961  O  "O4'" . DC  J 6 47  ? 47.828  42.719 -17.287 1.00 147.61 ? -26 DC  J "O4'" 1 
ATOM   9962  C  "C3'" . DC  J 6 47  ? 47.731  41.454 -19.236 1.00 147.35 ? -26 DC  J "C3'" 1 
ATOM   9963  O  "O3'" . DC  J 6 47  ? 46.809  40.683 -19.984 1.00 147.06 ? -26 DC  J "O3'" 1 
ATOM   9964  C  "C2'" . DC  J 6 47  ? 47.683  42.937 -19.642 1.00 147.40 ? -26 DC  J "C2'" 1 
ATOM   9965  C  "C1'" . DC  J 6 47  ? 47.702  43.687 -18.304 1.00 147.51 ? -26 DC  J "C1'" 1 
ATOM   9966  N  N1    . DC  J 6 47  ? 48.824  44.665 -18.174 1.00 147.47 ? -26 DC  J N1    1 
ATOM   9967  C  C2    . DC  J 6 47  ? 48.624  46.003 -18.540 1.00 147.46 ? -26 DC  J C2    1 
ATOM   9968  O  O2    . DC  J 6 47  ? 47.521  46.352 -18.983 1.00 147.46 ? -26 DC  J O2    1 
ATOM   9969  N  N3    . DC  J 6 47  ? 49.646  46.881 -18.389 1.00 147.42 ? -26 DC  J N3    1 
ATOM   9970  C  C4    . DC  J 6 47  ? 50.817  46.466 -17.905 1.00 147.38 ? -26 DC  J C4    1 
ATOM   9971  N  N4    . DC  J 6 47  ? 51.795  47.367 -17.782 1.00 147.38 ? -26 DC  J N4    1 
ATOM   9972  C  C5    . DC  J 6 47  ? 51.039  45.109 -17.528 1.00 147.35 ? -26 DC  J C5    1 
ATOM   9973  C  C6    . DC  J 6 47  ? 50.027  44.251 -17.681 1.00 147.40 ? -26 DC  J C6    1 
ATOM   9974  P  P     . DC  J 6 48  ? 47.323  39.770 -21.193 1.00 146.74 ? -25 DC  J P     1 
ATOM   9975  O  OP1   . DC  J 6 48  ? 46.342  38.676 -21.386 1.00 146.74 ? -25 DC  J OP1   1 
ATOM   9976  O  OP2   . DC  J 6 48  ? 48.750  39.448 -20.960 1.00 146.77 ? -25 DC  J OP2   1 
ATOM   9977  O  "O5'" . DC  J 6 48  ? 47.247  40.768 -22.438 1.00 146.23 ? -25 DC  J "O5'" 1 
ATOM   9978  C  "C5'" . DC  J 6 48  ? 46.089  41.573 -22.641 1.00 145.59 ? -25 DC  J "C5'" 1 
ATOM   9979  C  "C4'" . DC  J 6 48  ? 46.402  42.734 -23.562 1.00 144.98 ? -25 DC  J "C4'" 1 
ATOM   9980  O  "O4'" . DC  J 6 48  ? 47.331  43.633 -22.905 1.00 144.72 ? -25 DC  J "O4'" 1 
ATOM   9981  C  "C3'" . DC  J 6 48  ? 47.052  42.343 -24.889 1.00 144.55 ? -25 DC  J "C3'" 1 
ATOM   9982  O  "O3'" . DC  J 6 48  ? 46.494  43.108 -25.938 1.00 144.21 ? -25 DC  J "O3'" 1 
ATOM   9983  C  "C2'" . DC  J 6 48  ? 48.523  42.684 -24.671 1.00 144.56 ? -25 DC  J "C2'" 1 
ATOM   9984  C  "C1'" . DC  J 6 48  ? 48.413  43.897 -23.765 1.00 144.67 ? -25 DC  J "C1'" 1 
ATOM   9985  N  N1    . DC  J 6 48  ? 49.624  44.138 -22.939 1.00 144.65 ? -25 DC  J N1    1 
ATOM   9986  C  C2    . DC  J 6 48  ? 50.152  45.428 -22.855 1.00 144.59 ? -25 DC  J C2    1 
ATOM   9987  O  O2    . DC  J 6 48  ? 49.582  46.349 -23.450 1.00 144.47 ? -25 DC  J O2    1 
