data_6LTJ
# 
_entry.id   6LTJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6LTJ         
WWPDB D_1300015408 
EMDB  EMD-0974     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB 'Structure of nucleosomo-bound human BAF complex in the apo state' EMD-0974 'associated EM volume' 
EMDB .                                                                  EMD-0968 'other EM volume'      
EMDB .                                                                  EMD-0969 'other EM volume'      
EMDB .                                                                  EMD-0970 'other EM volume'      
EMDB .                                                                  EMD-0971 'other EM volume'      
EMDB .                                                                  EMD-0972 'other EM volume'      
EMDB .                                                                  EMD-0973 'other EM volume'      
PDB  .                                                                  6LTH     unspecified            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6LTJ 
_pdbx_database_status.recvd_initial_deposition_date   2020-01-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shuang, H.' 1 ? 
'Zihan, W.'  2 ? 
'Yuan, T.'   3 ? 
'Zishuo, Y.' 4 ? 
'Jiali, Y.'  5 ? 
'Xinxin, W.' 6 ? 
'Jie, L.'    7 ? 
'Bijun, L.'  8 ? 
'Yanhui, X.' 9 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Structure of nucleosome-bound human BAF complex' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aaz9761 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shuang, H.' 1 ? 
primary 'Zihan, W.'  2 ? 
primary 'Yuan, T.'   3 ? 
primary 'Zishuo, Y.' 4 ? 
primary 'Jiali, Y.'  5 ? 
primary 'Xinxin, W.' 6 ? 
primary 'Jie, L.'    7 ? 
primary 'Bijun, L.'  8 ? 
primary 'Yanhui, X.' 9 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Histone H3.3'                                                                                  15360.983  2 ? 
? ?                                          ? 
2  polymer     man 'Histone H4'                                                                                    11394.426  2 ? 
? ?                                          ? 
3  polymer     man 'Histone H2A type 1'                                                                            13993.295  2 ? 
? ?                                          ? 
4  polymer     man 'Histone H2B'                                                                                   13873.086  2 ? 
? ?                                          ? 
5  polymer     man 'Transcription activator BRG1'                                                                  184923.828 1 
3.6.4.- ? ?                                          ? 
6  polymer     man 'Actin-like protein 6A'                                                                         45236.273  1 ? 
? ?                                          ? 
7  polymer     man 'Actin, cytoplasmic 1'                                                                          41782.660  1 ? 
? ?                                          ? 
8  polymer     man 'AT-rich interactive domain-containing protein 1A'                                              142316.531 1 ? 
? ?                                          ? 
9  polymer     man 'SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1' 38015.094  1 ? 
? 'UNP residues 1-113, UNP residues 172-385' ? 
10 polymer     man 'SWI/SNF complex subunit SMARCC2'                                                               133048.109 2 ? 
? ?                                          ? 
11 polymer     man 'SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1' 58311.391  1 ? 
? ?                                          ? 
12 polymer     man 'SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1' 46710.371  1 ? 
? ?                                          ? 
13 polymer     man 'Zinc finger protein ubi-d4'                                                                    32781.926  1 ? 
? 'UNP residues 1-100, UNP residues 209-391' ? 
14 polymer     syn 'DNA (119-MER)'                                                                                 36520.266  1 ? 
? ?                                          ? 
15 polymer     syn 'DNA (119-MER)'                                                                                 36929.520  1 ? 
? ?                                          ? 
16 non-polymer syn 'ZINC ION'                                                                                      65.409     1 ? 
? ?                                          ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
5  'ATP-dependent helicase SMARCA4,BRG1-associated factor 190A,BAF190A'                                           
6  'Actin-related protein Baf53a,ArpNbeta,BRG1-associated factor 53A,BAF53A'                                      
7  Beta-actin                                                                                                     
8  'ARID domain-containing protein 1A,B120,BRG1-associated factor 250,BAF250,BRG1-associated factor 250a,BAF250A' 
9  'BRG1-associated factor 47,BAF47'                                                                              
10 'BRG1-associated factor 170,BAF170'                                                                            
13 'Apoptosis response zinc finger protein,BRG1-associated factor 45D,BAF45D'                                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2  'polypeptide(L)'        no no 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3  'polypeptide(L)'        no no 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
C,G ? 
4  'polypeptide(L)'        no no 
;MSDPAKSAPAAKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAGRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;MSDPAKSAPAAKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAGRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5  'polypeptide(L)'        no no 
;MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMH
EKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQ
ALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGP
GPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPP
AASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKA
TIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSIL
QHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEY
VANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLE
AWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGV
SQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHK
RINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIV
DEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEE
TILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIM
QLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRG
FKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVR
VLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAG
VNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCE
EEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQ
KKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYR
SLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLG
RKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED
;
;MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMH
EKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQ
ALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGP
GPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPP
AASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKA
TIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSIL
QHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEY
VANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLE
AWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGV
SQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHK
RINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIV
DEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEE
TILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIM
QLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRG
FKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVR
VLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAG
VNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCE
EEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQ
KKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYR
SLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLG
RKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED
;
I   ? 
6  'polypeptide(L)'        no no 
;GALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNG
MVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILD
SGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWH
NYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTT
SVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWI
SKQEYEP
;
;GALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNG
MVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILD
SGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWH
NYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTT
SVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWI
SKQEYEP
;
J   ? 
7  'polypeptide(L)'        no no 
;MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD
DMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVT
HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITAL
APSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
;
;MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD
DMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVT
HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITAL
APSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
;
K   ? 
8  'polypeptide(L)'        no no 
;TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKN
KKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQST
SSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNK
DPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLM
PSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYS
VPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGT
NAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGT
RQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPV
QPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLP
GLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAF
SGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRP
HAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHR
NIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLT
YEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNA
VLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKG
SIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSL
VSQVICDVLFLIGQS
;
;TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKN
KKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQST
SSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNK
DPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLM
PSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYS
VPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGT
NAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGT
RQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPV
QPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLP
GLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAF
SGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRP
HAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHR
NIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLT
YEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNA
VLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKG
SIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSL
VSQVICDVLFLIGQS
;
L   ? 
9  'polypeptide(L)'        no no 
;MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHG
YTTLATSVTLLKASEVEEILDGNDEKYKAVSISGGSGGSGGSDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMN
EKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENS
PEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQD
RNTRRMRRLANTAPAW
;
;MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHG
YTTLATSVTLLKASEVEEILDGNDEKYKAVSISGGSGGSGGSDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMN
EKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENS
PEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQD
RNTRRMRRLANTAPAW
;
M   ? 
10 'polypeptide(L)'        no no 
;MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKC
FLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDII
KRHQGTVTEDKNNASHVVYPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAK
WILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGP
STPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENST
GNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEY
LTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQQTSASQQMLN
FPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFL
RLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVE
EAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEK
GKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVE
ERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQ
PPPALPPGSQPIPPTGAAGPPAVHGLAVAPASVVPAPAGSGAPPGSLGPSEQIGQAGSTAGPQQQQPAGAPQPGAVPPGV
PPPGPHGPSPFPNQQTPPSMMPGAVPGSGHPGVAGNAPLGLPFGMPPPPPPPAPSIIPFGSLADSISINLPAPPNLHGHH
HHLPFAPGTLPPPNLPVSMANPLHPNLPATTTMPSSLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLPDPGTPLPPDPT
APSPGTVTPVPPPQ
;
;MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKC
FLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDII
KRHQGTVTEDKNNASHVVYPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAK
WILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGP
STPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENST
GNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEY
LTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQQTSASQQMLN
FPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFL
RLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVE
EAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEK
GKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVE
ERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQ
PPPALPPGSQPIPPTGAAGPPAVHGLAVAPASVVPAPAGSGAPPGSLGPSEQIGQAGSTAGPQQQQPAGAPQPGAVPPGV
PPPGPHGPSPFPNQQTPPSMMPGAVPGSGHPGVAGNAPLGLPFGMPPPPPPPAPSIIPFGSLADSISINLPAPPNLHGHH
HHLPFAPGTLPPPNLPVSMANPLHPNLPATTTMPSSLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLPDPGTPLPPDPT
APSPGTVTPVPPPQ
;
N,O ? 
11 'polypeptide(L)'        no no 
;MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPG
YGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQT
IMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSL
VIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALW
QYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTL
KTQMNSFLLSTASQQEIATLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRAE
FYFQPWAQEAVCRYFYSKVQQRRQELEQALGIRNT
;
;MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPG
YGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQT
IMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSL
VIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALW
QYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTL
KTQMNSFLLSTASQQEIATLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRAE
FYFQPWAQEAVCRYFYSKVQQRRQELEQALGIRNT
;
P   ? 
12 'polypeptide(L)'        no no 
;MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKV
WDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQR
QSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRK
LEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQEEREKEAAEQAERSQSSIVP
EEEQAANKGEEKKDDENIPMETEETHLEETTESQQNGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPP
TDPIPEDEKKE
;
;MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKV
WDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQR
QSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRK
LEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQEEREKEAAEQAERSQSSIVP
EEEQAANKGEEKKDDENIPMETEETHLEETTESQQNGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPP
TDPIPEDEKKE
;
Q   ? 
13 'polypeptide(L)'        no no 
;MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQLYSYPARRWR
KKRRAHPPEDPRLSFPSIKPGGSGGSGGSYACDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKS
KKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSEND
DQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
;
;MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQLYSYPARRWR
KKRRAHPPEDPRLSFPSIKPGGSGGSGGSYACDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKS
KKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSEND
DQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
;
R   ? 
14 polydeoxyribonucleotide no no 
;(DT)(DG)(DC)(DC)(DG)(DA)(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)
(DT)(DC)(DG)(DT)(DA)(DG)(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)
(DG)(DC)(DT)(DT)(DA)(DA)(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)
(DT)(DG)(DT)(DC)(DC)(DC)(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)
(DC)(DC)(DA)(DA)(DG)(DG)(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)
(DT)(DC)(DT)(DC)(DC)(DA)(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)
;
;TGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCG
CCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGA
;
X   ? 
15 polydeoxyribonucleotide no no 
;(DT)(DC)(DT)(DG)(DA)(DC)(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)
(DT)(DA)(DG)(DG)(DG)(DA)(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)
(DG)(DG)(DT)(DT)(DA)(DA)(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)
(DC)(DG)(DC)(DG)(DT)(DA)(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)
(DG)(DT)(DG)(DC)(DT)(DA)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)
(DC)(DA)(DA)(DT)(DT)(DG)(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)
;
;TCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCG
GTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCA
;
Y   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    ALA n 
1  3    ARG n 
1  4    THR n 
1  5    LYS n 
1  6    GLN n 
1  7    THR n 
1  8    ALA n 
1  9    ARG n 
1  10   LYS n 
1  11   SER n 
1  12   THR n 
1  13   GLY n 
1  14   GLY n 
1  15   LYS n 
1  16   ALA n 
1  17   PRO n 
1  18   ARG n 
1  19   LYS n 
1  20   GLN n 
1  21   LEU n 
1  22   ALA n 
1  23   THR n 
1  24   LYS n 
1  25   ALA n 
1  26   ALA n 
1  27   ARG n 
1  28   LYS n 
1  29   SER n 
1  30   ALA n 
1  31   PRO n 
1  32   SER n 
1  33   THR n 
1  34   GLY n 
1  35   GLY n 
1  36   VAL n 
1  37   LYS n 
1  38   LYS n 
1  39   PRO n 
1  40   HIS n 
1  41   ARG n 
1  42   TYR n 
1  43   ARG n 
1  44   PRO n 
1  45   GLY n 
1  46   THR n 
1  47   VAL n 
1  48   ALA n 
1  49   LEU n 
1  50   ARG n 
1  51   GLU n 
1  52   ILE n 
1  53   ARG n 
1  54   ARG n 
1  55   TYR n 
1  56   GLN n 
1  57   LYS n 
1  58   SER n 
1  59   THR n 
1  60   GLU n 
1  61   LEU n 
1  62   LEU n 
1  63   ILE n 
1  64   ARG n 
1  65   LYS n 
1  66   LEU n 
1  67   PRO n 
1  68   PHE n 
1  69   GLN n 
1  70   ARG n 
1  71   LEU n 
1  72   VAL n 
1  73   ARG n 
1  74   GLU n 
1  75   ILE n 
1  76   ALA n 
1  77   GLN n 
1  78   ASP n 
1  79   PHE n 
1  80   LYS n 
1  81   THR n 
1  82   ASP n 
1  83   LEU n 
1  84   ARG n 
1  85   PHE n 
1  86   GLN n 
1  87   SER n 
1  88   ALA n 
1  89   ALA n 
1  90   ILE n 
1  91   GLY n 
1  92   ALA n 
1  93   LEU n 
1  94   GLN n 
1  95   GLU n 
1  96   ALA n 
1  97   SER n 
1  98   GLU n 
1  99   ALA n 
1  100  TYR n 
1  101  LEU n 
1  102  VAL n 
1  103  GLY n 
1  104  LEU n 
1  105  PHE n 
1  106  GLU n 
1  107  ASP n 
1  108  THR n 
1  109  ASN n 
1  110  LEU n 
1  111  CYS n 
1  112  ALA n 
1  113  ILE n 
1  114  HIS n 
1  115  ALA n 
1  116  LYS n 
1  117  ARG n 
1  118  VAL n 
1  119  THR n 
1  120  ILE n 
1  121  MET n 
1  122  PRO n 
1  123  LYS n 
1  124  ASP n 
1  125  ILE n 
1  126  GLN n 
1  127  LEU n 
1  128  ALA n 
1  129  ARG n 
1  130  ARG n 
1  131  ILE n 
1  132  ARG n 
1  133  GLY n 
1  134  GLU n 
1  135  ARG n 
1  136  ALA n 
2  1    MET n 
2  2    SER n 
2  3    GLY n 
2  4    ARG n 
2  5    GLY n 
2  6    LYS n 
2  7    GLY n 
2  8    GLY n 
2  9    LYS n 
2  10   GLY n 
2  11   LEU n 
2  12   GLY n 
2  13   LYS n 
2  14   GLY n 
2  15   GLY n 
2  16   ALA n 
2  17   LYS n 
2  18   ARG n 
2  19   HIS n 
2  20   ARG n 
2  21   LYS n 
2  22   VAL n 
2  23   LEU n 
2  24   ARG n 
2  25   ASP n 
2  26   ASN n 
2  27   ILE n 
2  28   GLN n 
2  29   GLY n 
2  30   ILE n 
2  31   THR n 
2  32   LYS n 
2  33   PRO n 
2  34   ALA n 
2  35   ILE n 
2  36   ARG n 
2  37   ARG n 
2  38   LEU n 
2  39   ALA n 
2  40   ARG n 
2  41   ARG n 
2  42   GLY n 
2  43   GLY n 
2  44   VAL n 
2  45   LYS n 
2  46   ARG n 
2  47   ILE n 
2  48   SER n 
2  49   GLY n 
2  50   LEU n 
2  51   ILE n 
2  52   TYR n 
2  53   GLU n 
2  54   GLU n 
2  55   THR n 
2  56   ARG n 
2  57   GLY n 
2  58   VAL n 
2  59   LEU n 
2  60   LYS n 
2  61   VAL n 
2  62   PHE n 
2  63   LEU n 
2  64   GLU n 
2  65   ASN n 
2  66   VAL n 
2  67   ILE n 
2  68   ARG n 
2  69   ASP n 
2  70   ALA n 
2  71   VAL n 
2  72   THR n 
2  73   TYR n 
2  74   THR n 
2  75   GLU n 
2  76   HIS n 
2  77   ALA n 
2  78   LYS n 
2  79   ARG n 
2  80   LYS n 
2  81   THR n 
2  82   VAL n 
2  83   THR n 
2  84   ALA n 
2  85   MET n 
2  86   ASP n 
2  87   VAL n 
2  88   VAL n 
2  89   TYR n 
2  90   ALA n 
2  91   LEU n 
2  92   LYS n 
2  93   ARG n 
2  94   GLN n 
2  95   GLY n 
2  96   ARG n 
2  97   THR n 
2  98   LEU n 
2  99   TYR n 
2  100  GLY n 
2  101  PHE n 
2  102  GLY n 
2  103  GLY n 
3  1    MET n 
3  2    SER n 
3  3    GLY n 
3  4    ARG n 
3  5    GLY n 
3  6    LYS n 
3  7    GLN n 
3  8    GLY n 
3  9    GLY n 
3  10   LYS n 
3  11   THR n 
3  12   ARG n 
3  13   ALA n 
3  14   LYS n 
3  15   ALA n 
3  16   LYS n 
3  17   THR n 
3  18   ARG n 
3  19   SER n 
3  20   SER n 
3  21   ARG n 
3  22   ALA n 
3  23   GLY n 
3  24   LEU n 
3  25   GLN n 
3  26   PHE n 
3  27   PRO n 
3  28   VAL n 
3  29   GLY n 
3  30   ARG n 
3  31   VAL n 
3  32   HIS n 
3  33   ARG n 
3  34   LEU n 
3  35   LEU n 
3  36   ARG n 
3  37   LYS n 
3  38   GLY n 
3  39   ASN n 
3  40   TYR n 
3  41   ALA n 
3  42   GLU n 
3  43   ARG n 
3  44   VAL n 
3  45   GLY n 
3  46   ALA n 
3  47   GLY n 
3  48   ALA n 
3  49   PRO n 
3  50   VAL n 
3  51   TYR n 
3  52   LEU n 
3  53   ALA n 
3  54   ALA n 
3  55   VAL n 
3  56   LEU n 
3  57   GLU n 
3  58   TYR n 
3  59   LEU n 
3  60   THR n 
3  61   ALA n 
3  62   GLU n 
3  63   ILE n 
3  64   LEU n 
3  65   GLU n 
3  66   LEU n 
3  67   ALA n 
3  68   GLY n 
3  69   ASN n 
3  70   ALA n 
3  71   ALA n 
3  72   ARG n 
3  73   ASP n 
3  74   ASN n 
3  75   LYS n 
3  76   LYS n 
3  77   THR n 
3  78   ARG n 
3  79   ILE n 
3  80   ILE n 
3  81   PRO n 
3  82   ARG n 
3  83   HIS n 
3  84   LEU n 
3  85   GLN n 
3  86   LEU n 
3  87   ALA n 
3  88   VAL n 
3  89   ARG n 
3  90   ASN n 
3  91   ASP n 
3  92   GLU n 
3  93   GLU n 
3  94   LEU n 
3  95   ASN n 
3  96   LYS n 
3  97   LEU n 
3  98   LEU n 
3  99   GLY n 
3  100  GLY n 
3  101  VAL n 
3  102  THR n 
3  103  ILE n 
3  104  ALA n 
3  105  GLN n 
3  106  GLY n 
3  107  GLY n 
3  108  VAL n 
3  109  LEU n 
3  110  PRO n 
3  111  ASN n 
3  112  ILE n 
3  113  GLN n 
3  114  SER n 
3  115  VAL n 
3  116  LEU n 
3  117  LEU n 
3  118  PRO n 
3  119  LYS n 
3  120  LYS n 
3  121  THR n 
3  122  GLU n 
3  123  SER n 
3  124  ALA n 
3  125  LYS n 
3  126  SER n 
3  127  ALA n 
3  128  LYS n 
3  129  SER n 
3  130  LYS n 
4  1    MET n 
4  2    SER n 
4  3    ASP n 
4  4    PRO n 
4  5    ALA n 
4  6    LYS n 
4  7    SER n 
4  8    ALA n 
4  9    PRO n 
4  10   ALA n 
4  11   ALA n 
4  12   LYS n 
4  13   LYS n 
4  14   GLY n 
4  15   SER n 
4  16   LYS n 
4  17   LYS n 
4  18   ALA n 
4  19   VAL n 
4  20   THR n 
4  21   LYS n 
4  22   THR n 
4  23   GLN n 
4  24   LYS n 
4  25   LYS n 
4  26   ASP n 
4  27   GLY n 
4  28   LYS n 
4  29   LYS n 
4  30   ARG n 
4  31   ARG n 
4  32   LYS n 
4  33   SER n 
4  34   ARG n 
4  35   LYS n 
4  36   GLU n 
4  37   SER n 
4  38   TYR n 
4  39   ALA n 
4  40   ILE n 
4  41   TYR n 
4  42   VAL n 
4  43   TYR n 
4  44   LYS n 
4  45   VAL n 
4  46   LEU n 
4  47   LYS n 
4  48   GLN n 
4  49   VAL n 
4  50   HIS n 
4  51   PRO n 
4  52   ASP n 
4  53   THR n 
4  54   GLY n 
4  55   ILE n 
4  56   SER n 
4  57   SER n 
4  58   LYS n 
4  59   ALA n 
4  60   MET n 
4  61   SER n 
4  62   ILE n 
4  63   MET n 
4  64   ASN n 
4  65   SER n 
4  66   PHE n 
4  67   VAL n 
4  68   ASN n 
4  69   ASP n 
4  70   VAL n 
4  71   PHE n 
4  72   GLU n 
4  73   ARG n 
4  74   ILE n 
4  75   ALA n 
4  76   GLY n 
4  77   GLU n 
4  78   ALA n 
4  79   SER n 
4  80   ARG n 
4  81   LEU n 
4  82   ALA n 
4  83   HIS n 
4  84   TYR n 
4  85   ASN n 
4  86   LYS n 
4  87   ARG n 
4  88   SER n 
4  89   THR n 
4  90   ILE n 
4  91   THR n 
4  92   SER n 
4  93   ARG n 
4  94   GLU n 
4  95   ILE n 
4  96   GLN n 
4  97   THR n 
4  98   ALA n 
4  99   GLY n 
4  100  ARG n 
4  101  LEU n 
4  102  LEU n 
4  103  LEU n 
4  104  PRO n 
4  105  GLY n 
4  106  GLU n 
4  107  LEU n 
4  108  ALA n 
4  109  LYS n 
4  110  HIS n 
4  111  ALA n 
4  112  VAL n 
4  113  SER n 
4  114  GLU n 
4  115  GLY n 
4  116  THR n 
4  117  LYS n 
4  118  ALA n 
4  119  VAL n 
4  120  THR n 
4  121  LYS n 
4  122  TYR n 
4  123  THR n 
4  124  SER n 
4  125  ALA n 
4  126  LYS n 
5  1    MET n 
5  2    SER n 
5  3    THR n 
5  4    PRO n 
5  5    ASP n 
5  6    PRO n 
5  7    PRO n 
5  8    LEU n 
5  9    GLY n 
5  10   GLY n 
5  11   THR n 
5  12   PRO n 
5  13   ARG n 
5  14   PRO n 
5  15   GLY n 
5  16   PRO n 
5  17   SER n 
5  18   PRO n 
5  19   GLY n 
5  20   PRO n 
5  21   GLY n 
5  22   PRO n 
5  23   SER n 
5  24   PRO n 
5  25   GLY n 
5  26   ALA n 
5  27   MET n 
5  28   LEU n 
5  29   GLY n 
5  30   PRO n 
5  31   SER n 
5  32   PRO n 
5  33   GLY n 
5  34   PRO n 
5  35   SER n 
5  36   PRO n 
5  37   GLY n 
5  38   SER n 
5  39   ALA n 
5  40   HIS n 
5  41   SER n 
5  42   MET n 
5  43   MET n 
5  44   GLY n 
5  45   PRO n 
5  46   SER n 
5  47   PRO n 
5  48   GLY n 
5  49   PRO n 
5  50   PRO n 
5  51   SER n 
5  52   ALA n 
5  53   GLY n 
5  54   HIS n 
5  55   PRO n 
5  56   ILE n 
5  57   PRO n 
5  58   THR n 
5  59   GLN n 
5  60   GLY n 
5  61   PRO n 
5  62   GLY n 
5  63   GLY n 
5  64   TYR n 
5  65   PRO n 
5  66   GLN n 
5  67   ASP n 
5  68   ASN n 
5  69   MET n 
5  70   HIS n 
5  71   GLN n 
5  72   MET n 
5  73   HIS n 
5  74   LYS n 
5  75   PRO n 
5  76   MET n 
5  77   GLU n 
5  78   SER n 
5  79   MET n 
5  80   HIS n 
5  81   GLU n 
5  82   LYS n 
5  83   GLY n 
5  84   MET n 
5  85   SER n 
5  86   ASP n 
5  87   ASP n 
5  88   PRO n 
5  89   ARG n 
5  90   TYR n 
5  91   ASN n 
5  92   GLN n 
5  93   MET n 
5  94   LYS n 
5  95   GLY n 
5  96   MET n 
5  97   GLY n 
5  98   MET n 
5  99   ARG n 
5  100  SER n 
5  101  GLY n 
5  102  GLY n 
5  103  HIS n 
5  104  ALA n 
5  105  GLY n 
5  106  MET n 
5  107  GLY n 
5  108  PRO n 
5  109  PRO n 
5  110  PRO n 
5  111  SER n 
5  112  PRO n 
5  113  MET n 
5  114  ASP n 
5  115  GLN n 
5  116  HIS n 
5  117  SER n 
5  118  GLN n 
5  119  GLY n 
5  120  TYR n 
5  121  PRO n 
5  122  SER n 
5  123  PRO n 
5  124  LEU n 
5  125  GLY n 
5  126  GLY n 
5  127  SER n 
5  128  GLU n 
5  129  HIS n 
5  130  ALA n 
5  131  SER n 
5  132  SER n 
5  133  PRO n 
5  134  VAL n 
5  135  PRO n 
5  136  ALA n 
5  137  SER n 
5  138  GLY n 
5  139  PRO n 
5  140  SER n 
5  141  SER n 
5  142  GLY n 
5  143  PRO n 
5  144  GLN n 
5  145  MET n 
5  146  SER n 
5  147  SER n 
5  148  GLY n 
5  149  PRO n 
5  150  GLY n 
5  151  GLY n 
5  152  ALA n 
5  153  PRO n 
5  154  LEU n 
5  155  ASP n 
5  156  GLY n 
5  157  ALA n 
5  158  ASP n 
5  159  PRO n 
5  160  GLN n 
5  161  ALA n 
5  162  LEU n 
5  163  GLY n 
5  164  GLN n 
5  165  GLN n 
5  166  ASN n 
5  167  ARG n 
5  168  GLY n 
5  169  PRO n 
5  170  THR n 
5  171  PRO n 
5  172  PHE n 
5  173  ASN n 
5  174  GLN n 
5  175  ASN n 
5  176  GLN n 
5  177  LEU n 
5  178  HIS n 
5  179  GLN n 
5  180  LEU n 
5  181  ARG n 
5  182  ALA n 
5  183  GLN n 
5  184  ILE n 
5  185  MET n 
5  186  ALA n 
5  187  TYR n 
5  188  LYS n 
5  189  MET n 
5  190  LEU n 
5  191  ALA n 
5  192  ARG n 
5  193  GLY n 
5  194  GLN n 
5  195  PRO n 
5  196  LEU n 
5  197  PRO n 
5  198  ASP n 
5  199  HIS n 
5  200  LEU n 
5  201  GLN n 
5  202  MET n 
5  203  ALA n 
5  204  VAL n 
5  205  GLN n 
5  206  GLY n 
5  207  LYS n 
5  208  ARG n 
5  209  PRO n 
5  210  MET n 
5  211  PRO n 
5  212  GLY n 
5  213  MET n 
5  214  GLN n 
5  215  GLN n 
5  216  GLN n 
5  217  MET n 
5  218  PRO n 
5  219  THR n 
5  220  LEU n 
5  221  PRO n 
5  222  PRO n 
5  223  PRO n 
5  224  SER n 
5  225  VAL n 
5  226  SER n 
5  227  ALA n 
5  228  THR n 
5  229  GLY n 
5  230  PRO n 
5  231  GLY n 
5  232  PRO n 
5  233  GLY n 
5  234  PRO n 
5  235  GLY n 
5  236  PRO n 
5  237  GLY n 
5  238  PRO n 
5  239  GLY n 
5  240  PRO n 
5  241  GLY n 
5  242  PRO n 
5  243  GLY n 
5  244  PRO n 
5  245  ALA n 
5  246  PRO n 
5  247  PRO n 
5  248  ASN n 
5  249  TYR n 
5  250  SER n 
5  251  ARG n 
5  252  PRO n 
5  253  HIS n 
5  254  GLY n 
5  255  MET n 
5  256  GLY n 
5  257  GLY n 
5  258  PRO n 
5  259  ASN n 
5  260  MET n 
5  261  PRO n 
5  262  PRO n 
5  263  PRO n 
5  264  GLY n 
5  265  PRO n 
5  266  SER n 
5  267  GLY n 
5  268  VAL n 
5  269  PRO n 
5  270  PRO n 
5  271  GLY n 
5  272  MET n 
5  273  PRO n 
5  274  GLY n 
5  275  GLN n 
5  276  PRO n 
5  277  PRO n 
5  278  GLY n 
5  279  GLY n 
5  280  PRO n 
5  281  PRO n 
5  282  LYS n 
5  283  PRO n 
5  284  TRP n 
5  285  PRO n 
5  286  GLU n 
5  287  GLY n 
5  288  PRO n 
5  289  MET n 
5  290  ALA n 
5  291  ASN n 
5  292  ALA n 
5  293  ALA n 
5  294  ALA n 
5  295  PRO n 
5  296  THR n 
5  297  SER n 
5  298  THR n 
5  299  PRO n 
5  300  GLN n 
5  301  LYS n 
5  302  LEU n 
5  303  ILE n 
5  304  PRO n 
5  305  PRO n 
5  306  GLN n 
5  307  PRO n 
5  308  THR n 
5  309  GLY n 
5  310  ARG n 
5  311  PRO n 
5  312  SER n 
5  313  PRO n 
5  314  ALA n 
5  315  PRO n 
5  316  PRO n 
5  317  ALA n 
5  318  VAL n 
5  319  PRO n 
5  320  PRO n 
5  321  ALA n 
5  322  ALA n 
5  323  SER n 
5  324  PRO n 
5  325  VAL n 
5  326  MET n 
5  327  PRO n 
5  328  PRO n 
5  329  GLN n 
5  330  THR n 
5  331  GLN n 
5  332  SER n 
5  333  PRO n 
5  334  GLY n 
5  335  GLN n 
5  336  PRO n 
5  337  ALA n 
5  338  GLN n 
5  339  PRO n 
5  340  ALA n 
5  341  PRO n 
5  342  MET n 
5  343  VAL n 
5  344  PRO n 
5  345  LEU n 
5  346  HIS n 
5  347  GLN n 
5  348  LYS n 
5  349  GLN n 
5  350  SER n 
5  351  ARG n 
5  352  ILE n 
5  353  THR n 
5  354  PRO n 
5  355  ILE n 
5  356  GLN n 
5  357  LYS n 
5  358  PRO n 
5  359  ARG n 
5  360  GLY n 
5  361  LEU n 
5  362  ASP n 
5  363  PRO n 
5  364  VAL n 
5  365  GLU n 
5  366  ILE n 
5  367  LEU n 
5  368  GLN n 
5  369  GLU n 
5  370  ARG n 
5  371  GLU n 
5  372  TYR n 
5  373  ARG n 
5  374  LEU n 
5  375  GLN n 
5  376  ALA n 
5  377  ARG n 
5  378  ILE n 
5  379  ALA n 
5  380  HIS n 
5  381  ARG n 
5  382  ILE n 
5  383  GLN n 
5  384  GLU n 
5  385  LEU n 
5  386  GLU n 
5  387  ASN n 
5  388  LEU n 
5  389  PRO n 
5  390  GLY n 
5  391  SER n 
5  392  LEU n 
5  393  ALA n 
5  394  GLY n 
5  395  ASP n 
5  396  LEU n 
5  397  ARG n 
5  398  THR n 
5  399  LYS n 
5  400  ALA n 
5  401  THR n 
5  402  ILE n 
5  403  GLU n 
5  404  LEU n 
5  405  LYS n 
5  406  ALA n 
5  407  LEU n 
5  408  ARG n 
5  409  LEU n 
5  410  LEU n 
5  411  ASN n 
5  412  PHE n 
5  413  GLN n 
5  414  ARG n 
5  415  GLN n 
5  416  LEU n 
5  417  ARG n 
5  418  GLN n 
5  419  GLU n 
5  420  VAL n 
5  421  VAL n 
5  422  VAL n 
5  423  CYS n 
5  424  MET n 
5  425  ARG n 
5  426  ARG n 
5  427  ASP n 
5  428  THR n 
5  429  ALA n 
5  430  LEU n 
5  431  GLU n 
5  432  THR n 
5  433  ALA n 
5  434  LEU n 
5  435  ASN n 
5  436  ALA n 
5  437  LYS n 
5  438  ALA n 
5  439  TYR n 
5  440  LYS n 
5  441  ARG n 
5  442  SER n 
5  443  LYS n 
5  444  ARG n 
5  445  GLN n 
5  446  SER n 
5  447  LEU n 
5  448  ARG n 
5  449  GLU n 
5  450  ALA n 
5  451  ARG n 
5  452  ILE n 
5  453  THR n 
5  454  GLU n 
5  455  LYS n 
5  456  LEU n 
5  457  GLU n 
5  458  LYS n 
5  459  GLN n 
5  460  GLN n 
5  461  LYS n 
5  462  ILE n 
5  463  GLU n 
5  464  GLN n 
5  465  GLU n 
5  466  ARG n 
5  467  LYS n 
5  468  ARG n 
5  469  ARG n 
5  470  GLN n 
5  471  LYS n 
5  472  HIS n 
5  473  GLN n 
5  474  GLU n 
5  475  TYR n 
5  476  LEU n 
5  477  ASN n 
5  478  SER n 
5  479  ILE n 
5  480  LEU n 
5  481  GLN n 
5  482  HIS n 
5  483  ALA n 
5  484  LYS n 
5  485  ASP n 
5  486  PHE n 
5  487  LYS n 
5  488  GLU n 
5  489  TYR n 
5  490  HIS n 
5  491  ARG n 
5  492  SER n 
5  493  VAL n 
5  494  THR n 
5  495  GLY n 
5  496  LYS n 
5  497  ILE n 
5  498  GLN n 
5  499  LYS n 
5  500  LEU n 
5  501  THR n 
5  502  LYS n 
5  503  ALA n 
5  504  VAL n 
5  505  ALA n 
5  506  THR n 
5  507  TYR n 
5  508  HIS n 
5  509  ALA n 
5  510  ASN n 
5  511  THR n 
5  512  GLU n 
5  513  ARG n 
5  514  GLU n 
5  515  GLN n 
5  516  LYS n 
5  517  LYS n 
5  518  GLU n 
5  519  ASN n 
5  520  GLU n 
5  521  ARG n 
5  522  ILE n 
5  523  GLU n 
5  524  LYS n 
5  525  GLU n 
5  526  ARG n 
5  527  MET n 
5  528  ARG n 
5  529  ARG n 
5  530  LEU n 
5  531  MET n 
5  532  ALA n 
5  533  GLU n 
5  534  ASP n 
5  535  GLU n 
5  536  GLU n 
5  537  GLY n 
5  538  TYR n 
5  539  ARG n 
5  540  LYS n 
5  541  LEU n 
5  542  ILE n 
5  543  ASP n 
5  544  GLN n 
5  545  LYS n 
5  546  LYS n 
5  547  ASP n 
5  548  LYS n 
5  549  ARG n 
5  550  LEU n 
5  551  ALA n 
5  552  TYR n 
5  553  LEU n 
5  554  LEU n 
5  555  GLN n 
5  556  GLN n 
5  557  THR n 
5  558  ASP n 
5  559  GLU n 
5  560  TYR n 
5  561  VAL n 
5  562  ALA n 
5  563  ASN n 
5  564  LEU n 
5  565  THR n 
5  566  GLU n 
5  567  LEU n 
5  568  VAL n 
5  569  ARG n 
5  570  GLN n 
5  571  HIS n 
5  572  LYS n 
5  573  ALA n 
5  574  ALA n 
5  575  GLN n 
5  576  VAL n 
5  577  ALA n 
5  578  LYS n 
5  579  GLU n 
5  580  LYS n 
5  581  LYS n 
5  582  LYS n 
5  583  LYS n 
5  584  LYS n 
5  585  LYS n 
5  586  LYS n 
5  587  LYS n 
5  588  LYS n 
5  589  ALA n 
5  590  GLU n 
5  591  ASN n 
5  592  ALA n 
5  593  GLU n 
5  594  GLY n 
5  595  GLN n 
5  596  THR n 
5  597  PRO n 
5  598  ALA n 
5  599  ILE n 
5  600  GLY n 
5  601  PRO n 
5  602  ASP n 
5  603  GLY n 
5  604  GLU n 
5  605  PRO n 
5  606  LEU n 
5  607  ASP n 
5  608  GLU n 
5  609  THR n 
5  610  SER n 
5  611  GLN n 
5  612  MET n 
5  613  SER n 
5  614  ASP n 
5  615  LEU n 
5  616  PRO n 
5  617  VAL n 
5  618  LYS n 
5  619  VAL n 
5  620  ILE n 
5  621  HIS n 
5  622  VAL n 
5  623  GLU n 
5  624  SER n 
5  625  GLY n 
5  626  LYS n 
5  627  ILE n 
5  628  LEU n 
5  629  THR n 
5  630  GLY n 
5  631  THR n 
5  632  ASP n 
5  633  ALA n 
5  634  PRO n 
5  635  LYS n 
5  636  ALA n 
5  637  GLY n 
5  638  GLN n 
5  639  LEU n 
5  640  GLU n 
5  641  ALA n 
5  642  TRP n 
5  643  LEU n 
5  644  GLU n 
5  645  MET n 
5  646  ASN n 
5  647  PRO n 
5  648  GLY n 
5  649  TYR n 
5  650  GLU n 
5  651  VAL n 
5  652  ALA n 
5  653  PRO n 
5  654  ARG n 
5  655  SER n 
5  656  ASP n 
5  657  SER n 
5  658  GLU n 
5  659  GLU n 
5  660  SER n 
5  661  GLY n 
5  662  SER n 
5  663  GLU n 
5  664  GLU n 
5  665  GLU n 
5  666  GLU n 
5  667  GLU n 
5  668  GLU n 
5  669  GLU n 
5  670  GLU n 
5  671  GLU n 
5  672  GLU n 
5  673  GLN n 
5  674  PRO n 
5  675  GLN n 
5  676  ALA n 
5  677  ALA n 
5  678  GLN n 
5  679  PRO n 
5  680  PRO n 
5  681  THR n 
5  682  LEU n 
5  683  PRO n 
5  684  VAL n 
5  685  GLU n 
5  686  GLU n 
5  687  LYS n 
5  688  LYS n 
5  689  LYS n 
5  690  ILE n 
5  691  PRO n 
5  692  ASP n 
5  693  PRO n 
5  694  ASP n 
5  695  SER n 
5  696  ASP n 
5  697  ASP n 
5  698  VAL n 
5  699  SER n 
5  700  GLU n 
5  701  VAL n 
5  702  ASP n 
5  703  ALA n 
5  704  ARG n 
5  705  HIS n 
5  706  ILE n 
5  707  ILE n 
5  708  GLU n 
5  709  ASN n 
5  710  ALA n 
5  711  LYS n 
5  712  GLN n 
5  713  ASP n 
5  714  VAL n 
5  715  ASP n 
5  716  ASP n 
5  717  GLU n 
5  718  TYR n 
5  719  GLY n 
5  720  VAL n 
5  721  SER n 
5  722  GLN n 
5  723  ALA n 
5  724  LEU n 
5  725  ALA n 
5  726  ARG n 
5  727  GLY n 
5  728  LEU n 
5  729  GLN n 
5  730  SER n 
5  731  TYR n 
5  732  TYR n 
5  733  ALA n 
5  734  VAL n 
5  735  ALA n 
5  736  HIS n 
5  737  ALA n 
5  738  VAL n 
5  739  THR n 
5  740  GLU n 
5  741  ARG n 
5  742  VAL n 
5  743  ASP n 
5  744  LYS n 
5  745  GLN n 
5  746  SER n 
5  747  ALA n 
5  748  LEU n 
5  749  MET n 
5  750  VAL n 
5  751  ASN n 
5  752  GLY n 
5  753  VAL n 
5  754  LEU n 
5  755  LYS n 
5  756  GLN n 
5  757  TYR n 
5  758  GLN n 
5  759  ILE n 
5  760  LYS n 
5  761  GLY n 
5  762  LEU n 
5  763  GLU n 
5  764  TRP n 
5  765  LEU n 
5  766  VAL n 
5  767  SER n 
5  768  LEU n 
5  769  TYR n 
5  770  ASN n 
5  771  ASN n 
5  772  ASN n 
5  773  LEU n 
5  774  ASN n 
5  775  GLY n 
5  776  ILE n 
5  777  LEU n 
5  778  ALA n 
5  779  ASP n 
5  780  GLU n 
5  781  MET n 
5  782  GLY n 
5  783  LEU n 
5  784  GLY n 
5  785  LYS n 
5  786  THR n 
5  787  ILE n 
5  788  GLN n 
5  789  THR n 
5  790  ILE n 
5  791  ALA n 
5  792  LEU n 
5  793  ILE n 
5  794  THR n 
5  795  TYR n 
5  796  LEU n 
5  797  MET n 
5  798  GLU n 
5  799  HIS n 
5  800  LYS n 
5  801  ARG n 
5  802  ILE n 
5  803  ASN n 
5  804  GLY n 
5  805  PRO n 
5  806  PHE n 
5  807  LEU n 
5  808  ILE n 
5  809  ILE n 
5  810  VAL n 
5  811  PRO n 
5  812  LEU n 
5  813  SER n 
5  814  THR n 
5  815  LEU n 
5  816  SER n 
5  817  ASN n 
5  818  TRP n 
5  819  ALA n 
5  820  TYR n 
5  821  GLU n 
5  822  PHE n 
5  823  ASP n 
5  824  LYS n 
5  825  TRP n 
5  826  ALA n 
5  827  PRO n 
5  828  SER n 
5  829  VAL n 
5  830  VAL n 
5  831  LYS n 
5  832  VAL n 
5  833  SER n 
5  834  TYR n 
5  835  LYS n 
5  836  GLY n 
5  837  SER n 
5  838  PRO n 
5  839  ALA n 
5  840  ALA n 
5  841  ARG n 
5  842  ARG n 
5  843  ALA n 
5  844  PHE n 
5  845  VAL n 
5  846  PRO n 
5  847  GLN n 
5  848  LEU n 
5  849  ARG n 
5  850  SER n 
5  851  GLY n 
5  852  LYS n 
5  853  PHE n 
5  854  ASN n 
5  855  VAL n 
5  856  LEU n 
5  857  LEU n 
5  858  THR n 
5  859  THR n 
5  860  TYR n 
5  861  GLU n 
5  862  TYR n 
5  863  ILE n 
5  864  ILE n 
5  865  LYS n 
5  866  ASP n 
5  867  LYS n 
5  868  HIS n 
5  869  ILE n 
5  870  LEU n 
5  871  ALA n 
5  872  LYS n 
5  873  ILE n 
5  874  ARG n 
5  875  TRP n 
5  876  LYS n 
5  877  TYR n 
5  878  MET n 
5  879  ILE n 
5  880  VAL n 
5  881  ASP n 
5  882  GLU n 
5  883  GLY n 
5  884  HIS n 
5  885  ARG n 
5  886  MET n 
5  887  LYS n 
5  888  ASN n 
5  889  HIS n 
5  890  HIS n 
5  891  CYS n 
5  892  LYS n 
5  893  LEU n 
5  894  THR n 
5  895  GLN n 
5  896  VAL n 
5  897  LEU n 
5  898  ASN n 
5  899  THR n 
5  900  HIS n 
5  901  TYR n 
5  902  VAL n 
5  903  ALA n 
5  904  PRO n 
5  905  ARG n 
5  906  ARG n 
5  907  LEU n 
5  908  LEU n 
5  909  LEU n 
5  910  THR n 
5  911  GLY n 
5  912  THR n 
5  913  PRO n 
5  914  LEU n 
5  915  GLN n 
5  916  ASN n 
5  917  LYS n 
5  918  LEU n 
5  919  PRO n 
5  920  GLU n 
5  921  LEU n 
5  922  TRP n 
5  923  ALA n 
5  924  LEU n 
5  925  LEU n 
5  926  ASN n 
5  927  PHE n 
5  928  LEU n 
5  929  LEU n 
5  930  PRO n 
5  931  THR n 
5  932  ILE n 
5  933  PHE n 
5  934  LYS n 
5  935  SER n 
5  936  CYS n 
5  937  SER n 
5  938  THR n 
5  939  PHE n 
5  940  GLU n 
5  941  GLN n 
5  942  TRP n 
5  943  PHE n 
5  944  ASN n 
5  945  ALA n 
5  946  PRO n 
5  947  PHE n 
5  948  ALA n 
5  949  MET n 
5  950  THR n 
5  951  GLY n 
5  952  GLU n 
5  953  LYS n 
5  954  VAL n 
5  955  ASP n 
5  956  LEU n 
5  957  ASN n 
5  958  GLU n 
5  959  GLU n 
5  960  GLU n 
5  961  THR n 
5  962  ILE n 
5  963  LEU n 
5  964  ILE n 
5  965  ILE n 
5  966  ARG n 
5  967  ARG n 
5  968  LEU n 
5  969  HIS n 
5  970  LYS n 
5  971  VAL n 
5  972  LEU n 
5  973  ARG n 
5  974  PRO n 
5  975  PHE n 
5  976  LEU n 
5  977  LEU n 
5  978  ARG n 
5  979  ARG n 
5  980  LEU n 
5  981  LYS n 
5  982  LYS n 
5  983  GLU n 
5  984  VAL n 
5  985  GLU n 
5  986  ALA n 
5  987  GLN n 
5  988  LEU n 
5  989  PRO n 
5  990  GLU n 
5  991  LYS n 
5  992  VAL n 
5  993  GLU n 
5  994  TYR n 
5  995  VAL n 
5  996  ILE n 
5  997  LYS n 
5  998  CYS n 
5  999  ASP n 
5  1000 MET n 
5  1001 SER n 
5  1002 ALA n 
5  1003 LEU n 
5  1004 GLN n 
5  1005 ARG n 
5  1006 VAL n 
5  1007 LEU n 
5  1008 TYR n 
5  1009 ARG n 
5  1010 HIS n 
5  1011 MET n 
5  1012 GLN n 
5  1013 ALA n 
5  1014 LYS n 
5  1015 GLY n 
5  1016 VAL n 
5  1017 LEU n 
5  1018 LEU n 
5  1019 THR n 
5  1020 ASP n 
5  1021 GLY n 
5  1022 SER n 
5  1023 GLU n 
5  1024 LYS n 
5  1025 ASP n 
5  1026 LYS n 
5  1027 LYS n 
5  1028 GLY n 
5  1029 LYS n 
5  1030 GLY n 
5  1031 GLY n 
5  1032 THR n 
5  1033 LYS n 
5  1034 THR n 
5  1035 LEU n 
5  1036 MET n 
5  1037 ASN n 
5  1038 THR n 
5  1039 ILE n 
5  1040 MET n 
5  1041 GLN n 
5  1042 LEU n 
5  1043 ARG n 
5  1044 LYS n 
5  1045 ILE n 
5  1046 CYS n 
5  1047 ASN n 
5  1048 HIS n 
5  1049 PRO n 
5  1050 TYR n 
5  1051 MET n 
5  1052 PHE n 
5  1053 GLN n 
5  1054 HIS n 
5  1055 ILE n 
5  1056 GLU n 
5  1057 GLU n 
5  1058 SER n 
5  1059 PHE n 
5  1060 SER n 
5  1061 GLU n 
5  1062 HIS n 
5  1063 LEU n 
5  1064 GLY n 
5  1065 PHE n 
5  1066 THR n 
5  1067 GLY n 
5  1068 GLY n 
5  1069 ILE n 
5  1070 VAL n 
5  1071 GLN n 
5  1072 GLY n 
5  1073 LEU n 
5  1074 ASP n 
5  1075 LEU n 
5  1076 TYR n 
5  1077 ARG n 
5  1078 ALA n 
5  1079 SER n 
5  1080 GLY n 
5  1081 LYS n 
5  1082 PHE n 
5  1083 GLU n 
5  1084 LEU n 
5  1085 LEU n 
5  1086 ASP n 
5  1087 ARG n 
5  1088 ILE n 
5  1089 LEU n 
5  1090 PRO n 
5  1091 LYS n 
5  1092 LEU n 
5  1093 ARG n 
5  1094 ALA n 
5  1095 THR n 
5  1096 ASN n 
5  1097 HIS n 
5  1098 LYS n 
5  1099 VAL n 
5  1100 LEU n 
5  1101 LEU n 
5  1102 PHE n 
5  1103 CYS n 
5  1104 GLN n 
5  1105 MET n 
5  1106 THR n 
5  1107 SER n 
5  1108 LEU n 
5  1109 MET n 
5  1110 THR n 
5  1111 ILE n 
5  1112 MET n 
5  1113 GLU n 
5  1114 ASP n 
5  1115 TYR n 
5  1116 PHE n 
5  1117 ALA n 
5  1118 TYR n 
5  1119 ARG n 
5  1120 GLY n 
5  1121 PHE n 
5  1122 LYS n 
5  1123 TYR n 
5  1124 LEU n 
5  1125 ARG n 
5  1126 LEU n 
5  1127 ASP n 
5  1128 GLY n 
5  1129 THR n 
5  1130 THR n 
5  1131 LYS n 
5  1132 ALA n 
5  1133 GLU n 
5  1134 ASP n 
5  1135 ARG n 
5  1136 GLY n 
5  1137 MET n 
5  1138 LEU n 
5  1139 LEU n 
5  1140 LYS n 
5  1141 THR n 
5  1142 PHE n 
5  1143 ASN n 
5  1144 GLU n 
5  1145 PRO n 
5  1146 GLY n 
5  1147 SER n 
5  1148 GLU n 
5  1149 TYR n 
5  1150 PHE n 
5  1151 ILE n 
5  1152 PHE n 
5  1153 LEU n 
5  1154 LEU n 
5  1155 SER n 
5  1156 THR n 
5  1157 ARG n 
5  1158 ALA n 
5  1159 GLY n 
5  1160 GLY n 
5  1161 LEU n 
5  1162 GLY n 
5  1163 LEU n 
5  1164 ASN n 
5  1165 LEU n 
5  1166 GLN n 
5  1167 SER n 
5  1168 ALA n 
5  1169 ASP n 
5  1170 THR n 
5  1171 VAL n 
5  1172 ILE n 
5  1173 ILE n 
5  1174 PHE n 
5  1175 ASP n 
5  1176 SER n 
5  1177 ASP n 
5  1178 TRP n 
5  1179 ASN n 
5  1180 PRO n 
5  1181 HIS n 
5  1182 GLN n 
5  1183 ASP n 
5  1184 LEU n 
5  1185 GLN n 
5  1186 ALA n 
5  1187 GLN n 
5  1188 ASP n 
5  1189 ARG n 
5  1190 ALA n 
5  1191 HIS n 
5  1192 ARG n 
5  1193 ILE n 
5  1194 GLY n 
5  1195 GLN n 
5  1196 GLN n 
5  1197 ASN n 
5  1198 GLU n 
5  1199 VAL n 
5  1200 ARG n 
5  1201 VAL n 
5  1202 LEU n 
5  1203 ARG n 
5  1204 LEU n 
5  1205 CYS n 
5  1206 THR n 
5  1207 VAL n 
5  1208 ASN n 
5  1209 SER n 
5  1210 VAL n 
5  1211 GLU n 
5  1212 GLU n 
5  1213 LYS n 
5  1214 ILE n 
5  1215 LEU n 
5  1216 ALA n 
5  1217 ALA n 
5  1218 ALA n 
5  1219 LYS n 
5  1220 TYR n 
5  1221 LYS n 
5  1222 LEU n 
5  1223 ASN n 
5  1224 VAL n 
5  1225 ASP n 
5  1226 GLN n 
5  1227 LYS n 
5  1228 VAL n 
5  1229 ILE n 
5  1230 GLN n 
5  1231 ALA n 
5  1232 GLY n 
5  1233 MET n 
5  1234 PHE n 
5  1235 ASP n 
5  1236 GLN n 
5  1237 LYS n 
5  1238 SER n 
5  1239 SER n 
5  1240 SER n 
5  1241 HIS n 
5  1242 GLU n 
5  1243 ARG n 
5  1244 ARG n 
5  1245 ALA n 
5  1246 PHE n 
5  1247 LEU n 
5  1248 GLN n 
5  1249 ALA n 
5  1250 ILE n 
5  1251 LEU n 
5  1252 GLU n 
5  1253 HIS n 
5  1254 GLU n 
5  1255 GLU n 
5  1256 GLN n 
5  1257 ASP n 
5  1258 GLU n 
5  1259 SER n 
5  1260 ARG n 
5  1261 HIS n 
5  1262 CYS n 
5  1263 SER n 
5  1264 THR n 
5  1265 GLY n 
5  1266 SER n 
5  1267 GLY n 
5  1268 SER n 
5  1269 ALA n 
5  1270 SER n 
5  1271 PHE n 
5  1272 ALA n 
5  1273 HIS n 
5  1274 THR n 
5  1275 ALA n 
5  1276 PRO n 
5  1277 PRO n 
5  1278 PRO n 
5  1279 ALA n 
5  1280 GLY n 
5  1281 VAL n 
5  1282 ASN n 
5  1283 PRO n 
5  1284 ASP n 
5  1285 LEU n 
5  1286 GLU n 
5  1287 GLU n 
5  1288 PRO n 
5  1289 PRO n 
5  1290 LEU n 
5  1291 LYS n 
5  1292 GLU n 
5  1293 GLU n 
5  1294 ASP n 
5  1295 GLU n 
5  1296 VAL n 
5  1297 PRO n 
5  1298 ASP n 
5  1299 ASP n 
5  1300 GLU n 
5  1301 THR n 
5  1302 VAL n 
5  1303 ASN n 
5  1304 GLN n 
5  1305 MET n 
5  1306 ILE n 
5  1307 ALA n 
5  1308 ARG n 
5  1309 HIS n 
5  1310 GLU n 
5  1311 GLU n 
5  1312 GLU n 
5  1313 PHE n 
5  1314 ASP n 
5  1315 LEU n 
5  1316 PHE n 
5  1317 MET n 
5  1318 ARG n 
5  1319 MET n 
5  1320 ASP n 
5  1321 LEU n 
5  1322 ASP n 
5  1323 ARG n 
5  1324 ARG n 
5  1325 ARG n 
5  1326 GLU n 
5  1327 GLU n 
5  1328 ALA n 
5  1329 ARG n 
5  1330 ASN n 
5  1331 PRO n 
5  1332 LYS n 
5  1333 ARG n 
5  1334 LYS n 
5  1335 PRO n 
5  1336 ARG n 
5  1337 LEU n 
5  1338 MET n 
5  1339 GLU n 
5  1340 GLU n 
5  1341 ASP n 
5  1342 GLU n 
5  1343 LEU n 
5  1344 PRO n 
5  1345 SER n 
5  1346 TRP n 
5  1347 ILE n 
5  1348 ILE n 
5  1349 LYS n 
5  1350 ASP n 
5  1351 ASP n 
5  1352 ALA n 
5  1353 GLU n 
5  1354 VAL n 
5  1355 GLU n 
5  1356 ARG n 
5  1357 LEU n 
5  1358 THR n 
5  1359 CYS n 
5  1360 GLU n 
5  1361 GLU n 
5  1362 GLU n 
5  1363 GLU n 
5  1364 GLU n 
5  1365 LYS n 
5  1366 MET n 
5  1367 PHE n 
5  1368 GLY n 
5  1369 ARG n 
5  1370 GLY n 
5  1371 SER n 
5  1372 ARG n 
5  1373 HIS n 
5  1374 ARG n 
5  1375 LYS n 
5  1376 GLU n 
5  1377 VAL n 
5  1378 ASP n 
5  1379 TYR n 
5  1380 SER n 
5  1381 ASP n 
5  1382 SER n 
5  1383 LEU n 
5  1384 THR n 
5  1385 GLU n 
5  1386 LYS n 
5  1387 GLN n 
5  1388 TRP n 
5  1389 LEU n 
5  1390 LYS n 
5  1391 ALA n 
5  1392 ILE n 
5  1393 GLU n 
5  1394 GLU n 
5  1395 GLY n 
5  1396 THR n 
5  1397 LEU n 
5  1398 GLU n 
5  1399 GLU n 
5  1400 ILE n 
5  1401 GLU n 
5  1402 GLU n 
5  1403 GLU n 
5  1404 VAL n 
5  1405 ARG n 
5  1406 GLN n 
5  1407 LYS n 
5  1408 LYS n 
5  1409 SER n 
5  1410 SER n 
5  1411 ARG n 
5  1412 LYS n 
5  1413 ARG n 
5  1414 LYS n 
5  1415 ARG n 
5  1416 ASP n 
5  1417 SER n 
5  1418 ASP n 
5  1419 ALA n 
5  1420 GLY n 
5  1421 SER n 
5  1422 SER n 
5  1423 THR n 
5  1424 PRO n 
5  1425 THR n 
5  1426 THR n 
5  1427 SER n 
5  1428 THR n 
5  1429 ARG n 
5  1430 SER n 
5  1431 ARG n 
5  1432 ASP n 
5  1433 LYS n 
5  1434 ASP n 
5  1435 ASP n 
5  1436 GLU n 
5  1437 SER n 
5  1438 LYS n 
5  1439 LYS n 
5  1440 GLN n 
5  1441 LYS n 
5  1442 LYS n 
5  1443 ARG n 
5  1444 GLY n 
5  1445 ARG n 
5  1446 PRO n 
5  1447 PRO n 
5  1448 ALA n 
5  1449 GLU n 
5  1450 LYS n 
5  1451 LEU n 
5  1452 SER n 
5  1453 PRO n 
5  1454 ASN n 
5  1455 PRO n 
5  1456 PRO n 
5  1457 ASN n 
5  1458 LEU n 
5  1459 THR n 
5  1460 LYS n 
5  1461 LYS n 
5  1462 MET n 
5  1463 LYS n 
5  1464 LYS n 
5  1465 ILE n 
5  1466 VAL n 
5  1467 ASP n 
5  1468 ALA n 
5  1469 VAL n 
5  1470 ILE n 
5  1471 LYS n 
5  1472 TYR n 
5  1473 LYS n 
5  1474 ASP n 
5  1475 SER n 
5  1476 SER n 
5  1477 SER n 
5  1478 GLY n 
5  1479 ARG n 
5  1480 GLN n 
5  1481 LEU n 
5  1482 SER n 
5  1483 GLU n 
5  1484 VAL n 
5  1485 PHE n 
5  1486 ILE n 
5  1487 GLN n 
5  1488 LEU n 
5  1489 PRO n 
5  1490 SER n 
5  1491 ARG n 
5  1492 LYS n 
5  1493 GLU n 
5  1494 LEU n 
5  1495 PRO n 
5  1496 GLU n 
5  1497 TYR n 
5  1498 TYR n 
5  1499 GLU n 
5  1500 LEU n 
5  1501 ILE n 
5  1502 ARG n 
5  1503 LYS n 
5  1504 PRO n 
5  1505 VAL n 
5  1506 ASP n 
5  1507 PHE n 
5  1508 LYS n 
5  1509 LYS n 
5  1510 ILE n 
5  1511 LYS n 
5  1512 GLU n 
5  1513 ARG n 
5  1514 ILE n 
5  1515 ARG n 
5  1516 ASN n 
5  1517 HIS n 
5  1518 LYS n 
5  1519 TYR n 
5  1520 ARG n 
5  1521 SER n 
5  1522 LEU n 
5  1523 ASN n 
5  1524 ASP n 
5  1525 LEU n 
5  1526 GLU n 
5  1527 LYS n 
5  1528 ASP n 
5  1529 VAL n 
5  1530 MET n 
5  1531 LEU n 
5  1532 LEU n 
5  1533 CYS n 
5  1534 GLN n 
5  1535 ASN n 
5  1536 ALA n 
5  1537 GLN n 
5  1538 THR n 
5  1539 PHE n 
5  1540 ASN n 
5  1541 LEU n 
5  1542 GLU n 
5  1543 GLY n 
5  1544 SER n 
5  1545 LEU n 
5  1546 ILE n 
5  1547 TYR n 
5  1548 GLU n 
5  1549 ASP n 
5  1550 SER n 
5  1551 ILE n 
5  1552 VAL n 
5  1553 LEU n 
5  1554 GLN n 
5  1555 SER n 
5  1556 VAL n 
5  1557 PHE n 
5  1558 THR n 
5  1559 SER n 
5  1560 VAL n 
5  1561 ARG n 
5  1562 GLN n 
5  1563 LYS n 
5  1564 ILE n 
5  1565 GLU n 
5  1566 LYS n 
5  1567 GLU n 
5  1568 ASP n 
5  1569 ASP n 
5  1570 SER n 
5  1571 GLU n 
5  1572 GLY n 
5  1573 GLU n 
5  1574 GLU n 
5  1575 SER n 
5  1576 GLU n 
5  1577 GLU n 
5  1578 GLU n 
5  1579 GLU n 
5  1580 GLU n 
5  1581 GLY n 
5  1582 GLU n 
5  1583 GLU n 
5  1584 GLU n 
5  1585 GLY n 
5  1586 SER n 
5  1587 GLU n 
5  1588 SER n 
5  1589 GLU n 
5  1590 SER n 
5  1591 ARG n 
5  1592 SER n 
5  1593 VAL n 
5  1594 LYS n 
5  1595 VAL n 
5  1596 LYS n 
5  1597 ILE n 
5  1598 LYS n 
5  1599 LEU n 
5  1600 GLY n 
5  1601 ARG n 
5  1602 LYS n 
5  1603 GLU n 
5  1604 LYS n 
5  1605 ALA n 
5  1606 GLN n 
5  1607 ASP n 
5  1608 ARG n 
5  1609 LEU n 
5  1610 LYS n 
5  1611 GLY n 
5  1612 GLY n 
5  1613 ARG n 
5  1614 ARG n 
5  1615 ARG n 
5  1616 PRO n 
5  1617 SER n 
5  1618 ARG n 
5  1619 GLY n 
5  1620 SER n 
5  1621 ARG n 
5  1622 ALA n 
5  1623 LYS n 
5  1624 PRO n 
5  1625 VAL n 
5  1626 VAL n 
5  1627 SER n 
5  1628 ASP n 
5  1629 ASP n 
5  1630 ASP n 
5  1631 SER n 
5  1632 GLU n 
5  1633 GLU n 
5  1634 GLU n 
5  1635 GLN n 
5  1636 GLU n 
5  1637 GLU n 
5  1638 ASP n 
5  1639 ARG n 
5  1640 SER n 
5  1641 GLY n 
5  1642 SER n 
5  1643 GLY n 
5  1644 SER n 
5  1645 GLU n 
5  1646 GLU n 
5  1647 ASP n 
6  1    GLY n 
6  2    ALA n 
6  3    LEU n 
6  4    VAL n 
6  5    PHE n 
6  6    ASP n 
6  7    ILE n 
6  8    GLY n 
6  9    SER n 
6  10   TYR n 
6  11   THR n 
6  12   VAL n 
6  13   ARG n 
6  14   ALA n 
6  15   GLY n 
6  16   TYR n 
6  17   ALA n 
6  18   GLY n 
6  19   GLU n 
6  20   ASP n 
6  21   CYS n 
6  22   PRO n 
6  23   LYS n 
6  24   VAL n 
6  25   ASP n 
6  26   PHE n 
6  27   PRO n 
6  28   THR n 
6  29   ALA n 
6  30   ILE n 
6  31   GLY n 
6  32   MET n 
6  33   VAL n 
6  34   VAL n 
6  35   GLU n 
6  36   ARG n 
6  37   ASP n 
6  38   ASP n 
6  39   GLY n 
6  40   SER n 
6  41   THR n 
6  42   LEU n 
6  43   MET n 
6  44   GLU n 
6  45   ILE n 
6  46   ASP n 
6  47   GLY n 
6  48   ASP n 
6  49   LYS n 
6  50   GLY n 
6  51   LYS n 
6  52   GLN n 
6  53   GLY n 
6  54   GLY n 
6  55   PRO n 
6  56   THR n 
6  57   TYR n 
6  58   TYR n 
6  59   ILE n 
6  60   ASP n 
6  61   THR n 
6  62   ASN n 
6  63   ALA n 
6  64   LEU n 
6  65   ARG n 
6  66   VAL n 
6  67   PRO n 
6  68   ARG n 
6  69   GLU n 
6  70   ASN n 
6  71   MET n 
6  72   GLU n 
6  73   ALA n 
6  74   ILE n 
6  75   SER n 
6  76   PRO n 
6  77   LEU n 
6  78   LYS n 
6  79   ASN n 
6  80   GLY n 
6  81   MET n 
6  82   VAL n 
6  83   GLU n 
6  84   ASP n 
6  85   TRP n 
6  86   ASP n 
6  87   SER n 
6  88   PHE n 
6  89   GLN n 
6  90   ALA n 
6  91   ILE n 
6  92   LEU n 
6  93   ASP n 
6  94   HIS n 
6  95   THR n 
6  96   TYR n 
6  97   LYS n 
6  98   MET n 
6  99   HIS n 
6  100  VAL n 
6  101  LYS n 
6  102  SER n 
6  103  GLU n 
6  104  ALA n 
6  105  SER n 
6  106  LEU n 
6  107  HIS n 
6  108  PRO n 
6  109  VAL n 
6  110  LEU n 
6  111  MET n 
6  112  SER n 
6  113  GLU n 
6  114  ALA n 
6  115  PRO n 
6  116  TRP n 
6  117  ASN n 
6  118  THR n 
6  119  ARG n 
6  120  ALA n 
6  121  LYS n 
6  122  ARG n 
6  123  GLU n 
6  124  LYS n 
6  125  LEU n 
6  126  THR n 
6  127  GLU n 
6  128  LEU n 
6  129  MET n 
6  130  PHE n 
6  131  GLU n 
6  132  HIS n 
6  133  TYR n 
6  134  ASN n 
6  135  ILE n 
6  136  PRO n 
6  137  ALA n 
6  138  PHE n 
6  139  PHE n 
6  140  LEU n 
6  141  CYS n 
6  142  LYS n 
6  143  THR n 
6  144  ALA n 
6  145  VAL n 
6  146  LEU n 
6  147  THR n 
6  148  ALA n 
6  149  PHE n 
6  150  ALA n 
6  151  ASN n 
6  152  GLY n 
6  153  ARG n 
6  154  SER n 
6  155  THR n 
6  156  GLY n 
6  157  LEU n 
6  158  ILE n 
6  159  LEU n 
6  160  ASP n 
6  161  SER n 
6  162  GLY n 
6  163  ALA n 
6  164  THR n 
6  165  HIS n 
6  166  THR n 
6  167  THR n 
6  168  ALA n 
6  169  ILE n 
6  170  PRO n 
6  171  VAL n 
6  172  HIS n 
6  173  ASP n 
6  174  GLY n 
6  175  TYR n 
6  176  VAL n 
6  177  LEU n 
6  178  GLN n 
6  179  GLN n 
6  180  GLY n 
6  181  ILE n 
6  182  VAL n 
6  183  LYS n 
6  184  SER n 
6  185  PRO n 
6  186  LEU n 
6  187  ALA n 
6  188  GLY n 
6  189  ASP n 
6  190  PHE n 
6  191  ILE n 
6  192  THR n 
6  193  MET n 
6  194  GLN n 
6  195  CYS n 
6  196  ARG n 
6  197  GLU n 
6  198  LEU n 
6  199  PHE n 
6  200  GLN n 
6  201  GLU n 
6  202  MET n 
6  203  ASN n 
6  204  ILE n 
6  205  GLU n 
6  206  LEU n 
6  207  VAL n 
6  208  PRO n 
6  209  PRO n 
6  210  TYR n 
6  211  MET n 
6  212  ILE n 
6  213  ALA n 
6  214  SER n 
6  215  LYS n 
6  216  GLU n 
6  217  ALA n 
6  218  VAL n 
6  219  ARG n 
6  220  GLU n 
6  221  GLY n 
6  222  SER n 
6  223  PRO n 
6  224  ALA n 
6  225  ASN n 
6  226  TRP n 
6  227  LYS n 
6  228  ARG n 
6  229  LYS n 
6  230  GLU n 
6  231  LYS n 
6  232  LEU n 
6  233  PRO n 
6  234  GLN n 
6  235  VAL n 
6  236  THR n 
6  237  ARG n 
6  238  SER n 
6  239  TRP n 
6  240  HIS n 
6  241  ASN n 
6  242  TYR n 
6  243  MET n 
6  244  CYS n 
6  245  ASN n 
6  246  CYS n 
6  247  VAL n 
6  248  ILE n 
6  249  GLN n 
6  250  ASP n 
6  251  PHE n 
6  252  GLN n 
6  253  ALA n 
6  254  SER n 
6  255  VAL n 
6  256  LEU n 
6  257  GLN n 
6  258  VAL n 
6  259  SER n 
6  260  ASP n 
6  261  SER n 
6  262  THR n 
6  263  TYR n 
6  264  ASP n 
6  265  GLU n 
6  266  GLN n 
6  267  VAL n 
6  268  ALA n 
6  269  ALA n 
6  270  GLN n 
6  271  MET n 
6  272  PRO n 
6  273  THR n 
6  274  VAL n 
6  275  HIS n 
6  276  TYR n 
6  277  GLU n 
6  278  PHE n 
6  279  PRO n 
6  280  ASN n 
6  281  GLY n 
6  282  TYR n 
6  283  ASN n 
6  284  CYS n 
6  285  ASP n 
6  286  PHE n 
6  287  GLY n 
6  288  ALA n 
6  289  GLU n 
6  290  ARG n 
6  291  LEU n 
6  292  LYS n 
6  293  ILE n 
6  294  PRO n 
6  295  GLU n 
6  296  GLY n 
6  297  LEU n 
6  298  PHE n 
6  299  ASP n 
6  300  PRO n 
6  301  SER n 
6  302  ASN n 
6  303  VAL n 
6  304  LYS n 
6  305  GLY n 
6  306  LEU n 
6  307  SER n 
6  308  GLY n 
6  309  ASN n 
6  310  THR n 
6  311  MET n 
6  312  LEU n 
6  313  GLY n 
6  314  VAL n 
6  315  SER n 
6  316  HIS n 
6  317  VAL n 
6  318  VAL n 
6  319  THR n 
6  320  THR n 
6  321  SER n 
6  322  VAL n 
6  323  GLY n 
6  324  MET n 
6  325  CYS n 
6  326  ASP n 
6  327  ILE n 
6  328  ASP n 
6  329  ILE n 
6  330  ARG n 
6  331  PRO n 
6  332  GLY n 
6  333  LEU n 
6  334  TYR n 
6  335  GLY n 
6  336  SER n 
6  337  VAL n 
6  338  ILE n 
6  339  VAL n 
6  340  ALA n 
6  341  GLY n 
6  342  GLY n 
6  343  ASN n 
6  344  THR n 
6  345  LEU n 
6  346  ILE n 
6  347  GLN n 
6  348  SER n 
6  349  PHE n 
6  350  THR n 
6  351  ASP n 
6  352  ARG n 
6  353  LEU n 
6  354  ASN n 
6  355  ARG n 
6  356  GLU n 
6  357  LEU n 
6  358  SER n 
6  359  GLN n 
6  360  LYS n 
6  361  THR n 
6  362  PRO n 
6  363  PRO n 
6  364  SER n 
6  365  MET n 
6  366  ARG n 
6  367  LEU n 
6  368  LYS n 
6  369  LEU n 
6  370  ILE n 
6  371  ALA n 
6  372  ASN n 
6  373  ASN n 
6  374  THR n 
6  375  THR n 
6  376  VAL n 
6  377  GLU n 
6  378  ARG n 
6  379  ARG n 
6  380  PHE n 
6  381  SER n 
6  382  SER n 
6  383  TRP n 
6  384  ILE n 
6  385  GLY n 
6  386  GLY n 
6  387  SER n 
6  388  ILE n 
6  389  LEU n 
6  390  ALA n 
6  391  SER n 
6  392  LEU n 
6  393  GLY n 
6  394  THR n 
6  395  PHE n 
6  396  GLN n 
6  397  GLN n 
6  398  MET n 
6  399  TRP n 
6  400  ILE n 
6  401  SER n 
6  402  LYS n 
6  403  GLN n 
6  404  GLU n 
6  405  TYR n 
6  406  GLU n 
6  407  PRO n 
7  1    MET n 
7  2    ASP n 
7  3    ASP n 
7  4    ASP n 
7  5    ILE n 
7  6    ALA n 
7  7    ALA n 
7  8    LEU n 
7  9    VAL n 
7  10   VAL n 
7  11   ASP n 
7  12   ASN n 
7  13   GLY n 
7  14   SER n 
7  15   GLY n 
7  16   MET n 
7  17   CYS n 
7  18   LYS n 
7  19   ALA n 
7  20   GLY n 
7  21   PHE n 
7  22   ALA n 
7  23   GLY n 
7  24   ASP n 
7  25   ASP n 
7  26   ALA n 
7  27   PRO n 
7  28   ARG n 
7  29   ALA n 
7  30   VAL n 
7  31   PHE n 
7  32   PRO n 
7  33   SER n 
7  34   ILE n 
7  35   VAL n 
7  36   GLY n 
7  37   ARG n 
7  38   PRO n 
7  39   ARG n 
7  40   HIS n 
7  41   GLN n 
7  42   GLY n 
7  43   VAL n 
7  44   MET n 
7  45   VAL n 
7  46   GLY n 
7  47   MET n 
7  48   GLY n 
7  49   GLN n 
7  50   LYS n 
7  51   ASP n 
7  52   SER n 
7  53   TYR n 
7  54   VAL n 
7  55   GLY n 
7  56   ASP n 
7  57   GLU n 
7  58   ALA n 
7  59   GLN n 
7  60   SER n 
7  61   LYS n 
7  62   ARG n 
7  63   GLY n 
7  64   ILE n 
7  65   LEU n 
7  66   THR n 
7  67   LEU n 
7  68   LYS n 
7  69   TYR n 
7  70   PRO n 
7  71   ILE n 
7  72   GLU n 
7  73   HIS n 
7  74   GLY n 
7  75   ILE n 
7  76   VAL n 
7  77   THR n 
7  78   ASN n 
7  79   TRP n 
7  80   ASP n 
7  81   ASP n 
7  82   MET n 
7  83   GLU n 
7  84   LYS n 
7  85   ILE n 
7  86   TRP n 
7  87   HIS n 
7  88   HIS n 
7  89   THR n 
7  90   PHE n 
7  91   TYR n 
7  92   ASN n 
7  93   GLU n 
7  94   LEU n 
7  95   ARG n 
7  96   VAL n 
7  97   ALA n 
7  98   PRO n 
7  99   GLU n 
7  100  GLU n 
7  101  HIS n 
7  102  PRO n 
7  103  VAL n 
7  104  LEU n 
7  105  LEU n 
7  106  THR n 
7  107  GLU n 
7  108  ALA n 
7  109  PRO n 
7  110  LEU n 
7  111  ASN n 
7  112  PRO n 
7  113  LYS n 
7  114  ALA n 
7  115  ASN n 
7  116  ARG n 
7  117  GLU n 
7  118  LYS n 
7  119  MET n 
7  120  THR n 
7  121  GLN n 
7  122  ILE n 
7  123  MET n 
7  124  PHE n 
7  125  GLU n 
7  126  THR n 
7  127  PHE n 
7  128  ASN n 
7  129  THR n 
7  130  PRO n 
7  131  ALA n 
7  132  MET n 
7  133  TYR n 
7  134  VAL n 
7  135  ALA n 
7  136  ILE n 
7  137  GLN n 
7  138  ALA n 
7  139  VAL n 
7  140  LEU n 
7  141  SER n 
7  142  LEU n 
7  143  TYR n 
7  144  ALA n 
7  145  SER n 
7  146  GLY n 
7  147  ARG n 
7  148  THR n 
7  149  THR n 
7  150  GLY n 
7  151  ILE n 
7  152  VAL n 
7  153  MET n 
7  154  ASP n 
7  155  SER n 
7  156  GLY n 
7  157  ASP n 
7  158  GLY n 
7  159  VAL n 
7  160  THR n 
7  161  HIS n 
7  162  THR n 
7  163  VAL n 
7  164  PRO n 
7  165  ILE n 
7  166  TYR n 
7  167  GLU n 
7  168  GLY n 
7  169  TYR n 
7  170  ALA n 
7  171  LEU n 
7  172  PRO n 
7  173  HIS n 
7  174  ALA n 
7  175  ILE n 
7  176  LEU n 
7  177  ARG n 
7  178  LEU n 
7  179  ASP n 
7  180  LEU n 
7  181  ALA n 
7  182  GLY n 
7  183  ARG n 
7  184  ASP n 
7  185  LEU n 
7  186  THR n 
7  187  ASP n 
7  188  TYR n 
7  189  LEU n 
7  190  MET n 
7  191  LYS n 
7  192  ILE n 
7  193  LEU n 
7  194  THR n 
7  195  GLU n 
7  196  ARG n 
7  197  GLY n 
7  198  TYR n 
7  199  SER n 
7  200  PHE n 
7  201  THR n 
7  202  THR n 
7  203  THR n 
7  204  ALA n 
7  205  GLU n 
7  206  ARG n 
7  207  GLU n 
7  208  ILE n 
7  209  VAL n 
7  210  ARG n 
7  211  ASP n 
7  212  ILE n 
7  213  LYS n 
7  214  GLU n 
7  215  LYS n 
7  216  LEU n 
7  217  CYS n 
7  218  TYR n 
7  219  VAL n 
7  220  ALA n 
7  221  LEU n 
7  222  ASP n 
7  223  PHE n 
7  224  GLU n 
7  225  GLN n 
7  226  GLU n 
7  227  MET n 
7  228  ALA n 
7  229  THR n 
7  230  ALA n 
7  231  ALA n 
7  232  SER n 
7  233  SER n 
7  234  SER n 
7  235  SER n 
7  236  LEU n 
7  237  GLU n 
7  238  LYS n 
7  239  SER n 
7  240  TYR n 
7  241  GLU n 
7  242  LEU n 
7  243  PRO n 
7  244  ASP n 
7  245  GLY n 
7  246  GLN n 
7  247  VAL n 
7  248  ILE n 
7  249  THR n 
7  250  ILE n 
7  251  GLY n 
7  252  ASN n 
7  253  GLU n 
7  254  ARG n 
7  255  PHE n 
7  256  ARG n 
7  257  CYS n 
7  258  PRO n 
7  259  GLU n 
7  260  ALA n 
7  261  LEU n 
7  262  PHE n 
7  263  GLN n 
7  264  PRO n 
7  265  SER n 
7  266  PHE n 
7  267  LEU n 
7  268  GLY n 
7  269  MET n 
7  270  GLU n 
7  271  SER n 
7  272  CYS n 
7  273  GLY n 
7  274  ILE n 
7  275  HIS n 
7  276  GLU n 
7  277  THR n 
7  278  THR n 
7  279  PHE n 
7  280  ASN n 
7  281  SER n 
7  282  ILE n 
7  283  MET n 
7  284  LYS n 
7  285  CYS n 
7  286  ASP n 
7  287  VAL n 
7  288  ASP n 
7  289  ILE n 
7  290  ARG n 
7  291  LYS n 
7  292  ASP n 
7  293  LEU n 
7  294  TYR n 
7  295  ALA n 
7  296  ASN n 
7  297  THR n 
7  298  VAL n 
7  299  LEU n 
7  300  SER n 
7  301  GLY n 
7  302  GLY n 
7  303  THR n 
7  304  THR n 
7  305  MET n 
7  306  TYR n 
7  307  PRO n 
7  308  GLY n 
7  309  ILE n 
7  310  ALA n 
7  311  ASP n 
7  312  ARG n 
7  313  MET n 
7  314  GLN n 
7  315  LYS n 
7  316  GLU n 
7  317  ILE n 
7  318  THR n 
7  319  ALA n 
7  320  LEU n 
7  321  ALA n 
7  322  PRO n 
7  323  SER n 
7  324  THR n 
7  325  MET n 
7  326  LYS n 
7  327  ILE n 
7  328  LYS n 
7  329  ILE n 
7  330  ILE n 
7  331  ALA n 
7  332  PRO n 
7  333  PRO n 
7  334  GLU n 
7  335  ARG n 
7  336  LYS n 
7  337  TYR n 
7  338  SER n 
7  339  VAL n 
7  340  TRP n 
7  341  ILE n 
7  342  GLY n 
7  343  GLY n 
7  344  SER n 
7  345  ILE n 
7  346  LEU n 
7  347  ALA n 
7  348  SER n 
7  349  LEU n 
7  350  SER n 
7  351  THR n 
7  352  PHE n 
7  353  GLN n 
7  354  GLN n 
7  355  MET n 
7  356  TRP n 
7  357  ILE n 
7  358  SER n 
7  359  LYS n 
7  360  GLN n 
7  361  GLU n 
7  362  TYR n 
7  363  ASP n 
7  364  GLU n 
7  365  SER n 
7  366  GLY n 
7  367  PRO n 
7  368  SER n 
7  369  ILE n 
7  370  VAL n 
7  371  HIS n 
7  372  ARG n 
7  373  LYS n 
7  374  CYS n 
7  375  PHE n 
8  1    THR n 
8  2    GLU n 
8  3    SER n 
8  4    LYS n 
8  5    SER n 
8  6    LYS n 
8  7    LYS n 
8  8    SER n 
8  9    SER n 
8  10   SER n 
8  11   SER n 
8  12   THR n 
8  13   THR n 
8  14   THR n 
8  15   ASN n 
8  16   GLU n 
8  17   LYS n 
8  18   ILE n 
8  19   THR n 
8  20   LYS n 
8  21   LEU n 
8  22   TYR n 
8  23   GLU n 
8  24   LEU n 
8  25   GLY n 
8  26   GLY n 
8  27   GLU n 
8  28   PRO n 
8  29   GLU n 
8  30   ARG n 
8  31   LYS n 
8  32   MET n 
8  33   TRP n 
8  34   VAL n 
8  35   ASP n 
8  36   ARG n 
8  37   TYR n 
8  38   LEU n 
8  39   ALA n 
8  40   PHE n 
8  41   THR n 
8  42   GLU n 
8  43   GLU n 
8  44   LYS n 
8  45   ALA n 
8  46   MET n 
8  47   GLY n 
8  48   MET n 
8  49   THR n 
8  50   ASN n 
8  51   LEU n 
8  52   PRO n 
8  53   ALA n 
8  54   VAL n 
8  55   GLY n 
8  56   ARG n 
8  57   LYS n 
8  58   PRO n 
8  59   LEU n 
8  60   ASP n 
8  61   LEU n 
8  62   TYR n 
8  63   ARG n 
8  64   LEU n 
8  65   TYR n 
8  66   VAL n 
8  67   SER n 
8  68   VAL n 
8  69   LYS n 
8  70   GLU n 
8  71   ILE n 
8  72   GLY n 
8  73   GLY n 
8  74   LEU n 
8  75   THR n 
8  76   GLN n 
8  77   VAL n 
8  78   ASN n 
8  79   LYS n 
8  80   ASN n 
8  81   LYS n 
8  82   LYS n 
8  83   TRP n 
8  84   ARG n 
8  85   GLU n 
8  86   LEU n 
8  87   ALA n 
8  88   THR n 
8  89   ASN n 
8  90   LEU n 
8  91   ASN n 
8  92   VAL n 
8  93   GLY n 
8  94   THR n 
8  95   SER n 
8  96   SER n 
8  97   SER n 
8  98   ALA n 
8  99   ALA n 
8  100  SER n 
8  101  SER n 
8  102  LEU n 
8  103  LYS n 
8  104  LYS n 
8  105  GLN n 
8  106  TYR n 
8  107  ILE n 
8  108  GLN n 
8  109  CYS n 
8  110  LEU n 
8  111  TYR n 
8  112  ALA n 
8  113  PHE n 
8  114  GLU n 
8  115  CYS n 
8  116  LYS n 
8  117  ILE n 
8  118  GLU n 
8  119  ARG n 
8  120  GLY n 
8  121  GLU n 
8  122  ASP n 
8  123  PRO n 
8  124  PRO n 
8  125  PRO n 
8  126  ASP n 
8  127  ILE n 
8  128  PHE n 
8  129  ALA n 
8  130  ALA n 
8  131  ALA n 
8  132  ASP n 
8  133  SER n 
8  134  LYS n 
8  135  LYS n 
8  136  SER n 
8  137  GLN n 
8  138  PRO n 
8  139  LYS n 
8  140  ILE n 
8  141  GLN n 
8  142  PRO n 
8  143  PRO n 
8  144  SER n 
8  145  PRO n 
8  146  ALA n 
8  147  GLY n 
8  148  SER n 
8  149  GLY n 
8  150  SER n 
8  151  MET n 
8  152  GLN n 
8  153  GLY n 
8  154  PRO n 
8  155  GLN n 
8  156  THR n 
8  157  PRO n 
8  158  GLN n 
8  159  SER n 
8  160  THR n 
8  161  SER n 
8  162  SER n 
8  163  SER n 
8  164  MET n 
8  165  ALA n 
8  166  GLU n 
8  167  GLY n 
8  168  GLY n 
8  169  ASP n 
8  170  LEU n 
8  171  LYS n 
8  172  PRO n 
8  173  PRO n 
8  174  THR n 
8  175  PRO n 
8  176  ALA n 
8  177  SER n 
8  178  THR n 
8  179  PRO n 
8  180  HIS n 
8  181  SER n 
8  182  GLN n 
8  183  ILE n 
8  184  PRO n 
8  185  PRO n 
8  186  LEU n 
8  187  PRO n 
8  188  GLY n 
8  189  MET n 
8  190  SER n 
8  191  ARG n 
8  192  SER n 
8  193  ASN n 
8  194  SER n 
8  195  VAL n 
8  196  GLY n 
8  197  ILE n 
8  198  GLN n 
8  199  ASP n 
8  200  ALA n 
8  201  PHE n 
8  202  ASN n 
8  203  ASP n 
8  204  GLY n 
8  205  SER n 
8  206  ASP n 
8  207  SER n 
8  208  THR n 
8  209  PHE n 
8  210  GLN n 
8  211  LYS n 
8  212  ARG n 
8  213  ASN n 
8  214  SER n 
8  215  MET n 
8  216  THR n 
8  217  PRO n 
8  218  ASN n 
8  219  PRO n 
8  220  GLY n 
8  221  TYR n 