ATOM   9988  N  N3    . DC  J 6 48  ? 51.258  45.638 -22.097 1.00 144.63 ? -25 DC  J N3    1 
ATOM   9989  C  C4    . DC  J 6 48  ? 51.832  44.618 -21.453 1.00 144.73 ? -25 DC  J C4    1 
ATOM   9990  N  N4    . DC  J 6 48  ? 52.921  44.873 -20.718 1.00 144.64 ? -25 DC  J N4    1 
ATOM   9991  C  C5    . DC  J 6 48  ? 51.312  43.291 -21.533 1.00 144.78 ? -25 DC  J C5    1 
ATOM   9992  C  C6    . DC  J 6 48  ? 50.219  43.098 -22.282 1.00 144.80 ? -25 DC  J C6    1 
ATOM   9993  P  P     . DC  J 6 49  ? 46.329  42.482 -27.398 1.00 143.92 ? -24 DC  J P     1 
ATOM   9994  O  OP1   . DC  J 6 49  ? 45.012  41.814 -27.459 1.00 143.88 ? -24 DC  J OP1   1 
ATOM   9995  O  OP2   . DC  J 6 49  ? 47.558  41.726 -27.724 1.00 143.81 ? -24 DC  J OP2   1 
ATOM   9996  O  "O5'" . DC  J 6 49  ? 46.294  43.783 -28.316 1.00 144.00 ? -24 DC  J "O5'" 1 
ATOM   9997  C  "C5'" . DC  J 6 49  ? 45.643  44.951 -27.841 1.00 144.19 ? -24 DC  J "C5'" 1 
ATOM   9998  C  "C4'" . DC  J 6 49  ? 46.602  46.121 -27.797 1.00 144.39 ? -24 DC  J "C4'" 1 
ATOM   9999  O  "O4'" . DC  J 6 49  ? 47.700  45.805 -26.926 1.00 144.46 ? -24 DC  J "O4'" 1 
ATOM   10000 C  "C3'" . DC  J 6 49  ? 47.257  46.453 -29.124 1.00 144.59 ? -24 DC  J "C3'" 1 
ATOM   10001 O  "O3'" . DC  J 6 49  ? 46.504  47.434 -29.808 1.00 144.89 ? -24 DC  J "O3'" 1 
ATOM   10002 C  "C2'" . DC  J 6 49  ? 48.645  46.985 -28.732 1.00 144.56 ? -24 DC  J "C2'" 1 
ATOM   10003 C  "C1'" . DC  J 6 49  ? 48.767  46.663 -27.240 1.00 144.59 ? -24 DC  J "C1'" 1 
ATOM   10004 N  N1    . DC  J 6 49  ? 50.065  45.997 -26.882 1.00 144.51 ? -24 DC  J N1    1 
ATOM   10005 C  C2    . DC  J 6 49  ? 51.143  46.776 -26.449 1.00 144.56 ? -24 DC  J C2    1 
ATOM   10006 O  O2    . DC  J 6 49  ? 50.977  47.994 -26.287 1.00 144.49 ? -24 DC  J O2    1 
ATOM   10007 N  N3    . DC  J 6 49  ? 52.319  46.163 -26.152 1.00 144.41 ? -24 DC  J N3    1 
ATOM   10008 C  C4    . DC  J 6 49  ? 52.446  44.844 -26.316 1.00 144.34 ? -24 DC  J C4    1 
ATOM   10009 N  N4    . DC  J 6 49  ? 53.625  44.287 -26.022 1.00 144.15 ? -24 DC  J N4    1 
ATOM   10010 C  C5    . DC  J 6 49  ? 51.370  44.040 -26.788 1.00 144.35 ? -24 DC  J C5    1 
ATOM   10011 C  C6    . DC  J 6 49  ? 50.217  44.655 -27.078 1.00 144.54 ? -24 DC  J C6    1 
ATOM   10012 P  P     . DT  J 6 50  ? 46.713  47.632 -31.376 1.00 145.48 ? -23 DT  J P     1 
ATOM   10013 O  OP1   . DT  J 6 50  ? 45.471  48.198 -31.936 1.00 145.28 ? -23 DT  J OP1   1 
ATOM   10014 O  OP2   . DT  J 6 50  ? 47.266  46.375 -31.919 1.00 145.26 ? -23 DT  J OP2   1 
ATOM   10015 O  "O5'" . DT  J 6 50  ? 47.854  48.741 -31.444 1.00 147.06 ? -23 DT  J "O5'" 1 
ATOM   10016 C  "C5'" . DT  J 6 50  ? 47.660  49.988 -30.798 1.00 148.64 ? -23 DT  J "C5'" 1 
ATOM   10017 C  "C4'" . DT  J 6 50  ? 48.987  50.676 -30.532 1.00 150.24 ? -23 DT  J "C4'" 1 
ATOM   10018 O  "O4'" . DT  J 6 50  ? 49.873  49.780 -29.820 1.00 150.54 ? -23 DT  J "O4'" 1 
ATOM   10019 C  "C3'" . DT  J 6 50  ? 49.742  51.134 -31.780 1.00 151.56 ? -23 DT  J "C3'" 1 
ATOM   10020 O  "O3'" . DT  J 6 50  ? 49.974  52.534 -31.707 1.00 153.30 ? -23 DT  J "O3'" 1 
ATOM   10021 C  "C2'" . DT  J 6 50  ? 51.052  50.332 -31.751 1.00 151.18 ? -23 DT  J "C2'" 1 
ATOM   10022 C  "C1'" . DT  J 6 50  ? 51.186  49.967 -30.277 1.00 150.85 ? -23 DT  J "C1'" 1 
ATOM   10023 N  N1    . DT  J 6 50  ? 51.975  48.698 -30.024 1.00 150.78 ? -23 DT  J N1    1 
ATOM   10024 C  C2    . DT  J 6 50  ? 52.876  48.659 -28.978 1.00 150.68 ? -23 DT  J C2    1 
ATOM   10025 O  O2    . DT  J 6 50  ? 53.036  49.581 -28.197 1.00 150.58 ? -23 DT  J O2    1 
ATOM   10026 N  N3    . DT  J 6 50  ? 53.530  47.463 -28.830 1.00 150.70 ? -23 DT  J N3    1 
ATOM   10027 C  C4    . DT  J 6 50  ? 53.418  46.339 -29.634 1.00 150.72 ? -23 DT  J C4    1 
ATOM   10028 O  O4    . DT  J 6 50  ? 54.091  45.343 -29.385 1.00 150.71 ? -23 DT  J O4    1 
ATOM   10029 C  C5    . DT  J 6 50  ? 52.484  46.455 -30.728 1.00 150.70 ? -23 DT  J C5    1 
ATOM   10030 C  C7    . DT  J 6 50  ? 52.283  45.303 -31.668 1.00 150.62 ? -23 DT  J C7    1 
ATOM   10031 C  C6    . DT  J 6 50  ? 51.813  47.612 -30.869 1.00 150.75 ? -23 DT  J C6    1 
ATOM   10032 P  P     . DA  J 6 51  ? 50.290  53.377 -33.031 1.00 155.02 ? -22 DA  J P     1 
ATOM   10033 O  OP1   . DA  J 6 51  ? 49.511  54.637 -32.966 1.00 154.92 ? -22 DA  J OP1   1 
ATOM   10034 O  OP2   . DA  J 6 51  ? 50.143  52.476 -34.198 1.00 155.02 ? -22 DA  J OP2   1 
ATOM   10035 O  "O5'" . DA  J 6 51  ? 51.848  53.712 -32.859 1.00 156.77 ? -22 DA  J "O5'" 1 
ATOM   10036 C  "C5'" . DA  J 6 51  ? 52.388  53.920 -31.545 1.00 158.38 ? -22 DA  J "C5'" 1 
ATOM   10037 C  "C4'" . DA  J 6 51  ? 53.915  53.985 -31.551 1.00 159.93 ? -22 DA  J "C4'" 1 
ATOM   10038 O  "O4'" . DA  J 6 51  ? 54.462  52.753 -31.010 1.00 160.32 ? -22 DA  J "O4'" 1 
ATOM   10039 C  "C3'" . DA  J 6 51  ? 54.584  54.199 -32.914 1.00 161.03 ? -22 DA  J "C3'" 1 