8  222  GLN n 
8  223  PRO n 
8  224  SER n 
8  225  MET n 
8  226  ASN n 
8  227  THR n 
8  228  SER n 
8  229  ASP n 
8  230  MET n 
8  231  MET n 
8  232  GLY n 
8  233  ARG n 
8  234  MET n 
8  235  SER n 
8  236  TYR n 
8  237  GLU n 
8  238  PRO n 
8  239  ASN n 
8  240  LYS n 
8  241  ASP n 
8  242  PRO n 
8  243  TYR n 
8  244  GLY n 
8  245  SER n 
8  246  MET n 
8  247  ARG n 
8  248  LYS n 
8  249  ALA n 
8  250  PRO n 
8  251  GLY n 
8  252  SER n 
8  253  ASP n 
8  254  PRO n 
8  255  PHE n 
8  256  MET n 
8  257  SER n 
8  258  SER n 
8  259  GLY n 
8  260  GLN n 
8  261  GLY n 
8  262  PRO n 
8  263  ASN n 
8  264  GLY n 
8  265  GLY n 
8  266  MET n 
8  267  GLY n 
8  268  ASP n 
8  269  PRO n 
8  270  TYR n 
8  271  SER n 
8  272  ARG n 
8  273  ALA n 
8  274  ALA n 
8  275  GLY n 
8  276  PRO n 
8  277  GLY n 
8  278  LEU n 
8  279  GLY n 
8  280  ASN n 
8  281  VAL n 
8  282  ALA n 
8  283  MET n 
8  284  GLY n 
8  285  PRO n 
8  286  ARG n 
8  287  GLN n 
8  288  HIS n 
8  289  TYR n 
8  290  PRO n 
8  291  TYR n 
8  292  GLY n 
8  293  GLY n 
8  294  PRO n 
8  295  TYR n 
8  296  ASP n 
8  297  ARG n 
8  298  VAL n 
8  299  ARG n 
8  300  THR n 
8  301  GLU n 
8  302  PRO n 
8  303  GLY n 
8  304  ILE n 
8  305  GLY n 
8  306  PRO n 
8  307  GLU n 
8  308  GLY n 
8  309  ASN n 
8  310  MET n 
8  311  SER n 
8  312  THR n 
8  313  GLY n 
8  314  ALA n 
8  315  PRO n 
8  316  GLN n 
8  317  PRO n 
8  318  ASN n 
8  319  LEU n 
8  320  MET n 
8  321  PRO n 
8  322  SER n 
8  323  ASN n 
8  324  PRO n 
8  325  ASP n 
8  326  SER n 
8  327  GLY n 
8  328  MET n 
8  329  TYR n 
8  330  SER n 
8  331  PRO n 
8  332  SER n 
8  333  ARG n 
8  334  TYR n 
8  335  PRO n 
8  336  PRO n 
8  337  GLN n 
8  338  GLN n 
8  339  GLN n 
8  340  GLN n 
8  341  GLN n 
8  342  GLN n 
8  343  GLN n 
8  344  GLN n 
8  345  ARG n 
8  346  HIS n 
8  347  ASP n 
8  348  SER n 
8  349  TYR n 
8  350  GLY n 
8  351  ASN n 
8  352  GLN n 
8  353  PHE n 
8  354  SER n 
8  355  THR n 
8  356  GLN n 
8  357  GLY n 
8  358  THR n 
8  359  PRO n 
8  360  SER n 
8  361  GLY n 
8  362  SER n 
8  363  PRO n 
8  364  PHE n 
8  365  PRO n 
8  366  SER n 
8  367  GLN n 
8  368  GLN n 
8  369  THR n 
8  370  THR n 
8  371  MET n 
8  372  TYR n 
8  373  GLN n 
8  374  GLN n 
8  375  GLN n 
8  376  GLN n 
8  377  GLN n 
8  378  ASN n 
8  379  TYR n 
8  380  LYS n 
8  381  ARG n 
8  382  PRO n 
8  383  MET n 
8  384  ASP n 
8  385  GLY n 
8  386  THR n 
8  387  TYR n 
8  388  GLY n 
8  389  PRO n 
8  390  PRO n 
8  391  ALA n 
8  392  LYS n 
8  393  ARG n 
8  394  HIS n 
8  395  GLU n 
8  396  GLY n 
8  397  GLU n 
8  398  MET n 
8  399  TYR n 
8  400  SER n 
8  401  VAL n 
8  402  PRO n 
8  403  TYR n 
8  404  SER n 
8  405  THR n 
8  406  GLY n 
8  407  GLN n 
8  408  GLY n 
8  409  GLN n 
8  410  PRO n 
8  411  GLN n 
8  412  GLN n 
8  413  GLN n 
8  414  GLN n 
8  415  LEU n 
8  416  PRO n 
8  417  PRO n 
8  418  ALA n 
8  419  GLN n 
8  420  PRO n 
8  421  GLN n 
8  422  PRO n 
8  423  ALA n 
8  424  SER n 
8  425  GLN n 
8  426  GLN n 
8  427  GLN n 
8  428  ALA n 
8  429  ALA n 
8  430  GLN n 
8  431  PRO n 
8  432  SER n 
8  433  PRO n 
8  434  GLN n 
8  435  GLN n 
8  436  ASP n 
8  437  VAL n 
8  438  TYR n 
8  439  ASN n 
8  440  GLN n 
8  441  TYR n 
8  442  GLY n 
8  443  ASN n 
8  444  ALA n 
8  445  TYR n 
8  446  PRO n 
8  447  ALA n 
8  448  THR n 
8  449  ALA n 
8  450  THR n 
8  451  ALA n 
8  452  ALA n 
8  453  THR n 
8  454  GLU n 
8  455  ARG n 
8  456  ARG n 
8  457  PRO n 
8  458  ALA n 
8  459  GLY n 
8  460  GLY n 
8  461  PRO n 
8  462  GLN n 
8  463  ASN n 
8  464  GLN n 
8  465  PHE n 
8  466  PRO n 
8  467  PHE n 
8  468  GLN n 
8  469  PHE n 
8  470  GLY n 
8  471  ARG n 
8  472  ASP n 
8  473  ARG n 
8  474  VAL n 
8  475  SER n 
8  476  ALA n 
8  477  PRO n 
8  478  PRO n 
8  479  GLY n 
8  480  THR n 
8  481  ASN n 
8  482  ALA n 
8  483  GLN n 
8  484  GLN n 
8  485  ASN n 
8  486  MET n 
8  487  PRO n 
8  488  PRO n 
8  489  GLN n 
8  490  MET n 
8  491  MET n 
8  492  GLY n 
8  493  GLY n 
8  494  PRO n 
8  495  ILE n 
8  496  GLN n 
8  497  ALA n 
8  498  SER n 
8  499  ALA n 
8  500  GLU n 
8  501  VAL n 
8  502  ALA n 
8  503  GLN n 
8  504  GLN n 
8  505  GLY n 
8  506  THR n 
8  507  MET n 
8  508  TRP n 
8  509  GLN n 
8  510  GLY n 
8  511  ARG n 
8  512  ASN n 
8  513  ASP n 
8  514  MET n 
8  515  THR n 
8  516  TYR n 
8  517  ASN n 
8  518  TYR n 
8  519  ALA n 
8  520  ASN n 
8  521  ARG n 
8  522  GLN n 
8  523  SER n 
8  524  THR n 
8  525  GLY n 
8  526  SER n 
8  527  ALA n 
8  528  PRO n 
8  529  GLN n 
8  530  GLY n 
8  531  PRO n 
8  532  ALA n 
8  533  TYR n 
8  534  HIS n 
8  535  GLY n 
8  536  VAL n 
8  537  ASN n 
8  538  ARG n 
8  539  THR n 
8  540  ASP n 
8  541  GLU n 
8  542  MET n 
8  543  LEU n 
8  544  HIS n 
8  545  THR n 
8  546  ASP n 
8  547  GLN n 
8  548  ARG n 
8  549  ALA n 
8  550  ASN n 
8  551  HIS n 
8  552  GLU n 
8  553  GLY n 
8  554  SER n 
8  555  TRP n 
8  556  PRO n 
8  557  SER n 
8  558  HIS n 
8  559  GLY n 
8  560  THR n 
8  561  ARG n 
8  562  GLN n 
8  563  PRO n 
8  564  PRO n 
8  565  TYR n 
8  566  GLY n 
8  567  PRO n 
8  568  SER n 
8  569  ALA n 
8  570  PRO n 
8  571  VAL n 
8  572  PRO n 
8  573  PRO n 
8  574  MET n 
8  575  THR n 
8  576  ARG n 
8  577  PRO n 
8  578  PRO n 
8  579  PRO n 
8  580  SER n 
8  581  ASN n 
8  582  TYR n 
8  583  GLN n 
8  584  PRO n 
8  585  PRO n 
8  586  PRO n 
8  587  SER n 
8  588  MET n 
8  589  GLN n 
8  590  ASN n 
8  591  HIS n 
8  592  ILE n 
8  593  PRO n 
8  594  GLN n 
8  595  VAL n 
8  596  SER n 
8  597  SER n 
8  598  PRO n 
8  599  ALA n 
8  600  PRO n 
8  601  LEU n 
8  602  PRO n 
8  603  ARG n 
8  604  PRO n 
8  605  MET n 
8  606  GLU n 
8  607  ASN n 
8  608  ARG n 
8  609  THR n 
8  610  SER n 
8  611  PRO n 
8  612  SER n 
8  613  LYS n 
8  614  SER n 
8  615  PRO n 
8  616  PHE n 
8  617  LEU n 
8  618  HIS n 
8  619  SER n 
8  620  GLY n 
8  621  MET n 
8  622  LYS n 
8  623  MET n 
8  624  GLN n 
8  625  LYS n 
8  626  ALA n 
8  627  GLY n 
8  628  PRO n 
8  629  PRO n 
8  630  VAL n 
8  631  PRO n 
8  632  ALA n 
8  633  SER n 
8  634  HIS n 
8  635  ILE n 
8  636  ALA n 
8  637  PRO n 
8  638  ALA n 
8  639  PRO n 
8  640  VAL n 
8  641  GLN n 
8  642  PRO n 
8  643  PRO n 
8  644  MET n 
8  645  ILE n 
8  646  ARG n 
8  647  ARG n 
8  648  ASP n 
8  649  ILE n 
8  650  THR n 
8  651  PHE n 
8  652  PRO n 
8  653  PRO n 
8  654  GLY n 
8  655  SER n 
8  656  VAL n 
8  657  GLU n 
8  658  ALA n 
8  659  THR n 
8  660  GLN n 
8  661  PRO n 
8  662  VAL n 
8  663  LEU n 
8  664  LYS n 
8  665  GLN n 
8  666  ARG n 
8  667  ARG n 
8  668  ARG n 
8  669  LEU n 
8  670  THR n 
8  671  MET n 
8  672  LYS n 
8  673  ASP n 
8  674  ILE n 
8  675  GLY n 
8  676  THR n 
8  677  PRO n 
8  678  GLU n 
8  679  ALA n 
8  680  TRP n 
8  681  ARG n 
8  682  VAL n 
8  683  MET n 
8  684  MET n 
8  685  SER n 
8  686  LEU n 
8  687  LYS n 
8  688  SER n 
8  689  GLY n 
8  690  LEU n 
8  691  LEU n 
8  692  ALA n 
8  693  GLU n 
8  694  SER n 
8  695  THR n 
8  696  TRP n 
8  697  ALA n 
8  698  LEU n 
8  699  ASP n 
8  700  THR n 
8  701  ILE n 
8  702  ASN n 
8  703  ILE n 
8  704  LEU n 
8  705  LEU n 
8  706  TYR n 
8  707  ASP n 
8  708  ASP n 
8  709  ASN n 
8  710  SER n 
8  711  ILE n 
8  712  MET n 
8  713  THR n 
8  714  PHE n 
8  715  ASN n 
8  716  LEU n 
8  717  SER n 
8  718  GLN n 
8  719  LEU n 
8  720  PRO n 
8  721  GLY n 
8  722  LEU n 
8  723  LEU n 
8  724  GLU n 
8  725  LEU n 
8  726  LEU n 
8  727  VAL n 
8  728  GLU n 
8  729  TYR n 
8  730  PHE n 
8  731  ARG n 
8  732  ARG n 
8  733  CYS n 
8  734  LEU n 
8  735  ILE n 
8  736  GLU n 
8  737  ILE n 
8  738  PHE n 
8  739  GLY n 
8  740  ILE n 
8  741  LEU n 
8  742  LYS n 
8  743  GLU n 
8  744  TYR n 
8  745  GLU n 
8  746  VAL n 
8  747  GLY n 
8  748  ASP n 
8  749  PRO n 
8  750  GLY n 
8  751  GLN n 
8  752  ARG n 
8  753  THR n 
8  754  LEU n 
8  755  LEU n 
8  756  ASP n 
8  757  PRO n 
8  758  GLY n 
8  759  ARG n 
8  760  PHE n 
8  761  SER n 
8  762  LYS n 
8  763  VAL n 
8  764  SER n 
8  765  SER n 
8  766  PRO n 
8  767  ALA n 
8  768  PRO n 
8  769  MET n 
8  770  GLU n 
8  771  GLY n 
8  772  GLY n 
8  773  GLU n 
8  774  GLU n 
8  775  GLU n 
8  776  GLU n 
8  777  GLU n 
8  778  LEU n 
8  779  LEU n 
8  780  GLY n 
8  781  PRO n 
8  782  LYS n 
8  783  LEU n 
8  784  GLU n 
8  785  GLU n 
8  786  GLU n 
8  787  GLU n 
8  788  GLU n 
8  789  GLU n 
8  790  GLU n 
8  791  VAL n 
8  792  VAL n 
8  793  GLU n 
8  794  ASN n 
8  795  ASP n 
8  796  GLU n 
8  797  GLU n 
8  798  ILE n 
8  799  ALA n 
8  800  PHE n 
8  801  SER n 
8  802  GLY n 
8  803  LYS n 
8  804  ASP n 
8  805  LYS n 
8  806  PRO n 
8  807  ALA n 
8  808  SER n 
8  809  GLU n 
8  810  ASN n 
8  811  SER n 
8  812  GLU n 
8  813  GLU n 
8  814  LYS n 
8  815  LEU n 
8  816  ILE n 
8  817  SER n 
8  818  LYS n 
8  819  PHE n 
8  820  ASP n 
8  821  LYS n 
8  822  LEU n 
8  823  PRO n 
8  824  VAL n 
8  825  LYS n 
8  826  ILE n 
8  827  VAL n 
8  828  GLN n 
8  829  LYS n 
8  830  ASN n 
8  831  ASP n 
8  832  PRO n 
8  833  PHE n 
8  834  VAL n 
8  835  VAL n 
8  836  ASP n 
8  837  CYS n 
8  838  SER n 
8  839  ASP n 
8  840  LYS n 
8  841  LEU n 
8  842  GLY n 
8  843  ARG n 
8  844  VAL n 
8  845  GLN n 
8  846  GLU n 
8  847  PHE n 
8  848  ASP n 
8  849  SER n 
8  850  GLY n 
8  851  LEU n 
8  852  LEU n 
8  853  HIS n 
8  854  TRP n 
8  855  ARG n 
8  856  ILE n 
8  857  GLY n 
8  858  GLY n 
8  859  GLY n 
8  860  ASP n 
8  861  THR n 
8  862  THR n 
8  863  GLU n 
8  864  HIS n 
8  865  ILE n 
8  866  GLN n 
8  867  THR n 
8  868  HIS n 
8  869  PHE n 
8  870  GLU n 
8  871  SER n 
8  872  LYS n 
8  873  THR n 
8  874  GLU n 
8  875  LEU n 
8  876  LEU n 
8  877  PRO n 
8  878  SER n 
8  879  ARG n 
8  880  PRO n 
8  881  HIS n 
8  882  ALA n 
8  883  PRO n 
8  884  CYS n 
8  885  PRO n 
8  886  PRO n 
8  887  ALA n 
8  888  PRO n 
8  889  ARG n 
8  890  LYS n 
8  891  HIS n 
8  892  VAL n 
8  893  THR n 
8  894  THR n 
8  895  ALA n 
8  896  GLU n 
8  897  GLY n 
8  898  THR n 
8  899  PRO n 
8  900  GLY n 
8  901  THR n 
8  902  THR n 
8  903  ASP n 
8  904  GLN n 
8  905  GLU n 
8  906  GLY n 
8  907  PRO n 
8  908  PRO n 
8  909  PRO n 
8  910  ASP n 
8  911  GLY n 
8  912  PRO n 
8  913  PRO n 
8  914  GLU n 
8  915  LYS n 
8  916  ARG n 
8  917  ILE n 
8  918  THR n 
8  919  ALA n 
8  920  THR n 
8  921  MET n 
8  922  ASP n 
8  923  ASP n 
8  924  MET n 
8  925  LEU n 
8  926  SER n 
8  927  THR n 
8  928  ARG n 
8  929  SER n 
8  930  SER n 
8  931  THR n 
8  932  LEU n 
8  933  THR n 
8  934  GLU n 
8  935  ASP n 
8  936  GLY n 
8  937  ALA n 
8  938  LYS n 
8  939  SER n 
8  940  SER n 
8  941  GLU n 
8  942  ALA n 
8  943  ILE n 
8  944  LYS n 
8  945  GLU n 
8  946  SER n 
8  947  SER n 
8  948  LYS n 
8  949  PHE n 
8  950  PRO n 
8  951  PHE n 
8  952  GLY n 
8  953  ILE n 
8  954  SER n 
8  955  PRO n 
8  956  ALA n 
8  957  GLN n 
8  958  SER n 
8  959  HIS n 
8  960  ARG n 
8  961  ASN n 
8  962  ILE n 
8  963  LYS n 
8  964  ILE n 
8  965  LEU n 
8  966  GLU n 
8  967  ASP n 
8  968  GLU n 
8  969  PRO n 
8  970  HIS n 
8  971  SER n 
8  972  LYS n 
8  973  ASP n 
8  974  GLU n 
8  975  THR n 
8  976  PRO n 
8  977  LEU n 
8  978  CYS n 
8  979  THR n 
8  980  LEU n 
8  981  LEU n 
8  982  ASP n 
8  983  TRP n 
8  984  GLN n 
8  985  ASP n 
8  986  SER n 
8  987  LEU n 
8  988  ALA n 
8  989  LYS n 
8  990  ARG n 
8  991  CYS n 
8  992  VAL n 
8  993  CYS n 
8  994  VAL n 
8  995  SER n 
8  996  ASN n 
8  997  THR n 
8  998  ILE n 
8  999  ARG n 
8  1000 SER n 
8  1001 LEU n 
8  1002 SER n 
8  1003 PHE n 
8  1004 VAL n 
8  1005 PRO n 
8  1006 GLY n 
8  1007 ASN n 
8  1008 ASP n 
8  1009 PHE n 
8  1010 GLU n 
8  1011 MET n 
8  1012 SER n 
8  1013 LYS n 
8  1014 HIS n 
8  1015 PRO n 
8  1016 GLY n 
8  1017 LEU n 
8  1018 LEU n 
8  1019 LEU n 
8  1020 ILE n 
8  1021 LEU n 
8  1022 GLY n 
8  1023 LYS n 
8  1024 LEU n 
8  1025 ILE n 
8  1026 LEU n 
8  1027 LEU n 
8  1028 HIS n 
8  1029 HIS n 
8  1030 LYS n 
8  1031 HIS n 
8  1032 PRO n 
8  1033 GLU n 
8  1034 ARG n 
8  1035 LYS n 
8  1036 GLN n 
8  1037 ALA n 
8  1038 PRO n 
8  1039 LEU n 
8  1040 THR n 
8  1041 TYR n 
8  1042 GLU n 
8  1043 LYS n 
8  1044 GLU n 
8  1045 GLU n 
8  1046 GLU n 
8  1047 GLN n 
8  1048 ASP n 
8  1049 GLN n 
8  1050 GLY n 
8  1051 VAL n 
8  1052 SER n 
8  1053 CYS n 
8  1054 ASN n 
8  1055 LYS n 
8  1056 VAL n 
8  1057 GLU n 
8  1058 TRP n 
8  1059 TRP n 
8  1060 TRP n 
8  1061 ASP n 
8  1062 CYS n 
8  1063 LEU n 
8  1064 GLU n 
8  1065 MET n 
8  1066 LEU n 
8  1067 ARG n 
8  1068 GLU n 
8  1069 ASN n 
8  1070 THR n 
8  1071 LEU n 
8  1072 VAL n 
8  1073 THR n 
8  1074 LEU n 
8  1075 ALA n 
8  1076 ASN n 
8  1077 ILE n 
8  1078 SER n 
8  1079 GLY n 
8  1080 GLN n 
8  1081 LEU n 
8  1082 ASP n 
8  1083 LEU n 
8  1084 SER n 
8  1085 PRO n 
8  1086 TYR n 
8  1087 PRO n 
8  1088 GLU n 
8  1089 SER n 
8  1090 ILE n 
8  1091 CYS n 
8  1092 LEU n 
8  1093 PRO n 
8  1094 VAL n 
8  1095 LEU n 
8  1096 ASP n 
8  1097 GLY n 
8  1098 LEU n 
8  1099 LEU n 
8  1100 HIS n 
8  1101 TRP n 
8  1102 ALA n 
8  1103 VAL n 
8  1104 CYS n 
8  1105 PRO n 
8  1106 SER n 
8  1107 ALA n 
8  1108 GLU n 
8  1109 ALA n 
8  1110 GLN n 
8  1111 ASP n 
8  1112 PRO n 
8  1113 PHE n 
8  1114 SER n 
8  1115 THR n 
8  1116 LEU n 
8  1117 GLY n 
8  1118 PRO n 
8  1119 ASN n 
8  1120 ALA n 
8  1121 VAL n 
8  1122 LEU n 
8  1123 SER n 
8  1124 PRO n 
8  1125 GLN n 
8  1126 ARG n 
8  1127 LEU n 
8  1128 VAL n 
8  1129 LEU n 
8  1130 GLU n 
8  1131 THR n 
8  1132 LEU n 
8  1133 SER n 
8  1134 LYS n 
8  1135 LEU n 
8  1136 SER n 
8  1137 ILE n 
8  1138 GLN n 
8  1139 ASP n 
8  1140 ASN n 
8  1141 ASN n 
8  1142 VAL n 
8  1143 ASP n 
8  1144 LEU n 
8  1145 ILE n 
8  1146 LEU n 
8  1147 ALA n 
8  1148 THR n 
8  1149 PRO n 
8  1150 PRO n 
8  1151 PHE n 
8  1152 SER n 
8  1153 ARG n 
8  1154 LEU n 
8  1155 GLU n 
8  1156 LYS n 
8  1157 LEU n 
8  1158 TYR n 
8  1159 SER n 
8  1160 THR n 
8  1161 MET n 
8  1162 VAL n 
8  1163 ARG n 
8  1164 PHE n 
8  1165 LEU n 
8  1166 SER n 
8  1167 ASP n 
8  1168 ARG n 
8  1169 LYS n 
8  1170 ASN n 
8  1171 PRO n 
8  1172 VAL n 
8  1173 CYS n 
8  1174 ARG n 
8  1175 GLU n 
8  1176 MET n 
8  1177 ALA n 
8  1178 VAL n 
8  1179 VAL n 
8  1180 LEU n 
8  1181 LEU n 
8  1182 ALA n 
8  1183 ASN n 
8  1184 LEU n 
8  1185 ALA n 
8  1186 GLN n 
8  1187 GLY n 
8  1188 ASP n 
8  1189 SER n 
8  1190 LEU n 
8  1191 ALA n 
8  1192 ALA n 
8  1193 ARG n 
8  1194 ALA n 
8  1195 ILE n 
8  1196 ALA n 
8  1197 VAL n 
8  1198 GLN n 
8  1199 LYS n 
8  1200 GLY n 
8  1201 SER n 
8  1202 ILE n 
8  1203 GLY n 
8  1204 ASN n 
8  1205 LEU n 
8  1206 LEU n 
8  1207 GLY n 
8  1208 PHE n 
8  1209 LEU n 
8  1210 GLU n 
8  1211 ASP n 
8  1212 SER n 
8  1213 LEU n 
8  1214 ALA n 
8  1215 ALA n 
8  1216 THR n 
8  1217 GLN n 
8  1218 PHE n 
8  1219 GLN n 
8  1220 GLN n 
8  1221 SER n 
8  1222 GLN n 
8  1223 ALA n 
8  1224 SER n 
8  1225 LEU n 
8  1226 LEU n 
8  1227 HIS n 
8  1228 MET n 
8  1229 GLN n 
8  1230 ASN n 
8  1231 PRO n 
8  1232 PRO n 
8  1233 PHE n 
8  1234 GLU n 
8  1235 PRO n 
8  1236 THR n 
8  1237 SER n 
8  1238 VAL n 
8  1239 ASP n 
8  1240 MET n 
8  1241 MET n 
8  1242 ARG n 
8  1243 ARG n 
8  1244 ALA n 
8  1245 ALA n 
8  1246 ARG n 
8  1247 ALA n 
8  1248 LEU n 
8  1249 LEU n 
8  1250 ALA n 
8  1251 LEU n 
8  1252 ALA n 
8  1253 LYS n 
8  1254 VAL n 
8  1255 ASP n 
8  1256 GLU n 
8  1257 ASN n 
8  1258 HIS n 
8  1259 SER n 
8  1260 GLU n 
8  1261 PHE n 
8  1262 THR n 
8  1263 LEU n 
8  1264 TYR n 
8  1265 GLU n 
8  1266 SER n 
8  1267 ARG n 
8  1268 LEU n 
8  1269 LEU n 
8  1270 ASP n 
8  1271 ILE n 
8  1272 SER n 
8  1273 VAL n 
8  1274 SER n 
8  1275 PRO n 
8  1276 LEU n 
8  1277 MET n 
8  1278 ASN n 
8  1279 SER n 
8  1280 LEU n 
8  1281 VAL n 
8  1282 SER n 
8  1283 GLN n 
8  1284 VAL n 
8  1285 ILE n 
8  1286 CYS n 
8  1287 ASP n 
8  1288 VAL n 
8  1289 LEU n 
8  1290 PHE n 
8  1291 LEU n 
8  1292 ILE n 
8  1293 GLY n 
8  1294 GLN n 
8  1295 SER n 
9  1    MET n 
9  2    MET n 
9  3    MET n 
9  4    MET n 
9  5    ALA n 
9  6    LEU n 
9  7    SER n 
9  8    LYS n 
9  9    THR n 
9  10   PHE n 
9  11   GLY n 
9  12   GLN n 
9  13   LYS n 
9  14   PRO n 
9  15   VAL n 
9  16   LYS n 
9  17   PHE n 
9  18   GLN n 
9  19   LEU n 
9  20   GLU n 
9  21   ASP n 
9  22   ASP n 
9  23   GLY n 
9  24   GLU n 
9  25   PHE n 
9  26   TYR n 
9  27   MET n 
9  28   ILE n 
9  29   GLY n 
9  30   SER n 
9  31   GLU n 
9  32   VAL n 
9  33   GLY n 
9  34   ASN n 
9  35   TYR n 
9  36   LEU n 
9  37   ARG n 
9  38   MET n 
9  39   PHE n 
9  40   ARG n 
9  41   GLY n 
9  42   SER n 
9  43   LEU n 
9  44   TYR n 
9  45   LYS n 
9  46   ARG n 
9  47   TYR n 
9  48   PRO n 
9  49   SER n 
9  50   LEU n 
9  51   TRP n 
9  52   ARG n 
9  53   ARG n 
9  54   LEU n 
9  55   ALA n 
9  56   THR n 
9  57   VAL n 
9  58   GLU n 
9  59   GLU n 
9  60   ARG n 
9  61   LYS n 
9  62   LYS n 
9  63   ILE n 
9  64   VAL n 
9  65   ALA n 
9  66   SER n 
9  67   SER n 
9  68   HIS n 
9  69   GLY n 
9  70   LYS n 
9  71   LYS n 
9  72   THR n 
9  73   LYS n 
9  74   PRO n 
9  75   ASN n 
9  76   THR n 
9  77   LYS n 
9  78   ASP n 
9  79   HIS n 
9  80   GLY n 
9  81   TYR n 
9  82   THR n 
9  83   THR n 
9  84   LEU n 
9  85   ALA n 
9  86   THR n 
9  87   SER n 
9  88   VAL n 
9  89   THR n 
9  90   LEU n 
9  91   LEU n 
9  92   LYS n 
9  93   ALA n 
9  94   SER n 
9  95   GLU n 
9  96   VAL n 
9  97   GLU n 
9  98   GLU n 
9  99   ILE n 
9  100  LEU n 
9  101  ASP n 
9  102  GLY n 
9  103  ASN n 
9  104  ASP n 
9  105  GLU n 
9  106  LYS n 
9  107  TYR n 
9  108  LYS n 
9  109  ALA n 
9  110  VAL n 
9  111  SER n 
9  112  ILE n 
9  113  SER n 
9  114  GLY n 
9  115  GLY n 
9  116  SER n 
9  117  GLY n 
9  118  GLY n 
9  119  SER n 
9  120  GLY n 
9  121  GLY n 
9  122  SER n 
9  123  ASP n 
9  124  PRO n 
9  125  ALA n 
9  126  VAL n 
9  127  ILE n 
9  128  HIS n 
9  129  GLU n 
9  130  ASN n 
9  131  ALA n 
9  132  SER n 
9  133  GLN n 
9  134  PRO n 
9  135  GLU n 
9  136  VAL n 
9  137  LEU n 
9  138  VAL n 
9  139  PRO n 
9  140  ILE n 
9  141  ARG n 
9  142  LEU n 
9  143  ASP n 
9  144  MET n 
9  145  GLU n 
9  146  ILE n 
9  147  ASP n 
9  148  GLY n 
9  149  GLN n 
9  150  LYS n 
9  151  LEU n 
9  152  ARG n 
9  153  ASP n 
9  154  ALA n 
9  155  PHE n 
9  156  THR n 
9  157  TRP n 
9  158  ASN n 
9  159  MET n 
9  160  ASN n 
9  161  GLU n 
9  162  LYS n 
9  163  LEU n 
9  164  MET n 
9  165  THR n 
9  166  PRO n 
9  167  GLU n 
9  168  MET n 
9  169  PHE n 
9  170  SER n 
9  171  GLU n 
9  172  ILE n 
9  173  LEU n 
9  174  CYS n 
9  175  ASP n 
9  176  ASP n 
9  177  LEU n 
9  178  ASP n 
9  179  LEU n 
9  180  ASN n 
9  181  PRO n 
9  182  LEU n 
9  183  THR n 
9  184  PHE n 
9  185  VAL n 
9  186  PRO n 
9  187  ALA n 
9  188  ILE n 
9  189  ALA n 
9  190  SER n 
9  191  ALA n 
9  192  ILE n 
9  193  ARG n 
9  194  GLN n 
9  195  GLN n 
9  196  ILE n 
9  197  GLU n 
9  198  SER n 
9  199  TYR n 
9  200  PRO n 
9  201  THR n 
9  202  ASP n 
9  203  SER n 
9  204  ILE n 
9  205  LEU n 
9  206  GLU n 
9  207  ASP n 
9  208  GLN n 
9  209  SER n 
9  210  ASP n 
9  211  GLN n 
9  212  ARG n 
9  213  VAL n 
9  214  ILE n 
9  215  ILE n 
9  216  LYS n 
9  217  LEU n 
9  218  ASN n 
9  219  ILE n 
9  220  HIS n 
9  221  VAL n 
9  222  GLY n 
9  223  ASN n 
9  224  ILE n 
9  225  SER n 
9  226  LEU n 
9  227  VAL n 
9  228  ASP n 
9  229  GLN n 
9  230  PHE n 
9  231  GLU n 
9  232  TRP n 
9  233  ASP n 
9  234  MET n 
9  235  SER n 
9  236  GLU n 
9  237  LYS n 
9  238  GLU n 
9  239  ASN n 
9  240  SER n 
9  241  PRO n 
9  242  GLU n 
9  243  LYS n 
9  244  PHE n 
9  245  ALA n 
9  246  LEU n 
9  247  LYS n 
9  248  LEU n 
9  249  CYS n 
9  250  SER n 
9  251  GLU n 
9  252  LEU n 
9  253  GLY n 
9  254  LEU n 
9  255  GLY n 
9  256  GLY n 
9  257  GLU n 
9  258  PHE n 
9  259  VAL n 
9  260  THR n 
9  261  THR n 
9  262  ILE n 
9  263  ALA n 
9  264  TYR n 
9  265  SER n 
9  266  ILE n 
9  267  ARG n 
9  268  GLY n 
9  269  GLN n 
9  270  LEU n 
9  271  SER n 
9  272  TRP n 
9  273  HIS n 
9  274  GLN n 
9  275  LYS n 
9  276  THR n 
9  277  TYR n 
9  278  ALA n 
9  279  PHE n 
9  280  SER n 
9  281  GLU n 
9  282  ASN n 
9  283  PRO n 
9  284  LEU n 
9  285  PRO n 
9  286  THR n 
9  287  VAL n 
9  288  GLU n 
9  289  ILE n 
9  290  ALA n 
9  291  ILE n 
9  292  ARG n 
9  293  ASN n 
9  294  THR n 
9  295  GLY n 
9  296  ASP n 
9  297  ALA n 
9  298  ASP n 
9  299  GLN n 
9  300  TRP n 
9  301  CYS n 
9  302  PRO n 
9  303  LEU n 
9  304  LEU n 
9  305  GLU n 
9  306  THR n 
9  307  LEU n 
9  308  THR n 
9  309  ASP n 
9  310  ALA n 
9  311  GLU n 
9  312  MET n 
9  313  GLU n 
9  314  LYS n 
9  315  LYS n 
9  316  ILE n 
9  317  ARG n 
9  318  ASP n 
9  319  GLN n 
9  320  ASP n 
9  321  ARG n 
9  322  ASN n 
9  323  THR n 
9  324  ARG n 
9  325  ARG n 
9  326  MET n 
9  327  ARG n 
9  328  ARG n 
9  329  LEU n 
9  330  ALA n 
9  331  ASN n 
9  332  THR n 
9  333  ALA n 
9  334  PRO n 
9  335  ALA n 
9  336  TRP n 
10 1    MET n 
10 2    ALA n 
10 3    VAL n 
10 4    ARG n 
10 5    LYS n 
10 6    LYS n 
10 7    ASP n 
10 8    GLY n 
10 9    GLY n 
10 10   PRO n 
10 11   ASN n 
10 12   VAL n 
10 13   LYS n 
10 14   TYR n 
10 15   TYR n 
10 16   GLU n 
10 17   ALA n 
10 18   ALA n 
10 19   ASP n 
10 20   THR n 
10 21   VAL n 
10 22   THR n 
10 23   GLN n 
10 24   PHE n 
10 25   ASP n 
10 26   ASN n 
10 27   VAL n 
10 28   ARG n 
10 29   LEU n 
10 30   TRP n 
10 31   LEU n 
10 32   GLY n 
10 33   LYS n 
10 34   ASN n 
10 35   TYR n 
10 36   LYS n 
10 37   LYS n 
10 38   TYR n 
10 39   ILE n 
10 40   GLN n 
10 41   ALA n 
10 42   GLU n 
10 43   PRO n 
10 44   PRO n 
10 45   THR n 
10 46   ASN n 
10 47   LYS n 
10 48   SER n 
10 49   LEU n 
10 50   SER n 
10 51   SER n 
10 52   LEU n 
10 53   VAL n 
10 54   VAL n 
10 55   GLN n 
10 56   LEU n 
10 57   LEU n 
10 58   GLN n 
10 59   PHE n 
10 60   GLN n 
10 61   GLU n 
10 62   GLU n 
10 63   VAL n 
10 64   PHE n 
10 65   GLY n 
10 66   LYS n 
10 67   HIS n 
10 68   VAL n 
10 69   SER n 
10 70   ASN n 
10 71   ALA n 
10 72   PRO n 
10 73   LEU n 
10 74   THR n 
10 75   LYS n 
10 76   LEU n 
10 77   PRO n 
10 78   ILE n 
10 79   LYS n 
10 80   CYS n 
10 81   PHE n 
10 82   LEU n 
10 83   ASP n 
10 84   PHE n 
10 85   LYS n 
10 86   ALA n 
10 87   GLY n 
10 88   GLY n 
10 89   SER n 
10 90   LEU n 
10 91   CYS n 
10 92   HIS n 
10 93   ILE n 
10 94   LEU n 
10 95   ALA n 
10 96   ALA n 
10 97   ALA n 
10 98   TYR n 
10 99   LYS n 
10 100  PHE n 
10 101  LYS n 
10 102  SER n 
10 103  ASP n 
10 104  GLN n 
10 105  GLY n 
10 106  TRP n 
10 107  ARG n 
10 108  ARG n 
10 109  TYR n 
10 110  ASP n 
10 111  PHE n 
10 112  GLN n 
10 113  ASN n 
10 114  PRO n 
10 115  SER n 
10 116  ARG n 
10 117  MET n 
10 118  ASP n 
10 119  ARG n 
10 120  ASN n 
10 121  VAL n 
10 122  GLU n 
10 123  MET n 
10 124  PHE n 
10 125  MET n 
10 126  THR n 
10 127  ILE n 
10 128  GLU n 
10 129  LYS n 
10 130  SER n 
10 131  LEU n 
10 132  VAL n 
10 133  GLN n 
10 134  ASN n 
10 135  ASN n 
10 136  CYS n 
10 137  LEU n 
10 138  SER n 
10 139  ARG n 
10 140  PRO n 
10 141  ASN n 
10 142  ILE n 
10 143  PHE n 
10 144  LEU n 
10 145  CYS n 
10 146  PRO n 
10 147  GLU n 
10 148  ILE n 
10 149  GLU n 
10 150  PRO n 
10 151  LYS n 
10 152  LEU n 
10 153  LEU n 
10 154  GLY n 
10 155  LYS n 
10 156  LEU n 
10 157  LYS n 
10 158  ASP n 
10 159  ILE n 
10 160  ILE n 
10 161  LYS n 
10 162  ARG n 
10 163  HIS n 
10 164  GLN n 
10 165  GLY n 
10 166  THR n 
10 167  VAL n 
10 168  THR n 
10 169  GLU n 
10 170  ASP n 
10 171  LYS n 
10 172  ASN n 
10 173  ASN n 
10 174  ALA n 
10 175  SER n 
10 176  HIS n 
10 177  VAL n 
10 178  VAL n 
10 179  TYR n 
10 180  PRO n 
10 181  VAL n 
10 182  PRO n 
10 183  GLY n 
10 184  ASN n 
10 185  LEU n 
10 186  GLU n 
10 187  GLU n 
10 188  GLU n 
10 189  GLU n 
10 190  TRP n 
10 191  VAL n 
10 192  ARG n 
10 193  PRO n 
10 194  VAL n 
10 195  MET n 
10 196  LYS n 
10 197  ARG n 
10 198  ASP n 
10 199  LYS n 
10 200  GLN n 
10 201  VAL n 
10 202  LEU n 
10 203  LEU n 
10 204  HIS n 
10 205  TRP n 
10 206  GLY n 
10 207  TYR n 
10 208  TYR n 
10 209  PRO n 
10 210  ASP n 
10 211  SER n 
10 212  TYR n 
10 213  ASP n 
10 214  THR n 
10 215  TRP n 
10 216  ILE n 
10 217  PRO n 
10 218  ALA n 
10 219  SER n 
10 220  GLU n 
10 221  ILE n 
10 222  GLU n 
10 223  ALA n 
10 224  SER n 
10 225  VAL n 
10 226  GLU n 
10 227  ASP n 
10 228  ALA n 
10 229  PRO n 
10 230  THR n 
10 231  PRO n 
10 232  GLU n 
10 233  LYS n 
10 234  PRO n 
10 235  ARG n 
10 236  LYS n 
10 237  VAL n 
10 238  HIS n 
10 239  ALA n 
10 240  LYS n 
10 241  TRP n 
10 242  ILE n 
10 243  LEU n 
10 244  ASP n 
10 245  THR n 
10 246  ASP n 
10 247  THR n 
10 248  PHE n 
10 249  ASN n 
10 250  GLU n 
10 251  TRP n 
10 252  MET n 
10 253  ASN n 
10 254  GLU n 
10 255  GLU n 
10 256  ASP n 
10 257  TYR n 
10 258  GLU n 
10 259  VAL n 
10 260  ASN n 
10 261  ASP n 
10 262  ASP n 
10 263  LYS n 
10 264  ASN n 
10 265  PRO n 
10 266  VAL n 
10 267  SER n 
10 268  ARG n 
10 269  ARG n 
10 270  LYS n 
10 271  LYS n 
10 272  ILE n 
10 273  SER n 
10 274  ALA n 
10 275  LYS n 
10 276  THR n 
10 277  LEU n 
10 278  THR n 
10 279  ASP n 
10 280  GLU n 
10 281  VAL n 
10 282  ASN n 
10 283  SER n 
10 284  PRO n 
10 285  ASP n 
10 286  SER n 
10 287  ASP n 
10 288  ARG n 
10 289  ARG n 
10 290  ASP n 
10 291  LYS n 
10 292  LYS n 
10 293  GLY n 
10 294  GLY n 
10 295  ASN n 
10 296  TYR n 
10 297  LYS n 
10 298  LYS n 
10 299  ARG n 
10 300  LYS n 
10 301  ARG n 
10 302  SER n 
10 303  PRO n 
10 304  SER n 
10 305  PRO n 
10 306  SER n 
10 307  PRO n 
10 308  THR n 
10 309  PRO n 
10 310  GLU n 
10 311  ALA n 
10 312  LYS n 
10 313  LYS n 
10 314  LYS n 
10 315  ASN n 
10 316  ALA n 
10 317  LYS n 
10 318  LYS n 
10 319  GLY n 
10 320  PRO n 
10 321  SER n 
10 322  THR n 
10 323  PRO n 
10 324  TYR n 
10 325  THR n 
10 326  LYS n 
10 327  SER n 
10 328  LYS n 
10 329  ARG n 
10 330  GLY n 
10 331  HIS n 
10 332  ARG n 
10 333  GLU n 
10 334  GLU n 
10 335  GLU n 
10 336  GLN n 
10 337  GLU n 
10 338  ASP n 
10 339  LEU n 
10 340  THR n 
10 341  LYS n 
10 342  ASP n 
10 343  MET n 
10 344  ASP n 
10 345  GLU n 
10 346  PRO n 
10 347  SER n 
10 348  PRO n 
10 349  VAL n 
10 350  PRO n 
10 351  ASN n 
10 352  VAL n 
10 353  GLU n 
10 354  GLU n 
10 355  VAL n 
10 356  THR n 
10 357  LEU n 
10 358  PRO n 
10 359  LYS n 
10 360  THR n 
10 361  VAL n 
10 362  ASN n 
10 363  THR n 
10 364  LYS n 
10 365  LYS n 
10 366  ASP n 
10 367  SER n 
10 368  GLU n 
10 369  SER n 
10 370  ALA n 
10 371  PRO n 
10 372  VAL n 
10 373  LYS n 
10 374  GLY n 
10 375  GLY n 
10 376  THR n 
10 377  MET n 
10 378  THR n 
10 379  ASP n 
10 380  LEU n 
10 381  ASP n 
10 382  GLU n 
10 383  GLN n 
10 384  GLU n 
10 385  ASP n 
10 386  GLU n 
10 387  SER n 
10 388  MET n 
10 389  GLU n 
10 390  THR n 
10 391  THR n 
10 392  GLY n 
10 393  LYS n 
10 394  ASP n 
10 395  GLU n 
10 396  ASP n 
10 397  GLU n 
10 398  ASN n 
10 399  SER n 
10 400  THR n 
10 401  GLY n 
10 402  ASN n 
10 403  LYS n 
10 404  GLY n 
10 405  GLU n 
10 406  GLN n 
10 407  THR n 
10 408  LYS n 
10 409  ASN n 
10 410  PRO n 
10 411  ASP n 
10 412  LEU n 
10 413  HIS n 
10 414  GLU n 
10 415  ASP n 
10 416  ASN n 
10 417  VAL n 
10 418  THR n 
10 419  GLU n 
10 420  GLN n 
10 421  THR n 
10 422  HIS n 
10 423  HIS n 
10 424  ILE n 
10 425  ILE n 
10 426  ILE n 
10 427  PRO n 
10 428  SER n 
10 429  TYR n 
10 430  ALA n 
10 431  ALA n 
10 432  TRP n 
10 433  PHE n 
10 434  ASP n 
10 435  TYR n 
10 436  ASN n 
10 437  SER n 
10 438  VAL n 
10 439  HIS n 
10 440  ALA n 
10 441  ILE n 
10 442  GLU n 
10 443  ARG n 
10 444  ARG n 
10 445  ALA n 
10 446  LEU n 
10 447  PRO n 
10 448  GLU n 
10 449  PHE n 
10 450  PHE n 
10 451  ASN n 
10 452  GLY n 
10 453  LYS n 
10 454  ASN n 
10 455  LYS n 
10 456  SER n 
10 457  LYS n 
10 458  THR n 
10 459  PRO n 
10 460  GLU n 
10 461  ILE n 
10 462  TYR n 
10 463  LEU n 
10 464  ALA n 
10 465  TYR n 
10 466  ARG n 
10 467  ASN n 
10 468  PHE n 
10 469  MET n 
10 470  ILE n 
10 471  ASP n 
10 472  THR n 
10 473  TYR n 
10 474  ARG n 
10 475  LEU n 
10 476  ASN n 
10 477  PRO n 
10 478  GLN n 
10 479  GLU n 
10 480  TYR n 
10 481  LEU n 
10 482  THR n 
10 483  SER n 
10 484  THR n 
10 485  ALA n 
10 486  CYS n 
10 487  ARG n 
10 488  ARG n 
10 489  ASN n 
10 490  LEU n 
10 491  ALA n 
10 492  GLY n 
10 493  ASP n 
10 494  VAL n 
10 495  CYS n 
10 496  ALA n 
10 497  ILE n 
10 498  MET n 
10 499  ARG n 
10 500  VAL n 
10 501  HIS n 
10 502  ALA n 
10 503  PHE n 
10 504  LEU n 
10 505  GLU n 
10 506  GLN n 
10 507  TRP n 
10 508  GLY n 
10 509  LEU n 
10 510  ILE n 
10 511  ASN n 
10 512  TYR n 
10 513  GLN n 
10 514  VAL n 
10 515  ASP n 
10 516  ALA n 
10 517  GLU n 
10 518  SER n 
10 519  ARG n 
10 520  PRO n 
10 521  THR n 
10 522  PRO n 
10 523  MET n 
10 524  GLY n 
10 525  PRO n 
10 526  PRO n 
10 527  PRO n 
10 528  THR n 
10 529  SER n 
10 530  HIS n 
10 531  PHE n 
10 532  HIS n 
10 533  VAL n 
10 534  LEU n 
10 535  ALA n 
10 536  ASP n 
10 537  THR n 
10 538  PRO n 
10 539  SER n 
10 540  GLY n 
10 541  LEU n 
10 542  VAL n 
10 543  PRO n 
10 544  LEU n 
10 545  GLN n 
10 546  PRO n 
10 547  LYS n 
10 548  THR n 
10 549  PRO n 
10 550  GLN n 
10 551  GLN n 
10 552  THR n 
10 553  SER n 
10 554  ALA n 
10 555  SER n 
10 556  GLN n 
10 557  GLN n 
10 558  MET n 
10 559  LEU n 
10 560  ASN n 
10 561  PHE n 
10 562  PRO n 
10 563  ASP n 
10 564  LYS n 
10 565  GLY n 
10 566  LYS n 
10 567  GLU n 
10 568  LYS n 
10 569  PRO n 
10 570  THR n 
10 571  ASP n 
10 572  MET n 
10 573  GLN n 
10 574  ASN n 
10 575  PHE n 
10 576  GLY n 
10 577  LEU n 
10 578  ARG n 
10 579  THR n 
10 580  ASP n 
10 581  MET n 
10 582  TYR n 
10 583  THR n 
10 584  LYS n 
10 585  LYS n 
10 586  ASN n 
10 587  VAL n 
10 588  PRO n 
10 589  SER n 
10 590  LYS n 
10 591  SER n 
10 592  LYS n 
10 593  ALA n 
10 594  ALA n 
10 595  ALA n 
10 596  SER n 
10 597  ALA n 
10 598  THR n 
10 599  ARG n 
10 600  GLU n 
10 601  TRP n 
10 602  THR n 
10 603  GLU n 
10 604  GLN n 
10 605  GLU n 
10 606  THR n 
10 607  LEU n 
10 608  LEU n 
10 609  LEU n 
10 610  LEU n 
10 611  GLU n 
10 612  ALA n 
10 613  LEU n 
10 614  GLU n 
10 615  MET n 
10 616  TYR n 
10 617  LYS n 
10 618  ASP n 
10 619  ASP n 
10 620  TRP n 
10 621  ASN n 
10 622  LYS n 
10 623  VAL n 
10 624  SER n 
10 625  GLU n 
10 626  HIS n 
10 627  VAL n 
10 628  GLY n 
10 629  SER n 
10 630  ARG n 
10 631  THR n 
10 632  GLN n 
10 633  ASP n 
10 634  GLU n 
10 635  CYS n 
10 636  ILE n 
10 637  LEU n 
10 638  HIS n 
10 639  PHE n 
10 640  LEU n 
10 641  ARG n 
10 642  LEU n 
10 643  PRO n 
10 644  ILE n 
10 645  GLU n 
10 646  ASP n 
10 647  PRO n 
10 648  TYR n 
10 649  LEU n 
10 650  GLU n 
10 651  ASP n 
10 652  SER n 
10 653  GLU n 
10 654  ALA n 
10 655  SER n 
10 656  LEU n 
10 657  GLY n 
10 658  PRO n 
10 659  LEU n 
10 660  ALA n 
10 661  TYR n 
10 662  GLN n 
10 663  PRO n 
10 664  ILE n 
10 665  PRO n 
10 666  PHE n 
10 667  SER n 
10 668  GLN n 
10 669  SER n 
10 670  GLY n 
10 671  ASN n 
10 672  PRO n 
10 673  VAL n 
10 674  MET n 
10 675  SER n 
10 676  THR n 
10 677  VAL n 
10 678  ALA n 
10 679  PHE n 
10 680  LEU n 
10 681  ALA n 
10 682  SER n 
10 683  VAL n 
10 684  VAL n 
10 685  ASP n 
10 686  PRO n 
10 687  ARG n 
10 688  VAL n 
10 689  ALA n 
10 690  SER n 
10 691  ALA n 
10 692  ALA n 
10 693  ALA n 
10 694  LYS n 
10 695  SER n 
10 696  ALA n 
10 697  LEU n 
10 698  GLU n 
10 699  GLU n 
10 700  PHE n 
10 701  SER n 
10 702  LYS n 
10 703  MET n 
10 704  LYS n 
10 705  GLU n 
10 706  GLU n 
10 707  VAL n 
10 708  PRO n 
10 709  THR n 
10 710  ALA n 
10 711  LEU n 
10 712  VAL n 
10 713  GLU n 
10 714  ALA n 
10 715  HIS n 
10 716  VAL n 
10 717  ARG n 
10 718  LYS n 
10 719  VAL n 
10 720  GLU n 
10 721  GLU n 
10 722  ALA n 
10 723  ALA n 
10 724  LYS n 
10 725  VAL n 
10 726  THR n 
10 727  GLY n 
10 728  LYS n 
10 729  ALA n 
10 730  ASP n 
10 731  PRO n 
10 732  ALA n 
10 733  PHE n 
10 734  GLY n 
10 735  LEU n 
10 736  GLU n 
10 737  SER n 
10 738  SER n 
10 739  GLY n 
10 740  ILE n 
10 741  ALA n 
10 742  GLY n 
10 743  THR n 
10 744  THR n 
10 745  SER n 
10 746  ASP n 
10 747  GLU n 
10 748  PRO n 
10 749  GLU n 
10 750  ARG n 
10 751  ILE n 
10 752  GLU n 
10 753  GLU n 
10 754  SER n 
10 755  GLY n 
10 756  ASN n 
10 757  ASP n 
10 758  GLU n 
10 759  ALA n 
10 760  ARG n 
10 761  VAL n 
10 762  GLU n 
10 763  GLY n 
10 764  GLN n 
10 765  ALA n 
10 766  THR n 
10 767  ASP n 
10 768  GLU n 
10 769  LYS n 
10 770  LYS n 
10 771  GLU n 
10 772  PRO n 
10 773  LYS n 
10 774  GLU n 
10 775  PRO n 
10 776  ARG n 
10 777  GLU n 
10 778  GLY n 
10 779  GLY n 
10 780  GLY n 
10 781  ALA n 
10 782  ILE n 
10 783  GLU n 
10 784  GLU n 
10 785  GLU n 
10 786  ALA n 
10 787  LYS n 
10 788  GLU n 
10 789  LYS n 
10 790  THR n 
10 791  SER n 
10 792  GLU n 
10 793  ALA n 
10 794  PRO n 
10 795  LYS n 
10 796  LYS n 
10 797  ASP n 
10 798  GLU n 
10 799  GLU n 
10 800  LYS n 
10 801  GLY n 
10 802  LYS n 
10 803  GLU n 
10 804  GLY n 
10 805  ASP n 
10 806  SER n 
10 807  GLU n 
10 808  LYS n 
10 809  GLU n 
10 810  SER n 
10 811  GLU n 
10 812  LYS n 
10 813  SER n 
10 814  ASP n 
10 815  GLY n 
10 816  ASP n 
10 817  PRO n 
10 818  ILE n 
10 819  VAL n 
10 820  ASP n 
10 821  PRO n 
10 822  GLU n 
10 823  LYS n 
10 824  GLU n 
10 825  LYS n 
10 826  GLU n 
10 827  PRO n 
10 828  LYS n 
10 829  GLU n 
10 830  GLY n 
10 831  GLN n 
10 832  GLU n 
10 833  GLU n 
10 834  VAL n 
10 835  LEU n 
10 836  LYS n 
10 837  GLU n 
10 838  VAL n 
10 839  VAL n 
10 840  GLU n 
10 841  SER n 
10 842  GLU n 
10 843  GLY n 
10 844  GLU n 
10 845  ARG n 
10 846  LYS n 
10 847  THR n 
10 848  LYS n 
10 849  VAL n 
10 850  GLU n 
10 851  ARG n 
10 852  ASP n 
10 853  ILE n 
10 854  GLY n 
10 855  GLU n 
10 856  GLY n 
10 857  ASN n 
10 858  LEU n 
10 859  SER n 
10 860  THR n 
10 861  ALA n 
10 862  ALA n 
10 863  ALA n 
10 864  ALA n 
10 865  ALA n 
10 866  LEU n 
10 867  ALA n 
10 868  ALA n 
10 869  ALA n 
10 870  ALA n 
10 871  VAL n 
10 872  LYS n 
10 873  ALA n 
10 874  LYS n 
10 875  HIS n 
10 876  LEU n 
10 877  ALA n 
10 878  ALA n 
10 879  VAL n 
10 880  GLU n 
10 881  GLU n 
10 882  ARG n 
10 883  LYS n 
10 884  ILE n 
10 885  LYS n 
10 886  SER n 
10 887  LEU n 
10 888  VAL n 
10 889  ALA n 
10 890  LEU n 
10 891  LEU n 
10 892  VAL n 
10 893  GLU n 
10 894  THR n 
10 895  GLN n 
10 896  MET n 
10 897  LYS n 
10 898  LYS n 
10 899  LEU n 
10 900  GLU n 
10 901  ILE n 
10 902  LYS n 
10 903  LEU n 
10 904  ARG n 
10 905  HIS n 
10 906  PHE n 
10 907  GLU n 
10 908  GLU n 
10 909  LEU n 
10 910  GLU n 
10 911  THR n 
10 912  ILE n 
10 913  MET n 
10 914  ASP n 
10 915  ARG n 
10 916  GLU n 
10 917  ARG n 
10 918  GLU n 
10 919  ALA n 
10 920  LEU n 
10 921  GLU n 
10 922  TYR n 
10 923  GLN n 
10 924  ARG n 
10 925  GLN n 
10 926  GLN n 
10 927  LEU n 
10 928  LEU n 
10 929  ALA n 
10 930  ASP n 
10 931  ARG n 
10 932  GLN n 
10 933  ALA n 
10 934  PHE n 
10 935  HIS n 
10 936  MET n 
10 937  GLU n 
10 938  GLN n 
10 939  LEU n 
10 940  LYS n 
10 941  TYR n 
10 942  ALA n 
10 943  GLU n 
10 944  MET n 
10 945  ARG n 
10 946  ALA n 
10 947  ARG n 
10 948  GLN n 
10 949  GLN n 
10 950  HIS n 
10 951  PHE n 
10 952  GLN n 
10 953  GLN n 
10 954  MET n 
10 955  HIS n 
10 956  GLN n 
10 957  GLN n 
10 958  GLN n 
10 959  GLN n 
10 960  GLN n 
10 961  PRO n 
10 962  PRO n 
10 963  PRO n 
10 964  ALA n 
10 965  LEU n 
10 966  PRO n 
10 967  PRO n 
10 968  GLY n 
10 969  SER n 
10 970  GLN n 
10 971  PRO n 
10 972  ILE n 
10 973  PRO n 
10 974  PRO n 
10 975  THR n 
10 976  GLY n 
10 977  ALA n 
10 978  ALA n 
10 979  GLY n 
10 980  PRO n 
10 981  PRO n 
10 982  ALA n 
10 983  VAL n 
10 984  HIS n 
10 985  GLY n 
10 986  LEU n 
10 987  ALA n 
10 988  VAL n 
10 989  ALA n 
10 990  PRO n 
10 991  ALA n 
10 992  SER n 
10 993  VAL n 
10 994  VAL n 
10 995  PRO n 
10 996  ALA n 
10 997  PRO n 
10 998  ALA n 
10 999  GLY n 
10 1000 SER n 
10 1001 GLY n 
10 1002 ALA n 
10 1003 PRO n 
10 1004 PRO n 
10 1005 GLY n 
10 1006 SER n 
10 1007 LEU n 
10 1008 GLY n 
10 1009 PRO n 
10 1010 SER n 
10 1011 GLU n 
10 1012 GLN n 
10 1013 ILE n 
10 1014 GLY n 
10 1015 GLN n 
10 1016 ALA n 
10 1017 GLY n 
10 1018 SER n 
10 1019 THR n 
10 1020 ALA n 
10 1021 GLY n 
10 1022 PRO n 
10 1023 GLN n 
10 1024 GLN n 
10 1025 GLN n 
10 1026 GLN n 
10 1027 PRO n 
10 1028 ALA n 
10 1029 GLY n 
10 1030 ALA n 
10 1031 PRO n 
10 1032 GLN n 
10 1033 PRO n 
10 1034 GLY n 
10 1035 ALA n 
10 1036 VAL n 
10 1037 PRO n 
10 1038 PRO n 
10 1039 GLY n 
10 1040 VAL n 
10 1041 PRO n 
10 1042 PRO n 
10 1043 PRO n 
10 1044 GLY n 
10 1045 PRO n 
10 1046 HIS n 
10 1047 GLY n 
10 1048 PRO n 
10 1049 SER n 
10 1050 PRO n 
10 1051 PHE n 
10 1052 PRO n 
10 1053 ASN n 
10 1054 GLN n 
10 1055 GLN n 
10 1056 THR n 
10 1057 PRO n 
10 1058 PRO n 
10 1059 SER n 
10 1060 MET n 
10 1061 MET n 
10 1062 PRO n 
10 1063 GLY n 
10 1064 ALA n 
10 1065 VAL n 
10 1066 PRO n 
10 1067 GLY n 
10 1068 SER n 
10 1069 GLY n 
10 1070 HIS n 
10 1071 PRO n 
10 1072 GLY n 
10 1073 VAL n 
10 1074 ALA n 
10 1075 GLY n 
10 1076 ASN n 
10 1077 ALA n 
10 1078 PRO n 
10 1079 LEU n 
10 1080 GLY n 
10 1081 LEU n 
10 1082 PRO n 
10 1083 PHE n 
10 1084 GLY n 
10 1085 MET n 
10 1086 PRO n 
10 1087 PRO n 
10 1088 PRO n 
10 1089 PRO n 
10 1090 PRO n 
10 1091 PRO n 
10 1092 PRO n 
10 1093 ALA n 
10 1094 PRO n 
10 1095 SER n 
10 1096 ILE n 
10 1097 ILE n 
10 1098 PRO n 
10 1099 PHE n 
10 1100 GLY n 
10 1101 SER n 
10 1102 LEU n 
10 1103 ALA n 
10 1104 ASP n 
10 1105 SER n 
10 1106 ILE n 
10 1107 SER n 
10 1108 ILE n 
10 1109 ASN n 
10 1110 LEU n 
10 1111 PRO n 
10 1112 ALA n 
10 1113 PRO n 
10 1114 PRO n 
10 1115 ASN n 
10 1116 LEU n 
10 1117 HIS n 
10 1118 GLY n 
10 1119 HIS n 
10 1120 HIS n 
10 1121 HIS n 
10 1122 HIS n 
10 1123 LEU n 
10 1124 PRO n 
10 1125 PHE n 
10 1126 ALA n 
10 1127 PRO n 
10 1128 GLY n 
10 1129 THR n 
10 1130 LEU n 
10 1131 PRO n 
10 1132 PRO n 
10 1133 PRO n 
10 1134 ASN n 
10 1135 LEU n 
10 1136 PRO n 
10 1137 VAL n 
10 1138 SER n 
10 1139 MET n 
10 1140 ALA n 
10 1141 ASN n 
10 1142 PRO n 
10 1143 LEU n 
10 1144 HIS n 
10 1145 PRO n 
10 1146 ASN n 
10 1147 LEU n 
10 1148 PRO n 
10 1149 ALA n 
10 1150 THR n 
10 1151 THR n 
10 1152 THR n 
10 1153 MET n 
10 1154 PRO n 
10 1155 SER n 
10 1156 SER n 
10 1157 LEU n 
10 1158 PRO n 
10 1159 LEU n 
10 1160 GLY n 
10 1161 PRO n 
10 1162 GLY n 
10 1163 LEU n 
10 1164 GLY n 
10 1165 SER n 
10 1166 ALA n 
10 1167 ALA n 
10 1168 ALA n 
10 1169 GLN n 
10 1170 SER n 
10 1171 PRO n 
10 1172 ALA n 
10 1173 ILE n 
10 1174 VAL n 
10 1175 ALA n 
10 1176 ALA n 
10 1177 VAL n 
10 1178 GLN n 
10 1179 GLY n 
10 1180 ASN n 
10 1181 LEU n 
10 1182 LEU n 
10 1183 PRO n 
10 1184 SER n 
10 1185 ALA n 
10 1186 SER n 
10 1187 PRO n 
10 1188 LEU n 
10 1189 PRO n 
10 1190 ASP n 
10 1191 PRO n 
10 1192 GLY n 
10 1193 THR n 
10 1194 PRO n 
10 1195 LEU n 
10 1196 PRO n 
10 1197 PRO n 
10 1198 ASP n 
10 1199 PRO n 
10 1200 THR n 
10 1201 ALA n 
10 1202 PRO n 
10 1203 SER n 
10 1204 PRO n 
10 1205 GLY n 
10 1206 THR n 
10 1207 VAL n 
10 1208 THR n 
10 1209 PRO n 
10 1210 VAL n 
10 1211 PRO n 
10 1212 PRO n 
10 1213 PRO n 
10 1214 GLN n 
11 1    MET n 
11 2    ALA n 
11 3    ALA n 
11 4    ARG n 
11 5    ALA n 
11 6    GLY n 
11 7    PHE n 
11 8    GLN n 
11 9    SER n 
11 10   VAL n 
11 11   ALA n 
11 12   PRO n 
11 13   SER n 
11 14   GLY n 
11 15   GLY n 
11 16   ALA n 
11 17   GLY n 
11 18   ALA n 
11 19   SER n 
11 20   GLY n 
11 21   GLY n 
11 22   ALA n 
11 23   GLY n 
11 24   ALA n 
11 25   ALA n 
11 26   ALA n 
11 27   ALA n 
11 28   LEU n 
11 29   GLY n 
11 30   PRO n 
11 31   GLY n 
11 32   GLY n 
11 33   THR n 
11 34   PRO n 
11 35   GLY n 
11 36   PRO n 
11 37   PRO n 
11 38   VAL n 
11 39   ARG n 
11 40   MET n 
11 41   GLY n 
11 42   PRO n 
11 43   ALA n 
11 44   PRO n 
11 45   GLY n 
11 46   GLN n 
11 47   GLY n 
11 48   LEU n 
11 49   TYR n 
11 50   ARG n 
11 51   SER n 
11 52   PRO n 
11 53   MET n 
11 54   PRO n 
11 55   GLY n 
11 56   ALA n 
11 57   ALA n 
11 58   TYR n 
11 59   PRO n 
11 60   ARG n 
11 61   PRO n 
11 62   GLY n 
11 63   MET n 
11 64   LEU n 
11 65   PRO n 
11 66   GLY n 
11 67   SER n 
11 68   ARG n 
11 69   MET n 
11 70   THR n 
11 71   PRO n 
11 72   GLN n 
11 73   GLY n 
11 74   PRO n 
11 75   SER n 
11 76   MET n 
11 77   GLY n 
11 78   PRO n 
11 79   PRO n 
11 80   GLY n 
11 81   TYR n 
11 82   GLY n 
11 83   GLY n 
11 84   ASN n 
11 85   PRO n 
11 86   SER n 
11 87   VAL n 
11 88   ARG n 
11 89   PRO n 
11 90   GLY n 
11 91   LEU n 
11 92   ALA n 
11 93   GLN n 
11 94   SER n 
11 95   GLY n 
11 96   MET n 
11 97   ASP n 
11 98   GLN n 
11 99   SER n 
11 100  ARG n 
11 101  LYS n 
11 102  ARG n 
11 103  PRO n 
11 104  ALA n 
11 105  PRO n 
11 106  GLN n 
11 107  GLN n 
11 108  ILE n 
11 109  GLN n 
11 110  GLN n 
11 111  VAL n 
11 112  GLN n 
11 113  GLN n 
11 114  GLN n 
11 115  ALA n 
11 116  VAL n 
11 117  GLN n 
11 118  ASN n 
11 119  ARG n 
11 120  ASN n 
11 121  HIS n 
11 122  ASN n 
11 123  ALA n 
11 124  LYS n 
11 125  LYS n 
11 126  LYS n 
11 127  LYS n 
11 128  MET n 
11 129  ALA n 
11 130  ASP n 
11 131  LYS n 
11 132  ILE n 
11 133  LEU n 
11 134  PRO n 
11 135  GLN n 
11 136  ARG n 
11 137  ILE n 
11 138  ARG n 
11 139  GLU n 
11 140  LEU n 
11 141  VAL n 
11 142  PRO n 
11 143  GLU n 
11 144  SER n 
11 145  GLN n 
11 146  ALA n 
11 147  TYR n 
11 148  MET n 
11 149  ASP n 
11 150  LEU n 
11 151  LEU n 
11 152  ALA n 
11 153  PHE n 
11 154  GLU n 
11 155  ARG n 
11 156  LYS n 
11 157  LEU n 
11 158  ASP n 
11 159  GLN n 
11 160  THR n 
11 161  ILE n 
11 162  MET n 
11 163  ARG n 
11 164  LYS n 
11 165  ARG n 
11 166  LEU n 
11 167  ASP n 
11 168  ILE n 
11 169  GLN n 
11 170  GLU n 
11 171  ALA n 
11 172  LEU n 
11 173  LYS n 
11 174  ARG n 
11 175  PRO n 
11 176  ILE n 
11 177  LYS n 
11 178  GLN n 
11 179  LYS n 
11 180  ARG n 
11 181  LYS n 
11 182  LEU n 
11 183  ARG n 
11 184  ILE n 
11 185  PHE n 
11 186  ILE n 
11 187  SER n 
11 188  ASN n 
11 189  THR n 
11 190  PHE n 
11 191  ASN n 
11 192  PRO n 
11 193  ALA n 
11 194  LYS n 
11 195  SER n 
11 196  ASP n 
11 197  ALA n 
11 198  GLU n 
11 199  ASP n 
11 200  GLY n 
11 201  GLU n 
11 202  GLY n 
11 203  THR n 
11 204  VAL n 
11 205  ALA n 
11 206  SER n 
11 207  TRP n 
11 208  GLU n 
11 209  LEU n 
11 210  ARG n 
11 211  VAL n 
11 212  GLU n 
11 213  GLY n 
11 214  ARG n 
11 215  LEU n 
11 216  LEU n 
11 217  GLU n 
11 218  ASP n 
11 219  SER n 
11 220  ALA n 
11 221  LEU n 
11 222  SER n 
11 223  LYS n 
11 224  TYR n 
11 225  ASP n 
11 226  ALA n 
11 227  THR n 
11 228  LYS n 
11 229  GLN n 
11 230  LYS n 
11 231  ARG n 
11 232  LYS n 
11 233  PHE n 
11 234  SER n 
11 235  SER n 
11 236  PHE n 
11 237  PHE n 
11 238  LYS n 
11 239  SER n 
11 240  LEU n 
11 241  VAL n 
11 242  ILE n 
11 243  GLU n 
11 244  LEU n 
11 245  ASP n 
11 246  LYS n 
11 247  ASP n 
11 248  LEU n 
11 249  TYR n 
11 250  GLY n 
11 251  PRO n 
11 252  ASP n 
11 253  ASN n 
11 254  HIS n 
11 255  LEU n 
11 256  VAL n 
11 257  GLU n 
11 258  TRP n 
11 259  HIS n 
11 260  ARG n 
11 261  THR n 
11 262  ALA n 
11 263  THR n 
11 264  THR n 
11 265  GLN n 
11 266  GLU n 
11 267  THR n 
11 268  ASP n 
11 269  GLY n 
11 270  PHE n 
11 271  GLN n 
11 272  VAL n 
11 273  LYS n 
11 274  ARG n 
11 275  PRO n 
11 276  GLY n 
11 277  ASP n 
11 278  VAL n 
11 279  ASN n 
11 280  VAL n 
11 281  ARG n 
11 282  CYS n 
11 283  THR n 
11 284  VAL n 
11 285  LEU n 
11 286  LEU n 
11 287  MET n 
11 288  LEU n 
11 289  ASP n 
11 290  TYR n 
11 291  GLN n 
11 292  PRO n 
11 293  PRO n 
11 294  GLN n 
11 295  PHE n 
11 296  LYS n 
11 297  LEU n 
11 298  ASP n 
11 299  PRO n 
11 300  ARG n 
11 301  LEU n 
11 302  ALA n 
11 303  ARG n 
11 304  LEU n 
11 305  LEU n 
11 306  GLY n 
11 307  ILE n 
11 308  HIS n 
11 309  THR n 
11 310  GLN n 
11 311  THR n 
11 312  ARG n 
11 313  PRO n 
11 314  VAL n 
11 315  ILE n 
11 316  ILE n 
11 317  GLN n 
11 318  ALA n 
11 319  LEU n 
11 320  TRP n 
11 321  GLN n 
11 322  TYR n 
11 323  ILE n 
11 324  LYS n 
11 325  THR n 
11 326  HIS n 
11 327  LYS n 
11 328  LEU n 
11 329  GLN n 
11 330  ASP n 
11 331  PRO n 
11 332  HIS n 
11 333  GLU n 
11 334  ARG n 
11 335  GLU n 
11 336  PHE n 
11 337  VAL n 
11 338  ILE n 
11 339  CYS n 
11 340  ASP n 
11 341  LYS n 
11 342  TYR n 
11 343  LEU n 
11 344  GLN n 
11 345  GLN n 
11 346  ILE n 
11 347  PHE n 
11 348  GLU n 
11 349  SER n 
11 350  GLN n 
11 351  ARG n 
11 352  MET n 
11 353  LYS n 
11 354  PHE n 
11 355  SER n 
11 356  GLU n 
11 357  ILE n 
11 358  PRO n 
11 359  GLN n 
11 360  ARG n 
11 361  LEU n 
11 362  HIS n 
11 363  ALA n 
11 364  LEU n 
11 365  LEU n 
11 366  MET n 
11 367  PRO n 
11 368  PRO n 
11 369  GLU n 
11 370  PRO n 
11 371  ILE n 
11 372  ILE n 
11 373  ILE n 
11 374  ASN n 
11 375  HIS n 
11 376  VAL n 
11 377  ILE n 
11 378  SER n 
11 379  VAL n 
11 380  ASP n 
11 381  PRO n 
11 382  ASN n 
11 383  ASP n 
11 384  GLN n 
11 385  LYS n 
11 386  LYS n 
11 387  THR n 
11 388  ALA n 
11 389  CYS n 
11 390  TYR n 
11 391  ASP n 
11 392  ILE n 
11 393  ASP n 
11 394  VAL n 
11 395  GLU n 
11 396  VAL n 
11 397  ASP n 
11 398  ASP n 
11 399  THR n 
11 400  LEU n 
11 401  LYS n 
11 402  THR n 
11 403  GLN n 
11 404  MET n 
11 405  ASN n 
11 406  SER n 
11 407  PHE n 
11 408  LEU n 
11 409  LEU n 
11 410  SER n 
11 411  THR n 
11 412  ALA n 
11 413  SER n 
11 414  GLN n 
11 415  GLN n 
11 416  GLU n 
11 417  ILE n 
11 418  ALA n 
11 419  THR n 
11 420  LEU n 
11 421  ASP n 
11 422  ASN n 
11 423  LYS n 
11 424  ILE n 
11 425  HIS n 
11 426  GLU n 
11 427  THR n 
11 428  ILE n 
11 429  GLU n 
11 430  THR n 
11 431  ILE n 
11 432  ASN n 
11 433  GLN n 
11 434  LEU n 
11 435  LYS n 
11 436  THR n 
11 437  GLN n 
11 438  ARG n 
11 439  GLU n 
11 440  PHE n 
11 441  MET n 
11 442  LEU n 
11 443  SER n 
11 444  PHE n 
11 445  ALA n 
11 446  ARG n 
11 447  ASP n 
11 448  PRO n 
11 449  GLN n 
11 450  GLY n 
11 451  PHE n 
11 452  ILE n 
11 453  ASN n 
11 454  ASP n 
11 455  TRP n 
11 456  LEU n 
11 457  GLN n 
11 458  SER n 
11 459  GLN n 
11 460  CYS n 
11 461  ARG n 
11 462  ASP n 
11 463  LEU n 
11 464  LYS n 
11 465  THR n 
11 466  MET n 
11 467  THR n 
11 468  ASP n 
11 469  VAL n 
11 470  VAL n 
11 471  GLY n 
11 472  ASN n 
11 473  PRO n 
11 474  GLU n 
11 475  GLU n 
11 476  GLU n 
11 477  ARG n 
11 478  ARG n 
11 479  ALA n 
11 480  GLU n 
11 481  PHE n 
11 482  TYR n 
11 483  PHE n 
11 484  GLN n 
11 485  PRO n 
11 486  TRP n 
11 487  ALA n 
11 488  GLN n 
11 489  GLU n 
11 490  ALA n 
11 491  VAL n 
11 492  CYS n 
11 493  ARG n 
11 494  TYR n 
11 495  PHE n 
11 496  TYR n 
11 497  SER n 
11 498  LYS n 
11 499  VAL n 
11 500  GLN n 
11 501  GLN n 
11 502  ARG n 
11 503  ARG n 
11 504  GLN n 
11 505  GLU n 
11 506  LEU n 
11 507  GLU n 
11 508  GLN n 
11 509  ALA n 
11 510  LEU n 
11 511  GLY n 
11 512  ILE n 
11 513  ARG n 
11 514  ASN n 
11 515  THR n 
12 1    MET n 
12 2    SER n 
12 3    LYS n 
12 4    ARG n 
12 5    PRO n 
12 6    SER n 
12 7    TYR n 
12 8    ALA n 
12 9    PRO n 
12 10   PRO n 
12 11   PRO n 
12 12   THR n 
12 13   PRO n 
12 14   ALA n 
12 15   PRO n 
12 16   ALA n 
12 17   THR n 
12 18   GLN n 
12 19   MET n 
12 20   PRO n 
12 21   SER n 
12 22   THR n 
12 23   PRO n 
12 24   GLY n 
12 25   PHE n 
12 26   VAL n 
12 27   GLY n 
12 28   TYR n 
12 29   ASN n 
12 30   PRO n 
12 31   TYR n 
12 32   SER n 
12 33   HIS n 
12 34   LEU n 
12 35   ALA n 
12 36   TYR n 
12 37   ASN n 
12 38   ASN n 
12 39   TYR n 
12 40   ARG n 
12 41   LEU n 
12 42   GLY n 
12 43   GLY n 
12 44   ASN n 
12 45   PRO n 
12 46   GLY n 
12 47   THR n 
12 48   ASN n 
12 49   SER n 
12 50   ARG n 
12 51   VAL n 
12 52   THR n 
12 53   ALA n 
12 54   SER n 
12 55   SER n 
12 56   GLY n 
12 57   ILE n 
12 58   THR n 
12 59   ILE n 
12 60   PRO n 
12 61   LYS n 
12 62   PRO n 
12 63   PRO n 
12 64   LYS n 
12 65   PRO n 
12 66   PRO n 
12 67   ASP n 
12 68   LYS n 
12 69   PRO n 
12 70   LEU n 
12 71   MET n 
12 72   PRO n 
12 73   TYR n 
12 74   MET n 
12 75   ARG n 
12 76   TYR n 
12 77   SER n 
12 78   ARG n 
12 79   LYS n 
12 80   VAL n 
12 81   TRP n 
12 82   ASP n 
12 83   GLN n 
12 84   VAL n 
12 85   LYS n 
12 86   ALA n 
12 87   SER n 
12 88   ASN n 
12 89   PRO n 
12 90   ASP n 
12 91   LEU n 
12 92   LYS n 
12 93   LEU n 
12 94   TRP n 
12 95   GLU n 
12 96   ILE n 
12 97   GLY n 
12 98   LYS n 
12 99   ILE n 
12 100  ILE n 
12 101  GLY n 
12 102  GLY n 
12 103  MET n 
12 104  TRP n 
12 105  ARG n 
12 106  ASP n 
12 107  LEU n 
12 108  THR n 
12 109  ASP n 
12 110  GLU n 
12 111  GLU n 
12 112  LYS n 
12 113  GLN n 
12 114  GLU n 
12 115  TYR n 
12 116  LEU n 
12 117  ASN n 
12 118  GLU n 
12 119  TYR n 
12 120  GLU n 
12 121  ALA n 
12 122  GLU n 
12 123  LYS n 
12 124  ILE n 
12 125  GLU n 
12 126  TYR n 
12 127  ASN n 
12 128  GLU n 
12 129  SER n 
12 130  MET n 
12 131  LYS n 
12 132  ALA n 
12 133  TYR n 
12 134  HIS n 
12 135  ASN n 
12 136  SER n 
12 137  PRO n 
12 138  ALA n 
12 139  TYR n 
12 140  LEU n 
12 141  ALA n 
12 142  TYR n 
12 143  ILE n 
12 144  ASN n 
12 145  ALA n 
12 146  LYS n 
12 147  SER n 
12 148  ARG n 
12 149  ALA n 
12 150  GLU n 
12 151  ALA n 
12 152  ALA n 
12 153  LEU n 
12 154  GLU n 
12 155  GLU n 
12 156  GLU n 
12 157  SER n 
12 158  ARG n 
12 159  GLN n 
12 160  ARG n 
12 161  GLN n 
12 162  SER n 
12 163  ARG n 
12 164  MET n 
12 165  GLU n 
12 166  LYS n 
12 167  GLY n 
12 168  GLU n 
12 169  PRO n 
12 170  TYR n 
12 171  MET n 
12 172  SER n 
12 173  ILE n 
12 174  GLN n 
12 175  PRO n 
12 176  ALA n 
12 177  GLU n 
12 178  ASP n 
12 179  PRO n 
12 180  ASP n 
12 181  ASP n 
12 182  TYR n 
12 183  ASP n 
12 184  ASP n 
12 185  GLY n 
12 186  PHE n 
12 187  SER n 
12 188  MET n 
12 189  LYS n 
12 190  HIS n 
12 191  THR n 
12 192  ALA n 
12 193  THR n 
12 194  ALA n 
12 195  ARG n 
12 196  PHE n 
12 197  GLN n 
12 198  ARG n 
12 199  ASN n 
12 200  HIS n 
12 201  ARG n 
12 202  LEU n 
12 203  ILE n 
12 204  SER n 
12 205  GLU n 
12 206  ILE n 
12 207  LEU n 
12 208  SER n 
12 209  GLU n 
12 210  SER n 
12 211  VAL n 
12 212  VAL n 
12 213  PRO n 
12 214  ASP n 
12 215  VAL n 
12 216  ARG n 
12 217  SER n 
12 218  VAL n 
12 219  VAL n 
12 220  THR n 
12 221  THR n 
12 222  ALA n 
12 223  ARG n 
12 224  MET n 
12 225  GLN n 
12 226  VAL n 
12 227  LEU n 
12 228  LYS n 
12 229  ARG n 
12 230  GLN n 
12 231  VAL n 
12 232  GLN n 
12 233  SER n 
12 234  LEU n 
12 235  MET n 
12 236  VAL n 
12 237  HIS n 
12 238  GLN n 
12 239  ARG n 
12 240  LYS n 
12 241  LEU n 
12 242  GLU n 
12 243  ALA n 
12 244  GLU n 
12 245  LEU n 
12 246  LEU n 
12 247  GLN n 
12 248  ILE n 
12 249  GLU n 
12 250  GLU n 
12 251  ARG n 
12 252  HIS n 
12 253  GLN n 
12 254  GLU n 
12 255  LYS n 
12 256  LYS n 
12 257  ARG n 
12 258  LYS n 
12 259  PHE n 
12 260  LEU n 
12 261  GLU n 
12 262  SER n 
12 263  THR n 
12 264  ASP n 
12 265  SER n 
12 266  PHE n 
12 267  ASN n 
12 268  ASN n 
12 269  GLU n 
12 270  LEU n 
12 271  LYS n 
12 272  ARG n 
12 273  LEU n 
12 274  CYS n 
12 275  GLY n 
12 276  LEU n 
12 277  LYS n 
12 278  VAL n 
12 279  GLU n 
12 280  VAL n 
12 281  ASP n 
12 282  MET n 
12 283  GLU n 
12 284  LYS n 
12 285  ILE n 
12 286  ALA n 
12 287  ALA n 
12 288  GLU n 
12 289  ILE n 
12 290  ALA n 
12 291  GLN n 
12 292  ALA n 
12 293  GLU n 
12 294  GLU n 
12 295  GLN n 
12 296  ALA n 
12 297  ARG n 
12 298  LYS n 
12 299  ARG n 
12 300  GLN n 
12 301  GLU n 
12 302  GLU n 
12 303  ARG n 
12 304  GLU n 
12 305  LYS n 
12 306  GLU n 
12 307  ALA n 
12 308  ALA n 
12 309  GLU n 
12 310  GLN n 
12 311  ALA n 
12 312  GLU n 
12 313  ARG n 
12 314  SER n 
12 315  GLN n 
12 316  SER n 
12 317  SER n 
12 318  ILE n 
12 319  VAL n 
12 320  PRO n 
12 321  GLU n 
12 322  GLU n 
12 323  GLU n 
12 324  GLN n 
12 325  ALA n 
12 326  ALA n 
12 327  ASN n 
12 328  LYS n 
12 329  GLY n 
12 330  GLU n 
12 331  GLU n 
12 332  LYS n 
12 333  LYS n 
12 334  ASP n 
12 335  ASP n 
12 336  GLU n 
12 337  ASN n 
12 338  ILE n 
12 339  PRO n 
12 340  MET n 
12 341  GLU n 
12 342  THR n 
12 343  GLU n 
12 344  GLU n 
12 345  THR n 
12 346  HIS n 
12 347  LEU n 
12 348  GLU n 
12 349  GLU n 
12 350  THR n 
12 351  THR n 
12 352  GLU n 
12 353  SER n 
12 354  GLN n 
12 355  GLN n 
12 356  ASN n 
12 357  GLY n 
12 358  GLU n 
12 359  GLU n 
12 360  GLY n 
12 361  THR n 
12 362  SER n 
12 363  THR n 
12 364  PRO n 
12 365  GLU n 
12 366  ASP n 
12 367  LYS n 
12 368  GLU n 
12 369  SER n 
12 370  GLY n 
12 371  GLN n 
12 372  GLU n 
12 373  GLY n 
12 374  VAL n 
12 375  ASP n 
12 376  SER n 
12 377  MET n 
12 378  ALA n 
12 379  GLU n 
12 380  GLU n 
12 381  GLY n 
12 382  THR n 
12 383  SER n 
12 384  ASP n 
12 385  SER n 
12 386  ASN n 
12 387  THR n 
12 388  GLY n 
12 389  SER n 
12 390  GLU n 
12 391  SER n 
12 392  ASN n 
12 393  SER n 
12 394  ALA n 
12 395  THR n 
12 396  VAL n 
12 397  GLU n 
12 398  GLU n 
12 399  PRO n 
12 400  PRO n 
12 401  THR n 
12 402  ASP n 
12 403  PRO n 
12 404  ILE n 
12 405  PRO n 
12 406  GLU n 
12 407  ASP n 
12 408  GLU n 
12 409  LYS n 
12 410  LYS n 
12 411  GLU n 
13 1    MET n 
13 2    ALA n 
13 3    ALA n 
13 4    VAL n 
13 5    VAL n 
13 6    GLU n 
13 7    ASN n 
13 8    VAL n 
13 9    VAL n 
13 10   LYS n 
13 11   LEU n 
13 12   LEU n 
13 13   GLY n 
13 14   GLU n 
13 15   GLN n 
13 16   TYR n 
13 17   TYR n 
13 18   LYS n 
13 19   ASP n 
13 20   ALA n 
13 21   MET n 
13 22   GLU n 
13 23   GLN n 
13 24   CYS n 
13 25   HIS n 
13 26   ASN n 
13 27   TYR n 
13 28   ASN n 
13 29   ALA n 
13 30   ARG n 
13 31   LEU n 
13 32   CYS n 
13 33   ALA n 
13 34   GLU n 
13 35   ARG n 
13 36   SER n 
13 37   VAL n 
13 38   ARG n 
13 39   LEU n 
13 40   PRO n 
13 41   PHE n 
13 42   LEU n 
13 43   ASP n 
13 44   SER n 
13 45   GLN n 
13 46   THR n 
13 47   GLY n 
13 48   VAL n 
13 49   ALA n 
13 50   GLN n 
13 51   SER n 
13 52   ASN n 
13 53   CYS n 
13 54   TYR n 
13 55   ILE n 
13 56   TRP n 
13 57   MET n 
13 58   GLU n 
13 59   LYS n 
13 60   ARG n 
13 61   HIS n 
13 62   ARG n 
13 63   GLY n 
13 64   PRO n 
13 65   GLY n 
13 66   LEU n 
13 67   ALA n 
13 68   SER n 
13 69   GLY n 
13 70   GLN n 
13 71   LEU n 
13 72   TYR n 
13 73   SER n 
13 74   TYR n 
13 75   PRO n 
13 76   ALA n 
13 77   ARG n 
13 78   ARG n 
13 79   TRP n 
13 80   ARG n 
13 81   LYS n 
13 82   LYS n 
13 83   ARG n 
13 84   ARG n 
13 85   ALA n 
13 86   HIS n 
13 87   PRO n 
13 88   PRO n 
13 89   GLU n 
13 90   ASP n 
13 91   PRO n 
13 92   ARG n 
13 93   LEU n 
13 94   SER n 
13 95   PHE n 
13 96   PRO n 
13 97   SER n 
13 98   ILE n 
13 99   LYS n 
13 100  PRO n 
13 101  GLY n 
13 102  GLY n 
13 103  SER n 
13 104  GLY n 
13 105  GLY n 
13 106  SER n 
13 107  GLY n 
13 108  GLY n 
13 109  SER n 
13 110  TYR n 
13 111  ALA n 
13 112  CYS n 
13 113  ASP n 
13 114  ILE n 
13 115  CYS n 
13 116  GLY n 
13 117  LYS n 
13 118  ARG n 
13 119  TYR n 
13 120  LYS n 
13 121  ASN n 
13 122  ARG n 
13 123  PRO n 
13 124  GLY n 
13 125  LEU n 
13 126  SER n 
13 127  TYR n 
13 128  HIS n 
13 129  TYR n 
13 130  ALA n 
13 131  HIS n 
13 132  SER n 
13 133  HIS n 
13 134  LEU n 
13 135  ALA n 
13 136  GLU n 
13 137  GLU n 
13 138  GLU n 
13 139  GLY n 
13 140  GLU n 
13 141  ASP n 
13 142  LYS n 
13 143  GLU n 
13 144  ASP n 
13 145  SER n 
13 146  GLN n 
13 147  PRO n 
13 148  PRO n 
13 149  THR n 
13 150  PRO n 
13 151  VAL n 
13 152  SER n 
13 153  GLN n 
13 154  ARG n 
13 155  SER n 
13 156  GLU n 
13 157  GLU n 
13 158  GLN n 
13 159  LYS n 
13 160  SER n 
13 161  LYS n 
13 162  LYS n 
13 163  GLY n 
13 164  PRO n 
13 165  ASP n 
13 166  GLY n 
13 167  LEU n 
13 168  ALA n 
13 169  LEU n 
13 170  PRO n 
13 171  ASN n 
13 172  ASN n 
13 173  TYR n 
13 174  CYS n 
13 175  ASP n 
13 176  PHE n 
13 177  CYS n 
13 178  LEU n 
13 179  GLY n 
13 180  ASP n 
13 181  SER n 
13 182  LYS n 
13 183  ILE n 
13 184  ASN n 
13 185  LYS n 
13 186  LYS n 
13 187  THR n 
13 188  GLY n 
13 189  GLN n 
13 190  PRO n 
13 191  GLU n 
13 192  GLU n 
13 193  LEU n 
13 194  VAL n 
13 195  SER n 
13 196  CYS n 
13 197  SER n 
13 198  ASP n 
13 199  CYS n 
13 200  GLY n 
13 201  ARG n 
13 202  SER n 
13 203  GLY n 
13 204  HIS n 
13 205  PRO n 
13 206  SER n 
13 207  CYS n 
13 208  LEU n 
13 209  GLN n 
13 210  PHE n 
13 211  THR n 
13 212  PRO n 
13 213  VAL n 
13 214  MET n 
13 215  MET n 
13 216  ALA n 
13 217  ALA n 
13 218  VAL n 
13 219  LYS n 
13 220  THR n 
13 221  TYR n 
13 222  ARG n 
13 223  TRP n 
13 224  GLN n 
13 225  CYS n 
13 226  ILE n 
13 227  GLU n 
13 228  CYS n 
13 229  LYS n 
13 230  CYS n 
13 231  CYS n 
13 232  ASN n 
13 233  ILE n 
13 234  CYS n 
13 235  GLY n 
13 236  THR n 
13 237  SER n 
13 238  GLU n 
13 239  ASN n 
13 240  ASP n 
13 241  ASP n 
13 242  GLN n 
13 243  LEU n 
13 244  LEU n 
13 245  PHE n 
13 246  CYS n 
13 247  ASP n 
13 248  ASP n 
13 249  CYS n 
13 250  ASP n 
13 251  ARG n 
13 252  GLY n 
13 253  TYR n 
13 254  HIS n 
13 255  MET n 
13 256  TYR n 
13 257  CYS n 
13 258  LEU n 
13 259  THR n 
13 260  PRO n 
13 261  SER n 
13 262  MET n 
13 263  SER n 
13 264  GLU n 
13 265  PRO n 
13 266  PRO n 
13 267  GLU n 
13 268  GLY n 
13 269  SER n 
13 270  TRP n 
13 271  SER n 
13 272  CYS n 
13 273  HIS n 
13 274  LEU n 
13 275  CYS n 
13 276  LEU n 
13 277  ASP n 
13 278  LEU n 
13 279  LEU n 
13 280  LYS n 
13 281  GLU n 
13 282  LYS n 
13 283  ALA n 
13 284  SER n 
13 285  ILE n 
13 286  TYR n 
13 287  GLN n 
13 288  ASN n 
13 289  GLN n 
13 290  ASN n 
13 291  SER n 
13 292  SER n 
14 1    DT  n 
14 2    DG  n 
14 3    DC  n 
14 4    DC  n 
14 5    DG  n 
14 6    DA  n 
14 7    DG  n 
14 8    DG  n 
14 9    DC  n 
14 10   DC  n 
14 11   DG  n 
14 12   DC  n 
14 13   DT  n 
14 14   DC  n 
14 15   DA  n 
14 16   DA  n 
14 17   DT  n 
14 18   DT  n 
14 19   DG  n 
14 20   DG  n 
14 21   DT  n 
14 22   DC  n 
14 23   DG  n 
14 24   DT  n 
14 25   DA  n 
14 26   DG  n 
14 27   DA  n 
14 28   DC  n 
14 29   DA  n 
14 30   DG  n 
14 31   DC  n 
14 32   DT  n 
14 33   DC  n 
14 34   DT  n 
14 35   DA  n 
14 36   DG  n 
14 37   DC  n 
14 38   DA  n 
14 39   DC  n 
14 40   DC  n 
14 41   DG  n 
14 42   DC  n 
14 43   DT  n 
14 44   DT  n 
14 45   DA  n 
14 46   DA  n 
14 47   DA  n 
14 48   DC  n 
14 49   DG  n 
14 50   DC  n 
14 51   DA  n 
14 52   DC  n 
14 53   DG  n 
14 54   DT  n 
14 55   DA  n 
14 56   DC  n 
14 57   DG  n 
14 58   DC  n 
14 59   DG  n 
14 60   DC  n 
14 61   DT  n 
14 62   DG  n 
14 63   DT  n 
14 64   DC  n 
14 65   DC  n 
14 66   DC  n 
14 67   DC  n 
14 68   DC  n 
14 69   DG  n 
14 70   DC  n 
14 71   DG  n 
14 72   DT  n 
14 73   DT  n 
14 74   DT  n 
14 75   DT  n 
14 76   DA  n 
14 77   DA  n 
14 78   DC  n 
14 79   DC  n 
14 80   DG  n 
14 81   DC  n 
14 82   DC  n 
14 83   DA  n 
14 84   DA  n 
14 85   DG  n 
14 86   DG  n 
14 87   DG  n 
14 88   DG  n 
14 89   DA  n 
14 90   DT  n 
14 91   DT  n 
14 92   DA  n 
14 93   DC  n 
14 94   DT  n 
14 95   DC  n 
14 96   DC  n 
14 97   DC  n 
14 98   DT  n 
14 99   DA  n 
14 100  DG  n 
14 101  DT  n 
14 102  DC  n 
14 103  DT  n 
14 104  DC  n 
14 105  DC  n 
14 106  DA  n 
14 107  DG  n 
14 108  DG  n 
14 109  DC  n 
14 110  DA  n 
14 111  DC  n 
14 112  DG  n 
14 113  DT  n 
14 114  DG  n 
14 115  DT  n 
14 116  DC  n 
14 117  DA  n 
14 118  DG  n 
14 119  DA  n 
15 1    DT  n 
15 2    DC  n 
15 3    DT  n 
15 4    DG  n 
15 5    DA  n 
15 6    DC  n 
15 7    DA  n 
15 8    DC  n 
15 9    DG  n 
15 10   DT  n 
15 11   DG  n 
15 12   DC  n 
15 13   DC  n 
15 14   DT  n 
15 15   DG  n 
15 16   DG  n 
15 17   DA  n 
15 18   DG  n 
15 19   DA  n 
15 20   DC  n 
15 21   DT  n 
15 22   DA  n 
15 23   DG  n 
15 24   DG  n 
15 25   DG  n 
15 26   DA  n 
15 27   DG  n 
15 28   DT  n 
15 29   DA  n 
15 30   DA  n 
15 31   DT  n 
15 32   DC  n 
15 33   DC  n 
15 34   DC  n 
15 35   DC  n 
15 36   DT  n 
15 37   DT  n 
15 38   DG  n 
15 39   DG  n 
15 40   DC  n 
15 41   DG  n 
15 42   DG  n 
15 43   DT  n 
15 44   DT  n 
15 45   DA  n 
15 46   DA  n 
15 47   DA  n 
15 48   DA  n 
15 49   DC  n 
15 50   DG  n 
15 51   DC  n 
15 52   DG  n 
15 53   DG  n 
15 54   DG  n 
15 55   DG  n 
15 56   DG  n 
15 57   DA  n 
15 58   DC  n 
15 59   DA  n 
15 60   DG  n 
15 61   DC  n 
15 62   DG  n 
15 63   DC  n 
15 64   DG  n 
15 65   DT  n 
15 66   DA  n 
15 67   DC  n 
15 68   DG  n 
15 69   DT  n 
15 70   DG  n 
15 71   DC  n 
15 72   DG  n 
15 73   DT  n 
15 74   DT  n 
15 75   DT  n 
15 76   DA  n 
15 77   DA  n 
15 78   DG  n 
15 79   DC  n 
15 80   DG  n 
15 81   DG  n 
15 82   DT  n 
15 83   DG  n 
15 84   DC  n 
15 85   DT  n 
15 86   DA  n 
15 87   DG  n 
15 88   DA  n 
15 89   DG  n 
15 90   DC  n 
15 91   DT  n 
15 92   DG  n 
15 93   DT  n 
15 94   DC  n 
15 95   DT  n 
15 96   DA  n 
15 97   DC  n 
15 98   DG  n 
15 99   DA  n 
15 100  DC  n 
15 101  DC  n 
15 102  DA  n 
15 103  DA  n 
15 104  DT  n 
15 105  DT  n 
15 106  DG  n 
15 107  DA  n 
15 108  DG  n 
15 109  DC  n 
15 110  DG  n 
15 111  DG  n 
15 112  DC  n 
15 113  DC  n 
15 114  DT  n 
15 115  DC  n 
15 116  DG  n 
15 117  DG  n 
15 118  DC  n 
15 119  DA  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1  1 sample 'Biological sequence' 1   136  'African clawed frog' ? ?                         ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? 
? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? ? ? ? BL21 ? ?       ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 'Biological sequence' 1   103  'African clawed frog' ? ?                         ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? 
? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? ? ? ? BL21 ? ?       ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 'Biological sequence' 1   130  'African clawed frog' ? ?                         ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? 
? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? ? ? ? BL21 ? ?       ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 'Biological sequence' 1   126  'African clawed frog' ? H2B                       ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? 
? ? ? ? ? ? 'Escherichia coli BL21' 511693 ? ? ? ? ? ? BL21 ? ?       ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 'Biological sequence' 1   1647 Human                 ? SMARCA4                   ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? 
? ? ? ? ? ? 'Homo sapiens'          9606   ? ? ? ? ? ? ?    ? HEK293T ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 'Biological sequence' 1   407  Human                 ? 'ACTL6A, BAF53, BAF53A'   ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? 
? ? ? ? ? ? 'Homo sapiens'          9606   ? ? ? ? ? ? ?    ? HEK293T ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 'Biological sequence' 1   375  Human                 ? ACTB                      ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? 
? ? ? ? ? ? 'Homo sapiens'          9606   ? ? ? ? ? ? ?    ? HEK293T ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 'Biological sequence' 1   1295 Human                 ? 'ARID1A, BAF250, BAF250A' ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? 
? ? ? ? ? ? 'Homo sapiens'          9606   ? ? ? ? ? ? ?    ? HEK293T ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 'Biological sequence' 1   122  Human                 ? 'SMARCB1, BAF47'          ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? 
? ? ? ? ? ? 'Homo sapiens'          9606   ? ? ? ? ? ? ?    ? HEK293T ? ? ? ? ? ? ? ? ? ? ? ? 
9  2 sample 'Biological sequence' 123 336  Human                 ? 'SMARCB1, BAF47'          ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? 
? ? ? ? ? ? 'Homo sapiens'          9606   ? ? ? ? ? ? ?    ? HEK293T ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 'Biological sequence' 1   1214 Human                 ? SMARCC2                   ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? 
? ? ? ? ? ? 'Homo sapiens'          9606   ? ? ? ? ? ? ?    ? HEK293T ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 'Biological sequence' 1   515  Human                 ? SMARCD1                   ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? 
? ? ? ? ? ? 'Homo sapiens'          9606   ? ? ? ? ? ? ?    ? HEK293T ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 'Biological sequence' 1   411  Human                 ? SMARCE1                   ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? 
? ? ? ? ? ? 'Homo sapiens'          9606   ? ? ? ? ? ? ?    ? HEK293T ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 'Biological sequence' 1   109  Human                 ? 'DPF2, BAF45D'            ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? 
? ? ? ? ? ? 'Homo sapiens'          9606   ? ? ? ? ? ? ?    ? HEK293T ? ? ? ? ? ? ? ? ? ? ? ? 