ATOM   10040 O  "O3'" . DA  J 6 51  ? 55.606  55.197 -32.801 1.00 162.16 ? -22 DA  J "O3'" 1 
ATOM   10041 C  "C2'" . DA  J 6 51  ? 55.166  52.821 -33.241 1.00 160.88 ? -22 DA  J "C2'" 1 
ATOM   10042 C  "C1'" . DA  J 6 51  ? 55.482  52.273 -31.856 1.00 160.71 ? -22 DA  J "C1'" 1 
ATOM   10043 N  N9    . DA  J 6 51  ? 55.469  50.816 -31.796 1.00 160.90 ? -22 DA  J N9    1 
ATOM   10044 C  C8    . DA  J 6 51  ? 54.548  49.985 -32.368 1.00 160.97 ? -22 DA  J C8    1 
ATOM   10045 N  N7    . DA  J 6 51  ? 54.773  48.712 -32.147 1.00 161.05 ? -22 DA  J N7    1 
ATOM   10046 C  C5    . DA  J 6 51  ? 55.928  48.704 -31.382 1.00 161.08 ? -22 DA  J C5    1 
ATOM   10047 C  C6    . DA  J 6 51  ? 56.689  47.656 -30.828 1.00 161.10 ? -22 DA  J C6    1 
ATOM   10048 N  N6    . DA  J 6 51  ? 56.372  46.365 -30.976 1.00 161.06 ? -22 DA  J N6    1 
ATOM   10049 N  N1    . DA  J 6 51  ? 57.792  47.988 -30.120 1.00 161.10 ? -22 DA  J N1    1 
ATOM   10050 C  C2    . DA  J 6 51  ? 58.114  49.284 -29.999 1.00 161.10 ? -22 DA  J C2    1 
ATOM   10051 N  N3    . DA  J 6 51  ? 57.467  50.356 -30.460 1.00 161.09 ? -22 DA  J N3    1 
ATOM   10052 C  C4    . DA  J 6 51  ? 56.376  49.993 -31.158 1.00 161.05 ? -22 DA  J C4    1 
ATOM   10053 P  P     . DA  J 6 52  ? 56.182  55.923 -34.108 1.00 163.23 ? -21 DA  J P     1 
ATOM   10054 O  OP1   . DA  J 6 52  ? 56.422  57.345 -33.770 1.00 163.12 ? -21 DA  J OP1   1 
ATOM   10055 O  OP2   . DA  J 6 52  ? 55.310  55.573 -35.251 1.00 163.12 ? -21 DA  J OP2   1 
ATOM   10056 O  "O5'" . DA  J 6 52  ? 57.590  55.186 -34.315 1.00 164.59 ? -21 DA  J "O5'" 1 
ATOM   10057 C  "C5'" . DA  J 6 52  ? 58.350  54.770 -33.170 1.00 165.96 ? -21 DA  J "C5'" 1 
ATOM   10058 C  "C4'" . DA  J 6 52  ? 59.429  53.754 -33.539 1.00 167.28 ? -21 DA  J "C4'" 1 
ATOM   10059 O  "O4'" . DA  J 6 52  ? 58.974  52.410 -33.240 1.00 167.56 ? -21 DA  J "O4'" 1 
ATOM   10060 C  "C3'" . DA  J 6 52  ? 59.874  53.735 -35.017 1.00 168.35 ? -21 DA  J "C3'" 1 
ATOM   10061 O  "O3'" . DA  J 6 52  ? 61.264  54.115 -35.126 1.00 169.50 ? -21 DA  J "O3'" 1 
ATOM   10062 C  "C2'" . DA  J 6 52  ? 59.649  52.276 -35.453 1.00 168.11 ? -21 DA  J "C2'" 1 
ATOM   10063 C  "C1'" . DA  J 6 52  ? 59.622  51.537 -34.125 1.00 167.82 ? -21 DA  J "C1'" 1 
ATOM   10064 N  N9    . DA  J 6 52  ? 58.899  50.268 -34.184 1.00 167.85 ? -21 DA  J N9    1 
ATOM   10065 C  C8    . DA  J 6 52  ? 57.830  49.970 -34.985 1.00 167.86 ? -21 DA  J C8    1 
ATOM   10066 N  N7    . DA  J 6 52  ? 57.436  48.719 -34.903 1.00 167.89 ? -21 DA  J N7    1 