13 2 sample 'Biological sequence' 110 292  Human                 ? 'DPF2, BAF45D'            ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? 
? ? ? ? ? ? 'Homo sapiens'          9606   ? ? ? ? ? ? ?    ? HEK293T ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
14 1 sample 1 119 'Homo sapiens' ? 9606 ? 
15 1 sample 1 119 'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP H33_XENLA    Q6PI79 ? 1  
;MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1   
2  UNP H4_XENLA     P62799 ? 2  
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1   
3  UNP H2A1_XENLA   P06897 ? 3  
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
1   
4  UNP Q92131_XENLA Q92131 ? 4  
;MSDPAKSAPAAKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAGRLLLPGELAKHAVSEGTKAVTKYTSAK
;
1   
5  UNP SMCA4_HUMAN  P51532 ? 5  
;MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMH
EKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQ
ALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGP
GPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPP
AASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKA
TIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSIL
QHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEY
VANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLE
AWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGV
SQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHK
RINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIV
DEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEE
TILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIM
QLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRG
FKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVR
VLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAG
VNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCE
EEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQ
KKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYR
SLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLG
RKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED
;
1   
6  UNP ACL6A_HUMAN  O96019 ? 6  
;GALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNG
MVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILD
SGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWH
NYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTT
SVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWI
SKQEYE
;
12  
7  UNP ACTB_HUMAN   P60709 ? 7  
;MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD
DMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVT
HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITAL
APSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
;
1   
8  UNP ARI1A_HUMAN  O14497 ? 8  
;TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKN
KKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQST
SSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNK
DPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLM
PSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYS
VPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGT
NAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGT
RQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPV
QPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLP
GLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAF
SGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRP
HAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHR
NIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLT
YEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNA
VLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKG
SIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSL
VSQVICDVLFLIGQS
;
991 
9  UNP SNF5_HUMAN   Q12824 ? 9  
;MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHG
YTTLATSVTLLKASEVEEILDGNDEKYKAVSIS
;
1   
10 UNP SNF5_HUMAN   Q12824 ? 9  
;DPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTD
SILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSEN
PLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW
;
172 
11 UNP SMRC2_HUMAN  Q8TAQ2 ? 10 
;MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKC
FLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDII
KRHQGTVTEDKNNASHVVYPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAK
WILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGP
STPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENST
GNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEY
LTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQQTSASQQMLN
FPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFL
RLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVE
EAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEK
GKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVE
ERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQ
PPPALPPGSQPIPPTGAAGPPAVHGLAVAPASVVPAPAGSGAPPGSLGPSEQIGQAGSTAGPQQQQPAGAPQPGAVPPGV
PPPGPHGPSPFPNQQTPPSMMPGAVPGSGHPGVAGNAPLGLPFGMPPPPPPPAPSIIPFGSLADSISINLPAPPNLHGHH
HHLPFAPGTLPPPNLPVSMANPLHPNLPATTTMPSSLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLPDPGTPLPPDPT
APSPGTVTPVPPPQ
;
1   
12 UNP SMRD1_HUMAN  Q96GM5 ? 11 
;MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPG
YGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQT
IMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSL
VIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALW
QYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTL
KTQMNSFLLSTASQQEIATLDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRAE
FYFQPWAQEAVCRYFYSKVQQRRQELEQALGIRNT
;
1   
13 UNP SMCE1_HUMAN  Q969G3 ? 12 
;MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKV
WDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQR
QSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRK
LEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQEEREKEAAEQAERSQSSIVP
EEEQAANKGEEKKDDENIPMETEETHLEETTESQQNGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPP
TDPIPEDEKKE
;
1   
14 UNP REQU_HUMAN   Q92785 ? 13 
;MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQLYSYPARRWR
KKRRAHPPEDPRLSFPSIKP
;
1   
15 UNP REQU_HUMAN   Q92785 ? 13 
;YACDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQ
PEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGS
WSCHLCLDLLKEKASIYQNQNSS
;
209 
16 PDB 6LTJ         6LTJ   ? 14 ? 1   
17 PDB 6LTJ         6LTJ   ? 15 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6LTJ A 1   ? 136  ? Q6PI79 1   ? 136  ? -3  132  
2  2  6LTJ B 1   ? 103  ? P62799 1   ? 103  ? 0   102  
3  3  6LTJ C 1   ? 130  ? P06897 1   ? 130  ? 0   129  
4  4  6LTJ D 1   ? 126  ? Q92131 1   ? 126  ? -3  122  
5  1  6LTJ E 1   ? 136  ? Q6PI79 1   ? 136  ? 0   135  
6  2  6LTJ F 1   ? 103  ? P62799 1   ? 103  ? 0   102  
7  3  6LTJ G 1   ? 130  ? P06897 1   ? 130  ? 0   129  
8  4  6LTJ H 1   ? 126  ? Q92131 1   ? 126  ? -3  122  
9  5  6LTJ I 1   ? 1647 ? P51532 1   ? 1647 ? 1   1647 
10 6  6LTJ J 1   ? 406  ? O96019 12  ? 417  ? 12  417  
11 7  6LTJ K 1   ? 375  ? P60709 1   ? 375  ? 1   375  
12 8  6LTJ L 1   ? 1295 ? O14497 991 ? 2285 ? 991 2285 
13 9  6LTJ M 1   ? 113  ? Q12824 1   ? 113  ? 1   162  
14 10 6LTJ M 123 ? 336  ? Q12824 172 ? 385  ? 172 385  
15 11 6LTJ N 1   ? 1214 ? Q8TAQ2 1   ? 1214 ? 1   1214 
16 11 6LTJ O 1   ? 1214 ? Q8TAQ2 1   ? 1214 ? 1   1214 
17 12 6LTJ P 1   ? 515  ? Q96GM5 1   ? 515  ? 1   515  
18 13 6LTJ Q 1   ? 411  ? Q969G3 1   ? 411  ? 1   411  
19 14 6LTJ R 1   ? 100  ? Q92785 1   ? 100  ? 1   100  
20 15 6LTJ R 110 ? 292  ? Q92785 209 ? 391  ? 110 292  
21 16 6LTJ X 1   ? 119  ? 6LTJ   18  ? 136  ? 18  136  
22 17 6LTJ Y 1   ? 119  ? 6LTJ   18  ? 136  ? 18  136  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
10 6LTJ PRO J 407 ? UNP O96019 ? ? 'expression tag' 418 1  
13 6LTJ GLY M 114 ? UNP Q12824 ? ? linker           163 2  
13 6LTJ GLY M 115 ? UNP Q12824 ? ? linker           164 3  
13 6LTJ SER M 116 ? UNP Q12824 ? ? linker           165 4  
13 6LTJ GLY M 117 ? UNP Q12824 ? ? linker           166 5  
13 6LTJ GLY M 118 ? UNP Q12824 ? ? linker           167 6  
13 6LTJ SER M 119 ? UNP Q12824 ? ? linker           168 7  
13 6LTJ GLY M 120 ? UNP Q12824 ? ? linker           169 8  
13 6LTJ GLY M 121 ? UNP Q12824 ? ? linker           170 9  
13 6LTJ SER M 122 ? UNP Q12824 ? ? linker           171 10 
19 6LTJ GLY R 101 ? UNP Q92785 ? ? linker           101 11 
19 6LTJ GLY R 102 ? UNP Q92785 ? ? linker           102 12 
19 6LTJ SER R 103 ? UNP Q92785 ? ? linker           103 13 
19 6LTJ GLY R 104 ? UNP Q92785 ? ? linker           104 14 
19 6LTJ GLY R 105 ? UNP Q92785 ? ? linker           105 15 
19 6LTJ SER R 106 ? UNP Q92785 ? ? linker           106 16 
19 6LTJ GLY R 107 ? UNP Q92785 ? ? linker           107 17 
19 6LTJ GLY R 108 ? UNP Q92785 ? ? linker           108 18 
19 6LTJ SER R 109 ? UNP Q92785 ? ? linker           109 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6LTJ 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6LTJ 
_struct.title                        'Structure of nucleosome-bound human BAF complex' 
_struct.pdbx_descriptor              
;Histone H3.2, Histone H4, Histone H2A type 1-B/E, Histone H2B type 1-J, Transcription activator BRG1, Actin-like protein 6A, Actin, cytoplasmic 1, AT-rich interactive domain-containing protein 1A, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1,SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1, SWI/SNF complex subunit SMARCC2, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1, Zinc finger protein ubi-d4,Zinc finger protein ubi-d4/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6LTJ 
_struct_keywords.text            'Chromatin remodeler, Complex, GENE REGULATION' 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 1  ? 
F N N 2  ? 
G N N 3  ? 
H N N 4  ? 
I N N 5  ? 
J N N 6  ? 
K N N 7  ? 
L N N 8  ? 
M N N 9  ? 
N N N 10 ? 
O N N 10 ? 
P N N 11 ? 
Q N N 12 ? 
R N N 13 ? 
S N N 14 ? 
T N N 15 ? 
U N N 16 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 THR A 46   ? SER A 58   ? THR A 42   SER A 54   1 ? 13 
HELX_P HELX_P2   AA2 ARG A 64   ? LYS A 80   ? ARG A 60   LYS A 76   1 ? 17 
HELX_P HELX_P3   AA3 GLN A 86   ? ALA A 115  ? GLN A 82   ALA A 111  1 ? 30 
HELX_P HELX_P4   AA4 MET A 121  ? ARG A 132  ? MET A 117  ARG A 128  1 ? 12 
HELX_P HELX_P5   AA5 ASP B 25   ? ILE B 30   ? ASP B 24   ILE B 29   5 ? 6  
HELX_P HELX_P6   AA6 THR B 31   ? GLY B 43   ? THR B 30   GLY B 42   1 ? 13 
HELX_P HELX_P7   AA7 LEU B 50   ? ALA B 77   ? LEU B 49   ALA B 76   1 ? 28 
HELX_P HELX_P8   AA8 THR B 83   ? GLN B 94   ? THR B 82   GLN B 93   1 ? 12 
HELX_P HELX_P9   AA9 ARG C 18   ? GLY C 23   ? ARG C 17   GLY C 22   1 ? 6  
HELX_P HELX_P10  AB1 PRO C 27   ? GLY C 38   ? PRO C 26   GLY C 37   1 ? 12 
HELX_P HELX_P11  AB2 GLY C 47   ? ASP C 73   ? GLY C 46   ASP C 72   1 ? 27 
HELX_P HELX_P12  AB3 ILE C 80   ? ASP C 91   ? ILE C 79   ASP C 90   1 ? 12 
HELX_P HELX_P13  AB4 GLU C 93   ? LEU C 98   ? GLU C 92   LEU C 97   1 ? 6  
HELX_P HELX_P14  AB5 TYR D 38   ? HIS D 50   ? TYR D 34   HIS D 46   1 ? 13 
HELX_P HELX_P15  AB6 SER D 56   ? ASN D 85   ? SER D 52   ASN D 81   1 ? 30 
HELX_P HELX_P16  AB7 THR D 91   ? LEU D 103  ? THR D 87   LEU D 99   1 ? 13 
HELX_P HELX_P17  AB8 GLY D 105  ? THR D 123  ? GLY D 101  THR D 119  1 ? 19 
HELX_P HELX_P18  AB9 THR E 46   ? SER E 58   ? THR E 45   SER E 57   1 ? 13 
HELX_P HELX_P19  AC1 ARG E 64   ? LYS E 80   ? ARG E 63   LYS E 79   1 ? 17 
HELX_P HELX_P20  AC2 GLN E 86   ? ALA E 115  ? GLN E 85   ALA E 114  1 ? 30 
HELX_P HELX_P21  AC3 MET E 121  ? ARG E 132  ? MET E 120  ARG E 131  1 ? 12 
HELX_P HELX_P22  AC4 ASN F 26   ? ILE F 30   ? ASN F 25   ILE F 29   5 ? 5  
HELX_P HELX_P23  AC5 THR F 31   ? GLY F 43   ? THR F 30   GLY F 42   1 ? 13 
HELX_P HELX_P24  AC6 ILE F 51   ? ALA F 77   ? ILE F 50   ALA F 76   1 ? 27 
HELX_P HELX_P25  AC7 THR F 83   ? GLN F 94   ? THR F 82   GLN F 93   1 ? 12 
HELX_P HELX_P26  AC8 THR G 17   ? ALA G 22   ? THR G 16   ALA G 21   1 ? 6  
HELX_P HELX_P27  AC9 PRO G 27   ? GLY G 38   ? PRO G 26   GLY G 37   1 ? 12 
HELX_P HELX_P28  AD1 ALA G 46   ? ASN G 74   ? ALA G 45   ASN G 73   1 ? 29 
HELX_P HELX_P29  AD2 ILE G 80   ? ASP G 91   ? ILE G 79   ASP G 90   1 ? 12 
HELX_P HELX_P30  AD3 ASP G 91   ? LEU G 98   ? ASP G 90   LEU G 97   1 ? 8  
HELX_P HELX_P31  AD4 ALA H 39   ? LYS H 47   ? ALA H 35   LYS H 43   1 ? 9  
HELX_P HELX_P32  AD5 SER H 56   ? ASN H 85   ? SER H 52   ASN H 81   1 ? 30 
HELX_P HELX_P33  AD6 THR H 91   ? LEU H 103  ? THR H 87   LEU H 99   1 ? 13 
HELX_P HELX_P34  AD7 GLY H 105  ? SER H 124  ? GLY H 101  SER H 120  1 ? 20 
HELX_P HELX_P35  AD8 ASP I 362  ? ASN I 387  ? ASP I 362  ASN I 387  1 ? 26 
HELX_P HELX_P36  AD9 ARG I 397  ? LEU I 409  ? ARG I 397  LEU I 409  1 ? 13 
HELX_P HELX_P37  AE1 LEU I 409  ? THR I 428  ? LEU I 409  THR I 428  1 ? 20 
HELX_P HELX_P38  AE2 LEU I 430  ? LEU I 434  ? LEU I 430  LEU I 434  5 ? 5  
HELX_P HELX_P39  AE3 SER I 446  ? LYS I 517  ? SER I 446  LYS I 517  1 ? 72 
HELX_P HELX_P40  AE4 TYR I 757  ? LEU I 768  ? TYR I 757  LEU I 768  1 ? 12 
HELX_P HELX_P41  AE5 GLY I 784  ? TYR I 795  ? GLY I 784  TYR I 795  1 ? 12 
HELX_P HELX_P42  AE6 LEU I 812  ? ALA I 826  ? LEU I 812  ALA I 826  1 ? 15 
HELX_P HELX_P43  AE7 ALA I 839  ? PHE I 844  ? ALA I 839  PHE I 844  1 ? 6  
HELX_P HELX_P44  AE8 VAL I 845  ? ARG I 849  ? VAL I 845  ARG I 849  5 ? 5  
HELX_P HELX_P45  AE9 LEU I 893  ? ASN I 898  ? LEU I 893  ASN I 898  1 ? 6  
HELX_P HELX_P46  AF1 THR I 899  ? TYR I 901  ? THR I 899  TYR I 901  5 ? 3  
HELX_P HELX_P47  AF2 LYS I 917  ? LEU I 925  ? LYS I 917  LEU I 925  1 ? 9  
HELX_P HELX_P48  AF3 THR I 931  ? PHE I 939  ? THR I 931  PHE I 939  1 ? 9  
HELX_P HELX_P49  AF4 LEU I 972  ? LEU I 976  ? LEU I 972  LEU I 976  5 ? 5  
HELX_P HELX_P50  AF5 SER I 1001 ? ALA I 1013 ? SER I 1001 ALA I 1013 1 ? 13 
HELX_P HELX_P51  AF6 ILE I 1039 ? HIS I 1048 ? ILE I 1039 HIS I 1048 1 ? 10 
HELX_P HELX_P52  AF7 ILE I 1055 ? PHE I 1059 ? ILE I 1055 PHE I 1059 5 ? 5  
HELX_P HELX_P53  AF8 SER I 1079 ? LEU I 1089 ? SER I 1079 LEU I 1089 1 ? 11 
HELX_P HELX_P54  AF9 SER I 1107 ? GLY I 1120 ? SER I 1107 GLY I 1120 1 ? 14 
HELX_P HELX_P55  AG1 ASN I 1179 ? GLN I 1182 ? ASN I 1179 GLN I 1182 5 ? 4  
HELX_P HELX_P56  AG2 ASP I 1183 ? ARG I 1192 ? ASP I 1183 ARG I 1192 1 ? 10 
HELX_P HELX_P57  AG3 GLU I 1300 ? ILE I 1306 ? GLU I 1300 ILE I 1306 1 ? 7  
HELX_P HELX_P58  AG4 GLU I 1311 ? ARG I 1323 ? GLU I 1311 ARG I 1323 1 ? 13 
HELX_P HELX_P59  AG5 ALA I 1352 ? GLU I 1362 ? ALA I 1352 GLU I 1362 1 ? 11 
HELX_P HELX_P60  AG6 ILE J 59   ? VAL J 66   ? ILE J 70   VAL J 77   1 ? 8  
HELX_P HELX_P61  AG7 ASP J 84   ? HIS J 99   ? ASP J 95   HIS J 110  1 ? 16 
HELX_P HELX_P62  AG8 THR J 118  ? HIS J 132  ? THR J 129  HIS J 143  1 ? 15 
HELX_P HELX_P63  AG9 THR J 143  ? ASN J 151  ? THR J 154  ASN J 162  1 ? 9  
HELX_P HELX_P64  AH1 ALA J 187  ? MET J 202  ? ALA J 198  MET J 213  1 ? 16 
HELX_P HELX_P65  AH2 ARG J 237  ? VAL J 255  ? ARG J 248  VAL J 266  1 ? 19 
HELX_P HELX_P66  AH3 ILE J 293  ? ASP J 299  ? ILE J 304  ASP J 310  5 ? 7  
HELX_P HELX_P67  AH4 GLY J 313  ? MET J 324  ? GLY J 324  MET J 335  1 ? 12 
HELX_P HELX_P68  AH5 ILE J 329  ? SER J 336  ? ILE J 340  SER J 347  1 ? 8  
HELX_P HELX_P69  AH6 SER J 348  ? LYS J 360  ? SER J 359  LYS J 371  1 ? 13 
HELX_P HELX_P70  AH7 PHE J 380  ? ILE J 388  ? PHE J 391  ILE J 399  1 ? 9  
HELX_P HELX_P71  AH8 GLY J 393  ? MET J 398  ? GLY J 404  MET J 409  1 ? 6  
HELX_P HELX_P72  AH9 ASP K 80   ? TYR K 91   ? ASP K 80   TYR K 91   1 ? 12 
HELX_P HELX_P73  AI1 PRO K 112  ? GLU K 125  ? PRO K 112  GLU K 125  1 ? 14 
HELX_P HELX_P74  AI2 GLN K 137  ? GLY K 146  ? GLN K 137  GLY K 146  1 ? 10 
HELX_P HELX_P75  AI3 ALA K 181  ? ARG K 196  ? ALA K 181  ARG K 196  1 ? 16 
HELX_P HELX_P76  AI4 ALA K 204  ? LEU K 216  ? ALA K 204  LEU K 216  1 ? 13 
HELX_P HELX_P77  AI5 ASP K 222  ? ALA K 231  ? ASP K 222  ALA K 231  1 ? 10 
HELX_P HELX_P78  AI6 ASN K 252  ? CYS K 257  ? ASN K 252  CYS K 257  1 ? 6  
HELX_P HELX_P79  AI7 PRO K 258  ? LEU K 261  ? PRO K 258  LEU K 261  5 ? 4  
HELX_P HELX_P80  AI8 GLN K 263  ? GLY K 268  ? GLN K 263  GLY K 268  1 ? 6  
HELX_P HELX_P81  AI9 GLY K 273  ? LYS K 284  ? GLY K 273  LYS K 284  1 ? 12 
HELX_P HELX_P82  AJ1 ILE K 289  ? ASN K 296  ? ILE K 289  ASN K 296  1 ? 8  
HELX_P HELX_P83  AJ2 GLY K 301  ? MET K 305  ? GLY K 301  MET K 305  5 ? 5  
HELX_P HELX_P84  AJ3 GLY K 308  ? ALA K 321  ? GLY K 308  ALA K 321  1 ? 14 
HELX_P HELX_P85  AJ4 TYR K 337  ? ILE K 345  ? TYR K 337  ILE K 345  1 ? 9  
HELX_P HELX_P86  AJ5 LEU K 346  ? GLN K 353  ? LEU K 346  GLN K 353  5 ? 8  
HELX_P HELX_P87  AJ6 LYS K 359  ? GLY K 366  ? LYS K 359  GLY K 366  1 ? 8  
HELX_P HELX_P88  AJ7 PRO K 367  ? ARG K 372  ? PRO K 367  ARG K 372  5 ? 6  
HELX_P HELX_P89  AJ8 SER L 655  ? THR L 659  ? SER L 1645 THR L 1649 5 ? 5  
HELX_P HELX_P90  AJ9 GLU L 678  ? GLY L 689  ? GLU L 1668 GLY L 1679 1 ? 12 
HELX_P HELX_P91  AK1 LEU L 690  ? ASP L 707  ? LEU L 1680 ASP L 1697 1 ? 18 
HELX_P HELX_P92  AK2 ASP L 708  ? ILE L 711  ? ASP L 1698 ILE L 1701 5 ? 4  
HELX_P HELX_P93  AK3 ASN L 715  ? LEU L 719  ? ASN L 1705 LEU L 1709 5 ? 5  
HELX_P HELX_P94  AK4 GLY L 721  ? GLY L 739  ? GLY L 1711 GLY L 1729 1 ? 19 
HELX_P HELX_P95  AK5 GLY L 750  ? LEU L 755  ? GLY L 1740 LEU L 1745 1 ? 6  
HELX_P HELX_P96  AK6 GLY L 850  ? ILE L 856  ? GLY L 1840 ILE L 1846 1 ? 7  
HELX_P HELX_P97  AK7 LEU L 981  ? SER L 1002 ? LEU L 1971 SER L 1992 1 ? 22 
HELX_P HELX_P98  AK8 GLY L 1006 ? SER L 1012 ? GLY L 1996 SER L 2002 1 ? 7  
HELX_P HELX_P99  AK9 HIS L 1014 ? LEU L 1026 ? HIS L 2004 LEU L 2016 1 ? 13 
HELX_P HELX_P100 AL1 TRP L 1059 ? SER L 1078 ? TRP L 2049 SER L 2068 1 ? 20 
HELX_P HELX_P101 AL2 GLY L 1079 ? LEU L 1081 ? GLY L 2069 LEU L 2071 5 ? 3  
HELX_P HELX_P102 AL3 PRO L 1087 ? CYS L 1104 ? PRO L 2077 CYS L 2094 1 ? 18 
HELX_P HELX_P103 AL4 SER L 1123 ? ILE L 1137 ? SER L 2113 ILE L 2127 1 ? 15 
HELX_P HELX_P104 AL5 GLN L 1138 ? ALA L 1147 ? GLN L 2128 ALA L 2137 1 ? 10 
HELX_P HELX_P105 AL6 PRO L 1150 ? ARG L 1168 ? PRO L 2140 ARG L 2158 1 ? 19 
HELX_P HELX_P106 AL7 ASN L 1170 ? ASP L 1188 ? ASN L 2160 ASP L 2178 1 ? 19 
HELX_P HELX_P107 AL8 ASP L 1188 ? VAL L 1197 ? ASP L 2178 VAL L 2187 1 ? 10 
HELX_P HELX_P108 AL9 GLY L 1200 ? GLN L 1219 ? GLY L 2190 GLN L 2209 1 ? 20 
HELX_P HELX_P109 AM1 VAL L 1238 ? LYS L 1253 ? VAL L 2228 LYS L 2243 1 ? 16 
HELX_P HELX_P110 AM2 ASN L 1257 ? THR L 1262 ? ASN L 2247 THR L 2252 1 ? 6  
HELX_P HELX_P111 AM3 TYR L 1264 ? SER L 1274 ? TYR L 2254 SER L 2264 1 ? 11 
HELX_P HELX_P112 AM4 ASN L 1278 ? GLN L 1294 ? ASN L 2268 GLN L 2284 1 ? 17 
HELX_P HELX_P113 AM5 GLY M 29   ? LEU M 36   ? GLY M 29   LEU M 36   1 ? 8  
HELX_P HELX_P114 AM6 GLY M 41   ? TYR M 47   ? GLY M 41   TYR M 47   1 ? 7  
HELX_P HELX_P115 AM7 THR M 56   ? SER M 66   ? THR M 56   SER M 66   1 ? 11 
HELX_P HELX_P116 AM8 GLY M 80   ? LEU M 84   ? GLY M 80   LEU M 84   5 ? 5  
HELX_P HELX_P117 AM9 ALA M 93   ? GLU M 98   ? ALA M 93   GLU M 98   1 ? 6  
HELX_P HELX_P118 AN1 PRO M 124  ? SER M 132  ? PRO M 173  SER M 181  1 ? 9  
HELX_P HELX_P119 AN2 THR M 165  ? LEU M 177  ? THR M 214  LEU M 226  1 ? 13 
HELX_P HELX_P120 AN3 ASN M 180  ? TYR M 199  ? ASN M 229  TYR M 248  1 ? 20 
HELX_P HELX_P121 AN4 SER M 240  ? GLY M 253  ? SER M 289  GLY M 302  1 ? 14 
HELX_P HELX_P122 AN5 GLY M 256  ? LYS M 275  ? GLY M 305  LYS M 324  1 ? 20 
HELX_P HELX_P123 AN6 ASN M 293  ? GLN M 299  ? ASN M 342  GLN M 348  1 ? 7  
HELX_P HELX_P124 AN7 THR M 308  ? THR M 332  ? THR M 357  THR M 381  1 ? 25 
HELX_P HELX_P125 AN8 PRO N 427  ? ALA N 431  ? PRO N 427  ALA N 431  5 ? 5  
HELX_P HELX_P126 AN9 ALA N 440  ? LEU N 446  ? ALA N 440  LEU N 446  1 ? 7  
HELX_P HELX_P127 AO1 PRO N 447  ? GLY N 452  ? PRO N 447  GLY N 452  1 ? 6  
HELX_P HELX_P128 AO2 THR N 458  ? LEU N 475  ? THR N 458  LEU N 475  1 ? 18 
HELX_P HELX_P129 AO3 THR N 482  ? LEU N 490  ? THR N 482  LEU N 490  1 ? 9  
HELX_P HELX_P130 AO4 ASP N 493  ? TRP N 507  ? ASP N 493  TRP N 507  1 ? 15 
HELX_P HELX_P131 AO5 GLU N 603  ? TYR N 616  ? GLU N 603  TYR N 616  1 ? 14 
HELX_P HELX_P132 AO6 TRP N 620  ? GLY N 628  ? TRP N 620  GLY N 628  1 ? 9  
HELX_P HELX_P133 AO7 THR N 631  ? ARG N 641  ? THR N 631  ARG N 641  1 ? 11 
HELX_P HELX_P134 AO8 PRO N 672  ? SER N 682  ? PRO N 672  SER N 682  1 ? 11 
HELX_P HELX_P135 AO9 ASP N 685  ? LYS N 702  ? ASP N 685  LYS N 702  1 ? 18 
HELX_P HELX_P136 AP1 SER N 859  ? GLN N 949  ? SER N 859  GLN N 949  1 ? 91 
HELX_P HELX_P137 AP2 HIS O 439  ? LEU O 446  ? HIS O 439  LEU O 446  1 ? 8  
HELX_P HELX_P138 AP3 PRO O 447  ? PHE O 450  ? PRO O 447  PHE O 450  5 ? 4  
HELX_P HELX_P139 AP4 THR O 458  ? LEU O 475  ? THR O 458  LEU O 475  1 ? 18 
HELX_P HELX_P140 AP5 THR O 482  ? LEU O 490  ? THR O 482  LEU O 490  1 ? 9  
HELX_P HELX_P141 AP6 ASP O 493  ? TRP O 507  ? ASP O 493  TRP O 507  1 ? 15 
HELX_P HELX_P142 AP7 THR O 602  ? TYR O 616  ? THR O 602  TYR O 616  1 ? 15 
HELX_P HELX_P143 AP8 ASP O 619  ? GLY O 628  ? ASP O 619  GLY O 628  1 ? 10 
HELX_P HELX_P144 AP9 THR O 631  ? ARG O 641  ? THR O 631  ARG O 641  1 ? 11 
HELX_P HELX_P145 AQ1 GLU O 645  ? GLU O 650  ? GLU O 645  GLU O 650  1 ? 6  
HELX_P HELX_P146 AQ2 GLY O 657  ? TYR O 661  ? GLY O 657  TYR O 661  5 ? 5  
HELX_P HELX_P147 AQ3 ASN O 671  ? VAL O 684  ? ASN O 671  VAL O 684  1 ? 14 
HELX_P HELX_P148 AQ4 ASP O 685  ? GLU O 705  ? ASP O 685  GLU O 705  1 ? 21 
HELX_P HELX_P149 AQ5 LEU O 711  ? VAL O 716  ? LEU O 711  VAL O 716  1 ? 6  
HELX_P HELX_P150 AQ6 ALA O 868  ? GLN O 952  ? ALA O 868  GLN O 952  1 ? 85 
HELX_P HELX_P151 AQ7 MET P 128  ? ILE P 132  ? MET P 128  ILE P 132  5 ? 5  
HELX_P HELX_P152 AQ8 PRO P 134  ? VAL P 141  ? PRO P 134  VAL P 141  1 ? 8  
HELX_P HELX_P153 AQ9 GLU P 143  ? LYS P 173  ? GLU P 143  LYS P 173  1 ? 31 
HELX_P HELX_P154 AR1 ASP P 298  ? GLY P 306  ? ASP P 298  GLY P 306  1 ? 9  
HELX_P HELX_P155 AR2 ARG P 312  ? LYS P 327  ? ARG P 312  LYS P 327  1 ? 16 
HELX_P HELX_P156 AR3 LYS P 353  ? SER P 355  ? LYS P 353  SER P 355  5 ? 3  
HELX_P HELX_P157 AR4 GLU P 356  ? LEU P 361  ? GLU P 356  LEU P 361  1 ? 6  
HELX_P HELX_P158 AR5 LEU P 400  ? THR P 411  ? LEU P 400  THR P 411  1 ? 12 
HELX_P HELX_P159 AR6 GLN P 414  ? ASP P 447  ? GLN P 414  ASP P 447  1 ? 34 
HELX_P HELX_P160 AR7 ASP P 447  ? ASP P 468  ? ASP P 447  ASP P 468  1 ? 22 
HELX_P HELX_P161 AR8 ARG P 478  ? GLN P 484  ? ARG P 478  GLN P 484  5 ? 7  
HELX_P HELX_P162 AR9 TRP P 486  ? GLU P 505  ? TRP P 486  GLU P 505  1 ? 20 
HELX_P HELX_P163 AS1 PHE Q 186  ? LEU Q 207  ? PHE Q 186  LEU Q 207  1 ? 22 
HELX_P HELX_P164 AS2 THR Q 220  ? LEU Q 276  ? THR Q 220  LEU Q 276  1 ? 57 
HELX_P HELX_P165 AS3 GLU R 14   ? ARG R 38   ? GLU R 14   ARG R 38   1 ? 25 
HELX_P HELX_P166 AS4 GLU R 58   ? ARG R 62   ? GLU R 58   ARG R 62   5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? L HIS 1029 NE2 ? ? ? 1_555 U ZN .   ZN ? ? L HIS 2019 L ZN 2301 1_555 ? ? ? ? ? ? ?                       
2.001 ? 
metalc2   metalc ? ? L HIS 1031 NE2 ? ? ? 1_555 U ZN .   ZN ? ? L HIS 2021 L ZN 2301 1_555 ? ? ? ? ? ? ?                       
2.019 ? 
metalc3   metalc ? ? L HIS 1100 NE2 ? ? ? 1_555 U ZN .   ZN ? ? L HIS 2090 L ZN 2301 1_555 ? ? ? ? ? ? ?                       
2.031 ? 
metalc4   metalc ? ? L CYS 1104 SG  ? ? ? 1_555 U ZN .   ZN ? ? L CYS 2094 L ZN 2301 1_555 ? ? ? ? ? ? ?                       
2.212 ? 
hydrog1   hydrog ? ? S DT  1    N3  ? ? ? 1_555 T DA 119 N1 ? ? X DT  18   Y DA 136  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog2   hydrog ? ? S DT  1    O4  ? ? ? 1_555 T DA 119 N6 ? ? X DT  18   Y DA 136  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog3   hydrog ? ? S DG  2    N1  ? ? ? 1_555 T DC 118 N3 ? ? X DG  19   Y DC 135  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog4   hydrog ? ? S DG  2    N2  ? ? ? 1_555 T DC 118 O2 ? ? X DG  19   Y DC 135  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog5   hydrog ? ? S DG  2    O6  ? ? ? 1_555 T DC 118 N4 ? ? X DG  19   Y DC 135  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog6   hydrog ? ? S DC  3    N3  ? ? ? 1_555 T DG 117 N1 ? ? X DC  20   Y DG 134  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog7   hydrog ? ? S DC  3    N4  ? ? ? 1_555 T DG 117 O6 ? ? X DC  20   Y DG 134  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog8   hydrog ? ? S DC  3    O2  ? ? ? 1_555 T DG 117 N2 ? ? X DC  20   Y DG 134  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog9   hydrog ? ? S DC  4    N3  ? ? ? 1_555 T DG 116 N1 ? ? X DC  21   Y DG 133  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog10  hydrog ? ? S DC  4    N4  ? ? ? 1_555 T DG 116 O6 ? ? X DC  21   Y DG 133  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog11  hydrog ? ? S DC  4    O2  ? ? ? 1_555 T DG 116 N2 ? ? X DC  21   Y DG 133  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog12  hydrog ? ? S DG  5    N1  ? ? ? 1_555 T DC 115 N3 ? ? X DG  22   Y DC 132  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog13  hydrog ? ? S DG  5    N2  ? ? ? 1_555 T DC 115 O2 ? ? X DG  22   Y DC 132  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog14  hydrog ? ? S DG  5    O6  ? ? ? 1_555 T DC 115 N4 ? ? X DG  22   Y DC 132  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog15  hydrog ? ? S DA  6    N1  ? ? ? 1_555 T DT 114 N3 ? ? X DA  23   Y DT 131  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog16  hydrog ? ? S DA  6    N6  ? ? ? 1_555 T DT 114 O4 ? ? X DA  23   Y DT 131  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog17  hydrog ? ? S DG  7    N1  ? ? ? 1_555 T DC 113 N3 ? ? X DG  24   Y DC 130  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog18  hydrog ? ? S DG  7    N2  ? ? ? 1_555 T DC 113 O2 ? ? X DG  24   Y DC 130  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog19  hydrog ? ? S DG  7    O6  ? ? ? 1_555 T DC 113 N4 ? ? X DG  24   Y DC 130  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog20  hydrog ? ? S DG  8    N1  ? ? ? 1_555 T DC 112 N3 ? ? X DG  25   Y DC 129  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog21  hydrog ? ? S DG  8    N2  ? ? ? 1_555 T DC 112 O2 ? ? X DG  25   Y DC 129  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog22  hydrog ? ? S DG  8    O6  ? ? ? 1_555 T DC 112 N4 ? ? X DG  25   Y DC 129  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog23  hydrog ? ? S DC  9    N3  ? ? ? 1_555 T DG 111 N1 ? ? X DC  26   Y DG 128  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog24  hydrog ? ? S DC  9    N4  ? ? ? 1_555 T DG 111 O6 ? ? X DC  26   Y DG 128  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog25  hydrog ? ? S DC  9    O2  ? ? ? 1_555 T DG 111 N2 ? ? X DC  26   Y DG 128  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog26  hydrog ? ? S DC  10   N3  ? ? ? 1_555 T DG 110 N1 ? ? X DC  27   Y DG 127  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog27  hydrog ? ? S DC  10   N4  ? ? ? 1_555 T DG 110 O6 ? ? X DC  27   Y DG 127  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog28  hydrog ? ? S DC  10   O2  ? ? ? 1_555 T DG 110 N2 ? ? X DC  27   Y DG 127  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog29  hydrog ? ? S DG  11   N1  ? ? ? 1_555 T DC 109 N3 ? ? X DG  28   Y DC 126  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog30  hydrog ? ? S DG  11   N2  ? ? ? 1_555 T DC 109 O2 ? ? X DG  28   Y DC 126  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog31  hydrog ? ? S DG  11   O6  ? ? ? 1_555 T DC 109 N4 ? ? X DG  28   Y DC 126  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog32  hydrog ? ? S DC  12   N3  ? ? ? 1_555 T DG 108 N1 ? ? X DC  29   Y DG 125  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog33  hydrog ? ? S DC  12   N4  ? ? ? 1_555 T DG 108 O6 ? ? X DC  29   Y DG 125  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog34  hydrog ? ? S DC  12   O2  ? ? ? 1_555 T DG 108 N2 ? ? X DC  29   Y DG 125  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog35  hydrog ? ? S DT  13   N3  ? ? ? 1_555 T DA 107 N1 ? ? X DT  30   Y DA 124  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog36  hydrog ? ? S DT  13   O4  ? ? ? 1_555 T DA 107 N6 ? ? X DT  30   Y DA 124  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog37  hydrog ? ? S DC  14   N3  ? ? ? 1_555 T DG 106 N1 ? ? X DC  31   Y DG 123  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog38  hydrog ? ? S DC  14   N4  ? ? ? 1_555 T DG 106 O6 ? ? X DC  31   Y DG 123  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog39  hydrog ? ? S DC  14   O2  ? ? ? 1_555 T DG 106 N2 ? ? X DC  31   Y DG 123  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog40  hydrog ? ? S DA  15   N1  ? ? ? 1_555 T DT 105 N3 ? ? X DA  32   Y DT 122  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog41  hydrog ? ? S DA  15   N6  ? ? ? 1_555 T DT 105 O4 ? ? X DA  32   Y DT 122  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog42  hydrog ? ? S DA  16   N1  ? ? ? 1_555 T DT 104 N3 ? ? X DA  33   Y DT 121  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog43  hydrog ? ? S DA  16   N6  ? ? ? 1_555 T DT 104 O4 ? ? X DA  33   Y DT 121  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog44  hydrog ? ? S DT  17   N3  ? ? ? 1_555 T DA 103 N1 ? ? X DT  34   Y DA 120  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog45  hydrog ? ? S DT  17   O4  ? ? ? 1_555 T DA 103 N6 ? ? X DT  34   Y DA 120  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog46  hydrog ? ? S DT  18   N3  ? ? ? 1_555 T DA 102 N1 ? ? X DT  35   Y DA 119  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog47  hydrog ? ? S DT  18   O4  ? ? ? 1_555 T DA 102 N6 ? ? X DT  35   Y DA 119  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog48  hydrog ? ? S DG  19   N1  ? ? ? 1_555 T DC 101 N3 ? ? X DG  36   Y DC 118  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog49  hydrog ? ? S DG  19   N2  ? ? ? 1_555 T DC 101 O2 ? ? X DG  36   Y DC 118  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog50  hydrog ? ? S DG  19   O6  ? ? ? 1_555 T DC 101 N4 ? ? X DG  36   Y DC 118  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog51  hydrog ? ? S DG  20   N1  ? ? ? 1_555 T DC 100 N3 ? ? X DG  37   Y DC 117  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog52  hydrog ? ? S DG  20   N2  ? ? ? 1_555 T DC 100 O2 ? ? X DG  37   Y DC 117  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog53  hydrog ? ? S DG  20   O6  ? ? ? 1_555 T DC 100 N4 ? ? X DG  37   Y DC 117  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog54  hydrog ? ? S DT  21   N3  ? ? ? 1_555 T DA 99  N1 ? ? X DT  38   Y DA 116  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog55  hydrog ? ? S DT  21   O4  ? ? ? 1_555 T DA 99  N6 ? ? X DT  38   Y DA 116  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog56  hydrog ? ? S DC  22   N3  ? ? ? 1_555 T DG 98  N1 ? ? X DC  39   Y DG 115  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog57  hydrog ? ? S DC  22   N4  ? ? ? 1_555 T DG 98  O6 ? ? X DC  39   Y DG 115  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog58  hydrog ? ? S DC  22   O2  ? ? ? 1_555 T DG 98  N2 ? ? X DC  39   Y DG 115  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog59  hydrog ? ? S DG  23   N1  ? ? ? 1_555 T DC 97  N3 ? ? X DG  40   Y DC 114  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog60  hydrog ? ? S DG  23   N2  ? ? ? 1_555 T DC 97  O2 ? ? X DG  40   Y DC 114  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog61  hydrog ? ? S DG  23   O6  ? ? ? 1_555 T DC 97  N4 ? ? X DG  40   Y DC 114  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog62  hydrog ? ? S DT  24   N3  ? ? ? 1_555 T DA 96  N1 ? ? X DT  41   Y DA 113  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog63  hydrog ? ? S DT  24   O4  ? ? ? 1_555 T DA 96  N6 ? ? X DT  41   Y DA 113  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog64  hydrog ? ? S DA  25   N1  ? ? ? 1_555 T DT 95  N3 ? ? X DA  42   Y DT 112  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog65  hydrog ? ? S DA  25   N6  ? ? ? 1_555 T DT 95  O4 ? ? X DA  42   Y DT 112  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog66  hydrog ? ? S DG  26   N1  ? ? ? 1_555 T DC 94  N3 ? ? X DG  43   Y DC 111  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog67  hydrog ? ? S DG  26   N2  ? ? ? 1_555 T DC 94  O2 ? ? X DG  43   Y DC 111  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog68  hydrog ? ? S DG  26   O6  ? ? ? 1_555 T DC 94  N4 ? ? X DG  43   Y DC 111  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog69  hydrog ? ? S DA  27   N1  ? ? ? 1_555 T DT 93  N3 ? ? X DA  44   Y DT 110  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog70  hydrog ? ? S DA  27   N6  ? ? ? 1_555 T DT 93  O4 ? ? X DA  44   Y DT 110  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog71  hydrog ? ? S DC  28   N3  ? ? ? 1_555 T DG 92  N1 ? ? X DC  45   Y DG 109  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog72  hydrog ? ? S DC  28   N4  ? ? ? 1_555 T DG 92  O6 ? ? X DC  45   Y DG 109  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog73  hydrog ? ? S DC  28   O2  ? ? ? 1_555 T DG 92  N2 ? ? X DC  45   Y DG 109  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog74  hydrog ? ? S DA  29   N1  ? ? ? 1_555 T DT 91  N3 ? ? X DA  46   Y DT 108  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog75  hydrog ? ? S DA  29   N6  ? ? ? 1_555 T DT 91  O4 ? ? X DA  46   Y DT 108  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog76  hydrog ? ? S DG  30   N1  ? ? ? 1_555 T DC 90  N3 ? ? X DG  47   Y DC 107  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog77  hydrog ? ? S DG  30   N2  ? ? ? 1_555 T DC 90  O2 ? ? X DG  47   Y DC 107  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog78  hydrog ? ? S DG  30   O6  ? ? ? 1_555 T DC 90  N4 ? ? X DG  47   Y DC 107  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog79  hydrog ? ? S DC  31   N3  ? ? ? 1_555 T DG 89  N1 ? ? X DC  48   Y DG 106  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog80  hydrog ? ? S DC  31   N4  ? ? ? 1_555 T DG 89  O6 ? ? X DC  48   Y DG 106  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog81  hydrog ? ? S DC  31   O2  ? ? ? 1_555 T DG 89  N2 ? ? X DC  48   Y DG 106  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog82  hydrog ? ? S DT  32   N3  ? ? ? 1_555 T DA 88  N1 ? ? X DT  49   Y DA 105  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog83  hydrog ? ? S DT  32   O4  ? ? ? 1_555 T DA 88  N6 ? ? X DT  49   Y DA 105  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog84  hydrog ? ? S DC  33   N3  ? ? ? 1_555 T DG 87  N1 ? ? X DC  50   Y DG 104  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog85  hydrog ? ? S DC  33   N4  ? ? ? 1_555 T DG 87  O6 ? ? X DC  50   Y DG 104  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog86  hydrog ? ? S DC  33   O2  ? ? ? 1_555 T DG 87  N2 ? ? X DC  50   Y DG 104  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog87  hydrog ? ? S DT  34   N3  ? ? ? 1_555 T DA 86  N1 ? ? X DT  51   Y DA 103  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog88  hydrog ? ? S DT  34   O4  ? ? ? 1_555 T DA 86  N6 ? ? X DT  51   Y DA 103  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog89  hydrog ? ? S DA  35   N1  ? ? ? 1_555 T DT 85  N3 ? ? X DA  52   Y DT 102  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog90  hydrog ? ? S DA  35   N6  ? ? ? 1_555 T DT 85  O4 ? ? X DA  52   Y DT 102  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog91  hydrog ? ? S DG  36   N1  ? ? ? 1_555 T DC 84  N3 ? ? X DG  53   Y DC 101  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog92  hydrog ? ? S DG  36   N2  ? ? ? 1_555 T DC 84  O2 ? ? X DG  53   Y DC 101  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog93  hydrog ? ? S DG  36   O6  ? ? ? 1_555 T DC 84  N4 ? ? X DG  53   Y DC 101  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog94  hydrog ? ? S DC  37   N3  ? ? ? 1_555 T DG 83  N1 ? ? X DC  54   Y DG 100  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog95  hydrog ? ? S DC  37   N4  ? ? ? 1_555 T DG 83  O6 ? ? X DC  54   Y DG 100  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog96  hydrog ? ? S DC  37   O2  ? ? ? 1_555 T DG 83  N2 ? ? X DC  54   Y DG 100  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog97  hydrog ? ? S DA  38   N1  ? ? ? 1_555 T DT 82  N3 ? ? X DA  55   Y DT 99   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog98  hydrog ? ? S DA  38   N6  ? ? ? 1_555 T DT 82  O4 ? ? X DA  55   Y DT 99   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog99  hydrog ? ? S DC  39   N3  ? ? ? 1_555 T DG 81  N1 ? ? X DC  56   Y DG 98   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog100 hydrog ? ? S DC  39   N4  ? ? ? 1_555 T DG 81  O6 ? ? X DC  56   Y DG 98   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog101 hydrog ? ? S DC  39   O2  ? ? ? 1_555 T DG 81  N2 ? ? X DC  56   Y DG 98   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog102 hydrog ? ? S DC  40   N3  ? ? ? 1_555 T DG 80  N1 ? ? X DC  57   Y DG 97   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog103 hydrog ? ? S DC  40   N4  ? ? ? 1_555 T DG 80  O6 ? ? X DC  57   Y DG 97   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog104 hydrog ? ? S DC  40   O2  ? ? ? 1_555 T DG 80  N2 ? ? X DC  57   Y DG 97   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog105 hydrog ? ? S DG  41   N1  ? ? ? 1_555 T DC 79  N3 ? ? X DG  58   Y DC 96   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog106 hydrog ? ? S DG  41   N2  ? ? ? 1_555 T DC 79  O2 ? ? X DG  58   Y DC 96   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog107 hydrog ? ? S DG  41   O6  ? ? ? 1_555 T DC 79  N4 ? ? X DG  58   Y DC 96   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog108 hydrog ? ? S DC  42   N3  ? ? ? 1_555 T DG 78  N1 ? ? X DC  59   Y DG 95   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog109 hydrog ? ? S DC  42   N4  ? ? ? 1_555 T DG 78  O6 ? ? X DC  59   Y DG 95   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog110 hydrog ? ? S DC  42   O2  ? ? ? 1_555 T DG 78  N2 ? ? X DC  59   Y DG 95   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog111 hydrog ? ? S DT  43   N3  ? ? ? 1_555 T DA 77  N1 ? ? X DT  60   Y DA 94   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog112 hydrog ? ? S DT  43   O4  ? ? ? 1_555 T DA 77  N6 ? ? X DT  60   Y DA 94   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog113 hydrog ? ? S DT  44   N3  ? ? ? 1_555 T DA 76  N1 ? ? X DT  61   Y DA 93   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog114 hydrog ? ? S DT  44   O4  ? ? ? 1_555 T DA 76  N6 ? ? X DT  61   Y DA 93   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog115 hydrog ? ? S DA  45   N1  ? ? ? 1_555 T DT 75  N3 ? ? X DA  62   Y DT 92   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog116 hydrog ? ? S DA  45   N6  ? ? ? 1_555 T DT 75  O4 ? ? X DA  62   Y DT 92   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog117 hydrog ? ? S DA  46   N1  ? ? ? 1_555 T DT 74  N3 ? ? X DA  63   Y DT 91   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog118 hydrog ? ? S DA  46   N6  ? ? ? 1_555 T DT 74  O4 ? ? X DA  63   Y DT 91   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog119 hydrog ? ? S DA  47   N1  ? ? ? 1_555 T DT 73  N3 ? ? X DA  64   Y DT 90   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog120 hydrog ? ? S DA  47   N6  ? ? ? 1_555 T DT 73  O4 ? ? X DA  64   Y DT 90   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog121 hydrog ? ? S DC  48   N3  ? ? ? 1_555 T DG 72  N1 ? ? X DC  65   Y DG 89   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog122 hydrog ? ? S DC  48   N4  ? ? ? 1_555 T DG 72  O6 ? ? X DC  65   Y DG 89   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog123 hydrog ? ? S DC  48   O2  ? ? ? 1_555 T DG 72  N2 ? ? X DC  65   Y DG 89   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog124 hydrog ? ? S DG  49   N1  ? ? ? 1_555 T DC 71  N3 ? ? X DG  66   Y DC 88   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog125 hydrog ? ? S DG  49   N2  ? ? ? 1_555 T DC 71  O2 ? ? X DG  66   Y DC 88   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog126 hydrog ? ? S DG  49   O6  ? ? ? 1_555 T DC 71  N4 ? ? X DG  66   Y DC 88   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog127 hydrog ? ? S DC  50   N3  ? ? ? 1_555 T DG 70  N1 ? ? X DC  67   Y DG 87   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog128 hydrog ? ? S DC  50   N4  ? ? ? 1_555 T DG 70  O6 ? ? X DC  67   Y DG 87   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog129 hydrog ? ? S DC  50   O2  ? ? ? 1_555 T DG 70  N2 ? ? X DC  67   Y DG 87   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog130 hydrog ? ? S DA  51   N1  ? ? ? 1_555 T DT 69  N3 ? ? X DA  68   Y DT 86   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog131 hydrog ? ? S DA  51   N6  ? ? ? 1_555 T DT 69  O4 ? ? X DA  68   Y DT 86   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog132 hydrog ? ? S DC  52   N3  ? ? ? 1_555 T DG 68  N1 ? ? X DC  69   Y DG 85   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog133 hydrog ? ? S DC  52   N4  ? ? ? 1_555 T DG 68  O6 ? ? X DC  69   Y DG 85   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog134 hydrog ? ? S DC  52   O2  ? ? ? 1_555 T DG 68  N2 ? ? X DC  69   Y DG 85   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog135 hydrog ? ? S DG  53   N1  ? ? ? 1_555 T DC 67  N3 ? ? X DG  70   Y DC 84   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog136 hydrog ? ? S DG  53   N2  ? ? ? 1_555 T DC 67  O2 ? ? X DG  70   Y DC 84   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog137 hydrog ? ? S DG  53   O6  ? ? ? 1_555 T DC 67  N4 ? ? X DG  70   Y DC 84   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog138 hydrog ? ? S DT  54   N3  ? ? ? 1_555 T DA 66  N1 ? ? X DT  71   Y DA 83   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog139 hydrog ? ? S DT  54   O4  ? ? ? 1_555 T DA 66  N6 ? ? X DT  71   Y DA 83   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog140 hydrog ? ? S DA  55   N1  ? ? ? 1_555 T DT 65  N3 ? ? X DA  72   Y DT 82   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog141 hydrog ? ? S DA  55   N6  ? ? ? 1_555 T DT 65  O4 ? ? X DA  72   Y DT 82   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog142 hydrog ? ? S DC  56   N3  ? ? ? 1_555 T DG 64  N1 ? ? X DC  73   Y DG 81   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog143 hydrog ? ? S DC  56   N4  ? ? ? 1_555 T DG 64  O6 ? ? X DC  73   Y DG 81   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog144 hydrog ? ? S DC  56   O2  ? ? ? 1_555 T DG 64  N2 ? ? X DC  73   Y DG 81   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog145 hydrog ? ? S DG  57   N1  ? ? ? 1_555 T DC 63  N3 ? ? X DG  74   Y DC 80   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog146 hydrog ? ? S DG  57   N2  ? ? ? 1_555 T DC 63  O2 ? ? X DG  74   Y DC 80   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog147 hydrog ? ? S DG  57   O6  ? ? ? 1_555 T DC 63  N4 ? ? X DG  74   Y DC 80   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog148 hydrog ? ? S DC  58   N3  ? ? ? 1_555 T DG 62  N1 ? ? X DC  75   Y DG 79   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog149 hydrog ? ? S DC  58   N4  ? ? ? 1_555 T DG 62  O6 ? ? X DC  75   Y DG 79   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog150 hydrog ? ? S DC  58   O2  ? ? ? 1_555 T DG 62  N2 ? ? X DC  75   Y DG 79   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog151 hydrog ? ? S DG  59   N1  ? ? ? 1_555 T DC 61  N3 ? ? X DG  76   Y DC 78   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog152 hydrog ? ? S DG  59   N2  ? ? ? 1_555 T DC 61  O2 ? ? X DG  76   Y DC 78   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog153 hydrog ? ? S DG  59   O6  ? ? ? 1_555 T DC 61  N4 ? ? X DG  76   Y DC 78   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog154 hydrog ? ? S DC  60   N3  ? ? ? 1_555 T DG 60  N1 ? ? X DC  77   Y DG 77   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog155 hydrog ? ? S DC  60   N4  ? ? ? 1_555 T DG 60  O6 ? ? X DC  77   Y DG 77   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog156 hydrog ? ? S DC  60   O2  ? ? ? 1_555 T DG 60  N2 ? ? X DC  77   Y DG 77   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog157 hydrog ? ? S DT  61   N3  ? ? ? 1_555 T DA 59  N1 ? ? X DT  78   Y DA 76   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog158 hydrog ? ? S DT  61   O4  ? ? ? 1_555 T DA 59  N6 ? ? X DT  78   Y DA 76   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog159 hydrog ? ? S DG  62   N1  ? ? ? 1_555 T DC 58  N3 ? ? X DG  79   Y DC 75   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog160 hydrog ? ? S DG  62   N2  ? ? ? 1_555 T DC 58  O2 ? ? X DG  79   Y DC 75   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog161 hydrog ? ? S DG  62   O6  ? ? ? 1_555 T DC 58  N4 ? ? X DG  79   Y DC 75   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog162 hydrog ? ? S DT  63   N3  ? ? ? 1_555 T DA 57  N1 ? ? X DT  80   Y DA 74   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog163 hydrog ? ? S DT  63   O4  ? ? ? 1_555 T DA 57  N6 ? ? X DT  80   Y DA 74   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog164 hydrog ? ? S DC  64   N3  ? ? ? 1_555 T DG 56  N1 ? ? X DC  81   Y DG 73   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog165 hydrog ? ? S DC  64   N4  ? ? ? 1_555 T DG 56  O6 ? ? X DC  81   Y DG 73   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog166 hydrog ? ? S DC  64   O2  ? ? ? 1_555 T DG 56  N2 ? ? X DC  81   Y DG 73   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog167 hydrog ? ? S DC  65   N3  ? ? ? 1_555 T DG 55  N1 ? ? X DC  82   Y DG 72   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog168 hydrog ? ? S DC  65   N4  ? ? ? 1_555 T DG 55  O6 ? ? X DC  82   Y DG 72   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog169 hydrog ? ? S DC  65   O2  ? ? ? 1_555 T DG 55  N2 ? ? X DC  82   Y DG 72   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog170 hydrog ? ? S DC  66   N3  ? ? ? 1_555 T DG 54  N1 ? ? X DC  83   Y DG 71   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog171 hydrog ? ? S DC  66   N4  ? ? ? 1_555 T DG 54  O6 ? ? X DC  83   Y DG 71   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog172 hydrog ? ? S DC  66   O2  ? ? ? 1_555 T DG 54  N2 ? ? X DC  83   Y DG 71   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog173 hydrog ? ? S DC  67   N3  ? ? ? 1_555 T DG 53  N1 ? ? X DC  84   Y DG 70   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog174 hydrog ? ? S DC  67   N4  ? ? ? 1_555 T DG 53  O6 ? ? X DC  84   Y DG 70   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog175 hydrog ? ? S DC  67   O2  ? ? ? 1_555 T DG 53  N2 ? ? X DC  84   Y DG 70   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog176 hydrog ? ? S DC  68   N3  ? ? ? 1_555 T DG 52  N1 ? ? X DC  85   Y DG 69   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog177 hydrog ? ? S DC  68   N4  ? ? ? 1_555 T DG 52  O6 ? ? X DC  85   Y DG 69   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog178 hydrog ? ? S DC  68   O2  ? ? ? 1_555 T DG 52  N2 ? ? X DC  85   Y DG 69   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog179 hydrog ? ? S DG  69   N1  ? ? ? 1_555 T DC 51  N3 ? ? X DG  86   Y DC 68   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog180 hydrog ? ? S DG  69   N2  ? ? ? 1_555 T DC 51  O2 ? ? X DG  86   Y DC 68   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog181 hydrog ? ? S DG  69   O6  ? ? ? 1_555 T DC 51  N4 ? ? X DG  86   Y DC 68   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog182 hydrog ? ? S DC  70   N3  ? ? ? 1_555 T DG 50  N1 ? ? X DC  87   Y DG 67   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog183 hydrog ? ? S DC  70   N4  ? ? ? 1_555 T DG 50  O6 ? ? X DC  87   Y DG 67   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog184 hydrog ? ? S DC  70   O2  ? ? ? 1_555 T DG 50  N2 ? ? X DC  87   Y DG 67   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog185 hydrog ? ? S DG  71   N1  ? ? ? 1_555 T DC 49  N3 ? ? X DG  88   Y DC 66   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog186 hydrog ? ? S DG  71   N2  ? ? ? 1_555 T DC 49  O2 ? ? X DG  88   Y DC 66   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog187 hydrog ? ? S DG  71   O6  ? ? ? 1_555 T DC 49  N4 ? ? X DG  88   Y DC 66   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog188 hydrog ? ? S DT  72   N3  ? ? ? 1_555 T DA 48  N1 ? ? X DT  89   Y DA 65   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog189 hydrog ? ? S DT  72   O4  ? ? ? 1_555 T DA 48  N6 ? ? X DT  89   Y DA 65   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog190 hydrog ? ? S DT  73   N3  ? ? ? 1_555 T DA 47  N1 ? ? X DT  90   Y DA 64   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog191 hydrog ? ? S DT  73   O4  ? ? ? 1_555 T DA 47  N6 ? ? X DT  90   Y DA 64   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog192 hydrog ? ? S DT  74   N3  ? ? ? 1_555 T DA 46  N1 ? ? X DT  91   Y DA 63   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog193 hydrog ? ? S DT  74   O4  ? ? ? 1_555 T DA 46  N6 ? ? X DT  91   Y DA 63   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog194 hydrog ? ? S DT  75   N3  ? ? ? 1_555 T DA 45  N1 ? ? X DT  92   Y DA 62   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog195 hydrog ? ? S DT  75   O4  ? ? ? 1_555 T DA 45  N6 ? ? X DT  92   Y DA 62   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog196 hydrog ? ? S DA  76   N1  ? ? ? 1_555 T DT 44  N3 ? ? X DA  93   Y DT 61   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog197 hydrog ? ? S DA  76   N6  ? ? ? 1_555 T DT 44  O4 ? ? X DA  93   Y DT 61   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog198 hydrog ? ? S DA  77   N1  ? ? ? 1_555 T DT 43  N3 ? ? X DA  94   Y DT 60   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog199 hydrog ? ? S DA  77   N6  ? ? ? 1_555 T DT 43  O4 ? ? X DA  94   Y DT 60   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog200 hydrog ? ? S DC  78   N3  ? ? ? 1_555 T DG 42  N1 ? ? X DC  95   Y DG 59   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog201 hydrog ? ? S DC  78   N4  ? ? ? 1_555 T DG 42  O6 ? ? X DC  95   Y DG 59   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog202 hydrog ? ? S DC  78   O2  ? ? ? 1_555 T DG 42  N2 ? ? X DC  95   Y DG 59   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog203 hydrog ? ? S DC  79   N3  ? ? ? 1_555 T DG 41  N1 ? ? X DC  96   Y DG 58   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog204 hydrog ? ? S DC  79   N4  ? ? ? 1_555 T DG 41  O6 ? ? X DC  96   Y DG 58   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog205 hydrog ? ? S DC  79   O2  ? ? ? 1_555 T DG 41  N2 ? ? X DC  96   Y DG 58   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog206 hydrog ? ? S DG  80   N1  ? ? ? 1_555 T DC 40  N3 ? ? X DG  97   Y DC 57   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog207 hydrog ? ? S DG  80   N2  ? ? ? 1_555 T DC 40  O2 ? ? X DG  97   Y DC 57   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog208 hydrog ? ? S DG  80   O6  ? ? ? 1_555 T DC 40  N4 ? ? X DG  97   Y DC 57   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog209 hydrog ? ? S DC  81   N3  ? ? ? 1_555 T DG 39  N1 ? ? X DC  98   Y DG 56   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog210 hydrog ? ? S DC  81   N4  ? ? ? 1_555 T DG 39  O6 ? ? X DC  98   Y DG 56   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog211 hydrog ? ? S DC  81   O2  ? ? ? 1_555 T DG 39  N2 ? ? X DC  98   Y DG 56   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog212 hydrog ? ? S DC  82   N3  ? ? ? 1_555 T DG 38  N1 ? ? X DC  99   Y DG 55   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog213 hydrog ? ? S DC  82   N4  ? ? ? 1_555 T DG 38  O6 ? ? X DC  99   Y DG 55   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog214 hydrog ? ? S DC  82   O2  ? ? ? 1_555 T DG 38  N2 ? ? X DC  99   Y DG 55   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog215 hydrog ? ? S DA  83   N1  ? ? ? 1_555 T DT 37  N3 ? ? X DA  100  Y DT 54   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog216 hydrog ? ? S DA  83   N6  ? ? ? 1_555 T DT 37  O4 ? ? X DA  100  Y DT 54   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog217 hydrog ? ? S DA  84   N1  ? ? ? 1_555 T DT 36  N3 ? ? X DA  101  Y DT 53   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog218 hydrog ? ? S DA  84   N6  ? ? ? 1_555 T DT 36  O4 ? ? X DA  101  Y DT 53   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog219 hydrog ? ? S DG  85   N1  ? ? ? 1_555 T DC 35  N3 ? ? X DG  102  Y DC 52   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog220 hydrog ? ? S DG  85   N2  ? ? ? 1_555 T DC 35  O2 ? ? X DG  102  Y DC 52   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog221 hydrog ? ? S DG  85   O6  ? ? ? 1_555 T DC 35  N4 ? ? X DG  102  Y DC 52   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog222 hydrog ? ? S DG  86   N1  ? ? ? 1_555 T DC 34  N3 ? ? X DG  103  Y DC 51   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog223 hydrog ? ? S DG  86   N2  ? ? ? 1_555 T DC 34  O2 ? ? X DG  103  Y DC 51   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog224 hydrog ? ? S DG  86   O6  ? ? ? 1_555 T DC 34  N4 ? ? X DG  103  Y DC 51   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog225 hydrog ? ? S DG  87   N2  ? ? ? 1_555 T DC 33  O2 ? ? X DG  104  Y DC 50   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog226 hydrog ? ? S DG  88   N1  ? ? ? 1_555 T DC 32  N3 ? ? X DG  105  Y DC 49   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog227 hydrog ? ? S DG  88   N2  ? ? ? 1_555 T DC 32  O2 ? ? X DG  105  Y DC 49   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog228 hydrog ? ? S DG  88   O6  ? ? ? 1_555 T DC 32  N4 ? ? X DG  105  Y DC 49   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog229 hydrog ? ? S DA  89   N1  ? ? ? 1_555 T DT 31  N3 ? ? X DA  106  Y DT 48   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog230 hydrog ? ? S DT  90   N3  ? ? ? 1_555 T DA 30  N1 ? ? X DT  107  Y DA 47   1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? ? 
hydrog231 hydrog ? ? S DT  91   N3  ? ? ? 1_555 T DA 29  N1 ? ? X DT  108  Y DA 46   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog232 hydrog ? ? S DT  91   O4  ? ? ? 1_555 T DA 29  N6 ? ? X DT  108  Y DA 46   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog233 hydrog ? ? S DA  92   N1  ? ? ? 1_555 T DT 28  N3 ? ? X DA  109  Y DT 45   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog234 hydrog ? ? S DA  92   N6  ? ? ? 1_555 T DT 28  O4 ? ? X DA  109  Y DT 45   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog235 hydrog ? ? S DC  93   O2  ? ? ? 1_555 T DG 27  N2 ? ? X DC  110  Y DG 44   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog236 hydrog ? ? S DT  94   N3  ? ? ? 1_555 T DA 26  N1 ? ? X DT  111  Y DA 43   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog237 hydrog ? ? S DT  94   O4  ? ? ? 1_555 T DA 26  N6 ? ? X DT  111  Y DA 43   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog238 hydrog ? ? S DC  95   N3  ? ? ? 1_555 T DG 25  N1 ? ? X DC  112  Y DG 42   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog239 hydrog ? ? S DC  95   N4  ? ? ? 1_555 T DG 25  O6 ? ? X DC  112  Y DG 42   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog240 hydrog ? ? S DC  95   O2  ? ? ? 1_555 T DG 25  N2 ? ? X DC  112  Y DG 42   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog241 hydrog ? ? S DC  96   N3  ? ? ? 1_555 T DG 24  N2 ? ? X DC  113  Y DG 41   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog242 hydrog ? ? S DC  96   O2  ? ? ? 1_555 T DG 24  N1 ? ? X DC  113  Y DG 41   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog243 hydrog ? ? S DC  97   N3  ? ? ? 1_555 T DA 22  N6 ? ? X DC  114  Y DA 39   1_555 ? ? ? ? ? ? 'DC-DA MISPAIR'         ? ? 
hydrog244 hydrog ? ? S DC  97   O2  ? ? ? 1_555 T DG 23  N2 ? ? X DC  114  Y DG 40   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog245 hydrog ? ? S DT  98   N3  ? ? ? 1_555 T DA 22  N1 ? ? X DT  115  Y DA 39   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog246 hydrog ? ? S DT  98   O4  ? ? ? 1_555 T DA 22  N6 ? ? X DT  115  Y DA 39   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog247 hydrog ? ? S DA  99   N1  ? ? ? 1_555 T DT 21  N3 ? ? X DA  116  Y DT 38   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog248 hydrog ? ? S DG  100  N1  ? ? ? 1_555 T DA 19  N1 ? ? X DG  117  Y DA 36   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog249 hydrog ? ? S DG  100  O6  ? ? ? 1_555 T DA 19  N6 ? ? X DG  117  Y DA 36   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog250 hydrog ? ? S DT  101  N3  ? ? ? 1_555 T DA 19  N1 ? ? X DT  118  Y DA 36   1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? ? 
hydrog251 hydrog ? ? S DC  102  N3  ? ? ? 1_555 T DG 18  N2 ? ? X DC  119  Y DG 35   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog252 hydrog ? ? S DC  102  O2  ? ? ? 1_555 T DG 18  N1 ? ? X DC  119  Y DG 35   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog253 hydrog ? ? S DT  103  O2  ? ? ? 1_555 T DG 16  N2 ? ? X DT  120  Y DG 33   1_555 ? ? ? ? ? ? 'DT-DG MISPAIR'         ? ? 
hydrog254 hydrog ? ? S DC  104  O2  ? ? ? 1_555 T DG 16  N2 ? ? X DC  121  Y DG 33   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog255 hydrog ? ? S DC  105  N3  ? ? ? 1_555 T DG 15  N1 ? ? X DC  122  Y DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog256 hydrog ? ? S DC  105  N4  ? ? ? 1_555 T DG 15  O6 ? ? X DC  122  Y DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog257 hydrog ? ? S DC  105  O2  ? ? ? 1_555 T DG 15  N2 ? ? X DC  122  Y DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog258 hydrog ? ? S DG  107  N1  ? ? ? 1_555 T DC 12  N3 ? ? X DG  124  Y DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog259 hydrog ? ? S DG  107  N2  ? ? ? 1_555 T DC 12  O2 ? ? X DG  124  Y DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog260 hydrog ? ? S DG  107  O6  ? ? ? 1_555 T DC 12  N4 ? ? X DG  124  Y DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog261 hydrog ? ? S DG  107  N2  ? ? ? 1_555 T DC 13  O2 ? ? X DG  124  Y DC 30   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog262 hydrog ? ? S DG  108  N2  ? ? ? 1_555 T DC 12  O2 ? ? X DG  125  Y DC 29   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog263 hydrog ? ? S DC  109  N3  ? ? ? 1_555 T DG 11  N1 ? ? X DC  126  Y DG 28   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog264 hydrog ? ? S DC  109  N4  ? ? ? 1_555 T DG 11  O6 ? ? X DC  126  Y DG 28   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog265 hydrog ? ? S DC  109  O2  ? ? ? 1_555 T DG 11  N2 ? ? X DC  126  Y DG 28   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog266 hydrog ? ? S DA  110  N1  ? ? ? 1_555 T DT 10  N3 ? ? X DA  127  Y DT 27   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog267 hydrog ? ? S DA  110  N6  ? ? ? 1_555 T DT 10  O4 ? ? X DA  127  Y DT 27   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog268 hydrog ? ? S DC  111  N3  ? ? ? 1_555 T DG 9   N1 ? ? X DC  128  Y DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog269 hydrog ? ? S DC  111  N4  ? ? ? 1_555 T DG 9   O6 ? ? X DC  128  Y DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog270 hydrog ? ? S DC  111  O2  ? ? ? 1_555 T DG 9   N2 ? ? X DC  128  Y DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog271 hydrog ? ? S DG  112  N1  ? ? ? 1_555 T DC 8   N3 ? ? X DG  129  Y DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog272 hydrog ? ? S DG  112  N2  ? ? ? 1_555 T DC 8   O2 ? ? X DG  129  Y DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog273 hydrog ? ? S DG  112  O6  ? ? ? 1_555 T DC 8   N4 ? ? X DG  129  Y DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog274 hydrog ? ? S DT  113  N3  ? ? ? 1_555 T DA 7   N1 ? ? X DT  130  Y DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog275 hydrog ? ? S DT  113  O4  ? ? ? 1_555 T DA 7   N6 ? ? X DT  130  Y DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog276 hydrog ? ? S DG  114  N1  ? ? ? 1_555 T DC 6   N3 ? ? X DG  131  Y DC 23   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog277 hydrog ? ? S DG  114  N2  ? ? ? 1_555 T DC 6   O2 ? ? X DG  131  Y DC 23   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog278 hydrog ? ? S DG  114  O6  ? ? ? 1_555 T DC 6   N4 ? ? X DG  131  Y DC 23   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog279 hydrog ? ? S DT  115  N3  ? ? ? 1_555 T DA 5   N1 ? ? X DT  132  Y DA 22   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog280 hydrog ? ? S DT  115  O4  ? ? ? 1_555 T DA 5   N6 ? ? X DT  132  Y DA 22   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog281 hydrog ? ? S DC  116  O2  ? ? ? 1_555 T DG 4   N2 ? ? X DC  133  Y DG 21   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog282 hydrog ? ? S DG  118  N1  ? ? ? 1_555 T DC 2   O2 ? ? X DG  135  Y DC 19   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog283 hydrog ? ? S DG  118  N2  ? ? ? 1_555 T DC 2   N3 ? ? X DG  135  Y DC 19   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 4 ? 
AB4 ? 5 ? 
AB5 ? 2 ? 
AB6 ? 2 ? 
AB7 ? 3 ? 
AB8 ? 4 ? 
AB9 ? 5 ? 
AC1 ? 4 ? 
AC2 ? 2 ? 
AC3 ? 3 ? 
AC4 ? 2 ? 
AC5 ? 3 ? 
AC6 ? 2 ? 
AC7 ? 3 ? 
AC8 ? 3 ? 
AC9 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? parallel      
AA3 1 2 ? parallel      
AA4 1 2 ? parallel      
AA5 1 2 ? parallel      
AA6 1 2 ? parallel      
AA7 1 2 ? parallel      
AA8 1 2 ? parallel      
AA9 1 2 ? parallel      
AB1 1 2 ? parallel      
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? parallel      
AB3 2 3 ? parallel      
AB3 3 4 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? parallel      
AB4 4 5 ? parallel      
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? parallel      
AB9 1 2 ? anti-parallel 
AB9 2 3 ? parallel      
AB9 3 4 ? parallel      
AB9 4 5 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? parallel      
AC2 1 2 ? parallel      
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC6 1 2 ? parallel      
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 84   ? PHE A 85   ? ARG A 80   PHE A 81   
AA1 2 THR B 81   ? VAL B 82   ? THR B 80   VAL B 81   
AA2 1 THR A 119  ? ILE A 120  ? THR A 115  ILE A 116  
AA2 2 ARG B 46   ? ILE B 47   ? ARG B 45   ILE B 46   
AA3 1 LEU B 98   ? TYR B 99   ? LEU B 97   TYR B 98   
AA3 2 THR G 102  ? ILE G 103  ? THR G 101  ILE G 102  
AA4 1 ARG C 43   ? VAL C 44   ? ARG C 42   VAL C 43   
AA4 2 THR D 89   ? ILE D 90   ? THR D 85   ILE D 86   
AA5 1 ARG C 78   ? ILE C 79   ? ARG C 77   ILE C 78   
AA5 2 GLY D 54   ? ILE D 55   ? GLY D 50   ILE D 51   
AA6 1 THR C 102  ? ILE C 103  ? THR C 101  ILE C 102  
AA6 2 LEU F 98   ? TYR F 99   ? LEU F 97   TYR F 98   
AA7 1 ARG E 84   ? PHE E 85   ? ARG E 83   PHE E 84   
AA7 2 THR F 81   ? VAL F 82   ? THR F 80   VAL F 81   
AA8 1 THR E 119  ? ILE E 120  ? THR E 118  ILE E 119  
AA8 2 ARG F 46   ? ILE F 47   ? ARG F 45   ILE F 46   
AA9 1 ARG G 43   ? VAL G 44   ? ARG G 42   VAL G 43   
AA9 2 THR H 89   ? ILE H 90   ? THR H 85   ILE H 86   
AB1 1 ARG G 78   ? ILE G 79   ? ARG G 77   ILE G 78   
AB1 2 GLY H 54   ? ILE H 55   ? GLY H 50   ILE H 51   
AB2 1 LYS I 991  ? VAL I 992  ? LYS I 991  VAL I 992  
AB2 2 VAL I 1199 ? CYS I 1205 ? VAL I 1199 CYS I 1205 
AB2 3 VAL I 995  ? LYS I 997  ? VAL I 995  LYS I 997  
AB3 1 LYS I 991  ? VAL I 992  ? LYS I 991  VAL I 992  
AB3 2 VAL I 1199 ? CYS I 1205 ? VAL I 1199 CYS I 1205 
AB3 3 THR I 1170 ? ILE I 1173 ? THR I 1170 ILE I 1173 
AB3 4 VAL I 1099 ? LEU I 1100 ? VAL I 1099 LEU I 1100 
AB4 1 VAL J 24   ? PRO J 27   ? VAL J 35   PRO J 38   
AB4 2 THR J 11   ? TYR J 16   ? THR J 22   TYR J 27   
AB4 3 LEU J 3    ? ILE J 7    ? LEU J 14   ILE J 18   
AB4 4 PRO J 108  ? GLU J 113  ? PRO J 119  GLU J 124  
AB4 5 ALA J 137  ? LYS J 142  ? ALA J 148  LYS J 153  
AB5 1 ILE J 30   ? MET J 32   ? ILE J 41   MET J 43   
AB5 2 GLU J 72   ? ILE J 74   ? GLU J 83   ILE J 85   
AB6 1 LEU J 77   ? LYS J 78   ? LEU J 88   LYS J 89   
AB6 2 MET J 81   ? VAL J 82   ? MET J 92   VAL J 93   
AB7 1 TYR J 175  ? VAL J 176  ? TYR J 186  VAL J 187  
AB7 2 THR J 166  ? HIS J 172  ? THR J 177  HIS J 183  
AB7 3 VAL J 182  ? SER J 184  ? VAL J 193  SER J 195  
AB8 1 TYR J 175  ? VAL J 176  ? TYR J 186  VAL J 187  
AB8 2 THR J 166  ? HIS J 172  ? THR J 177  HIS J 183  
AB8 3 GLY J 156  ? SER J 161  ? GLY J 167  SER J 172  
AB8 4 VAL J 337  ? GLY J 341  ? VAL J 348  GLY J 352  
AB9 1 LYS K 18   ? PHE K 21   ? LYS K 18   PHE K 21   
AB9 2 LEU K 8    ? ASP K 11   ? LEU K 8    ASP K 11   
AB9 3 VAL K 103  ? GLU K 107  ? VAL K 103  GLU K 107  
AB9 4 ALA K 131  ? ILE K 136  ? ALA K 131  ILE K 136  
AB9 5 ILE K 357  ? SER K 358  ? ILE K 357  SER K 358  
AC1 1 LEU K 176  ? LEU K 178  ? LEU K 176  LEU K 178  
AC1 2 THR K 160  ? ILE K 165  ? THR K 160  ILE K 165  
AC1 3 GLY K 150  ? SER K 155  ? GLY K 150  SER K 155  
AC1 4 THR K 297  ? SER K 300  ? THR K 297  SER K 300  
AC2 1 VAL L 824  ? ILE L 826  ? VAL L 1814 ILE L 1816 
AC2 2 ILE O 424  ? ILE O 426  ? ILE O 424  ILE O 426  
AC3 1 TYR M 26   ? ILE M 28   ? TYR M 26   ILE M 28   
AC3 2 THR M 89   ? LYS M 92   ? THR M 89   LYS M 92   
AC3 3 ARG M 52   ? LEU M 54   ? ARG M 52   LEU M 54   
AC4 1 LEU M 137  ? ILE M 146  ? LEU M 186  ILE M 195  
AC4 2 GLN M 149  ? ASN M 158  ? GLN M 198  ASN M 207  
AC5 1 ARG M 212  ? VAL M 221  ? ARG M 261  VAL M 270  
AC5 2 ILE M 224  ? ASP M 233  ? ILE M 273  ASP M 282  
AC5 3 LEU M 303  ? THR M 306  ? LEU M 352  THR M 355  
AC6 1 ILE N 424  ? ILE N 426  ? ILE N 424  ILE N 426  
AC6 2 VAL O 533  ? ALA O 535  ? VAL O 533  ALA O 535  
AC7 1 SER N 437  ? HIS N 439  ? SER N 437  HIS N 439  
AC7 2 GLN R 70   ? SER R 73   ? GLN R 70   SER R 73   
AC7 3 GLY R 63   ? PRO R 64   ? GLY R 63   PRO R 64   
AC8 1 MET O 523  ? GLY O 524  ? MET O 523  GLY O 524  
AC8 2 ALA R 49   ? ASN R 52   ? ALA R 49   ASN R 52   
AC8 3 PHE R 41   ? LEU R 42   ? PHE R 41   LEU R 42   
AC9 1 THR P 309  ? THR P 311  ? THR P 309  THR P 311  
AC9 2 GLN P 294  ? LEU P 297  ? GLN P 294  LEU P 297  
AC9 3 LEU P 365  ? MET P 366  ? LEU P 365  MET P 366  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 84   ? N ARG A 80   O VAL B 82   ? O VAL B 81   
AA2 1 2 N ILE A 120  ? N ILE A 116  O ARG B 46   ? O ARG B 45   
AA3 1 2 N TYR B 99   ? N TYR B 98   O THR G 102  ? O THR G 101  
AA4 1 2 N ARG C 43   ? N ARG C 42   O ILE D 90   ? O ILE D 86   
AA5 1 2 N ILE C 79   ? N ILE C 78   O GLY D 54   ? O GLY D 50   
AA6 1 2 N THR C 102  ? N THR C 101  O TYR F 99   ? O TYR F 98   
AA7 1 2 N ARG E 84   ? N ARG E 83   O VAL F 82   ? O VAL F 81   
AA8 1 2 N ILE E 120  ? N ILE E 119  O ARG F 46   ? O ARG F 45   
AA9 1 2 N ARG G 43   ? N ARG G 42   O ILE H 90   ? O ILE H 86   
AB1 1 2 N ILE G 79   ? N ILE G 78   O GLY H 54   ? O GLY H 50   
AB2 1 2 N VAL I 992  ? N VAL I 992  O VAL I 1199 ? O VAL I 1199 
AB2 2 3 O ARG I 1203 ? O ARG I 1203 N ILE I 996  ? N ILE I 996  
AB3 1 2 N VAL I 992  ? N VAL I 992  O VAL I 1199 ? O VAL I 1199 
AB3 2 3 O LEU I 1202 ? O LEU I 1202 N ILE I 1173 ? N ILE I 1173 
AB3 3 4 O ILE I 1172 ? O ILE I 1172 N LEU I 1100 ? N LEU I 1100 
AB4 1 2 O PHE J 26   ? O PHE J 37   N VAL J 12   ? N VAL J 23   
AB4 2 3 O GLY J 15   ? O GLY J 26   N VAL J 4    ? N VAL J 15   
AB4 3 4 N LEU J 3    ? N LEU J 14   O LEU J 110  ? O LEU J 121  
AB4 4 5 N MET J 111  ? N MET J 122  O PHE J 139  ? O PHE J 150  
AB5 1 2 N ILE J 30   ? N ILE J 41   O ILE J 74   ? O ILE J 85   
AB6 1 2 N LYS J 78   ? N LYS J 89   O MET J 81   ? O MET J 92   
AB7 1 2 O TYR J 175  ? O TYR J 186  N HIS J 172  ? N HIS J 183  
AB7 2 3 N ALA J 168  ? N ALA J 179  O VAL J 182  ? O VAL J 193  
AB8 1 2 O TYR J 175  ? O TYR J 186  N HIS J 172  ? N HIS J 183  
AB8 2 3 O ILE J 169  ? O ILE J 180  N ILE J 158  ? N ILE J 169  
AB8 3 4 N LEU J 157  ? N LEU J 168  O ILE J 338  ? O ILE J 349  
AB9 1 2 O GLY K 20   ? O GLY K 20   N VAL K 9    ? N VAL K 9    
AB9 2 3 N LEU K 8    ? N LEU K 8    O LEU K 104  ? O LEU K 104  
AB9 3 4 N VAL K 103  ? N VAL K 103  O ALA K 131  ? O ALA K 131  
AB9 4 5 N MET K 132  ? N MET K 132  O ILE K 357  ? O ILE K 357  
AC1 1 2 O LEU K 178  ? O LEU K 178  N THR K 160  ? N THR K 160  
AC1 2 3 O HIS K 161  ? O HIS K 161  N ASP K 154  ? N ASP K 154  
AC1 3 4 N SER K 155  ? N SER K 155  O SER K 300  ? O SER K 300  
AC2 1 2 N LYS L 825  ? N LYS L 1815 O ILE O 426  ? O ILE O 426  
AC3 1 2 N MET M 27   ? N MET M 27   O LEU M 91   ? O LEU M 91   
AC3 2 3 O LEU M 90   ? O LEU M 90   N ARG M 53   ? N ARG M 53   
AC4 1 2 N LEU M 142  ? N LEU M 191  O ASP M 153  ? O ASP M 202  
AC5 1 2 N ILE M 215  ? N ILE M 264  O PHE M 230  ? O PHE M 279  
AC5 2 3 N SER M 225  ? N SER M 274  O GLU M 305  ? O GLU M 354  
AC6 1 2 N ILE N 424  ? N ILE N 424  O LEU O 534  ? O LEU O 534  
AC7 1 2 N VAL N 438  ? N VAL N 438  O LEU R 71   ? O LEU R 71   
AC7 2 3 O SER R 73   ? O SER R 73   N GLY R 63   ? N GLY R 63   
AC8 1 2 N GLY O 524  ? N GLY O 524  O SER R 51   ? O SER R 51   
AC8 2 3 O GLN R 50   ? O GLN R 50   N PHE R 41   ? N PHE R 41   
AC9 1 2 O GLN P 310  ? O GLN P 310  N PHE P 295  ? N PHE P 295  
AC9 2 3 N LYS P 296  ? N LYS P 296  O MET P 366  ? O MET P 366  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    L 
_struct_site.pdbx_auth_comp_id    ZN 
_struct_site.pdbx_auth_seq_id     2301 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'binding site for residue ZN L 2301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 HIS L 1029 ? HIS L 2019 . ? 1_555 ? 
2 AC1 4 HIS L 1031 ? HIS L 2021 . ? 1_555 ? 
3 AC1 4 HIS L 1100 ? HIS L 2090 . ? 1_555 ? 
4 AC1 4 CYS L 1104 ? CYS L 2094 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6LTJ 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A 1  45   ? 306.357 263.070 229.707 1.00 65.85  ? 41   GLY A N     1 
ATOM   2     C  CA    . GLY A 1  45   ? 305.972 264.310 230.355 1.00 65.85  ? 41   GLY A CA    1 
ATOM   3     C  C     . GLY A 1  45   ? 304.529 264.407 230.816 1.00 65.85  ? 41   GLY A C     1 
ATOM   4     O  O     . GLY A 1  45   ? 304.056 265.486 231.132 1.00 65.85  ? 41   GLY A O     1 
ATOM   5     N  N     . THR A 1  46   ? 303.832 263.272 230.861 1.00 65.31  ? 42   THR A N     1 
ATOM   6     C  CA    . THR A 1  46   ? 302.420 263.284 231.231 1.00 65.31  ? 42   THR A CA    1 
ATOM   7     C  C     . THR A 1  46   ? 302.229 262.884 232.688 1.00 65.31  ? 42   THR A C     1 
ATOM   8     O  O     . THR A 1  46   ? 301.296 263.358 233.355 1.00 65.31  ? 42   THR A O     1 
ATOM   9     C  CB    . THR A 1  46   ? 301.643 262.384 230.263 1.00 65.31  ? 42   THR A CB    1 
ATOM   10    O  OG1   . THR A 1  46   ? 300.751 263.188 229.487 1.00 65.31  ? 42   THR A OG1   1 
ATOM   11    C  CG2   . THR A 1  46   ? 300.843 261.283 230.950 1.00 65.31  ? 42   THR A CG2   1 
ATOM   12    N  N     . VAL A 1  47   ? 303.143 262.067 233.213 1.00 61.87  ? 43   VAL A N     1 
ATOM   13    C  CA    . VAL A 1  47   ? 303.091 261.655 234.608 1.00 61.87  ? 43   VAL A CA    1 
ATOM   14    C  C     . VAL A 1  47   ? 303.338 262.846 235.519 1.00 61.87  ? 43   VAL A C     1 
ATOM   15    O  O     . VAL A 1  47   ? 302.834 262.897 236.640 1.00 61.87  ? 43   VAL A O     1 
ATOM   16    C  CB    . VAL A 1  47   ? 304.099 260.518 234.832 1.00 61.87  ? 43   VAL A CB    1 
ATOM   17    C  CG1   . VAL A 1  47   ? 304.077 260.008 236.238 1.00 61.87  ? 43   VAL A CG1   1 
ATOM   18    C  CG2   . VAL A 1  47   ? 303.788 259.390 233.891 1.00 61.87  ? 43   VAL A CG2   1 
ATOM   19    N  N     . ALA A 1  48   ? 304.054 263.852 235.019 1.00 61.68  ? 44   ALA A N     1 
ATOM   20    C  CA    . ALA A 1  48   ? 304.208 265.104 235.746 1.00 61.68  ? 44   ALA A CA    1 
ATOM   21    C  C     . ALA A 1  48   ? 302.873 265.793 235.948 1.00 61.68  ? 44   ALA A C     1 
ATOM   22    O  O     . ALA A 1  48   ? 302.576 266.257 237.051 1.00 61.68  ? 44   ALA A O     1 
ATOM   23    C  CB    . ALA A 1  48   ? 305.162 266.032 235.006 1.00 61.68  ? 44   ALA A CB    1 
ATOM   24    N  N     . LEU A 1  49   ? 302.032 265.814 234.917 1.00 62.75  ? 45   LEU A N     1 
ATOM   25    C  CA    . LEU A 1  49   ? 300.706 266.408 235.068 1.00 62.75  ? 45   LEU A CA    1 
ATOM   26    C  C     . LEU A 1  49   ? 299.816 265.556 235.958 1.00 62.75  ? 45   LEU A C     1 
ATOM   27    O  O     . LEU A 1  49   ? 299.001 266.089 236.727 1.00 62.75  ? 45   LEU A O     1 
ATOM   28    C  CB    . LEU A 1  49   ? 300.066 266.612 233.699 1.00 62.75  ? 45   LEU A CB    1 
ATOM   29    C  CG    . LEU A 1  49   ? 300.563 267.749 232.806 1.00 62.75  ? 45   LEU A CG    1 
ATOM   30    C  CD1   . LEU A 1  49   ? 299.404 268.350 232.065 1.00 62.75  ? 45   LEU A CD1   1 
ATOM   31    C  CD2   . LEU A 1  49   ? 301.225 268.839 233.601 1.00 62.75  ? 45   LEU A CD2   1 
ATOM   32    N  N     . ARG A 1  50   ? 299.991 264.236 235.904 1.00 62.55  ? 46   ARG A N     1 
ATOM   33    C  CA    . ARG A 1  50   ? 299.203 263.367 236.767 1.00 62.55  ? 46   ARG A CA    1 
ATOM   34    C  C     . ARG A 1  50   ? 299.539 263.575 238.231 1.00 62.55  ? 46   ARG A C     1 
ATOM   35    O  O     . ARG A 1  50   ? 298.633 263.676 239.062 1.00 62.55  ? 46   ARG A O     1 
ATOM   36    C  CB    . ARG A 1  50   ? 299.404 261.912 236.385 1.00 62.55  ? 46   ARG A CB    1 
ATOM   37    C  CG    . ARG A 1  50   ? 298.941 261.624 234.998 1.00 62.55  ? 46   ARG A CG    1 
ATOM   38    C  CD    . ARG A 1  50   ? 298.577 260.185 234.851 1.00 62.55  ? 46   ARG A CD    1 
ATOM   39    N  NE    . ARG A 1  50   ? 299.604 259.344 235.434 1.00 62.55  ? 46   ARG A NE    1 
ATOM   40    C  CZ    . ARG A 1  50   ? 299.616 258.026 235.340 1.00 62.55  ? 46   ARG A CZ    1 
ATOM   41    N  NH1   . ARG A 1  50   ? 298.659 257.404 234.668 1.00 62.55  ? 46   ARG A NH1   1 
ATOM   42    N  NH2   . ARG A 1  50   ? 300.591 257.329 235.901 1.00 62.55  ? 46   ARG A NH2   1 
ATOM   43    N  N     . GLU A 1  51   ? 300.814 263.702 238.574 1.00 61.21  ? 47   GLU A N     1 
ATOM   44    C  CA    . GLU A 1  51   ? 301.080 263.912 239.985 1.00 61.21  ? 47   GLU A CA    1 
ATOM   45    C  C     . GLU A 1  51   ? 300.993 265.376 240.367 1.00 61.21  ? 47   GLU A C     1 
ATOM   46    O  O     . GLU A 1  51   ? 300.923 265.681 241.554 1.00 61.21  ? 47   GLU A O     1 
ATOM   47    C  CB    . GLU A 1  51   ? 302.412 263.314 240.418 1.00 61.21  ? 47   GLU A CB    1 
ATOM   48    C  CG    . GLU A 1  51   ? 303.613 263.684 239.641 1.00 61.21  ? 47   GLU A CG    1 
ATOM   49    C  CD    . GLU A 1  51   ? 304.718 262.669 239.832 1.00 61.21  ? 47   GLU A CD    1 
ATOM   50    O  OE1   . GLU A 1  51   ? 305.663 262.950 240.595 1.00 61.21  ? 47   GLU A OE1   1 
ATOM   51    O  OE2   . GLU A 1  51   ? 304.626 261.575 239.245 1.00 61.21  ? 47   GLU A OE2   1 
ATOM   52    N  N     . ILE A 1  52   ? 300.894 266.291 239.400 1.00 58.48  ? 48   ILE A N     1 
ATOM   53    C  CA    . ILE A 1  52   ? 300.461 267.644 239.730 1.00 58.48  ? 48   ILE A CA    1 
ATOM   54    C  C     . ILE A 1  52   ? 299.034 267.611 240.249 1.00 58.48  ? 48   ILE A C     1 
ATOM   55    O  O     . ILE A 1  52   ? 298.731 268.151 241.320 1.00 58.48  ? 48   ILE A O     1 
ATOM   56    C  CB    . ILE A 1  52   ? 300.598 268.575 238.516 1.00 58.48  ? 48   ILE A CB    1 
ATOM   57    C  CG1   . ILE A 1  52   ? 302.004 269.129 238.430 1.00 58.48  ? 48   ILE A CG1   1 
ATOM   58    C  CG2   . ILE A 1  52   ? 299.693 269.757 238.639 1.00 58.48  ? 48   ILE A CG2   1 
ATOM   59    C  CD1   . ILE A 1  52   ? 302.277 269.853 237.164 1.00 58.48  ? 48   ILE A CD1   1 
ATOM   60    N  N     . ARG A 1  53   ? 298.153 266.915 239.519 1.00 64.16  ? 49   ARG A N     1 
ATOM   61    C  CA    . ARG A 1  53   ? 296.764 266.776 239.946 1.00 64.16  ? 49   ARG A CA    1 
ATOM   62    C  C     . ARG A 1  53   ? 296.659 265.986 241.235 1.00 64.16  ? 49   ARG A C     1 
ATOM   63    O  O     . ARG A 1  53   ? 295.819 266.288 242.088 1.00 64.16  ? 49   ARG A O     1 
ATOM   64    C  CB    . ARG A 1  53   ? 295.941 266.103 238.854 1.00 64.16  ? 49   ARG A CB    1 
ATOM   65    C  CG    . ARG A 1  53   ? 295.660 267.010 237.688 1.00 64.16  ? 49   ARG A CG    1 
ATOM   66    C  CD    . ARG A 1  53   ? 294.651 266.432 236.725 1.00 64.16  ? 49   ARG A CD    1 
ATOM   67    N  NE    . ARG A 1  53   ? 294.392 267.370 235.637 1.00 64.16  ? 49   ARG A NE    1 
ATOM   68    C  CZ    . ARG A 1  53   ? 295.020 267.352 234.465 1.00 64.16  ? 49   ARG A CZ    1 
ATOM   69    N  NH1   . ARG A 1  53   ? 295.945 266.437 234.215 1.00 64.16  ? 49   ARG A NH1   1 
ATOM   70    N  NH2   . ARG A 1  53   ? 294.722 268.251 233.537 1.00 64.16  ? 49   ARG A NH2   1 
ATOM   71    N  N     . ARG A 1  54   ? 297.532 264.995 241.407 1.00 61.58  ? 50   ARG A N     1 
ATOM   72    C  CA    . ARG A 1  54   ? 297.514 264.184 242.614 1.00 61.58  ? 50   ARG A CA    1 
ATOM   73    C  C     . ARG A 1  54   ? 297.915 264.976 243.841 1.00 61.58  ? 50   ARG A C     1 
ATOM   74    O  O     . ARG A 1  54   ? 297.222 264.927 244.858 1.00 61.58  ? 50   ARG A O     1 
ATOM   75    C  CB    . ARG A 1  54   ? 298.442 262.998 242.461 1.00 61.58  ? 50   ARG A CB    1 
ATOM   76    C  CG    . ARG A 1  54   ? 297.818 261.813 241.800 1.00 61.58  ? 50   ARG A CG    1 
ATOM   77    C  CD    . ARG A 1  54   ? 298.676 260.608 242.032 1.00 61.58  ? 50   ARG A CD    1 
ATOM   78    N  NE    . ARG A 1  54   ? 299.035 260.522 243.435 1.00 61.58  ? 50   ARG A NE    1 
ATOM   79    C  CZ    . ARG A 1  54   ? 300.276 260.416 243.874 1.00 61.58  ? 50   ARG A CZ    1 
ATOM   80    N  NH1   . ARG A 1  54   ? 301.269 260.373 243.011 1.00 61.58  ? 50   ARG A NH1   1 
ATOM   81    N  NH2   . ARG A 1  54   ? 300.513 260.352 245.171 1.00 61.58  ? 50   ARG A NH2   1 
ATOM   82    N  N     . TYR A 1  55   ? 299.021 265.709 243.778 1.00 60.12  ? 51   TYR A N     1 
ATOM   83    C  CA    . TYR A 1  55   ? 299.481 266.389 244.973 1.00 60.12  ? 51   TYR A CA    1 
ATOM   84    C  C     . TYR A 1  55   ? 298.756 267.696 245.193 1.00 60.12  ? 51   TYR A C     1 
ATOM   85    O  O     . TYR A 1  55   ? 298.872 268.281 246.269 1.00 60.12  ? 51   TYR A O     1 
ATOM   86    C  CB    . TYR A 1  55   ? 300.984 266.616 244.921 1.00 60.12  ? 51   TYR A CB    1 
ATOM   87    C  CG    . TYR A 1  55   ? 301.745 265.336 245.016 1.00 60.12  ? 51   TYR A CG    1 
ATOM   88    C  CD1   . TYR A 1  55   ? 301.547 264.476 246.074 1.00 60.12  ? 51   TYR A CD1   1 
ATOM   89    C  CD2   . TYR A 1  55   ? 302.641 264.973 244.039 1.00 60.12  ? 51   TYR A CD2   1 
ATOM   90    C  CE1   . TYR A 1  55   ? 302.223 263.297 246.154 1.00 60.12  ? 51   TYR A CE1   1 
ATOM   91    C  CE2   . TYR A 1  55   ? 303.316 263.796 244.105 1.00 60.12  ? 51   TYR A CE2   1 
ATOM   92    C  CZ    . TYR A 1  55   ? 303.108 262.964 245.163 1.00 60.12  ? 51   TYR A CZ    1 
ATOM   93    O  OH    . TYR A 1  55   ? 303.798 261.786 245.222 1.00 60.12  ? 51   TYR A OH    1 
ATOM   94    N  N     . GLN A 1  56   ? 298.005 268.175 244.210 1.00 60.12  ? 52   GLN A N     1 
ATOM   95    C  CA    . GLN A 1  56   ? 297.145 269.303 244.511 1.00 60.12  ? 52   GLN A CA    1 
ATOM   96    C  C     . GLN A 1  56   ? 295.814 268.857 245.083 1.00 60.12  ? 52   GLN A C     1 
ATOM   97    O  O     . GLN A 1  56   ? 295.171 269.622 245.805 1.00 60.12  ? 52   GLN A O     1 
ATOM   98    C  CB    . GLN A 1  56   ? 296.941 270.154 243.271 1.00 60.12  ? 52   GLN A CB    1 
ATOM   99    C  CG    . GLN A 1  56   ? 297.795 271.368 243.289 1.00 60.12  ? 52   GLN A CG    1 
ATOM   100   C  CD    . GLN A 1  56   ? 297.804 272.079 241.989 1.00 60.12  ? 52   GLN A CD    1 
ATOM   101   O  OE1   . GLN A 1  56   ? 298.035 271.482 240.955 1.00 60.12  ? 52   GLN A OE1   1 
ATOM   102   N  NE2   . GLN A 1  56   ? 297.544 273.367 242.022 1.00 60.12  ? 52   GLN A NE2   1 
ATOM   103   N  N     . LYS A 1  57   ? 295.395 267.627 244.795 1.00 62.38  ? 53   LYS A N     1 
ATOM   104   C  CA    . LYS A 1  57   ? 294.168 267.120 245.386 1.00 62.38  ? 53   LYS A CA    1 
ATOM   105   C  C     . LYS A 1  57   ? 294.320 266.840 246.873 1.00 62.38  ? 53   LYS A C     1 
ATOM   106   O  O     . LYS A 1  57   ? 293.357 266.982 247.626 1.00 62.38  ? 53   LYS A O     1 
ATOM   107   C  CB    . LYS A 1  57   ? 293.730 265.850 244.672 1.00 62.38  ? 53   LYS A CB    1 
ATOM   108   C  CG    . LYS A 1  57   ? 292.803 266.072 243.509 1.00 62.38  ? 53   LYS A CG    1 
ATOM   109   C  CD    . LYS A 1  57   ? 292.544 264.763 242.799 1.00 62.38  ? 53   LYS A CD    1 
ATOM   110   C  CE    . LYS A 1  57   ? 291.379 264.864 241.846 1.00 62.38  ? 53   LYS A CE    1 
ATOM   111   N  NZ    . LYS A 1  57   ? 290.087 264.784 242.573 1.00 62.38  ? 53   LYS A NZ    1 
ATOM   112   N  N     . SER A 1  58   ? 295.505 266.436 247.315 1.00 63.32  ? 54   SER A N     1 
ATOM   113   C  CA    . SER A 1  58   ? 295.659 265.945 248.674 1.00 63.32  ? 54   SER A CA    1 
ATOM   114   C  C     . SER A 1  58   ? 296.004 267.071 249.636 1.00 63.32  ? 54   SER A C     1 
ATOM   115   O  O     . SER A 1  58   ? 296.251 268.211 249.250 1.00 63.32  ? 54   SER A O     1 
ATOM   116   C  CB    . SER A 1  58   ? 296.750 264.892 248.744 1.00 63.32  ? 54   SER A CB    1 
ATOM   117   O  OG    . SER A 1  58   ? 298.003 265.494 248.529 1.00 63.32  ? 54   SER A OG    1 
ATOM   118   N  N     . THR A 1  59   ? 296.011 266.725 250.922 1.00 63.28  ? 55   THR A N     1 
ATOM   119   C  CA    . THR A 1  59   ? 296.351 267.646 251.995 1.00 63.28  ? 55   THR A CA    1 
ATOM   120   C  C     . THR A 1  59   ? 297.517 267.164 252.832 1.00 63.28  ? 55   THR A C     1 
ATOM   121   O  O     . THR A 1  59   ? 298.043 267.939 253.634 1.00 63.28  ? 55   THR A O     1 
ATOM   122   C  CB    . THR A 1  59   ? 295.171 267.837 252.938 1.00 63.28  ? 55   THR A CB    1 
ATOM   123   O  OG1   . THR A 1  59   ? 294.983 266.631 253.678 1.00 63.28  ? 55   THR A OG1   1 
ATOM   124   C  CG2   . THR A 1  59   ? 293.926 268.120 252.180 1.00 63.28  ? 55   THR A CG2   1 
ATOM   125   N  N     . GLU A 1  60   ? 297.913 265.906 252.694 1.00 62.86  ? 56   GLU A N     1 
ATOM   126   C  CA    . GLU A 1  60   ? 298.934 265.294 253.523 1.00 62.86  ? 56   GLU A CA    1 
ATOM   127   C  C     . GLU A 1  60   ? 300.303 265.860 253.193 1.00 62.86  ? 56   GLU A C     1 
ATOM   128   O  O     . GLU A 1  60   ? 300.498 266.549 252.193 1.00 62.86  ? 56   GLU A O     1 
ATOM   129   C  CB    . GLU A 1  60   ? 298.897 263.782 253.357 1.00 62.86  ? 56   GLU A CB    1 
ATOM   130   C  CG    . GLU A 1  60   ? 298.804 263.338 251.920 1.00 62.86  ? 56   GLU A CG    1 
ATOM   131   C  CD    . GLU A 1  60   ? 300.138 263.153 251.265 1.00 62.86  ? 56   GLU A CD    1 
ATOM   132   O  OE1   . GLU A 1  60   ? 301.135 263.028 251.994 1.00 62.86  ? 56   GLU A OE1   1 
ATOM   133   O  OE2   . GLU A 1  60   ? 300.193 263.116 250.017 1.00 62.86  ? 56   GLU A OE2   1 
ATOM   134   N  N     . LEU A 1  61   ? 301.257 265.565 254.061 1.00 60.72  ? 57   LEU A N     1 
ATOM   135   C  CA    . LEU A 1  61   ? 302.535 266.253 254.039 1.00 60.72  ? 57   LEU A CA    1 
ATOM   136   C  C     . LEU A 1  61   ? 303.529 265.515 253.173 1.00 60.72  ? 57   LEU A C     1 
ATOM   137   O  O     . LEU A 1  61   ? 303.518 264.288 253.085 1.00 60.72  ? 57   LEU A O     1 
ATOM   138   C  CB    . LEU A 1  61   ? 303.096 266.388 255.443 1.00 60.72  ? 57   LEU A CB    1 
ATOM   139   C  CG    . LEU A 1  61   ? 302.099 266.972 256.427 1.00 60.72  ? 57   LEU A CG    1 
ATOM   140   C  CD1   . LEU A 1  61   ? 302.700 267.006 257.814 1.00 60.72  ? 57   LEU A CD1   1 
ATOM   141   C  CD2   . LEU A 1  61   ? 301.675 268.339 255.958 1.00 60.72  ? 57   LEU A CD2   1 
ATOM   142   N  N     . LEU A 1  62   ? 304.414 266.277 252.547 1.00 57.10  ? 58   LEU A N     1 
ATOM   143   C  CA    . LEU A 1  62   ? 305.289 265.719 251.540 1.00 57.10  ? 58   LEU A CA    1 
ATOM   144   C  C     . LEU A 1  62   ? 306.690 265.418 252.046 1.00 57.10  ? 58   LEU A C     1 
ATOM   145   O  O     . LEU A 1  62   ? 307.288 264.440 251.602 1.00 57.10  ? 58   LEU A O     1 
ATOM   146   C  CB    . LEU A 1  62   ? 305.340 266.668 250.349 1.00 57.10  ? 58   LEU A CB    1 
ATOM   147   C  CG    . LEU A 1  62   ? 303.910 267.025 249.965 1.00 57.10  ? 58   LEU A CG    1 
ATOM   148   C  CD1   . LEU A 1  62   ? 303.894 268.132 248.987 1.00 57.10  ? 58   LEU A CD1   1 
ATOM   149   C  CD2   . LEU A 1  62   ? 303.234 265.832 249.378 1.00 57.10  ? 58   LEU A CD2   1 
ATOM   150   N  N     . ILE A 1  63   ? 307.227 266.216 252.957 1.00 60.21  ? 59   ILE A N     1 
ATOM   151   C  CA    . ILE A 1  63   ? 308.446 265.826 253.644 1.00 60.21  ? 59   ILE A CA    1 
ATOM   152   C  C     . ILE A 1  63   ? 308.142 264.652 254.557 1.00 60.21  ? 59   ILE A C     1 
ATOM   153   O  O     . ILE A 1  63   ? 307.108 264.635 255.230 1.00 60.21  ? 59   ILE A O     1 
ATOM   154   C  CB    . ILE A 1  63   ? 309.011 266.995 254.456 1.00 60.21  ? 59   ILE A CB    1 
ATOM   155   C  CG1   . ILE A 1  63   ? 308.984 268.279 253.650 1.00 60.21  ? 59   ILE A CG1   1 
ATOM   156   C  CG2   . ILE A 1  63   ? 310.415 266.683 254.909 1.00 60.21  ? 59   ILE A CG2   1 
ATOM   157   C  CD1   . ILE A 1  63   ? 309.982 268.311 252.557 1.00 60.21  ? 59   ILE A CD1   1 
ATOM   158   N  N     . ARG A 1  64   ? 309.024 263.660 254.571 1.00 63.38  ? 60   ARG A N     1 
ATOM   159   C  CA    . ARG A 1  64   ? 308.932 262.615 255.574 1.00 63.38  ? 60   ARG A CA    1 
ATOM   160   C  C     . ARG A 1  64   ? 309.181 263.215 256.947 1.00 63.38  ? 60   ARG A C     1 
ATOM   161   O  O     . ARG A 1  64   ? 309.921 264.180 257.092 1.00 63.38  ? 60   ARG A O     1 
ATOM   162   C  CB    . ARG A 1  64   ? 309.941 261.516 255.281 1.00 63.38  ? 60   ARG A CB    1 
ATOM   163   C  CG    . ARG A 1  64   ? 309.751 260.789 253.993 1.00 63.38  ? 60   ARG A CG    1 
ATOM   164   C  CD    . ARG A 1  64   ? 308.627 259.831 254.097 1.00 63.38  ? 60   ARG A CD    1 
ATOM   165   N  NE    . ARG A 1  64   ? 307.427 260.418 253.539 1.00 63.38  ? 60   ARG A NE    1 
ATOM   166   C  CZ    . ARG A 1  64   ? 306.212 259.934 253.729 1.00 63.38  ? 60   ARG A CZ    1 
ATOM   167   N  NH1   . ARG A 1  64   ? 306.043 258.851 254.467 1.00 63.38  ? 60   ARG A NH1   1 
ATOM   168   N  NH2   . ARG A 1  64   ? 305.167 260.539 253.180 1.00 63.38  ? 60   ARG A NH2   1 
ATOM   169   N  N     . LYS A 1  65   ? 308.551 262.645 257.963 1.00 62.83  ? 61   LYS A N     1 
ATOM   170   C  CA    . LYS A 1  65   ? 308.453 263.365 259.220 1.00 62.83  ? 61   LYS A CA    1 
ATOM   171   C  C     . LYS A 1  65   ? 309.675 263.182 260.101 1.00 62.83  ? 61   LYS A C     1 
ATOM   172   O  O     . LYS A 1  65   ? 310.074 264.122 260.791 1.00 62.83  ? 61   LYS A O     1 
ATOM   173   C  CB    . LYS A 1  65   ? 307.184 262.946 259.945 1.00 62.83  ? 61   LYS A CB    1 
ATOM   174   C  CG    . LYS A 1  65   ? 305.950 263.385 259.192 1.00 62.83  ? 61   LYS A CG    1 
ATOM   175   C  CD    . LYS A 1  65   ? 304.696 262.656 259.605 1.00 62.83  ? 61   LYS A CD    1 
ATOM   176   C  CE    . LYS A 1  65   ? 304.282 263.007 261.007 1.00 62.83  ? 61   LYS A CE    1 
ATOM   177   N  NZ    . LYS A 1  65   ? 303.037 262.281 261.382 1.00 62.83  ? 61   LYS A NZ    1 
ATOM   178   N  N     . LEU A 1  66   ? 310.277 262.000 260.100 1.00 62.05  ? 62   LEU A N     1 
ATOM   179   C  CA    . LEU A 1  66   ? 311.536 261.806 260.813 1.00 62.05  ? 62   LEU A CA    1 
ATOM   180   C  C     . LEU A 1  66   ? 312.700 262.649 260.308 1.00 62.05  ? 62   LEU A C     1 
ATOM   181   O  O     . LEU A 1  66   ? 313.413 263.197 261.154 1.00 62.05  ? 62   LEU A O     1 
ATOM   182   C  CB    . LEU A 1  66   ? 311.945 260.337 260.817 1.00 62.05  ? 62   LEU A CB    1 
ATOM   183   C  CG    . LEU A 1  66   ? 311.646 259.496 262.038 1.00 62.05  ? 62   LEU A CG    1 
ATOM   184   C  CD1   . LEU A 1  66   ? 312.432 260.077 263.163 1.00 62.05  ? 62   LEU A CD1   1 
ATOM   185   C  CD2   . LEU A 1  66   ? 310.192 259.499 262.364 1.00 62.05  ? 62   LEU A CD2   1 
ATOM   186   N  N     . PRO A 1  67   ? 312.980 262.778 259.003 1.00 59.93  ? 63   PRO A N     1 
ATOM   187   C  CA    . PRO A 1  67   ? 314.120 263.616 258.632 1.00 59.93  ? 63   PRO A CA    1 
ATOM   188   C  C     . PRO A 1  67   ? 313.883 265.074 258.879 1.00 59.93  ? 63   PRO A C     1 
ATOM   189   O  O     . PRO A 1  67   ? 314.827 265.800 259.191 1.00 59.93  ? 63   PRO A O     1 
ATOM   190   C  CB    . PRO A 1  67   ? 314.280 263.336 257.142 1.00 59.93  ? 63   PRO A CB    1 
ATOM   191   C  CG    . PRO A 1  67   ? 313.628 262.106 256.934 1.00 59.93  ? 63   PRO A CG    1 
ATOM   192   C  CD    . PRO A 1  67   ? 312.461 262.152 257.790 1.00 59.93  ? 63   PRO A CD    1 
ATOM   193   N  N     . PHE A 1  68   ? 312.640 265.521 258.779 1.00 60.23  ? 64   PHE A N     1 
ATOM   194   C  CA    . PHE A 1  68   ? 312.342 266.898 259.113 1.00 60.23  ? 64   PHE A CA    1 
ATOM   195   C  C     . PHE A 1  68   ? 312.509 267.139 260.592 1.00 60.23  ? 64   PHE A C     1 
ATOM   196   O  O     . PHE A 1  68   ? 312.971 268.206 261.002 1.00 60.23  ? 64   PHE A O     1 
ATOM   197   C  CB    . PHE A 1  68   ? 310.935 267.253 258.697 1.00 60.23  ? 64   PHE A CB    1 
ATOM   198   C  CG    . PHE A 1  68   ? 310.676 268.700 258.711 1.00 60.23  ? 64   PHE A CG    1 
ATOM   199   C  CD1   . PHE A 1  68   ? 310.990 269.463 257.623 1.00 60.23  ? 64   PHE A CD1   1 
ATOM   200   C  CD2   . PHE A 1  68   ? 310.135 269.307 259.812 1.00 60.23  ? 64   PHE A CD2   1 
ATOM   201   C  CE1   . PHE A 1  68   ? 310.764 270.796 257.632 1.00 60.23  ? 64   PHE A CE1   1 
ATOM   202   C  CE2   . PHE A 1  68   ? 309.923 270.633 259.830 1.00 60.23  ? 64   PHE A CE2   1 
ATOM   203   C  CZ    . PHE A 1  68   ? 310.227 271.380 258.737 1.00 60.23  ? 64   PHE A CZ    1 
ATOM   204   N  N     . GLN A 1  69   ? 312.112 266.170 261.406 1.00 59.99  ? 65   GLN A N     1 
ATOM   205   C  CA    . GLN A 1  69   ? 312.310 266.282 262.838 1.00 59.99  ? 65   GLN A CA    1 
ATOM   206   C  C     . GLN A 1  69   ? 313.782 266.378 263.170 1.00 59.99  ? 65   GLN A C     1 
ATOM   207   O  O     . GLN A 1  69   ? 314.196 267.255 263.927 1.00 59.99  ? 65   GLN A O     1 
ATOM   208   C  CB    . GLN A 1  69   ? 311.679 265.088 263.520 1.00 59.99  ? 65   GLN A CB    1 
ATOM   209   C  CG    . GLN A 1  69   ? 312.074 264.924 264.918 1.00 59.99  ? 65   GLN A CG    1 
ATOM   210   C  CD    . GLN A 1  69   ? 311.184 263.950 265.609 1.00 59.99  ? 65   GLN A CD    1 
ATOM   211   O  OE1   . GLN A 1  69   ? 311.007 262.828 265.151 1.00 59.99  ? 65   GLN A OE1   1 
ATOM   212   N  NE2   . GLN A 1  69   ? 310.600 264.369 266.718 1.00 59.99  ? 65   GLN A NE2   1 
ATOM   213   N  N     . ARG A 1  70   ? 314.598 265.546 262.536 1.00 60.82  ? 66   ARG A N     1 
ATOM   214   C  CA    . ARG A 1  70   ? 316.026 265.569 262.816 1.00 60.82  ? 66   ARG A CA    1 
ATOM   215   C  C     . ARG A 1  70   ? 316.679 266.841 262.307 1.00 60.82  ? 66   ARG A C     1 
ATOM   216   O  O     . ARG A 1  70   ? 317.619 267.349 262.927 1.00 60.82  ? 66   ARG A O     1 
ATOM   217   C  CB    . ARG A 1  70   ? 316.691 264.357 262.203 1.00 60.82  ? 66   ARG A CB    1 
ATOM   218   C  CG    . ARG A 1  70   ? 316.437 263.128 262.983 1.00 60.82  ? 66   ARG A CG    1 
ATOM   219   C  CD    . ARG A 1  70   ? 317.338 262.041 262.532 1.00 60.82  ? 66   ARG A CD    1 
ATOM   220   N  NE    . ARG A 1  70   ? 316.703 261.231 261.518 1.00 60.82  ? 66   ARG A NE    1 
ATOM   221   C  CZ    . ARG A 1  70   ? 316.951 261.352 260.229 1.00 60.82  ? 66   ARG A CZ    1 
ATOM   222   N  NH1   . ARG A 1  70   ? 317.816 262.252 259.812 1.00 60.82  ? 66   ARG A NH1   1 
ATOM   223   N  NH2   . ARG A 1  70   ? 316.339 260.572 259.360 1.00 60.82  ? 66   ARG A NH2   1 
ATOM   224   N  N     . LEU A 1  71   ? 316.178 267.389 261.206 1.00 60.08  ? 67   LEU A N     1 
ATOM   225   C  CA    . LEU A 1  71   ? 316.692 268.661 260.714 1.00 60.08  ? 67   LEU A CA    1 
ATOM   226   C  C     . LEU A 1  71   ? 316.391 269.783 261.686 1.00 60.08  ? 67   LEU A C     1 
ATOM   227   O  O     . LEU A 1  71   ? 317.276 270.586 262.007 1.00 60.08  ? 67   LEU A O     1 
ATOM   228   C  CB    . LEU A 1  71   ? 316.094 268.976 259.356 1.00 60.08  ? 67   LEU A CB    1 
ATOM   229   C  CG    . LEU A 1  71   ? 316.365 270.405 258.944 1.00 60.08  ? 67   LEU A CG    1 
ATOM   230   C  CD1   . LEU A 1  71   ? 317.771 270.493 258.475 1.00 60.08  ? 67   LEU A CD1   1 
ATOM   231   C  CD2   . LEU A 1  71   ? 315.421 270.876 257.905 1.00 60.08  ? 67   LEU A CD2   1 
ATOM   232   N  N     . VAL A 1  72   ? 315.157 269.836 262.181 1.00 60.57  ? 68   VAL A N     1 
ATOM   233   C  CA    . VAL A 1  72   ? 314.765 270.850 263.148 1.00 60.57  ? 68   VAL A CA    1 
ATOM   234   C  C     . VAL A 1  72   ? 315.592 270.743 264.417 1.00 60.57  ? 68   VAL A C     1 
ATOM   235   O  O     . VAL A 1  72   ? 316.020 271.760 264.976 1.00 60.57  ? 68   VAL A O     1 
ATOM   236   C  CB    . VAL A 1  72   ? 313.262 270.726 263.419 1.00 60.57  ? 68   VAL A CB    1 
ATOM   237   C  CG1   . VAL A 1  72   ? 312.857 271.492 264.618 1.00 60.57  ? 68   VAL A CG1   1 
ATOM   238   C  CG2   . VAL A 1  72   ? 312.523 271.262 262.259 1.00 60.57  ? 68   VAL A CG2   1 
ATOM   239   N  N     . ARG A 1  73   ? 315.916 269.526 264.840 1.00 64.48  ? 69   ARG A N     1 
ATOM   240   C  CA    . ARG A 1  73   ? 316.752 269.401 266.026 1.00 64.48  ? 69   ARG A CA    1 
ATOM   241   C  C     . ARG A 1  73   ? 318.185 269.803 265.741 1.00 64.48  ? 69   ARG A C     1 
ATOM   242   O  O     . ARG A 1  73   ? 318.862 270.326 266.626 1.00 64.48  ? 69   ARG A O     1 
ATOM   243   C  CB    . ARG A 1  73   ? 316.689 267.994 266.580 1.00 64.48  ? 69   ARG A CB    1 
ATOM   244   C  CG    . ARG A 1  73   ? 315.296 267.630 266.864 1.00 64.48  ? 69   ARG A CG    1 
ATOM   245   C  CD    . ARG A 1  73   ? 315.124 266.768 268.026 1.00 64.48  ? 69   ARG A CD    1 
ATOM   246   N  NE    . ARG A 1  73   ? 313.713 266.479 268.145 1.00 64.48  ? 69   ARG A NE    1 
ATOM   247   C  CZ    . ARG A 1  73   ? 313.159 265.977 269.228 1.00 64.48  ? 69   ARG A CZ    1 
ATOM   248   N  NH1   . ARG A 1  73   ? 313.903 265.751 270.290 1.00 64.48  ? 69   ARG A NH1   1 
ATOM   249   N  NH2   . ARG A 1  73   ? 311.862 265.732 269.255 1.00 64.48  ? 69   ARG A NH2   1 
ATOM   250   N  N     . GLU A 1  74   ? 318.647 269.622 264.507 1.00 65.89  ? 70   GLU A N     1 
ATOM   251   C  CA    . GLU A 1  74   ? 319.987 270.077 264.162 1.00 65.89  ? 70   GLU A CA    1 
ATOM   252   C  C     . GLU A 1  74   ? 320.084 271.592 264.193 1.00 65.89  ? 70   GLU A C     1 
ATOM   253   O  O     . GLU A 1  74   ? 321.034 272.151 264.754 1.00 65.89  ? 70   GLU A O     1 
ATOM   254   C  CB    . GLU A 1  74   ? 320.378 269.549 262.792 1.00 65.89  ? 70   GLU A CB    1 
ATOM   255   C  CG    . GLU A 1  74   ? 321.655 270.138 262.268 1.00 65.89  ? 70   GLU A CG    1 
ATOM   256   C  CD    . GLU A 1  74   ? 322.065 269.580 260.926 1.00 65.89  ? 70   GLU A CD    1 
ATOM   257   O  OE1   . GLU A 1  74   ? 321.717 270.192 259.896 1.00 65.89  ? 70   GLU A OE1   1 
ATOM   258   O  OE2   . GLU A 1  74   ? 322.747 268.539 260.902 1.00 65.89  ? 70   GLU A OE2   1 
ATOM   259   N  N     . ILE A 1  75   ? 319.093 272.274 263.625 1.00 63.52  ? 71   ILE A N     1 
ATOM   260   C  CA    . ILE A 1  75   ? 319.092 273.735 263.630 1.00 63.52  ? 71   ILE A CA    1 
ATOM   261   C  C     . ILE A 1  75   ? 318.973 274.264 265.053 1.00 63.52  ? 71   ILE A C     1 
ATOM   262   O  O     . ILE A 1  75   ? 319.650 275.221 265.445 1.00 63.52  ? 71   ILE A O     1 
ATOM   263   C  CB    . ILE A 1  75   ? 317.961 274.274 262.741 1.00 63.52  ? 71   ILE A CB    1 
ATOM   264   C  CG1   . ILE A 1  75   ? 317.994 273.651 261.362 1.00 63.52  ? 71   ILE A CG1   1 
ATOM   265   C  CG2   . ILE A 1  75   ? 318.103 275.736 262.584 1.00 63.52  ? 71   ILE A CG2   1 
ATOM   266   C  CD1   . ILE A 1  75   ? 319.241 273.890 260.617 1.00 63.52  ? 71   ILE A CD1   1 
ATOM   267   N  N     . ALA A 1  76   ? 318.140 273.629 265.860 1.00 67.15  ? 72   ALA A N     1 
ATOM   268   C  CA    . ALA A 1  76   ? 317.953 274.135 267.203 1.00 67.15  ? 72   ALA A CA    1 
ATOM   269   C  C     . ALA A 1  76   ? 319.139 273.853 268.103 1.00 67.15  ? 72   ALA A C     1 
ATOM   270   O  O     . ALA A 1  76   ? 319.414 274.649 269.000 1.00 67.15  ? 72   ALA A O     1 
ATOM   271   C  CB    . ALA A 1  76   ? 316.703 273.542 267.812 1.00 67.15  ? 72   ALA A CB    1 
ATOM   272   N  N     . GLN A 1  77   ? 319.869 272.760 267.884 1.00 69.38  ? 73   GLN A N     1 
ATOM   273   C  CA    . GLN A 1  77   ? 321.064 272.565 268.689 1.00 69.38  ? 73   GLN A CA    1 
ATOM   274   C  C     . GLN A 1  77   ? 322.165 273.493 268.236 1.00 69.38  ? 73   GLN A C     1 
ATOM   275   O  O     . GLN A 1  77   ? 323.139 273.685 268.960 1.00 69.38  ? 73   GLN A O     1 
ATOM   276   C  CB    . GLN A 1  77   ? 321.552 271.124 268.634 1.00 69.38  ? 73   GLN A CB    1 
ATOM   277   C  CG    . GLN A 1  77   ? 322.321 270.773 267.394 1.00 69.38  ? 73   GLN A CG    1 
ATOM   278   C  CD    . GLN A 1  77   ? 322.644 269.305 267.308 1.00 69.38  ? 73   GLN A CD    1 
ATOM   279   O  OE1   . GLN A 1  77   ? 322.284 268.529 268.188 1.00 69.38  ? 73   GLN A OE1   1 
ATOM   280   N  NE2   . GLN A 1  77   ? 323.335 268.913 266.245 1.00 69.38  ? 73   GLN A NE2   1 
ATOM   281   N  N     . ASP A 1  78   ? 322.041 274.068 267.042 1.00 70.57  ? 74   ASP A N     1 
ATOM   282   C  CA    . ASP A 1  78   ? 322.916 275.180 266.708 1.00 70.57  ? 74   ASP A CA    1 
ATOM   283   C  C     . ASP A 1  78   ? 322.586 276.421 267.524 1.00 70.57  ? 74   ASP A C     1 
ATOM   284   O  O     . ASP A 1  78   ? 323.491 277.145 267.943 1.00 70.57  ? 74   ASP A O     1 
ATOM   285   C  CB    . ASP A 1  78   ? 322.840 275.491 265.221 1.00 70.57  ? 74   ASP A CB    1 
ATOM   286   C  CG    . ASP A 1  78   ? 324.186 275.668 264.609 1.00 70.57  ? 74   ASP A CG    1 
ATOM   287   O  OD1   . ASP A 1  78   ? 324.856 276.660 264.942 1.00 70.57  ? 74   ASP A OD1   1 
ATOM   288   O  OD2   . ASP A 1  78   ? 324.581 274.810 263.802 1.00 70.57  ? 74   ASP A OD2   1 
ATOM   289   N  N     . PHE A 1  79   ? 321.307 276.696 267.759 1.00 67.24  ? 75   PHE A N     1 
ATOM   290   C  CA    . PHE A 1  79   ? 321.036 277.905 268.529 1.00 67.24  ? 75   PHE A CA    1 
ATOM   291   C  C     . PHE A 1  79   ? 321.205 277.691 270.024 1.00 67.24  ? 75   PHE A C     1 
ATOM   292   O  O     . PHE A 1  79   ? 322.082 278.299 270.637 1.00 67.24  ? 75   PHE A O     1 
ATOM   293   C  CB    . PHE A 1  79   ? 319.634 278.420 268.236 1.00 67.24  ? 75   PHE A CB    1 
ATOM   294   C  CG    . PHE A 1  79   ? 319.505 279.013 266.893 1.00 67.24  ? 75   PHE A CG    1 
ATOM   295   C  CD1   . PHE A 1  79   ? 320.012 280.258 266.632 1.00 67.24  ? 75   PHE A CD1   1 
ATOM   296   C  CD2   . PHE A 1  79   ? 318.910 278.313 265.878 1.00 67.24  ? 75   PHE A CD2   1 
ATOM   297   C  CE1   . PHE A 1  79   ? 319.911 280.802 265.380 1.00 67.24  ? 75   PHE A CE1   1 
ATOM   298   C  CE2   . PHE A 1  79   ? 318.807 278.847 264.629 1.00 67.24  ? 75   PHE A CE2   1 
ATOM   299   C  CZ    . PHE A 1  79   ? 319.308 280.093 264.380 1.00 67.24  ? 75   PHE A CZ    1 
ATOM   300   N  N     . LYS A 1  80   ? 320.393 276.832 270.626 1.00 69.56  ? 76   LYS A N     1 
ATOM   301   C  CA    . LYS A 1  80   ? 320.466 276.613 272.065 1.00 69.56  ? 76   LYS A CA    1 
ATOM   302   C  C     . LYS A 1  80   ? 320.480 275.119 272.304 1.00 69.56  ? 76   LYS A C     1 
ATOM   303   O  O     . LYS A 1  80   ? 319.548 274.421 271.905 1.00 69.56  ? 76   LYS A O     1 
ATOM   304   C  CB    . LYS A 1  80   ? 319.298 277.274 272.783 1.00 69.56  ? 76   LYS A CB    1 
ATOM   305   C  CG    . LYS A 1  80   ? 318.933 276.669 274.122 1.00 69.56  ? 76   LYS A CG    1 
ATOM   306   C  CD    . LYS A 1  80   ? 319.857 277.102 275.237 1.00 69.56  ? 76   LYS A CD    1 
ATOM   307   C  CE    . LYS A 1  80   ? 319.333 276.629 276.588 1.00 69.56  ? 76   LYS A CE    1 
ATOM   308   N  NZ    . LYS A 1  80   ? 319.912 277.395 277.725 1.00 69.56  ? 76   LYS A NZ    1 
ATOM   309   N  N     . THR A 1  81   ? 321.542 274.632 272.920 1.00 72.61  ? 77   THR A N     1 
ATOM   310   C  CA    . THR A 1  81   ? 321.767 273.203 273.023 1.00 72.61  ? 77   THR A CA    1 
ATOM   311   C  C     . THR A 1  81   ? 320.859 272.589 274.081 1.00 72.61  ? 77   THR A C     1 
ATOM   312   O  O     . THR A 1  81   ? 320.409 273.266 275.006 1.00 72.61  ? 77   THR A O     1 
ATOM   313   C  CB    . THR A 1  81   ? 323.260 272.948 273.287 1.00 72.61  ? 77   THR A CB    1 
ATOM   314   O  OG1   . THR A 1  81   ? 323.816 272.136 272.242 1.00 72.61  ? 77   THR A OG1   1 
ATOM   315   C  CG2   . THR A 1  81   ? 323.561 272.354 274.664 1.00 72.61  ? 77   THR A CG2   1 
ATOM   316   N  N     . ASP A 1  82   ? 320.551 271.299 273.880 1.00 75.70  ? 78   ASP A N     1 
ATOM   317   C  CA    . ASP A 1  82   ? 319.756 270.467 274.788 1.00 75.70  ? 78   ASP A CA    1 
ATOM   318   C  C     . ASP A 1  82   ? 318.357 271.045 274.983 1.00 75.70  ? 78   ASP A C     1 
ATOM   319   O  O     . ASP A 1  82   ? 317.961 271.462 276.065 1.00 75.70  ? 78   ASP A O     1 
ATOM   320   C  CB    . ASP A 1  82   ? 320.467 270.254 276.125 1.00 75.70  ? 78   ASP A CB    1 
ATOM   321   C  CG    . ASP A 1  82   ? 321.421 269.083 276.091 1.00 75.70  ? 78   ASP A CG    1 
ATOM   322   O  OD1   . ASP A 1  82   ? 321.671 268.552 274.995 1.00 75.70  ? 78   ASP A OD1   1 
ATOM   323   O  OD2   . ASP A 1  82   ? 321.913 268.678 277.158 1.00 75.70  ? 78   ASP A OD2   1 
ATOM   324   N  N     . LEU A 1  83   ? 317.624 271.060 273.888 1.00 70.18  ? 79   LEU A N     1 
ATOM   325   C  CA    . LEU A 1  83   ? 316.302 271.641 273.824 1.00 70.18  ? 79   LEU A CA    1 
ATOM   326   C  C     . LEU A 1  83   ? 315.323 270.537 273.481 1.00 70.18  ? 79   LEU A C     1 
ATOM   327   O  O     . LEU A 1  83   ? 315.559 269.769 272.548 1.00 70.18  ? 79   LEU A O     1 
ATOM   328   C  CB    . LEU A 1  83   ? 316.273 272.735 272.774 1.00 70.18  ? 79   LEU A CB    1 
ATOM   329   C  CG    . LEU A 1  83   ? 315.295 273.868 272.970 1.00 70.18  ? 79   LEU A CG    1 
ATOM   330   C  CD1   . LEU A 1  83   ? 315.313 274.346 274.383 1.00 70.18  ? 79   LEU A CD1   1 
ATOM   331   C  CD2   . LEU A 1  83   ? 315.731 274.962 272.073 1.00 70.18  ? 79   LEU A CD2   1 
ATOM   332   N  N     . ARG A 1  84   ? 314.253 270.431 274.245 1.00 72.43  ? 80   ARG A N     1 
ATOM   333   C  CA    . ARG A 1  84   ? 313.216 269.460 273.953 1.00 72.43  ? 80   ARG A CA    1 
ATOM   334   C  C     . ARG A 1  84   ? 312.223 270.101 273.014 1.00 72.43  ? 80   ARG A C     1 
ATOM   335   O  O     . ARG A 1  84   ? 312.012 271.310 273.066 1.00 72.43  ? 80   ARG A O     1 
ATOM   336   C  CB    . ARG A 1  84   ? 312.535 268.995 275.227 1.00 72.43  ? 80   ARG A CB    1 
ATOM   337   C  CG    . ARG A 1  84   ? 313.484 268.306 276.126 1.00 72.43  ? 80   ARG A CG    1 
ATOM   338   C  CD    . ARG A 1  84   ? 312.820 267.845 277.379 1.00 72.43  ? 80   ARG A CD    1 
ATOM   339   N  NE    . ARG A 1  84   ? 312.505 266.423 277.410 1.00 72.43  ? 80   ARG A NE    1 
ATOM   340   C  CZ    . ARG A 1  84   ? 313.390 265.447 277.569 1.00 72.43  ? 80   ARG A CZ    1 
ATOM   341   N  NH1   . ARG A 1  84   ? 314.683 265.703 277.704 1.00 72.43  ? 80   ARG A NH1   1 
ATOM   342   N  NH2   . ARG A 1  84   ? 312.977 264.192 277.594 1.00 72.43  ? 80   ARG A NH2   1 
ATOM   343   N  N     . PHE A 1  85   ? 311.634 269.307 272.144 1.00 66.65  ? 81   PHE A N     1 
ATOM   344   C  CA    . PHE A 1  85   ? 310.636 269.808 271.226 1.00 66.65  ? 81   PHE A CA    1 
ATOM   345   C  C     . PHE A 1  85   ? 309.319 269.119 271.466 1.00 66.65  ? 81   PHE A C     1 
ATOM   346   O  O     . PHE A 1  85   ? 309.237 267.893 271.445 1.00 66.65  ? 81   PHE A O     1 
ATOM   347   C  CB    . PHE A 1  85   ? 311.054 269.582 269.797 1.00 66.65  ? 81   PHE A CB    1 
ATOM   348   C  CG    . PHE A 1  85   ? 311.810 270.689 269.238 1.00 66.65  ? 81   PHE A CG    1 
ATOM   349   C  CD1   . PHE A 1  85   ? 313.134 270.830 269.533 1.00 66.65  ? 81   PHE A CD1   1 
ATOM   350   C  CD2   . PHE A 1  85   ? 311.197 271.599 268.426 1.00 66.65  ? 81   PHE A CD2   1 
ATOM   351   C  CE1   . PHE A 1  85   ? 313.836 271.849 269.022 1.00 66.65  ? 81   PHE A CE1   1 
ATOM   352   C  CE2   . PHE A 1  85   ? 311.894 272.625 267.911 1.00 66.65  ? 81   PHE A CE2   1 
ATOM   353   C  CZ    . PHE A 1  85   ? 313.220 272.752 268.206 1.00 66.65  ? 81   PHE A CZ    1 
ATOM   354   N  N     . GLN A 1  86   ? 308.296 269.913 271.698 1.00 64.11  ? 82   GLN A N     1 
ATOM   355   C  CA    . GLN A 1  86   ? 306.940 269.420 271.721 1.00 64.11  ? 82   GLN A CA    1 
ATOM   356   C  C     . GLN A 1  86   ? 306.608 268.851 270.352 1.00 64.11  ? 82   GLN A C     1 
ATOM   357   O  O     . GLN A 1  86   ? 307.045 269.378 269.332 1.00 64.11  ? 82   GLN A O     1 
ATOM   358   C  CB    . GLN A 1  86   ? 306.005 270.557 272.085 1.00 64.11  ? 82   GLN A CB    1 
ATOM   359   C  CG    . GLN A 1  86   ? 304.605 270.179 272.290 1.00 64.11  ? 82   GLN A CG    1 
ATOM   360   C  CD    . GLN A 1  86   ? 303.974 271.085 273.274 1.00 64.11  ? 82   GLN A CD    1 
ATOM   361   O  OE1   . GLN A 1  86   ? 304.560 271.380 274.303 1.00 64.11  ? 82   GLN A OE1   1 
ATOM   362   N  NE2   . GLN A 1  86   ? 302.781 271.555 272.972 1.00 64.11  ? 82   GLN A NE2   1 
ATOM   363   N  N     . SER A 1  87   ? 305.893 267.732 270.341 1.00 64.23  ? 83   SER A N     1 
ATOM   364   C  CA    . SER A 1  87   ? 305.604 267.046 269.090 1.00 64.23  ? 83   SER A CA    1 
ATOM   365   C  C     . SER A 1  87   ? 304.711 267.879 268.194 1.00 64.23  ? 83   SER A C     1 
ATOM   366   O  O     . SER A 1  87   ? 304.844 267.843 266.966 1.00 64.23  ? 83   SER A O     1 
ATOM   367   C  CB    . SER A 1  87   ? 304.937 265.717 269.380 1.00 64.23  ? 83   SER A CB    1 
ATOM   368   O  OG    . SER A 1  87   ? 303.564 265.808 269.071 1.00 64.23  ? 83   SER A OG    1 
ATOM   369   N  N     . ALA A 1  88   ? 303.815 268.653 268.791 1.00 61.19  ? 84   ALA A N     1 
ATOM   370   C  CA    . ALA A 1  88   ? 303.004 269.569 268.015 1.00 61.19  ? 84   ALA A CA    1 
ATOM   371   C  C     . ALA A 1  88   ? 303.843 270.682 267.417 1.00 61.19  ? 84   ALA A C     1 
ATOM   372   O  O     . ALA A 1  88   ? 303.474 271.237 266.386 1.00 61.19  ? 84   ALA A O     1 
ATOM   373   C  CB    . ALA A 1  88   ? 301.896 270.145 268.884 1.00 61.19  ? 84   ALA A CB    1 
ATOM   374   N  N     . ALA A 1  89   ? 304.991 270.993 268.015 1.00 59.85  ? 85   ALA A N     1 
ATOM   375   C  CA    . ALA A 1  89   ? 305.813 272.064 267.470 1.00 59.85  ? 85   ALA A CA    1 
ATOM   376   C  C     . ALA A 1  89   ? 306.514 271.633 266.206 1.00 59.85  ? 85   ALA A C     1 
ATOM   377   O  O     . ALA A 1  89   ? 306.637 272.418 265.266 1.00 59.85  ? 85   ALA A O     1 
ATOM   378   C  CB    . ALA A 1  89   ? 306.835 272.533 268.487 1.00 59.85  ? 85   ALA A CB    1 
ATOM   379   N  N     . ILE A 1  90   ? 306.980 270.394 266.152 1.00 58.16  ? 86   ILE A N     1 
ATOM   380   C  CA    . ILE A 1  90   ? 307.583 269.905 264.923 1.00 58.16  ? 86   ILE A CA    1 
ATOM   381   C  C     . ILE A 1  90   ? 306.527 269.741 263.848 1.00 58.16  ? 86   ILE A C     1 
ATOM   382   O  O     . ILE A 1  90   ? 306.774 270.030 262.672 1.00 58.16  ? 86   ILE A O     1 
ATOM   383   C  CB    . ILE A 1  90   ? 308.336 268.601 265.204 1.00 58.16  ? 86   ILE A CB    1 
ATOM   384   C  CG1   . ILE A 1  90   ? 309.489 268.908 266.134 1.00 58.16  ? 86   ILE A CG1   1 
ATOM   385   C  CG2   . ILE A 1  90   ? 308.859 267.994 263.947 1.00 58.16  ? 86   ILE A CG2   1 
ATOM   386   C  CD1   . ILE A 1  90   ? 310.174 267.706 266.647 1.00 58.16  ? 86   ILE A CD1   1 
ATOM   387   N  N     . GLY A 1  91   ? 305.319 269.333 264.246 1.00 57.67  ? 87   GLY A N     1 
ATOM   388   C  CA    . GLY A 1  91   ? 304.204 269.335 263.316 1.00 57.67  ? 87   GLY A CA    1 
ATOM   389   C  C     . GLY A 1  91   ? 303.932 270.711 262.745 1.00 57.67  ? 87   GLY A C     1 
ATOM   390   O  O     . GLY A 1  91   ? 303.782 270.863 261.536 1.00 57.67  ? 87   GLY A O     1 
ATOM   391   N  N     . ALA A 1  92   ? 303.978 271.737 263.592 1.00 58.59  ? 88   ALA A N     1 
ATOM   392   C  CA    . ALA A 1  92   ? 303.694 273.098 263.149 1.00 58.59  ? 88   ALA A CA    1 
ATOM   393   C  C     . ALA A 1  92   ? 304.782 273.628 262.234 1.00 58.59  ? 88   ALA A C     1 
ATOM   394   O  O     . ALA A 1  92   ? 304.500 274.310 261.244 1.00 58.59  ? 88   ALA A O     1 
ATOM   395   C  CB    . ALA A 1  92   ? 303.541 274.011 264.356 1.00 58.59  ? 88   ALA A CB    1 
ATOM   396   N  N     . LEU A 1  93   ? 306.032 273.316 262.555 1.00 58.35  ? 89   LEU A N     1 
ATOM   397   C  CA    . LEU A 1  93   ? 307.137 273.717 261.702 1.00 58.35  ? 89   LEU A CA    1 
ATOM   398   C  C     . LEU A 1  93   ? 307.063 273.036 260.359 1.00 58.35  ? 89   LEU A C     1 
ATOM   399   O  O     . LEU A 1  93   ? 307.416 273.629 259.341 1.00 58.35  ? 89   LEU A O     1 
ATOM   400   C  CB    . LEU A 1  93   ? 308.451 273.382 262.370 1.00 58.35  ? 89   LEU A CB    1 
ATOM   401   C  CG    . LEU A 1  93   ? 308.948 274.504 263.244 1.00 58.35  ? 89   LEU A CG    1 
ATOM   402   C  CD1   . LEU A 1  93   ? 310.035 273.996 264.125 1.00 58.35  ? 89   LEU A CD1   1 
ATOM   403   C  CD2   . LEU A 1  93   ? 309.450 275.601 262.367 1.00 58.35  ? 89   LEU A CD2   1 
ATOM   404   N  N     . GLN A 1  94   ? 306.574 271.803 260.329 1.00 60.14  ? 90   GLN A N     1 
ATOM   405   C  CA    . GLN A 1  94   ? 306.478 271.109 259.058 1.00 60.14  ? 90   GLN A CA    1 
ATOM   406   C  C     . GLN A 1  94   ? 305.371 271.680 258.199 1.00 60.14  ? 90   GLN A C     1 
ATOM   407   O  O     . GLN A 1  94   ? 305.545 271.828 256.985 1.00 60.14  ? 90   GLN A O     1 
ATOM   408   C  CB    . GLN A 1  94   ? 306.270 269.629 259.275 1.00 60.14  ? 90   GLN A CB    1 
ATOM   409   C  CG    . GLN A 1  94   ? 306.469 268.872 258.027 1.00 60.14  ? 90   GLN A CG    1 
ATOM   410   C  CD    . GLN A 1  94   ? 306.595 267.417 258.259 1.00 60.14  ? 90   GLN A CD    1 
ATOM   411   O  OE1   . GLN A 1  94   ? 306.527 266.631 257.327 1.00 60.14  ? 90   GLN A OE1   1 
ATOM   412   N  NE2   . GLN A 1  94   ? 306.778 267.033 259.504 1.00 60.14  ? 90   GLN A NE2   1 
ATOM   413   N  N     . GLU A 1  95   ? 304.235 272.034 258.812 1.00 62.08  ? 91   GLU A N     1 
ATOM   414   C  CA    . GLU A 1  95   ? 303.169 272.685 258.051 1.00 62.08  ? 91   GLU A CA    1 
ATOM   415   C  C     . GLU A 1  95   ? 303.644 273.998 257.478 1.00 62.08  ? 91   GLU A C     1 
ATOM   416   O  O     . GLU A 1  95   ? 303.419 274.284 256.302 1.00 62.08  ? 91   GLU A O     1 
ATOM   417   C  CB    . GLU A 1  95   ? 301.938 272.991 258.893 1.00 62.08  ? 91   GLU A CB    1 
ATOM   418   C  CG    . GLU A 1  95   ? 301.380 271.990 259.845 1.00 62.08  ? 91   GLU A CG    1 
ATOM   419   C  CD    . GLU A 1  95   ? 300.875 270.724 259.240 1.00 62.08  ? 91   GLU A CD    1 
ATOM   420   O  OE1   . GLU A 1  95   ? 301.686 269.945 258.735 1.00 62.08  ? 91   GLU A OE1   1 
ATOM   421   O  OE2   . GLU A 1  95   ? 299.653 270.500 259.259 1.00 62.08  ? 91   GLU A OE2   1 
ATOM   422   N  N     . ALA A 1  96   ? 304.329 274.794 258.288 1.00 58.96  ? 92   ALA A N     1 
ATOM   423   C  CA    . ALA A 1  96   ? 304.704 276.121 257.837 1.00 58.96  ? 92   ALA A CA    1 
ATOM   424   C  C     . ALA A 1  96   ? 305.804 276.064 256.803 1.00 58.96  ? 92   ALA A C     1 
ATOM   425   O  O     . ALA A 1  96   ? 305.781 276.824 255.835 1.00 58.96  ? 92   ALA A O     1 
ATOM   426   C  CB    . ALA A 1  96   ? 305.137 276.970 259.014 1.00 58.96  ? 92   ALA A CB    1 
ATOM   427   N  N     . SER A 1  97   ? 306.754 275.149 256.962 1.00 58.42  ? 93   SER A N     1 
ATOM   428   C  CA    . SER A 1  97   ? 307.833 275.054 255.996 1.00 58.42  ? 93   SER A CA    1 
ATOM   429   C  C     . SER A 1  97   ? 307.334 274.517 254.674 1.00 58.42  ? 93   SER A C     1 
ATOM   430   O  O     . SER A 1  97   ? 307.714 275.023 253.616 1.00 58.42  ? 93   SER A O     1 
ATOM   431   C  CB    . SER A 1  97   ? 308.936 274.172 256.539 1.00 58.42  ? 93   SER A CB    1 
ATOM   432   O  OG    . SER A 1  97   ? 309.198 274.520 257.877 1.00 58.42  ? 93   SER A OG    1 
ATOM   433   N  N     . GLU A 1  98   ? 306.447 273.527 254.712 1.00 57.86  ? 94   GLU A N     1 
ATOM   434   C  CA    . GLU A 1  98   ? 305.898 273.011 253.473 1.00 57.86  ? 94   GLU A CA    1 
ATOM   435   C  C     . GLU A 1  98   ? 305.016 274.033 252.790 1.00 57.86  ? 94   GLU A C     1 
ATOM   436   O  O     . GLU A 1  98   ? 305.049 274.151 251.566 1.00 57.86  ? 94   GLU A O     1 
ATOM   437   C  CB    . GLU A 1  98   ? 305.120 271.743 253.748 1.00 57.86  ? 94   GLU A CB    1 
ATOM   438   C  CG    . GLU A 1  98   ? 305.968 270.523 253.661 1.00 57.86  ? 94   GLU A CG    1 
ATOM   439   C  CD    . GLU A 1  98   ? 305.249 269.303 254.156 1.00 57.86  ? 94   GLU A CD    1 
ATOM   440   O  OE1   . GLU A 1  98   ? 305.890 268.441 254.786 1.00 57.86  ? 94   GLU A OE1   1 
ATOM   441   O  OE2   . GLU A 1  98   ? 304.038 269.207 253.910 1.00 57.86  ? 94   GLU A OE2   1 
ATOM   442   N  N     . ALA A 1  99   ? 304.254 274.808 253.558 1.00 55.47  ? 95   ALA A N     1 
ATOM   443   C  CA    . ALA A 1  99   ? 303.387 275.819 252.972 1.00 55.47  ? 95   ALA A CA    1 
ATOM   444   C  C     . ALA A 1  99   ? 304.195 276.940 252.355 1.00 55.47  ? 95   ALA A C     1 
ATOM   445   O  O     . ALA A 1  99   ? 303.858 277.447 251.278 1.00 55.47  ? 95   ALA A O     1 
ATOM   446   C  CB    . ALA A 1  99   ? 302.449 276.372 254.034 1.00 55.47  ? 95   ALA A CB    1 
ATOM   447   N  N     . TYR A 1  100  ? 305.278 277.324 253.027 1.00 56.91  ? 96   TYR A N     1 
ATOM   448   C  CA    . TYR A 1  100  ? 306.186 278.313 252.480 1.00 56.91  ? 96   TYR A CA    1 
ATOM   449   C  C     . TYR A 1  100  ? 306.814 277.826 251.196 1.00 56.91  ? 96   TYR A C     1 
ATOM   450   O  O     . TYR A 1  100  ? 306.955 278.591 250.238 1.00 56.91  ? 96   TYR A O     1 
ATOM   451   C  CB    . TYR A 1  100  ? 307.268 278.621 253.494 1.00 56.91  ? 96   TYR A CB    1 
ATOM   452   C  CG    . TYR A 1  100  ? 308.373 279.457 252.949 1.00 56.91  ? 96   TYR A CG    1 
ATOM   453   C  CD1   . TYR A 1  100  ? 308.186 280.797 252.716 1.00 56.91  ? 96   TYR A CD1   1 
ATOM   454   C  CD2   . TYR A 1  100  ? 309.612 278.914 252.688 1.00 56.91  ? 96   TYR A CD2   1 
ATOM   455   C  CE1   . TYR A 1  100  ? 309.191 281.569 252.233 1.00 56.91  ? 96   TYR A CE1   1 
ATOM   456   C  CE2   . TYR A 1  100  ? 310.621 279.677 252.194 1.00 56.91  ? 96   TYR A CE2   1 
ATOM   457   C  CZ    . TYR A 1  100  ? 310.405 281.004 251.970 1.00 56.91  ? 96   TYR A CZ    1 
ATOM   458   O  OH    . TYR A 1  100  ? 311.417 281.780 251.479 1.00 56.91  ? 96   TYR A OH    1 
ATOM   459   N  N     . LEU A 1  101  ? 307.158 276.546 251.140 1.00 53.55  ? 97   LEU A N     1 
ATOM   460   C  CA    . LEU A 1  101  ? 307.819 276.042 249.953 1.00 53.55  ? 97   LEU A CA    1 
ATOM   461   C  C     . LEU A 1  101  ? 306.862 275.919 248.788 1.00 53.55  ? 97   LEU A C     1 
ATOM   462   O  O     . LEU A 1  101  ? 307.256 276.166 247.650 1.00 53.55  ? 97   LEU A O     1 
ATOM   463   C  CB    . LEU A 1  101  ? 308.485 274.718 250.243 1.00 53.55  ? 97   LEU A CB    1 
ATOM   464   C  CG    . LEU A 1  101  ? 309.783 274.944 250.990 1.00 53.55  ? 97   LEU A CG    1 
ATOM   465   C  CD1   . LEU A 1  101  ? 310.395 273.642 251.344 1.00 53.55  ? 97   LEU A CD1   1 
ATOM   466   C  CD2   . LEU A 1  101  ? 310.725 275.734 250.147 1.00 53.55  ? 97   LEU A CD2   1 
ATOM   467   N  N     . VAL A 1  102  ? 305.595 275.589 249.031 1.00 51.42  ? 98   VAL A N     1 
ATOM   468   C  CA    . VAL A 1  102  ? 304.717 275.475 247.872 1.00 51.42  ? 98   VAL A CA    1 
ATOM   469   C  C     . VAL A 1  102  ? 304.325 276.855 247.387 1.00 51.42  ? 98   VAL A C     1 
ATOM   470   O  O     . VAL A 1  102  ? 304.130 277.062 246.186 1.00 51.42  ? 98   VAL A O     1 
ATOM   471   C  CB    . VAL A 1  102  ? 303.465 274.634 248.145 1.00 51.42  ? 98   VAL A CB    1 
ATOM   472   C  CG1   . VAL A 1  102  ? 303.749 273.193 247.946 1.00 51.42  ? 98   VAL A CG1   1 
ATOM   473   C  CG2   . VAL A 1  102  ? 302.821 274.942 249.428 1.00 51.42  ? 98   VAL A CG2   1 
ATOM   474   N  N     . GLY A 1  103  ? 304.222 277.830 248.293 1.00 51.49  ? 99   GLY A N     1 
ATOM   475   C  CA    . GLY A 1  103  ? 303.977 279.192 247.851 1.00 51.49  ? 99   GLY A CA    1 
ATOM   476   C  C     . GLY A 1  103  ? 305.134 279.740 247.047 1.00 51.49  ? 99   GLY A C     1 
ATOM   477   O  O     . GLY A 1  103  ? 304.945 280.378 246.001 1.00 51.49  ? 99   GLY A O     1 
ATOM   478   N  N     . LEU A 1  104  ? 306.351 279.440 247.488 1.00 53.32  ? 100  LEU A N     1 
ATOM   479   C  CA    . LEU A 1  104  ? 307.530 279.824 246.737 1.00 53.32  ? 100  LEU A CA    1 
ATOM   480   C  C     . LEU A 1  104  ? 307.574 279.130 245.389 1.00 53.32  ? 100  LEU A C     1 
ATOM   481   O  O     . LEU A 1  104  ? 307.948 279.741 244.396 1.00 53.32  ? 100  LEU A O     1 
ATOM   482   C  CB    . LEU A 1  104  ? 308.774 279.506 247.547 1.00 53.32  ? 100  LEU A CB    1 
ATOM   483   C  CG    . LEU A 1  104  ? 310.101 279.689 246.847 1.00 53.32  ? 100  LEU A CG    1 
ATOM   484   C  CD1   . LEU A 1  104  ? 310.454 281.130 246.825 1.00 53.32  ? 100  LEU A CD1   1 
ATOM   485   C  CD2   . LEU A 1  104  ? 311.151 278.902 247.565 1.00 53.32  ? 100  LEU A CD2   1 
ATOM   486   N  N     . PHE A 1  105  ? 307.131 277.882 245.317 1.00 51.57  ? 101  PHE A N     1 
ATOM   487   C  CA    . PHE A 1  105  ? 307.211 277.176 244.049 1.00 51.57  ? 101  PHE A CA    1 
ATOM   488   C  C     . PHE A 1  105  ? 306.151 277.650 243.073 1.00 51.57  ? 101  PHE A C     1 
ATOM   489   O  O     . PHE A 1  105  ? 306.371 277.615 241.861 1.00 51.57  ? 101  PHE A O     1 
ATOM   490   C  CB    . PHE A 1  105  ? 307.101 275.690 244.278 1.00 51.57  ? 101  PHE A CB    1 
ATOM   491   C  CG    . PHE A 1  105  ? 308.395 275.056 244.549 1.00 51.57  ? 101  PHE A CG    1 
ATOM   492   C  CD1   . PHE A 1  105  ? 309.477 275.362 243.776 1.00 51.57  ? 101  PHE A CD1   1 
ATOM   493   C  CD2   . PHE A 1  105  ? 308.542 274.167 245.577 1.00 51.57  ? 101  PHE A CD2   1 
ATOM   494   C  CE1   . PHE A 1  105  ? 310.676 274.793 244.018 1.00 51.57  ? 101  PHE A CE1   1 
ATOM   495   C  CE2   . PHE A 1  105  ? 309.740 273.599 245.826 1.00 51.57  ? 101  PHE A CE2   1 
ATOM   496   C  CZ    . PHE A 1  105  ? 310.810 273.914 245.046 1.00 51.57  ? 101  PHE A CZ    1 
ATOM   497   N  N     . GLU A 1  106  ? 305.010 278.117 243.578 1.00 52.57  ? 102  GLU A N     1 
ATOM   498   C  CA    . GLU A 1  106  ? 304.067 278.823 242.719 1.00 52.57  ? 102  GLU A CA    1 
ATOM   499   C  C     . GLU A 1  106  ? 304.695 280.067 242.134 1.00 52.57  ? 102  GLU A C     1 
ATOM   500   O  O     . GLU A 1  106  ? 304.572 280.325 240.931 1.00 52.57  ? 102  GLU A O     1 
ATOM   501   C  CB    . GLU A 1  106  ? 302.826 279.222 243.499 1.00 52.57  ? 102  GLU A CB    1 
ATOM   502   C  CG    . GLU A 1  106  ? 302.000 278.088 243.988 1.00 52.57  ? 102  GLU A CG    1 
ATOM   503   C  CD    . GLU A 1  106  ? 300.596 278.517 244.302 1.00 52.57  ? 102  GLU A CD    1 
ATOM   504   O  OE1   . GLU A 1  106  ? 300.405 279.713 244.588 1.00 52.57  ? 102  GLU A OE1   1 
ATOM   505   O  OE2   . GLU A 1  106  ? 299.685 277.663 244.276 1.00 52.57  ? 102  GLU A OE2   1 
ATOM   506   N  N     . ASP A 1  107  ? 305.395 280.835 242.966 1.00 54.06  ? 103  ASP A N     1 
ATOM   507   C  CA    . ASP A 1  107  ? 306.000 282.064 242.473 1.00 54.06  ? 103  ASP A CA    1 
ATOM   508   C  C     . ASP A 1  107  ? 307.116 281.790 241.477 1.00 54.06  ? 103  ASP A C     1 
ATOM   509   O  O     . ASP A 1  107  ? 307.222 282.479 240.461 1.00 54.06  ? 103  ASP A O     1 
ATOM   510   C  CB    . ASP A 1  107  ? 306.507 282.893 243.638 1.00 54.06  ? 103  ASP A CB    1 
ATOM   511   C  CG    . ASP A 1  107  ? 305.409 283.247 244.601 1.00 54.06  ? 103  ASP A CG    1 
ATOM   512   O  OD1   . ASP A 1  107  ? 304.233 283.116 244.221 1.00 54.06  ? 103  ASP A OD1   1 
ATOM   513   O  OD2   . ASP A 1  107  ? 305.714 283.656 245.737 1.00 54.06  ? 103  ASP A OD2   1 
ATOM   514   N  N     . THR A 1  108  ? 307.929 280.768 241.712 1.00 53.00  ? 104  THR A N     1 
ATOM   515   C  CA    . THR A 1  108  ? 308.981 280.498 240.745 1.00 53.00  ? 104  THR A CA    1 
ATOM   516   C  C     . THR A 1  108  ? 308.434 279.840 239.503 1.00 53.00  ? 104  THR A C     1 
ATOM   517   O  O     . THR A 1  108  ? 309.057 279.913 238.445 1.00 53.00  ? 104  THR A O     1 
ATOM   518   C  CB    . THR A 1  108  ? 310.082 279.633 241.315 1.00 53.00  ? 104  THR A CB    1 
ATOM   519   O  OG1   . THR A 1  108  ? 309.617 278.297 241.431 1.00 53.00  ? 104  THR A OG1   1 
ATOM   520   C  CG2   . THR A 1  108  ? 310.514 280.141 242.613 1.00 53.00  ? 104  THR A CG2   1 
ATOM   521   N  N     . ASN A 1  109  ? 307.271 279.216 239.585 1.00 50.25  ? 105  ASN A N     1 
ATOM   522   C  CA    . ASN A 1  109  ? 306.659 278.764 238.350 1.00 50.25  ? 105  ASN A CA    1 
ATOM   523   C  C     . ASN A 1  109  ? 306.181 279.941 237.533 1.00 50.25  ? 105  ASN A C     1 
ATOM   524   O  O     . ASN A 1  109  ? 306.262 279.918 236.305 1.00 50.25  ? 105  ASN A O     1 
ATOM   525   C  CB    . ASN A 1  109  ? 305.513 277.819 238.628 1.00 50.25  ? 105  ASN A CB    1 
ATOM   526   C  CG    . ASN A 1  109  ? 305.186 276.997 237.441 1.00 50.25  ? 105  ASN A CG    1 
ATOM   527   O  OD1   . ASN A 1  109  ? 306.006 276.848 236.543 1.00 50.25  ? 105  ASN A OD1   1 
ATOM   528   N  ND2   . ASN A 1  109  ? 303.983 276.450 237.407 1.00 50.25  ? 105  ASN A ND2   1 
ATOM   529   N  N     . LEU A 1  110  ? 305.708 280.992 238.196 1.00 49.72  ? 106  LEU A N     1 
ATOM   530   C  CA    . LEU A 1  110  ? 305.357 282.205 237.467 1.00 49.72  ? 106  LEU A CA    1 
ATOM   531   C  C     . LEU A 1  110  ? 306.584 282.847 236.850 1.00 49.72  ? 106  LEU A C     1 
ATOM   532   O  O     . LEU A 1  110  ? 306.532 283.339 235.718 1.00 49.72  ? 106  LEU A O     1 
ATOM   533   C  CB    . LEU A 1  110  ? 304.672 283.194 238.386 1.00 49.72  ? 106  LEU A CB    1 
ATOM   534   C  CG    . LEU A 1  110  ? 303.325 282.715 238.866 1.00 49.72  ? 106  LEU A CG    1 
ATOM   535   C  CD1   . LEU A 1  110  ? 302.779 283.717 239.826 1.00 49.72  ? 106  LEU A CD1   1 
ATOM   536   C  CD2   . LEU A 1  110  ? 302.418 282.555 237.692 1.00 49.72  ? 106  LEU A CD2   1 
ATOM   537   N  N     . CYS A 1  111  ? 307.698 282.835 237.577 1.00 52.34  ? 107  CYS A N     1 
ATOM   538   C  CA    . CYS A 1  111  ? 308.927 283.411 237.045 1.00 52.34  ? 107  CYS A CA    1 
ATOM   539   C  C     . CYS A 1  111  ? 309.459 282.605 235.878 1.00 52.34  ? 107  CYS A C     1 
ATOM   540   O  O     . CYS A 1  111  ? 310.027 283.165 234.941 1.00 52.34  ? 107  CYS A O     1 
ATOM   541   C  CB    . CYS A 1  111  ? 309.987 283.496 238.129 1.00 52.34  ? 107  CYS A CB    1 
ATOM   542   S  SG    . CYS A 1  111  ? 309.550 284.466 239.527 1.00 52.34  ? 107  CYS A SG    1 
ATOM   543   N  N     . ALA A 1  112  ? 309.289 281.292 235.913 1.00 51.03  ? 108  ALA A N     1 
ATOM   544   C  CA    . ALA A 1  112  ? 309.795 280.482 234.823 1.00 51.03  ? 108  ALA A CA    1 
ATOM   545   C  C     . ALA A 1  112  ? 308.913 280.595 233.603 1.00 51.03  ? 108  ALA A C     1 
ATOM   546   O  O     . ALA A 1  112  ? 309.411 280.581 232.478 1.00 51.03  ? 108  ALA A O     1 
ATOM   547   C  CB    . ALA A 1  112  ? 309.909 279.036 235.253 1.00 51.03  ? 108  ALA A CB    1 
ATOM   548   N  N     . ILE A 1  113  ? 307.602 280.704 233.801 1.00 49.42  ? 109  ILE A N     1 
ATOM   549   C  CA    . ILE A 1  113  ? 306.693 280.929 232.684 1.00 49.42  ? 109  ILE A CA    1 
ATOM   550   C  C     . ILE A 1  113  ? 306.967 282.280 232.048 1.00 49.42  ? 109  ILE A C     1 
ATOM   551   O  O     . ILE A 1  113  ? 306.935 282.424 230.822 1.00 49.42  ? 109  ILE A O     1 
ATOM   552   C  CB    . ILE A 1  113  ? 305.245 280.797 233.181 1.00 49.42  ? 109  ILE A CB    1 
ATOM   553   C  CG1   . ILE A 1  113  ? 304.907 279.337 233.422 1.00 49.42  ? 109  ILE A CG1   1 
ATOM   554   C  CG2   . ILE A 1  113  ? 304.270 281.342 232.203 1.00 49.42  ? 109  ILE A CG2   1 
ATOM   555   C  CD1   . ILE A 1  113  ? 305.142 278.466 232.235 1.00 49.42  ? 109  ILE A CD1   1 
ATOM   556   N  N     . HIS A 1  114  ? 307.329 283.263 232.872 1.00 49.76  ? 110  HIS A N     1 
ATOM   557   C  CA    . HIS A 1  114  ? 307.625 284.601 232.383 1.00 49.76  ? 110  HIS A CA    1 
ATOM   558   C  C     . HIS A 1  114  ? 308.843 284.631 231.487 1.00 49.76  ? 110  HIS A C     1 
ATOM   559   O  O     . HIS A 1  114  ? 308.901 285.422 230.549 1.00 49.76  ? 110  HIS A O     1 
ATOM   560   C  CB    . HIS A 1  114  ? 307.853 285.533 233.550 1.00 49.76  ? 110  HIS A CB    1 
ATOM   561   C  CG    . HIS A 1  114  ? 308.044 286.948 233.146 1.00 49.76  ? 110  HIS A CG    1 
ATOM   562   N  ND1   . HIS A 1  114  ? 306.990 287.815 232.988 1.00 49.76  ? 110  HIS A ND1   1 
ATOM   563   C  CD2   . HIS A 1  114  ? 309.159 287.659 232.886 1.00 49.76  ? 110  HIS A CD2   1 
ATOM   564   C  CE1   . HIS A 1  114  ? 307.447 289.000 232.639 1.00 49.76  ? 110  HIS A CE1   1 
ATOM   565   N  NE2   . HIS A 1  114  ? 308.761 288.931 232.567 1.00 49.76  ? 110  HIS A NE2   1 
ATOM   566   N  N     . ALA A 1  115  ? 309.806 283.776 231.737 1.00 50.55  ? 111  ALA A N     1 
ATOM   567   C  CA    . ALA A 1  115  ? 310.982 283.720 230.888 1.00 50.55  ? 111  ALA A CA    1 
ATOM   568   C  C     . ALA A 1  115  ? 310.804 282.825 229.707 1.00 50.55  ? 111  ALA A C     1 
ATOM   569   O  O     . ALA A 1  115  ? 311.804 282.509 229.070 1.00 50.55  ? 111  ALA A O     1 
ATOM   570   C  CB    . ALA A 1  115  ? 312.189 283.260 231.693 1.00 50.55  ? 111  ALA A CB    1 
ATOM   571   N  N     . LYS A 1  116  ? 309.562 282.418 229.448 1.00 52.25  ? 112  LYS A N     1 
ATOM   572   C  CA    . LYS A 1  116  ? 309.169 281.598 228.307 1.00 52.25  ? 112  LYS A CA    1 
ATOM   573   C  C     . LYS A 1  116  ? 309.880 280.254 228.326 1.00 52.25  ? 112  LYS A C     1 
ATOM   574   O  O     . LYS A 1  116  ? 310.509 279.847 227.357 1.00 52.25  ? 112  LYS A O     1 
ATOM   575   C  CB    . LYS A 1  116  ? 309.397 282.332 226.987 1.00 52.25  ? 112  LYS A CB    1 
ATOM   576   C  CG    . LYS A 1  116  ? 308.447 283.484 226.768 1.00 52.25  ? 112  LYS A CG    1 
ATOM   577   C  CD    . LYS A 1  116  ? 307.252 283.052 225.946 1.00 52.25  ? 112  LYS A CD    1 
ATOM   578   C  CE    . LYS A 1  116  ? 306.102 284.047 226.047 1.00 52.25  ? 112  LYS A CE    1 
ATOM   579   N  NZ    . LYS A 1  116  ? 306.264 285.253 225.181 1.00 52.25  ? 112  LYS A NZ    1 
ATOM   580   N  N     . ARG A 1  117  ? 309.776 279.569 229.452 1.00 51.41  ? 113  ARG A N     1 
ATOM   581   C  CA    . ARG A 1  117  ? 310.269 278.212 229.570 1.00 51.41  ? 113  ARG A CA    1 
ATOM   582   C  C     . ARG A 1  117  ? 309.416 277.483 230.584 1.00 51.41  ? 113  ARG A C     1 
ATOM   583   O  O     . ARG A 1  117  ? 308.700 278.098 231.366 1.00 51.41  ? 113  ARG A O     1 
ATOM   584   C  CB    . ARG A 1  117  ? 311.724 278.186 229.987 1.00 51.41  ? 113  ARG A CB    1 
ATOM   585   C  CG    . ARG A 1  117  ? 311.949 278.745 231.322 1.00 51.41  ? 113  ARG A CG    1 
ATOM   586   C  CD    . ARG A 1  117  ? 313.310 278.436 231.790 1.00 51.41  ? 113  ARG A CD    1 
ATOM   587   N  NE    . ARG A 1  117  ? 313.500 279.066 233.070 1.00 51.41  ? 113  ARG A NE    1 
ATOM   588   C  CZ    . ARG A 1  117  ? 314.103 280.226 233.210 1.00 51.41  ? 113  ARG A CZ    1 
ATOM   589   N  NH1   . ARG A 1  117  ? 314.577 280.842 232.149 1.00 51.41  ? 113  ARG A NH1   1 
ATOM   590   N  NH2   . ARG A 1  117  ? 314.243 280.763 234.398 1.00 51.41  ? 113  ARG A NH2   1 
ATOM   591   N  N     . VAL A 1  118  ? 309.472 276.162 230.570 1.00 51.70  ? 114  VAL A N     1 
ATOM   592   C  CA    . VAL A 1  118  ? 308.598 275.368 231.418 1.00 51.70  ? 114  VAL A CA    1 
ATOM   593   C  C     . VAL A 1  118  ? 309.324 274.897 232.666 1.00 51.70  ? 114  VAL A C     1 
ATOM   594   O  O     . VAL A 1  118  ? 308.724 274.780 233.734 1.00 51.70  ? 114  VAL A O     1 
ATOM   595   C  CB    . VAL A 1  118  ? 307.978 274.188 230.639 1.00 51.70  ? 114  VAL A CB    1 
ATOM   596   C  CG1   . VAL A 1  118  ? 308.985 273.162 230.262 1.00 51.70  ? 114  VAL A CG1   1 
ATOM   597   C  CG2   . VAL A 1  118  ? 306.871 273.556 231.411 1.00 51.70  ? 114  VAL A CG2   1 
ATOM   598   N  N     . THR A 1  119  ? 310.636 274.714 232.579 1.00 52.12  ? 115  THR A N     1 
ATOM   599   C  CA    . THR A 1  119  ? 311.352 274.189 233.723 1.00 52.12  ? 115  THR A CA    1 
ATOM   600   C  C     . THR A 1  119  ? 311.779 275.330 234.619 1.00 52.12  ? 115  THR A C     1 
ATOM   601   O  O     . THR A 1  119  ? 311.809 276.483 234.198 1.00 52.12  ? 115  THR A O     1 
ATOM   602   C  CB    . THR A 1  119  ? 312.543 273.358 233.281 1.00 52.12  ? 115  THR A CB    1 
ATOM   603   O  OG1   . THR A 1  119  ? 312.884 272.462 234.332 1.00 52.12  ? 115  THR A OG1   1 
ATOM   604   C  CG2   . THR A 1  119  ? 313.712 274.188 233.028 1.00 52.12  ? 115  THR A CG2   1 
ATOM   605   N  N     . ILE A 1  120  ? 312.041 275.038 235.856 1.00 50.45  ? 116  ILE A N     1 
ATOM   606   C  CA    . ILE A 1  120  ? 312.409 276.104 236.763 1.00 50.45  ? 116  ILE A CA    1 
ATOM   607   C  C     . ILE A 1  120  ? 313.891 276.003 237.073 1.00 50.45  ? 116  ILE A C     1 
ATOM   608   O  O     . ILE A 1  120  ? 314.397 274.951 237.441 1.00 50.45  ? 116  ILE A O     1 
ATOM   609   C  CB    . ILE A 1  120  ? 311.527 276.101 238.025 1.00 50.45  ? 116  ILE A CB    1 
ATOM   610   C  CG1   . ILE A 1  120  ? 311.558 274.803 238.787 1.00 50.45  ? 116  ILE A CG1   1 
ATOM   611   C  CG2   . ILE A 1  120  ? 310.121 276.230 237.638 1.00 50.45  ? 116  ILE A CG2   1 
ATOM   612   C  CD1   . ILE A 1  120  ? 310.930 274.927 240.129 1.00 50.45  ? 116  ILE A CD1   1 
ATOM   613   N  N     . MET A 1  121  ? 314.608 277.084 236.851 1.00 53.87  ? 117  MET A N     1 
ATOM   614   C  CA    . MET A 1  121  ? 316.024 277.115 237.139 1.00 53.87  ? 117  MET A CA    1 
ATOM   615   C  C     . MET A 1  121  ? 316.185 277.786 238.492 1.00 53.87  ? 117  MET A C     1 
ATOM   616   O  O     . MET A 1  121  ? 315.196 278.289 239.019 1.00 53.87  ? 117  MET A O     1 
ATOM   617   C  CB    . MET A 1  121  ? 316.767 277.864 236.036 1.00 53.87  ? 117  MET A CB    1 
ATOM   618   C  CG    . MET A 1  121  ? 316.153 277.700 234.693 1.00 53.87  ? 117  MET A CG    1 
ATOM   619   S  SD    . MET A 1  121  ? 316.643 276.204 233.867 1.00 53.87  ? 117  MET A SD    1 
ATOM   620   C  CE    . MET A 1  121  ? 318.333 276.613 233.559 1.00 53.87  ? 117  MET A CE    1 
ATOM   621   N  N     . PRO A 1  122  ? 317.362 277.770 239.120 1.00 54.03  ? 118  PRO A N     1 
ATOM   622   C  CA    . PRO A 1  122  ? 317.479 278.455 240.413 1.00 54.03  ? 118  PRO A CA    1 
ATOM   623   C  C     . PRO A 1  122  ? 317.377 279.962 240.342 1.00 54.03  ? 118  PRO A C     1 
ATOM   624   O  O     . PRO A 1  122  ? 317.071 280.598 241.360 1.00 54.03  ? 118  PRO A O     1 
ATOM   625   C  CB    . PRO A 1  122  ? 318.856 278.023 240.900 1.00 54.03  ? 118  PRO A CB    1 
ATOM   626   C  CG    . PRO A 1  122  ? 319.062 276.753 240.275 1.00 54.03  ? 118  PRO A CG    1 
ATOM   627   C  CD    . PRO A 1  122  ? 318.473 276.827 238.942 1.00 54.03  ? 118  PRO A CD    1 
ATOM   628   N  N     . LYS A 1  123  ? 317.614 280.559 239.172 1.00 54.05  ? 119  LYS A N     1 
ATOM   629   C  CA    . LYS A 1  123  ? 317.500 282.003 239.060 1.00 54.05  ? 119  LYS A CA    1 
ATOM   630   C  C     . LYS A 1  123  ? 316.062 282.457 239.212 1.00 54.05  ? 119  LYS A C     1 
ATOM   631   O  O     . LYS A 1  123  ? 315.816 283.580 239.656 1.00 54.05  ? 119  LYS A O     1 
ATOM   632   C  CB    . LYS A 1  123  ? 318.073 282.495 237.740 1.00 54.05  ? 119  LYS A CB    1 
ATOM   633   C  CG    . LYS A 1  123  ? 317.844 281.628 236.558 1.00 54.05  ? 119  LYS A CG    1 
ATOM   634   C  CD    . LYS A 1  123  ? 318.246 282.384 235.309 1.00 54.05  ? 119  LYS A CD    1 
ATOM   635   C  CE    . LYS A 1  123  ? 317.923 281.639 234.029 1.00 54.05  ? 119  LYS A CE    1 
ATOM   636   N  NZ    . LYS A 1  123  ? 318.923 280.593 233.701 1.00 54.05  ? 119  LYS A NZ    1 
ATOM   637   N  N     . ASP A 1  124  ? 315.107 281.580 238.916 1.00 55.22  ? 120  ASP A N     1 
ATOM   638   C  CA    . ASP A 1  124  ? 313.718 281.840 239.267 1.00 55.22  ? 120  ASP A CA    1 
ATOM   639   C  C     . ASP A 1  124  ? 313.535 281.936 240.764 1.00 55.22  ? 120  ASP A C     1 
ATOM   640   O  O     . ASP A 1  124  ? 312.777 282.779 241.251 1.00 55.22  ? 120  ASP A O     1 
ATOM   641   C  CB    . ASP A 1  124  ? 312.841 280.741 238.716 1.00 55.22  ? 120  ASP A CB    1 
ATOM   642   C  CG    . ASP A 1  124  ? 313.231 280.373 237.346 1.00 55.22  ? 120  ASP A CG    1 
ATOM   643   O  OD1   . ASP A 1  124  ? 313.466 281.281 236.547 1.00 55.22  ? 120  ASP A OD1   1 
ATOM   644   O  OD2   . ASP A 1  124  ? 313.346 279.189 237.045 1.00 55.22  ? 120  ASP A OD2   1 
ATOM   645   N  N     . ILE A 1  125  ? 314.233 281.095 241.514 1.00 54.86  ? 121  ILE A N     1 
ATOM   646   C  CA    . ILE A 1  125  ? 314.040 281.079 242.951 1.00 54.86  ? 121  ILE A CA    1 
ATOM   647   C  C     . ILE A 1  125  ? 314.628 282.326 243.569 1.00 54.86  ? 121  ILE A C     1 
ATOM   648   O  O     . ILE A 1  125  ? 313.985 282.983 244.395 1.00 54.86  ? 121  ILE A O     1 
ATOM   649   C  CB    . ILE A 1  125  ? 314.634 279.806 243.560 1.00 54.86  ? 121  ILE A CB    1 
ATOM   650   C  CG1   . ILE A 1  125  ? 313.894 278.602 243.012 1.00 54.86  ? 121  ILE A CG1   1 
ATOM   651   C  CG2   . ILE A 1  125  ? 314.483 279.840 245.046 1.00 54.86  ? 121  ILE A CG2   1 
ATOM   652   C  CD1   . ILE A 1  125  ? 314.280 277.318 243.625 1.00 54.86  ? 121  ILE A CD1   1 
ATOM   653   N  N     . GLN A 1  126  ? 315.827 282.715 243.145 1.00 54.28  ? 122  GLN A N     1 
ATOM   654   C  CA    . GLN A 1  126  ? 316.344 283.948 243.720 1.00 54.28  ? 122  GLN A CA    1 
ATOM   655   C  C     . GLN A 1  126  ? 315.637 285.176 243.178 1.00 54.28  ? 122  GLN A C     1 
ATOM   656   O  O     . GLN A 1  126  ? 315.576 286.188 243.876 1.00 54.28  ? 122  GLN A O     1 