ATOM   10067 C  C5    . DA  J 6 52  ? 58.335  48.145 -34.017 1.00 167.90 ? -21 DA  J C5    1 
ATOM   10068 C  C6    . DA  J 6 52  ? 58.461  46.833 -33.504 1.00 167.89 ? -21 DA  J C6    1 
ATOM   10069 N  N6    . DA  J 6 52  ? 57.640  45.828 -33.832 1.00 167.84 ? -21 DA  J N6    1 
ATOM   10070 N  N1    . DA  J 6 52  ? 59.470  46.596 -32.640 1.00 167.91 ? -21 DA  J N1    1 
ATOM   10071 C  C2    . DA  J 6 52  ? 60.291  47.603 -32.316 1.00 167.91 ? -21 DA  J C2    1 
ATOM   10072 N  N3    . DA  J 6 52  ? 60.271  48.872 -32.726 1.00 167.89 ? -21 DA  J N3    1 
ATOM   10073 C  C4    . DA  J 6 52  ? 59.260  49.079 -33.585 1.00 167.88 ? -21 DA  J C4    1 
ATOM   10074 P  P     . DC  J 6 53  ? 61.944  54.361 -36.564 1.00 170.62 ? -20 DC  J P     1 
ATOM   10075 O  OP1   . DC  J 6 53  ? 63.001  55.389 -36.392 1.00 170.58 ? -20 DC  J OP1   1 
ATOM   10076 O  OP2   . DC  J 6 53  ? 60.864  54.589 -37.551 1.00 170.50 ? -20 DC  J OP2   1 
ATOM   10077 O  "O5'" . DC  J 6 53  ? 62.614  52.924 -36.883 1.00 171.90 ? -20 DC  J "O5'" 1 
ATOM   10078 C  "C5'" . DC  J 6 53  ? 64.043  52.763 -36.997 1.00 173.25 ? -20 DC  J "C5'" 1 
ATOM   10079 C  "C4'" . DC  J 6 53  ? 64.557  51.691 -36.041 1.00 174.54 ? -20 DC  J "C4'" 1 
ATOM   10080 O  "O4'" . DC  J 6 53  ? 63.447  51.128 -35.295 1.00 174.94 ? -20 DC  J "O4'" 1 
ATOM   10081 C  "C3'" . DC  J 6 53  ? 65.214  50.487 -36.700 1.00 175.47 ? -20 DC  J "C3'" 1 
ATOM   10082 O  "O3'" . DC  J 6 53  ? 66.586  50.756 -36.997 1.00 176.36 ? -20 DC  J "O3'" 1 
ATOM   10083 C  "C2'" . DC  J 6 53  ? 65.081  49.430 -35.609 1.00 175.39 ? -20 DC  J "C2'" 1 
ATOM   10084 C  "C1'" . DC  J 6 53  ? 63.711  49.760 -35.006 1.00 175.30 ? -20 DC  J "C1'" 1 
ATOM   10085 N  N1    . DC  J 6 53  ? 62.593  48.920 -35.558 1.00 175.59 ? -20 DC  J N1    1 
ATOM   10086 C  C2    . DC  J 6 53  ? 62.443  47.591 -35.130 1.00 175.75 ? -20 DC  J C2    1 
ATOM   10087 O  O2    . DC  J 6 53  ? 63.216  47.136 -34.277 1.00 175.78 ? -20 DC  J O2    1 
ATOM   10088 N  N3    . DC  J 6 53  ? 61.426  46.849 -35.639 1.00 175.85 ? -20 DC  J N3    1 
ATOM   10089 C  C4    . DC  J 6 53  ? 60.599  47.378 -36.545 1.00 175.87 ? -20 DC  J C4    1 
ATOM   10090 N  N4    . DC  J 6 53  ? 59.615  46.607 -37.022 1.00 175.92 ? -20 DC  J N4    1 
ATOM   10091 C  C5    . DC  J 6 53  ? 60.744  48.721 -37.002 1.00 175.79 ? -20 DC  J C5    1 
ATOM   10092 C  C6    . DC  J 6 53  ? 61.741  49.447 -36.487 1.00 175.68 ? -20 DC  J C6    1 
ATOM   10093 P  P     . DC  J 6 54  ? 67.246  50.183 -38.344 1.00 177.18 ? -19 DC  J P     1 
ATOM   10094 O  OP1   . DC  J 6 54  ? 68.672  50.594 -38.360 1.00 177.18 ? -19 DC  J OP1   1 
ATOM   10095 O  OP2   . DC  J 6 54  ? 66.364  50.560 -39.475 1.00 177.18 ? -19 DC  J OP2   1 
ATOM   10096 O  "O5'" . DC  J 6 54  ? 67.139  48.584 -38.157 1.00 177.90 ? -19 DC  J "O5'" 1 
ATOM   10097 C  "C5'" . DC  J 6 54  ? 68.238  47.818 -37.631 1.00 178.60 ? -19 DC  J "C5'" 1 
ATOM   10098 C  "C4'" . DC  J 6 54  ? 68.062  46.338 -37.936 1.00 179.28 ? -19 DC  J "C4'" 1 
ATOM   10099 O  "O4'" . DC  J 6 54  ? 66.675  45.965 -37.716 1.00 179.65 ? -19 DC  J "O4'" 1 
ATOM   10100 C  "C3'" . DC  J 6 54  ? 68.397  45.925 -39.379 1.00 179.57 ? -19 DC  J "C3'" 1 
ATOM   10101 O  "O3'" . DC  J 6 54  ? 69.209  44.737 -39.390 1.00 179.60 ? -19 DC  J "O3'" 1 
ATOM   10102 C  "C2'" . DC  J 6 54  ? 67.024  45.674 -40.003 1.00 179.82 ? -19 DC  J "C2'" 1 
ATOM   10103 C  "C1'" . DC  J 6 54  ? 66.222  45.196 -38.804 1.00 179.99 ? -19 DC  J "C1'" 1 
ATOM   10104 N  N1    . DC  J 6 54  ? 64.751  45.401 -38.958 1.00 180.33 ? -19 DC  J N1    1 
ATOM   10105 C  C2    . DC  J 6 54  ? 63.889  44.297 -38.902 1.00 180.46 ? -19 DC  J C2    1 
ATOM   10106 O  O2    . DC  J 6 54  ? 64.359  43.175 -38.671 1.00 180.47 ? -19 DC  J O2    1 
ATOM   10107 N  N3    . DC  J 6 54  ? 62.558  44.496 -39.071 1.00 180.51 ? -19 DC  J N3    1 
ATOM   10108 C  C4    . DC  J 6 54  ? 62.092  45.721 -39.318 1.00 180.49 ? -19 DC  J C4    1 
ATOM   10109 N  N4    . DC  J 6 54  ? 60.773  45.865 -39.485 1.00 180.50 ? -19 DC  J N4    1 
ATOM   10110 C  C5    . DC  J 6 54  ? 62.956  46.854 -39.404 1.00 180.44 ? -19 DC  J C5    1 
ATOM   10111 C  C6    . DC  J 6 54  ? 64.265  46.648 -39.229 1.00 180.40 ? -19 DC  J C6    1 
ATOM   10112 P  P     . DC  J 6 55  ? 70.302  44.509 -40.549 1.00 179.55 ? -18 DC  J P     1 
ATOM   10113 O  OP1   . DC  J 6 55  ? 71.615  44.964 -40.034 1.00 179.61 ? -18 DC  J OP1   1 
ATOM   10114 O  OP2   . DC  J 6 55  ? 69.763  45.079 -41.808 1.00 179.55 ? -18 DC  J OP2   1 
ATOM   10115 O  "O5'" . DC  J 6 55  ? 70.341  42.916 -40.711 1.00 179.26 ? -18 DC  J "O5'" 1 
ATOM   10116 C  "C5'" . DC  J 6 55  ? 69.153  42.155 -40.542 1.00 178.93 ? -18 DC  J "C5'" 1 
ATOM   10117 C  "C4'" . DC  J 6 55  ? 69.029  41.075 -41.605 1.00 178.59 ? -18 DC  J "C4'" 1 
ATOM   10118 O  "O4'" . DC  J 6 55  ? 67.630  40.866 -41.901 1.00 178.48 ? -18 DC  J "O4'" 1 
ATOM   10119 C  "C3'" . DC  J 6 55  ? 69.654  41.411 -42.948 1.00 178.38 ? -18 DC  J "C3'" 1 