ATOM   657   C  CB    . GLN A 1  126  ? 317.855 284.087 243.577 1.00 54.28  ? 122  GLN A CB    1 
ATOM   658   C  CG    . GLN A 1  126  ? 318.462 283.860 242.256 1.00 54.28  ? 122  GLN A CG    1 
ATOM   659   C  CD    . GLN A 1  126  ? 319.222 282.574 242.261 1.00 54.28  ? 122  GLN A CD    1 
ATOM   660   O  OE1   . GLN A 1  126  ? 319.025 281.746 243.137 1.00 54.28  ? 122  GLN A OE1   1 
ATOM   661   N  NE2   . GLN A 1  126  ? 320.130 282.413 241.318 1.00 54.28  ? 122  GLN A NE2   1 
ATOM   662   N  N     . LEU A 1  127  ? 315.011 285.096 242.004 1.00 52.86  ? 123  LEU A N     1 
ATOM   663   C  CA    . LEU A 1  127  ? 314.224 286.233 241.548 1.00 52.86  ? 123  LEU A CA    1 
ATOM   664   C  C     . LEU A 1  127  ? 312.964 286.396 242.378 1.00 52.86  ? 123  LEU A C     1 
ATOM   665   O  O     . LEU A 1  127  ? 312.638 287.507 242.805 1.00 52.86  ? 123  LEU A O     1 
ATOM   666   C  CB    . LEU A 1  127  ? 313.874 286.088 240.076 1.00 52.86  ? 123  LEU A CB    1 
ATOM   667   C  CG    . LEU A 1  127  ? 312.839 287.105 239.617 1.00 52.86  ? 123  LEU A CG    1 
ATOM   668   C  CD1   . LEU A 1  127  ? 313.479 288.437 239.534 1.00 52.86  ? 123  LEU A CD1   1 
ATOM   669   C  CD2   . LEU A 1  127  ? 312.253 286.735 238.306 1.00 52.86  ? 123  LEU A CD2   1 
ATOM   670   N  N     . ALA A 1  128  ? 312.259 285.302 242.640 1.00 54.03  ? 124  ALA A N     1 
ATOM   671   C  CA    . ALA A 1  128  ? 311.038 285.393 243.425 1.00 54.03  ? 124  ALA A CA    1 
ATOM   672   C  C     . ALA A 1  128  ? 311.339 285.762 244.862 1.00 54.03  ? 124  ALA A C     1 
ATOM   673   O  O     . ALA A 1  128  ? 310.582 286.504 245.493 1.00 54.03  ? 124  ALA A O     1 
ATOM   674   C  CB    . ALA A 1  128  ? 310.282 284.078 243.368 1.00 54.03  ? 124  ALA A CB    1 
ATOM   675   N  N     . ARG A 1  129  ? 312.462 285.291 245.389 1.00 57.13  ? 125  ARG A N     1 
ATOM   676   C  CA    . ARG A 1  129  ? 312.825 285.680 246.738 1.00 57.13  ? 125  ARG A CA    1 
ATOM   677   C  C     . ARG A 1  129  ? 313.320 287.113 246.789 1.00 57.13  ? 125  ARG A C     1 
ATOM   678   O  O     . ARG A 1  129  ? 313.227 287.764 247.831 1.00 57.13  ? 125  ARG A O     1 
ATOM   679   C  CB    . ARG A 1  129  ? 313.880 284.736 247.275 1.00 57.13  ? 125  ARG A CB    1 
ATOM   680   C  CG    . ARG A 1  129  ? 313.330 283.418 247.646 1.00 57.13  ? 125  ARG A CG    1 
ATOM   681   C  CD    . ARG A 1  129  ? 314.420 282.517 248.122 1.00 57.13  ? 125  ARG A CD    1 
ATOM   682   N  NE    . ARG A 1  129  ? 315.308 283.164 249.071 1.00 57.13  ? 125  ARG A NE    1 
ATOM   683   C  CZ    . ARG A 1  129  ? 315.054 283.286 250.365 1.00 57.13  ? 125  ARG A CZ    1 
ATOM   684   N  NH1   . ARG A 1  129  ? 313.928 282.817 250.871 1.00 57.13  ? 125  ARG A NH1   1 
ATOM   685   N  NH2   . ARG A 1  129  ? 315.925 283.882 251.157 1.00 57.13  ? 125  ARG A NH2   1 
ATOM   686   N  N     . ARG A 1  130  ? 313.850 287.625 245.685 1.00 58.35  ? 126  ARG A N     1 
ATOM   687   C  CA    . ARG A 1  130  ? 314.288 289.009 245.667 1.00 58.35  ? 126  ARG A CA    1 
ATOM   688   C  C     . ARG A 1  130  ? 313.101 289.947 245.557 1.00 58.35  ? 126  ARG A C     1 
ATOM   689   O  O     . ARG A 1  130  ? 313.080 291.005 246.189 1.00 58.35  ? 126  ARG A O     1 
ATOM   690   C  CB    . ARG A 1  130  ? 315.275 289.207 244.523 1.00 58.35  ? 126  ARG A CB    1 
ATOM   691   C  CG    . ARG A 1  130  ? 315.733 290.625 244.269 1.00 58.35  ? 126  ARG A CG    1 
ATOM   692   C  CD    . ARG A 1  130  ? 316.280 291.321 245.499 1.00 58.35  ? 126  ARG A CD    1 
ATOM   693   N  NE    . ARG A 1  130  ? 317.497 290.707 246.017 1.00 58.35  ? 126  ARG A NE    1 
ATOM   694   C  CZ    . ARG A 1  130  ? 317.894 290.790 247.286 1.00 58.35  ? 126  ARG A CZ    1 
ATOM   695   N  NH1   . ARG A 1  130  ? 317.167 291.452 248.175 1.00 58.35  ? 126  ARG A NH1   1 
ATOM   696   N  NH2   . ARG A 1  130  ? 319.019 290.201 247.670 1.00 58.35  ? 126  ARG A NH2   1 
ATOM   697   N  N     . ILE A 1  131  ? 312.087 289.568 244.787 1.00 55.37  ? 127  ILE A N     1 
ATOM   698   C  CA    . ILE A 1  131  ? 310.913 290.421 244.649 1.00 55.37  ? 127  ILE A CA    1 
ATOM   699   C  C     . ILE A 1  131  ? 310.098 290.412 245.926 1.00 55.37  ? 127  ILE A C     1 
ATOM   700   O  O     . ILE A 1  131  ? 309.629 291.454 246.387 1.00 55.37  ? 127  ILE A O     1 
ATOM   701   C  CB    . ILE A 1  131  ? 310.081 289.984 243.443 1.00 55.37  ? 127  ILE A CB    1 
ATOM   702   C  CG1   . ILE A 1  131  ? 310.849 290.265 242.180 1.00 55.37  ? 127  ILE A CG1   1 
ATOM   703   C  CG2   . ILE A 1  131  ? 308.826 290.750 243.369 1.00 55.37  ? 127  ILE A CG2   1 
ATOM   704   C  CD1   . ILE A 1  131  ? 310.214 289.663 241.004 1.00 55.37  ? 127  ILE A CD1   1 
ATOM   705   N  N     . ARG A 1  132  ? 309.979 289.252 246.569 1.00 56.48  ? 128  ARG A N     1 
ATOM   706   C  CA    . ARG A 1  132  ? 309.272 289.205 247.842 1.00 56.48  ? 128  ARG A CA    1 
ATOM   707   C  C     . ARG A 1  132  ? 310.043 289.857 248.977 1.00 56.48  ? 128  ARG A C     1 
ATOM   708   O  O     . ARG A 1  132  ? 309.500 289.991 250.073 1.00 56.48  ? 128  ARG A O     1 
ATOM   709   C  CB    . ARG A 1  132  ? 308.963 287.769 248.219 1.00 56.48  ? 128  ARG A CB    1 
ATOM   710   C  CG    . ARG A 1  132  ? 307.929 287.133 247.360 1.00 56.48  ? 128  ARG A CG    1 
ATOM   711   C  CD    . ARG A 1  132  ? 308.053 285.636 247.399 1.00 56.48  ? 128  ARG A CD    1 
ATOM   712   N  NE    . ARG A 1  132  ? 307.068 285.036 248.280 1.00 56.48  ? 128  ARG A NE    1 
ATOM   713   C  CZ    . ARG A 1  132  ? 307.153 283.800 248.743 1.00 56.48  ? 128  ARG A CZ    1 
ATOM   714   N  NH1   . ARG A 1  132  ? 308.179 283.049 248.411 1.00 56.48  ? 128  ARG A NH1   1 
ATOM   715   N  NH2   . ARG A 1  132  ? 306.219 283.319 249.544 1.00 56.48  ? 128  ARG A NH2   1 
ATOM   716   N  N     . GLY A 1  133  ? 311.286 290.257 248.753 1.00 59.17  ? 129  GLY A N     1 
ATOM   717   C  CA    . GLY A 1  133  ? 312.069 290.890 249.780 1.00 59.17  ? 129  GLY A CA    1 
ATOM   718   C  C     . GLY A 1  133  ? 312.742 289.938 250.728 1.00 59.17  ? 129  GLY A C     1 
ATOM   719   O  O     . GLY A 1  133  ? 313.355 290.389 251.698 1.00 59.17  ? 129  GLY A O     1 
ATOM   720   N  N     . GLU A 1  134  ? 312.676 288.636 250.466 1.00 62.27  ? 130  GLU A N     1 
ATOM   721   C  CA    . GLU A 1  134  ? 313.155 287.649 251.421 1.00 62.27  ? 130  GLU A CA    1 
ATOM   722   C  C     . GLU A 1  134  ? 314.654 287.461 251.349 1.00 62.27  ? 130  GLU A C     1 
ATOM   723   O  O     . GLU A 1  134  ? 315.228 286.727 252.159 1.00 62.27  ? 130  GLU A O     1 
ATOM   724   C  CB    . GLU A 1  134  ? 312.463 286.315 251.185 1.00 62.27  ? 130  GLU A CB    1 
ATOM   725   C  CG    . GLU A 1  134  ? 311.039 286.272 251.624 1.00 62.27  ? 130  GLU A CG    1 
ATOM   726   C  CD    . GLU A 1  134  ? 310.329 285.093 251.035 1.00 62.27  ? 130  GLU A CD    1 
ATOM   727   O  OE1   . GLU A 1  134  ? 309.202 285.264 250.538 1.00 62.27  ? 130  GLU A OE1   1 
ATOM   728   O  OE2   . GLU A 1  134  ? 310.910 283.993 251.052 1.00 62.27  ? 130  GLU A OE2   1 
ATOM   729   N  N     . ARG A 1  135  ? 315.311 288.089 250.394 1.00 61.33  ? 131  ARG A N     1 
ATOM   730   C  CA    . ARG A 1  135  ? 316.716 287.815 250.205 1.00 61.33  ? 131  ARG A CA    1 
ATOM   731   C  C     . ARG A 1  135  ? 317.577 288.884 250.856 1.00 61.33  ? 131  ARG A C     1 
ATOM   732   O  O     . ARG A 1  135  ? 317.892 288.798 252.043 1.00 61.33  ? 131  ARG A O     1 
ATOM   733   C  CB    . ARG A 1  135  ? 317.019 287.697 248.720 1.00 61.33  ? 131  ARG A CB    1 
ATOM   734   C  CG    . ARG A 1  135  ? 318.273 286.927 248.411 1.00 61.33  ? 131  ARG A CG    1 
ATOM   735   C  CD    . ARG A 1  135  ? 318.173 286.260 247.053 1.00 61.33  ? 131  ARG A CD    1 
ATOM   736   N  NE    . ARG A 1  135  ? 317.607 284.918 247.130 1.00 61.33  ? 131  ARG A NE    1 
ATOM   737   C  CZ    . ARG A 1  135  ? 318.328 283.822 247.330 1.00 61.33  ? 131  ARG A CZ    1 
ATOM   738   N  NH1   . ARG A 1  135  ? 319.642 283.912 247.480 1.00 61.33  ? 131  ARG A NH1   1 
ATOM   739   N  NH2   . ARG A 1  135  ? 317.744 282.636 247.378 1.00 61.33  ? 131  ARG A NH2   1 
ATOM   740   N  N     . ASP B 2  25   ? 324.729 265.764 258.189 1.00 74.56  ? 24   ASP B N     1 
ATOM   741   C  CA    . ASP B 2  25   ? 323.800 266.701 257.582 1.00 74.56  ? 24   ASP B CA    1 
ATOM   742   C  C     . ASP B 2  25   ? 322.433 266.100 257.319 1.00 74.56  ? 24   ASP B C     1 
ATOM   743   O  O     . ASP B 2  25   ? 322.255 265.211 256.491 1.00 74.56  ? 24   ASP B O     1 
ATOM   744   C  CB    . ASP B 2  25   ? 324.383 267.276 256.288 1.00 74.56  ? 24   ASP B CB    1 
ATOM   745   C  CG    . ASP B 2  25   ? 325.148 266.250 255.459 1.00 74.56  ? 24   ASP B CG    1 
ATOM   746   O  OD1   . ASP B 2  25   ? 324.776 265.060 255.400 1.00 74.56  ? 24   ASP B OD1   1 
ATOM   747   O  OD2   . ASP B 2  25   ? 326.161 266.654 254.853 1.00 74.56  ? 24   ASP B OD2   1 
ATOM   748   N  N     . ASN B 2  26   ? 321.447 266.593 258.046 1.00 66.09  ? 25   ASN B N     1 
ATOM   749   C  CA    . ASN B 2  26   ? 320.104 266.113 257.811 1.00 66.09  ? 25   ASN B CA    1 
ATOM   750   C  C     . ASN B 2  26   ? 319.375 266.924 256.769 1.00 66.09  ? 25   ASN B C     1 
ATOM   751   O  O     . ASN B 2  26   ? 318.234 266.594 256.453 1.00 66.09  ? 25   ASN B O     1 
ATOM   752   C  CB    . ASN B 2  26   ? 319.321 266.106 259.106 1.00 66.09  ? 25   ASN B CB    1 
ATOM   753   C  CG    . ASN B 2  26   ? 320.129 265.585 260.241 1.00 66.09  ? 25   ASN B CG    1 
ATOM   754   O  OD1   . ASN B 2  26   ? 320.949 266.296 260.806 1.00 66.09  ? 25   ASN B OD1   1 
ATOM   755   N  ND2   . ASN B 2  26   ? 319.928 264.329 260.576 1.00 66.09  ? 25   ASN B ND2   1 
ATOM   756   N  N     . ILE B 2  27   ? 320.005 267.952 256.206 1.00 62.66  ? 26   ILE B N     1 
ATOM   757   C  CA    . ILE B 2  27   ? 319.348 268.685 255.140 1.00 62.66  ? 26   ILE B CA    1 
ATOM   758   C  C     . ILE B 2  27   ? 319.333 267.875 253.860 1.00 62.66  ? 26   ILE B C     1 
ATOM   759   O  O     . ILE B 2  27   ? 318.526 268.145 252.970 1.00 62.66  ? 26   ILE B O     1 
ATOM   760   C  CB    . ILE B 2  27   ? 319.999 270.061 254.946 1.00 62.66  ? 26   ILE B CB    1 
ATOM   761   C  CG1   . ILE B 2  27   ? 319.002 271.015 254.310 1.00 62.66  ? 26   ILE B CG1   1 
ATOM   762   C  CG2   . ILE B 2  27   ? 321.238 269.973 254.111 1.00 62.66  ? 26   ILE B CG2   1 
ATOM   763   C  CD1   . ILE B 2  27   ? 319.515 272.390 254.157 1.00 62.66  ? 26   ILE B CD1   1 
ATOM   764   N  N     . GLN B 2  28   ? 320.162 266.842 253.759 1.00 61.96  ? 27   GLN B N     1 
ATOM   765   C  CA    . GLN B 2  28   ? 320.020 265.913 252.657 1.00 61.96  ? 27   GLN B CA    1 
ATOM   766   C  C     . GLN B 2  28   ? 318.884 264.936 252.867 1.00 61.96  ? 27   GLN B C     1 
ATOM   767   O  O     . GLN B 2  28   ? 318.587 264.154 251.966 1.00 61.96  ? 27   GLN B O     1 
ATOM   768   C  CB    . GLN B 2  28   ? 321.315 265.159 252.460 1.00 61.96  ? 27   GLN B CB    1 
ATOM   769   C  CG    . GLN B 2  28   ? 322.456 266.067 252.160 1.00 61.96  ? 27   GLN B CG    1 
ATOM   770   C  CD    . GLN B 2  28   ? 322.564 266.369 250.693 1.00 61.96  ? 27   GLN B CD    1 
ATOM   771   O  OE1   . GLN B 2  28   ? 322.350 267.500 250.263 1.00 61.96  ? 27   GLN B OE1   1 
ATOM   772   N  NE2   . GLN B 2  28   ? 322.893 265.356 249.907 1.00 61.96  ? 27   GLN B NE2   1 
ATOM   773   N  N     . GLY B 2  29   ? 318.260 264.947 254.039 1.00 57.67  ? 28   GLY B N     1 
ATOM   774   C  CA    . GLY B 2  29   ? 317.085 264.139 254.243 1.00 57.67  ? 28   GLY B CA    1 
ATOM   775   C  C     . GLY B 2  29   ? 315.850 264.711 253.599 1.00 57.67  ? 28   GLY B C     1 
ATOM   776   O  O     . GLY B 2  29   ? 314.835 264.023 253.510 1.00 57.67  ? 28   GLY B O     1 
ATOM   777   N  N     . ILE B 2  30   ? 315.899 265.960 253.172 1.00 56.83  ? 29   ILE B N     1 
ATOM   778   C  CA    . ILE B 2  30   ? 314.824 266.502 252.366 1.00 56.83  ? 29   ILE B CA    1 
ATOM   779   C  C     . ILE B 2  30   ? 315.199 266.147 250.944 1.00 56.83  ? 29   ILE B C     1 
ATOM   780   O  O     . ILE B 2  30   ? 315.996 266.833 250.299 1.00 56.83  ? 29   ILE B O     1 
ATOM   781   C  CB    . ILE B 2  30   ? 314.627 268.006 252.590 1.00 56.83  ? 29   ILE B CB    1 
ATOM   782   C  CG1   . ILE B 2  30   ? 314.096 268.258 253.999 1.00 56.83  ? 29   ILE B CG1   1 
ATOM   783   C  CG2   . ILE B 2  30   ? 313.612 268.551 251.635 1.00 56.83  ? 29   ILE B CG2   1 
ATOM   784   C  CD1   . ILE B 2  30   ? 315.111 268.530 255.040 1.00 56.83  ? 29   ILE B CD1   1 
ATOM   785   N  N     . THR B 2  31   ? 314.658 265.038 250.469 1.00 51.96  ? 30   THR B N     1 
ATOM   786   C  CA    . THR B 2  31   ? 315.207 264.295 249.358 1.00 51.96  ? 30   THR B CA    1 
ATOM   787   C  C     . THR B 2  31   ? 314.934 264.996 248.047 1.00 51.96  ? 30   THR B C     1 
ATOM   788   O  O     . THR B 2  31   ? 314.315 266.049 247.994 1.00 51.96  ? 30   THR B O     1 
ATOM   789   C  CB    . THR B 2  31   ? 314.587 262.922 249.317 1.00 51.96  ? 30   THR B CB    1 
ATOM   790   O  OG1   . THR B 2  31   ? 313.227 263.078 248.933 1.00 51.96  ? 30   THR B OG1   1 
ATOM   791   C  CG2   . THR B 2  31   ? 314.599 262.313 250.675 1.00 51.96  ? 30   THR B CG2   1 
ATOM   792   N  N     . LYS B 2  32   ? 315.398 264.389 246.972 1.00 49.71  ? 31   LYS B N     1 
ATOM   793   C  CA    . LYS B 2  32   ? 314.985 264.859 245.659 1.00 49.71  ? 31   LYS B CA    1 
ATOM   794   C  C     . LYS B 2  32   ? 313.516 264.571 245.365 1.00 49.71  ? 31   LYS B C     1 
ATOM   795   O  O     . LYS B 2  32   ? 312.851 265.482 244.846 1.00 49.71  ? 31   LYS B O     1 
ATOM   796   C  CB    . LYS B 2  32   ? 315.922 264.297 244.586 1.00 49.71  ? 31   LYS B CB    1 
ATOM   797   C  CG    . LYS B 2  32   ? 315.272 264.078 243.257 1.00 49.71  ? 31   LYS B CG    1 
ATOM   798   C  CD    . LYS B 2  32   ? 316.128 263.267 242.329 1.00 49.71  ? 31   LYS B CD    1 
ATOM   799   C  CE    . LYS B 2  32   ? 317.220 264.124 241.770 1.00 49.71  ? 31   LYS B CE    1 
ATOM   800   N  NZ    . LYS B 2  32   ? 317.693 263.622 240.468 1.00 49.71  ? 31   LYS B NZ    1 
ATOM   801   N  N     . PRO B 2  33   ? 312.930 263.399 245.677 1.00 49.13  ? 32   PRO B N     1 
ATOM   802   C  CA    . PRO B 2  33   ? 311.486 263.279 245.487 1.00 49.13  ? 32   PRO B CA    1 
ATOM   803   C  C     . PRO B 2  33   ? 310.650 264.102 246.429 1.00 49.13  ? 32   PRO B C     1 
ATOM   804   O  O     . PRO B 2  33   ? 309.517 264.398 246.075 1.00 49.13  ? 32   PRO B O     1 
ATOM   805   C  CB    . PRO B 2  33   ? 311.225 261.788 245.682 1.00 49.13  ? 32   PRO B CB    1 
ATOM   806   C  CG    . PRO B 2  33   ? 312.355 261.288 246.319 1.00 49.13  ? 32   PRO B CG    1 
ATOM   807   C  CD    . PRO B 2  33   ? 313.483 262.041 245.809 1.00 49.13  ? 32   PRO B CD    1 
ATOM   808   N  N     . ALA B 2  34   ? 311.150 264.534 247.575 1.00 50.61  ? 33   ALA B N     1 
ATOM   809   C  CA    . ALA B 2  34   ? 310.310 265.352 248.442 1.00 50.61  ? 33   ALA B CA    1 
ATOM   810   C  C     . ALA B 2  34   ? 310.211 266.775 247.918 1.00 50.61  ? 33   ALA B C     1 
ATOM   811   O  O     . ALA B 2  34   ? 309.136 267.383 247.929 1.00 50.61  ? 33   ALA B O     1 
ATOM   812   C  CB    . ALA B 2  34   ? 310.844 265.340 249.863 1.00 50.61  ? 33   ALA B CB    1 
ATOM   813   N  N     . ILE B 2  35   ? 311.320 267.317 247.432 1.00 50.38  ? 34   ILE B N     1 
ATOM   814   C  CA    . ILE B 2  35   ? 311.273 268.620 246.798 1.00 50.38  ? 34   ILE B CA    1 
ATOM   815   C  C     . ILE B 2  35   ? 310.546 268.520 245.483 1.00 50.38  ? 34   ILE B C     1 
ATOM   816   O  O     . ILE B 2  35   ? 309.878 269.463 245.057 1.00 50.38  ? 34   ILE B O     1 
ATOM   817   C  CB    . ILE B 2  35   ? 312.694 269.157 246.627 1.00 50.38  ? 34   ILE B CB    1 
ATOM   818   C  CG1   . ILE B 2  35   ? 313.377 269.190 247.969 1.00 50.38  ? 34   ILE B CG1   1 
ATOM   819   C  CG2   . ILE B 2  35   ? 312.683 270.549 246.112 1.00 50.38  ? 34   ILE B CG2   1 
ATOM   820   C  CD1   . ILE B 2  35   ? 314.801 269.468 247.874 1.00 50.38  ? 34   ILE B CD1   1 
ATOM   821   N  N     . ARG B 2  36   ? 310.613 267.364 244.844 1.00 49.79  ? 35   ARG B N     1 
ATOM   822   C  CA    . ARG B 2  36   ? 309.839 267.152 243.636 1.00 49.79  ? 35   ARG B CA    1 
ATOM   823   C  C     . ARG B 2  36   ? 308.355 267.158 243.936 1.00 49.79  ? 35   ARG B C     1 
ATOM   824   O  O     . ARG B 2  36   ? 307.578 267.745 243.193 1.00 49.79  ? 35   ARG B O     1 
ATOM   825   C  CB    . ARG B 2  36   ? 310.268 265.853 242.998 1.00 49.79  ? 35   ARG B CB    1 
ATOM   826   C  CG    . ARG B 2  36   ? 309.463 265.442 241.853 1.00 49.79  ? 35   ARG B CG    1 
ATOM   827   C  CD    . ARG B 2  36   ? 310.097 264.230 241.270 1.00 49.79  ? 35   ARG B CD    1 
ATOM   828   N  NE    . ARG B 2  36   ? 311.464 264.567 240.962 1.00 49.79  ? 35   ARG B NE    1 
ATOM   829   C  CZ    . ARG B 2  36   ? 311.844 265.083 239.811 1.00 49.79  ? 35   ARG B CZ    1 
ATOM   830   N  NH1   . ARG B 2  36   ? 310.956 265.284 238.851 1.00 49.79  ? 35   ARG B NH1   1 
ATOM   831   N  NH2   . ARG B 2  36   ? 313.113 265.382 239.615 1.00 49.79  ? 35   ARG B NH2   1 
ATOM   832   N  N     . ARG B 2  37   ? 307.955 266.578 245.064 1.00 50.90  ? 36   ARG B N     1 
ATOM   833   C  CA    . ARG B 2  37   ? 306.556 266.589 245.469 1.00 50.90  ? 36   ARG B CA    1 
ATOM   834   C  C     . ARG B 2  37   ? 306.079 267.987 245.803 1.00 50.90  ? 36   ARG B C     1 
ATOM   835   O  O     . ARG B 2  37   ? 304.950 268.355 245.471 1.00 50.90  ? 36   ARG B O     1 
ATOM   836   C  CB    . ARG B 2  37   ? 306.355 265.695 246.675 1.00 50.90  ? 36   ARG B CB    1 
ATOM   837   C  CG    . ARG B 2  37   ? 306.276 264.256 246.358 1.00 50.90  ? 36   ARG B CG    1 
ATOM   838   C  CD    . ARG B 2  37   ? 305.721 263.522 247.525 1.00 50.90  ? 36   ARG B CD    1 
ATOM   839   N  NE    . ARG B 2  37   ? 306.738 263.231 248.509 1.00 50.90  ? 36   ARG B NE    1 
ATOM   840   C  CZ    . ARG B 2  37   ? 307.405 262.094 248.545 1.00 50.90  ? 36   ARG B CZ    1 
ATOM   841   N  NH1   . ARG B 2  37   ? 307.157 261.164 247.647 1.00 50.90  ? 36   ARG B NH1   1 
ATOM   842   N  NH2   . ARG B 2  37   ? 308.315 261.891 249.474 1.00 50.90  ? 36   ARG B NH2   1 
ATOM   843   N  N     . LEU B 2  38   ? 306.915 268.778 246.468 1.00 51.05  ? 37   LEU B N     1 
ATOM   844   C  CA    . LEU B 2  38   ? 306.536 270.160 246.747 1.00 51.05  ? 37   LEU B CA    1 
ATOM   845   C  C     . LEU B 2  38   ? 306.443 270.981 245.474 1.00 51.05  ? 37   LEU B C     1 
ATOM   846   O  O     . LEU B 2  38   ? 305.603 271.877 245.363 1.00 51.05  ? 37   LEU B O     1 
ATOM   847   C  CB    . LEU B 2  38   ? 307.532 270.796 247.697 1.00 51.05  ? 37   LEU B CB    1 
ATOM   848   C  CG    . LEU B 2  38   ? 307.380 270.316 249.115 1.00 51.05  ? 37   LEU B CG    1 
ATOM   849   C  CD1   . LEU B 2  38   ? 308.604 270.661 249.858 1.00 51.05  ? 37   LEU B CD1   1 
ATOM   850   C  CD2   . LEU B 2  38   ? 306.217 271.007 249.716 1.00 51.05  ? 37   LEU B CD2   1 
ATOM   851   N  N     . ALA B 2  39   ? 307.286 270.683 244.493 1.00 50.50  ? 38   ALA B N     1 
ATOM   852   C  CA    . ALA B 2  39   ? 307.176 271.355 243.212 1.00 50.50  ? 38   ALA B CA    1 
ATOM   853   C  C     . ALA B 2  39   ? 305.899 270.967 242.500 1.00 50.50  ? 38   ALA B C     1 
ATOM   854   O  O     . ALA B 2  39   ? 305.213 271.828 241.953 1.00 50.50  ? 38   ALA B O     1 
ATOM   855   C  CB    . ALA B 2  39   ? 308.376 271.023 242.342 1.00 50.50  ? 38   ALA B CB    1 
ATOM   856   N  N     . ARG B 2  40   ? 305.555 269.683 242.508 1.00 51.17  ? 39   ARG B N     1 
ATOM   857   C  CA    . ARG B 2  40   ? 304.367 269.241 241.794 1.00 51.17  ? 39   ARG B CA    1 
ATOM   858   C  C     . ARG B 2  40   ? 303.108 269.732 242.475 1.00 51.17  ? 39   ARG B C     1 
ATOM   859   O  O     . ARG B 2  40   ? 302.087 269.933 241.818 1.00 51.17  ? 39   ARG B O     1 
ATOM   860   C  CB    . ARG B 2  40   ? 304.344 267.731 241.677 1.00 51.17  ? 39   ARG B CB    1 
ATOM   861   C  CG    . ARG B 2  40   ? 305.478 267.164 240.896 1.00 51.17  ? 39   ARG B CG    1 
ATOM   862   C  CD    . ARG B 2  40   ? 305.241 267.137 239.447 1.00 51.17  ? 39   ARG B CD    1 
ATOM   863   N  NE    . ARG B 2  40   ? 305.988 266.050 238.857 1.00 51.17  ? 39   ARG B NE    1 
ATOM   864   C  CZ    . ARG B 2  40   ? 307.175 266.202 238.302 1.00 51.17  ? 39   ARG B CZ    1 
ATOM   865   N  NH1   . ARG B 2  40   ? 307.718 267.402 238.263 1.00 51.17  ? 39   ARG B NH1   1 
ATOM   866   N  NH2   . ARG B 2  40   ? 307.812 265.163 237.788 1.00 51.17  ? 39   ARG B NH2   1 
ATOM   867   N  N     . ARG B 2  41   ? 303.151 269.944 243.786 1.00 53.90  ? 40   ARG B N     1 
ATOM   868   C  CA    . ARG B 2  41   ? 302.034 270.629 244.417 1.00 53.90  ? 40   ARG B CA    1 
ATOM   869   C  C     . ARG B 2  41   ? 302.029 272.093 244.036 1.00 53.90  ? 40   ARG B C     1 
ATOM   870   O  O     . ARG B 2  41   ? 300.966 272.693 243.865 1.00 53.90  ? 40   ARG B O     1 
ATOM   871   C  CB    . ARG B 2  41   ? 302.084 270.477 245.928 1.00 53.90  ? 40   ARG B CB    1 
ATOM   872   C  CG    . ARG B 2  41   ? 300.915 271.129 246.631 1.00 53.90  ? 40   ARG B CG    1 
ATOM   873   C  CD    . ARG B 2  41   ? 300.775 270.710 248.055 1.00 53.90  ? 40   ARG B CD    1 
ATOM   874   N  NE    . ARG B 2  41   ? 300.037 269.471 248.164 1.00 53.90  ? 40   ARG B NE    1 
ATOM   875   C  CZ    . ARG B 2  41   ? 299.938 268.772 249.280 1.00 53.90  ? 40   ARG B CZ    1 
ATOM   876   N  NH1   . ARG B 2  41   ? 300.526 269.205 250.383 1.00 53.90  ? 40   ARG B NH1   1 
ATOM   877   N  NH2   . ARG B 2  41   ? 299.246 267.649 249.297 1.00 53.90  ? 40   ARG B NH2   1 
ATOM   878   N  N     . GLY B 2  42   ? 303.205 272.681 243.845 1.00 52.09  ? 41   GLY B N     1 
ATOM   879   C  CA    . GLY B 2  42   ? 303.250 274.055 243.389 1.00 52.09  ? 41   GLY B CA    1 
ATOM   880   C  C     . GLY B 2  42   ? 302.815 274.242 241.959 1.00 52.09  ? 41   GLY B C     1 
ATOM   881   O  O     . GLY B 2  42   ? 302.516 275.362 241.556 1.00 52.09  ? 41   GLY B O     1 
ATOM   882   N  N     . GLY B 2  43   ? 302.758 273.177 241.186 1.00 50.31  ? 42   GLY B N     1 
ATOM   883   C  CA    . GLY B 2  43   ? 302.268 273.285 239.836 1.00 50.31  ? 42   GLY B CA    1 
ATOM   884   C  C     . GLY B 2  43   ? 303.415 273.404 238.874 1.00 50.31  ? 42   GLY B C     1 
ATOM   885   O  O     . GLY B 2  43   ? 303.326 274.104 237.867 1.00 50.31  ? 42   GLY B O     1 
ATOM   886   N  N     . VAL B 2  44   ? 304.500 272.713 239.184 1.00 48.45  ? 43   VAL B N     1 
ATOM   887   C  CA    . VAL B 2  44   ? 305.727 272.791 238.427 1.00 48.45  ? 43   VAL B CA    1 
ATOM   888   C  C     . VAL B 2  44   ? 305.814 271.552 237.562 1.00 48.45  ? 43   VAL B C     1 
ATOM   889   O  O     . VAL B 2  44   ? 305.909 270.436 238.074 1.00 48.45  ? 43   VAL B O     1 
ATOM   890   C  CB    . VAL B 2  44   ? 306.938 272.904 239.341 1.00 48.45  ? 43   VAL B CB    1 
ATOM   891   C  CG1   . VAL B 2  44   ? 308.140 273.025 238.515 1.00 48.45  ? 43   VAL B CG1   1 
ATOM   892   C  CG2   . VAL B 2  44   ? 306.800 274.103 240.213 1.00 48.45  ? 43   VAL B CG2   1 
ATOM   893   N  N     . LYS B 2  45   ? 305.794 271.739 236.252 1.00 50.66  ? 44   LYS B N     1 
ATOM   894   C  CA    . LYS B 2  45   ? 305.728 270.598 235.355 1.00 50.66  ? 44   LYS B CA    1 
ATOM   895   C  C     . LYS B 2  45   ? 307.081 269.916 235.242 1.00 50.66  ? 44   LYS B C     1 
ATOM   896   O  O     . LYS B 2  45   ? 307.244 268.763 235.647 1.00 50.66  ? 44   LYS B O     1 
ATOM   897   C  CB    . LYS B 2  45   ? 305.229 271.060 233.997 1.00 50.66  ? 44   LYS B CB    1 
ATOM   898   C  CG    . LYS B 2  45   ? 304.729 269.959 233.116 1.00 50.66  ? 44   LYS B CG    1 
ATOM   899   C  CD    . LYS B 2  45   ? 304.050 270.515 231.883 1.00 50.66  ? 44   LYS B CD    1 
ATOM   900   C  CE    . LYS B 2  45   ? 304.499 269.795 230.631 1.00 50.66  ? 44   LYS B CE    1 
ATOM   901   N  NZ    . LYS B 2  45   ? 303.823 270.312 229.411 1.00 50.66  ? 44   LYS B NZ    1 
ATOM   902   N  N     . ARG B 2  46   ? 308.066 270.617 234.712 1.00 49.36  ? 45   ARG B N     1 
ATOM   903   C  CA    . ARG B 2  46   ? 309.428 270.130 234.644 1.00 49.36  ? 45   ARG B CA    1 
ATOM   904   C  C     . ARG B 2  46   ? 310.246 270.935 235.639 1.00 49.36  ? 45   ARG B C     1 
ATOM   905   O  O     . ARG B 2  46   ? 309.971 272.106 235.865 1.00 49.36  ? 45   ARG B O     1 
ATOM   906   C  CB    . ARG B 2  46   ? 309.973 270.263 233.225 1.00 49.36  ? 45   ARG B CB    1 
ATOM   907   C  CG    . ARG B 2  46   ? 311.370 269.806 233.062 1.00 49.36  ? 45   ARG B CG    1 
ATOM   908   C  CD    . ARG B 2  46   ? 311.898 269.927 231.693 1.00 49.36  ? 45   ARG B CD    1 
ATOM   909   N  NE    . ARG B 2  46   ? 311.505 268.807 230.870 1.00 49.36  ? 45   ARG B NE    1 
ATOM   910   C  CZ    . ARG B 2  46   ? 312.278 268.305 229.922 1.00 49.36  ? 45   ARG B CZ    1 
ATOM   911   N  NH1   . ARG B 2  46   ? 311.868 267.284 229.192 1.00 49.36  ? 45   ARG B NH1   1 
ATOM   912   N  NH2   . ARG B 2  46   ? 313.478 268.819 229.725 1.00 49.36  ? 45   ARG B NH2   1 
ATOM   913   N  N     . ILE B 2  47   ? 311.204 270.294 236.283 1.00 49.13  ? 46   ILE B N     1 
ATOM   914   C  CA    . ILE B 2  47   ? 312.021 270.931 237.303 1.00 49.13  ? 46   ILE B CA    1 
ATOM   915   C  C     . ILE B 2  47   ? 313.477 270.566 237.073 1.00 49.13  ? 46   ILE B C     1 
ATOM   916   O  O     . ILE B 2  47   ? 313.813 269.396 236.891 1.00 49.13  ? 46   ILE B O     1 
ATOM   917   C  CB    . ILE B 2  47   ? 311.533 270.541 238.707 1.00 49.13  ? 46   ILE B CB    1 
ATOM   918   C  CG1   . ILE B 2  47   ? 312.529 270.945 239.766 1.00 49.13  ? 46   ILE B CG1   1 
ATOM   919   C  CG2   . ILE B 2  47   ? 311.193 269.101 238.810 1.00 49.13  ? 46   ILE B CG2   1 
ATOM   920   C  CD1   . ILE B 2  47   ? 312.001 270.760 241.123 1.00 49.13  ? 46   ILE B CD1   1 
ATOM   921   N  N     . SER B 2  48   ? 314.337 271.579 237.032 1.00 50.42  ? 47   SER B N     1 
ATOM   922   C  CA    . SER B 2  48   ? 315.746 271.386 236.741 1.00 50.42  ? 47   SER B CA    1 
ATOM   923   C  C     . SER B 2  48   ? 316.473 270.760 237.914 1.00 50.42  ? 47   SER B C     1 
ATOM   924   O  O     . SER B 2  48   ? 316.034 270.822 239.056 1.00 50.42  ? 47   SER B O     1 
ATOM   925   C  CB    . SER B 2  48   ? 316.419 272.697 236.402 1.00 50.42  ? 47   SER B CB    1 
ATOM   926   O  OG    . SER B 2  48   ? 317.784 272.628 236.737 1.00 50.42  ? 47   SER B OG    1 
ATOM   927   N  N     . GLY B 2  49   ? 317.637 270.190 237.616 1.00 53.12  ? 48   GLY B N     1 
ATOM   928   C  CA    . GLY B 2  49   ? 318.232 269.233 238.527 1.00 53.12  ? 48   GLY B CA    1 
ATOM   929   C  C     . GLY B 2  49   ? 319.026 269.862 239.648 1.00 53.12  ? 48   GLY B C     1 
ATOM   930   O  O     . GLY B 2  49   ? 319.301 269.216 240.657 1.00 53.12  ? 48   GLY B O     1 
ATOM   931   N  N     . LEU B 2  50   ? 319.434 271.104 239.489 1.00 51.48  ? 49   LEU B N     1 
ATOM   932   C  CA    . LEU B 2  50   ? 320.156 271.768 240.557 1.00 51.48  ? 49   LEU B CA    1 
ATOM   933   C  C     . LEU B 2  50   ? 319.264 272.701 241.337 1.00 51.48  ? 49   LEU B C     1 
ATOM   934   O  O     . LEU B 2  50   ? 319.752 273.606 242.007 1.00 51.48  ? 49   LEU B O     1 
ATOM   935   C  CB    . LEU B 2  50   ? 321.382 272.488 240.002 1.00 51.48  ? 49   LEU B CB    1 
ATOM   936   C  CG    . LEU B 2  50   ? 321.363 273.726 239.119 1.00 51.48  ? 49   LEU B CG    1 
ATOM   937   C  CD1   . LEU B 2  50   ? 322.731 274.339 239.176 1.00 51.48  ? 49   LEU B CD1   1 
ATOM   938   C  CD2   . LEU B 2  50   ? 321.023 273.412 237.685 1.00 51.48  ? 49   LEU B CD2   1 
ATOM   939   N  N     . ILE B 2  51   ? 317.957 272.485 241.259 1.00 50.97  ? 50   ILE B N     1 
ATOM   940   C  CA    . ILE B 2  51   ? 317.013 273.204 242.080 1.00 50.97  ? 50   ILE B CA    1 
ATOM   941   C  C     . ILE B 2  51   ? 317.133 272.799 243.523 1.00 50.97  ? 50   ILE B C     1 
ATOM   942   O  O     . ILE B 2  51   ? 317.178 273.672 244.394 1.00 50.97  ? 50   ILE B O     1 
ATOM   943   C  CB    . ILE B 2  51   ? 315.599 272.942 241.548 1.00 50.97  ? 50   ILE B CB    1 
ATOM   944   C  CG1   . ILE B 2  51   ? 315.323 273.825 240.358 1.00 50.97  ? 50   ILE B CG1   1 
ATOM   945   C  CG2   . ILE B 2  51   ? 314.557 273.180 242.575 1.00 50.97  ? 50   ILE B CG2   1 
ATOM   946   C  CD1   . ILE B 2  51   ? 315.233 275.258 240.690 1.00 50.97  ? 50   ILE B CD1   1 
ATOM   947   N  N     . TYR B 2  52   ? 317.259 271.491 243.772 1.00 52.12  ? 51   TYR B N     1 
ATOM   948   C  CA    . TYR B 2  52   ? 317.045 270.909 245.089 1.00 52.12  ? 51   TYR B CA    1 
ATOM   949   C  C     . TYR B 2  52   ? 318.003 271.472 246.115 1.00 52.12  ? 51   TYR B C     1 
ATOM   950   O  O     . TYR B 2  52   ? 317.573 271.905 247.191 1.00 52.12  ? 51   TYR B O     1 
ATOM   951   C  CB    . TYR B 2  52   ? 317.198 269.402 245.019 1.00 52.12  ? 51   TYR B CB    1 
ATOM   952   C  CG    . TYR B 2  52   ? 316.524 268.781 243.845 1.00 52.12  ? 51   TYR B CG    1 
ATOM   953   C  CD1   . TYR B 2  52   ? 315.155 268.743 243.753 1.00 52.12  ? 51   TYR B CD1   1 
ATOM   954   C  CD2   . TYR B 2  52   ? 317.258 268.221 242.833 1.00 52.12  ? 51   TYR B CD2   1 
ATOM   955   C  CE1   . TYR B 2  52   ? 314.538 268.174 242.677 1.00 52.12  ? 51   TYR B CE1   1 
ATOM   956   C  CE2   . TYR B 2  52   ? 316.652 267.652 241.754 1.00 52.12  ? 51   TYR B CE2   1 
ATOM   957   C  CZ    . TYR B 2  52   ? 315.291 267.628 241.682 1.00 52.12  ? 51   TYR B CZ    1 
ATOM   958   O  OH    . TYR B 2  52   ? 314.689 267.054 240.595 1.00 52.12  ? 51   TYR B OH    1 
ATOM   959   N  N     . GLU B 2  53   ? 319.287 271.513 245.768 1.00 54.76  ? 52   GLU B N     1 
ATOM   960   C  CA    . GLU B 2  53   ? 320.334 272.143 246.556 1.00 54.76  ? 52   GLU B CA    1 
ATOM   961   C  C     . GLU B 2  53   ? 319.950 273.553 246.943 1.00 54.76  ? 52   GLU B C     1 
ATOM   962   O  O     . GLU B 2  53   ? 319.868 273.884 248.131 1.00 54.76  ? 52   GLU B O     1 
ATOM   963   C  CB    . GLU B 2  53   ? 321.615 272.146 245.733 1.00 54.76  ? 52   GLU B CB    1 
ATOM   964   C  CG    . GLU B 2  53   ? 322.270 270.795 245.601 1.00 54.76  ? 52   GLU B CG    1 
ATOM   965   C  CD    . GLU B 2  53   ? 321.654 269.905 244.536 1.00 54.76  ? 52   GLU B CD    1 
ATOM   966   O  OE1   . GLU B 2  53   ? 320.634 270.285 243.933 1.00 54.76  ? 52   GLU B OE1   1 
ATOM   967   O  OE2   . GLU B 2  53   ? 322.189 268.804 244.304 1.00 54.76  ? 52   GLU B OE2   1 
ATOM   968   N  N     . GLU B 2  54   ? 319.601 274.336 245.922 1.00 53.77  ? 53   GLU B N     1 
ATOM   969   C  CA    . GLU B 2  54   ? 319.061 275.675 246.091 1.00 53.77  ? 53   GLU B CA    1 
ATOM   970   C  C     . GLU B 2  54   ? 317.864 275.686 247.021 1.00 53.77  ? 53   GLU B C     1 
ATOM   971   O  O     . GLU B 2  54   ? 317.838 276.437 248.002 1.00 53.77  ? 53   GLU B O     1 
ATOM   972   C  CB    . GLU B 2  54   ? 318.671 276.227 244.732 1.00 53.77  ? 53   GLU B CB    1 
ATOM   973   C  CG    . GLU B 2  54   ? 318.151 277.612 244.787 1.00 53.77  ? 53   GLU B CG    1 
ATOM   974   C  CD    . GLU B 2  54   ? 319.248 278.620 244.616 1.00 53.77  ? 53   GLU B CD    1 
ATOM   975   O  OE1   . GLU B 2  54   ? 320.205 278.325 243.873 1.00 53.77  ? 53   GLU B OE1   1 
ATOM   976   O  OE2   . GLU B 2  54   ? 319.168 279.700 245.240 1.00 53.77  ? 53   GLU B OE2   1 
ATOM   977   N  N     . THR B 2  55   ? 316.909 274.786 246.775 1.00 51.92  ? 54   THR B N     1 
ATOM   978   C  CA    . THR B 2  55   ? 315.719 274.727 247.607 1.00 51.92  ? 54   THR B CA    1 
ATOM   979   C  C     . THR B 2  55   ? 316.070 274.324 249.011 1.00 51.92  ? 54   THR B C     1 
ATOM   980   O  O     . THR B 2  55   ? 315.554 274.915 249.964 1.00 51.92  ? 54   THR B O     1 
ATOM   981   C  CB    . THR B 2  55   ? 314.724 273.742 247.041 1.00 51.92  ? 54   THR B CB    1 
ATOM   982   O  OG1   . THR B 2  55   ? 314.482 274.068 245.681 1.00 51.92  ? 54   THR B OG1   1 
ATOM   983   C  CG2   . THR B 2  55   ? 313.438 273.839 247.786 1.00 51.92  ? 54   THR B CG2   1 
ATOM   984   N  N     . ARG B 2  56   ? 317.023 273.393 249.144 1.00 52.13  ? 55   ARG B N     1 
ATOM   985   C  CA    . ARG B 2  56   ? 317.484 272.988 250.459 1.00 52.13  ? 55   ARG B CA    1 
ATOM   986   C  C     . ARG B 2  56   ? 318.065 274.175 251.194 1.00 52.13  ? 55   ARG B C     1 
ATOM   987   O  O     . ARG B 2  56   ? 317.666 274.450 252.334 1.00 52.13  ? 55   ARG B O     1 
ATOM   988   C  CB    . ARG B 2  56   ? 318.499 271.863 250.332 1.00 52.13  ? 55   ARG B CB    1 
ATOM   989   C  CG    . ARG B 2  56   ? 317.869 270.512 250.171 1.00 52.13  ? 55   ARG B CG    1 
ATOM   990   C  CD    . ARG B 2  56   ? 318.904 269.471 249.901 1.00 52.13  ? 55   ARG B CD    1 
ATOM   991   N  NE    . ARG B 2  56   ? 318.385 268.412 249.054 1.00 52.13  ? 55   ARG B NE    1 
ATOM   992   C  CZ    . ARG B 2  56   ? 319.151 267.610 248.337 1.00 52.13  ? 55   ARG B CZ    1 
ATOM   993   N  NH1   . ARG B 2  56   ? 320.456 267.757 248.375 1.00 52.13  ? 55   ARG B NH1   1 
ATOM   994   N  NH2   . ARG B 2  56   ? 318.619 266.672 247.587 1.00 52.13  ? 55   ARG B NH2   1 
ATOM   995   N  N     . GLY B 2  57   ? 318.844 274.985 250.470 1.00 52.98  ? 56   GLY B N     1 
ATOM   996   C  CA    . GLY B 2  57   ? 319.374 276.208 251.036 1.00 52.98  ? 56   GLY B CA    1 
ATOM   997   C  C     . GLY B 2  57   ? 318.280 277.145 251.482 1.00 52.98  ? 56   GLY B C     1 
ATOM   998   O  O     . GLY B 2  57   ? 318.265 277.560 252.642 1.00 52.98  ? 56   GLY B O     1 
ATOM   999   N  N     . VAL B 2  58   ? 317.272 277.341 250.621 1.00 52.02  ? 57   VAL B N     1 
ATOM   1000  C  CA    . VAL B 2  58   ? 316.166 278.239 250.932 1.00 52.02  ? 57   VAL B CA    1 
ATOM   1001  C  C     . VAL B 2  58   ? 315.421 277.741 252.145 1.00 52.02  ? 57   VAL B C     1 
ATOM   1002  O  O     . VAL B 2  58   ? 315.155 278.512 253.075 1.00 52.02  ? 57   VAL B O     1 
ATOM   1003  C  CB    . VAL B 2  58   ? 315.222 278.375 249.727 1.00 52.02  ? 57   VAL B CB    1 
ATOM   1004  C  CG1   . VAL B 2  58   ? 313.961 279.074 250.130 1.00 52.02  ? 57   VAL B CG1   1 
ATOM   1005  C  CG2   . VAL B 2  58   ? 315.894 279.121 248.620 1.00 52.02  ? 57   VAL B CG2   1 
ATOM   1006  N  N     . LEU B 2  59   ? 315.246 276.422 252.229 1.00 53.81  ? 58   LEU B N     1 
ATOM   1007  C  CA    . LEU B 2  59   ? 314.466 275.854 253.311 1.00 53.81  ? 58   LEU B CA    1 
ATOM   1008  C  C     . LEU B 2  59   ? 315.176 276.069 254.616 1.00 53.81  ? 58   LEU B C     1 
ATOM   1009  O  O     . LEU B 2  59   ? 314.555 276.494 255.599 1.00 53.81  ? 58   LEU B O     1 
ATOM   1010  C  CB    . LEU B 2  59   ? 314.242 274.378 253.067 1.00 53.81  ? 58   LEU B CB    1 
ATOM   1011  C  CG    . LEU B 2  59   ? 313.724 273.606 254.257 1.00 53.81  ? 58   LEU B CG    1 
ATOM   1012  C  CD1   . LEU B 2  59   ? 312.320 274.001 254.512 1.00 53.81  ? 58   LEU B CD1   1 
ATOM   1013  C  CD2   . LEU B 2  59   ? 313.797 272.149 253.953 1.00 53.81  ? 58   LEU B CD2   1 
ATOM   1014  N  N     . LYS B 2  60   ? 316.505 275.966 254.579 1.00 56.17  ? 59   LYS B N     1 
ATOM   1015  C  CA    . LYS B 2  60   ? 317.301 276.113 255.783 1.00 56.17  ? 59   LYS B CA    1 
ATOM   1016  C  C     . LYS B 2  60   ? 317.164 277.508 256.332 1.00 56.17  ? 59   LYS B C     1 
ATOM   1017  O  O     . LYS B 2  60   ? 316.881 277.673 257.523 1.00 56.17  ? 59   LYS B O     1 
ATOM   1018  C  CB    . LYS B 2  60   ? 318.756 275.802 255.491 1.00 56.17  ? 59   LYS B CB    1 
ATOM   1019  C  CG    . LYS B 2  60   ? 319.581 275.592 256.715 1.00 56.17  ? 59   LYS B CG    1 
ATOM   1020  C  CD    . LYS B 2  60   ? 320.992 275.200 256.327 1.00 56.17  ? 59   LYS B CD    1 
ATOM   1021  C  CE    . LYS B 2  60   ? 321.904 275.108 257.528 1.00 56.17  ? 59   LYS B CE    1 
ATOM   1022  N  NZ    . LYS B 2  60   ? 323.317 274.965 257.105 1.00 56.17  ? 59   LYS B NZ    1 
ATOM   1023  N  N     . VAL B 2  61   ? 317.177 278.511 255.447 1.00 56.36  ? 60   VAL B N     1 
ATOM   1024  C  CA    . VAL B 2  61   ? 317.183 279.869 255.965 1.00 56.36  ? 60   VAL B CA    1 
ATOM   1025  C  C     . VAL B 2  61   ? 315.822 280.207 256.523 1.00 56.36  ? 60   VAL B C     1 
ATOM   1026  O  O     . VAL B 2  61   ? 315.733 280.911 257.532 1.00 56.36  ? 60   VAL B O     1 
ATOM   1027  C  CB    . VAL B 2  61   ? 317.665 280.888 254.918 1.00 56.36  ? 60   VAL B CB    1 
ATOM   1028  C  CG1   . VAL B 2  61   ? 318.875 280.365 254.212 1.00 56.36  ? 60   VAL B CG1   1 
ATOM   1029  C  CG2   . VAL B 2  61   ? 316.606 281.280 253.946 1.00 56.36  ? 60   VAL B CG2   1 
ATOM   1030  N  N     . PHE B 2  62   ? 314.777 279.549 256.008 1.00 55.84  ? 61   PHE B N     1 
ATOM   1031  C  CA    . PHE B 2  62   ? 313.447 279.753 256.550 1.00 55.84  ? 61   PHE B CA    1 
ATOM   1032  C  C     . PHE B 2  62   ? 313.395 279.264 257.975 1.00 55.84  ? 61   PHE B C     1 
ATOM   1033  O  O     . PHE B 2  62   ? 313.055 280.022 258.890 1.00 55.84  ? 61   PHE B O     1 
ATOM   1034  C  CB    . PHE B 2  62   ? 312.418 279.025 255.704 1.00 55.84  ? 61   PHE B CB    1 
ATOM   1035  C  CG    . PHE B 2  62   ? 311.031 279.238 256.157 1.00 55.84  ? 61   PHE B CG    1 
ATOM   1036  C  CD1   . PHE B 2  62   ? 310.377 280.400 255.853 1.00 55.84  ? 61   PHE B CD1   1 
ATOM   1037  C  CD2   . PHE B 2  62   ? 310.380 278.287 256.891 1.00 55.84  ? 61   PHE B CD2   1 
ATOM   1038  C  CE1   . PHE B 2  62   ? 309.102 280.608 256.273 1.00 55.84  ? 61   PHE B CE1   1 
ATOM   1039  C  CE2   . PHE B 2  62   ? 309.106 278.497 257.317 1.00 55.84  ? 61   PHE B CE2   1 
ATOM   1040  C  CZ    . PHE B 2  62   ? 308.467 279.656 257.004 1.00 55.84  ? 61   PHE B CZ    1 
ATOM   1041  N  N     . LEU B 2  63   ? 313.906 278.060 258.193 1.00 55.35  ? 62   LEU B N     1 
ATOM   1042  C  CA    . LEU B 2  63   ? 313.911 277.508 259.530 1.00 55.35  ? 62   LEU B CA    1 
ATOM   1043  C  C     . LEU B 2  63   ? 314.862 278.280 260.412 1.00 55.35  ? 62   LEU B C     1 
ATOM   1044  O  O     . LEU B 2  63   ? 314.550 278.553 261.576 1.00 55.35  ? 62   LEU B O     1 
ATOM   1045  C  CB    . LEU B 2  63   ? 314.275 276.034 259.486 1.00 55.35  ? 62   LEU B CB    1 
ATOM   1046  C  CG    . LEU B 2  63   ? 313.114 275.063 259.364 1.00 55.35  ? 62   LEU B CG    1 
ATOM   1047  C  CD1   . LEU B 2  63   ? 312.474 275.125 258.032 1.00 55.35  ? 62   LEU B CD1   1 
ATOM   1048  C  CD2   . LEU B 2  63   ? 313.620 273.697 259.594 1.00 55.35  ? 62   LEU B CD2   1 
ATOM   1049  N  N     . GLU B 2  64   ? 315.943 278.787 259.829 1.00 60.61  ? 63   GLU B N     1 
ATOM   1050  C  CA    . GLU B 2  64   ? 316.932 279.451 260.654 1.00 60.61  ? 63   GLU B CA    1 
ATOM   1051  C  C     . GLU B 2  64   ? 316.436 280.813 261.087 1.00 60.61  ? 63   GLU B C     1 
ATOM   1052  O  O     . GLU B 2  64   ? 316.952 281.395 262.043 1.00 60.61  ? 63   GLU B O     1 
ATOM   1053  C  CB    . GLU B 2  64   ? 318.237 279.566 259.903 1.00 60.61  ? 63   GLU B CB    1 
ATOM   1054  C  CG    . GLU B 2  64   ? 319.020 278.311 259.933 1.00 60.61  ? 63   GLU B CG    1 
ATOM   1055  C  CD    . GLU B 2  64   ? 320.381 278.504 259.345 1.00 60.61  ? 63   GLU B CD    1 
ATOM   1056  O  OE1   . GLU B 2  64   ? 321.257 277.650 259.578 1.00 60.61  ? 63   GLU B OE1   1 
ATOM   1057  O  OE2   . GLU B 2  64   ? 320.582 279.523 258.657 1.00 60.61  ? 63   GLU B OE2   1 
ATOM   1058  N  N     . ASN B 2  65   ? 315.414 281.331 260.415 1.00 59.74  ? 64   ASN B N     1 
ATOM   1059  C  CA    . ASN B 2  65   ? 314.742 282.471 260.993 1.00 59.74  ? 64   ASN B CA    1 
ATOM   1060  C  C     . ASN B 2  65   ? 313.782 281.991 262.051 1.00 59.74  ? 64   ASN B C     1 
ATOM   1061  O  O     . ASN B 2  65   ? 313.929 282.326 263.230 1.00 59.74  ? 64   ASN B O     1 
ATOM   1062  C  CB    . ASN B 2  65   ? 314.030 283.256 259.917 1.00 59.74  ? 64   ASN B CB    1 
ATOM   1063  C  CG    . ASN B 2  65   ? 314.959 283.673 258.836 1.00 59.74  ? 64   ASN B CG    1 
ATOM   1064  O  OD1   . ASN B 2  65   ? 316.171 283.552 258.974 1.00 59.74  ? 64   ASN B OD1   1 
ATOM   1065  N  ND2   . ASN B 2  65   ? 314.411 284.161 257.740 1.00 59.74  ? 64   ASN B ND2   1 
ATOM   1066  N  N     . VAL B 2  66   ? 312.884 281.087 261.657 1.00 57.13  ? 65   VAL B N     1 
ATOM   1067  C  CA    . VAL B 2  66   ? 311.647 280.878 262.400 1.00 57.13  ? 65   VAL B CA    1 
ATOM   1068  C  C     . VAL B 2  66   ? 311.945 280.266 263.744 1.00 57.13  ? 65   VAL B C     1 
ATOM   1069  O  O     . VAL B 2  66   ? 311.603 280.837 264.787 1.00 57.13  ? 65   VAL B O     1 
ATOM   1070  C  CB    . VAL B 2  66   ? 310.674 280.005 261.600 1.00 57.13  ? 65   VAL B CB    1 
ATOM   1071  C  CG1   . VAL B 2  66   ? 309.615 279.465 262.497 1.00 57.13  ? 65   VAL B CG1   1 
ATOM   1072  C  CG2   . VAL B 2  66   ? 310.038 280.815 260.538 1.00 57.13  ? 65   VAL B CG2   1 
ATOM   1073  N  N     . ILE B 2  67   ? 312.710 279.176 263.746 1.00 58.54  ? 66   ILE B N     1 
ATOM   1074  C  CA    . ILE B 2  67   ? 312.929 278.506 264.998 1.00 58.54  ? 66   ILE B CA    1 
ATOM   1075  C  C     . ILE B 2  67   ? 313.877 279.298 265.864 1.00 58.54  ? 66   ILE B C     1 
ATOM   1076  O  O     . ILE B 2  67   ? 313.805 279.157 267.082 1.00 58.54  ? 66   ILE B O     1 
ATOM   1077  C  CB    . ILE B 2  67   ? 313.430 277.070 264.833 1.00 58.54  ? 66   ILE B CB    1 
ATOM   1078  C  CG1   . ILE B 2  67   ? 314.908 277.006 264.651 1.00 58.54  ? 66   ILE B CG1   1 
ATOM   1079  C  CG2   . ILE B 2  67   ? 312.875 276.478 263.595 1.00 58.54  ? 66   ILE B CG2   1 
ATOM   1080  C  CD1   . ILE B 2  67   ? 315.353 275.662 264.977 1.00 58.54  ? 66   ILE B CD1   1 
ATOM   1081  N  N     . ARG B 2  68   ? 314.664 280.212 265.278 1.00 60.79  ? 67   ARG B N     1 
ATOM   1082  C  CA    . ARG B 2  68   ? 315.470 281.097 266.101 1.00 60.79  ? 67   ARG B CA    1 
ATOM   1083  C  C     . ARG B 2  68   ? 314.577 281.955 266.960 1.00 60.79  ? 67   ARG B C     1 
ATOM   1084  O  O     . ARG B 2  68   ? 314.709 281.963 268.189 1.00 60.79  ? 67   ARG B O     1 
ATOM   1085  C  CB    . ARG B 2  68   ? 316.359 281.981 265.251 1.00 60.79  ? 67   ARG B CB    1 
ATOM   1086  C  CG    . ARG B 2  68   ? 316.902 283.132 266.039 1.00 60.79  ? 67   ARG B CG    1 
ATOM   1087  C  CD    . ARG B 2  68   ? 317.362 284.226 265.139 1.00 60.79  ? 67   ARG B CD    1 
ATOM   1088  N  NE    . ARG B 2  68   ? 318.435 283.754 264.285 1.00 60.79  ? 67   ARG B NE    1 
ATOM   1089  C  CZ    . ARG B 2  68   ? 318.640 284.186 263.053 1.00 60.79  ? 67   ARG B CZ    1 
ATOM   1090  N  NH1   . ARG B 2  68   ? 317.838 285.104 262.539 1.00 60.79  ? 67   ARG B NH1   1 
ATOM   1091  N  NH2   . ARG B 2  68   ? 319.643 283.701 262.339 1.00 60.79  ? 67   ARG B NH2   1 
ATOM   1092  N  N     . ASP B 2  69   ? 313.563 282.559 266.338 1.00 59.87  ? 68   ASP B N     1 
ATOM   1093  C  CA    . ASP B 2  69   ? 312.607 283.341 267.098 1.00 59.87  ? 68   ASP B CA    1 
ATOM   1094  C  C     . ASP B 2  69   ? 311.850 282.465 268.065 1.00 59.87  ? 68   ASP B C     1 
ATOM   1095  O  O     . ASP B 2  69   ? 311.634 282.875 269.210 1.00 59.87  ? 68   ASP B O     1 
ATOM   1096  C  CB    . ASP B 2  69   ? 311.655 284.058 266.160 1.00 59.87  ? 68   ASP B CB    1 
ATOM   1097  C  CG    . ASP B 2  69   ? 312.372 285.000 265.219 1.00 59.87  ? 68   ASP B CG    1 
ATOM   1098  O  OD1   . ASP B 2  69   ? 313.616 285.057 265.260 1.00 59.87  ? 68   ASP B OD1   1 
ATOM   1099  O  OD2   . ASP B 2  69   ? 311.698 285.697 264.440 1.00 59.87  ? 68   ASP B OD2   1 
ATOM   1100  N  N     . ALA B 2  70   ? 311.606 281.209 267.682 1.00 58.18  ? 69   ALA B N     1 
ATOM   1101  C  CA    . ALA B 2  70   ? 310.887 280.298 268.554 1.00 58.18  ? 69   ALA B CA    1 
ATOM   1102  C  C     . ALA B 2  70   ? 311.681 280.025 269.812 1.00 58.18  ? 69   ALA B C     1 
ATOM   1103  O  O     . ALA B 2  70   ? 311.140 280.127 270.919 1.00 58.18  ? 69   ALA B O     1 
ATOM   1104  C  CB    . ALA B 2  70   ? 310.571 279.004 267.828 1.00 58.18  ? 69   ALA B CB    1 
ATOM   1105  N  N     . VAL B 2  71   ? 312.998 279.827 269.679 1.00 56.45  ? 70   VAL B N     1 
ATOM   1106  C  CA    . VAL B 2  71   ? 313.724 279.496 270.892 1.00 56.45  ? 70   VAL B CA    1 
ATOM   1107  C  C     . VAL B 2  71   ? 313.898 280.726 271.744 1.00 56.45  ? 70   VAL B C     1 
ATOM   1108  O  O     . VAL B 2  71   ? 313.987 280.592 272.968 1.00 56.45  ? 70   VAL B O     1 
ATOM   1109  C  CB    . VAL B 2  71   ? 315.076 278.807 270.643 1.00 56.45  ? 70   VAL B CB    1 
ATOM   1110  C  CG1   . VAL B 2  71   ? 314.918 277.685 269.696 1.00 56.45  ? 70   VAL B CG1   1 
ATOM   1111  C  CG2   . VAL B 2  71   ? 316.099 279.756 270.152 1.00 56.45  ? 70   VAL B CG2   1 
ATOM   1112  N  N     . THR B 2  72   ? 313.808 281.919 271.142 1.00 55.44  ? 71   THR B N     1 
ATOM   1113  C  CA    . THR B 2  72   ? 313.841 283.129 271.939 1.00 55.44  ? 71   THR B CA    1 
ATOM   1114  C  C     . THR B 2  72   ? 312.636 283.173 272.848 1.00 55.44  ? 71   THR B C     1 
ATOM   1115  O  O     . THR B 2  72   ? 312.777 283.358 274.063 1.00 55.44  ? 71   THR B O     1 
ATOM   1116  C  CB    . THR B 2  72   ? 313.884 284.357 271.048 1.00 55.44  ? 71   THR B CB    1 
ATOM   1117  O  OG1   . THR B 2  72   ? 315.040 284.301 270.211 1.00 55.44  ? 71   THR B OG1   1 
ATOM   1118  C  CG2   . THR B 2  72   ? 313.975 285.567 271.907 1.00 55.44  ? 71   THR B CG2   1 
ATOM   1119  N  N     . TYR B 2  73   ? 311.471 282.824 272.292 1.00 55.68  ? 72   TYR B N     1 
ATOM   1120  C  CA    . TYR B 2  73   ? 310.260 282.750 273.085 1.00 55.68  ? 72   TYR B CA    1 
ATOM   1121  C  C     . TYR B 2  73   ? 310.397 281.693 274.152 1.00 55.68  ? 72   TYR B C     1 
ATOM   1122  O  O     . TYR B 2  73   ? 310.086 281.943 275.322 1.00 55.68  ? 72   TYR B O     1 
ATOM   1123  C  CB    . TYR B 2  73   ? 309.077 282.445 272.187 1.00 55.68  ? 72   TYR B CB    1 
ATOM   1124  C  CG    . TYR B 2  73   ? 308.484 283.651 271.539 1.00 55.68  ? 72   TYR B CG    1 
ATOM   1125  C  CD1   . TYR B 2  73   ? 307.693 284.515 272.257 1.00 55.68  ? 72   TYR B CD1   1 
ATOM   1126  C  CD2   . TYR B 2  73   ? 308.699 283.919 270.211 1.00 55.68  ? 72   TYR B CD2   1 
ATOM   1127  C  CE1   . TYR B 2  73   ? 307.139 285.614 271.673 1.00 55.68  ? 72   TYR B CE1   1 
ATOM   1128  C  CE2   . TYR B 2  73   ? 308.152 285.018 269.620 1.00 55.68  ? 72   TYR B CE2   1 
ATOM   1129  C  CZ    . TYR B 2  73   ? 307.372 285.861 270.361 1.00 55.68  ? 72   TYR B CZ    1 
ATOM   1130  O  OH    . TYR B 2  73   ? 306.807 286.973 269.798 1.00 55.68  ? 72   TYR B OH    1 
ATOM   1131  N  N     . THR B 2  74   ? 311.021 280.571 273.790 1.00 56.97  ? 73   THR B N     1 
ATOM   1132  C  CA    . THR B 2  74   ? 311.218 279.486 274.733 1.00 56.97  ? 73   THR B CA    1 
ATOM   1133  C  C     . THR B 2  74   ? 312.149 279.912 275.842 1.00 56.97  ? 73   THR B C     1 
ATOM   1134  O  O     . THR B 2  74   ? 311.850 279.734 277.024 1.00 56.97  ? 73   THR B O     1 
ATOM   1135  C  CB    . THR B 2  74   ? 311.783 278.290 274.011 1.00 56.97  ? 73   THR B CB    1 
ATOM   1136  O  OG1   . THR B 2  74   ? 311.066 278.118 272.796 1.00 56.97  ? 73   THR B OG1   1 
ATOM   1137  C  CG2   . THR B 2  74   ? 311.604 277.104 274.846 1.00 56.97  ? 73   THR B CG2   1 
ATOM   1138  N  N     . GLU B 2  75   ? 313.222 280.608 275.482 1.00 56.89  ? 74   GLU B N     1 
ATOM   1139  C  CA    . GLU B 2  75   ? 314.158 280.959 276.521 1.00 56.89  ? 74   GLU B CA    1 
ATOM   1140  C  C     . GLU B 2  75   ? 313.681 282.168 277.278 1.00 56.89  ? 74   GLU B C     1 
ATOM   1141  O  O     . GLU B 2  75   ? 314.228 282.466 278.337 1.00 56.89  ? 74   GLU B O     1 
ATOM   1142  C  CB    . GLU B 2  75   ? 315.543 281.184 275.946 1.00 56.89  ? 74   GLU B CB    1 
ATOM   1143  C  CG    . GLU B 2  75   ? 315.758 282.543 275.355 1.00 56.89  ? 74   GLU B CG    1 
ATOM   1144  C  CD    . GLU B 2  75   ? 317.200 282.776 274.947 1.00 56.89  ? 74   GLU B CD    1 
ATOM   1145  O  OE1   . GLU B 2  75   ? 317.514 283.867 274.426 1.00 56.89  ? 74   GLU B OE1   1 
ATOM   1146  O  OE2   . GLU B 2  75   ? 318.027 281.867 275.149 1.00 56.89  ? 74   GLU B OE2   1 
ATOM   1147  N  N     . HIS B 2  76   ? 312.645 282.849 276.798 1.00 54.71  ? 75   HIS B N     1 
ATOM   1148  C  CA    . HIS B 2  76   ? 312.083 283.871 277.659 1.00 54.71  ? 75   HIS B CA    1 
ATOM   1149  C  C     . HIS B 2  76   ? 311.188 283.240 278.700 1.00 54.71  ? 75   HIS B C     1 
ATOM   1150  O  O     . HIS B 2  76   ? 311.078 283.741 279.819 1.00 54.71  ? 75   HIS B O     1 
ATOM   1151  C  CB    . HIS B 2  76   ? 311.323 284.915 276.863 1.00 54.71  ? 75   HIS B CB    1 
ATOM   1152  C  CG    . HIS B 2  76   ? 310.727 285.980 277.720 1.00 54.71  ? 75   HIS B CG    1 
ATOM   1153  N  ND1   . HIS B 2  76   ? 309.479 286.503 277.498 1.00 54.71  ? 75   HIS B ND1   1 
ATOM   1154  C  CD2   . HIS B 2  76   ? 311.204 286.609 278.816 1.00 54.71  ? 75   HIS B CD2   1 
ATOM   1155  C  CE1   . HIS B 2  76   ? 309.213 287.413 278.414 1.00 54.71  ? 75   HIS B CE1   1 
ATOM   1156  N  NE2   . HIS B 2  76   ? 310.241 287.492 279.231 1.00 54.71  ? 75   HIS B NE2   1 
ATOM   1157  N  N     . ALA B 2  77   ? 310.591 282.104 278.382 1.00 54.16  ? 76   ALA B N     1 
ATOM   1158  C  CA    . ALA B 2  77   ? 309.696 281.546 279.375 1.00 54.16  ? 76   ALA B CA    1 
ATOM   1159  C  C     . ALA B 2  77   ? 310.393 280.588 280.304 1.00 54.16  ? 76   ALA B C     1 
ATOM   1160  O  O     . ALA B 2  77   ? 309.719 279.861 281.031 1.00 54.16  ? 76   ALA B O     1 
ATOM   1161  C  CB    . ALA B 2  77   ? 308.530 280.858 278.687 1.00 54.16  ? 76   ALA B CB    1 
ATOM   1162  N  N     . LYS B 2  78   ? 311.720 280.541 280.244 1.00 55.42  ? 77   LYS B N     1 
ATOM   1163  C  CA    . LYS B 2  78   ? 312.604 279.750 281.089 1.00 55.42  ? 77   LYS B CA    1 
ATOM   1164  C  C     . LYS B 2  78   ? 312.364 278.256 280.988 1.00 55.42  ? 77   LYS B C     1 
ATOM   1165  O  O     . LYS B 2  78   ? 312.859 277.501 281.815 1.00 55.42  ? 77   LYS B O     1 
ATOM   1166  C  CB    . LYS B 2  78   ? 312.531 280.201 282.545 1.00 55.42  ? 77   LYS B CB    1 
ATOM   1167  C  CG    . LYS B 2  78   ? 313.420 281.389 282.842 1.00 55.42  ? 77   LYS B CG    1 
ATOM   1168  C  CD    . LYS B 2  78   ? 312.722 282.390 283.749 1.00 55.42  ? 77   LYS B CD    1 
ATOM   1169  C  CE    . LYS B 2  78   ? 313.693 283.415 284.307 1.00 55.42  ? 77   LYS B CE    1 
ATOM   1170  N  NZ    . LYS B 2  78   ? 313.033 284.287 285.318 1.00 55.42  ? 77   LYS B NZ    1 
ATOM   1171  N  N     . ARG B 2  79   ? 311.642 277.796 279.980 1.00 62.66  ? 78   ARG B N     1 
ATOM   1172  C  CA    . ARG B 2  79   ? 311.407 276.383 279.783 1.00 62.66  ? 78   ARG B CA    1 
ATOM   1173  C  C     . ARG B 2  79   ? 312.335 275.885 278.701 1.00 62.66  ? 78   ARG B C     1 
ATOM   1174  O  O     . ARG B 2  79   ? 312.907 276.664 277.945 1.00 62.66  ? 78   ARG B O     1 
ATOM   1175  C  CB    . ARG B 2  79   ? 309.964 276.108 279.396 1.00 62.66  ? 78   ARG B CB    1 
ATOM   1176  C  CG    . ARG B 2  79   ? 309.576 276.766 278.151 1.00 62.66  ? 78   ARG B CG    1 
ATOM   1177  C  CD    . ARG B 2  79   ? 308.208 276.363 277.781 1.00 62.66  ? 78   ARG B CD    1 
ATOM   1178  N  NE    . ARG B 2  79   ? 307.765 277.142 276.648 1.00 62.66  ? 78   ARG B NE    1 
ATOM   1179  C  CZ    . ARG B 2  79   ? 306.854 278.093 276.735 1.00 62.66  ? 78   ARG B CZ    1 
ATOM   1180  N  NH1   . ARG B 2  79   ? 306.296 278.364 277.902 1.00 62.66  ? 78   ARG B NH1   1 
ATOM   1181  N  NH2   . ARG B 2  79   ? 306.496 278.768 275.661 1.00 62.66  ? 78   ARG B NH2   1 
ATOM   1182  N  N     . LYS B 2  80   ? 312.489 274.569 278.637 1.00 69.56  ? 79   LYS B N     1 
ATOM   1183  C  CA    . LYS B 2  80   ? 313.395 273.944 277.688 1.00 69.56  ? 79   LYS B CA    1 
ATOM   1184  C  C     . LYS B 2  80   ? 312.635 273.128 276.660 1.00 69.56  ? 79   LYS B C     1 
ATOM   1185  O  O     . LYS B 2  80   ? 313.202 272.263 276.001 1.00 69.56  ? 79   LYS B O     1 
ATOM   1186  C  CB    . LYS B 2  80   ? 314.395 273.070 278.423 1.00 69.56  ? 79   LYS B CB    1 
ATOM   1187  C  CG    . LYS B 2  80   ? 315.099 273.821 279.494 1.00 69.56  ? 79   LYS B CG    1 
ATOM   1188  C  CD    . LYS B 2  80   ? 316.253 273.056 280.039 1.00 69.56  ? 79   LYS B CD    1 
ATOM   1189  C  CE    . LYS B 2  80   ? 317.308 272.914 278.964 1.00 69.56  ? 79   LYS B CE    1 
ATOM   1190  N  NZ    . LYS B 2  80   ? 317.765 274.214 278.396 1.00 69.56  ? 79   LYS B NZ    1 
ATOM   1191  N  N     . THR B 2  81   ? 311.348 273.389 276.521 1.00 67.76  ? 80   THR B N     1 
ATOM   1192  C  CA    . THR B 2  81   ? 310.502 272.667 275.588 1.00 67.76  ? 80   THR B CA    1 
ATOM   1193  C  C     . THR B 2  81   ? 309.961 273.685 274.609 1.00 67.76  ? 80   THR B C     1 
ATOM   1194  O  O     . THR B 2  81   ? 309.189 274.560 274.995 1.00 67.76  ? 80   THR B O     1 
ATOM   1195  C  CB    . THR B 2  81   ? 309.362 271.958 276.304 1.00 67.76  ? 80   THR B CB    1 
ATOM   1196  O  OG1   . THR B 2  81   ? 309.820 271.464 277.561 1.00 67.76  ? 80   THR B OG1   1 
ATOM   1197  C  CG2   . THR B 2  81   ? 308.908 270.792 275.501 1.00 67.76  ? 80   THR B CG2   1 
ATOM   1198  N  N     . VAL B 2  82   ? 310.363 273.591 273.350 1.00 63.05  ? 81   VAL B N     1 
ATOM   1199  C  CA    . VAL B 2  82   ? 309.811 274.500 272.358 1.00 63.05  ? 81   VAL B CA    1 
ATOM   1200  C  C     . VAL B 2  82   ? 308.384 274.061 272.083 1.00 63.05  ? 81   VAL B C     1 
ATOM   1201  O  O     . VAL B 2  82   ? 308.162 273.069 271.394 1.00 63.05  ? 81   VAL B O     1 
ATOM   1202  C  CB    . VAL B 2  82   ? 310.636 274.504 271.076 1.00 63.05  ? 81   VAL B CB    1 
ATOM   1203  C  CG1   . VAL B 2  82   ? 310.043 275.462 270.102 1.00 63.05  ? 81   VAL B CG1   1 
ATOM   1204  C  CG2   . VAL B 2  82   ? 312.033 274.883 271.372 1.00 63.05  ? 81   VAL B CG2   1 
ATOM   1205  N  N     . THR B 2  83   ? 307.415 274.773 272.632 1.00 60.16  ? 82   THR B N     1 
ATOM   1206  C  CA    . THR B 2  83   ? 306.040 274.359 272.462 1.00 60.16  ? 82   THR B CA    1 
ATOM   1207  C  C     . THR B 2  83   ? 305.553 274.733 271.078 1.00 60.16  ? 82   THR B C     1 
ATOM   1208  O  O     . THR B 2  83   ? 306.236 275.402 270.310 1.00 60.16  ? 82   THR B O     1 
ATOM   1209  C  CB    . THR B 2  83   ? 305.150 275.009 273.495 1.00 60.16  ? 82   THR B CB    1 
ATOM   1210  O  OG1   . THR B 2  83   ? 304.875 276.340 273.079 1.00 60.16  ? 82   THR B OG1   1 
ATOM   1211  C  CG2   . THR B 2  83   ? 305.840 275.050 274.801 1.00 60.16  ? 82   THR B CG2   1 
ATOM   1212  N  N     . ALA B 2  84   ? 304.346 274.312 270.753 1.00 59.44  ? 83   ALA B N     1 
ATOM   1213  C  CA    . ALA B 2  84   ? 303.768 274.684 269.480 1.00 59.44  ? 83   ALA B CA    1 
ATOM   1214  C  C     . ALA B 2  84   ? 303.217 276.085 269.482 1.00 59.44  ? 83   ALA B C     1 
ATOM   1215  O  O     . ALA B 2  84   ? 302.974 276.640 268.412 1.00 59.44  ? 83   ALA B O     1 
ATOM   1216  C  CB    . ALA B 2  84   ? 302.650 273.729 269.112 1.00 59.44  ? 83   ALA B CB    1 
ATOM   1217  N  N     . MET B 2  85   ? 302.977 276.662 270.655 1.00 61.34  ? 84   MET B N     1 
ATOM   1218  C  CA    . MET B 2  85   ? 302.544 278.047 270.700 1.00 61.34  ? 84   MET B CA    1 
ATOM   1219  C  C     . MET B 2  85   ? 303.687 278.978 270.387 1.00 61.34  ? 84   MET B C     1 
ATOM   1220  O  O     . MET B 2  85   ? 303.474 280.052 269.825 1.00 61.34  ? 84   MET B O     1 
ATOM   1221  C  CB    . MET B 2  85   ? 301.963 278.382 272.061 1.00 61.34  ? 84   MET B CB    1 
ATOM   1222  C  CG    . MET B 2  85   ? 300.516 278.025 272.164 1.00 61.34  ? 84   MET B CG    1 
ATOM   1223  S  SD    . MET B 2  85   ? 299.643 278.343 270.623 1.00 61.34  ? 84   MET B SD    1 
ATOM   1224  C  CE    . MET B 2  85   ? 299.339 280.093 270.742 1.00 61.34  ? 84   MET B CE    1 
ATOM   1225  N  N     . ASP B 2  86   ? 304.901 278.583 270.728 1.00 60.43  ? 85   ASP B N     1 
ATOM   1226  C  CA    . ASP B 2  86   ? 306.051 279.387 270.390 1.00 60.43  ? 85   ASP B CA    1 
ATOM   1227  C  C     . ASP B 2  86   ? 306.284 279.431 268.904 1.00 60.43  ? 85   ASP B C     1 
ATOM   1228  O  O     . ASP B 2  86   ? 306.687 280.474 268.386 1.00 60.43  ? 85   ASP B O     1 
ATOM   1229  C  CB    . ASP B 2  86   ? 307.273 278.843 271.092 1.00 60.43  ? 85   ASP B CB    1 
ATOM   1230  C  CG    . ASP B 2  86   ? 307.161 278.969 272.573 1.00 60.43  ? 85   ASP B CG    1 
ATOM   1231  O  OD1   . ASP B 2  86   ? 306.643 280.003 273.024 1.00 60.43  ? 85   ASP B OD1   1 
ATOM   1232  O  OD2   . ASP B 2  86   ? 307.558 278.042 273.301 1.00 60.43  ? 85   ASP B OD2   1 
ATOM   1233  N  N     . VAL B 2  87   ? 305.985 278.355 268.197 1.00 56.80  ? 86   VAL B N     1 
ATOM   1234  C  CA    . VAL B 2  87   ? 306.190 278.366 266.764 1.00 56.80  ? 86   VAL B CA    1 
ATOM   1235  C  C     . VAL B 2  87   ? 305.167 279.239 266.077 1.00 56.80  ? 86   VAL B C     1 
ATOM   1236  O  O     . VAL B 2  87   ? 305.507 279.981 265.157 1.00 56.80  ? 86   VAL B O     1 
ATOM   1237  C  CB    . VAL B 2  87   ? 306.170 276.947 266.210 1.00 56.80  ? 86   VAL B CB    1 
ATOM   1238  C  CG1   . VAL B 2  87   ? 306.701 276.969 264.839 1.00 56.80  ? 86   VAL B CG1   1 
ATOM   1239  C  CG2   . VAL B 2  87   ? 307.030 276.087 267.046 1.00 56.80  ? 86   VAL B CG2   1 
ATOM   1240  N  N     . VAL B 2  88   ? 303.916 279.217 266.520 1.00 57.30  ? 87   VAL B N     1 
ATOM   1241  C  CA    . VAL B 2  88   ? 302.953 280.067 265.860 1.00 57.30  ? 87   VAL B CA    1 
ATOM   1242  C  C     . VAL B 2  88   ? 303.116 281.505 266.287 1.00 57.30  ? 87   VAL B C     1 
ATOM   1243  O  O     . VAL B 2  88   ? 302.781 282.400 265.516 1.00 57.30  ? 87   VAL B O     1 
ATOM   1244  C  CB    . VAL B 2  88   ? 301.525 279.562 266.081 1.00 57.30  ? 87   VAL B CB    1 
ATOM   1245  C  CG1   . VAL B 2  88   ? 301.455 278.120 265.722 1.00 57.30  ? 87   VAL B CG1   1 
ATOM   1246  C  CG2   . VAL B 2  88   ? 301.122 279.726 267.489 1.00 57.30  ? 87   VAL B CG2   1 
ATOM   1247  N  N     . TYR B 2  89   ? 303.715 281.764 267.449 1.00 59.34  ? 88   TYR B N     1 
ATOM   1248  C  CA    . TYR B 2  89   ? 304.043 283.140 267.795 1.00 59.34  ? 88   TYR B CA    1 
ATOM   1249  C  C     . TYR B 2  89   ? 305.177 283.658 266.940 1.00 59.34  ? 88   TYR B C     1 
ATOM   1250  O  O     . TYR B 2  89   ? 305.148 284.810 266.514 1.00 59.34  ? 88   TYR B O     1 
ATOM   1251  C  CB    . TYR B 2  89   ? 304.425 283.251 269.252 1.00 59.34  ? 88   TYR B CB    1 
ATOM   1252  C  CG    . TYR B 2  89   ? 303.277 283.160 270.184 1.00 59.34  ? 88   TYR B CG    1 
ATOM   1253  C  CD1   . TYR B 2  89   ? 302.011 283.490 269.777 1.00 59.34  ? 88   TYR B CD1   1 
ATOM   1254  C  CD2   . TYR B 2  89   ? 303.464 282.734 271.478 1.00 59.34  ? 88   TYR B CD2   1 
ATOM   1255  C  CE1   . TYR B 2  89   ? 300.960 283.398 270.628 1.00 59.34  ? 88   TYR B CE1   1 
ATOM   1256  C  CE2   . TYR B 2  89   ? 302.427 282.638 272.344 1.00 59.34  ? 88   TYR B CE2   1 
ATOM   1257  C  CZ    . TYR B 2  89   ? 301.171 282.975 271.921 1.00 59.34  ? 88   TYR B CZ    1 
ATOM   1258  O  OH    . TYR B 2  89   ? 300.123 282.878 272.809 1.00 59.34  ? 88   TYR B OH    1 
ATOM   1259  N  N     . ALA B 2  90   ? 306.173 282.817 266.667 1.00 58.06  ? 89   ALA B N     1 
ATOM   1260  C  CA    . ALA B 2  90   ? 307.282 283.225 265.816 1.00 58.06  ? 89   ALA B CA    1 
ATOM   1261  C  C     . ALA B 2  90   ? 306.829 283.437 264.387 1.00 58.06  ? 89   ALA B C     1 
ATOM   1262  O  O     . ALA B 2  90   ? 307.236 284.405 263.734 1.00 58.06  ? 89   ALA B O     1 
ATOM   1263  C  CB    . ALA B 2  90   ? 308.374 282.176 265.862 1.00 58.06  ? 89   ALA B CB    1 
ATOM   1264  N  N     . LEU B 2  91   ? 305.970 282.556 263.897 1.00 56.53  ? 90   LEU B N     1 
ATOM   1265  C  CA    . LEU B 2  91   ? 305.453 282.691 262.548 1.00 56.53  ? 90   LEU B CA    1 
ATOM   1266  C  C     . LEU B 2  91   ? 304.542 283.897 262.427 1.00 56.53  ? 90   LEU B C     1 
ATOM   1267  O  O     . LEU B 2  91   ? 304.495 284.549 261.382 1.00 56.53  ? 90   LEU B O     1 
ATOM   1268  C  CB    . LEU B 2  91   ? 304.713 281.428 262.166 1.00 56.53  ? 90   LEU B CB    1 
ATOM   1269  C  CG    . LEU B 2  91   ? 305.604 280.261 261.829 1.00 56.53  ? 90   LEU B CG    1 
ATOM   1270  C  CD1   . LEU B 2  91   ? 304.827 279.024 262.046 1.00 56.53  ? 90   LEU B CD1   1 
ATOM   1271  C  CD2   . LEU B 2  91   ? 306.018 280.365 260.413 1.00 56.53  ? 90   LEU B CD2   1 
ATOM   1272  N  N     . LYS B 2  92   ? 303.794 284.202 263.483 1.00 59.37  ? 91   LYS B N     1 
ATOM   1273  C  CA    . LYS B 2  92   ? 302.977 285.398 263.472 1.00 59.37  ? 91   LYS B CA    1 
ATOM   1274  C  C     . LYS B 2  92   ? 303.845 286.635 263.529 1.00 59.37  ? 91   LYS B C     1 
ATOM   1275  O  O     . LYS B 2  92   ? 303.528 287.654 262.910 1.00 59.37  ? 91   LYS B O     1 
ATOM   1276  C  CB    . LYS B 2  92   ? 302.015 285.364 264.651 1.00 59.37  ? 91   LYS B CB    1 
ATOM   1277  C  CG    . LYS B 2  92   ? 301.068 286.528 264.750 1.00 59.37  ? 91   LYS B CG    1 
ATOM   1278  C  CD    . LYS B 2  92   ? 300.141 286.345 265.932 1.00 59.37  ? 91   LYS B CD    1 
ATOM   1279  C  CE    . LYS B 2  92   ? 298.747 286.847 265.614 1.00 59.37  ? 91   LYS B CE    1 
ATOM   1280  N  NZ    . LYS B 2  92   ? 297.705 286.178 266.443 1.00 59.37  ? 91   LYS B NZ    1 
ATOM   1281  N  N     . ARG B 2  93   ? 304.955 286.555 264.258 1.00 60.54  ? 92   ARG B N     1 
ATOM   1282  C  CA    . ARG B 2  93   ? 305.864 287.682 264.390 1.00 60.54  ? 92   ARG B CA    1 
ATOM   1283  C  C     . ARG B 2  93   ? 306.514 288.013 263.063 1.00 60.54  ? 92   ARG B C     1 
ATOM   1284  O  O     . ARG B 2  93   ? 306.687 289.186 262.728 1.00 60.54  ? 92   ARG B O     1 
ATOM   1285  C  CB    . ARG B 2  93   ? 306.921 287.373 265.450 1.00 60.54  ? 92   ARG B CB    1 
ATOM   1286  C  CG    . ARG B 2  93   ? 307.924 288.469 265.681 1.00 60.54  ? 92   ARG B CG    1 
ATOM   1287  C  CD    . ARG B 2  93   ? 309.268 288.099 265.139 1.00 60.54  ? 92   ARG B CD    1 
ATOM   1288  N  NE    . ARG B 2  93   ? 309.955 289.294 264.686 1.00 60.54  ? 92   ARG B NE    1 
ATOM   1289  C  CZ    . ARG B 2  93   ? 311.030 289.284 263.911 1.00 60.54  ? 92   ARG B CZ    1 
ATOM   1290  N  NH1   . ARG B 2  93   ? 311.563 288.137 263.526 1.00 60.54  ? 92   ARG B NH1   1 
ATOM   1291  N  NH2   . ARG B 2  93   ? 311.583 290.423 263.534 1.00 60.54  ? 92   ARG B NH2   1 
ATOM   1292  N  N     . GLN B 2  94   ? 306.871 287.010 262.284 1.00 60.38  ? 93   GLN B N     1 
ATOM   1293  C  CA    . GLN B 2  94   ? 307.379 287.346 260.968 1.00 60.38  ? 93   GLN B CA    1 
ATOM   1294  C  C     . GLN B 2  94   ? 306.303 287.333 259.901 1.00 60.38  ? 93   GLN B C     1 
ATOM   1295  O  O     . GLN B 2  94   ? 306.624 287.340 258.713 1.00 60.38  ? 93   GLN B O     1 
ATOM   1296  C  CB    . GLN B 2  94   ? 308.524 286.428 260.591 1.00 60.38  ? 93   GLN B CB    1 
ATOM   1297  C  CG    . GLN B 2  94   ? 308.169 285.026 260.361 1.00 60.38  ? 93   GLN B CG    1 
ATOM   1298  C  CD    . GLN B 2  94   ? 309.367 284.274 259.917 1.00 60.38  ? 93   GLN B CD    1 
ATOM   1299  O  OE1   . GLN B 2  94   ? 310.396 284.303 260.579 1.00 60.38  ? 93   GLN B OE1   1 
ATOM   1300  N  NE2   . GLN B 2  94   ? 309.269 283.625 258.771 1.00 60.38  ? 93   GLN B NE2   1 
ATOM   1301  N  N     . GLY B 2  95   ? 305.042 287.332 260.295 1.00 61.60  ? 94   GLY B N     1 
ATOM   1302  C  CA    . GLY B 2  95   ? 303.967 287.653 259.394 1.00 61.60  ? 94   GLY B CA    1 
ATOM   1303  C  C     . GLY B 2  95   ? 303.422 286.519 258.568 1.00 61.60  ? 94   GLY B C     1 
ATOM   1304  O  O     . GLY B 2  95   ? 302.817 286.779 257.525 1.00 61.60  ? 94   GLY B O     1 
ATOM   1305  N  N     . ARG B 2  96   ? 303.621 285.273 258.979 1.00 61.61  ? 95   ARG B N     1 
ATOM   1306  C  CA    . ARG B 2  96   ? 303.075 284.123 258.267 1.00 61.61  ? 95   ARG B CA    1 
ATOM   1307  C  C     . ARG B 2  96   ? 302.205 283.367 259.254 1.00 61.61  ? 95   ARG B C     1 
ATOM   1308  O  O     . ARG B 2  96   ? 302.658 282.407 259.863 1.00 61.61  ? 95   ARG B O     1 
ATOM   1309  C  CB    . ARG B 2  96   ? 304.154 283.264 257.745 1.00 61.61  ? 95   ARG B CB    1 
ATOM   1310  C  CG    . ARG B 2  96   ? 305.364 284.005 257.255 1.00 61.61  ? 95   ARG B CG    1 
ATOM   1311  C  CD    . ARG B 2  96   ? 306.268 283.084 256.522 1.00 61.61  ? 95   ARG B CD    1 
ATOM   1312  N  NE    . ARG B 2  96   ? 305.557 282.488 255.408 1.00 61.61  ? 95   ARG B NE    1 
ATOM   1313  C  CZ    . ARG B 2  96   ? 305.552 282.996 254.185 1.00 61.61  ? 95   ARG B CZ    1 
ATOM   1314  N  NH1   . ARG B 2  96   ? 306.242 284.097 253.930 1.00 61.61  ? 95   ARG B NH1   1 
ATOM   1315  N  NH2   . ARG B 2  96   ? 304.870 282.398 253.221 1.00 61.61  ? 95   ARG B NH2   1 
ATOM   1316  N  N     . THR B 2  97   ? 300.957 283.778 259.391 1.00 60.43  ? 96   THR B N     1 
ATOM   1317  C  CA    . THR B 2  97   ? 300.117 283.247 260.449 1.00 60.43  ? 96   THR B CA    1 
ATOM   1318  C  C     . THR B 2  97   ? 299.698 281.821 260.140 1.00 60.43  ? 96   THR B C     1 
ATOM   1319  O  O     . THR B 2  97   ? 299.324 281.500 259.015 1.00 60.43  ? 96   THR B O     1 
ATOM   1320  C  CB    . THR B 2  97   ? 298.894 284.125 260.613 1.00 60.43  ? 96   THR B CB    1 
ATOM   1321  O  OG1   . THR B 2  97   ? 299.315 285.478 260.749 1.00 60.43  ? 96   THR B OG1   1 
ATOM   1322  C  CG2   . THR B 2  97   ? 298.147 283.761 261.856 1.00 60.43  ? 96   THR B CG2   1 
ATOM   1323  N  N     . LEU B 2  98   ? 299.771 280.955 261.141 1.00 59.00  ? 97   LEU B N     1 
ATOM   1324  C  CA    . LEU B 2  98   ? 299.471 279.542 260.977 1.00 59.00  ? 97   LEU B CA    1 
ATOM   1325  C  C     . LEU B 2  98   ? 298.328 279.167 261.899 1.00 59.00  ? 97   LEU B C     1 
ATOM   1326  O  O     . LEU B 2  98   ? 298.446 279.295 263.117 1.00 59.00  ? 97   LEU B O     1 
ATOM   1327  C  CB    . LEU B 2  98   ? 300.702 278.706 261.280 1.00 59.00  ? 97   LEU B CB    1 
ATOM   1328  C  CG    . LEU B 2  98   ? 300.554 277.218 261.508 1.00 59.00  ? 97   LEU B CG    1 
ATOM   1329  C  CD1   . LEU B 2  98   ? 300.449 276.494 260.216 1.00 59.00  ? 97   LEU B CD1   1 
ATOM   1330  C  CD2   . LEU B 2  98   ? 301.765 276.757 262.235 1.00 59.00  ? 97   LEU B CD2   1 
ATOM   1331  N  N     . TYR B 2  99   ? 297.232 278.707 261.318 1.00 59.96  ? 98   TYR B N     1 
ATOM   1332  C  CA    . TYR B 2  99   ? 296.041 278.348 262.063 1.00 59.96  ? 98   TYR B CA    1 
ATOM   1333  C  C     . TYR B 2  99   ? 296.051 276.866 262.360 1.00 59.96  ? 98   TYR B C     1 
ATOM   1334  O  O     . TYR B 2  99   ? 296.433 276.058 261.521 1.00 59.96  ? 98   TYR B O     1 
ATOM   1335  C  CB    . TYR B 2  99   ? 294.780 278.660 261.270 1.00 59.96  ? 98   TYR B CB    1 
ATOM   1336  C  CG    . TYR B 2  99   ? 294.406 280.104 261.193 1.00 59.96  ? 98   TYR B CG    1 
ATOM   1337  C  CD1   . TYR B 2  99   ? 295.117 281.060 261.876 1.00 59.96  ? 98   TYR B CD1   1 
ATOM   1338  C  CD2   . TYR B 2  99   ? 293.331 280.506 260.438 1.00 59.96  ? 98   TYR B CD2   1 
ATOM   1339  C  CE1   . TYR B 2  99   ? 294.779 282.370 261.802 1.00 59.96  ? 98   TYR B CE1   1 
ATOM   1340  C  CE2   . TYR B 2  99   ? 292.983 281.813 260.364 1.00 59.96  ? 98   TYR B CE2   1 
ATOM   1341  C  CZ    . TYR B 2  99   ? 293.717 282.741 261.045 1.00 59.96  ? 98   TYR B CZ    1 
ATOM   1342  O  OH    . TYR B 2  99   ? 293.388 284.064 260.981 1.00 59.96  ? 98   TYR B OH    1 
ATOM   1343  N  N     . GLY B 2  100  ? 295.612 276.509 263.549 1.00 59.07  ? 99   GLY B N     1 
ATOM   1344  C  CA    . GLY B 2  100  ? 295.392 275.108 263.808 1.00 59.07  ? 99   GLY B CA    1 
ATOM   1345  C  C     . GLY B 2  100  ? 296.079 274.572 265.031 1.00 59.07  ? 99   GLY B C     1 
ATOM   1346  O  O     . GLY B 2  100  ? 295.674 273.543 265.567 1.00 59.07  ? 99   GLY B O     1 
ATOM   1347  N  N     . PHE B 2  101  ? 297.152 275.216 265.450 1.00 59.29  ? 100  PHE B N     1 
ATOM   1348  C  CA    . PHE B 2  101  ? 297.878 274.774 266.626 1.00 59.29  ? 100  PHE B CA    1 
ATOM   1349  C  C     . PHE B 2  101  ? 297.617 275.710 267.803 1.00 59.29  ? 100  PHE B C     1 
ATOM   1350  O  O     . PHE B 2  101  ? 298.460 276.491 268.215 1.00 59.29  ? 100  PHE B O     1 
ATOM   1351  C  CB    . PHE B 2  101  ? 299.349 274.654 266.293 1.00 59.29  ? 100  PHE B CB    1 
ATOM   1352  C  CG    . PHE B 2  101  ? 299.611 273.732 265.167 1.00 59.29  ? 100  PHE B CG    1 
ATOM   1353  C  CD1   . PHE B 2  101  ? 299.708 272.386 265.394 1.00 59.29  ? 100  PHE B CD1   1 
ATOM   1354  C  CD2   . PHE B 2  101  ? 299.729 274.198 263.884 1.00 59.29  ? 100  PHE B CD2   1 
ATOM   1355  C  CE1   . PHE B 2  101  ? 299.932 271.530 264.369 1.00 59.29  ? 100  PHE B CE1   1 
ATOM   1356  C  CE2   . PHE B 2  101  ? 299.953 273.340 262.862 1.00 59.29  ? 100  PHE B CE2   1 
ATOM   1357  C  CZ    . PHE B 2  101  ? 300.052 272.005 263.109 1.00 59.29  ? 100  PHE B CZ    1 
ATOM   1358  N  N     . GLY B 2  102  ? 296.427 275.597 268.367 1.00 61.50  ? 101  GLY B N     1 
ATOM   1359  C  CA    . GLY B 2  102  ? 296.074 276.401 269.520 1.00 61.50  ? 101  GLY B CA    1 
ATOM   1360  C  C     . GLY B 2  102  ? 295.904 277.881 269.244 1.00 61.50  ? 101  GLY B C     1 
ATOM   1361  O  O     . GLY B 2  102  ? 296.056 278.342 268.117 1.00 61.50  ? 101  GLY B O     1 
ATOM   1362  N  N     . THR C 3  17   ? 319.204 312.856 288.262 1.00 77.12  ? 16   THR C N     1 
ATOM   1363  C  CA    . THR C 3  17   ? 317.991 312.625 287.497 1.00 77.12  ? 16   THR C CA    1 
ATOM   1364  C  C     . THR C 3  17   ? 317.771 311.152 287.292 1.00 77.12  ? 16   THR C C     1 
ATOM   1365  O  O     . THR C 3  17   ? 317.861 310.380 288.229 1.00 77.12  ? 16   THR C O     1 
ATOM   1366  C  CB    . THR C 3  17   ? 318.047 313.279 286.137 1.00 77.12  ? 16   THR C CB    1 
ATOM   1367  O  OG1   . THR C 3  17   ? 319.078 312.651 285.376 1.00 77.12  ? 16   THR C OG1   1 
ATOM   1368  C  CG2   . THR C 3  17   ? 318.349 314.751 286.270 1.00 77.12  ? 16   THR C CG2   1 
ATOM   1369  N  N     . ARG C 3  18   ? 317.455 310.755 286.065 1.00 71.94  ? 17   ARG C N     1 
ATOM   1370  C  CA    . ARG C 3  18   ? 317.467 309.338 285.750 1.00 71.94  ? 17   ARG C CA    1 
ATOM   1371  C  C     . ARG C 3  18   ? 318.376 309.052 284.567 1.00 71.94  ? 17   ARG C C     1 
ATOM   1372  O  O     . ARG C 3  18   ? 319.073 308.034 284.549 1.00 71.94  ? 17   ARG C O     1 
ATOM   1373  C  CB    . ARG C 3  18   ? 316.060 308.846 285.469 1.00 71.94  ? 17   ARG C CB    1 
ATOM   1374  C  CG    . ARG C 3  18   ? 315.181 308.722 286.681 1.00 71.94  ? 17   ARG C CG    1 
ATOM   1375  C  CD    . ARG C 3  18   ? 314.050 307.786 286.351 1.00 71.94  ? 17   ARG C CD    1 
ATOM   1376  N  NE    . ARG C 3  18   ? 312.831 308.092 287.072 1.00 71.94  ? 17   ARG C NE    1 
ATOM   1377  C  CZ    . ARG C 3  18   ? 311.646 307.628 286.711 1.00 71.94  ? 17   ARG C CZ    1 
ATOM   1378  N  NH1   . ARG C 3  18   ? 311.552 306.835 285.661 1.00 71.94  ? 17   ARG C NH1   1 
ATOM   1379  N  NH2   . ARG C 3  18   ? 310.556 307.950 287.388 1.00 71.94  ? 17   ARG C NH2   1 
ATOM   1380  N  N     . SER C 3  19   ? 318.395 309.947 283.586 1.00 67.25  ? 18   SER C N     1 
ATOM   1381  C  CA    . SER C 3  19   ? 319.338 309.827 282.490 1.00 67.25  ? 18   SER C CA    1 
ATOM   1382  C  C     . SER C 3  19   ? 320.756 310.134 282.928 1.00 67.25  ? 18   SER C C     1 
ATOM   1383  O  O     . SER C 3  19   ? 321.701 309.684 282.283 1.00 67.25  ? 18   SER C O     1 
ATOM   1384  C  CB    . SER C 3  19   ? 318.934 310.756 281.363 1.00 67.25  ? 18   SER C CB    1 
ATOM   1385  O  OG    . SER C 3  19   ? 317.631 310.450 280.922 1.00 67.25  ? 18   SER C OG    1 
ATOM   1386  N  N     . SER C 3  20   ? 320.928 310.901 283.999 1.00 72.49  ? 19   SER C N     1 
ATOM   1387  C  CA    . SER C 3  20   ? 322.256 311.057 284.571 1.00 72.49  ? 19   SER C CA    1 
ATOM   1388  C  C     . SER C 3  20   ? 322.616 309.850 285.413 1.00 72.49  ? 19   SER C C     1 
ATOM   1389  O  O     . SER C 3  20   ? 323.781 309.452 285.470 1.00 72.49  ? 19   SER C O     1 
ATOM   1390  C  CB    . SER C 3  20   ? 322.331 312.323 285.419 1.00 72.49  ? 19   SER C CB    1 
ATOM   1391  O  OG    . SER C 3  20   ? 321.219 312.424 286.286 1.00 72.49  ? 19   SER C OG    1 
ATOM   1392  N  N     . ARG C 3  21   ? 321.627 309.263 286.084 1.00 73.64  ? 20   ARG C N     1 
ATOM   1393  C  CA    . ARG C 3  21   ? 321.876 308.053 286.846 1.00 73.64  ? 20   ARG C CA    1 
ATOM   1394  C  C     . ARG C 3  21   ? 322.224 306.886 285.958 1.00 73.64  ? 20   ARG C C     1 
ATOM   1395  O  O     . ARG C 3  21   ? 322.919 305.975 286.402 1.00 73.64  ? 20   ARG C O     1 
ATOM   1396  C  CB    . ARG C 3  21   ? 320.666 307.673 287.664 1.00 73.64  ? 20   ARG C CB    1 
ATOM   1397  C  CG    . ARG C 3  21   ? 320.662 308.176 289.065 1.00 73.64  ? 20   ARG C CG    1 
ATOM   1398  C  CD    . ARG C 3  21   ? 319.362 307.807 289.703 1.00 73.64  ? 20   ARG C CD    1 
ATOM   1399  N  NE    . ARG C 3  21   ? 319.213 308.461 290.982 1.00 73.64  ? 20   ARG C NE    1 
ATOM   1400  C  CZ    . ARG C 3  21   ? 318.034 308.731 291.523 1.00 73.64  ? 20   ARG C CZ    1 
ATOM   1401  N  NH1   . ARG C 3  21   ? 316.934 308.402 290.862 1.00 73.64  ? 20   ARG C NH1   1 
ATOM   1402  N  NH2   . ARG C 3  21   ? 317.949 309.340 292.704 1.00 73.64  ? 20   ARG C NH2   1 
ATOM   1403  N  N     . ALA C 3  22   ? 321.757 306.879 284.723 1.00 65.23  ? 21   ALA C N     1 
ATOM   1404  C  CA    . ALA C 3  22   ? 322.128 305.813 283.819 1.00 65.23  ? 21   ALA C CA    1 
ATOM   1405  C  C     . ALA C 3  22   ? 323.268 306.179 282.900 1.00 65.23  ? 21   ALA C C     1 
ATOM   1406  O  O     . ALA C 3  22   ? 323.774 305.301 282.203 1.00 65.23  ? 21   ALA C O     1 
ATOM   1407  C  CB    . ALA C 3  22   ? 320.940 305.405 282.962 1.00 65.23  ? 21   ALA C CB    1 
ATOM   1408  N  N     . GLY C 3  23   ? 323.676 307.439 282.872 1.00 63.53  ? 22   GLY C N     1 
ATOM   1409  C  CA    . GLY C 3  23   ? 324.679 307.861 281.915 1.00 63.53  ? 22   GLY C CA    1 
ATOM   1410  C  C     . GLY C 3  23   ? 324.195 307.808 280.489 1.00 63.53  ? 22   GLY C C     1 
ATOM   1411  O  O     . GLY C 3  23   ? 324.798 307.126 279.662 1.00 63.53  ? 22   GLY C O     1 
ATOM   1412  N  N     . LEU C 3  24   ? 323.099 308.477 280.191 1.00 60.37  ? 23   LEU C N     1 
ATOM   1413  C  CA    . LEU C 3  24   ? 322.468 308.466 278.886 1.00 60.37  ? 23   LEU C CA    1 
ATOM   1414  C  C     . LEU C 3  24   ? 322.211 309.894 278.448 1.00 60.37  ? 23   LEU C C     1 
ATOM   1415  O  O     . LEU C 3  24   ? 322.519 310.847 279.155 1.00 60.37  ? 23   LEU C O     1 
ATOM   1416  C  CB    . LEU C 3  24   ? 321.160 307.688 278.934 1.00 60.37  ? 23   LEU C CB    1 
ATOM   1417  C  CG    . LEU C 3  24   ? 321.209 306.179 278.848 1.00 60.37  ? 23   LEU C CG    1 
ATOM   1418  C  CD1   . LEU C 3  24   ? 319.942 305.615 279.398 1.00 60.37  ? 23   LEU C CD1   1 
ATOM   1419  C  CD2   . LEU C 3  24   ? 321.348 305.809 277.411 1.00 60.37  ? 23   LEU C CD2   1 
ATOM   1420  N  N     . GLN C 3  25   ? 321.628 310.039 277.274 1.00 62.33  ? 24   GLN C N     1 
ATOM   1421  C  CA    . GLN C 3  25   ? 321.091 311.317 276.848 1.00 62.33  ? 24   GLN C CA    1 
ATOM   1422  C  C     . GLN C 3  25   ? 319.601 311.265 276.598 1.00 62.33  ? 24   GLN C C     1 
ATOM   1423  O  O     . GLN C 3  25   ? 318.913 312.254 276.831 1.00 62.33  ? 24   GLN C O     1 
ATOM   1424  C  CB    . GLN C 3  25   ? 321.796 311.806 275.588 1.00 62.33  ? 24   GLN C CB    1 
ATOM   1425  C  CG    . GLN C 3  25   ? 323.296 311.842 275.697 1.00 62.33  ? 24   GLN C CG    1 
ATOM   1426  C  CD    . GLN C 3  25   ? 323.817 312.940 276.599 1.00 62.33  ? 24   GLN C CD    1 
ATOM   1427  O  OE1   . GLN C 3  25   ? 323.109 313.878 276.939 1.00 62.33  ? 24   GLN C OE1   1 
ATOM   1428  N  NE2   . GLN C 3  25   ? 325.074 312.831 276.980 1.00 62.33  ? 24   GLN C NE2   1 
ATOM   1429  N  N     . PHE C 3  26   ? 319.096 310.134 276.135 1.00 58.95  ? 25   PHE C N     1 
ATOM   1430  C  CA    . PHE C 3  26   ? 317.674 309.966 275.960 1.00 58.95  ? 25   PHE C CA    1 
ATOM   1431  C  C     . PHE C 3  26   ? 316.985 309.971 277.313 1.00 58.95  ? 25   PHE C C     1 
ATOM   1432  O  O     . PHE C 3  26   ? 317.573 309.562 278.308 1.00 58.95  ? 25   PHE C O     1 
ATOM   1433  C  CB    . PHE C 3  26   ? 317.397 308.669 275.240 1.00 58.95  ? 25   PHE C CB    1 
ATOM   1434  C  CG    . PHE C 3  26   ? 317.292 308.833 273.790 1.00 58.95  ? 25   PHE C CG    1 
ATOM   1435  C  CD1   . PHE C 3  26   ? 318.360 309.296 273.074 1.00 58.95  ? 25   PHE C CD1   1 
ATOM   1436  C  CD2   . PHE C 3  26   ? 316.123 308.561 273.144 1.00 58.95  ? 25   PHE C CD2   1 
ATOM   1437  C  CE1   . PHE C 3  26   ? 318.273 309.466 271.737 1.00 58.95  ? 25   PHE C CE1   1 
ATOM   1438  C  CE2   . PHE C 3  26   ? 316.035 308.729 271.804 1.00 58.95  ? 25   PHE C CE2   1 
ATOM   1439  C  CZ    . PHE C 3  26   ? 317.115 309.181 271.100 1.00 58.95  ? 25   PHE C CZ    1 
ATOM   1440  N  N     . PRO C 3  27   ? 315.752 310.466 277.394 1.00 61.85  ? 26   PRO C N     1 
ATOM   1441  C  CA    . PRO C 3  27   ? 315.147 310.636 278.713 1.00 61.85  ? 26   PRO C CA    1 
ATOM   1442  C  C     . PRO C 3  27   ? 314.596 309.314 279.216 1.00 61.85  ? 26   PRO C C     1 
ATOM   1443  O  O     . PRO C 3  27   ? 313.766 308.687 278.564 1.00 61.85  ? 26   PRO C O     1 
ATOM   1444  C  CB    . PRO C 3  27   ? 314.037 311.656 278.459 1.00 61.85  ? 26   PRO C CB    1 
ATOM   1445  C  CG    . PRO C 3  27   ? 313.706 311.498 277.057 1.00 61.85  ? 26   PRO C CG    1 
ATOM   1446  C  CD    . PRO C 3  27   ? 314.884 310.983 276.333 1.00 61.85  ? 26   PRO C CD    1 
ATOM   1447  N  N     . VAL C 3  28   ? 315.078 308.876 280.370 1.00 59.72  ? 27   VAL C N     1 
ATOM   1448  C  CA    . VAL C 3  28   ? 314.476 307.718 281.002 1.00 59.72  ? 27   VAL C CA    1 
ATOM   1449  C  C     . VAL C 3  28   ? 313.082 308.062 281.499 1.00 59.72  ? 27   VAL C C     1 
ATOM   1450  O  O     . VAL C 3  28   ? 312.160 307.242 281.424 1.00 59.72  ? 27   VAL C O     1 
ATOM   1451  C  CB    . VAL C 3  28   ? 315.400 307.229 282.119 1.00 59.72  ? 27   VAL C CB    1 
ATOM   1452  C  CG1   . VAL C 3  28   ? 314.738 306.208 282.995 1.00 59.72  ? 27   VAL C CG1   1 
ATOM   1453  C  CG2   . VAL C 3  28   ? 316.629 306.659 281.504 1.00 59.72  ? 27   VAL C CG2   1 
ATOM   1454  N  N     . GLY C 3  29   ? 312.887 309.306 281.933 1.00 63.31  ? 28   GLY C N     1 
ATOM   1455  C  CA    . GLY C 3  29   ? 311.593 309.714 282.445 1.00 63.31  ? 28   GLY C CA    1 
ATOM   1456  C  C     . GLY C 3  29   ? 310.514 309.699 281.390 1.00 63.31  ? 28   GLY C C     1 
ATOM   1457  O  O     . GLY C 3  29   ? 309.434 309.154 281.599 1.00 63.31  ? 28   GLY C O     1 
ATOM   1458  N  N     . ARG C 3  30   ? 310.805 310.249 280.222 1.00 65.41  ? 29   ARG C N     1 
ATOM   1459  C  CA    . ARG C 3  30   ? 309.768 310.328 279.210 1.00 65.41  ? 29   ARG C CA    1 
ATOM   1460  C  C     . ARG C 3  30   ? 309.525 308.997 278.536 1.00 65.41  ? 29   ARG C C     1 
ATOM   1461  O  O     . ARG C 3  30   ? 308.402 308.732 278.128 1.00 65.41  ? 29   ARG C O     1 
ATOM   1462  C  CB    . ARG C 3  30   ? 310.106 311.383 278.182 1.00 65.41  ? 29   ARG C CB    1 
ATOM   1463  C  CG    . ARG C 3  30   ? 309.540 312.720 278.553 1.00 65.41  ? 29   ARG C CG    1 
ATOM   1464  C  CD    . ARG C 3  30   ? 309.740 313.720 277.460 1.00 65.41  ? 29   ARG C CD    1 
ATOM   1465  N  NE    . ARG C 3  30   ? 309.493 313.104 276.171 1.00 65.41  ? 29   ARG C NE    1 
ATOM   1466  C  CZ    . ARG C 3  30   ? 310.107 313.459 275.063 1.00 65.41  ? 29   ARG C CZ    1 
ATOM   1467  N  NH1   . ARG C 3  30   ? 311.003 314.431 275.093 1.00 65.41  ? 29   ARG C NH1   1 
ATOM   1468  N  NH2   . ARG C 3  30   ? 309.824 312.843 273.932 1.00 65.41  ? 29   ARG C NH2   1 
ATOM   1469  N  N     . VAL C 3  31   ? 310.532 308.135 278.434 1.00 59.80  ? 30   VAL C N     1 
ATOM   1470  C  CA    . VAL C 3  31   ? 310.271 306.788 277.941 1.00 59.80  ? 30   VAL C CA    1 
ATOM   1471  C  C     . VAL C 3  31   ? 309.435 306.007 278.942 1.00 59.80  ? 30   VAL C C     1 
ATOM   1472  O  O     . VAL C 3  31   ? 308.542 305.245 278.559 1.00 59.80  ? 30   VAL C O     1 
ATOM   1473  C  CB    . VAL C 3  31   ? 311.591 306.083 277.603 1.00 59.80  ? 30   VAL C CB    1 
ATOM   1474  C  CG1   . VAL C 3  31   ? 311.340 304.714 277.114 1.00 59.80  ? 30   VAL C CG1   1 
ATOM   1475  C  CG2   . VAL C 3  31   ? 312.252 306.797 276.483 1.00 59.80  ? 30   VAL C CG2   1 
ATOM   1476  N  N     . HIS C 3  32   ? 309.655 306.240 280.233 1.00 58.33  ? 31   HIS C N     1 
ATOM   1477  C  CA    . HIS C 3  32   ? 308.822 305.631 281.260 1.00 58.33  ? 31   HIS C CA    1 
ATOM   1478  C  C     . HIS C 3  32   ? 307.387 306.099 281.154 1.00 58.33  ? 31   HIS C C     1 
ATOM   1479  O  O     . HIS C 3  32   ? 306.451 305.300 281.252 1.00 58.33  ? 31   HIS C O     1 
ATOM   1480  C  CB    . HIS C 3  32   ? 309.395 305.984 282.616 1.00 58.33  ? 31   HIS C CB    1 
ATOM   1481  C  CG    . HIS C 3  32   ? 308.748 305.286 283.760 1.00 58.33  ? 31   HIS C CG    1 
ATOM   1482  N  ND1   . HIS C 3  32   ? 308.968 303.959 284.041 1.00 58.33  ? 31   HIS C ND1   1 
ATOM   1483  C  CD2   . HIS C 3  32   ? 307.931 305.745 284.734 1.00 58.33  ? 31   HIS C CD2   1 
ATOM   1484  C  CE1   . HIS C 3  32   ? 308.296 303.624 285.125 1.00 58.33  ? 31   HIS C CE1   1 
ATOM   1485  N  NE2   . HIS C 3  32   ? 307.652 304.689 285.562 1.00 58.33  ? 31   HIS C NE2   1 
ATOM   1486  N  N     . ARG C 3  33   ? 307.202 307.385 280.896 1.00 62.33  ? 32   ARG C N     1 
ATOM   1487  C  CA    . ARG C 3  33   ? 305.863 307.927 280.767 1.00 62.33  ? 32   ARG C CA    1 
ATOM   1488  C  C     . ARG C 3  33   ? 305.179 307.447 279.509 1.00 62.33  ? 32   ARG C C     1 
ATOM   1489  O  O     . ARG C 3  33   ? 303.978 307.202 279.526 1.00 62.33  ? 32   ARG C O     1 
ATOM   1490  C  CB    . ARG C 3  33   ? 305.911 309.435 280.759 1.00 62.33  ? 32   ARG C CB    1 
ATOM   1491  C  CG    . ARG C 3  33   ? 304.575 310.076 280.917 1.00 62.33  ? 32   ARG C CG    1 
ATOM   1492  C  CD    . ARG C 3  33   ? 304.669 311.510 280.516 1.00 62.33  ? 32   ARG C CD    1 
ATOM   1493  N  NE    . ARG C 3  33   ? 304.793 311.629 279.073 1.00 62.33  ? 32   ARG C NE    1 
ATOM   1494  C  CZ    . ARG C 3  33   ? 305.396 312.639 278.466 1.00 62.33  ? 32   ARG C CZ    1 
ATOM   1495  N  NH1   . ARG C 3  33   ? 305.960 313.596 279.188 1.00 62.33  ? 32   ARG C NH1   1 
ATOM   1496  N  NH2   . ARG C 3  33   ? 305.463 312.673 277.143 1.00 62.33  ? 32   ARG C NH2   1 
ATOM   1497  N  N     . LEU C 3  34   ? 305.907 307.297 278.414 1.00 58.89  ? 33   LEU C N     1 
ATOM   1498  C  CA    . LEU C 3  34   ? 305.263 306.800 277.206 1.00 58.89  ? 33   LEU C CA    1 
ATOM   1499  C  C     . LEU C 3  34   ? 304.997 305.310 277.291 1.00 58.89  ? 33   LEU C C     1 
ATOM   1500  O  O     . LEU C 3  34   ? 304.144 304.799 276.570 1.00 58.89  ? 33   LEU C O     1 
ATOM   1501  C  CB    . LEU C 3  34   ? 306.107 307.104 275.980 1.00 58.89  ? 33   LEU C CB    1 
ATOM   1502  C  CG    . LEU C 3  34   ? 306.410 308.558 275.649 1.00 58.89  ? 33   LEU C CG    1 
ATOM   1503  C  CD1   . LEU C 3  34   ? 307.137 308.657 274.344 1.00 58.89  ? 33   LEU C CD1   1 
ATOM   1504  C  CD2   . LEU C 3  34   ? 305.182 309.412 275.658 1.00 58.89  ? 33   LEU C CD2   1 
ATOM   1505  N  N     . LEU C 3  35   ? 305.712 304.595 278.153 1.00 59.06  ? 34   LEU C N     1 
ATOM   1506  C  CA    . LEU C 3  35   ? 305.395 303.192 278.368 1.00 59.06  ? 34   LEU C CA    1 
ATOM   1507  C  C     . LEU C 3  35   ? 304.170 303.036 279.247 1.00 59.06  ? 34   LEU C C     1 
ATOM   1508  O  O     . LEU C 3  35   ? 303.427 302.065 279.109 1.00 59.06  ? 34   LEU C O     1 
ATOM   1509  C  CB    . LEU C 3  35   ? 306.575 302.480 279.002 1.00 59.06  ? 34   LEU C CB    1 
ATOM   1510  C  CG    . LEU C 3  35   ? 307.659 302.031 278.054 1.00 59.06  ? 34   LEU C CG    1 
ATOM   1511  C  CD1   . LEU C 3  35   ? 308.744 301.422 278.851 1.00 59.06  ? 34   LEU C CD1   1 
ATOM   1512  C  CD2   . LEU C 3  35   ? 307.111 301.030 277.105 1.00 59.06  ? 34   LEU C CD2   1 
ATOM   1513  N  N     . ARG C 3  36   ? 303.976 303.940 280.201 1.00 60.84  ? 35   ARG C N     1 
ATOM   1514  C  CA    . ARG C 3  36   ? 302.728 303.934 280.952 1.00 60.84  ? 35   ARG C CA    1 
ATOM   1515  C  C     . ARG C 3  36   ? 301.567 304.324 280.060 1.00 60.84  ? 35   ARG C C     1 
ATOM   1516  O  O     . ARG C 3  36   ? 300.635 303.545 279.842 1.00 60.84  ? 35   ARG C O     1 
ATOM   1517  C  CB    . ARG C 3  36   ? 302.800 304.906 282.118 1.00 60.84  ? 35   ARG C CB    1 
ATOM   1518  C  CG    . ARG C 3  36   ? 303.823 304.622 283.144 1.00 60.84  ? 35   ARG C CG    1 
ATOM   1519  C  CD    . ARG C 3  36   ? 303.888 305.823 284.037 1.00 60.84  ? 35   ARG C CD    1 
ATOM   1520  N  NE    . ARG C 3  36   ? 304.766 305.634 285.177 1.00 60.84  ? 35   ARG C NE    1 
ATOM   1521  C  CZ    . ARG C 3  36   ? 304.353 305.266 286.380 1.00 60.84  ? 35   ARG C CZ    1 
ATOM   1522  N  NH1   . ARG C 3  36   ? 303.068 305.041 286.598 1.00 60.84  ? 35   ARG C NH1   1 
ATOM   1523  N  NH2   . ARG C 3  36   ? 305.222 305.121 287.366 1.00 60.84  ? 35   ARG C NH2   1 
ATOM   1524  N  N     . LYS C 3  37   ? 301.635 305.540 279.525 1.00 58.69  ? 36   LYS C N     1 
ATOM   1525  C  CA    . LYS C 3  37   ? 300.562 306.166 278.767 1.00 58.69  ? 36   LYS C CA    1 
ATOM   1526  C  C     . LYS C 3  37   ? 300.217 305.387 277.514 1.00 58.69  ? 36   LYS C C     1 
ATOM   1527  O  O     . LYS C 3  37   ? 299.063 305.380 277.090 1.00 58.69  ? 36   LYS C O     1 
ATOM   1528  C  CB    . LYS C 3  37   ? 301.005 307.586 278.423 1.00 58.69  ? 36   LYS C CB    1 
ATOM   1529  C  CG    . LYS C 3  37   ? 300.072 308.416 277.596 1.00 58.69  ? 36   LYS C CG    1 
ATOM   1530  C  CD    . LYS C 3  37   ? 300.769 309.674 277.096 1.00 58.69  ? 36   LYS C CD    1 
ATOM   1531  C  CE    . LYS C 3  37   ? 299.789 310.654 276.459 1.00 58.69  ? 36   LYS C CE    1 
ATOM   1532  N  NZ    . LYS C 3  37   ? 299.732 310.525 274.977 1.00 58.69  ? 36   LYS C NZ    1 
ATOM   1533  N  N     . GLY C 3  38   ? 301.186 304.695 276.935 1.00 58.75  ? 37   GLY C N     1 
ATOM   1534  C  CA    . GLY C 3  38   ? 300.949 303.957 275.710 1.00 58.75  ? 37   GLY C CA    1 
ATOM   1535  C  C     . GLY C 3  38   ? 300.142 302.706 275.889 1.00 58.75  ? 37   GLY C C     1 
ATOM   1536  O  O     . GLY C 3  38   ? 299.716 302.122 274.891 1.00 58.75  ? 37   GLY C O     1 
ATOM   1537  N  N     . ASN C 3  39   ? 299.927 302.297 277.137 1.00 60.14  ? 38   ASN C N     1 
ATOM   1538  C  CA    . ASN C 3  39   ? 299.079 301.173 277.520 1.00 60.14  ? 38   ASN C CA    1 
ATOM   1539  C  C     . ASN C 3  39   ? 299.561 299.870 276.908 1.00 60.14  ? 38   ASN C C     1 
ATOM   1540  O  O     . ASN C 3  39   ? 298.930 299.308 276.019 1.00 60.14  ? 38   ASN C O     1 
ATOM   1541  C  CB    . ASN C 3  39   ? 297.616 301.406 277.160 1.00 60.14  ? 38   ASN C CB    1 
ATOM   1542  C  CG    . ASN C 3  39   ? 296.712 300.489 277.909 1.00 60.14  ? 38   ASN C CG    1 
ATOM   1543  O  OD1   . ASN C 3  39   ? 296.454 299.371 277.482 1.00 60.14  ? 38   ASN C OD1   1 
ATOM   1544  N  ND2   . ASN C 3  39   ? 296.254 300.936 279.060 1.00 60.14  ? 38   ASN C ND2   1 
ATOM   1545  N  N     . TYR C 3  40   ? 300.723 299.425 277.367 1.00 57.98  ? 39   TYR C N     1 
ATOM   1546  C  CA    . TYR C 3  40   ? 301.232 298.134 276.952 1.00 57.98  ? 39   TYR C CA    1 
ATOM   1547  C  C     . TYR C 3  40   ? 301.092 297.068 278.021 1.00 57.98  ? 39   TYR C C     1 
ATOM   1548  O  O     . TYR C 3  40   ? 300.970 295.892 277.680 1.00 57.98  ? 39   TYR C O     1 
ATOM   1549  C  CB    . TYR C 3  40   ? 302.699 298.239 276.558 1.00 57.98  ? 39   TYR C CB    1 
ATOM   1550  C  CG    . TYR C 3  40   ? 302.992 299.295 275.553 1.00 57.98  ? 39   TYR C CG    1 
ATOM   1551  C  CD1   . TYR C 3  40   ? 302.711 299.109 274.223 1.00 57.98  ? 39   TYR C CD1   1 
ATOM   1552  C  CD2   . TYR C 3  40   ? 303.564 300.474 275.937 1.00 57.98  ? 39   TYR C CD2   1 
ATOM   1553  C  CE1   . TYR C 3  40   ? 302.987 300.075 273.315 1.00 57.98  ? 39   TYR C CE1   1 
ATOM   1554  C  CE2   . TYR C 3  40   ? 303.843 301.433 275.043 1.00 57.98  ? 39   TYR C CE2   1 
ATOM   1555  C  CZ    . TYR C 3  40   ? 303.554 301.233 273.742 1.00 57.98  ? 39   TYR C CZ    1 
ATOM   1556  O  OH    . TYR C 3  40   ? 303.843 302.230 272.868 1.00 57.98  ? 39   TYR C OH    1 
ATOM   1557  N  N     . ALA C 3  41   ? 301.125 297.445 279.289 1.00 61.25  ? 40   ALA C N     1 
ATOM   1558  C  CA    . ALA C 3  41   ? 300.819 296.527 280.371 1.00 61.25  ? 40   ALA C CA    1 
ATOM   1559  C  C     . ALA C 3  41   ? 300.343 297.363 281.536 1.00 61.25  ? 40   ALA C C     1 
ATOM   1560  O  O     . ALA C 3  41   ? 300.473 298.586 281.530 1.00 61.25  ? 40   ALA C O     1 
ATOM   1561  C  CB    . ALA C 3  41   ? 302.017 295.684 280.768 1.00 61.25  ? 40   ALA C CB    1 
ATOM   1562  N  N     . GLU C 3  42   ? 299.783 296.701 282.535 1.00 65.72  ? 41   GLU C N     1 
ATOM   1563  C  CA    . GLU C 3  42   ? 299.333 297.469 283.679 1.00 65.72  ? 41   GLU C CA    1 
ATOM   1564  C  C     . GLU C 3  42   ? 300.479 297.836 284.601 1.00 65.72  ? 41   GLU C C     1 
ATOM   1565  O  O     . GLU C 3  42   ? 300.305 298.682 285.474 1.00 65.72  ? 41   GLU C O     1 
ATOM   1566  C  CB    . GLU C 3  42   ? 298.260 296.706 284.443 1.00 65.72  ? 41   GLU C CB    1 
ATOM   1567  C  CG    . GLU C 3  42   ? 298.747 295.451 285.095 1.00 65.72  ? 41   GLU C CG    1 
ATOM   1568  C  CD    . GLU C 3  42   ? 297.859 294.997 286.230 1.00 65.72  ? 41   GLU C CD    1 
ATOM   1569  O  OE1   . GLU C 3  42   ? 298.152 295.349 287.391 1.00 65.72  ? 41   GLU C OE1   1 
ATOM   1570  O  OE2   . GLU C 3  42   ? 296.870 294.283 285.963 1.00 65.72  ? 41   GLU C OE2   1 
ATOM   1571  N  N     . ARG C 3  43   ? 301.634 297.214 284.440 1.00 67.15  ? 42   ARG C N     1 
ATOM   1572  C  CA    . ARG C 3  43   ? 302.817 297.538 285.214 1.00 67.15  ? 42   ARG C CA    1 
ATOM   1573  C  C     . ARG C 3  43   ? 303.974 297.741 284.257 1.00 67.15  ? 42   ARG C C     1 
ATOM   1574  O  O     . ARG C 3  43   ? 303.961 297.215 283.149 1.00 67.15  ? 42   ARG C O     1 
ATOM   1575  C  CB    . ARG C 3  43   ? 303.164 296.421 286.204 1.00 67.15  ? 42   ARG C CB    1 
ATOM   1576  C  CG    . ARG C 3  43   ? 301.992 295.809 286.938 1.00 67.15  ? 42   ARG C CG    1 
ATOM   1577  C  CD    . ARG C 3  43   ? 302.203 295.820 288.405 1.00 67.15  ? 42   ARG C CD    1 
ATOM   1578  N  NE    . ARG C 3  43   ? 303.377 295.054 288.784 1.00 67.15  ? 42   ARG C NE    1 
ATOM   1579  C  CZ    . ARG C 3  43   ? 303.898 295.091 290.001 1.00 67.15  ? 42   ARG C CZ    1 
ATOM   1580  N  NH1   . ARG C 3  43   ? 303.346 295.875 290.911 1.00 67.15  ? 42   ARG C NH1   1 
ATOM   1581  N  NH2   . ARG C 3  43   ? 304.967 294.368 290.308 1.00 67.15  ? 42   ARG C NH2   1 
ATOM   1582  N  N     . VAL C 3  44   ? 304.971 298.514 284.666 1.00 63.83  ? 43   VAL C N     1 
ATOM   1583  C  CA    . VAL C 3  44   ? 306.239 298.565 283.950 1.00 63.83  ? 43   VAL C CA    1 
ATOM   1584  C  C     . VAL C 3  44   ? 307.369 298.369 284.948 1.00 63.83  ? 43   VAL C C     1 
ATOM   1585  O  O     . VAL C 3  44   ? 307.307 298.854 286.079 1.00 63.83  ? 43   VAL C O     1 
ATOM   1586  C  CB    . VAL C 3  44   ? 306.435 299.870 283.151 1.00 63.83  ? 43   VAL C CB    1 
ATOM   1587  C  CG1   . VAL C 3  44   ? 305.519 299.894 281.983 1.00 63.83  ? 43   VAL C CG1   1 
ATOM   1588  C  CG2   . VAL C 3  44   ? 306.188 301.062 283.990 1.00 63.83  ? 43   VAL C CG2   1 
ATOM   1589  N  N     . GLY C 3  45   ? 308.380 297.609 284.555 1.00 60.15  ? 44   GLY C N     1 
ATOM   1590  C  CA    . GLY C 3  45   ? 309.535 297.466 285.408 1.00 60.15  ? 44   GLY C CA    1 
ATOM   1591  C  C     . GLY C 3  45   ? 310.267 298.782 285.521 1.00 60.15  ? 44   GLY C C     1 
ATOM   1592  O  O     . GLY C 3  45   ? 310.289 299.578 284.593 1.00 60.15  ? 44   GLY C O     1 
ATOM   1593  N  N     . ALA C 3  46   ? 310.833 299.032 286.693 1.00 59.24  ? 45   ALA C N     1 
ATOM   1594  C  CA    . ALA C 3  46   ? 311.520 300.297 286.891 1.00 59.24  ? 45   ALA C CA    1 
ATOM   1595  C  C     . ALA C 3  46   ? 312.832 300.332 286.140 1.00 59.24  ? 45   ALA C C     1 
ATOM   1596  O  O     . ALA C 3  46   ? 313.374 301.408 285.893 1.00 59.24  ? 45   ALA C O     1 
ATOM   1597  C  CB    . ALA C 3  46   ? 311.746 300.550 288.375 1.00 59.24  ? 45   ALA C CB    1 
ATOM   1598  N  N     . GLY C 3  47   ? 313.350 299.184 285.770 1.00 54.22  ? 46   GLY C N     1 
ATOM   1599  C  CA    . GLY C 3  47   ? 314.474 299.135 284.880 1.00 54.22  ? 46   GLY C CA    1 
ATOM   1600  C  C     . GLY C 3  47   ? 314.103 298.923 283.441 1.00 54.22  ? 46   GLY C C     1 
ATOM   1601  O  O     . GLY C 3  47   ? 314.982 298.673 282.619 1.00 54.22  ? 46   GLY C O     1 
ATOM   1602  N  N     . ALA C 3  48   ? 312.844 298.978 283.108 1.00 52.35  ? 47   ALA C N     1 
ATOM   1603  C  CA    . ALA C 3  48   ? 312.482 298.843 281.710 1.00 52.35  ? 47   ALA C CA    1 
ATOM   1604  C  C     . ALA C 3  48   ? 312.661 300.114 280.895 1.00 52.35  ? 47   ALA C C     1 
ATOM   1605  O  O     . ALA C 3  48   ? 313.113 299.998 279.753 1.00 52.35  ? 47   ALA C O     1 
ATOM   1606  C  CB    . ALA C 3  48   ? 311.054 298.350 281.552 1.00 52.35  ? 47   ALA C CB    1 
ATOM   1607  N  N     . PRO C 3  49   ? 312.308 301.322 281.369 1.00 52.22  ? 48   PRO C N     1 
ATOM   1608  C  CA    . PRO C 3  49   ? 312.587 302.488 280.533 1.00 52.22  ? 48   PRO C CA    1 
ATOM   1609  C  C     . PRO C 3  49   ? 314.046 302.768 280.350 1.00 52.22  ? 48   PRO C C     1 
ATOM   1610  O  O     . PRO C 3  49   ? 314.416 303.320 279.320 1.00 52.22  ? 48   PRO C O     1 
ATOM   1611  C  CB    . PRO C 3  49   ? 311.917 303.620 281.297 1.00 52.22  ? 48   PRO C CB    1 
ATOM   1612  C  CG    . PRO C 3  49   ? 311.888 303.179 282.627 1.00 52.22  ? 48   PRO C CG    1 
ATOM   1613  C  CD    . PRO C 3  49   ? 311.488 301.781 282.500 1.00 52.22  ? 48   PRO C CD    1 
ATOM   1614  N  N     . VAL C 3  50   ? 314.898 302.383 281.288 1.00 50.63  ? 49   VAL C N     1 
ATOM   1615  C  CA    . VAL C 3  50   ? 316.311 302.639 281.091 1.00 50.63  ? 49   VAL C CA    1 
ATOM   1616  C  C     . VAL C 3  50   ? 316.885 301.667 280.078 1.00 50.63  ? 49   VAL C C     1 
ATOM   1617  O  O     . VAL C 3  50   ? 317.714 302.044 279.244 1.00 50.63  ? 49   VAL C O     1 
ATOM   1618  C  CB    . VAL C 3  50   ? 317.032 302.628 282.441 1.00 50.63  ? 49   VAL C CB    1 
ATOM   1619  C  CG1   . VAL C 3  50   ? 316.751 301.410 283.162 1.00 50.63  ? 49   VAL C CG1   1 
ATOM   1620  C  CG2   . VAL C 3  50   ? 318.482 302.740 282.255 1.00 50.63  ? 49   VAL C CG2   1 
ATOM   1621  N  N     . TYR C 3  51   ? 316.357 300.451 280.031 1.00 52.14  ? 50   TYR C N     1 
ATOM   1622  C  CA    . TYR C 3  51   ? 316.753 299.524 278.984 1.00 52.14  ? 50   TYR C CA    1 
ATOM   1623  C  C     . TYR C 3  51   ? 316.305 300.019 277.626 1.00 52.14  ? 50   TYR C C     1 
ATOM   1624  O  O     . TYR C 3  51   ? 317.084 300.026 276.669 1.00 52.14  ? 50   TYR C O     1 
ATOM   1625  C  CB    . TYR C 3  51   ? 316.172 298.150 279.253 1.00 52.14  ? 50   TYR C CB    1 
ATOM   1626  C  CG    . TYR C 3  51   ? 317.001 297.048 278.676 1.00 52.14  ? 50   TYR C CG    1 
ATOM   1627  C  CD1   . TYR C 3  51   ? 317.071 296.843 277.312 1.00 52.14  ? 50   TYR C CD1   1 
ATOM   1628  C  CD2   . TYR C 3  51   ? 317.721 296.221 279.489 1.00 52.14  ? 50   TYR C CD2   1 
ATOM   1629  C  CE1   . TYR C 3  51   ? 317.825 295.862 276.787 1.00 52.14  ? 50   TYR C CE1   1 
ATOM   1630  C  CE2   . TYR C 3  51   ? 318.476 295.232 278.971 1.00 52.14  ? 50   TYR C CE2   1 
ATOM   1631  C  CZ    . TYR C 3  51   ? 318.521 295.056 277.618 1.00 52.14  ? 50   TYR C CZ    1 
ATOM   1632  O  OH    . TYR C 3  51   ? 319.281 294.051 277.086 1.00 52.14  ? 50   TYR C OH    1 
ATOM   1633  N  N     . LEU C 3  52   ? 315.059 300.443 277.529 1.00 49.60  ? 51   LEU C N     1 
ATOM   1634  C  CA    . LEU C 3  52   ? 314.549 300.877 276.243 1.00 49.60  ? 51   LEU C CA    1 
ATOM   1635  C  C     . LEU C 3  52   ? 315.204 302.169 275.805 1.00 49.60  ? 51   LEU C C     1 
ATOM   1636  O  O     . LEU C 3  52   ? 315.480 302.348 274.619 1.00 49.60  ? 51   LEU C O     1 
ATOM   1637  C  CB    . LEU C 3  52   ? 313.047 301.033 276.325 1.00 49.60  ? 51   LEU C CB    1 
ATOM   1638  C  CG    . LEU C 3  52   ? 312.296 301.463 275.092 1.00 49.60  ? 51   LEU C CG    1 
ATOM   1639  C  CD1   . LEU C 3  52   ? 312.697 300.652 273.920 1.00 49.60  ? 51   LEU C CD1   1 
ATOM   1640  C  CD2   . LEU C 3  52   ? 310.885 301.186 275.388 1.00 49.60  ? 51   LEU C CD2   1 
ATOM   1641  N  N     . ALA C 3  53   ? 315.515 303.050 276.749 1.00 51.92  ? 52   ALA C N     1 
ATOM   1642  C  CA    . ALA C 3  53   ? 316.154 304.303 276.402 1.00 51.92  ? 52   ALA C CA    1 
ATOM   1643  C  C     . ALA C 3  53   ? 317.566 304.069 275.930 1.00 51.92  ? 52   ALA C C     1 
ATOM   1644  O  O     . ALA C 3  53   ? 318.028 304.738 275.011 1.00 51.92  ? 52   ALA C O     1 
ATOM   1645  C  CB    . ALA C 3  53   ? 316.148 305.243 277.591 1.00 51.92  ? 52   ALA C CB    1 
ATOM   1646  N  N     . ALA C 3  54   ? 318.245 303.084 276.506 1.00 50.77  ? 53   ALA C N     1 
ATOM   1647  C  CA    . ALA C 3  54   ? 319.596 302.784 276.068 1.00 50.77  ? 53   ALA C CA    1 
ATOM   1648  C  C     . ALA C 3  54   ? 319.607 302.149 274.698 1.00 50.77  ? 53   ALA C C     1 
ATOM   1649  O  O     . ALA C 3  54   ? 320.505 302.421 273.900 1.00 50.77  ? 53   ALA C O     1 
ATOM   1650  C  CB    . ALA C 3  54   ? 320.258 301.862 277.058 1.00 50.77  ? 53   ALA C CB    1 
ATOM   1651  N  N     . VAL C 3  55   ? 318.623 301.303 274.404 1.00 50.27  ? 54   VAL C N     1 
ATOM   1652  C  CA    . VAL C 3  55   ? 318.532 300.721 273.074 1.00 50.27  ? 54   VAL C CA    1 
ATOM   1653  C  C     . VAL C 3  55   ? 318.235 301.789 272.043 1.00 50.27  ? 54   VAL C C     1 
ATOM   1654  O  O     . VAL C 3  55   ? 318.852 301.818 270.969 1.00 50.27  ? 54   VAL C O     1 
ATOM   1655  C  CB    . VAL C 3  55   ? 317.469 299.621 273.071 1.00 50.27  ? 54   VAL C CB    1 
ATOM   1656  C  CG1   . VAL C 3  55   ? 317.142 299.199 271.692 1.00 50.27  ? 54   VAL C CG1   1 
ATOM   1657  C  CG2   . VAL C 3  55   ? 317.961 298.451 273.839 1.00 50.27  ? 54   VAL C CG2   1 
ATOM   1658  N  N     . LEU C 3  56   ? 317.340 302.718 272.372 1.00 52.52  ? 55   LEU C N     1 
ATOM   1659  C  CA    . LEU C 3  56   ? 317.001 303.791 271.449 1.00 52.52  ? 55   LEU C CA    1 
ATOM   1660  C  C     . LEU C 3  56   ? 318.186 304.707 271.215 1.00 52.52  ? 55   LEU C C     1 
ATOM   1661  O  O     . LEU C 3  56   ? 318.450 305.115 270.084 1.00 52.52  ? 55   LEU C O     1 
ATOM   1662  C  CB    . LEU C 3  56   ? 315.831 304.592 271.998 1.00 52.52  ? 55   LEU C CB    1 
ATOM   1663  C  CG    . LEU C 3  56   ? 314.448 303.968 271.964 1.00 52.52  ? 55   LEU C CG    1 
ATOM   1664  C  CD1   . LEU C 3  56   ? 313.447 304.976 272.407 1.00 52.52  ? 55   LEU C CD1   1 
ATOM   1665  C  CD2   . LEU C 3  56   ? 314.135 303.509 270.593 1.00 52.52  ? 55   LEU C CD2   1 
ATOM   1666  N  N     . GLU C 3  57   ? 318.928 305.011 272.269 1.00 55.63  ? 56   GLU C N     1 
ATOM   1667  C  CA    . GLU C 3  57   ? 320.056 305.913 272.141 1.00 55.63  ? 56   GLU C CA    1 
ATOM   1668  C  C     . GLU C 3  57   ? 321.187 305.253 271.396 1.00 55.63  ? 56   GLU C C     1 
ATOM   1669  O  O     . GLU C 3  57   ? 321.881 305.903 270.613 1.00 55.63  ? 56   GLU C O     1 
ATOM   1670  C  CB    . GLU C 3  57   ? 320.496 306.369 273.519 1.00 55.63  ? 56   GLU C CB    1 
ATOM   1671  C  CG    . GLU C 3  57   ? 321.743 307.167 273.549 1.00 55.63  ? 56   GLU C CG    1 
ATOM   1672  C  CD    . GLU C 3  57   ? 321.772 308.116 274.704 1.00 55.63  ? 56   GLU C CD    1 
ATOM   1673  O  OE1   . GLU C 3  57   ? 320.705 308.345 275.303 1.00 55.63  ? 56   GLU C OE1   1 
ATOM   1674  O  OE2   . GLU C 3  57   ? 322.861 308.628 275.030 1.00 55.63  ? 56   GLU C OE2   1 
ATOM   1675  N  N     . TYR C 3  58   ? 321.339 303.946 271.551 1.00 54.84  ? 57   TYR C N     1 
ATOM   1676  C  CA    . TYR C 3  58   ? 322.348 303.246 270.771 1.00 54.84  ? 57   TYR C CA    1 
ATOM   1677  C  C     . TYR C 3  58   ? 321.997 303.237 269.291 1.00 54.84  ? 57   TYR C C     1 
ATOM   1678  O  O     . TYR C 3  58   ? 322.863 303.472 268.443 1.00 54.84  ? 57   TYR C O     1 
ATOM   1679  C  CB    . TYR C 3  58   ? 322.518 301.822 271.282 1.00 54.84  ? 57   TYR C CB    1 
ATOM   1680  C  CG    . TYR C 3  58   ? 323.173 300.956 270.261 1.00 54.84  ? 57   TYR C CG    1 
ATOM   1681  C  CD1   . TYR C 3  58   ? 324.502 301.122 269.952 1.00 54.84  ? 57   TYR C CD1   1 
ATOM   1682  C  CD2   . TYR C 3  58   ? 322.455 299.996 269.586 1.00 54.84  ? 57   TYR C CD2   1 
ATOM   1683  C  CE1   . TYR C 3  58   ? 325.092 300.360 269.012 1.00 54.84  ? 57   TYR C CE1   1 
ATOM   1684  C  CE2   . TYR C 3  58   ? 323.043 299.232 268.636 1.00 54.84  ? 57   TYR C CE2   1 
ATOM   1685  C  CZ    . TYR C 3  58   ? 324.361 299.416 268.360 1.00 54.84  ? 57   TYR C CZ    1 
ATOM   1686  O  OH    . TYR C 3  58   ? 324.961 298.649 267.408 1.00 54.84  ? 57   TYR C OH    1 
ATOM   1687  N  N     . LEU C 3  59   ? 320.740 302.945 268.963 1.00 54.99  ? 58   LEU C N     1 
ATOM   1688  C  CA    . LEU C 3  59   ? 320.354 302.883 267.561 1.00 54.99  ? 58   LEU C CA    1 
ATOM   1689  C  C     . LEU C 3  59   ? 320.423 304.247 266.914 1.00 54.99  ? 58   LEU C C     1 
ATOM   1690  O  O     . LEU C 3  59   ? 320.804 304.367 265.746 1.00 54.99  ? 58   LEU C O     1 
ATOM   1691  C  CB    . LEU C 3  59   ? 318.955 302.321 267.429 1.00 54.99  ? 58   LEU C CB    1 
ATOM   1692  C  CG    . LEU C 3  59   ? 318.851 300.836 267.688 1.00 54.99  ? 58   LEU C CG    1 
ATOM   1693  C  CD1   . LEU C 3  59   ? 317.429 300.510 268.003 1.00 54.99  ? 58   LEU C CD1   1 
ATOM   1694  C  CD2   . LEU C 3  59   ? 319.302 300.099 266.471 1.00 54.99  ? 58   LEU C CD2   1 
ATOM   1695  N  N     . THR C 3  60   ? 320.089 305.286 267.667 1.00 55.64  ? 59   THR C N     1 
ATOM   1696  C  CA    . THR C 3  60   ? 320.224 306.638 267.162 1.00 55.64  ? 59   THR C CA    1 
ATOM   1697  C  C     . THR C 3  60   ? 321.679 306.976 266.917 1.00 55.64  ? 59   THR C C     1 
ATOM   1698  O  O     . THR C 3  60   ? 322.012 307.615 265.918 1.00 55.64  ? 59   THR C O     1 
ATOM   1699  C  CB    . THR C 3  60   ? 319.612 307.606 268.155 1.00 55.64  ? 59   THR C CB    1 
ATOM   1700  O  OG1   . THR C 3  60   ? 318.261 307.225 268.398 1.00 55.64  ? 59   THR C OG1   1 
ATOM   1701  C  CG2   . THR C 3  60   ? 319.587 308.963 267.595 1.00 55.64  ? 59   THR C CG2   1 
ATOM   1702  N  N     . ALA C 3  61   ? 322.568 306.507 267.786 1.00 57.22  ? 60   ALA C N     1 
ATOM   1703  C  CA    . ALA C 3  61   ? 323.981 306.772 267.582 1.00 57.22  ? 60   ALA C CA    1 
ATOM   1704  C  C     . ALA C 3  61   ? 324.514 306.016 266.386 1.00 57.22  ? 60   ALA C C     1 
ATOM   1705  O  O     . ALA C 3  61   ? 325.396 306.509 265.687 1.00 57.22  ? 60   ALA C O     1 
ATOM   1706  C  CB    . ALA C 3  61   ? 324.771 306.409 268.823 1.00 57.22  ? 60   ALA C CB    1 
ATOM   1707  N  N     . GLU C 3  62   ? 323.962 304.844 266.101 1.00 59.58  ? 61   GLU C N     1 
ATOM   1708  C  CA    . GLU C 3  62   ? 324.417 304.091 264.936 1.00 59.58  ? 61   GLU C CA    1 
ATOM   1709  C  C     . GLU C 3  62   ? 323.991 304.757 263.640 1.00 59.58  ? 61   GLU C C     1 
ATOM   1710  O  O     . GLU C 3  62   ? 324.810 304.941 262.728 1.00 59.58  ? 61   GLU C O     1 
ATOM   1711  C  CB    . GLU C 3  62   ? 323.886 302.674 264.994 1.00 59.58  ? 61   GLU C CB    1 
ATOM   1712  C  CG    . GLU C 3  62   ? 324.663 301.751 264.145 1.00 59.58  ? 61   GLU C CG    1 
ATOM   1713  C  CD    . GLU C 3  62   ? 326.086 301.604 264.622 1.00 59.58  ? 61   GLU C CD    1 
ATOM   1714  O  OE1   . GLU C 3  62   ? 326.296 301.523 265.848 1.00 59.58  ? 61   GLU C OE1   1 
ATOM   1715  O  OE2   . GLU C 3  62   ? 327.002 301.564 263.774 1.00 59.58  ? 61   GLU C OE2   1 
ATOM   1716  N  N     . ILE C 3  63   ? 322.711 305.124 263.550 1.00 58.08  ? 62   ILE C N     1 
ATOM   1717  C  CA    . ILE C 3  63   ? 322.196 305.867 262.401 1.00 58.08  ? 62   ILE C CA    1 
ATOM   1718  C  C     . ILE C 3  63   ? 322.955 307.171 262.213 1.00 58.08  ? 62   ILE C C     1 
ATOM   1719  O  O     . ILE C 3  63   ? 323.363 307.511 261.101 1.00 58.08  ? 62   ILE C O     1 
ATOM   1720  C  CB    . ILE C 3  63   ? 320.696 306.134 262.585 1.00 58.08  ? 62   ILE C CB    1 
ATOM   1721  C  CG1   . ILE C 3  63   ? 319.920 304.829 262.638 1.00 58.08  ? 62   ILE C CG1   1 
ATOM   1722  C  CG2   . ILE C 3  63   ? 320.183 307.049 261.509 1.00 58.08  ? 62   ILE C CG2   1 
ATOM   1723  C  CD1   . ILE C 3  63   ? 319.512 304.288 261.327 1.00 58.08  ? 62   ILE C CD1   1 
ATOM   1724  N  N     . LEU C 3  64   ? 323.209 307.888 263.302 1.00 59.87  ? 63   LEU C N     1 
ATOM   1725  C  CA    . LEU C 3  64   ? 323.838 309.189 263.184 1.00 59.87  ? 63   LEU C CA    1 
ATOM   1726  C  C     . LEU C 3  64   ? 325.313 309.084 262.875 1.00 59.87  ? 63   LEU C C     1 
ATOM   1727  O  O     . LEU C 3  64   ? 325.845 309.941 262.178 1.00 59.87  ? 63   LEU C O     1 
ATOM   1728  C  CB    . LEU C 3  64   ? 323.628 309.978 264.457 1.00 59.87  ? 63   LEU C CB    1 
ATOM   1729  C  CG    . LEU C 3  64   ? 322.250 310.596 264.500 1.00 59.87  ? 63   LEU C CG    1 
ATOM   1730  C  CD1   . LEU C 3  64   ? 322.089 311.380 265.748 1.00 59.87  ? 63   LEU C CD1   1 
ATOM   1731  C  CD2   . LEU C 3  64   ? 322.054 311.484 263.304 1.00 59.87  ? 63   LEU C CD2   1 
ATOM   1732  N  N     . GLU C 3  65   ? 325.983 308.045 263.355 1.00 60.11  ? 64   GLU C N     1 
ATOM   1733  C  CA    . GLU C 3  65   ? 327.384 307.863 263.026 1.00 60.11  ? 64   GLU C CA    1 
ATOM   1734  C  C     . GLU C 3  65   ? 327.548 307.553 261.554 1.00 60.11  ? 64   GLU C C     1 
ATOM   1735  O  O     . GLU C 3  65   ? 328.372 308.172 260.871 1.00 60.11  ? 64   GLU C O     1 
ATOM   1736  C  CB    . GLU C 3  65   ? 327.977 306.758 263.887 1.00 60.11  ? 64   GLU C CB    1 
ATOM   1737  C  CG    . GLU C 3  65   ? 329.238 306.148 263.340 1.00 60.11  ? 64   GLU C CG    1 
ATOM   1738  C  CD    . GLU C 3  65   ? 329.712 304.961 264.150 1.00 60.11  ? 64   GLU C CD    1 
ATOM   1739  O  OE1   . GLU C 3  65   ? 330.410 305.162 265.161 1.00 60.11  ? 64   GLU C OE1   1 
ATOM   1740  O  OE2   . GLU C 3  65   ? 329.379 303.818 263.786 1.00 60.11  ? 64   GLU C OE2   1 
ATOM   1741  N  N     . LEU C 3  66   ? 326.719 306.648 261.029 1.00 59.58  ? 65   LEU C N     1 
ATOM   1742  C  CA    . LEU C 3  66   ? 326.821 306.324 259.613 1.00 59.58  ? 65   LEU C CA    1 
ATOM   1743  C  C     . LEU C 3  66   ? 326.380 307.489 258.740 1.00 59.58  ? 65   LEU C C     1 
ATOM   1744  O  O     . LEU C 3  66   ? 326.952 307.724 257.670 1.00 59.58  ? 65   LEU C O     1 
ATOM   1745  C  CB    . LEU C 3  66   ? 325.993 305.095 259.305 1.00 59.58  ? 65   LEU C CB    1 
ATOM   1746  C  CG    . LEU C 3  66   ? 326.314 303.790 259.996 1.00 59.58  ? 65   LEU C CG    1 
ATOM   1747  C  CD1   . LEU C 3  66   ? 325.675 302.687 259.223 1.00 59.58  ? 65   LEU C CD1   1 
ATOM   1748  C  CD2   . LEU C 3  66   ? 327.787 303.563 260.062 1.00 59.58  ? 65   LEU C CD2   1 
ATOM   1749  N  N     . ALA C 3  67   ? 325.401 308.264 259.198 1.00 61.92  ? 66   ALA C N     1 
ATOM   1750  C  CA    . ALA C 3  67   ? 324.954 309.406 258.419 1.00 61.92  ? 66   ALA C CA    1 
ATOM   1751  C  C     . ALA C 3  67   ? 325.953 310.540 258.462 1.00 61.92  ? 66   ALA C C     1 
ATOM   1752  O  O     . ALA C 3  67   ? 326.092 311.261 257.483 1.00 61.92  ? 66   ALA C O     1 
ATOM   1753  C  CB    . ALA C 3  67   ? 323.609 309.886 258.925 1.00 61.92  ? 66   ALA C CB    1 
ATOM   1754  N  N     . GLY C 3  68   ? 326.663 310.714 259.568 1.00 63.23  ? 67   GLY C N     1 
ATOM   1755  C  CA    . GLY C 3  68   ? 327.717 311.704 259.597 1.00 63.23  ? 67   GLY C CA    1 
ATOM   1756  C  C     . GLY C 3  68   ? 328.883 311.308 258.724 1.00 63.23  ? 67   GLY C C     1 
ATOM   1757  O  O     . GLY C 3  68   ? 329.544 312.163 258.137 1.00 63.23  ? 67   GLY C O     1 
ATOM   1758  N  N     . ASN C 3  69   ? 329.122 310.002 258.593 1.00 63.56  ? 68   ASN C N     1 
ATOM   1759  C  CA    . ASN C 3  69   ? 330.082 309.513 257.610 1.00 63.56  ? 68   ASN C CA    1 
ATOM   1760  C  C     . ASN C 3  69   ? 329.651 309.859 256.195 1.00 63.56  ? 68   ASN C C     1 
ATOM   1761  O  O     . ASN C 3  69   ? 330.455 310.321 255.377 1.00 63.56  ? 68   ASN C O     1 
ATOM   1762  C  CB    . ASN C 3  69   ? 330.239 308.013 257.755 1.00 63.56  ? 68   ASN C CB    1 
ATOM   1763  C  CG    . ASN C 3  69   ? 331.210 307.656 258.802 1.00 63.56  ? 68   ASN C CG    1 
ATOM   1764  O  OD1   . ASN C 3  69   ? 332.100 308.431 259.112 1.00 63.56  ? 68   ASN C OD1   1 
ATOM   1765  N  ND2   . ASN C 3  69   ? 331.065 306.478 259.364 1.00 63.56  ? 68   ASN C ND2   1 
ATOM   1766  N  N     . ALA C 3  70   ? 328.373 309.658 255.893 1.00 65.11  ? 69   ALA C N     1 
ATOM   1767  C  CA    . ALA C 3  70   ? 327.890 309.961 254.554 1.00 65.11  ? 69   ALA C CA    1 
ATOM   1768  C  C     . ALA C 3  70   ? 327.839 311.455 254.291 1.00 65.11  ? 69   ALA C C     1 
ATOM   1769  O  O     . ALA C 3  70   ? 327.963 311.882 253.144 1.00 65.11  ? 69   ALA C O     1 
ATOM   1770  C  CB    . ALA C 3  70   ? 326.516 309.349 254.340 1.00 65.11  ? 69   ALA C CB    1 
ATOM   1771  N  N     . ALA C 3  71   ? 327.648 312.259 255.321 1.00 69.06  ? 70   ALA C N     1 
ATOM   1772  C  CA    . ALA C 3  71   ? 327.660 313.698 255.121 1.00 69.06  ? 70   ALA C CA    1 
ATOM   1773  C  C     . ALA C 3  71   ? 329.072 314.192 254.909 1.00 69.06  ? 70   ALA C C     1 
ATOM   1774  O  O     . ALA C 3  71   ? 329.293 315.151 254.166 1.00 69.06  ? 70   ALA C O     1 
ATOM   1775  C  CB    . ALA C 3  71   ? 327.031 314.408 256.312 1.00 69.06  ? 70   ALA C CB    1 
ATOM   1776  N  N     . ARG C 3  72   ? 330.029 313.573 255.595 1.00 70.23  ? 71   ARG C N     1 
ATOM   1777  C  CA    . ARG C 3  72   ? 331.432 313.864 255.362 1.00 70.23  ? 71   ARG C CA    1 
ATOM   1778  C  C     . ARG C 3  72   ? 331.808 313.556 253.934 1.00 70.23  ? 71   ARG C C     1 
ATOM   1779  O  O     . ARG C 3  72   ? 332.430 314.379 253.258 1.00 70.23  ? 71   ARG C O     1 
ATOM   1780  C  CB    . ARG C 3  72   ? 332.267 313.045 256.330 1.00 70.23  ? 71   ARG C CB    1 
ATOM   1781  C  CG    . ARG C 3  72   ? 333.709 312.915 256.018 1.00 70.23  ? 71   ARG C CG    1 
ATOM   1782  C  CD    . ARG C 3  72   ? 334.318 312.015 257.056 1.00 70.23  ? 71   ARG C CD    1 
ATOM   1783  N  NE    . ARG C 3  72   ? 334.347 312.681 258.356 1.00 70.23  ? 71   ARG C NE    1 
ATOM   1784  C  CZ    . ARG C 3  72   ? 334.168 312.082 259.532 1.00 70.23  ? 71   ARG C CZ    1 
ATOM   1785  N  NH1   . ARG C 3  72   ? 333.933 310.779 259.597 1.00 70.23  ? 71   ARG C NH1   1 
ATOM   1786  N  NH2   . ARG C 3  72   ? 334.215 312.794 260.646 1.00 70.23  ? 71   ARG C NH2   1 
ATOM   1787  N  N     . ASP C 3  73   ? 331.363 312.409 253.424 1.00 72.53  ? 72   ASP C N     1 
ATOM   1788  C  CA    . ASP C 3  73   ? 331.753 311.972 252.088 1.00 72.53  ? 72   ASP C CA    1 
ATOM   1789  C  C     . ASP C 3  73   ? 331.095 312.759 250.966 1.00 72.53  ? 72   ASP C C     1 
ATOM   1790  O  O     . ASP C 3  73   ? 331.350 312.456 249.802 1.00 72.53  ? 72   ASP C O     1 
ATOM   1791  C  CB    . ASP C 3  73   ? 331.427 310.498 251.912 1.00 72.53  ? 72   ASP C CB    1 
ATOM   1792  C  CG    . ASP C 3  73   ? 332.245 309.620 252.819 1.00 72.53  ? 72   ASP C CG    1 
ATOM   1793  O  OD1   . ASP C 3  73   ? 333.391 309.997 253.128 1.00 72.53  ? 72   ASP C OD1   1 
ATOM   1794  O  OD2   . ASP C 3  73   ? 331.747 308.558 253.239 1.00 72.53  ? 72   ASP C OD2   1 
ATOM   1795  N  N     . ASN C 3  74   ? 330.250 313.741 251.263 1.00 75.58  ? 73   ASN C N     1 
ATOM   1796  C  CA    . ASN C 3  74   ? 329.693 314.607 250.234 1.00 75.58  ? 73   ASN C CA    1 
ATOM   1797  C  C     . ASN C 3  74   ? 330.036 316.060 250.492 1.00 75.58  ? 73   ASN C C     1 
ATOM   1798  O  O     . ASN C 3  74   ? 329.364 316.940 249.955 1.00 75.58  ? 73   ASN C O     1 
ATOM   1799  C  CB    . ASN C 3  74   ? 328.180 314.455 250.138 1.00 75.58  ? 73   ASN C CB    1 
ATOM   1800  C  CG    . ASN C 3  74   ? 327.776 313.101 249.649 1.00 75.58  ? 73   ASN C CG    1 
ATOM   1801  O  OD1   . ASN C 3  74   ? 328.578 312.376 249.066 1.00 75.58  ? 73   ASN C OD1   1 
ATOM   1802  N  ND2   . ASN C 3  74   ? 326.519 312.743 249.876 1.00 75.58  ? 73   ASN C ND2   1 
ATOM   1803  N  N     . LYS C 3  75   ? 331.043 316.300 251.329 1.00 82.12  ? 74   LYS C N     1 
ATOM   1804  C  CA    . LYS C 3  75   ? 331.561 317.631 251.643 1.00 82.12  ? 74   LYS C CA    1 
ATOM   1805  C  C     . LYS C 3  75   ? 330.474 318.550 252.194 1.00 82.12  ? 74   LYS C C     1 
ATOM   1806  O  O     . LYS C 3  75   ? 330.426 319.742 251.892 1.00 82.12  ? 74   LYS C O     1 
ATOM   1807  C  CB    . LYS C 3  75   ? 332.255 318.248 250.438 1.00 82.12  ? 74   LYS C CB    1 
ATOM   1808  C  CG    . LYS C 3  75   ? 333.485 317.476 250.010 1.00 82.12  ? 74   LYS C CG    1 
ATOM   1809  C  CD    . LYS C 3  75   ? 333.199 316.564 248.816 1.00 82.12  ? 74   LYS C CD    1 
ATOM   1810  C  CE    . LYS C 3  75   ? 334.475 316.102 248.139 1.00 82.12  ? 74   LYS C CE    1 
ATOM   1811  N  NZ    . LYS C 3  75   ? 334.176 315.240 246.980 1.00 82.12  ? 74   LYS C NZ    1 
ATOM   1812  N  N     . LYS C 3  76   ? 329.589 317.981 253.000 1.00 87.86  ? 75   LYS C N     1 
ATOM   1813  C  CA    . LYS C 3  76   ? 328.551 318.719 253.687 1.00 87.86  ? 75   LYS C CA    1 
ATOM   1814  C  C     . LYS C 3  76   ? 328.902 318.873 255.157 1.00 87.86  ? 75   LYS C C     1 
ATOM   1815  O  O     . LYS C 3  76   ? 329.880 318.315 255.653 1.00 87.86  ? 75   LYS C O     1 
ATOM   1816  C  CB    . LYS C 3  76   ? 327.213 318.008 253.561 1.00 87.86  ? 75   LYS C CB    1 
ATOM   1817  C  CG    . LYS C 3  76   ? 326.705 317.881 252.163 1.00 87.86  ? 75   LYS C CG    1 
ATOM   1818  C  CD    . LYS C 3  76   ? 325.821 319.047 251.788 1.00 87.86  ? 75   LYS C CD    1 
ATOM   1819  C  CE    . LYS C 3  76   ? 324.922 318.703 250.601 1.00 87.86  ? 75   LYS C CE    1 
ATOM   1820  N  NZ    . LYS C 3  76   ? 325.667 318.595 249.313 1.00 87.86  ? 75   LYS C NZ    1 
ATOM   1821  N  N     . THR C 3  77   ? 328.086 319.665 255.842 1.00 95.75  ? 76   THR C N     1 
ATOM   1822  C  CA    . THR C 3  77   ? 328.100 319.817 257.289 1.00 95.75  ? 76   THR C CA    1 
ATOM   1823  C  C     . THR C 3  77   ? 326.750 319.521 257.903 1.00 95.75  ? 76   THR C C     1 
ATOM   1824  O  O     . THR C 3  77   ? 326.675 318.958 258.987 1.00 95.75  ? 76   THR C O     1 
ATOM   1825  C  CB    . THR C 3  77   ? 328.497 321.240 257.672 1.00 95.75  ? 76   THR C CB    1 
ATOM   1826  O  OG1   . THR C 3  77   ? 329.458 321.742 256.740 1.00 95.75  ? 76   THR C OG1   1 
ATOM   1827  C  CG2   . THR C 3  77   ? 329.088 321.266 259.063 1.00 95.75  ? 76   THR C CG2   1 
ATOM   1828  N  N     . ARG C 3  78   ? 325.682 319.925 257.244 1.00 98.26  ? 77   ARG C N     1 
ATOM   1829  C  CA    . ARG C 3  78   ? 324.351 319.532 257.649 1.00 98.26  ? 77   ARG C CA    1 
ATOM   1830  C  C     . ARG C 3  78   ? 324.098 318.120 257.162 1.00 98.26  ? 77   ARG C C     1 
ATOM   1831  O  O     . ARG C 3  78   ? 324.672 317.672 256.173 1.00 98.26  ? 77   ARG C O     1 
ATOM   1832  C  CB    . ARG C 3  78   ? 323.295 320.484 257.078 1.00 98.26  ? 77   ARG C CB    1 
ATOM   1833  C  CG    . ARG C 3  78   ? 322.744 321.527 258.032 1.00 98.26  ? 77   ARG C CG    1 
ATOM   1834  C  CD    . ARG C 3  78   ? 323.842 322.440 258.471 1.00 98.26  ? 77   ARG C CD    1 
ATOM   1835  N  NE    . ARG C 3  78   ? 323.450 323.840 258.497 1.00 98.26  ? 77   ARG C NE    1 
ATOM   1836  C  CZ    . ARG C 3  78   ? 324.297 324.845 258.701 1.00 98.26  ? 77   ARG C CZ    1 
ATOM   1837  N  NH1   . ARG C 3  78   ? 325.582 324.609 258.900 1.00 98.26  ? 77   ARG C NH1   1 
ATOM   1838  N  NH2   . ARG C 3  78   ? 323.862 326.092 258.700 1.00 98.26  ? 77   ARG C NH2   1 
ATOM   1839  N  N     . ILE C 3  79   ? 323.238 317.412 257.871 1.00 76.95  ? 78   ILE C N     1 
ATOM   1840  C  CA    . ILE C 3  79   ? 322.783 316.103 257.444 1.00 76.95  ? 78   ILE C CA    1 
ATOM   1841  C  C     . ILE C 3  79   ? 321.386 316.254 256.867 1.00 76.95  ? 78   ILE C C     1 
ATOM   1842  O  O     . ILE C 3  79   ? 320.437 316.567 257.583 1.00 76.95  ? 78   ILE C O     1 
ATOM   1843  C  CB    . ILE C 3  79   ? 322.803 315.098 258.589 1.00 76.95  ? 78   ILE C CB    1 
ATOM   1844  C  CG1   . ILE C 3  79   ? 324.211 314.977 259.118 1.00 76.95  ? 78   ILE C CG1   1 
ATOM   1845  C  CG2   . ILE C 3  79   ? 322.368 313.802 258.076 1.00 76.95  ? 78   ILE C CG2   1 
ATOM   1846  C  CD1   . ILE C 3  79   ? 324.386 313.904 260.139 1.00 76.95  ? 78   ILE C CD1   1 
ATOM   1847  N  N     . ILE C 3  80   ? 321.251 316.034 255.570 1.00 68.88  ? 79   ILE C N     1 
ATOM   1848  C  CA    . ILE C 3  80   ? 319.970 316.089 254.884 1.00 68.88  ? 79   ILE C CA    1 
ATOM   1849  C  C     . ILE C 3  80   ? 319.382 314.688 254.972 1.00 68.88  ? 79   ILE C C     1 
ATOM   1850  O  O     . ILE C 3  80   ? 320.089 313.788 255.429 1.00 68.88  ? 79   ILE C O     1 
ATOM   1851  C  CB    . ILE C 3  80   ? 320.171 316.572 253.449 1.00 68.88  ? 79   ILE C CB    1 
ATOM   1852  C  CG1   . ILE C 3  80   ? 321.115 315.630 252.735 1.00 68.88  ? 79   ILE C CG1   1 
ATOM   1853  C  CG2   . ILE C 3  80   ? 320.745 317.936 253.478 1.00 68.88  ? 79   ILE C CG2   1 
ATOM   1854  C  CD1   . ILE C 3  80   ? 321.482 316.065 251.340 1.00 68.88  ? 79   ILE C CD1   1 
ATOM   1855  N  N     . PRO C 3  81   ? 318.120 314.443 254.606 1.00 63.85  ? 80   PRO C N     1 
ATOM   1856  C  CA    . PRO C 3  81   ? 317.615 313.070 254.654 1.00 63.85  ? 80   PRO C CA    1 
ATOM   1857  C  C     . PRO C 3  81   ? 318.268 312.126 253.676 1.00 63.85  ? 80   PRO C C     1 
ATOM   1858  O  O     . PRO C 3  81   ? 318.162 310.908 253.866 1.00 63.85  ? 80   PRO C O     1 
ATOM   1859  C  CB    . PRO C 3  81   ? 316.138 313.248 254.334 1.00 63.85  ? 80   PRO C CB    1 
ATOM   1860  C  CG    . PRO C 3  81   ? 315.829 314.522 254.837 1.00 63.85  ? 80   PRO C CG    1 
ATOM   1861  C  CD    . PRO C 3  81   ? 316.989 315.376 254.529 1.00 63.85  ? 80   PRO C CD    1 
ATOM   1862  N  N     . ARG C 3  82   ? 318.920 312.636 252.637 1.00 64.17  ? 81   ARG C N     1 
ATOM   1863  C  CA    . ARG C 3  82   ? 319.608 311.769 251.694 1.00 64.17  ? 81   ARG C CA    1 
ATOM   1864  C  C     . ARG C 3  82   ? 320.734 311.030 252.375 1.00 64.17  ? 81   ARG C C     1 
ATOM   1865  O  O     . ARG C 3  82   ? 320.987 309.861 252.079 1.00 64.17  ? 81   ARG C O     1 
ATOM   1866  C  CB    . ARG C 3  82   ? 320.149 312.586 250.538 1.00 64.17  ? 81   ARG C CB    1 
ATOM   1867  C  CG    . ARG C 3  82   ? 320.900 311.790 249.519 1.00 64.17  ? 81   ARG C CG    1 
ATOM   1868  C  CD    . ARG C 3  82   ? 320.037 310.698 248.964 1.00 64.17  ? 81   ARG C CD    1 
ATOM   1869  N  NE    . ARG C 3  82   ? 320.808 309.663 248.308 1.00 64.17  ? 81   ARG C NE    1 
ATOM   1870  C  CZ    . ARG C 3  82   ? 321.146 309.705 247.033 1.00 64.17  ? 81   ARG C CZ    1 
ATOM   1871  N  NH1   . ARG C 3  82   ? 320.791 310.737 246.295 1.00 64.17  ? 81   ARG C NH1   1 
ATOM   1872  N  NH2   . ARG C 3  82   ? 321.845 308.729 246.495 1.00 64.17  ? 81   ARG C NH2   1 
ATOM   1873  N  N     . HIS C 3  83   ? 321.390 311.684 253.324 1.00 65.25  ? 82   HIS C N     1 
ATOM   1874  C  CA    . HIS C 3  83   ? 322.493 311.056 254.028 1.00 65.25  ? 82   HIS C CA    1 
ATOM   1875  C  C     . HIS C 3  83   ? 321.991 309.967 254.946 1.00 65.25  ? 82   HIS C C     1 
ATOM   1876  O  O     . HIS C 3  83   ? 322.641 308.934 255.099 1.00 65.25  ? 82   HIS C O     1 
ATOM   1877  C  CB    . HIS C 3  83   ? 323.256 312.098 254.809 1.00 65.25  ? 82   HIS C CB    1 
ATOM   1878  C  CG    . HIS C 3  83   ? 323.740 313.225 253.971 1.00 65.25  ? 82   HIS C CG    1 
ATOM   1879  N  ND1   . HIS C 3  83   ? 324.111 314.433 254.504 1.00 65.25  ? 82   HIS C ND1   1 
ATOM   1880  C  CD2   . HIS C 3  83   ? 323.924 313.333 252.639 1.00 65.25  ? 82   HIS C CD2   1 
ATOM   1881  C  CE1   . HIS C 3  83   ? 324.497 315.237 253.536 1.00 65.25  ? 82   HIS C CE1   1 
ATOM   1882  N  NE2   . HIS C 3  83   ? 324.391 314.595 252.393 1.00 65.25  ? 82   HIS C NE2   1 
ATOM   1883  N  N     . LEU C 3  84   ? 320.818 310.172 255.533 1.00 62.14  ? 83   LEU C N     1 
ATOM   1884  C  CA    . LEU C 3  84   ? 320.171 309.128 256.312 1.00 62.14  ? 83   LEU C CA    1 
ATOM   1885  C  C     . LEU C 3  84   ? 319.821 307.938 255.449 1.00 62.14  ? 83   LEU C C     1 
ATOM   1886  O  O     . LEU C 3  84   ? 319.983 306.792 255.869 1.00 62.14  ? 83   LEU C O     1 
ATOM   1887  C  CB    . LEU C 3  84   ? 318.916 309.667 256.962 1.00 62.14  ? 83   LEU C CB    1 
ATOM   1888  C  CG    . LEU C 3  84   ? 319.024 310.064 258.409 1.00 62.14  ? 83   LEU C CG    1 
ATOM   1889  C  CD1   . LEU C 3  84   ? 319.780 311.294 258.540 1.00 62.14  ? 83   LEU C CD1   1 
ATOM   1890  C  CD2   . LEU C 3  84   ? 317.662 310.313 258.868 1.00 62.14  ? 83   LEU C CD2   1 
ATOM   1891  N  N     . GLN C 3  85   ? 319.338 308.185 254.237 1.00 62.18  ? 84   GLN C N     1 
ATOM   1892  C  CA    . GLN C 3  85   ? 318.960 307.069 253.384 1.00 62.18  ? 84   GLN C CA    1 
ATOM   1893  C  C     . GLN C 3  85   ? 320.184 306.315 252.902 1.00 62.18  ? 84   GLN C C     1 
ATOM   1894  O  O     . GLN C 3  85   ? 320.176 305.084 252.838 1.00 62.18  ? 84   GLN C O     1 
ATOM   1895  C  CB    . GLN C 3  85   ? 318.136 307.572 252.213 1.00 62.18  ? 84   GLN C CB    1 
ATOM   1896  C  CG    . GLN C 3  85   ? 317.907 306.561 251.149 1.00 62.18  ? 84   GLN C CG    1 
ATOM   1897  C  CD    . GLN C 3  85   ? 316.688 305.735 251.395 1.00 62.18  ? 84   GLN C CD    1 
ATOM   1898  O  OE1   . GLN C 3  85   ? 316.037 305.866 252.424 1.00 62.18  ? 84   GLN C OE1   1 
ATOM   1899  N  NE2   . GLN C 3  85   ? 316.358 304.876 250.448 1.00 62.18  ? 84   GLN C NE2   1 
ATOM   1900  N  N     . LEU C 3  86   ? 321.260 307.030 252.601 1.00 62.98  ? 85   LEU C N     1 
ATOM   1901  C  CA    . LEU C 3  86   ? 322.495 306.372 252.200 1.00 62.98  ? 85   LEU C CA    1 
ATOM   1902  C  C     . LEU C 3  86   ? 323.102 305.603 253.357 1.00 62.98  ? 85   LEU C C     1 
ATOM   1903  O  O     . LEU C 3  86   ? 323.739 304.569 253.162 1.00 62.98  ? 85   LEU C O     1 
ATOM   1904  C  CB    . LEU C 3  86   ? 323.490 307.395 251.697 1.00 62.98  ? 85   LEU C CB    1 
ATOM   1905  C  CG    . LEU C 3  86   ? 323.172 308.036 250.376 1.00 62.98  ? 85   LEU C CG    1 
ATOM   1906  C  CD1   . LEU C 3  86   ? 323.966 309.303 250.287 1.00 62.98  ? 85   LEU C CD1   1 
ATOM   1907  C  CD2   . LEU C 3  86   ? 323.587 307.084 249.324 1.00 62.98  ? 85   LEU C CD2   1 
ATOM   1908  N  N     . ALA C 3  87   ? 322.930 306.100 254.570 1.00 61.46  ? 86   ALA C N     1 
ATOM   1909  C  CA    . ALA C 3  87   ? 323.456 305.391 255.717 1.00 61.46  ? 86   ALA C CA    1 
ATOM   1910  C  C     . ALA C 3  87   ? 322.638 304.161 256.021 1.00 61.46  ? 86   ALA C C     1 
ATOM   1911  O  O     . ALA C 3  87   ? 323.181 303.160 256.482 1.00 61.46  ? 86   ALA C O     1 
ATOM   1912  C  CB    . ALA C 3  87   ? 323.472 306.305 256.926 1.00 61.46  ? 86   ALA C CB    1 
ATOM   1913  N  N     . VAL C 3  88   ? 321.339 304.215 255.779 1.00 59.17  ? 87   VAL C N     1 
ATOM   1914  C  CA    . VAL C 3  88   ? 320.493 303.081 256.098 1.00 59.17  ? 87   VAL C CA    1 
ATOM   1915  C  C     . VAL C 3  88   ? 320.621 302.006 255.037 1.00 59.17  ? 87   VAL C C     1 
ATOM   1916  O  O     . VAL C 3  88   ? 320.769 300.826 255.358 1.00 59.17  ? 87   VAL C O     1 
ATOM   1917  C  CB    . VAL C 3  88   ? 319.045 303.555 256.273 1.00 59.17  ? 87   VAL C CB    1 
ATOM   1918  C  CG1   . VAL C 3  88   ? 318.089 302.431 256.133 1.00 59.17  ? 87   VAL C CG1   1 
ATOM   1919  C  CG2   . VAL C 3  88   ? 318.872 304.195 257.612 1.00 59.17  ? 87   VAL C CG2   1 
ATOM   1920  N  N     . ARG C 3  89   ? 320.611 302.381 253.763 1.00 63.17  ? 88   ARG C N     1 
ATOM   1921  C  CA    . ARG C 3  89   ? 320.560 301.365 252.722 1.00 63.17  ? 88   ARG C CA    1 
ATOM   1922  C  C     . ARG C 3  89   ? 321.897 300.684 252.514 1.00 63.17  ? 88   ARG C C     1 
ATOM   1923  O  O     . ARG C 3  89   ? 321.930 299.519 252.118 1.00 63.17  ? 88   ARG C O     1 
ATOM   1924  C  CB    . ARG C 3  89   ? 320.085 301.967 251.410 1.00 63.17  ? 88   ARG C CB    1 
ATOM   1925  C  CG    . ARG C 3  89   ? 318.671 302.462 251.447 1.00 63.17  ? 88   ARG C CG    1 
ATOM   1926  C  CD    . ARG C 3  89   ? 317.733 301.422 251.995 1.00 63.17  ? 88   ARG C CD    1 
ATOM   1927  N  NE    . ARG C 3  89   ? 316.427 302.002 252.261 1.00 63.17  ? 88   ARG C NE    1 
ATOM   1928  C  CZ    . ARG C 3  89   ? 315.631 301.634 253.255 1.00 63.17  ? 88   ARG C CZ    1 
ATOM   1929  N  NH1   . ARG C 3  89   ? 316.000 300.671 254.080 1.00 63.17  ? 88   ARG C NH1   1 
ATOM   1930  N  NH2   . ARG C 3  89   ? 314.456 302.224 253.419 1.00 63.17  ? 88   ARG C NH2   1 
ATOM   1931  N  N     . ASN C 3  90   ? 323.000 301.377 252.771 1.00 63.42  ? 89   ASN C N     1 
ATOM   1932  C  CA    . ASN C 3  90   ? 324.302 300.765 252.577 1.00 63.42  ? 89   ASN C CA    1 
ATOM   1933  C  C     . ASN C 3  90   ? 324.603 299.691 253.598 1.00 63.42  ? 89   ASN C C     1 
ATOM   1934  O  O     . ASN C 3  90   ? 325.402 298.799 253.313 1.00 63.42  ? 89   ASN C O     1 
ATOM   1935  C  CB    . ASN C 3  90   ? 325.393 301.811 252.640 1.00 63.42  ? 89   ASN C CB    1 
ATOM   1936  C  CG    . ASN C 3  90   ? 325.456 302.635 251.404 1.00 63.42  ? 89   ASN C CG    1 
ATOM   1937  O  OD1   . ASN C 3  90   ? 325.051 302.197 250.337 1.00 63.42  ? 89   ASN C OD1   1 
ATOM   1938  N  ND2   . ASN C 3  90   ? 325.966 303.842 251.529 1.00 63.42  ? 89   ASN C ND2   1 
ATOM   1939  N  N     . ASP C 3  91   ? 323.995 299.758 254.765 1.00 67.93  ? 90   ASP C N     1 
ATOM   1940  C  CA    . ASP C 3  91   ? 324.189 298.759 255.796 1.00 67.93  ? 90   ASP C CA    1 
ATOM   1941  C  C     . ASP C 3  91   ? 323.445 297.485 255.428 1.00 67.93  ? 90   ASP C C     1 
ATOM   1942  O  O     . ASP C 3  91   ? 322.419 297.510 254.753 1.00 67.93  ? 90   ASP C O     1 
ATOM   1943  C  CB    . ASP C 3  91   ? 323.707 299.296 257.133 1.00 67.93  ? 90   ASP C CB    1 
ATOM   1944  C  CG    . ASP C 3  91   ? 323.982 298.354 258.258 1.00 67.93  ? 90   ASP C CG    1 
ATOM   1945  O  OD1   . ASP C 3  91   ? 323.206 297.392 258.420 1.00 67.93  ? 90   ASP C OD1   1 
ATOM   1946  O  OD2   . ASP C 3  91   ? 324.976 298.564 258.982 1.00 67.93  ? 90   ASP C OD2   1 
ATOM   1947  N  N     . GLU C 3  92   ? 323.975 296.361 255.892 1.00 72.03  ? 91   GLU C N     1 
ATOM   1948  C  CA    . GLU C 3  92   ? 323.401 295.064 255.576 1.00 72.03  ? 91   GLU C CA    1 
ATOM   1949  C  C     . GLU C 3  92   ? 322.244 294.715 256.497 1.00 72.03  ? 91   GLU C C     1 
ATOM   1950  O  O     . GLU C 3  92   ? 321.308 294.031 256.081 1.00 72.03  ? 91   GLU C O     1 
ATOM   1951  C  CB    . GLU C 3  92   ? 324.459 293.957 255.652 1.00 72.03  ? 91   GLU C CB    1 
ATOM   1952  C  CG    . GLU C 3  92   ? 325.627 294.049 254.671 1.00 72.03  ? 91   GLU C CG    1 
ATOM   1953  C  CD    . GLU C 3  92   ? 326.653 295.101 255.040 1.00 72.03  ? 91   GLU C CD    1 
ATOM   1954  O  OE1   . GLU C 3  92   ? 327.433 295.510 254.158 1.00 72.03  ? 91   GLU C OE1   1 
ATOM   1955  O  OE2   . GLU C 3  92   ? 326.671 295.526 256.211 1.00 72.03  ? 91   GLU C OE2   1 
ATOM   1956  N  N     . GLU C 3  93   ? 322.294 295.153 257.751 1.00 68.14  ? 92   GLU C N     1 
ATOM   1957  C  CA    . GLU C 3  93   ? 321.273 294.756 258.704 1.00 68.14  ? 92   GLU C CA    1 
ATOM   1958  C  C     . GLU C 3  93   ? 320.436 295.916 259.199 1.00 68.14  ? 92   GLU C C     1 
ATOM   1959  O  O     . GLU C 3  93   ? 319.283 295.711 259.580 1.00 68.14  ? 92   GLU C O     1 
ATOM   1960  C  CB    . GLU C 3  93   ? 321.901 294.023 259.889 1.00 68.14  ? 92   GLU C CB    1 
ATOM   1961  C  CG    . GLU C 3  93   ? 322.628 294.893 260.855 1.00 68.14  ? 92   GLU C CG    1 
ATOM   1962  C  CD    . GLU C 3  93   ? 324.025 295.192 260.418 1.00 68.14  ? 92   GLU C CD    1 
ATOM   1963  O  OE1   . GLU C 3  93   ? 324.627 294.325 259.763 1.00 68.14  ? 92   GLU C OE1   1 
ATOM   1964  O  OE2   . GLU C 3  93   ? 324.525 296.295 260.719 1.00 68.14  ? 92   GLU C OE2   1 
ATOM   1965  N  N     . LEU C 3  94   ? 320.958 297.136 259.156 1.00 63.62  ? 93   LEU C N     1 
ATOM   1966  C  CA    . LEU C 3  94   ? 320.130 298.289 259.464 1.00 63.62  ? 93   LEU C CA    1 
ATOM   1967  C  C     . LEU C 3  94   ? 319.135 298.536 258.355 1.00 63.62  ? 93   LEU C C     1 
ATOM   1968  O  O     . LEU C 3  94   ? 318.096 299.153 258.579 1.00 63.62  ? 93   LEU C O     1 
ATOM   1969  C  CB    . LEU C 3  94   ? 321.015 299.499 259.661 1.00 63.62  ? 93   LEU C CB    1 
ATOM   1970  C  CG    . LEU C 3  94   ? 320.586 300.763 260.334 1.00 63.62  ? 93   LEU C CG    1 
ATOM   1971  C  CD1   . LEU C 3  94   ? 320.267 300.451 261.749 1.00 63.62  ? 93   LEU C CD1   1 
ATOM   1972  C  CD2   . LEU C 3  94   ? 321.797 301.632 260.242 1.00 63.62  ? 93   LEU C CD2   1 