ATOM   10120 O  "O3'" . DC  J 6 55  ? 69.900  40.214 -43.674 1.00 178.22 ? -18 DC  J "O3'" 1 
ATOM   10121 C  "C2'" . DC  J 6 55  ? 68.556  42.237 -43.600 1.00 178.34 ? -18 DC  J "C2'" 1 
ATOM   10122 C  "C1'" . DC  J 6 55  ? 67.302  41.489 -43.133 1.00 178.34 ? -18 DC  J "C1'" 1 
ATOM   10123 N  N1    . DC  J 6 55  ? 66.087  42.358 -42.922 1.00 178.19 ? -18 DC  J N1    1 
ATOM   10124 C  C2    . DC  J 6 55  ? 64.890  41.769 -42.498 1.00 178.11 ? -18 DC  J C2    1 
ATOM   10125 O  O2    . DC  J 6 55  ? 64.848  40.545 -42.317 1.00 178.06 ? -18 DC  J O2    1 
ATOM   10126 N  N3    . DC  J 6 55  ? 63.803  42.555 -42.307 1.00 178.12 ? -18 DC  J N3    1 
ATOM   10127 C  C4    . DC  J 6 55  ? 63.883  43.869 -42.516 1.00 178.13 ? -18 DC  J C4    1 
ATOM   10128 N  N4    . DC  J 6 55  ? 62.784  44.603 -42.309 1.00 178.12 ? -18 DC  J N4    1 
ATOM   10129 C  C5    . DC  J 6 55  ? 65.091  44.491 -42.946 1.00 178.14 ? -18 DC  J C5    1 
ATOM   10130 C  C6    . DC  J 6 55  ? 66.156  43.708 -43.134 1.00 178.15 ? -18 DC  J C6    1 
ATOM   10131 P  P     . DT  J 6 56  ? 71.107  40.150 -44.723 1.00 178.05 ? -17 DT  J P     1 
ATOM   10132 O  OP1   . DT  J 6 56  ? 71.579  38.741 -44.790 1.00 178.10 ? -17 DT  J OP1   1 
ATOM   10133 O  OP2   . DT  J 6 56  ? 72.061  41.225 -44.367 1.00 178.21 ? -17 DT  J OP2   1 
ATOM   10134 O  "O5'" . DT  J 6 56  ? 70.402  40.562 -46.114 1.00 177.44 ? -17 DT  J "O5'" 1 
ATOM   10135 C  "C5'" . DT  J 6 56  ? 69.984  39.568 -47.054 1.00 176.82 ? -17 DT  J "C5'" 1 
ATOM   10136 C  "C4'" . DT  J 6 56  ? 68.697  38.921 -46.594 1.00 176.22 ? -17 DT  J "C4'" 1 
ATOM   10137 O  "O4'" . DT  J 6 56  ? 67.761  39.942 -46.222 1.00 176.10 ? -17 DT  J "O4'" 1 
ATOM   10138 C  "C3'" . DT  J 6 56  ? 67.984  38.072 -47.637 1.00 175.76 ? -17 DT  J "C3'" 1 
ATOM   10139 O  "O3'" . DT  J 6 56  ? 68.257  36.636 -47.417 1.00 175.15 ? -17 DT  J "O3'" 1 
ATOM   10140 C  "C2'" . DT  J 6 56  ? 66.494  38.478 -47.538 1.00 175.89 ? -17 DT  J "C2'" 1 
ATOM   10141 C  "C1'" . DT  J 6 56  ? 66.465  39.424 -46.339 1.00 176.02 ? -17 DT  J "C1'" 1 
ATOM   10142 N  N1    . DT  J 6 56  ? 65.525  40.568 -46.492 1.00 176.06 ? -17 DT  J N1    1 
ATOM   10143 C  C2    . DT  J 6 56  ? 64.204  40.411 -46.138 1.00 176.06 ? -17 DT  J C2    1 
ATOM   10144 O  O2    . DT  J 6 56  ? 63.727  39.349 -45.771 1.00 175.99 ? -17 DT  J O2    1 
ATOM   10145 N  N3    . DT  J 6 56  ? 63.436  41.535 -46.300 1.00 176.09 ? -17 DT  J N3    1 