ATOM   1973  N  N     . ASN C 3  95   ? 319.447 298.070 257.155 1.00 63.39  ? 94   ASN C N     1 
ATOM   1974  C  CA    . ASN C 3  95   ? 318.457 298.018 256.100 1.00 63.39  ? 94   ASN C CA    1 
ATOM   1975  C  C     . ASN C 3  95   ? 317.384 296.993 256.417 1.00 63.39  ? 94   ASN C C     1 
ATOM   1976  O  O     . ASN C 3  95   ? 316.205 297.215 256.139 1.00 63.39  ? 94   ASN C O     1 
ATOM   1977  C  CB    . ASN C 3  95   ? 319.139 297.691 254.784 1.00 63.39  ? 94   ASN C CB    1 
ATOM   1978  C  CG    . ASN C 3  95   ? 318.175 297.349 253.710 1.00 63.39  ? 94   ASN C CG    1 
ATOM   1979  O  OD1   . ASN C 3  95   ? 317.172 298.023 253.517 1.00 63.39  ? 94   ASN C OD1   1 
ATOM   1980  N  ND2   . ASN C 3  95   ? 318.461 296.284 252.997 1.00 63.39  ? 94   ASN C ND2   1 
ATOM   1981  N  N     . LYS C 3  96   ? 317.772 295.856 256.993 1.00 62.12  ? 95   LYS C N     1 
ATOM   1982  C  CA    . LYS C 3  96   ? 316.784 294.841 257.325 1.00 62.12  ? 95   LYS C CA    1 
ATOM   1983  C  C     . LYS C 3  96   ? 315.883 295.288 258.449 1.00 62.12  ? 95   LYS C C     1 
ATOM   1984  O  O     . LYS C 3  96   ? 314.727 294.871 258.514 1.00 62.12  ? 95   LYS C O     1 
ATOM   1985  C  CB    . LYS C 3  96   ? 317.456 293.534 257.709 1.00 62.12  ? 95   LYS C CB    1 
ATOM   1986  C  CG    . LYS C 3  96   ? 317.852 292.688 256.533 1.00 62.12  ? 95   LYS C CG    1 
ATOM   1987  C  CD    . LYS C 3  96   ? 318.234 291.291 256.974 1.00 62.12  ? 95   LYS C CD    1 
ATOM   1988  C  CE    . LYS C 3  96   ? 319.640 291.258 257.528 1.00 62.12  ? 95   LYS C CE    1 
ATOM   1989  N  NZ    . LYS C 3  96   ? 320.065 289.888 257.886 1.00 62.12  ? 95   LYS C NZ    1 
ATOM   1990  N  N     . LEU C 3  97   ? 316.388 296.125 259.345 1.00 59.85  ? 96   LEU C N     1 
ATOM   1991  C  CA    . LEU C 3  97   ? 315.539 296.671 260.393 1.00 59.85  ? 96   LEU C CA    1 
ATOM   1992  C  C     . LEU C 3  97   ? 314.521 297.628 259.803 1.00 59.85  ? 96   LEU C C     1 
ATOM   1993  O  O     . LEU C 3  97   ? 313.312 297.430 259.937 1.00 59.85  ? 96   LEU C O     1 
ATOM   1994  C  CB    . LEU C 3  97   ? 316.393 297.366 261.440 1.00 59.85  ? 96   LEU C CB    1 
ATOM   1995  C  CG    . LEU C 3  97   ? 315.613 298.116 262.493 1.00 59.85  ? 96   LEU C CG    1 
ATOM   1996  C  CD1   . LEU C 3  97   ? 314.814 297.150 263.293 1.00 59.85  ? 96   LEU C CD1   1 
ATOM   1997  C  CD2   . LEU C 3  97   ? 316.563 298.855 263.376 1.00 59.85  ? 96   LEU C CD2   1 
ATOM   1998  N  N     . LEU C 3  98   ? 314.993 298.649 259.112 1.00 58.16  ? 97   LEU C N     1 
ATOM   1999  C  CA    . LEU C 3  98   ? 314.121 299.591 258.428 1.00 58.16  ? 97   LEU C CA    1 
ATOM   2000  C  C     . LEU C 3  98   ? 313.820 299.096 257.021 1.00 58.16  ? 97   LEU C C     1 
ATOM   2001  O  O     . LEU C 3  98   ? 314.246 299.655 256.026 1.00 58.16  ? 97   LEU C O     1 
ATOM   2002  C  CB    . LEU C 3  98   ? 314.765 300.961 258.408 1.00 58.16  ? 97   LEU C CB    1 
ATOM   2003  C  CG    . LEU C 3  98   ? 315.268 301.309 259.795 1.00 58.16  ? 97   LEU C CG    1 
ATOM   2004  C  CD1   . LEU C 3  98   ? 316.251 302.420 259.724 1.00 58.16  ? 97   LEU C CD1   1 
ATOM   2005  C  CD2   . LEU C 3  98   ? 314.108 301.708 260.638 1.00 58.16  ? 97   LEU C CD2   1 
ATOM   2006  N  N     . GLY C 3  99   ? 313.080 298.001 256.967 1.00 60.20  ? 98   GLY C N     1 
ATOM   2007  C  CA    . GLY C 3  99   ? 312.855 297.311 255.716 1.00 60.20  ? 98   GLY C CA    1 
ATOM   2008  C  C     . GLY C 3  99   ? 311.851 297.966 254.801 1.00 60.20  ? 98   GLY C C     1 
ATOM   2009  O  O     . GLY C 3  99   ? 312.207 298.451 253.728 1.00 60.20  ? 98   GLY C O     1 
ATOM   2010  N  N     . GLY C 3  100  ? 310.594 297.999 255.220 1.00 59.37  ? 99   GLY C N     1 
ATOM   2011  C  CA    . GLY C 3  100  ? 309.567 298.577 254.388 1.00 59.37  ? 99   GLY C CA    1 
ATOM   2012  C  C     . GLY C 3  100  ? 309.363 300.048 254.657 1.00 59.37  ? 99   GLY C C     1 
ATOM   2013  O  O     . GLY C 3  100  ? 308.258 300.558 254.502 1.00 59.37  ? 99   GLY C O     1 
ATOM   2014  N  N     . VAL C 3  101  ? 310.427 300.749 255.022 1.00 58.88  ? 100  VAL C N     1 
ATOM   2015  C  CA    . VAL C 3  101  ? 310.350 302.107 255.532 1.00 58.88  ? 100  VAL C CA    1 
ATOM   2016  C  C     . VAL C 3  101  ? 310.890 303.056 254.484 1.00 58.88  ? 100  VAL C C     1 
ATOM   2017  O  O     . VAL C 3  101  ? 311.971 302.829 253.935 1.00 58.88  ? 100  VAL C O     1 
ATOM   2018  C  CB    . VAL C 3  101  ? 311.150 302.252 256.829 1.00 58.88  ? 100  VAL C CB    1 
ATOM   2019  C  CG1   . VAL C 3  101  ? 310.964 303.594 257.376 1.00 58.88  ? 100  VAL C CG1   1 
ATOM   2020  C  CG2   . VAL C 3  101  ? 310.710 301.222 257.814 1.00 58.88  ? 100  VAL C CG2   1 
ATOM   2021  N  N     . THR C 3  102  ? 310.148 304.118 254.206 1.00 58.12  ? 101  THR C N     1 
ATOM   2022  C  CA    . THR C 3  102  ? 310.571 305.112 253.242 1.00 58.12  ? 101  THR C CA    1 
ATOM   2023  C  C     . THR C 3  102  ? 310.952 306.381 253.974 1.00 58.12  ? 101  THR C C     1 
ATOM   2024  O  O     . THR C 3  102  ? 310.137 306.955 254.688 1.00 58.12  ? 101  THR C O     1 
ATOM   2025  C  CB    . THR C 3  102  ? 309.469 305.415 252.240 1.00 58.12  ? 101  THR C CB    1 
ATOM   2026  O  OG1   . THR C 3  102  ? 308.413 306.089 252.909 1.00 58.12  ? 101  THR C OG1   1 
ATOM   2027  C  CG2   . THR C 3  102  ? 308.914 304.140 251.694 1.00 58.12  ? 101  THR C CG2   1 
ATOM   2028  N  N     . ILE C 3  103  ? 312.189 306.804 253.806 1.00 59.51  ? 102  ILE C N     1 
ATOM   2029  C  CA    . ILE C 3  103  ? 312.646 308.097 254.280 1.00 59.51  ? 102  ILE C CA    1 
ATOM   2030  C  C     . ILE C 3  103  ? 312.200 309.138 253.269 1.00 59.51  ? 102  ILE C C     1 
ATOM   2031  O  O     . ILE C 3  103  ? 312.486 309.014 252.077 1.00 59.51  ? 102  ILE C O     1 
ATOM   2032  C  CB    . ILE C 3  103  ? 314.168 308.105 254.465 1.00 59.51  ? 102  ILE C CB    1 
ATOM   2033  C  CG1   . ILE C 3  103  ? 314.560 307.391 255.748 1.00 59.51  ? 102  ILE C CG1   1 
ATOM   2034  C  CG2   . ILE C 3  103  ? 314.713 309.471 254.475 1.00 59.51  ? 102  ILE C CG2   1 
ATOM   2035  C  CD1   . ILE C 3  103  ? 314.923 305.956 255.582 1.00 59.51  ? 102  ILE C CD1   1 
ATOM   2036  N  N     . ALA C 3  104  ? 311.465 310.142 253.728 1.00 60.37  ? 103  ALA C N     1 
ATOM   2037  C  CA    . ALA C 3  104  ? 310.977 311.166 252.823 1.00 60.37  ? 103  ALA C CA    1 
ATOM   2038  C  C     . ALA C 3  104  ? 312.121 312.052 252.373 1.00 60.37  ? 103  ALA C C     1 
ATOM   2039  O  O     . ALA C 3  104  ? 312.999 312.386 253.165 1.00 60.37  ? 103  ALA C O     1 
ATOM   2040  C  CB    . ALA C 3  104  ? 309.911 312.012 253.498 1.00 60.37  ? 103  ALA C CB    1 
ATOM   2041  N  N     . GLN C 3  105  ? 312.104 312.400 251.083 1.00 60.48  ? 104  GLN C N     1 
ATOM   2042  C  CA    . GLN C 3  105  ? 313.120 313.213 250.407 1.00 60.48  ? 104  GLN C CA    1 
ATOM   2043  C  C     . GLN C 3  105  ? 314.509 312.596 250.476 1.00 60.48  ? 104  GLN C C     1 
ATOM   2044  O  O     . GLN C 3  105  ? 315.514 313.295 250.424 1.00 60.48  ? 104  GLN C O     1 
ATOM   2045  C  CB    . GLN C 3  105  ? 313.160 314.643 250.931 1.00 60.48  ? 104  GLN C CB    1 
ATOM   2046  C  CG    . GLN C 3  105  ? 311.931 315.420 250.656 1.00 60.48  ? 104  GLN C CG    1 
ATOM   2047  C  CD    . GLN C 3  105  ? 312.031 316.192 249.377 1.00 60.48  ? 104  GLN C CD    1 
ATOM   2048  O  OE1   . GLN C 3  105  ? 312.904 315.939 248.556 1.00 60.48  ? 104  GLN C OE1   1 
ATOM   2049  N  NE2   . GLN C 3  105  ? 311.140 317.157 249.197 1.00 60.48  ? 104  GLN C NE2   1 
ATOM   2050  N  N     . GLY C 3  106  ? 314.578 311.289 250.584 1.00 60.05  ? 105  GLY C N     1 
ATOM   2051  C  CA    . GLY C 3  106  ? 315.852 310.643 250.433 1.00 60.05  ? 105  GLY C CA    1 
ATOM   2052  C  C     . GLY C 3  106  ? 315.703 309.683 249.292 1.00 60.05  ? 105  GLY C C     1 
ATOM   2053  O  O     . GLY C 3  106  ? 314.987 308.695 249.414 1.00 60.05  ? 105  GLY C O     1 
ATOM   2054  N  N     . GLY C 3  107  ? 316.350 309.963 248.171 1.00 63.45  ? 106  GLY C N     1 
ATOM   2055  C  CA    . GLY C 3  107  ? 316.156 309.179 246.975 1.00 63.45  ? 106  GLY C CA    1 
ATOM   2056  C  C     . GLY C 3  107  ? 316.785 307.814 247.089 1.00 63.45  ? 106  GLY C C     1 
ATOM   2057  O  O     . GLY C 3  107  ? 317.398 307.455 248.090 1.00 63.45  ? 106  GLY C O     1 
ATOM   2058  N  N     . VAL C 3  108  ? 316.640 307.045 246.041 1.00 63.49  ? 107  VAL C N     1 
ATOM   2059  C  CA    . VAL C 3  108  ? 317.045 305.653 246.100 1.00 63.49  ? 107  VAL C CA    1 
ATOM   2060  C  C     . VAL C 3  108  ? 318.549 305.543 245.950 1.00 63.49  ? 107  VAL C C     1 
ATOM   2061  O  O     . VAL C 3  108  ? 319.234 306.478 245.525 1.00 63.49  ? 107  VAL C O     1 
ATOM   2062  C  CB    . VAL C 3  108  ? 316.320 304.833 245.033 1.00 63.49  ? 107  VAL C CB    1 
ATOM   2063  C  CG1   . VAL C 3  108  ? 314.851 305.128 245.086 1.00 63.49  ? 107  VAL C CG1   1 
ATOM   2064  C  CG2   . VAL C 3  108  ? 316.882 305.157 243.705 1.00 63.49  ? 107  VAL C CG2   1 
ATOM   2065  N  N     . LEU C 3  109  ? 319.052 304.389 246.322 1.00 66.92  ? 108  LEU C N     1 
ATOM   2066  C  CA    . LEU C 3  109  ? 320.479 304.172 246.412 1.00 66.92  ? 108  LEU C CA    1 
ATOM   2067  C  C     . LEU C 3  109  ? 321.055 304.015 245.014 1.00 66.92  ? 108  LEU C C     1 
ATOM   2068  O  O     . LEU C 3  109  ? 320.495 303.264 244.211 1.00 66.92  ? 108  LEU C O     1 
ATOM   2069  C  CB    . LEU C 3  109  ? 320.728 302.920 247.224 1.00 66.92  ? 108  LEU C CB    1 
ATOM   2070  C  CG    . LEU C 3  109  ? 322.140 302.703 247.710 1.00 66.92  ? 108  LEU C CG    1 
ATOM   2071  C  CD1   . LEU C 3  109  ? 322.343 303.611 248.868 1.00 66.92  ? 108  LEU C CD1   1 
ATOM   2072  C  CD2   . LEU C 3  109  ? 322.345 301.267 248.104 1.00 66.92  ? 108  LEU C CD2   1 
ATOM   2073  N  N     . PRO C 3  110  ? 322.170 304.679 244.687 1.00 68.46  ? 109  PRO C N     1 
ATOM   2074  C  CA    . PRO C 3  110  ? 322.671 304.659 243.307 1.00 68.46  ? 109  PRO C CA    1 
ATOM   2075  C  C     . PRO C 3  110  ? 323.185 303.305 242.870 1.00 68.46  ? 109  PRO C C     1 
ATOM   2076  O  O     . PRO C 3  110  ? 324.392 303.075 242.801 1.00 68.46  ? 109  PRO C O     1 
ATOM   2077  C  CB    . PRO C 3  110  ? 323.804 305.689 243.333 1.00 68.46  ? 109  PRO C CB    1 
ATOM   2078  C  CG    . PRO C 3  110  ? 323.543 306.519 244.511 1.00 68.46  ? 109  PRO C CG    1 
ATOM   2079  C  CD    . PRO C 3  110  ? 322.912 305.633 245.515 1.00 68.46  ? 109  PRO C CD    1 
ATOM   2080  N  N     . ASN C 3  111  ? 322.263 302.406 242.566 1.00 69.05  ? 110  ASN C N     1 
ATOM   2081  C  CA    . ASN C 3  111  ? 322.626 301.043 242.248 1.00 69.05  ? 110  ASN C CA    1 
ATOM   2082  C  C     . ASN C 3  111  ? 321.569 300.368 241.380 1.00 69.05  ? 110  ASN C C     1 
ATOM   2083  O  O     . ASN C 3  111  ? 321.814 300.060 240.214 1.00 69.05  ? 110  ASN C O     1 
ATOM   2084  C  CB    . ASN C 3  111  ? 322.829 300.254 243.533 1.00 69.05  ? 110  ASN C CB    1 
ATOM   2085  C  CG    . ASN C 3  111  ? 324.086 299.435 243.508 1.00 69.05  ? 110  ASN C CG    1 
ATOM   2086  O  OD1   . ASN C 3  111  ? 325.139 299.914 243.095 1.00 69.05  ? 110  ASN C OD1   1 
ATOM   2087  N  ND2   . ASN C 3  111  ? 323.993 298.195 243.959 1.00 69.05  ? 110  ASN C ND2   1 
ATOM   2088  N  N     . SER D 4  37   ? 308.572 315.569 271.523 1.00 62.68  ? 33   SER D N     1 
ATOM   2089  C  CA    . SER D 4  37   ? 309.539 315.450 270.448 1.00 62.68  ? 33   SER D CA    1 
ATOM   2090  C  C     . SER D 4  37   ? 310.940 315.241 270.978 1.00 62.68  ? 33   SER D C     1 
ATOM   2091  O  O     . SER D 4  37   ? 311.363 315.919 271.896 1.00 62.68  ? 33   SER D O     1 
ATOM   2092  C  CB    . SER D 4  37   ? 309.509 316.688 269.569 1.00 62.68  ? 33   SER D CB    1 
ATOM   2093  O  OG    . SER D 4  37   ? 310.538 316.636 268.602 1.00 62.68  ? 33   SER D OG    1 
ATOM   2094  N  N     . TYR D 4  38   ? 311.660 314.301 270.379 1.00 62.66  ? 34   TYR D N     1 
ATOM   2095  C  CA    . TYR D 4  38   ? 313.012 313.943 270.792 1.00 62.66  ? 34   TYR D CA    1 
ATOM   2096  C  C     . TYR D 4  38   ? 313.963 314.815 269.997 1.00 62.66  ? 34   TYR D C     1 
ATOM   2097  O  O     . TYR D 4  38   ? 314.741 314.330 269.188 1.00 62.66  ? 34   TYR D O     1 
ATOM   2098  C  CB    . TYR D 4  38   ? 313.329 312.484 270.523 1.00 62.66  ? 34   TYR D CB    1 
ATOM   2099  C  CG    . TYR D 4  38   ? 312.458 311.443 271.155 1.00 62.66  ? 34   TYR D CG    1 
ATOM   2100  C  CD1   . TYR D 4  38   ? 311.207 311.161 270.655 1.00 62.66  ? 34   TYR D CD1   1 
ATOM   2101  C  CD2   . TYR D 4  38   ? 312.926 310.684 272.202 1.00 62.66  ? 34   TYR D CD2   1 
ATOM   2102  C  CE1   . TYR D 4  38   ? 310.435 310.195 271.208 1.00 62.66  ? 34   TYR D CE1   1 
ATOM   2103  C  CE2   . TYR D 4  38   ? 312.161 309.713 272.757 1.00 62.66  ? 34   TYR D CE2   1 
ATOM   2104  C  CZ    . TYR D 4  38   ? 310.915 309.470 272.255 1.00 62.66  ? 34   TYR D CZ    1 
ATOM   2105  O  OH    . TYR D 4  38   ? 310.129 308.492 272.801 1.00 62.66  ? 34   TYR D OH    1 
ATOM   2106  N  N     . ALA D 4  39   ? 313.911 316.109 270.221 1.00 68.11  ? 35   ALA D N     1 
ATOM   2107  C  CA    . ALA D 4  39   ? 314.695 317.010 269.407 1.00 68.11  ? 35   ALA D CA    1 
ATOM   2108  C  C     . ALA D 4  39   ? 316.086 317.201 269.982 1.00 68.11  ? 35   ALA D C     1 
ATOM   2109  O  O     . ALA D 4  39   ? 317.072 317.044 269.274 1.00 68.11  ? 35   ALA D O     1 
ATOM   2110  C  CB    . ALA D 4  39   ? 313.983 318.355 269.279 1.00 68.11  ? 35   ALA D CB    1 
ATOM   2111  N  N     . ILE D 4  40   ? 316.179 317.543 271.261 1.00 72.05  ? 36   ILE D N     1 
ATOM   2112  C  CA    . ILE D 4  40   ? 317.464 317.888 271.839 1.00 72.05  ? 36   ILE D CA    1 
ATOM   2113  C  C     . ILE D 4  40   ? 318.323 316.664 272.029 1.00 72.05  ? 36   ILE D C     1 
ATOM   2114  O  O     . ILE D 4  40   ? 319.551 316.758 272.043 1.00 72.05  ? 36   ILE D O     1 
ATOM   2115  C  CB    . ILE D 4  40   ? 317.241 318.616 273.164 1.00 72.05  ? 36   ILE D CB    1 
ATOM   2116  C  CG1   . ILE D 4  40   ? 316.054 317.999 273.881 1.00 72.05  ? 36   ILE D CG1   1 
ATOM   2117  C  CG2   . ILE D 4  40   ? 317.001 320.075 272.932 1.00 72.05  ? 36   ILE D CG2   1 
ATOM   2118  C  CD1   . ILE D 4  40   ? 315.880 318.515 275.255 1.00 72.05  ? 36   ILE D CD1   1 
ATOM   2119  N  N     . TYR D 4  41   ? 317.705 315.497 272.170 1.00 70.27  ? 37   TYR D N     1 
ATOM   2120  C  CA    . TYR D 4  41   ? 318.465 314.292 272.460 1.00 70.27  ? 37   TYR D CA    1 
ATOM   2121  C  C     . TYR D 4  41   ? 319.150 313.776 271.215 1.00 70.27  ? 37   TYR D C     1 
ATOM   2122  O  O     . TYR D 4  41   ? 320.272 313.271 271.279 1.00 70.27  ? 37   TYR D O     1 
ATOM   2123  C  CB    . TYR D 4  41   ? 317.555 313.233 273.052 1.00 70.27  ? 37   TYR D CB    1 
ATOM   2124  C  CG    . TYR D 4  41   ? 316.684 313.799 274.109 1.00 70.27  ? 37   TYR D CG    1 
ATOM   2125  C  CD1   . TYR D 4  41   ? 317.226 314.430 275.203 1.00 70.27  ? 37   TYR D CD1   1 
ATOM   2126  C  CD2   . TYR D 4  41   ? 315.317 313.741 274.001 1.00 70.27  ? 37   TYR D CD2   1 
ATOM   2127  C  CE1   . TYR D 4  41   ? 316.429 314.971 276.164 1.00 70.27  ? 37   TYR D CE1   1 
ATOM   2128  C  CE2   . TYR D 4  41   ? 314.511 314.282 274.961 1.00 70.27  ? 37   TYR D CE2   1 
ATOM   2129  C  CZ    . TYR D 4  41   ? 315.075 314.891 276.035 1.00 70.27  ? 37   TYR D CZ    1 
ATOM   2130  O  OH    . TYR D 4  41   ? 314.282 315.434 277.000 1.00 70.27  ? 37   TYR D OH    1 
ATOM   2131  N  N     . VAL D 4  42   ? 318.501 313.910 270.069 1.00 68.82  ? 38   VAL D N     1 
ATOM   2132  C  CA    . VAL D 4  42   ? 319.146 313.510 268.833 1.00 68.82  ? 38   VAL D CA    1 
ATOM   2133  C  C     . VAL D 4  42   ? 320.267 314.475 268.500 1.00 68.82  ? 38   VAL D C     1 
ATOM   2134  O  O     . VAL D 4  42   ? 321.326 314.077 268.012 1.00 68.82  ? 38   VAL D O     1 
ATOM   2135  C  CB    . VAL D 4  42   ? 318.104 313.404 267.715 1.00 68.82  ? 38   VAL D CB    1 
ATOM   2136  C  CG1   . VAL D 4  42   ? 318.749 313.041 266.422 1.00 68.82  ? 38   VAL D CG1   1 
ATOM   2137  C  CG2   . VAL D 4  42   ? 317.116 312.353 268.070 1.00 68.82  ? 38   VAL D CG2   1 
ATOM   2138  N  N     . TYR D 4  43   ? 320.104 315.737 268.851 1.00 79.85  ? 39   TYR D N     1 
ATOM   2139  C  CA    . TYR D 4  43   ? 321.192 316.665 268.620 1.00 79.85  ? 39   TYR D CA    1 
ATOM   2140  C  C     . TYR D 4  43   ? 322.324 316.438 269.609 1.00 79.85  ? 39   TYR D C     1 
ATOM   2141  O  O     . TYR D 4  43   ? 323.485 316.640 269.260 1.00 79.85  ? 39   TYR D O     1 
ATOM   2142  C  CB    . TYR D 4  43   ? 320.671 318.099 268.669 1.00 79.85  ? 39   TYR D CB    1 
ATOM   2143  C  CG    . TYR D 4  43   ? 321.654 319.109 268.158 1.00 79.85  ? 39   TYR D CG    1 
ATOM   2144  C  CD1   . TYR D 4  43   ? 322.555 318.783 267.160 1.00 79.85  ? 39   TYR D CD1   1 
ATOM   2145  C  CD2   . TYR D 4  43   ? 321.691 320.386 268.679 1.00 79.85  ? 39   TYR D CD2   1 
ATOM   2146  C  CE1   . TYR D 4  43   ? 323.471 319.685 266.705 1.00 79.85  ? 39   TYR D CE1   1 
ATOM   2147  C  CE2   . TYR D 4  43   ? 322.607 321.304 268.221 1.00 79.85  ? 39   TYR D CE2   1 
ATOM   2148  C  CZ    . TYR D 4  43   ? 323.491 320.942 267.232 1.00 79.85  ? 39   TYR D CZ    1 
ATOM   2149  O  OH    . TYR D 4  43   ? 324.408 321.842 266.763 1.00 79.85  ? 39   TYR D OH    1 
ATOM   2150  N  N     . LYS D 4  44   ? 322.038 315.941 270.802 1.00 67.73  ? 40   LYS D N     1 
ATOM   2151  C  CA    . LYS D 4  44   ? 323.149 315.707 271.712 1.00 67.73  ? 40   LYS D CA    1 
ATOM   2152  C  C     . LYS D 4  44   ? 323.870 314.410 271.399 1.00 67.73  ? 40   LYS D C     1 
ATOM   2153  O  O     . LYS D 4  44   ? 325.098 314.339 271.499 1.00 67.73  ? 40   LYS D O     1 
ATOM   2154  C  CB    . LYS D 4  44   ? 322.675 315.715 273.146 1.00 67.73  ? 40   LYS D CB    1 
ATOM   2155  C  CG    . LYS D 4  44   ? 323.800 315.591 274.137 1.00 67.73  ? 40   LYS D CG    1 
ATOM   2156  C  CD    . LYS D 4  44   ? 324.921 316.588 273.902 1.00 67.73  ? 40   LYS D CD    1 
ATOM   2157  C  CE    . LYS D 4  44   ? 326.251 316.017 274.358 1.00 67.73  ? 40   LYS D CE    1 
ATOM   2158  N  NZ    . LYS D 4  44   ? 327.219 317.078 274.726 1.00 67.73  ? 40   LYS D NZ    1 
ATOM   2159  N  N     . VAL D 4  45   ? 323.154 313.382 270.959 1.00 64.75  ? 41   VAL D N     1 
ATOM   2160  C  CA    . VAL D 4  45   ? 323.870 312.203 270.504 1.00 64.75  ? 41   VAL D CA    1 
ATOM   2161  C  C     . VAL D 4  45   ? 324.566 312.465 269.178 1.00 64.75  ? 41   VAL D C     1 
ATOM   2162  O  O     . VAL D 4  45   ? 325.542 311.797 268.864 1.00 64.75  ? 41   VAL D O     1 
ATOM   2163  C  CB    . VAL D 4  45   ? 322.908 311.001 270.466 1.00 64.75  ? 41   VAL D CB    1 
ATOM   2164  C  CG1   . VAL D 4  45   ? 321.935 311.151 269.418 1.00 64.75  ? 41   VAL D CG1   1 
ATOM   2165  C  CG2   . VAL D 4  45   ? 323.633 309.704 270.320 1.00 64.75  ? 41   VAL D CG2   1 
ATOM   2166  N  N     . LEU D 4  46   ? 324.161 313.486 268.436 1.00 67.49  ? 42   LEU D N     1 
ATOM   2167  C  CA    . LEU D 4  46   ? 324.965 313.919 267.304 1.00 67.49  ? 42   LEU D CA    1 
ATOM   2168  C  C     . LEU D 4  46   ? 326.206 314.671 267.752 1.00 67.49  ? 42   LEU D C     1 
ATOM   2169  O  O     . LEU D 4  46   ? 327.278 314.480 267.188 1.00 67.49  ? 42   LEU D O     1 
ATOM   2170  C  CB    . LEU D 4  46   ? 324.130 314.786 266.379 1.00 67.49  ? 42   LEU D CB    1 
ATOM   2171  C  CG    . LEU D 4  46   ? 324.777 315.181 265.072 1.00 67.49  ? 42   LEU D CG    1 
ATOM   2172  C  CD1   . LEU D 4  46   ? 325.184 313.966 264.331 1.00 67.49  ? 42   LEU D CD1   1 
ATOM   2173  C  CD2   . LEU D 4  46   ? 323.780 315.914 264.278 1.00 67.49  ? 42   LEU D CD2   1 
ATOM   2174  N  N     . LYS D 4  47   ? 326.102 315.505 268.777 1.00 68.66  ? 43   LYS D N     1 
ATOM   2175  C  CA    . LYS D 4  47   ? 327.293 316.172 269.286 1.00 68.66  ? 43   LYS D CA    1 
ATOM   2176  C  C     . LYS D 4  47   ? 328.165 315.270 270.127 1.00 68.66  ? 43   LYS D C     1 
ATOM   2177  O  O     . LYS D 4  47   ? 329.131 315.760 270.711 1.00 68.66  ? 43   LYS D O     1 
ATOM   2178  C  CB    . LYS D 4  47   ? 326.927 317.387 270.119 1.00 68.66  ? 43   LYS D CB    1 
ATOM   2179  C  CG    . LYS D 4  47   ? 326.202 318.461 269.373 1.00 68.66  ? 43   LYS D CG    1 
ATOM   2180  C  CD    . LYS D 4  47   ? 326.381 319.815 270.049 1.00 68.66  ? 43   LYS D CD    1 
ATOM   2181  C  CE    . LYS D 4  47   ? 325.859 319.839 271.488 1.00 68.66  ? 43   LYS D CE    1 
ATOM   2182  N  NZ    . LYS D 4  47   ? 324.412 320.147 271.609 1.00 68.66  ? 43   LYS D NZ    1 
ATOM   2183  N  N     . GLN D 4  48   ? 327.806 314.003 270.286 1.00 66.40  ? 44   GLN D N     1 
ATOM   2184  C  CA    . GLN D 4  48   ? 328.763 313.023 270.780 1.00 66.40  ? 44   GLN D CA    1 
ATOM   2185  C  C     . GLN D 4  48   ? 329.537 312.335 269.668 1.00 66.40  ? 44   GLN D C     1 
ATOM   2186  O  O     . GLN D 4  48   ? 330.757 312.226 269.781 1.00 66.40  ? 44   GLN D O     1 
ATOM   2187  C  CB    . GLN D 4  48   ? 328.074 311.963 271.627 1.00 66.40  ? 44   GLN D CB    1 
ATOM   2188  C  CG    . GLN D 4  48   ? 327.473 312.530 272.873 1.00 66.40  ? 44   GLN D CG    1 
ATOM   2189  C  CD    . GLN D 4  48   ? 327.537 311.586 274.031 1.00 66.40  ? 44   GLN D CD    1 
ATOM   2190  O  OE1   . GLN D 4  48   ? 328.613 311.170 274.442 1.00 66.40  ? 44   GLN D OE1   1 
ATOM   2191  N  NE2   . GLN D 4  48   ? 326.381 311.240 274.575 1.00 66.40  ? 44   GLN D NE2   1 
ATOM   2192  N  N     . VAL D 4  49   ? 328.890 311.855 268.606 1.00 60.83  ? 45   VAL D N     1 
ATOM   2193  C  CA    . VAL D 4  49   ? 329.647 311.178 267.553 1.00 60.83  ? 45   VAL D CA    1 
ATOM   2194  C  C     . VAL D 4  49   ? 330.405 312.168 266.689 1.00 60.83  ? 45   VAL D C     1 
ATOM   2195  O  O     . VAL D 4  49   ? 331.629 312.115 266.622 1.00 60.83  ? 45   VAL D O     1 
ATOM   2196  C  CB    . VAL D 4  49   ? 328.758 310.247 266.704 1.00 60.83  ? 45   VAL D CB    1 
ATOM   2197  C  CG1   . VAL D 4  49   ? 328.485 309.006 267.443 1.00 60.83  ? 45   VAL D CG1   1 
ATOM   2198  C  CG2   . VAL D 4  49   ? 327.437 310.848 266.409 1.00 60.83  ? 45   VAL D CG2   1 
ATOM   2199  N  N     . HIS D 4  50   ? 329.717 313.104 266.054 1.00 64.28  ? 46   HIS D N     1 
ATOM   2200  C  CA    . HIS D 4  50   ? 330.329 314.095 265.184 1.00 64.28  ? 46   HIS D CA    1 
ATOM   2201  C  C     . HIS D 4  50   ? 330.079 315.448 265.820 1.00 64.28  ? 46   HIS D C     1 
ATOM   2202  O  O     . HIS D 4  50   ? 329.041 316.070 265.578 1.00 64.28  ? 46   HIS D O     1 
ATOM   2203  C  CB    . HIS D 4  50   ? 329.718 314.055 263.801 1.00 64.28  ? 46   HIS D CB    1 
ATOM   2204  C  CG    . HIS D 4  50   ? 329.662 312.698 263.218 1.00 64.28  ? 46   HIS D CG    1 
ATOM   2205  N  ND1   . HIS D 4  50   ? 330.757 312.091 262.653 1.00 64.28  ? 46   HIS D ND1   1 
ATOM   2206  C  CD2   . HIS D 4  50   ? 328.643 311.826 263.099 1.00 64.28  ? 46   HIS D CD2   1 
ATOM   2207  C  CE1   . HIS D 4  50   ? 330.416 310.896 262.211 1.00 64.28  ? 46   HIS D CE1   1 
ATOM   2208  N  NE2   . HIS D 4  50   ? 329.137 310.711 262.468 1.00 64.28  ? 46   HIS D NE2   1 
ATOM   2209  N  N     . PRO D 4  51   ? 330.984 315.941 266.596 1.00 66.56  ? 47   PRO D N     1 
ATOM   2210  C  CA    . PRO D 4  51   ? 330.752 317.255 267.182 1.00 66.56  ? 47   PRO D CA    1 
ATOM   2211  C  C     . PRO D 4  51   ? 331.178 318.390 266.281 1.00 66.56  ? 47   PRO D C     1 
ATOM   2212  O  O     . PRO D 4  51   ? 331.661 319.411 266.766 1.00 66.56  ? 47   PRO D O     1 
ATOM   2213  C  CB    . PRO D 4  51   ? 331.613 317.213 268.439 1.00 66.56  ? 47   PRO D CB    1 
ATOM   2214  C  CG    . PRO D 4  51   ? 332.738 316.338 268.050 1.00 66.56  ? 47   PRO D CG    1 
ATOM   2215  C  CD    . PRO D 4  51   ? 332.218 315.324 267.088 1.00 66.56  ? 47   PRO D CD    1 
ATOM   2216  N  N     . ASP D 4  52   ? 330.978 318.244 264.979 1.00 73.69  ? 48   ASP D N     1 
ATOM   2217  C  CA    . ASP D 4  52   ? 331.200 319.320 264.033 1.00 73.69  ? 48   ASP D CA    1 
ATOM   2218  C  C     . ASP D 4  52   ? 330.224 319.314 262.874 1.00 73.69  ? 48   ASP D C     1 
ATOM   2219  O  O     . ASP D 4  52   ? 330.315 320.196 262.021 1.00 73.69  ? 48   ASP D O     1 
ATOM   2220  C  CB    . ASP D 4  52   ? 332.634 319.271 263.517 1.00 73.69  ? 48   ASP D CB    1 
ATOM   2221  C  CG    . ASP D 4  52   ? 333.021 317.913 263.023 1.00 73.69  ? 48   ASP D CG    1 
ATOM   2222  O  OD1   . ASP D 4  52   ? 332.181 316.996 263.033 1.00 73.69  ? 48   ASP D OD1   1 
ATOM   2223  O  OD2   . ASP D 4  52   ? 334.196 317.742 262.664 1.00 73.69  ? 48   ASP D OD2   1 
ATOM   2224  N  N     . THR D 4  53   ? 329.317 318.345 262.795 1.00 78.53  ? 49   THR D N     1 
ATOM   2225  C  CA    . THR D 4  53   ? 328.306 318.307 261.754 1.00 78.53  ? 49   THR D CA    1 
ATOM   2226  C  C     . THR D 4  53   ? 326.942 318.564 262.365 1.00 78.53  ? 49   THR D C     1 
ATOM   2227  O  O     . THR D 4  53   ? 326.641 318.094 263.461 1.00 78.53  ? 49   THR D O     1 
ATOM   2228  C  CB    . THR D 4  53   ? 328.263 316.980 261.045 1.00 78.53  ? 49   THR D CB    1 
ATOM   2229  O  OG1   . THR D 4  53   ? 327.504 316.076 261.838 1.00 78.53  ? 49   THR D OG1   1 
ATOM   2230  C  CG2   . THR D 4  53   ? 329.644 316.436 260.876 1.00 78.53  ? 49   THR D CG2   1 
ATOM   2231  N  N     . GLY D 4  54   ? 326.121 319.325 261.646 1.00 87.09  ? 50   GLY D N     1 
ATOM   2232  C  CA    . GLY D 4  54   ? 324.791 319.669 262.086 1.00 87.09  ? 50   GLY D CA    1 
ATOM   2233  C  C     . GLY D 4  54   ? 323.768 318.819 261.360 1.00 87.09  ? 50   GLY D C     1 
ATOM   2234  O  O     . GLY D 4  54   ? 324.096 317.969 260.539 1.00 87.09  ? 50   GLY D O     1 
ATOM   2235  N  N     . ILE D 4  55   ? 322.504 319.063 261.673 1.00 87.18  ? 51   ILE D N     1 
ATOM   2236  C  CA    . ILE D 4  55   ? 321.439 318.227 261.149 1.00 87.18  ? 51   ILE D CA    1 
ATOM   2237  C  C     . ILE D 4  55   ? 320.310 319.110 260.649 1.00 87.18  ? 51   ILE D C     1 
ATOM   2238  O  O     . ILE D 4  55   ? 319.908 320.057 261.325 1.00 87.18  ? 51   ILE D O     1 
ATOM   2239  C  CB    . ILE D 4  55   ? 320.965 317.212 262.199 1.00 87.18  ? 51   ILE D CB    1 
ATOM   2240  C  CG1   . ILE D 4  55   ? 319.757 316.444 261.716 1.00 87.18  ? 51   ILE D CG1   1 
ATOM   2241  C  CG2   . ILE D 4  55   ? 320.714 317.861 263.511 1.00 87.18  ? 51   ILE D CG2   1 
ATOM   2242  C  CD1   . ILE D 4  55   ? 319.671 315.098 262.307 1.00 87.18  ? 51   ILE D CD1   1 
ATOM   2243  N  N     . SER D 4  56   ? 319.849 318.842 259.438 1.00 85.23  ? 52   SER D N     1 
ATOM   2244  C  CA    . SER D 4  56   ? 318.741 319.582 258.878 1.00 85.23  ? 52   SER D CA    1 
ATOM   2245  C  C     . SER D 4  56   ? 317.457 319.177 259.564 1.00 85.23  ? 52   SER D C     1 
ATOM   2246  O  O     . SER D 4  56   ? 317.243 318.002 259.850 1.00 85.23  ? 52   SER D O     1 
ATOM   2247  C  CB    . SER D 4  56   ? 318.607 319.287 257.407 1.00 85.23  ? 52   SER D CB    1 
ATOM   2248  O  OG    . SER D 4  56   ? 317.916 318.076 257.278 1.00 85.23  ? 52   SER D OG    1 
ATOM   2249  N  N     . SER D 4  57   ? 316.577 320.151 259.793 1.00 84.55  ? 53   SER D N     1 
ATOM   2250  C  CA    . SER D 4  57   ? 315.431 319.907 260.660 1.00 84.55  ? 53   SER D CA    1 
ATOM   2251  C  C     . SER D 4  57   ? 314.392 319.019 259.996 1.00 84.55  ? 53   SER D C     1 
ATOM   2252  O  O     . SER D 4  57   ? 313.569 318.402 260.685 1.00 84.55  ? 53   SER D O     1 
ATOM   2253  C  CB    . SER D 4  57   ? 314.812 321.220 261.099 1.00 84.55  ? 53   SER D CB    1 
ATOM   2254  O  OG    . SER D 4  57   ? 315.554 321.738 262.180 1.00 84.55  ? 53   SER D OG    1 
ATOM   2255  N  N     . LYS D 4  58   ? 314.418 318.931 258.668 1.00 73.01  ? 54   LYS D N     1 
ATOM   2256  C  CA    . LYS D 4  58   ? 313.715 317.856 257.980 1.00 73.01  ? 54   LYS D CA    1 
ATOM   2257  C  C     . LYS D 4  58   ? 314.233 316.499 258.435 1.00 73.01  ? 54   LYS D C     1 
ATOM   2258  O  O     . LYS D 4  58   ? 313.462 315.619 258.840 1.00 73.01  ? 54   LYS D O     1 
ATOM   2259  C  CB    . LYS D 4  58   ? 313.901 318.019 256.476 1.00 73.01  ? 54   LYS D CB    1 
ATOM   2260  C  CG    . LYS D 4  58   ? 313.120 317.048 255.610 1.00 73.01  ? 54   LYS D CG    1 
ATOM   2261  C  CD    . LYS D 4  58   ? 311.743 317.599 255.286 1.00 73.01  ? 54   LYS D CD    1 
ATOM   2262  C  CE    . LYS D 4  58   ? 310.917 316.639 254.463 1.00 73.01  ? 54   LYS D CE    1 
ATOM   2263  N  NZ    . LYS D 4  58   ? 309.494 317.068 254.485 1.00 73.01  ? 54   LYS D NZ    1 
ATOM   2264  N  N     . ALA D 4  59   ? 315.553 316.330 258.430 1.00 69.28  ? 55   ALA D N     1 
ATOM   2265  C  CA    . ALA D 4  59   ? 316.126 315.065 258.860 1.00 69.28  ? 55   ALA D CA    1 
ATOM   2266  C  C     . ALA D 4  59   ? 316.035 314.894 260.357 1.00 69.28  ? 55   ALA D C     1 
ATOM   2267  O  O     . ALA D 4  59   ? 316.036 313.766 260.847 1.00 69.28  ? 55   ALA D O     1 
ATOM   2268  C  CB    . ALA D 4  59   ? 317.572 314.958 258.418 1.00 69.28  ? 55   ALA D CB    1 
ATOM   2269  N  N     . MET D 4  60   ? 315.947 315.986 261.102 1.00 70.60  ? 56   MET D N     1 
ATOM   2270  C  CA    . MET D 4  60   ? 315.687 315.856 262.523 1.00 70.60  ? 56   MET D CA    1 
ATOM   2271  C  C     . MET D 4  60   ? 314.295 315.313 262.770 1.00 70.60  ? 56   MET D C     1 
ATOM   2272  O  O     . MET D 4  60   ? 314.102 314.485 263.663 1.00 70.60  ? 56   MET D O     1 
ATOM   2273  C  CB    . MET D 4  60   ? 315.864 317.193 263.208 1.00 70.60  ? 56   MET D CB    1 
ATOM   2274  C  CG    . MET D 4  60   ? 315.509 317.178 264.656 1.00 70.60  ? 56   MET D CG    1 
ATOM   2275  S  SD    . MET D 4  60   ? 316.712 316.310 265.630 1.00 70.60  ? 56   MET D SD    1 
ATOM   2276  C  CE    . MET D 4  60   ? 317.847 317.653 265.930 1.00 70.60  ? 56   MET D CE    1 
ATOM   2277  N  N     . SER D 4  61   ? 313.328 315.709 261.947 1.00 65.16  ? 57   SER D N     1 
ATOM   2278  C  CA    . SER D 4  61   ? 312.006 315.105 262.038 1.00 65.16  ? 57   SER D CA    1 
ATOM   2279  C  C     . SER D 4  61   ? 312.029 313.652 261.615 1.00 65.16  ? 57   SER D C     1 
ATOM   2280  O  O     . SER D 4  61   ? 311.244 312.843 262.116 1.00 65.16  ? 57   SER D O     1 
ATOM   2281  C  CB    . SER D 4  61   ? 311.011 315.860 261.179 1.00 65.16  ? 57   SER D CB    1 
ATOM   2282  O  OG    . SER D 4  61   ? 309.777 315.181 261.187 1.00 65.16  ? 57   SER D OG    1 
ATOM   2283  N  N     . ILE D 4  62   ? 312.917 313.302 260.693 1.00 60.92  ? 58   ILE D N     1 
ATOM   2284  C  CA    . ILE D 4  62   ? 313.015 311.900 260.309 1.00 60.92  ? 58   ILE D CA    1 
ATOM   2285  C  C     . ILE D 4  62   ? 313.584 311.073 261.445 1.00 60.92  ? 58   ILE D C     1 
ATOM   2286  O  O     . ILE D 4  62   ? 313.095 309.982 261.735 1.00 60.92  ? 58   ILE D O     1 
ATOM   2287  C  CB    . ILE D 4  62   ? 313.827 311.751 259.020 1.00 60.92  ? 58   ILE D CB    1 
ATOM   2288  C  CG1   . ILE D 4  62   ? 313.056 312.462 257.931 1.00 60.92  ? 58   ILE D CG1   1 
ATOM   2289  C  CG2   . ILE D 4  62   ? 314.000 310.314 258.674 1.00 60.92  ? 58   ILE D CG2   1 
ATOM   2290  C  CD1   . ILE D 4  62   ? 313.475 312.187 256.574 1.00 60.92  ? 58   ILE D CD1   1 
ATOM   2291  N  N     . MET D 4  63   ? 314.578 311.601 262.145 1.00 61.32  ? 59   MET D N     1 
ATOM   2292  C  CA    . MET D 4  63   ? 315.118 310.886 263.292 1.00 61.32  ? 59   MET D CA    1 
ATOM   2293  C  C     . MET D 4  63   ? 314.107 310.811 264.424 1.00 61.32  ? 59   MET D C     1 
ATOM   2294  O  O     . MET D 4  63   ? 314.053 309.815 265.154 1.00 61.32  ? 59   MET D O     1 
ATOM   2295  C  CB    . MET D 4  63   ? 316.396 311.554 263.764 1.00 61.32  ? 59   MET D CB    1 
ATOM   2296  C  CG    . MET D 4  63   ? 317.508 311.432 262.794 1.00 61.32  ? 59   MET D CG    1 
ATOM   2297  S  SD    . MET D 4  63   ? 317.836 309.710 262.482 1.00 61.32  ? 59   MET D SD    1 
ATOM   2298  C  CE    . MET D 4  63   ? 318.301 309.178 264.111 1.00 61.32  ? 59   MET D CE    1 
ATOM   2299  N  N     . ASN D 4  64   ? 313.271 311.833 264.555 1.00 58.09  ? 60   ASN D N     1 
ATOM   2300  C  CA    . ASN D 4  64   ? 312.236 311.822 265.576 1.00 58.09  ? 60   ASN D CA    1 
ATOM   2301  C  C     . ASN D 4  64   ? 311.196 310.752 265.293 1.00 58.09  ? 60   ASN D C     1 
ATOM   2302  O  O     . ASN D 4  64   ? 310.815 309.980 266.182 1.00 58.09  ? 60   ASN D O     1 
ATOM   2303  C  CB    . ASN D 4  64   ? 311.587 313.187 265.642 1.00 58.09  ? 60   ASN D CB    1 
ATOM   2304  C  CG    . ASN D 4  64   ? 310.908 313.420 266.929 1.00 58.09  ? 60   ASN D CG    1 
ATOM   2305  O  OD1   . ASN D 4  64   ? 310.884 312.555 267.786 1.00 58.09  ? 60   ASN D OD1   1 
ATOM   2306  N  ND2   . ASN D 4  64   ? 310.359 314.605 267.096 1.00 58.09  ? 60   ASN D ND2   1 
ATOM   2307  N  N     . SER D 4  65   ? 310.757 310.659 264.046 1.00 58.31  ? 61   SER D N     1 
ATOM   2308  C  CA    . SER D 4  65   ? 309.788 309.632 263.709 1.00 58.31  ? 61   SER D CA    1 
ATOM   2309  C  C     . SER D 4  65   ? 310.427 308.259 263.705 1.00 58.31  ? 61   SER D C     1 
ATOM   2310  O  O     . SER D 4  65   ? 309.742 307.263 263.939 1.00 58.31  ? 61   SER D O     1 
ATOM   2311  C  CB    . SER D 4  65   ? 309.153 309.927 262.364 1.00 58.31  ? 61   SER D CB    1 
ATOM   2312  O  OG    . SER D 4  65   ? 309.900 309.329 261.341 1.00 58.31  ? 61   SER D OG    1 
ATOM   2313  N  N     . PHE D 4  66   ? 311.739 308.189 263.515 1.00 55.43  ? 62   PHE D N     1 
ATOM   2314  C  CA    . PHE D 4  66   ? 312.421 306.907 263.576 1.00 55.43  ? 62   PHE D CA    1 
ATOM   2315  C  C     . PHE D 4  66   ? 312.445 306.371 264.986 1.00 55.43  ? 62   PHE D C     1 
ATOM   2316  O  O     . PHE D 4  66   ? 312.196 305.185 265.206 1.00 55.43  ? 62   PHE D O     1 
ATOM   2317  C  CB    . PHE D 4  66   ? 313.837 307.046 263.050 1.00 55.43  ? 62   PHE D CB    1 
ATOM   2318  C  CG    . PHE D 4  66   ? 314.751 305.956 263.484 1.00 55.43  ? 62   PHE D CG    1 
ATOM   2319  C  CD1   . PHE D 4  66   ? 314.668 304.717 262.921 1.00 55.43  ? 62   PHE D CD1   1 
ATOM   2320  C  CD2   . PHE D 4  66   ? 315.722 306.181 264.429 1.00 55.43  ? 62   PHE D CD2   1 
ATOM   2321  C  CE1   . PHE D 4  66   ? 315.515 303.721 263.305 1.00 55.43  ? 62   PHE D CE1   1 
ATOM   2322  C  CE2   . PHE D 4  66   ? 316.559 305.181 264.819 1.00 55.43  ? 62   PHE D CE2   1 
ATOM   2323  C  CZ    . PHE D 4  66   ? 316.456 303.953 264.252 1.00 55.43  ? 62   PHE D CZ    1 
ATOM   2324  N  N     . VAL D 4  67   ? 312.776 307.222 265.955 1.00 55.56  ? 63   VAL D N     1 
ATOM   2325  C  CA    . VAL D 4  67   ? 312.823 306.709 267.314 1.00 55.56  ? 63   VAL D CA    1 
ATOM   2326  C  C     . VAL D 4  67   ? 311.425 306.454 267.824 1.00 55.56  ? 63   VAL D C     1 
ATOM   2327  O  O     . VAL D 4  67   ? 311.236 305.546 268.629 1.00 55.56  ? 63   VAL D O     1 
ATOM   2328  C  CB    . VAL D 4  67   ? 313.617 307.616 268.264 1.00 55.56  ? 63   VAL D CB    1 
ATOM   2329  C  CG1   . VAL D 4  67   ? 314.957 307.893 267.702 1.00 55.56  ? 63   VAL D CG1   1 
ATOM   2330  C  CG2   . VAL D 4  67   ? 312.935 308.873 268.496 1.00 55.56  ? 63   VAL D CG2   1 
ATOM   2331  N  N     . ASN D 4  68   ? 310.414 307.158 267.302 1.00 55.86  ? 64   ASN D N     1 
ATOM   2332  C  CA    . ASN D 4  68   ? 309.043 306.795 267.644 1.00 55.86  ? 64   ASN D CA    1 
ATOM   2333  C  C     . ASN D 4  68   ? 308.677 305.434 267.094 1.00 55.86  ? 64   ASN D C     1 
ATOM   2334  O  O     . ASN D 4  68   ? 308.022 304.644 267.776 1.00 55.86  ? 64   ASN D O     1 
ATOM   2335  C  CB    . ASN D 4  68   ? 308.065 307.820 267.113 1.00 55.86  ? 64   ASN D CB    1 
ATOM   2336  C  CG    . ASN D 4  68   ? 308.006 309.010 267.955 1.00 55.86  ? 64   ASN D CG    1 
ATOM   2337  O  OD1   . ASN D 4  68   ? 308.413 308.975 269.102 1.00 55.86  ? 64   ASN D OD1   1 
ATOM   2338  N  ND2   . ASN D 4  68   ? 307.487 310.089 267.415 1.00 55.86  ? 64   ASN D ND2   1 
ATOM   2339  N  N     . ASP D 4  69   ? 309.112 305.130 265.879 1.00 56.20  ? 65   ASP D N     1 
ATOM   2340  C  CA    . ASP D 4  69   ? 308.740 303.864 265.271 1.00 56.20  ? 65   ASP D CA    1 
ATOM   2341  C  C     . ASP D 4  69   ? 309.450 302.700 265.932 1.00 56.20  ? 65   ASP D C     1 
ATOM   2342  O  O     . ASP D 4  69   ? 308.846 301.656 266.184 1.00 56.20  ? 65   ASP D O     1 
ATOM   2343  C  CB    . ASP D 4  69   ? 309.044 303.890 263.789 1.00 56.20  ? 65   ASP D CB    1 
ATOM   2344  C  CG    . ASP D 4  69   ? 309.134 302.519 263.208 1.00 56.20  ? 65   ASP D CG    1 
ATOM   2345  O  OD1   . ASP D 4  69   ? 308.112 301.810 263.165 1.00 56.20  ? 65   ASP D OD1   1 
ATOM   2346  O  OD2   . ASP D 4  69   ? 310.236 302.144 262.780 1.00 56.20  ? 65   ASP D OD2   1 
ATOM   2347  N  N     . VAL D 4  70   ? 310.728 302.865 266.239 1.00 55.76  ? 66   VAL D N     1 
ATOM   2348  C  CA    . VAL D 4  70   ? 311.459 301.776 266.868 1.00 55.76  ? 66   VAL D CA    1 
ATOM   2349  C  C     . VAL D 4  70   ? 311.010 301.600 268.310 1.00 55.76  ? 66   VAL D C     1 
ATOM   2350  O  O     . VAL D 4  70   ? 310.888 300.468 268.794 1.00 55.76  ? 66   VAL D O     1 
ATOM   2351  C  CB    . VAL D 4  70   ? 312.964 302.020 266.728 1.00 55.76  ? 66   VAL D CB    1 
ATOM   2352  C  CG1   . VAL D 4  70   ? 313.753 301.212 267.689 1.00 55.76  ? 66   VAL D CG1   1 
ATOM   2353  C  CG2   . VAL D 4  70   ? 313.371 301.649 265.342 1.00 55.76  ? 66   VAL D CG2   1 
ATOM   2354  N  N     . PHE D 4  71   ? 310.668 302.702 268.986 1.00 54.74  ? 67   PHE D N     1 
ATOM   2355  C  CA    . PHE D 4  71   ? 310.074 302.633 270.312 1.00 54.74  ? 67   PHE D CA    1 
ATOM   2356  C  C     . PHE D 4  71   ? 308.781 301.851 270.291 1.00 54.74  ? 67   PHE D C     1 
ATOM   2357  O  O     . PHE D 4  71   ? 308.570 300.966 271.116 1.00 54.74  ? 67   PHE D O     1 
ATOM   2358  C  CB    . PHE D 4  71   ? 309.820 304.042 270.832 1.00 54.74  ? 67   PHE D CB    1 
ATOM   2359  C  CG    . PHE D 4  71   ? 309.026 304.097 272.107 1.00 54.74  ? 67   PHE D CG    1 
ATOM   2360  C  CD1   . PHE D 4  71   ? 309.652 303.971 273.314 1.00 54.74  ? 67   PHE D CD1   1 
ATOM   2361  C  CD2   . PHE D 4  71   ? 307.669 304.326 272.099 1.00 54.74  ? 67   PHE D CD2   1 
ATOM   2362  C  CE1   . PHE D 4  71   ? 308.943 304.033 274.470 1.00 54.74  ? 67   PHE D CE1   1 
ATOM   2363  C  CE2   . PHE D 4  71   ? 306.968 304.366 273.254 1.00 54.74  ? 67   PHE D CE2   1 
ATOM   2364  C  CZ    . PHE D 4  71   ? 307.609 304.224 274.441 1.00 54.74  ? 67   PHE D CZ    1 
ATOM   2365  N  N     . GLU D 4  72   ? 307.898 302.178 269.357 1.00 57.40  ? 68   GLU D N     1 
ATOM   2366  C  CA    . GLU D 4  72   ? 306.605 301.521 269.332 1.00 57.40  ? 68   GLU D CA    1 
ATOM   2367  C  C     . GLU D 4  72   ? 306.724 300.073 268.930 1.00 57.40  ? 68   GLU D C     1 
ATOM   2368  O  O     . GLU D 4  72   ? 305.989 299.238 269.450 1.00 57.40  ? 68   GLU D O     1 
ATOM   2369  C  CB    . GLU D 4  72   ? 305.652 302.230 268.382 1.00 57.40  ? 68   GLU D CB    1 
ATOM   2370  C  CG    . GLU D 4  72   ? 304.654 303.148 269.060 1.00 57.40  ? 68   GLU D CG    1 
ATOM   2371  C  CD    . GLU D 4  72   ? 303.556 302.421 269.840 1.00 57.40  ? 68   GLU D CD    1 
ATOM   2372  O  OE1   . GLU D 4  72   ? 303.472 301.173 269.812 1.00 57.40  ? 68   GLU D OE1   1 
ATOM   2373  O  OE2   . GLU D 4  72   ? 302.765 303.111 270.520 1.00 57.40  ? 68   GLU D OE2   1 
ATOM   2374  N  N     . ARG D 4  73   ? 307.674 299.752 268.060 1.00 55.58  ? 69   ARG D N     1 
ATOM   2375  C  CA    . ARG D 4  73   ? 307.864 298.374 267.641 1.00 55.58  ? 69   ARG D CA    1 
ATOM   2376  C  C     . ARG D 4  73   ? 308.397 297.518 268.778 1.00 55.58  ? 69   ARG D C     1 
ATOM   2377  O  O     . ARG D 4  73   ? 307.878 296.425 269.039 1.00 55.58  ? 69   ARG D O     1 
ATOM   2378  C  CB    . ARG D 4  73   ? 308.807 298.350 266.459 1.00 55.58  ? 69   ARG D CB    1 
ATOM   2379  C  CG    . ARG D 4  73   ? 309.045 297.007 265.914 1.00 55.58  ? 69   ARG D CG    1 
ATOM   2380  C  CD    . ARG D 4  73   ? 309.984 297.116 264.752 1.00 55.58  ? 69   ARG D CD    1 
ATOM   2381  N  NE    . ARG D 4  73   ? 309.553 298.147 263.830 1.00 55.58  ? 69   ARG D NE    1 
ATOM   2382  C  CZ    . ARG D 4  73   ? 310.346 298.694 262.926 1.00 55.58  ? 69   ARG D CZ    1 
ATOM   2383  N  NH1   . ARG D 4  73   ? 311.602 298.311 262.841 1.00 55.58  ? 69   ARG D NH1   1 
ATOM   2384  N  NH2   . ARG D 4  73   ? 309.884 299.619 262.110 1.00 55.58  ? 69   ARG D NH2   1 
ATOM   2385  N  N     . ILE D 4  74   ? 309.407 298.021 269.490 1.00 52.64  ? 70   ILE D N     1 
ATOM   2386  C  CA    . ILE D 4  74   ? 309.962 297.305 270.632 1.00 52.64  ? 70   ILE D CA    1 
ATOM   2387  C  C     . ILE D 4  74   ? 308.933 297.172 271.730 1.00 52.64  ? 70   ILE D C     1 
ATOM   2388  O  O     . ILE D 4  74   ? 308.765 296.094 272.300 1.00 52.64  ? 70   ILE D O     1 
ATOM   2389  C  CB    . ILE D 4  74   ? 311.224 298.003 271.146 1.00 52.64  ? 70   ILE D CB    1 
ATOM   2390  C  CG1   . ILE D 4  74   ? 312.364 297.790 270.184 1.00 52.64  ? 70   ILE D CG1   1 
ATOM   2391  C  CG2   . ILE D 4  74   ? 311.641 297.446 272.452 1.00 52.64  ? 70   ILE D CG2   1 
ATOM   2392  C  CD1   . ILE D 4  74   ? 313.589 298.529 270.576 1.00 52.64  ? 70   ILE D CD1   1 
ATOM   2393  N  N     . ALA D 4  75   ? 308.195 298.237 272.017 1.00 53.30  ? 71   ALA D N     1 
ATOM   2394  C  CA    . ALA D 4  75   ? 307.266 298.166 273.129 1.00 53.30  ? 71   ALA D CA    1 
ATOM   2395  C  C     . ALA D 4  75   ? 306.054 297.325 272.782 1.00 53.30  ? 71   ALA D C     1 
ATOM   2396  O  O     . ALA D 4  75   ? 305.478 296.685 273.660 1.00 53.30  ? 71   ALA D O     1 
ATOM   2397  C  CB    . ALA D 4  75   ? 306.851 299.560 273.562 1.00 53.30  ? 71   ALA D CB    1 
ATOM   2398  N  N     . GLY D 4  76   ? 305.682 297.257 271.511 1.00 55.86  ? 72   GLY D N     1 
ATOM   2399  C  CA    . GLY D 4  76   ? 304.605 296.368 271.132 1.00 55.86  ? 72   GLY D CA    1 
ATOM   2400  C  C     . GLY D 4  76   ? 305.002 294.917 271.258 1.00 55.86  ? 72   GLY D C     1 
ATOM   2401  O  O     . GLY D 4  76   ? 304.233 294.095 271.772 1.00 55.86  ? 72   GLY D O     1 
ATOM   2402  N  N     . GLU D 4  77   ? 306.223 294.589 270.829 1.00 57.07  ? 73   GLU D N     1 
ATOM   2403  C  CA    . GLU D 4  77   ? 306.701 293.225 270.978 1.00 57.07  ? 73   GLU D CA    1 
ATOM   2404  C  C     . GLU D 4  77   ? 306.873 292.860 272.441 1.00 57.07  ? 73   GLU D C     1 
ATOM   2405  O  O     . GLU D 4  77   ? 306.581 291.732 272.840 1.00 57.07  ? 73   GLU D O     1 
ATOM   2406  C  CB    . GLU D 4  77   ? 308.011 293.054 270.241 1.00 57.07  ? 73   GLU D CB    1 
ATOM   2407  C  CG    . GLU D 4  77   ? 308.485 291.643 270.243 1.00 57.07  ? 73   GLU D CG    1 
ATOM   2408  C  CD    . GLU D 4  77   ? 307.637 290.739 269.372 1.00 57.07  ? 73   GLU D CD    1 
ATOM   2409  O  OE1   . GLU D 4  77   ? 307.173 291.181 268.298 1.00 57.07  ? 73   GLU D OE1   1 
ATOM   2410  O  OE2   . GLU D 4  77   ? 307.408 289.578 269.774 1.00 57.07  ? 73   GLU D OE2   1 
ATOM   2411  N  N     . ALA D 4  78   ? 307.273 293.821 273.269 1.00 55.29  ? 74   ALA D N     1 
ATOM   2412  C  CA    . ALA D 4  78   ? 307.407 293.575 274.700 1.00 55.29  ? 74   ALA D CA    1 
ATOM   2413  C  C     . ALA D 4  78   ? 306.059 293.372 275.354 1.00 55.29  ? 74   ALA D C     1 
ATOM   2414  O  O     . ALA D 4  78   ? 305.922 292.555 276.269 1.00 55.29  ? 74   ALA D O     1 
ATOM   2415  C  CB    . ALA D 4  78   ? 308.121 294.735 275.365 1.00 55.29  ? 74   ALA D CB    1 
ATOM   2416  N  N     . SER D 4  79   ? 305.050 294.101 274.894 1.00 56.01  ? 75   SER D N     1 
ATOM   2417  C  CA    . SER D 4  79   ? 303.712 293.942 275.441 1.00 56.01  ? 75   SER D CA    1 
ATOM   2418  C  C     . SER D 4  79   ? 303.164 292.570 275.139 1.00 56.01  ? 75   SER D C     1 
ATOM   2419  O  O     . SER D 4  79   ? 302.612 291.904 276.018 1.00 56.01  ? 75   SER D O     1 
ATOM   2420  C  CB    . SER D 4  79   ? 302.785 294.999 274.870 1.00 56.01  ? 75   SER D CB    1 
ATOM   2421  O  OG    . SER D 4  79   ? 301.597 295.066 275.627 1.00 56.01  ? 75   SER D OG    1 
ATOM   2422  N  N     . ARG D 4  80   ? 303.331 292.112 273.909 1.00 58.47  ? 76   ARG D N     1 
ATOM   2423  C  CA    . ARG D 4  80   ? 302.794 290.796 273.624 1.00 58.47  ? 76   ARG D CA    1 
ATOM   2424  C  C     . ARG D 4  80   ? 303.664 289.703 274.218 1.00 58.47  ? 76   ARG D C     1 
ATOM   2425  O  O     . ARG D 4  80   ? 303.169 288.612 274.480 1.00 58.47  ? 76   ARG D O     1 
ATOM   2426  C  CB    . ARG D 4  80   ? 302.589 290.604 272.134 1.00 58.47  ? 76   ARG D CB    1 
ATOM   2427  C  CG    . ARG D 4  80   ? 303.816 290.456 271.337 1.00 58.47  ? 76   ARG D CG    1 
ATOM   2428  C  CD    . ARG D 4  80   ? 303.433 290.431 269.891 1.00 58.47  ? 76   ARG D CD    1 
ATOM   2429  N  NE    . ARG D 4  80   ? 302.946 291.734 269.473 1.00 58.47  ? 76   ARG D NE    1 
ATOM   2430  C  CZ    . ARG D 4  80   ? 302.439 291.988 268.275 1.00 58.47  ? 76   ARG D CZ    1 
ATOM   2431  N  NH1   . ARG D 4  80   ? 302.350 291.024 267.373 1.00 58.47  ? 76   ARG D NH1   1 
ATOM   2432  N  NH2   . ARG D 4  80   ? 302.025 293.207 267.972 1.00 58.47  ? 76   ARG D NH2   1 
ATOM   2433  N  N     . LEU D 4  81   ? 304.931 289.988 274.504 1.00 57.11  ? 77   LEU D N     1 
ATOM   2434  C  CA    . LEU D 4  81   ? 305.748 289.040 275.253 1.00 57.11  ? 77   LEU D CA    1 
ATOM   2435  C  C     . LEU D 4  81   ? 305.256 288.899 276.672 1.00 57.11  ? 77   LEU D C     1 
ATOM   2436  O  O     . LEU D 4  81   ? 305.319 287.817 277.255 1.00 57.11  ? 77   LEU D O     1 
ATOM   2437  C  CB    . LEU D 4  81   ? 307.193 289.491 275.269 1.00 57.11  ? 77   LEU D CB    1 
ATOM   2438  C  CG    . LEU D 4  81   ? 307.963 288.857 274.149 1.00 57.11  ? 77   LEU D CG    1 
ATOM   2439  C  CD1   . LEU D 4  81   ? 309.237 289.581 273.967 1.00 57.11  ? 77   LEU D CD1   1 
ATOM   2440  C  CD2   . LEU D 4  81   ? 308.214 287.460 274.543 1.00 57.11  ? 77   LEU D CD2   1 
ATOM   2441  N  N     . ALA D 4  82   ? 304.806 289.996 277.264 1.00 58.64  ? 78   ALA D N     1 
ATOM   2442  C  CA    . ALA D 4  82   ? 304.257 289.913 278.605 1.00 58.64  ? 78   ALA D CA    1 
ATOM   2443  C  C     . ALA D 4  82   ? 302.932 289.185 278.600 1.00 58.64  ? 78   ALA D C     1 
ATOM   2444  O  O     . ALA D 4  82   ? 302.638 288.402 279.503 1.00 58.64  ? 78   ALA D O     1 
ATOM   2445  C  CB    . ALA D 4  82   ? 304.089 291.308 279.183 1.00 58.64  ? 78   ALA D CB    1 
ATOM   2446  N  N     . HIS D 4  83   ? 302.126 289.422 277.580 1.00 63.24  ? 79   HIS D N     1 
ATOM   2447  C  CA    . HIS D 4  83   ? 300.786 288.863 277.567 1.00 63.24  ? 79   HIS D CA    1 
ATOM   2448  C  C     . HIS D 4  83   ? 300.802 287.384 277.219 1.00 63.24  ? 79   HIS D C     1 
ATOM   2449  O  O     . HIS D 4  83   ? 299.933 286.635 277.665 1.00 63.24  ? 79   HIS D O     1 
ATOM   2450  C  CB    . HIS D 4  83   ? 299.924 289.646 276.588 1.00 63.24  ? 79   HIS D CB    1 
ATOM   2451  C  CG    . HIS D 4  83   ? 298.489 289.243 276.591 1.00 63.24  ? 79   HIS D CG    1 
ATOM   2452  N  ND1   . HIS D 4  83   ? 297.596 289.690 277.538 1.00 63.24  ? 79   HIS D ND1   1 
ATOM   2453  C  CD2   . HIS D 4  83   ? 297.785 288.443 275.754 1.00 63.24  ? 79   HIS D CD2   1 
ATOM   2454  C  CE1   . HIS D 4  83   ? 296.404 289.175 277.292 1.00 63.24  ? 79   HIS D CE1   1 
ATOM   2455  N  NE2   . HIS D 4  83   ? 296.492 288.417 276.213 1.00 63.24  ? 79   HIS D NE2   1 
ATOM   2456  N  N     . TYR D 4  84   ? 301.780 286.946 276.421 1.00 61.84  ? 80   TYR D N     1 
ATOM   2457  C  CA    . TYR D 4  84   ? 301.884 285.530 276.077 1.00 61.84  ? 80   TYR D CA    1 
ATOM   2458  C  C     . TYR D 4  84   ? 302.253 284.693 277.277 1.00 61.84  ? 80   TYR D C     1 
ATOM   2459  O  O     . TYR D 4  84   ? 301.868 283.527 277.362 1.00 61.84  ? 80   TYR D O     1 
ATOM   2460  C  CB    . TYR D 4  84   ? 302.934 285.295 275.006 1.00 61.84  ? 80   TYR D CB    1 
ATOM   2461  C  CG    . TYR D 4  84   ? 302.590 285.791 273.638 1.00 61.84  ? 80   TYR D CG    1 
ATOM   2462  C  CD1   . TYR D 4  84   ? 301.295 286.110 273.294 1.00 61.84  ? 80   TYR D CD1   1 
ATOM   2463  C  CD2   . TYR D 4  84   ? 303.580 285.970 272.693 1.00 61.84  ? 80   TYR D CD2   1 
ATOM   2464  C  CE1   . TYR D 4  84   ? 300.993 286.579 272.028 1.00 61.84  ? 80   TYR D CE1   1 
ATOM   2465  C  CE2   . TYR D 4  84   ? 303.289 286.431 271.432 1.00 61.84  ? 80   TYR D CE2   1 
ATOM   2466  C  CZ    . TYR D 4  84   ? 301.997 286.732 271.104 1.00 61.84  ? 80   TYR D CZ    1 
ATOM   2467  O  OH    . TYR D 4  84   ? 301.707 287.199 269.849 1.00 61.84  ? 80   TYR D OH    1 
ATOM   2468  N  N     . ASN D 4  85   ? 303.023 285.251 278.195 1.00 60.87  ? 81   ASN D N     1 
ATOM   2469  C  CA    . ASN D 4  85   ? 303.483 284.512 279.350 1.00 60.87  ? 81   ASN D CA    1 
ATOM   2470  C  C     . ASN D 4  85   ? 302.658 284.810 280.577 1.00 60.87  ? 81   ASN D C     1 
ATOM   2471  O  O     . ASN D 4  85   ? 303.083 284.475 281.685 1.00 60.87  ? 81   ASN D O     1 
ATOM   2472  C  CB    . ASN D 4  85   ? 304.942 284.828 279.594 1.00 60.87  ? 81   ASN D CB    1 
ATOM   2473  C  CG    . ASN D 4  85   ? 305.754 284.576 278.392 1.00 60.87  ? 81   ASN D CG    1 
ATOM   2474  O  OD1   . ASN D 4  85   ? 305.509 283.630 277.665 1.00 60.87  ? 81   ASN D OD1   1 
ATOM   2475  N  ND2   . ASN D 4  85   ? 306.712 285.431 278.141 1.00 60.87  ? 81   ASN D ND2   1 
ATOM   2476  N  N     . LYS D 4  86   ? 301.496 285.437 280.386 1.00 62.37  ? 82   LYS D N     1 
ATOM   2477  C  CA    . LYS D 4  86   ? 300.518 285.708 281.434 1.00 62.37  ? 82   LYS D CA    1 
ATOM   2478  C  C     . LYS D 4  86   ? 301.133 286.501 282.574 1.00 62.37  ? 82   LYS D C     1 
ATOM   2479  O  O     . LYS D 4  86   ? 300.962 286.177 283.743 1.00 62.37  ? 82   LYS D O     1 
ATOM   2480  C  CB    . LYS D 4  86   ? 299.877 284.420 281.949 1.00 62.37  ? 82   LYS D CB    1 
ATOM   2481  C  CG    . LYS D 4  86   ? 299.339 283.504 280.861 1.00 62.37  ? 82   LYS D CG    1 
ATOM   2482  C  CD    . LYS D 4  86   ? 298.183 284.139 280.097 1.00 62.37  ? 82   LYS D CD    1 
ATOM   2483  C  CE    . LYS D 4  86   ? 297.901 283.434 278.773 1.00 62.37  ? 82   LYS D CE    1 
ATOM   2484  N  NZ    . LYS D 4  86   ? 296.819 284.112 278.008 1.00 62.37  ? 82   LYS D NZ    1 
ATOM   2485  N  N     . ARG D 4  87   ? 301.900 287.521 282.232 1.00 67.28  ? 83   ARG D N     1 
ATOM   2486  C  CA    . ARG D 4  87   ? 302.498 288.392 283.226 1.00 67.28  ? 83   ARG D CA    1 
ATOM   2487  C  C     . ARG D 4  87   ? 302.103 289.832 282.965 1.00 67.28  ? 83   ARG D C     1 
ATOM   2488  O  O     . ARG D 4  87   ? 301.861 290.225 281.826 1.00 67.28  ? 83   ARG D O     1 
ATOM   2489  C  CB    . ARG D 4  87   ? 304.003 288.247 283.228 1.00 67.28  ? 83   ARG D CB    1 
ATOM   2490  C  CG    . ARG D 4  87   ? 304.414 286.876 283.653 1.00 67.28  ? 83   ARG D CG    1 
ATOM   2491  C  CD    . ARG D 4  87   ? 305.707 286.509 283.043 1.00 67.28  ? 83   ARG D CD    1 
ATOM   2492  N  NE    . ARG D 4  87   ? 306.761 287.307 283.621 1.00 67.28  ? 83   ARG D NE    1 
ATOM   2493  C  CZ    . ARG D 4  87   ? 307.439 286.950 284.698 1.00 67.28  ? 83   ARG D CZ    1 
ATOM   2494  N  NH1   . ARG D 4  87   ? 307.167 285.802 285.304 1.00 67.28  ? 83   ARG D NH1   1 
ATOM   2495  N  NH2   . ARG D 4  87   ? 308.386 287.747 285.162 1.00 67.28  ? 83   ARG D NH2   1 
ATOM   2496  N  N     . SER D 4  88   ? 302.022 290.617 284.029 1.00 68.11  ? 84   SER D N     1 
ATOM   2497  C  CA    . SER D 4  88   ? 301.427 291.939 283.936 1.00 68.11  ? 84   SER D CA    1 
ATOM   2498  C  C     . SER D 4  88   ? 302.441 293.062 283.923 1.00 68.11  ? 84   SER D C     1 
ATOM   2499  O  O     . SER D 4  88   ? 302.053 294.215 283.749 1.00 68.11  ? 84   SER D O     1 
ATOM   2500  C  CB    . SER D 4  88   ? 300.470 292.161 285.096 1.00 68.11  ? 84   SER D CB    1 
ATOM   2501  O  OG    . SER D 4  88   ? 301.066 291.720 286.289 1.00 68.11  ? 84   SER D OG    1 
ATOM   2502  N  N     . THR D 4  89   ? 303.709 292.769 284.125 1.00 64.66  ? 85   THR D N     1 
ATOM   2503  C  CA    . THR D 4  89   ? 304.746 293.780 284.190 1.00 64.66  ? 85   THR D CA    1 
ATOM   2504  C  C     . THR D 4  89   ? 305.570 293.676 282.926 1.00 64.66  ? 85   THR D C     1 
ATOM   2505  O  O     . THR D 4  89   ? 305.754 292.583 282.394 1.00 64.66  ? 85   THR D O     1 
ATOM   2506  C  CB    . THR D 4  89   ? 305.618 293.577 285.434 1.00 64.66  ? 85   THR D CB    1 
ATOM   2507  O  OG1   . THR D 4  89   ? 304.782 293.530 286.588 1.00 64.66  ? 85   THR D OG1   1 
ATOM   2508  C  CG2   . THR D 4  89   ? 306.572 294.694 285.642 1.00 64.66  ? 85   THR D CG2   1 
ATOM   2509  N  N     . ILE D 4  90   ? 306.006 294.813 282.410 1.00 58.94  ? 86   ILE D N     1 
ATOM   2510  C  CA    . ILE D 4  90   ? 307.049 294.870 281.407 1.00 58.94  ? 86   ILE D CA    1 
ATOM   2511  C  C     . ILE D 4  90   ? 308.332 295.232 282.120 1.00 58.94  ? 86   ILE D C     1 
ATOM   2512  O  O     . ILE D 4  90   ? 308.517 296.384 282.520 1.00 58.94  ? 86   ILE D O     1 
ATOM   2513  C  CB    . ILE D 4  90   ? 306.735 295.896 280.326 1.00 58.94  ? 86   ILE D CB    1 
ATOM   2514  C  CG1   . ILE D 4  90   ? 305.507 295.469 279.561 1.00 58.94  ? 86   ILE D CG1   1 
ATOM   2515  C  CG2   . ILE D 4  90   ? 307.875 295.986 279.384 1.00 58.94  ? 86   ILE D CG2   1 
ATOM   2516  C  CD1   . ILE D 4  90   ? 305.179 296.387 278.455 1.00 58.94  ? 86   ILE D CD1   1 
ATOM   2517  N  N     . THR D 4  91   ? 309.208 294.260 282.315 1.00 57.44  ? 87   THR D N     1 
ATOM   2518  C  CA    . THR D 4  91   ? 310.487 294.563 282.915 1.00 57.44  ? 87   THR D CA    1 
ATOM   2519  C  C     . THR D 4  91   ? 311.552 294.441 281.847 1.00 57.44  ? 87   THR D C     1 
ATOM   2520  O  O     . THR D 4  91   ? 311.248 294.259 280.672 1.00 57.44  ? 87   THR D O     1 
ATOM   2521  C  CB    . THR D 4  91   ? 310.787 293.679 284.124 1.00 57.44  ? 87   THR D CB    1 
ATOM   2522  O  OG1   . THR D 4  91   ? 312.018 294.110 284.707 1.00 57.44  ? 87   THR D OG1   1 
ATOM   2523  C  CG2   . THR D 4  91   ? 310.892 292.226 283.752 1.00 57.44  ? 87   THR D CG2   1 
ATOM   2524  N  N     . SER D 4  92   ? 312.812 294.556 282.260 1.00 53.76  ? 88   SER D N     1 
ATOM   2525  C  CA    . SER D 4  92   ? 313.909 294.651 281.308 1.00 53.76  ? 88   SER D CA    1 
ATOM   2526  C  C     . SER D 4  92   ? 314.125 293.374 280.524 1.00 53.76  ? 88   SER D C     1 
ATOM   2527  O  O     . SER D 4  92   ? 314.749 293.401 279.468 1.00 53.76  ? 88   SER D O     1 
ATOM   2528  C  CB    . SER D 4  92   ? 315.188 295.005 282.035 1.00 53.76  ? 88   SER D CB    1 
ATOM   2529  O  OG    . SER D 4  92   ? 315.395 294.122 283.110 1.00 53.76  ? 88   SER D OG    1 
ATOM   2530  N  N     . ARG D 4  93   ? 313.628 292.249 281.014 1.00 54.41  ? 89   ARG D N     1 
ATOM   2531  C  CA    . ARG D 4  93   ? 313.796 291.004 280.286 1.00 54.41  ? 89   ARG D CA    1 
ATOM   2532  C  C     . ARG D 4  93   ? 312.903 290.959 279.064 1.00 54.41  ? 89   ARG D C     1 
ATOM   2533  O  O     . ARG D 4  93   ? 313.305 290.443 278.018 1.00 54.41  ? 89   ARG D O     1 
ATOM   2534  C  CB    . ARG D 4  93   ? 313.506 289.837 281.207 1.00 54.41  ? 89   ARG D CB    1 
ATOM   2535  C  CG    . ARG D 4  93   ? 313.728 288.518 280.582 1.00 54.41  ? 89   ARG D CG    1 
ATOM   2536  C  CD    . ARG D 4  93   ? 313.726 287.439 281.613 1.00 54.41  ? 89   ARG D CD    1 
ATOM   2537  N  NE    . ARG D 4  93   ? 314.718 286.435 281.280 1.00 54.41  ? 89   ARG D NE    1 
ATOM   2538  C  CZ    . ARG D 4  93   ? 314.414 285.220 280.857 1.00 54.41  ? 89   ARG D CZ    1 
ATOM   2539  N  NH1   . ARG D 4  93   ? 313.147 284.874 280.726 1.00 54.41  ? 89   ARG D NH1   1 
ATOM   2540  N  NH2   . ARG D 4  93   ? 315.374 284.357 280.567 1.00 54.41  ? 89   ARG D NH2   1 
ATOM   2541  N  N     . GLU D 4  94   ? 311.697 291.510 279.165 1.00 56.25  ? 90   GLU D N     1 
ATOM   2542  C  CA    . GLU D 4  94   ? 310.849 291.598 277.989 1.00 56.25  ? 90   GLU D CA    1 
ATOM   2543  C  C     . GLU D 4  94   ? 311.427 292.561 276.981 1.00 56.25  ? 90   GLU D C     1 
ATOM   2544  O  O     . GLU D 4  94   ? 311.371 292.310 275.777 1.00 56.25  ? 90   GLU D O     1 
ATOM   2545  C  CB    . GLU D 4  94   ? 309.436 292.019 278.355 1.00 56.25  ? 90   GLU D CB    1 
ATOM   2546  C  CG    . GLU D 4  94   ? 308.648 290.967 279.063 1.00 56.25  ? 90   GLU D CG    1 
ATOM   2547  C  CD    . GLU D 4  94   ? 308.770 291.087 280.542 1.00 56.25  ? 90   GLU D CD    1 
ATOM   2548  O  OE1   . GLU D 4  94   ? 309.342 292.103 280.971 1.00 56.25  ? 90   GLU D OE1   1 
ATOM   2549  O  OE2   . GLU D 4  94   ? 308.315 290.189 281.275 1.00 56.25  ? 90   GLU D OE2   1 
ATOM   2550  N  N     . ILE D 4  95   ? 312.028 293.649 277.452 1.00 52.51  ? 91   ILE D N     1 
ATOM   2551  C  CA    . ILE D 4  95   ? 312.661 294.586 276.535 1.00 52.51  ? 91   ILE D CA    1 
ATOM   2552  C  C     . ILE D 4  95   ? 313.873 293.950 275.890 1.00 52.51  ? 91   ILE D C     1 
ATOM   2553  O  O     . ILE D 4  95   ? 314.146 294.166 274.710 1.00 52.51  ? 91   ILE D O     1 
ATOM   2554  C  CB    . ILE D 4  95   ? 313.027 295.882 277.266 1.00 52.51  ? 91   ILE D CB    1 
ATOM   2555  C  CG1   . ILE D 4  95   ? 311.797 296.461 277.930 1.00 52.51  ? 91   ILE D CG1   1 
ATOM   2556  C  CG2   . ILE D 4  95   ? 313.555 296.880 276.307 1.00 52.51  ? 91   ILE D CG2   1 
ATOM   2557  C  CD1   . ILE D 4  95   ? 310.742 296.910 276.979 1.00 52.51  ? 91   ILE D CD1   1 
ATOM   2558  N  N     . GLN D 4  96   ? 314.583 293.114 276.628 1.00 51.72  ? 92   GLN D N     1 
ATOM   2559  C  CA    . GLN D 4  96   ? 315.775 292.500 276.072 1.00 51.72  ? 92   GLN D CA    1 
ATOM   2560  C  C     . GLN D 4  96   ? 315.424 291.451 275.038 1.00 51.72  ? 92   GLN D C     1 
ATOM   2561  O  O     . GLN D 4  96   ? 316.047 291.392 273.983 1.00 51.72  ? 92   GLN D O     1 
ATOM   2562  C  CB    . GLN D 4  96   ? 316.602 291.887 277.176 1.00 51.72  ? 92   GLN D CB    1 
ATOM   2563  C  CG    . GLN D 4  96   ? 317.791 291.165 276.701 1.00 51.72  ? 92   GLN D CG    1 
ATOM   2564  C  CD    . GLN D 4  96   ? 318.691 290.834 277.825 1.00 51.72  ? 92   GLN D CD    1 
ATOM   2565  O  OE1   . GLN D 4  96   ? 318.445 289.888 278.556 1.00 51.72  ? 92   GLN D OE1   1 
ATOM   2566  N  NE2   . GLN D 4  96   ? 319.733 291.621 278.000 1.00 51.72  ? 92   GLN D NE2   1 
ATOM   2567  N  N     . THR D 4  97   ? 314.412 290.636 275.295 1.00 53.78  ? 93   THR D N     1 
ATOM   2568  C  CA    . THR D 4  97   ? 314.018 289.668 274.284 1.00 53.78  ? 93   THR D CA    1 
ATOM   2569  C  C     . THR D 4  97   ? 313.340 290.342 273.107 1.00 53.78  ? 93   THR D C     1 
ATOM   2570  O  O     . THR D 4  97   ? 313.460 289.865 271.980 1.00 53.78  ? 93   THR D O     1 
ATOM   2571  C  CB    . THR D 4  97   ? 313.116 288.611 274.888 1.00 53.78  ? 93   THR D CB    1 
ATOM   2572  O  OG1   . THR D 4  97   ? 312.064 289.250 275.596 1.00 53.78  ? 93   THR D OG1   1 
ATOM   2573  C  CG2   . THR D 4  97   ? 313.890 287.783 275.864 1.00 53.78  ? 93   THR D CG2   1 
ATOM   2574  N  N     . ALA D 4  98   ? 312.683 291.479 273.329 1.00 54.13  ? 94   ALA D N     1 
ATOM   2575  C  CA    . ALA D 4  98   ? 312.106 292.226 272.224 1.00 54.13  ? 94   ALA D CA    1 
ATOM   2576  C  C     . ALA D 4  98   ? 313.192 292.831 271.356 1.00 54.13  ? 94   ALA D C     1 
ATOM   2577  O  O     . ALA D 4  98   ? 313.138 292.744 270.127 1.00 54.13  ? 94   ALA D O     1 
ATOM   2578  C  CB    . ALA D 4  98   ? 311.186 293.305 272.764 1.00 54.13  ? 94   ALA D CB    1 
ATOM   2579  N  N     . GLY D 4  99   ? 314.209 293.422 271.980 1.00 53.53  ? 95   GLY D N     1 
ATOM   2580  C  CA    . GLY D 4  99   ? 315.378 293.867 271.257 1.00 53.53  ? 95   GLY D CA    1 
ATOM   2581  C  C     . GLY D 4  99   ? 316.160 292.741 270.643 1.00 53.53  ? 95   GLY D C     1 
ATOM   2582  O  O     . GLY D 4  99   ? 316.917 292.967 269.706 1.00 53.53  ? 95   GLY D O     1 
ATOM   2583  N  N     . ARG D 4  100  ? 315.991 291.526 271.148 1.00 55.00  ? 96   ARG D N     1 
ATOM   2584  C  CA    . ARG D 4  100  ? 316.690 290.391 270.580 1.00 55.00  ? 96   ARG D CA    1 
ATOM   2585  C  C     . ARG D 4  100  ? 315.999 289.892 269.339 1.00 55.00  ? 96   ARG D C     1 
ATOM   2586  O  O     . ARG D 4  100  ? 316.657 289.443 268.399 1.00 55.00  ? 96   ARG D O     1 
ATOM   2587  C  CB    . ARG D 4  100  ? 316.778 289.269 271.594 1.00 55.00  ? 96   ARG D CB    1 
ATOM   2588  C  CG    . ARG D 4  100  ? 318.035 289.278 272.364 1.00 55.00  ? 96   ARG D CG    1 
ATOM   2589  C  CD    . ARG D 4  100  ? 318.314 287.930 272.908 1.00 55.00  ? 96   ARG D CD    1 
ATOM   2590  N  NE    . ARG D 4  100  ? 319.505 287.964 273.730 1.00 55.00  ? 96   ARG D NE    1 
ATOM   2591  C  CZ    . ARG D 4  100  ? 320.230 286.894 274.014 1.00 55.00  ? 96   ARG D CZ    1 
ATOM   2592  N  NH1   . ARG D 4  100  ? 319.877 285.715 273.530 1.00 55.00  ? 96   ARG D NH1   1 
ATOM   2593  N  NH2   . ARG D 4  100  ? 321.307 287.005 274.772 1.00 55.00  ? 96   ARG D NH2   1 
ATOM   2594  N  N     . LEU D 4  101  ? 314.684 289.920 269.324 1.00 55.65  ? 97   LEU D N     1 
ATOM   2595  C  CA    . LEU D 4  101  ? 314.017 289.392 268.153 1.00 55.65  ? 97   LEU D CA    1 
ATOM   2596  C  C     . LEU D 4  101  ? 313.468 290.474 267.247 1.00 55.65  ? 97   LEU D C     1 
ATOM   2597  O  O     . LEU D 4  101  ? 312.736 290.159 266.314 1.00 55.65  ? 97   LEU D O     1 
ATOM   2598  C  CB    . LEU D 4  101  ? 312.921 288.409 268.556 1.00 55.65  ? 97   LEU D CB    1 
ATOM   2599  C  CG    . LEU D 4  101  ? 311.714 288.763 269.396 1.00 55.65  ? 97   LEU D CG    1 
ATOM   2600  C  CD1   . LEU D 4  101  ? 310.568 289.042 268.511 1.00 55.65  ? 97   LEU D CD1   1 
ATOM   2601  C  CD2   . LEU D 4  101  ? 311.375 287.606 270.258 1.00 55.65  ? 97   LEU D CD2   1 
ATOM   2602  N  N     . LEU D 4  102  ? 313.812 291.730 267.470 1.00 56.21  ? 98   LEU D N     1 
ATOM   2603  C  CA    . LEU D 4  102  ? 313.512 292.716 266.447 1.00 56.21  ? 98   LEU D CA    1 
ATOM   2604  C  C     . LEU D 4  102  ? 314.767 293.164 265.731 1.00 56.21  ? 98   LEU D C     1 
ATOM   2605  O  O     . LEU D 4  102  ? 314.765 293.347 264.514 1.00 56.21  ? 98   LEU D O     1 
ATOM   2606  C  CB    . LEU D 4  102  ? 312.815 293.910 267.065 1.00 56.21  ? 98   LEU D CB    1 
ATOM   2607  C  CG    . LEU D 4  102  ? 311.370 293.574 267.318 1.00 56.21  ? 98   LEU D CG    1 
ATOM   2608  C  CD1   . LEU D 4  102  ? 310.805 294.549 268.271 1.00 56.21  ? 98   LEU D CD1   1 
ATOM   2609  C  CD2   . LEU D 4  102  ? 310.643 293.641 266.019 1.00 56.21  ? 98   LEU D CD2   1 
ATOM   2610  N  N     . LEU D 4  103  ? 315.814 293.346 266.461 1.00 57.57  ? 99   LEU D N     1 
ATOM   2611  C  CA    . LEU D 4  103  ? 317.059 293.777 265.877 1.00 57.57  ? 99   LEU D CA    1 
ATOM   2612  C  C     . LEU D 4  103  ? 317.729 292.591 265.204 1.00 57.57  ? 99   LEU D C     1 
ATOM   2613  O  O     . LEU D 4  103  ? 317.840 291.530 265.814 1.00 57.57  ? 99   LEU D O     1 
ATOM   2614  C  CB    . LEU D 4  103  ? 317.963 294.357 266.934 1.00 57.57  ? 99   LEU D CB    1 
ATOM   2615  C  CG    . LEU D 4  103  ? 317.838 295.831 267.279 1.00 57.57  ? 99   LEU D CG    1 
ATOM   2616  C  CD1   . LEU D 4  103  ? 318.083 296.582 266.028 1.00 57.57  ? 99   LEU D CD1   1 
ATOM   2617  C  CD2   . LEU D 4  103  ? 316.526 296.242 267.880 1.00 57.57  ? 99   LEU D CD2   1 
ATOM   2618  N  N     . PRO D 4  104  ? 318.162 292.727 263.974 1.00 58.30  ? 100  PRO D N     1 
ATOM   2619  C  CA    . PRO D 4  104  ? 318.536 291.553 263.183 1.00 58.30  ? 100  PRO D CA    1 
ATOM   2620  C  C     . PRO D 4  104  ? 319.804 290.823 263.584 1.00 58.30  ? 100  PRO D C     1 
ATOM   2621  O  O     . PRO D 4  104  ? 319.779 289.599 263.715 1.00 58.30  ? 100  PRO D O     1 
ATOM   2622  C  CB    . PRO D 4  104  ? 318.676 292.130 261.774 1.00 58.30  ? 100  PRO D CB    1 
ATOM   2623  C  CG    . PRO D 4  104  ? 318.856 293.543 261.959 1.00 58.30  ? 100  PRO D CG    1 
ATOM   2624  C  CD    . PRO D 4  104  ? 318.100 293.934 263.148 1.00 58.30  ? 100  PRO D CD    1 
ATOM   2625  N  N     . GLY D 4  105  ? 320.913 291.514 263.754 1.00 58.28  ? 101  GLY D N     1 
ATOM   2626  C  CA    . GLY D 4  105  ? 322.168 290.794 263.765 1.00 58.28  ? 101  GLY D CA    1 
ATOM   2627  C  C     . GLY D 4  105  ? 323.135 291.175 264.852 1.00 58.28  ? 101  GLY D C     1 
ATOM   2628  O  O     . GLY D 4  105  ? 322.863 290.997 266.038 1.00 58.28  ? 101  GLY D O     1 
ATOM   2629  N  N     . GLU D 4  106  ? 324.308 291.646 264.418 1.00 60.34  ? 102  GLU D N     1 
ATOM   2630  C  CA    . GLU D 4  106  ? 325.249 292.372 265.266 1.00 60.34  ? 102  GLU D CA    1 