ATOM   10146 C  C4    . DT  J 6 56  ? 63.860  42.786 -46.722 1.00 176.06 ? -17 DT  J C4    1 
ATOM   10147 O  O4    . DT  J 6 56  ? 63.055  43.702 -46.803 1.00 176.07 ? -17 DT  J O4    1 
ATOM   10148 C  C5    . DT  J 6 56  ? 65.258  42.889 -47.047 1.00 176.01 ? -17 DT  J C5    1 
ATOM   10149 C  C7    . DT  J 6 56  ? 65.823  44.194 -47.521 1.00 175.94 ? -17 DT  J C7    1 
ATOM   10150 C  C6    . DT  J 6 56  ? 66.018  41.792 -46.908 1.00 176.05 ? -17 DT  J C6    1 
ATOM   10151 P  P     . DA  J 6 57  ? 67.470  35.722 -46.335 1.00 174.52 ? -16 DA  J P     1 
ATOM   10152 O  OP1   . DA  J 6 57  ? 67.103  36.563 -45.168 1.00 174.55 ? -16 DA  J OP1   1 
ATOM   10153 O  OP2   . DA  J 6 57  ? 68.272  34.495 -46.120 1.00 174.51 ? -16 DA  J OP2   1 
ATOM   10154 O  "O5'" . DA  J 6 57  ? 66.143  35.296 -47.131 1.00 173.77 ? -16 DA  J "O5'" 1 
ATOM   10155 C  "C5'" . DA  J 6 57  ? 64.932  35.003 -46.431 1.00 172.98 ? -16 DA  J "C5'" 1 
ATOM   10156 C  "C4'" . DA  J 6 57  ? 63.737  35.056 -47.369 1.00 172.04 ? -16 DA  J "C4'" 1 
ATOM   10157 O  "O4'" . DA  J 6 57  ? 63.539  36.415 -47.848 1.00 171.93 ? -16 DA  J "O4'" 1 
ATOM   10158 C  "C3'" . DA  J 6 57  ? 63.841  34.173 -48.618 1.00 171.36 ? -16 DA  J "C3'" 1 
ATOM   10159 O  "O3'" . DA  J 6 57  ? 62.598  33.541 -48.848 1.00 170.35 ? -16 DA  J "O3'" 1 
ATOM   10160 C  "C2'" . DA  J 6 57  ? 64.162  35.175 -49.726 1.00 171.51 ? -16 DA  J "C2'" 1 
ATOM   10161 C  "C1'" . DA  J 6 57  ? 63.393  36.398 -49.252 1.00 171.75 ? -16 DA  J "C1'" 1 
ATOM   10162 N  N9    . DA  J 6 57  ? 63.900  37.656 -49.792 1.00 171.78 ? -16 DA  J N9    1 
ATOM   10163 C  C8    . DA  J 6 57  ? 64.971  37.824 -50.627 1.00 171.80 ? -16 DA  J C8    1 
ATOM   10164 N  N7    . DA  J 6 57  ? 65.203  39.076 -50.944 1.00 171.82 ? -16 DA  J N7    1 
ATOM   10165 C  C5    . DA  J 6 57  ? 64.204  39.775 -50.289 1.00 171.77 ? -16 DA  J C5    1 
ATOM   10166 C  C6    . DA  J 6 57  ? 63.879  41.144 -50.244 1.00 171.81 ? -16 DA  J C6    1 
ATOM   10167 N  N6    . DA  J 6 57  ? 64.581  42.088 -50.877 1.00 171.79 ? -16 DA  J N6    1 
ATOM   10168 N  N1    . DA  J 6 57  ? 62.807  41.507 -49.512 1.00 171.75 ? -16 DA  J N1    1 
ATOM   10169 C  C2    . DA  J 6 57  ? 62.099  40.557 -48.894 1.00 171.76 ? -16 DA  J C2    1 
ATOM   10170 N  N3    . DA  J 6 57  ? 62.317  39.245 -48.844 1.00 171.73 ? -16 DA  J N3    1 
ATOM   10171 C  C4    . DA  J 6 57  ? 63.394  38.916 -49.571 1.00 171.77 ? -16 DA  J C4    1 
ATOM   10172 P  P     . DA  J 6 58  ? 62.524  32.119