ATOM   2631  C  C     . GLU D 4  106  ? 324.567 293.490 266.038 1.00 60.34  ? 102  GLU D C     1 
ATOM   2632  O  O     . GLU D 4  106  ? 324.957 293.787 267.170 1.00 60.34  ? 102  GLU D O     1 
ATOM   2633  C  CB    . GLU D 4  106  ? 326.353 292.957 264.383 1.00 60.34  ? 102  GLU D CB    1 
ATOM   2634  C  CG    . GLU D 4  106  ? 327.542 293.621 265.075 1.00 60.34  ? 102  GLU D CG    1 
ATOM   2635  C  CD    . GLU D 4  106  ? 328.127 294.807 264.271 1.00 60.34  ? 102  GLU D CD    1 
ATOM   2636  O  OE1   . GLU D 4  106  ? 327.420 295.351 263.398 1.00 60.34  ? 102  GLU D OE1   1 
ATOM   2637  O  OE2   . GLU D 4  106  ? 329.298 295.187 264.503 1.00 60.34  ? 102  GLU D OE2   1 
ATOM   2638  N  N     . LEU D 4  107  ? 323.565 294.128 265.423 1.00 57.95  ? 103  LEU D N     1 
ATOM   2639  C  CA    . LEU D 4  107  ? 322.739 295.127 266.085 1.00 57.95  ? 103  LEU D CA    1 
ATOM   2640  C  C     . LEU D 4  107  ? 322.111 294.595 267.355 1.00 57.95  ? 103  LEU D C     1 
ATOM   2641  O  O     . LEU D 4  107  ? 322.047 295.304 268.355 1.00 57.95  ? 103  LEU D O     1 
ATOM   2642  C  CB    . LEU D 4  107  ? 321.642 295.589 265.140 1.00 57.95  ? 103  LEU D CB    1 
ATOM   2643  C  CG    . LEU D 4  107  ? 321.979 296.664 264.136 1.00 57.95  ? 103  LEU D CG    1 
ATOM   2644  C  CD1   . LEU D 4  107  ? 320.757 296.980 263.347 1.00 57.95  ? 103  LEU D CD1   1 
ATOM   2645  C  CD2   . LEU D 4  107  ? 322.441 297.872 264.874 1.00 57.95  ? 103  LEU D CD2   1 
ATOM   2646  N  N     . ALA D 4  108  ? 321.662 293.345 267.343 1.00 57.59  ? 104  ALA D N     1 
ATOM   2647  C  CA    . ALA D 4  108  ? 320.982 292.787 268.503 1.00 57.59  ? 104  ALA D CA    1 
ATOM   2648  C  C     . ALA D 4  108  ? 321.945 292.586 269.652 1.00 57.59  ? 104  ALA D C     1 
ATOM   2649  O  O     . ALA D 4  108  ? 321.649 292.966 270.789 1.00 57.59  ? 104  ALA D O     1 
ATOM   2650  C  CB    . ALA D 4  108  ? 320.322 291.466 268.136 1.00 57.59  ? 104  ALA D CB    1 
ATOM   2651  N  N     . LYS D 4  109  ? 323.111 292.017 269.362 1.00 56.50  ? 105  LYS D N     1 
ATOM   2652  C  CA    . LYS D 4  109  ? 324.127 291.794 270.379 1.00 56.50  ? 105  LYS D CA    1 
ATOM   2653  C  C     . LYS D 4  109  ? 324.617 293.107 270.952 1.00 56.50  ? 105  LYS D C     1 
ATOM   2654  O  O     . LYS D 4  109  ? 324.753 293.255 272.171 1.00 56.50  ? 105  LYS D O     1 
ATOM   2655  C  CB    . LYS D 4  109  ? 325.272 291.001 269.769 1.00 56.50  ? 105  LYS D CB    1 
ATOM   2656  C  CG    . LYS D 4  109  ? 326.608 291.218 270.405 1.00 56.50  ? 105  LYS D CG    1 
ATOM   2657  C  CD    . LYS D 4  109  ? 327.632 290.206 269.898 1.00 56.50  ? 105  LYS D CD    1 
ATOM   2658  C  CE    . LYS D 4  109  ? 328.497 290.766 268.782 1.00 56.50  ? 105  LYS D CE    1 
ATOM   2659  N  NZ    . LYS D 4  109  ? 329.834 290.118 268.750 1.00 56.50  ? 105  LYS D NZ    1 
ATOM   2660  N  N     . HIS D 4  110  ? 324.791 294.104 270.099 1.00 54.43  ? 106  HIS D N     1 
ATOM   2661  C  CA    . HIS D 4  110  ? 325.297 295.372 270.595 1.00 54.43  ? 106  HIS D CA    1 
ATOM   2662  C  C     . HIS D 4  110  ? 324.246 296.123 271.379 1.00 54.43  ? 106  HIS D C     1 
ATOM   2663  O  O     . HIS D 4  110  ? 324.567 296.759 272.385 1.00 54.43  ? 106  HIS D O     1 
ATOM   2664  C  CB    . HIS D 4  110  ? 325.817 296.218 269.455 1.00 54.43  ? 106  HIS D CB    1 
ATOM   2665  C  CG    . HIS D 4  110  ? 327.160 295.791 268.985 1.00 54.43  ? 106  HIS D CG    1 
ATOM   2666  N  ND1   . HIS D 4  110  ? 328.269 296.591 269.090 1.00 54.43  ? 106  HIS D ND1   1 
ATOM   2667  C  CD2   . HIS D 4  110  ? 327.580 294.634 268.435 1.00 54.43  ? 106  HIS D CD2   1 
ATOM   2668  C  CE1   . HIS D 4  110  ? 329.317 295.944 268.615 1.00 54.43  ? 106  HIS D CE1   1 
ATOM   2669  N  NE2   . HIS D 4  110  ? 328.923 294.755 268.206 1.00 54.43  ? 106  HIS D NE2   1 
ATOM   2670  N  N     . ALA D 4  111  ? 322.991 296.043 270.960 1.00 53.01  ? 107  ALA D N     1 
ATOM   2671  C  CA    . ALA D 4  111  ? 321.952 296.783 271.647 1.00 53.01  ? 107  ALA D CA    1 
ATOM   2672  C  C     . ALA D 4  111  ? 321.681 296.190 273.000 1.00 53.01  ? 107  ALA D C     1 
ATOM   2673  O  O     . ALA D 4  111  ? 321.453 296.928 273.953 1.00 53.01  ? 107  ALA D O     1 
ATOM   2674  C  CB    . ALA D 4  111  ? 320.675 296.809 270.828 1.00 53.01  ? 107  ALA D CB    1 
ATOM   2675  N  N     . VAL D 4  112  ? 321.740 294.865 273.124 1.00 51.95  ? 108  VAL D N     1 
ATOM   2676  C  CA    . VAL D 4  112  ? 321.534 294.310 274.454 1.00 51.95  ? 108  VAL D CA    1 
ATOM   2677  C  C     . VAL D 4  112  ? 322.754 294.531 275.322 1.00 51.95  ? 108  VAL D C     1 
ATOM   2678  O  O     . VAL D 4  112  ? 322.618 294.657 276.539 1.00 51.95  ? 108  VAL D O     1 
ATOM   2679  C  CB    . VAL D 4  112  ? 321.127 292.833 274.406 1.00 51.95  ? 108  VAL D CB    1 
ATOM   2680  C  CG1   . VAL D 4  112  ? 319.929 292.683 273.549 1.00 51.95  ? 108  VAL D CG1   1 
ATOM   2681  C  CG2   . VAL D 4  112  ? 322.238 291.962 273.910 1.00 51.95  ? 108  VAL D CG2   1 
ATOM   2682  N  N     . SER D 4  113  ? 323.940 294.678 274.733 1.00 54.25  ? 109  SER D N     1 
ATOM   2683  C  CA    . SER D 4  113  ? 325.099 295.003 275.552 1.00 54.25  ? 109  SER D CA    1 
ATOM   2684  C  C     . SER D 4  113  ? 325.006 296.419 276.091 1.00 54.25  ? 109  SER D C     1 
ATOM   2685  O  O     . SER D 4  113  ? 325.263 296.657 277.273 1.00 54.25  ? 109  SER D O     1 
ATOM   2686  C  CB    . SER D 4  113  ? 326.376 294.830 274.755 1.00 54.25  ? 109  SER D CB    1 
ATOM   2687  O  OG    . SER D 4  113  ? 326.377 295.705 273.658 1.00 54.25  ? 109  SER D OG    1 
ATOM   2688  N  N     . GLU D 4  114  ? 324.607 297.370 275.254 1.00 54.37  ? 110  GLU D N     1 
ATOM   2689  C  CA    . GLU D 4  114  ? 324.503 298.736 275.749 1.00 54.37  ? 110  GLU D CA    1 
ATOM   2690  C  C     . GLU D 4  114  ? 323.293 298.927 276.641 1.00 54.37  ? 110  GLU D C     1 
ATOM   2691  O  O     . GLU D 4  114  ? 323.364 299.698 277.601 1.00 54.37  ? 110  GLU D O     1 
ATOM   2692  C  CB    . GLU D 4  114  ? 324.495 299.732 274.599 1.00 54.37  ? 110  GLU D CB    1 
ATOM   2693  C  CG    . GLU D 4  114  ? 325.687 299.535 273.681 1.00 54.37  ? 110  GLU D CG    1 
ATOM   2694  C  CD    . GLU D 4  114  ? 326.238 300.820 273.095 1.00 54.37  ? 110  GLU D CD    1 
ATOM   2695  O  OE1   . GLU D 4  114  ? 327.458 300.877 272.839 1.00 54.37  ? 110  GLU D OE1   1 
ATOM   2696  O  OE2   . GLU D 4  114  ? 325.463 301.774 272.893 1.00 54.37  ? 110  GLU D OE2   1 
ATOM   2697  N  N     . GLY D 4  115  ? 322.221 298.176 276.410 1.00 54.63  ? 111  GLY D N     1 
ATOM   2698  C  CA    . GLY D 4  115  ? 321.093 298.226 277.316 1.00 54.63  ? 111  GLY D CA    1 
ATOM   2699  C  C     . GLY D 4  115  ? 321.431 297.660 278.676 1.00 54.63  ? 111  GLY D C     1 
ATOM   2700  O  O     . GLY D 4  115  ? 321.096 298.252 279.703 1.00 54.63  ? 111  GLY D O     1 
ATOM   2701  N  N     . THR D 4  116  ? 322.144 296.536 278.706 1.00 52.50  ? 112  THR D N     1 
ATOM   2702  C  CA    . THR D 4  116  ? 322.465 295.908 279.974 1.00 52.50  ? 112  THR D CA    1 
ATOM   2703  C  C     . THR D 4  116  ? 323.518 296.696 280.724 1.00 52.50  ? 112  THR D C     1 
ATOM   2704  O  O     . THR D 4  116  ? 323.469 296.790 281.956 1.00 52.50  ? 112  THR D O     1 
ATOM   2705  C  CB    . THR D 4  116  ? 322.945 294.499 279.730 1.00 52.50  ? 112  THR D CB    1 
ATOM   2706  O  OG1   . THR D 4  116  ? 322.038 293.865 278.833 1.00 52.50  ? 112  THR D OG1   1 
ATOM   2707  C  CG2   . THR D 4  116  ? 322.920 293.741 281.006 1.00 52.50  ? 112  THR D CG2   1 
ATOM   2708  N  N     . LYS D 4  117  ? 324.456 297.294 279.997 1.00 54.15  ? 113  LYS D N     1 
ATOM   2709  C  CA    . LYS D 4  117  ? 325.421 298.177 280.630 1.00 54.15  ? 113  LYS D CA    1 
ATOM   2710  C  C     . LYS D 4  117  ? 324.740 299.388 281.231 1.00 54.15  ? 113  LYS D C     1 
ATOM   2711  O  O     . LYS D 4  117  ? 325.084 299.806 282.337 1.00 54.15  ? 113  LYS D O     1 
ATOM   2712  C  CB    . LYS D 4  117  ? 326.474 298.619 279.633 1.00 54.15  ? 113  LYS D CB    1 
ATOM   2713  C  CG    . LYS D 4  117  ? 327.602 299.369 280.280 1.00 54.15  ? 113  LYS D CG    1 
ATOM   2714  C  CD    . LYS D 4  117  ? 328.237 300.373 279.340 1.00 54.15  ? 113  LYS D CD    1 
ATOM   2715  C  CE    . LYS D 4  117  ? 329.337 301.160 280.038 1.00 54.15  ? 113  LYS D CE    1 
ATOM   2716  N  NZ    . LYS D 4  117  ? 330.335 301.697 279.073 1.00 54.15  ? 113  LYS D NZ    1 
ATOM   2717  N  N     . ALA D 4  118  ? 323.727 299.927 280.563 1.00 54.51  ? 114  ALA D N     1 
ATOM   2718  C  CA    . ALA D 4  118  ? 323.066 301.092 281.127 1.00 54.51  ? 114  ALA D CA    1 
ATOM   2719  C  C     . ALA D 4  118  ? 322.210 300.733 282.320 1.00 54.51  ? 114  ALA D C     1 
ATOM   2720  O  O     . ALA D 4  118  ? 322.149 301.494 283.285 1.00 54.51  ? 114  ALA D O     1 
ATOM   2721  C  CB    . ALA D 4  118  ? 322.221 301.777 280.082 1.00 54.51  ? 114  ALA D CB    1 
ATOM   2722  N  N     . VAL D 4  119  ? 321.562 299.571 282.293 1.00 54.85  ? 115  VAL D N     1 
ATOM   2723  C  CA    . VAL D 4  119  ? 320.729 299.182 283.427 1.00 54.85  ? 115  VAL D CA    1 
ATOM   2724  C  C     . VAL D 4  119  ? 321.583 298.887 284.650 1.00 54.85  ? 115  VAL D C     1 
ATOM   2725  O  O     . VAL D 4  119  ? 321.305 299.379 285.750 1.00 54.85  ? 115  VAL D O     1 
ATOM   2726  C  CB    . VAL D 4  119  ? 319.846 297.988 283.059 1.00 54.85  ? 115  VAL D CB    1 
ATOM   2727  C  CG1   . VAL D 4  119  ? 319.150 297.476 284.267 1.00 54.85  ? 115  VAL D CG1   1 
ATOM   2728  C  CG2   . VAL D 4  119  ? 318.839 298.407 282.069 1.00 54.85  ? 115  VAL D CG2   1 
ATOM   2729  N  N     . THR D 4  120  ? 322.663 298.130 284.483 1.00 56.93  ? 116  THR D N     1 
ATOM   2730  C  CA    . THR D 4  120  ? 323.502 297.855 285.637 1.00 56.93  ? 116  THR D CA    1 
ATOM   2731  C  C     . THR D 4  120  ? 324.371 299.038 286.008 1.00 56.93  ? 116  THR D C     1 
ATOM   2732  O  O     . THR D 4  120  ? 324.965 299.041 287.084 1.00 56.93  ? 116  THR D O     1 
ATOM   2733  C  CB    . THR D 4  120  ? 324.366 296.642 285.388 1.00 56.93  ? 116  THR D CB    1 
ATOM   2734  O  OG1   . THR D 4  120  ? 325.172 296.867 284.233 1.00 56.93  ? 116  THR D OG1   1 
ATOM   2735  C  CG2   . THR D 4  120  ? 323.496 295.441 285.167 1.00 56.93  ? 116  THR D CG2   1 
ATOM   2736  N  N     . LYS D 4  121  ? 324.481 300.037 285.143 1.00 58.08  ? 117  LYS D N     1 
ATOM   2737  C  CA    . LYS D 4  121  ? 325.029 301.306 285.588 1.00 58.08  ? 117  LYS D CA    1 
ATOM   2738  C  C     . LYS D 4  121  ? 324.002 302.066 286.399 1.00 58.08  ? 117  LYS D C     1 
ATOM   2739  O  O     . LYS D 4  121  ? 324.352 302.790 287.333 1.00 58.08  ? 117  LYS D O     1 
ATOM   2740  C  CB    . LYS D 4  121  ? 325.483 302.115 284.375 1.00 58.08  ? 117  LYS D CB    1 
ATOM   2741  C  CG    . LYS D 4  121  ? 326.094 303.454 284.689 1.00 58.08  ? 117  LYS D CG    1 
ATOM   2742  C  CD    . LYS D 4  121  ? 327.248 303.765 283.778 1.00 58.08  ? 117  LYS D CD    1 
ATOM   2743  C  CE    . LYS D 4  121  ? 327.971 305.013 284.247 1.00 58.08  ? 117  LYS D CE    1 
ATOM   2744  N  NZ    . LYS D 4  121  ? 328.246 305.010 285.715 1.00 58.08  ? 117  LYS D NZ    1 
ATOM   2745  N  N     . TYR D 4  122  ? 322.730 301.877 286.084 1.00 60.99  ? 118  TYR D N     1 
ATOM   2746  C  CA    . TYR D 4  122  ? 321.663 302.640 286.711 1.00 60.99  ? 118  TYR D CA    1 
ATOM   2747  C  C     . TYR D 4  122  ? 321.388 302.160 288.119 1.00 60.99  ? 118  TYR D C     1 
ATOM   2748  O  O     . TYR D 4  122  ? 321.271 302.965 289.046 1.00 60.99  ? 118  TYR D O     1 
ATOM   2749  C  CB    . TYR D 4  122  ? 320.413 302.522 285.862 1.00 60.99  ? 118  TYR D CB    1 
ATOM   2750  C  CG    . TYR D 4  122  ? 319.183 303.111 286.449 1.00 60.99  ? 118  TYR D CG    1 
ATOM   2751  C  CD1   . TYR D 4  122  ? 318.974 304.463 286.423 1.00 60.99  ? 118  TYR D CD1   1 
ATOM   2752  C  CD2   . TYR D 4  122  ? 318.199 302.309 286.967 1.00 60.99  ? 118  TYR D CD2   1 
ATOM   2753  C  CE1   . TYR D 4  122  ? 317.840 305.003 286.925 1.00 60.99  ? 118  TYR D CE1   1 
ATOM   2754  C  CE2   . TYR D 4  122  ? 317.065 302.843 287.475 1.00 60.99  ? 118  TYR D CE2   1 
ATOM   2755  C  CZ    . TYR D 4  122  ? 316.893 304.191 287.448 1.00 60.99  ? 118  TYR D CZ    1 
ATOM   2756  O  OH    . TYR D 4  122  ? 315.755 304.735 287.960 1.00 60.99  ? 118  TYR D OH    1 
ATOM   2757  N  N     . THR D 4  123  ? 321.271 300.852 288.297 1.00 61.40  ? 119  THR D N     1 
ATOM   2758  C  CA    . THR D 4  123  ? 321.018 300.334 289.628 1.00 61.40  ? 119  THR D CA    1 
ATOM   2759  C  C     . THR D 4  123  ? 322.266 300.315 290.488 1.00 61.40  ? 119  THR D C     1 
ATOM   2760  O  O     . THR D 4  123  ? 322.163 300.076 291.692 1.00 61.40  ? 119  THR D O     1 
ATOM   2761  C  CB    . THR D 4  123  ? 320.445 298.934 289.563 1.00 61.40  ? 119  THR D CB    1 
ATOM   2762  O  OG1   . THR D 4  123  ? 321.498 298.018 289.271 1.00 61.40  ? 119  THR D OG1   1 
ATOM   2763  C  CG2   . THR D 4  123  ? 319.419 298.855 288.487 1.00 61.40  ? 119  THR D CG2   1 
ATOM   2764  N  N     . SER D 4  124  ? 323.432 300.540 289.910 1.00 61.78  ? 120  SER D N     1 
ATOM   2765  C  CA    . SER D 4  124  ? 324.627 300.712 290.703 1.00 61.78  ? 120  SER D CA    1 
ATOM   2766  C  C     . SER D 4  124  ? 324.588 302.048 291.426 1.00 61.78  ? 120  SER D C     1 
ATOM   2767  O  O     . SER D 4  124  ? 325.627 302.656 291.678 1.00 61.78  ? 120  SER D O     1 
ATOM   2768  C  CB    . SER D 4  124  ? 325.868 300.628 289.834 1.00 61.78  ? 120  SER D CB    1 
ATOM   2769  O  OG    . SER D 4  124  ? 327.020 300.862 290.608 1.00 61.78  ? 120  SER D OG    1 
ATOM   2770  N  N     . GLY E 1  45   ? 320.770 305.650 222.823 1.00 65.79  ? 44   GLY E N     1 
ATOM   2771  C  CA    . GLY E 1  45   ? 320.544 304.923 224.058 1.00 65.79  ? 44   GLY E CA    1 
ATOM   2772  C  C     . GLY E 1  45   ? 321.469 305.260 225.214 1.00 65.79  ? 44   GLY E C     1 
ATOM   2773  O  O     . GLY E 1  45   ? 321.522 304.532 226.192 1.00 65.79  ? 44   GLY E O     1 
ATOM   2774  N  N     . THR E 1  46   ? 322.194 306.372 225.102 1.00 67.58  ? 45   THR E N     1 
ATOM   2775  C  CA    . THR E 1  46   ? 323.155 306.738 226.137 1.00 67.58  ? 45   THR E CA    1 
ATOM   2776  C  C     . THR E 1  46   ? 322.582 307.793 227.075 1.00 67.58  ? 45   THR E C     1 
ATOM   2777  O  O     . THR E 1  46   ? 322.915 307.822 228.271 1.00 67.58  ? 45   THR E O     1 
ATOM   2778  C  CB    . THR E 1  46   ? 324.461 307.187 225.472 1.00 67.58  ? 45   THR E CB    1 
ATOM   2779  O  OG1   . THR E 1  46   ? 325.497 306.251 225.790 1.00 67.58  ? 45   THR E OG1   1 
ATOM   2780  C  CG2   . THR E 1  46   ? 324.916 308.583 225.881 1.00 67.58  ? 45   THR E CG2   1 
ATOM   2781  N  N     . VAL E 1  47   ? 321.667 308.619 226.565 1.00 67.06  ? 46   VAL E N     1 
ATOM   2782  C  CA    . VAL E 1  47   ? 321.015 309.635 227.377 1.00 67.06  ? 46   VAL E CA    1 
ATOM   2783  C  C     . VAL E 1  47   ? 320.133 308.982 228.427 1.00 67.06  ? 46   VAL E C     1 
ATOM   2784  O  O     . VAL E 1  47   ? 319.930 309.532 229.511 1.00 67.06  ? 46   VAL E O     1 
ATOM   2785  C  CB    . VAL E 1  47   ? 320.237 310.588 226.459 1.00 67.06  ? 46   VAL E CB    1 
ATOM   2786  C  CG1   . VAL E 1  47   ? 319.568 311.691 227.217 1.00 67.06  ? 46   VAL E CG1   1 
ATOM   2787  C  CG2   . VAL E 1  47   ? 321.180 311.182 225.451 1.00 67.06  ? 46   VAL E CG2   1 
ATOM   2788  N  N     . ALA E 1  48   ? 319.659 307.768 228.152 1.00 64.08  ? 47   ALA E N     1 
ATOM   2789  C  CA    . ALA E 1  48   ? 318.943 306.990 229.154 1.00 64.08  ? 47   ALA E CA    1 
ATOM   2790  C  C     . ALA E 1  48   ? 319.827 306.675 230.343 1.00 64.08  ? 47   ALA E C     1 
ATOM   2791  O  O     . ALA E 1  48   ? 319.401 306.823 231.489 1.00 64.08  ? 47   ALA E O     1 
ATOM   2792  C  CB    . ALA E 1  48   ? 318.417 305.699 228.543 1.00 64.08  ? 47   ALA E CB    1 
ATOM   2793  N  N     . LEU E 1  49   ? 321.080 306.295 230.094 1.00 64.41  ? 48   LEU E N     1 
ATOM   2794  C  CA    . LEU E 1  49   ? 322.000 306.037 231.196 1.00 64.41  ? 48   LEU E CA    1 
ATOM   2795  C  C     . LEU E 1  49   ? 322.380 307.324 231.912 1.00 64.41  ? 48   LEU E C     1 
ATOM   2796  O  O     . LEU E 1  49   ? 322.553 307.333 233.140 1.00 64.41  ? 48   LEU E O     1 
ATOM   2797  C  CB    . LEU E 1  49   ? 323.241 305.315 230.685 1.00 64.41  ? 48   LEU E CB    1 
ATOM   2798  C  CG    . LEU E 1  49   ? 323.144 303.835 230.316 1.00 64.41  ? 48   LEU E CG    1 
ATOM   2799  C  CD1   . LEU E 1  49   ? 324.410 303.132 230.711 1.00 64.41  ? 48   LEU E CD1   1 
ATOM   2800  C  CD2   . LEU E 1  49   ? 321.998 303.158 231.011 1.00 64.41  ? 48   LEU E CD2   1 
ATOM   2801  N  N     . ARG E 1  50   ? 322.468 308.427 231.169 1.00 66.82  ? 49   ARG E N     1 
ATOM   2802  C  CA    . ARG E 1  50   ? 322.784 309.700 231.801 1.00 66.82  ? 49   ARG E CA    1 
ATOM   2803  C  C     . ARG E 1  50   ? 321.679 310.152 232.737 1.00 66.82  ? 49   ARG E C     1 
ATOM   2804  O  O     . ARG E 1  50   ? 321.957 310.580 233.859 1.00 66.82  ? 49   ARG E O     1 
ATOM   2805  C  CB    . ARG E 1  50   ? 323.049 310.765 230.755 1.00 66.82  ? 49   ARG E CB    1 
ATOM   2806  C  CG    . ARG E 1  50   ? 324.230 310.438 229.906 1.00 66.82  ? 49   ARG E CG    1 
ATOM   2807  C  CD    . ARG E 1  50   ? 324.832 311.679 229.338 1.00 66.82  ? 49   ARG E CD    1 
ATOM   2808  N  NE    . ARG E 1  50   ? 323.798 312.538 228.796 1.00 66.82  ? 49   ARG E NE    1 
ATOM   2809  C  CZ    . ARG E 1  50   ? 324.043 313.645 228.116 1.00 66.82  ? 49   ARG E CZ    1 
ATOM   2810  N  NH1   . ARG E 1  50   ? 325.292 314.012 227.883 1.00 66.82  ? 49   ARG E NH1   1 
ATOM   2811  N  NH2   . ARG E 1  50   ? 323.040 314.373 227.654 1.00 66.82  ? 49   ARG E NH2   1 
ATOM   2812  N  N     . GLU E 1  51   ? 320.420 310.018 232.338 1.00 63.59  ? 50   GLU E N     1 
ATOM   2813  C  CA    . GLU E 1  51   ? 319.399 310.450 233.275 1.00 63.59  ? 50   GLU E CA    1 
ATOM   2814  C  C     . GLU E 1  51   ? 319.039 309.361 234.265 1.00 63.59  ? 50   GLU E C     1 
ATOM   2815  O  O     . GLU E 1  51   ? 318.404 309.657 235.274 1.00 63.59  ? 50   GLU E O     1 
ATOM   2816  C  CB    . GLU E 1  51   ? 318.159 310.983 232.573 1.00 63.59  ? 50   GLU E CB    1 
ATOM   2817  C  CG    . GLU E 1  51   ? 317.534 310.127 231.544 1.00 63.59  ? 50   GLU E CG    1 
ATOM   2818  C  CD    . GLU E 1  51   ? 316.674 310.943 230.604 1.00 63.59  ? 50   GLU E CD    1 
ATOM   2819  O  OE1   . GLU E 1  51   ? 315.437 310.916 230.752 1.00 63.59  ? 50   GLU E OE1   1 
ATOM   2820  O  OE2   . GLU E 1  51   ? 317.238 311.641 229.741 1.00 63.59  ? 50   GLU E OE2   1 
ATOM   2821  N  N     . ILE E 1  52   ? 319.506 308.129 234.064 1.00 62.11  ? 51   ILE E N     1 
ATOM   2822  C  CA    . ILE E 1  52   ? 319.478 307.161 235.159 1.00 62.11  ? 51   ILE E CA    1 
ATOM   2823  C  C     . ILE E 1  52   ? 320.378 307.636 236.285 1.00 62.11  ? 51   ILE E C     1 
ATOM   2824  O  O     . ILE E 1  52   ? 319.961 307.705 237.448 1.00 62.11  ? 51   ILE E O     1 
ATOM   2825  C  CB    . ILE E 1  52   ? 319.882 305.764 234.666 1.00 62.11  ? 51   ILE E CB    1 
ATOM   2826  C  CG1   . ILE E 1  52   ? 318.683 305.037 234.092 1.00 62.11  ? 51   ILE E CG1   1 
ATOM   2827  C  CG2   . ILE E 1  52   ? 320.377 304.919 235.792 1.00 62.11  ? 51   ILE E CG2   1 
ATOM   2828  C  CD1   . ILE E 1  52   ? 319.035 303.778 233.392 1.00 62.11  ? 51   ILE E CD1   1 
ATOM   2829  N  N     . ARG E 1  53   ? 321.609 308.032 235.936 1.00 66.88  ? 52   ARG E N     1 
ATOM   2830  C  CA    . ARG E 1  53   ? 322.543 308.551 236.930 1.00 66.88  ? 52   ARG E CA    1 
ATOM   2831  C  C     . ARG E 1  53   ? 322.050 309.856 237.522 1.00 66.88  ? 52   ARG E C     1 
ATOM   2832  O  O     . ARG E 1  53   ? 322.230 310.106 238.718 1.00 66.88  ? 52   ARG E O     1 
ATOM   2833  C  CB    . ARG E 1  53   ? 323.919 308.747 236.309 1.00 66.88  ? 52   ARG E CB    1 
ATOM   2834  C  CG    . ARG E 1  53   ? 324.646 307.454 236.066 1.00 66.88  ? 52   ARG E CG    1 
ATOM   2835  C  CD    . ARG E 1  53   ? 326.090 307.656 235.677 1.00 66.88  ? 52   ARG E CD    1 
ATOM   2836  N  NE    . ARG E 1  53   ? 326.752 306.367 235.493 1.00 66.88  ? 52   ARG E NE    1 
ATOM   2837  C  CZ    . ARG E 1  53   ? 326.874 305.748 234.323 1.00 66.88  ? 52   ARG E CZ    1 
ATOM   2838  N  NH1   . ARG E 1  53   ? 326.387 306.298 233.219 1.00 66.88  ? 52   ARG E NH1   1 
ATOM   2839  N  NH2   . ARG E 1  53   ? 327.486 304.575 234.253 1.00 66.88  ? 52   ARG E NH2   1 
ATOM   2840  N  N     . ARG E 1  54   ? 321.388 310.674 236.709 1.00 64.60  ? 53   ARG E N     1 
ATOM   2841  C  CA    . ARG E 1  54   ? 320.871 311.946 237.187 1.00 64.60  ? 53   ARG E CA    1 
ATOM   2842  C  C     . ARG E 1  54   ? 319.751 311.768 238.189 1.00 64.60  ? 53   ARG E C     1 
ATOM   2843  O  O     . ARG E 1  54   ? 319.775 312.382 239.255 1.00 64.60  ? 53   ARG E O     1 
ATOM   2844  C  CB    . ARG E 1  54   ? 320.368 312.778 236.024 1.00 64.60  ? 53   ARG E CB    1 
ATOM   2845  C  CG    . ARG E 1  54   ? 321.426 313.597 235.358 1.00 64.60  ? 53   ARG E CG    1 
ATOM   2846  C  CD    . ARG E 1  54   ? 320.777 314.634 234.495 1.00 64.60  ? 53   ARG E CD    1 
ATOM   2847  N  NE    . ARG E 1  54   ? 319.732 315.310 235.238 1.00 64.60  ? 53   ARG E NE    1 
ATOM   2848  C  CZ    . ARG E 1  54   ? 318.485 315.427 234.818 1.00 64.60  ? 53   ARG E CZ    1 
ATOM   2849  N  NH1   . ARG E 1  54   ? 318.141 314.921 233.652 1.00 64.60  ? 53   ARG E NH1   1 
ATOM   2850  N  NH2   . ARG E 1  54   ? 317.595 316.052 235.564 1.00 64.60  ? 53   ARG E NH2   1 
ATOM   2851  N  N     . TYR E 1  55   ? 318.760 310.939 237.878 1.00 61.20  ? 54   TYR E N     1 
ATOM   2852  C  CA    . TYR E 1  55   ? 317.626 310.836 238.777 1.00 61.20  ? 54   TYR E CA    1 
ATOM   2853  C  C     . TYR E 1  55   ? 317.902 309.899 239.929 1.00 61.20  ? 54   TYR E C     1 
ATOM   2854  O  O     . TYR E 1  55   ? 317.131 309.871 240.888 1.00 61.20  ? 54   TYR E O     1 
ATOM   2855  C  CB    . TYR E 1  55   ? 316.379 310.396 238.023 1.00 61.20  ? 54   TYR E CB    1 
ATOM   2856  C  CG    . TYR E 1  55   ? 315.896 311.450 237.082 1.00 61.20  ? 54   TYR E CG    1 
ATOM   2857  C  CD1   . TYR E 1  55   ? 315.615 312.721 237.534 1.00 61.20  ? 54   TYR E CD1   1 
ATOM   2858  C  CD2   . TYR E 1  55   ? 315.743 311.184 235.741 1.00 61.20  ? 54   TYR E CD2   1 
ATOM   2859  C  CE1   . TYR E 1  55   ? 315.195 313.691 236.674 1.00 61.20  ? 54   TYR E CE1   1 
ATOM   2860  C  CE2   . TYR E 1  55   ? 315.331 312.146 234.876 1.00 61.20  ? 54   TYR E CE2   1 
ATOM   2861  C  CZ    . TYR E 1  55   ? 315.056 313.394 235.347 1.00 61.20  ? 54   TYR E CZ    1 
ATOM   2862  O  OH    . TYR E 1  55   ? 314.636 314.353 234.467 1.00 61.20  ? 54   TYR E OH    1 
ATOM   2863  N  N     . GLN E 1  56   ? 318.982 309.131 239.875 1.00 63.98  ? 55   GLN E N     1 
ATOM   2864  C  CA    . GLN E 1  56   ? 319.354 308.409 241.077 1.00 63.98  ? 55   GLN E CA    1 
ATOM   2865  C  C     . GLN E 1  56   ? 320.209 309.256 241.998 1.00 63.98  ? 55   GLN E C     1 
ATOM   2866  O  O     . GLN E 1  56   ? 320.229 309.016 243.207 1.00 63.98  ? 55   GLN E O     1 
ATOM   2867  C  CB    . GLN E 1  56   ? 320.066 307.119 240.715 1.00 63.98  ? 55   GLN E CB    1 
ATOM   2868  C  CG    . GLN E 1  56   ? 319.165 305.943 240.820 1.00 63.98  ? 55   GLN E CG    1 
ATOM   2869  C  CD    . GLN E 1  56   ? 319.756 304.716 240.236 1.00 63.98  ? 55   GLN E CD    1 
ATOM   2870  O  OE1   . GLN E 1  56   ? 320.221 304.725 239.111 1.00 63.98  ? 55   GLN E OE1   1 
ATOM   2871  N  NE2   . GLN E 1  56   ? 319.756 303.645 240.995 1.00 63.98  ? 55   GLN E NE2   1 
ATOM   2872  N  N     . LYS E 1  57   ? 320.902 310.256 241.458 1.00 63.04  ? 56   LYS E N     1 
ATOM   2873  C  CA    . LYS E 1  57   ? 321.669 311.151 242.310 1.00 63.04  ? 56   LYS E CA    1 
ATOM   2874  C  C     . LYS E 1  57   ? 320.777 312.065 243.134 1.00 63.04  ? 56   LYS E C     1 
ATOM   2875  O  O     . LYS E 1  57   ? 321.140 312.429 244.254 1.00 63.04  ? 56   LYS E O     1 
ATOM   2876  C  CB    . LYS E 1  57   ? 322.614 311.990 241.465 1.00 63.04  ? 56   LYS E CB    1 
ATOM   2877  C  CG    . LYS E 1  57   ? 323.977 311.389 241.262 1.00 63.04  ? 56   LYS E CG    1 
ATOM   2878  C  CD    . LYS E 1  57   ? 324.779 312.240 240.303 1.00 63.04  ? 56   LYS E CD    1 
ATOM   2879  C  CE    . LYS E 1  57   ? 326.243 311.874 240.320 1.00 63.04  ? 56   LYS E CE    1 
ATOM   2880  N  NZ    . LYS E 1  57   ? 326.926 312.467 241.498 1.00 63.04  ? 56   LYS E NZ    1 
ATOM   2881  N  N     . SER E 1  58   ? 319.622 312.453 242.608 1.00 61.97  ? 57   SER E N     1 
ATOM   2882  C  CA    . SER E 1  58   ? 318.831 313.491 243.246 1.00 61.97  ? 57   SER E CA    1 
ATOM   2883  C  C     . SER E 1  58   ? 317.851 312.906 244.251 1.00 61.97  ? 57   SER E C     1 
ATOM   2884  O  O     . SER E 1  58   ? 317.682 311.695 244.370 1.00 61.97  ? 57   SER E O     1 
ATOM   2885  C  CB    . SER E 1  58   ? 318.056 314.287 242.213 1.00 61.97  ? 57   SER E CB    1 
ATOM   2886  O  OG    . SER E 1  58   ? 317.048 313.482 241.655 1.00 61.97  ? 57   SER E OG    1 
ATOM   2887  N  N     . THR E 1  59   ? 317.199 313.805 244.985 1.00 62.98  ? 58   THR E N     1 
ATOM   2888  C  CA    . THR E 1  59   ? 316.193 313.450 245.973 1.00 62.98  ? 58   THR E CA    1 
ATOM   2889  C  C     . THR E 1  59   ? 314.849 314.093 245.699 1.00 62.98  ? 58   THR E C     1 
ATOM   2890  O  O     . THR E 1  59   ? 313.860 313.711 246.329 1.00 62.98  ? 58   THR E O     1 
ATOM   2891  C  CB    . THR E 1  59   ? 316.623 313.891 247.366 1.00 62.98  ? 58   THR E CB    1 
ATOM   2892  O  OG1   . THR E 1  59   ? 316.561 315.315 247.429 1.00 62.98  ? 58   THR E OG1   1 
ATOM   2893  C  CG2   . THR E 1  59   ? 318.017 313.470 247.649 1.00 62.98  ? 58   THR E CG2   1 
ATOM   2894  N  N     . GLU E 1  60   ? 314.790 315.070 244.804 1.00 62.44  ? 59   GLU E N     1 
ATOM   2895  C  CA    . GLU E 1  60   ? 313.593 315.843 244.544 1.00 62.44  ? 59   GLU E CA    1 
ATOM   2896  C  C     . GLU E 1  60   ? 312.556 314.998 243.826 1.00 62.44  ? 59   GLU E C     1 
ATOM   2897  O  O     . GLU E 1  60   ? 312.833 313.904 243.339 1.00 62.44  ? 59   GLU E O     1 
ATOM   2898  C  CB    . GLU E 1  60   ? 313.946 317.092 243.749 1.00 62.44  ? 59   GLU E CB    1 
ATOM   2899  C  CG    . GLU E 1  60   ? 314.873 316.825 242.591 1.00 62.44  ? 59   GLU E CG    1 
ATOM   2900  C  CD    . GLU E 1  60   ? 314.157 316.492 241.319 1.00 62.44  ? 59   GLU E CD    1 
ATOM   2901  O  OE1   . GLU E 1  60   ? 312.956 316.798 241.227 1.00 62.44  ? 59   GLU E OE1   1 
ATOM   2902  O  OE2   . GLU E 1  60   ? 314.797 315.936 240.400 1.00 62.44  ? 59   GLU E OE2   1 
ATOM   2903  N  N     . LEU E 1  61   ? 311.341 315.524 243.773 1.00 59.68  ? 60   LEU E N     1 
ATOM   2904  C  CA    . LEU E 1  61   ? 310.195 314.729 243.379 1.00 59.68  ? 60   LEU E CA    1 
ATOM   2905  C  C     . LEU E 1  61   ? 309.959 314.829 241.888 1.00 59.68  ? 60   LEU E C     1 
ATOM   2906  O  O     . LEU E 1  61   ? 310.205 315.861 241.266 1.00 59.68  ? 60   LEU E O     1 
ATOM   2907  C  CB    . LEU E 1  61   ? 308.948 315.182 244.115 1.00 59.68  ? 60   LEU E CB    1 
ATOM   2908  C  CG    . LEU E 1  61   ? 309.143 315.272 245.618 1.00 59.68  ? 60   LEU E CG    1 
ATOM   2909  C  CD1   . LEU E 1  61   ? 307.889 315.801 246.272 1.00 59.68  ? 60   LEU E CD1   1 
ATOM   2910  C  CD2   . LEU E 1  61   ? 309.537 313.922 246.152 1.00 59.68  ? 60   LEU E CD2   1 
ATOM   2911  N  N     . LEU E 1  62   ? 309.453 313.745 241.319 1.00 58.01  ? 61   LEU E N     1 
ATOM   2912  C  CA    . LEU E 1  62   ? 309.365 313.639 239.879 1.00 58.01  ? 61   LEU E CA    1 
ATOM   2913  C  C     . LEU E 1  62   ? 307.981 313.936 239.327 1.00 58.01  ? 61   LEU E C     1 
ATOM   2914  O  O     . LEU E 1  62   ? 307.877 314.497 238.238 1.00 58.01  ? 61   LEU E O     1 
ATOM   2915  C  CB    . LEU E 1  62   ? 309.825 312.249 239.457 1.00 58.01  ? 61   LEU E CB    1 
ATOM   2916  C  CG    . LEU E 1  62   ? 311.159 311.964 240.137 1.00 58.01  ? 61   LEU E CG    1 
ATOM   2917  C  CD1   . LEU E 1  62   ? 311.533 310.545 239.973 1.00 58.01  ? 61   LEU E CD1   1 
ATOM   2918  C  CD2   . LEU E 1  62   ? 312.219 312.830 239.546 1.00 58.01  ? 61   LEU E CD2   1 
ATOM   2919  N  N     . ILE E 1  63   ? 306.919 313.586 240.036 1.00 57.80  ? 62   ILE E N     1 
ATOM   2920  C  CA    . ILE E 1  63   ? 305.599 314.070 239.671 1.00 57.80  ? 62   ILE E CA    1 
ATOM   2921  C  C     . ILE E 1  63   ? 305.535 315.563 239.934 1.00 57.80  ? 62   ILE E C     1 
ATOM   2922  O  O     . ILE E 1  63   ? 306.024 316.040 240.960 1.00 57.80  ? 62   ILE E O     1 
ATOM   2923  C  CB    . ILE E 1  63   ? 304.513 313.346 240.470 1.00 57.80  ? 62   ILE E CB    1 
ATOM   2924  C  CG1   . ILE E 1  63   ? 304.774 311.853 240.514 1.00 57.80  ? 62   ILE E CG1   1 
ATOM   2925  C  CG2   . ILE E 1  63   ? 303.155 313.626 239.875 1.00 57.80  ? 62   ILE E CG2   1 
ATOM   2926  C  CD1   . ILE E 1  63   ? 304.542 311.174 239.220 1.00 57.80  ? 62   ILE E CD1   1 
ATOM   2927  N  N     . ARG E 1  64   ? 304.952 316.311 239.004 1.00 60.26  ? 63   ARG E N     1 
ATOM   2928  C  CA    . ARG E 1  64   ? 304.642 317.702 239.271 1.00 60.26  ? 63   ARG E CA    1 
ATOM   2929  C  C     . ARG E 1  64   ? 303.597 317.782 240.371 1.00 60.26  ? 63   ARG E C     1 
ATOM   2930  O  O     . ARG E 1  64   ? 302.761 316.898 240.514 1.00 60.26  ? 63   ARG E O     1 
ATOM   2931  C  CB    . ARG E 1  64   ? 304.138 318.382 238.009 1.00 60.26  ? 63   ARG E CB    1 
ATOM   2932  C  CG    . ARG E 1  64   ? 305.108 318.447 236.878 1.00 60.26  ? 63   ARG E CG    1 
ATOM   2933  C  CD    . ARG E 1  64   ? 306.127 319.492 237.121 1.00 60.26  ? 63   ARG E CD    1 
ATOM   2934  N  NE    . ARG E 1  64   ? 307.327 318.893 237.658 1.00 60.26  ? 63   ARG E NE    1 
ATOM   2935  C  CZ    . ARG E 1  64   ? 308.302 319.576 238.234 1.00 60.26  ? 63   ARG E CZ    1 
ATOM   2936  N  NH1   . ARG E 1  64   ? 308.206 320.891 238.342 1.00 60.26  ? 63   ARG E NH1   1 
ATOM   2937  N  NH2   . ARG E 1  64   ? 309.369 318.944 238.701 1.00 60.26  ? 63   ARG E NH2   1 
ATOM   2938  N  N     . LYS E 1  65   ? 303.654 318.841 241.161 1.00 59.44  ? 64   LYS E N     1 
ATOM   2939  C  CA    . LYS E 1  65   ? 302.938 318.812 242.425 1.00 59.44  ? 64   LYS E CA    1 
ATOM   2940  C  C     . LYS E 1  65   ? 301.479 319.204 242.288 1.00 59.44  ? 64   LYS E C     1 
ATOM   2941  O  O     . LYS E 1  65   ? 300.629 318.645 242.987 1.00 59.44  ? 64   LYS E O     1 
ATOM   2942  C  CB    . LYS E 1  65   ? 303.656 319.697 243.433 1.00 59.44  ? 64   LYS E CB    1 
ATOM   2943  C  CG    . LYS E 1  65   ? 305.016 319.140 243.784 1.00 59.44  ? 64   LYS E CG    1 
ATOM   2944  C  CD    . LYS E 1  65   ? 305.937 320.148 244.420 1.00 59.44  ? 64   LYS E CD    1 
ATOM   2945  C  CE    . LYS E 1  65   ? 305.462 320.553 245.789 1.00 59.44  ? 64   LYS E CE    1 
ATOM   2946  N  NZ    . LYS E 1  65   ? 306.394 321.541 246.398 1.00 59.44  ? 64   LYS E NZ    1 
ATOM   2947  N  N     . LEU E 1  66   ? 301.165 320.149 241.414 1.00 58.56  ? 65   LEU E N     1 
ATOM   2948  C  CA    . LEU E 1  66   ? 299.769 320.471 241.134 1.00 58.56  ? 65   LEU E CA    1 
ATOM   2949  C  C     . LEU E 1  66   ? 298.953 319.333 240.534 1.00 58.56  ? 65   LEU E C     1 
ATOM   2950  O  O     . LEU E 1  66   ? 297.819 319.144 240.988 1.00 58.56  ? 65   LEU E O     1 
ATOM   2951  C  CB    . LEU E 1  66   ? 299.655 321.698 240.236 1.00 58.56  ? 65   LEU E CB    1 
ATOM   2952  C  CG    . LEU E 1  66   ? 299.368 323.044 240.865 1.00 58.56  ? 65   LEU E CG    1 
ATOM   2953  C  CD1   . LEU E 1  66   ? 298.017 322.945 241.488 1.00 58.56  ? 65   LEU E CD1   1 
ATOM   2954  C  CD2   . LEU E 1  66   ? 300.388 323.401 241.889 1.00 58.56  ? 65   LEU E CD2   1 
ATOM   2955  N  N     . PRO E 1  67   ? 299.412 318.574 239.529 1.00 55.09  ? 66   PRO E N     1 
ATOM   2956  C  CA    . PRO E 1  67   ? 298.544 317.506 239.032 1.00 55.09  ? 66   PRO E CA    1 
ATOM   2957  C  C     . PRO E 1  67   ? 298.381 316.380 240.008 1.00 55.09  ? 66   PRO E C     1 
ATOM   2958  O  O     . PRO E 1  67   ? 297.320 315.755 240.045 1.00 55.09  ? 66   PRO E O     1 
ATOM   2959  C  CB    . PRO E 1  67   ? 299.266 317.035 237.775 1.00 55.09  ? 66   PRO E CB    1 
ATOM   2960  C  CG    . PRO E 1  67   ? 300.107 318.107 237.421 1.00 55.09  ? 66   PRO E CG    1 
ATOM   2961  C  CD    . PRO E 1  67   ? 300.597 318.631 238.676 1.00 55.09  ? 66   PRO E CD    1 
ATOM   2962  N  N     . PHE E 1  68   ? 299.392 316.122 240.825 1.00 55.14  ? 67   PHE E N     1 
ATOM   2963  C  CA    . PHE E 1  68   ? 299.245 315.117 241.857 1.00 55.14  ? 67   PHE E CA    1 
ATOM   2964  C  C     . PHE E 1  68   ? 298.266 315.570 242.910 1.00 55.14  ? 67   PHE E C     1 
ATOM   2965  O  O     . PHE E 1  68   ? 297.497 314.762 243.436 1.00 55.14  ? 67   PHE E O     1 
ATOM   2966  C  CB    . PHE E 1  68   ? 300.579 314.816 242.501 1.00 55.14  ? 67   PHE E CB    1 
ATOM   2967  C  CG    . PHE E 1  68   ? 300.561 313.594 243.318 1.00 55.14  ? 67   PHE E CG    1 
ATOM   2968  C  CD1   . PHE E 1  68   ? 300.775 312.377 242.740 1.00 55.14  ? 67   PHE E CD1   1 
ATOM   2969  C  CD2   . PHE E 1  68   ? 300.314 313.654 244.664 1.00 55.14  ? 67   PHE E CD2   1 
ATOM   2970  C  CE1   . PHE E 1  68   ? 300.752 311.249 243.484 1.00 55.14  ? 67   PHE E CE1   1 
ATOM   2971  C  CE2   . PHE E 1  68   ? 300.275 312.535 245.404 1.00 55.14  ? 67   PHE E CE2   1 
ATOM   2972  C  CZ    . PHE E 1  68   ? 300.504 311.330 244.818 1.00 55.14  ? 67   PHE E CZ    1 
ATOM   2973  N  N     . GLN E 1  69   ? 298.300 316.850 243.248 1.00 56.28  ? 68   GLN E N     1 
ATOM   2974  C  CA    . GLN E 1  69   ? 297.340 317.391 244.191 1.00 56.28  ? 68   GLN E CA    1 
ATOM   2975  C  C     . GLN E 1  69   ? 295.930 317.251 243.663 1.00 56.28  ? 68   GLN E C     1 
ATOM   2976  O  O     . GLN E 1  69   ? 295.043 316.777 244.370 1.00 56.28  ? 68   GLN E O     1 
ATOM   2977  C  CB    . GLN E 1  69   ? 297.673 318.842 244.462 1.00 56.28  ? 68   GLN E CB    1 
ATOM   2978  C  CG    . GLN E 1  69   ? 296.613 319.578 245.145 1.00 56.28  ? 68   GLN E CG    1 
ATOM   2979  C  CD    . GLN E 1  69   ? 297.120 320.878 245.667 1.00 56.28  ? 68   GLN E CD    1 
ATOM   2980  O  OE1   . GLN E 1  69   ? 297.689 321.671 244.926 1.00 56.28  ? 68   GLN E OE1   1 
ATOM   2981  N  NE2   . GLN E 1  69   ? 296.935 321.111 246.955 1.00 56.28  ? 68   GLN E NE2   1 
ATOM   2982  N  N     . ARG E 1  70   ? 295.730 317.564 242.388 1.00 57.26  ? 69   ARG E N     1 
ATOM   2983  C  CA    . ARG E 1  70   ? 294.396 317.470 241.814 1.00 57.26  ? 69   ARG E CA    1 
ATOM   2984  C  C     . ARG E 1  70   ? 293.938 316.029 241.689 1.00 57.26  ? 69   ARG E C     1 
ATOM   2985  O  O     . ARG E 1  70   ? 292.749 315.738 241.843 1.00 57.26  ? 69   ARG E O     1 
ATOM   2986  C  CB    . ARG E 1  70   ? 294.367 318.148 240.462 1.00 57.26  ? 69   ARG E CB    1 
ATOM   2987  C  CG    . ARG E 1  70   ? 294.342 319.620 240.578 1.00 57.26  ? 69   ARG E CG    1 
ATOM   2988  C  CD    . ARG E 1  70   ? 294.012 320.232 239.270 1.00 57.26  ? 69   ARG E CD    1 
ATOM   2989  N  NE    . ARG E 1  70   ? 295.212 320.559 238.536 1.00 57.26  ? 69   ARG E NE    1 
ATOM   2990  C  CZ    . ARG E 1  70   ? 295.690 319.818 237.556 1.00 57.26  ? 69   ARG E CZ    1 
ATOM   2991  N  NH1   . ARG E 1  70   ? 295.063 318.714 237.206 1.00 57.26  ? 69   ARG E NH1   1 
ATOM   2992  N  NH2   . ARG E 1  70   ? 296.788 320.184 236.924 1.00 57.26  ? 69   ARG E NH2   1 
ATOM   2993  N  N     . LEU E 1  71   ? 294.868 315.109 241.446 1.00 56.27  ? 70   LEU E N     1 
ATOM   2994  C  CA    . LEU E 1  71   ? 294.514 313.697 241.409 1.00 56.27  ? 70   LEU E CA    1 
ATOM   2995  C  C     . LEU E 1  71   ? 294.060 313.210 242.771 1.00 56.27  ? 70   LEU E C     1 
ATOM   2996  O  O     . LEU E 1  71   ? 293.033 312.532 242.881 1.00 56.27  ? 70   LEU E O     1 
ATOM   2997  C  CB    . LEU E 1  71   ? 295.699 312.876 240.933 1.00 56.27  ? 70   LEU E CB    1 
ATOM   2998  C  CG    . LEU E 1  71   ? 295.479 311.398 241.156 1.00 56.27  ? 70   LEU E CG    1 
ATOM   2999  C  CD1   . LEU E 1  71   ? 294.561 310.899 240.102 1.00 56.27  ? 70   LEU E CD1   1 
ATOM   3000  C  CD2   . LEU E 1  71   ? 296.750 310.638 241.165 1.00 56.27  ? 70   LEU E CD2   1 
ATOM   3001  N  N     . VAL E 1  72   ? 294.801 313.571 243.815 1.00 56.03  ? 71   VAL E N     1 
ATOM   3002  C  CA    . VAL E 1  72   ? 294.441 313.190 245.174 1.00 56.03  ? 71   VAL E CA    1 
ATOM   3003  C  C     . VAL E 1  72   ? 293.085 313.755 245.559 1.00 56.03  ? 71   VAL E C     1 
ATOM   3004  O  O     . VAL E 1  72   ? 292.272 313.066 246.184 1.00 56.03  ? 71   VAL E O     1 
ATOM   3005  C  CB    . VAL E 1  72   ? 295.553 313.643 246.127 1.00 56.03  ? 71   VAL E CB    1 
ATOM   3006  C  CG1   . VAL E 1  72   ? 295.118 313.588 247.540 1.00 56.03  ? 71   VAL E CG1   1 
ATOM   3007  C  CG2   . VAL E 1  72   ? 296.712 312.740 245.970 1.00 56.03  ? 71   VAL E CG2   1 
ATOM   3008  N  N     . ARG E 1  73   ? 292.776 314.970 245.115 1.00 57.24  ? 72   ARG E N     1 
ATOM   3009  C  CA    . ARG E 1  73   ? 291.460 315.509 245.429 1.00 57.24  ? 72   ARG E CA    1 
ATOM   3010  C  C     . ARG E 1  73   ? 290.372 314.821 244.632 1.00 57.24  ? 72   ARG E C     1 
ATOM   3011  O  O     . ARG E 1  73   ? 289.252 314.678 245.121 1.00 57.24  ? 72   ARG E O     1 
ATOM   3012  C  CB    . ARG E 1  73   ? 291.429 317.005 245.202 1.00 57.24  ? 72   ARG E CB    1 
ATOM   3013  C  CG    . ARG E 1  73   ? 292.479 317.655 245.993 1.00 57.24  ? 72   ARG E CG    1 
ATOM   3014  C  CD    . ARG E 1  73   ? 292.122 318.972 246.500 1.00 57.24  ? 72   ARG E CD    1 
ATOM   3015  N  NE    . ARG E 1  73   ? 293.267 319.484 247.222 1.00 57.24  ? 72   ARG E NE    1 
ATOM   3016  C  CZ    . ARG E 1  73   ? 293.211 320.505 248.052 1.00 57.24  ? 72   ARG E CZ    1 
ATOM   3017  N  NH1   . ARG E 1  73   ? 292.054 321.089 248.280 1.00 57.24  ? 72   ARG E NH1   1 
ATOM   3018  N  NH2   . ARG E 1  73   ? 294.304 320.918 248.666 1.00 57.24  ? 72   ARG E NH2   1 
ATOM   3019  N  N     . GLU E 1  74   ? 290.691 314.339 243.433 1.00 60.99  ? 73   GLU E N     1 
ATOM   3020  C  CA    . GLU E 1  74   ? 289.704 313.589 242.669 1.00 60.99  ? 73   GLU E CA    1 
ATOM   3021  C  C     . GLU E 1  74   ? 289.374 312.263 243.335 1.00 60.99  ? 73   GLU E C     1 
ATOM   3022  O  O     . GLU E 1  74   ? 288.198 311.899 243.466 1.00 60.99  ? 73   GLU E O     1 
ATOM   3023  C  CB    . GLU E 1  74   ? 290.209 313.358 241.253 1.00 60.99  ? 73   GLU E CB    1 
ATOM   3024  C  CG    . GLU E 1  74   ? 289.350 312.414 240.461 1.00 60.99  ? 73   GLU E CG    1 
ATOM   3025  C  CD    . GLU E 1  74   ? 289.828 312.219 239.044 1.00 60.99  ? 73   GLU E CD    1 
ATOM   3026  O  OE1   . GLU E 1  74   ? 290.581 311.256 238.794 1.00 60.99  ? 73   GLU E OE1   1 
ATOM   3027  O  OE2   . GLU E 1  74   ? 289.438 313.019 238.171 1.00 60.99  ? 73   GLU E OE2   1 
ATOM   3028  N  N     . ILE E 1  75   ? 290.395 311.548 243.795 1.00 59.70  ? 74   ILE E N     1 
ATOM   3029  C  CA    . ILE E 1  75   ? 290.169 310.275 244.473 1.00 59.70  ? 74   ILE E CA    1 
ATOM   3030  C  C     . ILE E 1  75   ? 289.412 310.489 245.778 1.00 59.70  ? 74   ILE E C     1 
ATOM   3031  O  O     . ILE E 1  75   ? 288.492 309.738 246.122 1.00 59.70  ? 74   ILE E O     1 
ATOM   3032  C  CB    . ILE E 1  75   ? 291.502 309.551 244.721 1.00 59.70  ? 74   ILE E CB    1 
ATOM   3033  C  CG1   . ILE E 1  75   ? 292.320 309.451 243.452 1.00 59.70  ? 74   ILE E CG1   1 
ATOM   3034  C  CG2   . ILE E 1  75   ? 291.244 308.180 245.208 1.00 59.70  ? 74   ILE E CG2   1 
ATOM   3035  C  CD1   . ILE E 1  75   ? 291.661 308.715 242.358 1.00 59.70  ? 74   ILE E CD1   1 
ATOM   3036  N  N     . ALA E 1  76   ? 289.756 311.540 246.503 1.00 62.72  ? 75   ALA E N     1 
ATOM   3037  C  CA    . ALA E 1  76   ? 289.101 311.749 247.778 1.00 62.72  ? 75   ALA E CA    1 
ATOM   3038  C  C     . ALA E 1  76   ? 287.679 312.243 247.629 1.00 62.72  ? 75   ALA E C     1 
ATOM   3039  O  O     . ALA E 1  76   ? 286.841 311.924 248.471 1.00 62.72  ? 75   ALA E O     1 
ATOM   3040  C  CB    . ALA E 1  76   ? 289.893 312.729 248.614 1.00 62.72  ? 75   ALA E CB    1 
ATOM   3041  N  N     . GLN E 1  77   ? 287.363 312.990 246.572 1.00 62.18  ? 76   GLN E N     1 
ATOM   3042  C  CA    . GLN E 1  77   ? 285.970 313.364 246.390 1.00 62.18  ? 76   GLN E CA    1 
ATOM   3043  C  C     . GLN E 1  77   ? 285.166 312.184 245.900 1.00 62.18  ? 76   GLN E C     1 
ATOM   3044  O  O     . GLN E 1  77   ? 283.938 312.214 245.960 1.00 62.18  ? 76   GLN E O     1 
ATOM   3045  C  CB    . GLN E 1  77   ? 285.817 314.528 245.421 1.00 62.18  ? 76   GLN E CB    1 
ATOM   3046  C  CG    . GLN E 1  77   ? 285.913 314.148 243.972 1.00 62.18  ? 76   GLN E CG    1 
ATOM   3047  C  CD    . GLN E 1  77   ? 285.920 315.343 243.057 1.00 62.18  ? 76   GLN E CD    1 
ATOM   3048  O  OE1   . GLN E 1  77   ? 285.857 316.483 243.510 1.00 62.18  ? 76   GLN E OE1   1 
ATOM   3049  N  NE2   . GLN E 1  77   ? 285.989 315.092 241.756 1.00 62.18  ? 76   GLN E NE2   1 
ATOM   3050  N  N     . ASP E 1  78   ? 285.828 311.146 245.397 1.00 63.59  ? 77   ASP E N     1 
ATOM   3051  C  CA    . ASP E 1  78   ? 285.117 309.893 245.198 1.00 63.59  ? 77   ASP E CA    1 
ATOM   3052  C  C     . ASP E 1  78   ? 284.755 309.234 246.522 1.00 63.59  ? 77   ASP E C     1 
ATOM   3053  O  O     . ASP E 1  78   ? 283.668 308.668 246.654 1.00 63.59  ? 77   ASP E O     1 
ATOM   3054  C  CB    . ASP E 1  78   ? 285.941 308.941 244.347 1.00 63.59  ? 77   ASP E CB    1 
ATOM   3055  C  CG    . ASP E 1  78   ? 285.135 308.309 243.263 1.00 63.59  ? 77   ASP E CG    1 
ATOM   3056  O  OD1   . ASP E 1  78   ? 284.249 307.500 243.588 1.00 63.59  ? 77   ASP E OD1   1 
ATOM   3057  O  OD2   . ASP E 1  78   ? 285.380 308.625 242.087 1.00 63.59  ? 77   ASP E OD2   1 
ATOM   3058  N  N     . PHE E 1  79   ? 285.639 309.287 247.513 1.00 62.79  ? 78   PHE E N     1 
ATOM   3059  C  CA    . PHE E 1  79   ? 285.258 308.629 248.756 1.00 62.79  ? 78   PHE E CA    1 
ATOM   3060  C  C     . PHE E 1  79   ? 284.338 309.487 249.608 1.00 62.79  ? 78   PHE E C     1 
ATOM   3061  O  O     . PHE E 1  79   ? 283.186 309.115 249.838 1.00 62.79  ? 78   PHE E O     1 
ATOM   3062  C  CB    . PHE E 1  79   ? 286.493 308.242 249.557 1.00 62.79  ? 78   PHE E CB    1 
ATOM   3063  C  CG    . PHE E 1  79   ? 287.238 307.120 248.964 1.00 62.79  ? 78   PHE E CG    1 
ATOM   3064  C  CD1   . PHE E 1  79   ? 286.771 305.837 249.077 1.00 62.79  ? 78   PHE E CD1   1 
ATOM   3065  C  CD2   . PHE E 1  79   ? 288.390 307.345 248.256 1.00 62.79  ? 78   PHE E CD2   1 
ATOM   3066  C  CE1   . PHE E 1  79   ? 287.451 304.795 248.509 1.00 62.79  ? 78   PHE E CE1   1 
ATOM   3067  C  CE2   . PHE E 1  79   ? 289.073 306.312 247.687 1.00 62.79  ? 78   PHE E CE2   1 
ATOM   3068  C  CZ    . PHE E 1  79   ? 288.603 305.036 247.814 1.00 62.79  ? 78   PHE E CZ    1 
ATOM   3069  N  N     . LYS E 1  80   ? 284.812 310.634 250.078 1.00 62.61  ? 79   LYS E N     1 
ATOM   3070  C  CA    . LYS E 1  80   ? 284.002 311.483 250.942 1.00 62.61  ? 79   LYS E CA    1 
ATOM   3071  C  C     . LYS E 1  80   ? 284.091 312.897 250.413 1.00 62.61  ? 79   LYS E C     1 
ATOM   3072  O  O     . LYS E 1  80   ? 285.184 313.455 250.323 1.00 62.61  ? 79   LYS E O     1 
ATOM   3073  C  CB    . LYS E 1  80   ? 284.473 311.407 252.387 1.00 62.61  ? 79   LYS E CB    1 
ATOM   3074  C  CG    . LYS E 1  80   ? 284.138 312.611 253.243 1.00 62.61  ? 79   LYS E CG    1 
ATOM   3075  C  CD    . LYS E 1  80   ? 282.702 312.619 253.717 1.00 62.61  ? 79   LYS E CD    1 
ATOM   3076  C  CE    . LYS E 1  80   ? 282.473 313.735 254.728 1.00 62.61  ? 79   LYS E CE    1 
ATOM   3077  N  NZ    . LYS E 1  80   ? 281.259 313.511 255.559 1.00 62.61  ? 79   LYS E NZ    1 
ATOM   3078  N  N     . THR E 1  81   ? 282.955 313.456 250.036 1.00 64.59  ? 80   THR E N     1 
ATOM   3079  C  CA    . THR E 1  81   ? 282.933 314.719 249.326 1.00 64.59  ? 80   THR E CA    1 
ATOM   3080  C  C     . THR E 1  81   ? 283.201 315.880 250.278 1.00 64.59  ? 80   THR E C     1 
ATOM   3081  O  O     . THR E 1  81   ? 282.965 315.783 251.483 1.00 64.59  ? 80   THR E O     1 
ATOM   3082  C  CB    . THR E 1  81   ? 281.598 314.852 248.575 1.00 64.59  ? 80   THR E CB    1 
ATOM   3083  O  OG1   . THR E 1  81   ? 281.832 314.996 247.168 1.00 64.59  ? 80   THR E OG1   1 
ATOM   3084  C  CG2   . THR E 1  81   ? 280.693 315.966 249.098 1.00 64.59  ? 80   THR E CG2   1 
ATOM   3085  N  N     . ASP E 1  82   ? 283.764 316.957 249.712 1.00 64.99  ? 81   ASP E N     1 
ATOM   3086  C  CA    . ASP E 1  82   ? 284.053 318.221 250.398 1.00 64.99  ? 81   ASP E CA    1 
ATOM   3087  C  C     . ASP E 1  82   ? 285.010 318.008 251.565 1.00 64.99  ? 81   ASP E C     1 
ATOM   3088  O  O     . ASP E 1  82   ? 284.684 318.203 252.731 1.00 64.99  ? 81   ASP E O     1 
ATOM   3089  C  CB    . ASP E 1  82   ? 282.771 318.926 250.843 1.00 64.99  ? 81   ASP E CB    1 
ATOM   3090  C  CG    . ASP E 1  82   ? 282.183 319.796 249.756 1.00 64.99  ? 81   ASP E CG    1 
ATOM   3091  O  OD1   . ASP E 1  82   ? 282.656 319.714 248.609 1.00 64.99  ? 81   ASP E OD1   1 
ATOM   3092  O  OD2   . ASP E 1  82   ? 281.259 320.575 250.046 1.00 64.99  ? 81   ASP E OD2   1 
ATOM   3093  N  N     . LEU E 1  83   ? 286.209 317.590 251.208 1.00 60.99  ? 82   LEU E N     1 
ATOM   3094  C  CA    . LEU E 1  83   ? 287.244 317.243 252.156 1.00 60.99  ? 82   LEU E CA    1 
ATOM   3095  C  C     . LEU E 1  83   ? 288.408 318.188 251.940 1.00 60.99  ? 82   LEU E C     1 
ATOM   3096  O  O     . LEU E 1  83   ? 288.841 318.391 250.806 1.00 60.99  ? 82   LEU E O     1 
ATOM   3097  C  CB    . LEU E 1  83   ? 287.672 315.803 251.943 1.00 60.99  ? 82   LEU E CB    1 
ATOM   3098  C  CG    . LEU E 1  83   ? 288.196 315.044 253.137 1.00 60.99  ? 82   LEU E CG    1 
ATOM   3099  C  CD1   . LEU E 1  83   ? 287.340 315.280 254.335 1.00 60.99  ? 82   LEU E CD1   1 
ATOM   3100  C  CD2   . LEU E 1  83   ? 288.157 313.609 252.778 1.00 60.99  ? 82   LEU E CD2   1 
ATOM   3101  N  N     . ARG E 1  84   ? 288.892 318.789 253.010 1.00 60.66  ? 83   ARG E N     1 
ATOM   3102  C  CA    . ARG E 1  84   ? 290.055 319.650 252.926 1.00 60.66  ? 83   ARG E CA    1 
ATOM   3103  C  C     . ARG E 1  84   ? 291.288 318.796 253.110 1.00 60.66  ? 83   ARG E C     1 
ATOM   3104  O  O     . ARG E 1  84   ? 291.247 317.794 253.819 1.00 60.66  ? 83   ARG E O     1 
ATOM   3105  C  CB    . ARG E 1  84   ? 289.997 320.746 253.974 1.00 60.66  ? 83   ARG E CB    1 
ATOM   3106  C  CG    . ARG E 1  84   ? 288.831 321.628 253.766 1.00 60.66  ? 83   ARG E CG    1 
ATOM   3107  C  CD    . ARG E 1  84   ? 288.768 322.710 254.791 1.00 60.66  ? 83   ARG E CD    1 
ATOM   3108  N  NE    . ARG E 1  84   ? 289.229 324.011 254.328 1.00 60.66  ? 83   ARG E NE    1 
ATOM   3109  C  CZ    . ARG E 1  84   ? 288.563 324.814 253.504 1.00 60.66  ? 83   ARG E CZ    1 
ATOM   3110  N  NH1   . ARG E 1  84   ? 287.385 324.467 253.011 1.00 60.66  ? 83   ARG E NH1   1 
ATOM   3111  N  NH2   . ARG E 1  84   ? 289.082 325.980 253.167 1.00 60.66  ? 83   ARG E NH2   1 
ATOM   3112  N  N     . PHE E 1  85   ? 292.369 319.170 252.456 1.00 59.35  ? 84   PHE E N     1 
ATOM   3113  C  CA    . PHE E 1  85   ? 293.613 318.449 252.594 1.00 59.35  ? 84   PHE E CA    1 
ATOM   3114  C  C     . PHE E 1  85   ? 294.676 319.353 253.163 1.00 59.35  ? 84   PHE E C     1 
ATOM   3115  O  O     . PHE E 1  85   ? 294.944 320.425 252.628 1.00 59.35  ? 84   PHE E O     1 
ATOM   3116  C  CB    . PHE E 1  85   ? 294.082 317.922 251.263 1.00 59.35  ? 84   PHE E CB    1 
ATOM   3117  C  CG    . PHE E 1  85   ? 293.591 316.588 250.970 1.00 59.35  ? 84   PHE E CG    1 
ATOM   3118  C  CD1   . PHE E 1  85   ? 292.317 316.410 250.516 1.00 59.35  ? 84   PHE E CD1   1 
ATOM   3119  C  CD2   . PHE E 1  85   ? 294.399 315.502 251.157 1.00 59.35  ? 84   PHE E CD2   1 
ATOM   3120  C  CE1   . PHE E 1  85   ? 291.861 315.181 250.245 1.00 59.35  ? 84   PHE E CE1   1 
ATOM   3121  C  CE2   . PHE E 1  85   ? 293.947 314.266 250.889 1.00 59.35  ? 84   PHE E CE2   1 
ATOM   3122  C  CZ    . PHE E 1  85   ? 292.673 314.102 250.430 1.00 59.35  ? 84   PHE E CZ    1 
ATOM   3123  N  N     . GLN E 1  86   ? 295.270 318.914 254.252 1.00 58.15  ? 85   GLN E N     1 
ATOM   3124  C  CA    . GLN E 1  86   ? 296.454 319.548 254.780 1.00 58.15  ? 85   GLN E CA    1 
ATOM   3125  C  C     . GLN E 1  86   ? 297.559 319.458 253.744 1.00 58.15  ? 85   GLN E C     1 
ATOM   3126  O  O     . GLN E 1  86   ? 297.673 318.460 253.036 1.00 58.15  ? 85   GLN E O     1 
ATOM   3127  C  CB    . GLN E 1  86   ? 296.851 318.859 256.072 1.00 58.15  ? 85   GLN E CB    1 
ATOM   3128  C  CG    . GLN E 1  86   ? 297.952 319.486 256.807 1.00 58.15  ? 85   GLN E CG    1 
ATOM   3129  C  CD    . GLN E 1  86   ? 297.798 319.242 258.256 1.00 58.15  ? 85   GLN E CD    1 
ATOM   3130  O  OE1   . GLN E 1  86   ? 296.710 319.378 258.790 1.00 58.15  ? 85   GLN E OE1   1 
ATOM   3131  N  NE2   . GLN E 1  86   ? 298.875 318.861 258.914 1.00 58.15  ? 85   GLN E NE2   1 
ATOM   3132  N  N     . SER E 1  87   ? 298.329 320.533 253.611 1.00 58.40  ? 86   SER E N     1 
ATOM   3133  C  CA    . SER E 1  87   ? 299.353 320.591 252.580 1.00 58.40  ? 86   SER E CA    1 
ATOM   3134  C  C     . SER E 1  87   ? 300.448 319.576 252.825 1.00 58.40  ? 86   SER E C     1 
ATOM   3135  O  O     . SER E 1  87   ? 301.013 319.017 251.878 1.00 58.40  ? 86   SER E O     1 
ATOM   3136  C  CB    . SER E 1  87   ? 299.949 321.983 252.533 1.00 58.40  ? 86   SER E CB    1 
ATOM   3137  O  OG    . SER E 1  87   ? 301.237 321.957 253.111 1.00 58.40  ? 86   SER E OG    1 
ATOM   3138  N  N     . ALA E 1  88   ? 300.744 319.307 254.089 1.00 55.89  ? 87   ALA E N     1 
ATOM   3139  C  CA    . ALA E 1  88   ? 301.693 318.261 254.415 1.00 55.89  ? 87   ALA E CA    1 
ATOM   3140  C  C     . ALA E 1  88   ? 301.154 316.892 254.053 1.00 55.89  ? 87   ALA E C     1 
ATOM   3141  O  O     . ALA E 1  88   ? 301.934 315.978 253.789 1.00 55.89  ? 87   ALA E O     1 
ATOM   3142  C  CB    . ALA E 1  88   ? 302.045 318.321 255.893 1.00 55.89  ? 87   ALA E CB    1 
ATOM   3143  N  N     . ALA E 1  89   ? 299.834 316.732 253.984 1.00 54.37  ? 88   ALA E N     1 
ATOM   3144  C  CA    . ALA E 1  89   ? 299.288 315.425 253.649 1.00 54.37  ? 88   ALA E CA    1 
ATOM   3145  C  C     . ALA E 1  89   ? 299.464 315.112 252.182 1.00 54.37  ? 88   ALA E C     1 
ATOM   3146  O  O     . ALA E 1  89   ? 299.753 313.972 251.822 1.00 54.37  ? 88   ALA E O     1 
ATOM   3147  C  CB    . ALA E 1  89   ? 297.820 315.343 254.016 1.00 54.37  ? 88   ALA E CB    1 
ATOM   3148  N  N     . ILE E 1  90   ? 299.300 316.104 251.319 1.00 55.59  ? 89   ILE E N     1 
ATOM   3149  C  CA    . ILE E 1  90   ? 299.546 315.873 249.904 1.00 55.59  ? 89   ILE E CA    1 
ATOM   3150  C  C     . ILE E 1  90   ? 301.026 315.668 249.657 1.00 55.59  ? 89   ILE E C     1 
ATOM   3151  O  O     . ILE E 1  90   ? 301.419 314.833 248.833 1.00 55.59  ? 89   ILE E O     1 
ATOM   3152  C  CB    . ILE E 1  90   ? 298.974 317.034 249.089 1.00 55.59  ? 89   ILE E CB    1 
ATOM   3153  C  CG1   . ILE E 1  90   ? 297.469 317.034 249.249 1.00 55.59  ? 89   ILE E CG1   1 
ATOM   3154  C  CG2   . ILE E 1  90   ? 299.318 316.906 247.644 1.00 55.59  ? 89   ILE E CG2   1 
ATOM   3155  C  CD1   . ILE E 1  90   ? 296.808 318.224 248.678 1.00 55.59  ? 89   ILE E CD1   1 
ATOM   3156  N  N     . GLY E 1  91   ? 301.869 316.383 250.407 1.00 55.29  ? 90   GLY E N     1 
ATOM   3157  C  CA    . GLY E 1  91   ? 303.294 316.109 250.367 1.00 55.29  ? 90   GLY E CA    1 
ATOM   3158  C  C     . GLY E 1  91   ? 303.619 314.681 250.753 1.00 55.29  ? 90   GLY E C     1 
ATOM   3159  O  O     . GLY E 1  91   ? 304.377 314.007 250.060 1.00 55.29  ? 90   GLY E O     1 
ATOM   3160  N  N     . ALA E 1  92   ? 302.962 314.171 251.794 1.00 54.19  ? 91   ALA E N     1 
ATOM   3161  C  CA    . ALA E 1  92   ? 303.227 312.817 252.267 1.00 54.19  ? 91   ALA E CA    1 
ATOM   3162  C  C     . ALA E 1  92   ? 302.746 311.773 251.277 1.00 54.19  ? 91   ALA E C     1 
ATOM   3163  O  O     . ALA E 1  92   ? 303.414 310.757 251.053 1.00 54.19  ? 91   ALA E O     1 
ATOM   3164  C  CB    . ALA E 1  92   ? 302.557 312.603 253.615 1.00 54.19  ? 91   ALA E CB    1 
ATOM   3165  N  N     . LEU E 1  93   ? 301.589 312.014 250.672 1.00 55.21  ? 92   LEU E N     1 
ATOM   3166  C  CA    . LEU E 1  93   ? 301.080 311.109 249.657 1.00 55.21  ? 92   LEU E CA    1 
ATOM   3167  C  C     . LEU E 1  93   ? 301.976 311.091 248.446 1.00 55.21  ? 92   LEU E C     1 
ATOM   3168  O  O     . LEU E 1  93   ? 302.148 310.049 247.814 1.00 55.21  ? 92   LEU E O     1 
ATOM   3169  C  CB    . LEU E 1  93   ? 299.684 311.523 249.250 1.00 55.21  ? 92   LEU E CB    1 
ATOM   3170  C  CG    . LEU E 1  93   ? 298.625 310.878 250.107 1.00 55.21  ? 92   LEU E CG    1 
ATOM   3171  C  CD1   . LEU E 1  93   ? 297.328 311.575 249.893 1.00 55.21  ? 92   LEU E CD1   1 
ATOM   3172  C  CD2   . LEU E 1  93   ? 298.520 309.441 249.728 1.00 55.21  ? 92   LEU E CD2   1 
ATOM   3173  N  N     . GLN E 1  94   ? 302.587 312.224 248.123 1.00 56.11  ? 93   GLN E N     1 
ATOM   3174  C  CA    . GLN E 1  94   ? 303.464 312.254 246.966 1.00 56.11  ? 93   GLN E CA    1 
ATOM   3175  C  C     . GLN E 1  94   ? 304.757 311.514 247.237 1.00 56.11  ? 93   GLN E C     1 
ATOM   3176  O  O     . GLN E 1  94   ? 305.250 310.795 246.361 1.00 56.11  ? 93   GLN E O     1 
ATOM   3177  C  CB    . GLN E 1  94   ? 303.745 313.678 246.551 1.00 56.11  ? 93   GLN E CB    1 
ATOM   3178  C  CG    . GLN E 1  94   ? 304.376 313.732 245.222 1.00 56.11  ? 93   GLN E CG    1 
ATOM   3179  C  CD    . GLN E 1  94   ? 304.371 315.091 244.643 1.00 56.11  ? 93   GLN E CD    1 
ATOM   3180  O  OE1   . GLN E 1  94   ? 305.056 315.354 243.666 1.00 56.11  ? 93   GLN E OE1   1 
ATOM   3181  N  NE2   . GLN E 1  94   ? 303.602 315.979 245.234 1.00 56.11  ? 93   GLN E NE2   1 
ATOM   3182  N  N     . GLU E 1  95   ? 305.305 311.652 248.451 1.00 58.67  ? 94   GLU E N     1 
ATOM   3183  C  CA    . GLU E 1  95   ? 306.497 310.883 248.802 1.00 58.67  ? 94   GLU E CA    1 
ATOM   3184  C  C     . GLU E 1  95   ? 306.216 309.401 248.747 1.00 58.67  ? 94   GLU E C     1 
ATOM   3185  O  O     . GLU E 1  95   ? 306.998 308.636 248.182 1.00 58.67  ? 94   GLU E O     1 
ATOM   3186  C  CB    . GLU E 1  95   ? 307.008 311.184 250.204 1.00 58.67  ? 94   GLU E CB    1 
ATOM   3187  C  CG    . GLU E 1  95   ? 307.104 312.581 250.712 1.00 58.67  ? 94   GLU E CG    1 
ATOM   3188  C  CD    . GLU E 1  95   ? 308.045 313.478 249.982 1.00 58.67  ? 94   GLU E CD    1 
ATOM   3189  O  OE1   . GLU E 1  95   ? 307.772 313.808 248.826 1.00 58.67  ? 94   GLU E OE1   1 
ATOM   3190  O  OE2   . GLU E 1  95   ? 309.077 313.860 250.561 1.00 58.67  ? 94   GLU E OE2   1 
ATOM   3191  N  N     . ALA E 1  96   ? 305.087 308.983 249.306 1.00 56.06  ? 95   ALA E N     1 
ATOM   3192  C  CA    . ALA E 1  96   ? 304.818 307.562 249.399 1.00 56.06  ? 95   ALA E CA    1 
ATOM   3193  C  C     . ALA E 1  96   ? 304.484 306.973 248.047 1.00 56.06  ? 95   ALA E C     1 
ATOM   3194  O  O     . ALA E 1  96   ? 304.912 305.861 247.736 1.00 56.06  ? 95   ALA E O     1 
ATOM   3195  C  CB    . ALA E 1  96   ? 303.690 307.304 250.374 1.00 56.06  ? 95   ALA E CB    1 
ATOM   3196  N  N     . SER E 1  97   ? 303.753 307.709 247.216 1.00 55.52  ? 96   SER E N     1 
ATOM   3197  C  CA    . SER E 1  97   ? 303.404 307.189 245.908 1.00 55.52  ? 96   SER E CA    1 
ATOM   3198  C  C     . SER E 1  97   ? 304.618 307.115 245.010 1.00 55.52  ? 96   SER E C     1 
ATOM   3199  O  O     . SER E 1  97   ? 304.803 306.127 244.297 1.00 55.52  ? 96   SER E O     1 
ATOM   3200  C  CB    . SER E 1  97   ? 302.335 308.054 245.278 1.00 55.52  ? 96   SER E CB    1 
ATOM   3201  O  OG    . SER E 1  97   ? 301.337 308.335 246.228 1.00 55.52  ? 96   SER E OG    1 
ATOM   3202  N  N     . GLU E 1  98   ? 305.481 308.124 245.065 1.00 55.68  ? 97   GLU E N     1 
ATOM   3203  C  CA    . GLU E 1  98   ? 306.687 308.080 244.261 1.00 55.68  ? 97   GLU E CA    1 
ATOM   3204  C  C     . GLU E 1  98   ? 307.630 306.995 244.739 1.00 55.68  ? 97   GLU E C     1 
ATOM   3205  O  O     . GLU E 1  98   ? 308.251 306.319 243.920 1.00 55.68  ? 97   GLU E O     1 
ATOM   3206  C  CB    . GLU E 1  98   ? 307.375 309.426 244.293 1.00 55.68  ? 97   GLU E CB    1 
ATOM   3207  C  CG    . GLU E 1  98   ? 306.909 310.331 243.207 1.00 55.68  ? 97   GLU E CG    1 
ATOM   3208  C  CD    . GLU E 1  98   ? 307.421 311.729 243.382 1.00 55.68  ? 97   GLU E CD    1 
ATOM   3209  O  OE1   . GLU E 1  98   ? 306.682 312.683 243.075 1.00 55.68  ? 97   GLU E OE1   1 
ATOM   3210  O  OE2   . GLU E 1  98   ? 308.570 311.873 243.828 1.00 55.68  ? 97   GLU E OE2   1 
ATOM   3211  N  N     . ALA E 1  99   ? 307.721 306.784 246.050 1.00 54.28  ? 98   ALA E N     1 
ATOM   3212  C  CA    . ALA E 1  99   ? 308.600 305.753 246.581 1.00 54.28  ? 98   ALA E CA    1 
ATOM   3213  C  C     . ALA E 1  99   ? 308.096 304.372 246.227 1.00 54.28  ? 98   ALA E C     1 
ATOM   3214  O  O     . ALA E 1  99   ? 308.880 303.476 245.890 1.00 54.28  ? 98   ALA E O     1 
ATOM   3215  C  CB    . ALA E 1  99   ? 308.709 305.898 248.091 1.00 54.28  ? 98   ALA E CB    1 
ATOM   3216  N  N     . TYR E 1  100  ? 306.778 304.191 246.281 1.00 55.38  ? 99   TYR E N     1 
ATOM   3217  C  CA    . TYR E 1  100  ? 306.172 302.943 245.857 1.00 55.38  ? 99   TYR E CA    1 
ATOM   3218  C  C     . TYR E 1  100  ? 306.430 302.683 244.393 1.00 55.38  ? 99   TYR E C     1 
ATOM   3219  O  O     . TYR E 1  100  ? 306.716 301.549 243.998 1.00 55.38  ? 99   TYR E O     1 
ATOM   3220  C  CB    . TYR E 1  100  ? 304.682 302.990 246.116 1.00 55.38  ? 99   TYR E CB    1 
ATOM   3221  C  CG    . TYR E 1  100  ? 303.938 301.848 245.515 1.00 55.38  ? 99   TYR E CG    1 
ATOM   3222  C  CD1   . TYR E 1  100  ? 304.012 300.597 246.074 1.00 55.38  ? 99   TYR E CD1   1 
ATOM   3223  C  CD2   . TYR E 1  100  ? 303.142 302.023 244.405 1.00 55.38  ? 99   TYR E CD2   1 
ATOM   3224  C  CE1   . TYR E 1  100  ? 303.327 299.554 245.543 1.00 55.38  ? 99   TYR E CE1   1 
ATOM   3225  C  CE2   . TYR E 1  100  ? 302.460 300.983 243.860 1.00 55.38  ? 99   TYR E CE2   1 
ATOM   3226  C  CZ    . TYR E 1  100  ? 302.556 299.751 244.435 1.00 55.38  ? 99   TYR E CZ    1 
ATOM   3227  O  OH    . TYR E 1  100  ? 301.868 298.698 243.896 1.00 55.38  ? 99   TYR E OH    1 
ATOM   3228  N  N     . LEU E 1  101  ? 306.373 303.726 243.575 1.00 52.89  ? 100  LEU E N     1 
ATOM   3229  C  CA    . LEU E 1  101  ? 306.553 303.518 242.150 1.00 52.89  ? 100  LEU E CA    1 
ATOM   3230  C  C     . LEU E 1  101  ? 307.995 303.222 241.803 1.00 52.89  ? 100  LEU E C     1 
ATOM   3231  O  O     . LEU E 1  101  ? 308.250 302.421 240.908 1.00 52.89  ? 100  LEU E O     1 
ATOM   3232  C  CB    . LEU E 1  101  ? 306.049 304.717 241.378 1.00 52.89  ? 100  LEU E CB    1 
ATOM   3233  C  CG    . LEU E 1  101  ? 304.536 304.679 241.294 1.00 52.89  ? 100  LEU E CG    1 
ATOM   3234  C  CD1   . LEU E 1  101  ? 304.041 305.894 240.606 1.00 52.89  ? 100  LEU E CD1   1 
ATOM   3235  C  CD2   . LEU E 1  101  ? 304.096 303.462 240.554 1.00 52.89  ? 100  LEU E CD2   1 
ATOM   3236  N  N     . VAL E 1  102  ? 308.959 303.806 242.513 1.00 53.59  ? 101  VAL E N     1 
ATOM   3237  C  CA    . VAL E 1  102  ? 310.331 303.492 242.132 1.00 53.59  ? 101  VAL E CA    1 
ATOM   3238  C  C     . VAL E 1  102  ? 310.705 302.117 242.643 1.00 53.59  ? 101  VAL E C     1 
ATOM   3239  O  O     . VAL E 1  102  ? 311.487 301.407 242.007 1.00 53.59  ? 101  VAL E O     1 
ATOM   3240  C  CB    . VAL E 1  102  ? 311.344 304.534 242.621 1.00 53.59  ? 101  VAL E CB    1 
ATOM   3241  C  CG1   . VAL E 1  102  ? 311.438 305.659 241.661 1.00 53.59  ? 101  VAL E CG1   1 
ATOM   3242  C  CG2   . VAL E 1  102  ? 311.129 304.953 244.010 1.00 53.59  ? 101  VAL E CG2   1 
ATOM   3243  N  N     . GLY E 1  103  ? 310.145 301.701 243.783 1.00 53.32  ? 102  GLY E N     1 
ATOM   3244  C  CA    . GLY E 1  103  ? 310.378 300.340 244.237 1.00 53.32  ? 102  GLY E CA    1 
ATOM   3245  C  C     . GLY E 1  103  ? 309.777 299.322 243.294 1.00 53.32  ? 102  GLY E C     1 
ATOM   3246  O  O     . GLY E 1  103  ? 310.405 298.306 242.963 1.00 53.32  ? 102  GLY E O     1 
ATOM   3247  N  N     . LEU E 1  104  ? 308.580 299.615 242.800 1.00 54.50  ? 103  LEU E N     1 
ATOM   3248  C  CA    . LEU E 1  104  ? 307.957 298.761 241.808 1.00 54.50  ? 103  LEU E CA    1 
ATOM   3249  C  C     . LEU E 1  104  ? 308.762 298.734 240.523 1.00 54.50  ? 103  LEU E C     1 
ATOM   3250  O  O     . LEU E 1  104  ? 308.899 297.685 239.906 1.00 54.50  ? 103  LEU E O     1 
ATOM   3251  C  CB    . LEU E 1  104  ? 306.539 299.236 241.546 1.00 54.50  ? 103  LEU E CB    1 
ATOM   3252  C  CG    . LEU E 1  104  ? 305.797 298.562 240.415 1.00 54.50  ? 103  LEU E CG    1 
ATOM   3253  C  CD1   . LEU E 1  104  ? 305.297 297.242 240.872 1.00 54.50  ? 103  LEU E CD1   1 
ATOM   3254  C  CD2   . LEU E 1  104  ? 304.662 299.432 239.980 1.00 54.50  ? 103  LEU E CD2   1 
ATOM   3255  N  N     . PHE E 1  105  ? 309.358 299.855 240.138 1.00 52.82  ? 104  PHE E N     1 
ATOM   3256  C  CA    . PHE E 1  105  ? 310.091 299.871 238.882 1.00 52.82  ? 104  PHE E CA    1 
ATOM   3257  C  C     . PHE E 1  105  ? 311.423 299.156 238.999 1.00 52.82  ? 104  PHE E C     1 
ATOM   3258  O  O     . PHE E 1  105  ? 311.906 298.591 238.017 1.00 52.82  ? 104  PHE E O     1 
ATOM   3259  C  CB    . PHE E 1  105  ? 310.285 301.293 238.416 1.00 52.82  ? 104  PHE E CB    1 
ATOM   3260  C  CG    . PHE E 1  105  ? 309.168 301.785 237.606 1.00 52.82  ? 104  PHE E CG    1 
ATOM   3261  C  CD1   . PHE E 1  105  ? 308.649 301.003 236.617 1.00 52.82  ? 104  PHE E CD1   1 
ATOM   3262  C  CD2   . PHE E 1  105  ? 308.626 303.018 237.834 1.00 52.82  ? 104  PHE E CD2   1 
ATOM   3263  C  CE1   . PHE E 1  105  ? 307.617 301.442 235.866 1.00 52.82  ? 104  PHE E CE1   1 
ATOM   3264  C  CE2   . PHE E 1  105  ? 307.589 303.458 237.091 1.00 52.82  ? 104  PHE E CE2   1 
ATOM   3265  C  CZ    . PHE E 1  105  ? 307.083 302.669 236.105 1.00 52.82  ? 104  PHE E CZ    1 
ATOM   3266  N  N     . GLU E 1  106  ? 312.017 299.146 240.191 1.00 55.79  ? 105  GLU E N     1 
ATOM   3267  C  CA    . GLU E 1  106  ? 313.153 298.266 240.434 1.00 55.79  ? 105  GLU E CA    1 
ATOM   3268  C  C     . GLU E 1  106  ? 312.763 296.818 240.254 1.00 55.79  ? 105  GLU E C     1 
ATOM   3269  O  O     . GLU E 1  106  ? 313.480 296.049 239.602 1.00 55.79  ? 105  GLU E O     1 
ATOM   3270  C  CB    . GLU E 1  106  ? 313.690 298.457 241.841 1.00 55.79  ? 105  GLU E CB    1 
ATOM   3271  C  CG    . GLU E 1  106  ? 314.280 299.793 242.112 1.00 55.79  ? 105  GLU E CG    1 
ATOM   3272  C  CD    . GLU E 1  106  ? 315.201 299.767 243.297 1.00 55.79  ? 105  GLU E CD    1 
ATOM   3273  O  OE1   . GLU E 1  106  ? 315.020 298.882 244.153 1.00 55.79  ? 105  GLU E OE1   1 
ATOM   3274  O  OE2   . GLU E 1  106  ? 316.098 300.631 243.383 1.00 55.79  ? 105  GLU E OE2   1 
ATOM   3275  N  N     . ASP E 1  107  ? 311.614 296.433 240.807 1.00 55.98  ? 106  ASP E N     1 
ATOM   3276  C  CA    . ASP E 1  107  ? 311.194 295.042 240.699 1.00 55.98  ? 106  ASP E CA    1 
ATOM   3277  C  C     . ASP E 1  107  ? 310.859 294.658 239.266 1.00 55.98  ? 106  ASP E C     1 
ATOM   3278  O  O     . ASP E 1  107  ? 311.217 293.568 238.816 1.00 55.98  ? 106  ASP E O     1 
ATOM   3279  C  CB    . ASP E 1  107  ? 310.014 294.786 241.619 1.00 55.98  ? 106  ASP E CB    1 
ATOM   3280  C  CG    . ASP E 1  107  ? 310.341 295.082 243.054 1.00 55.98  ? 106  ASP E CG    1 
ATOM   3281  O  OD1   . ASP E 1  107  ? 311.538 295.189 243.371 1.00 55.98  ? 106  ASP E OD1   1 
ATOM   3282  O  OD2   . ASP E 1  107  ? 309.408 295.207 243.871 1.00 55.98  ? 106  ASP E OD2   1 
ATOM   3283  N  N     . THR E 1  108  ? 310.218 295.544 238.514 1.00 53.03  ? 107  THR E N     1 
ATOM   3284  C  CA    . THR E 1  108  ? 309.916 295.179 237.139 1.00 53.03  ? 107  THR E CA    1 
ATOM   3285  C  C     . THR E 1  108  ? 311.145 295.254 236.266 1.00 53.03  ? 107  THR E C     1 
ATOM   3286  O  O     . THR E 1  108  ? 311.196 294.609 235.221 1.00 53.03  ? 107  THR E O     1 
ATOM   3287  C  CB    . THR E 1  108  ? 308.832 296.040 236.537 1.00 53.03  ? 107  THR E CB    1 
ATOM   3288  O  OG1   . THR E 1  108  ? 309.358 297.330 236.255 1.00 53.03  ? 107  THR E OG1   1 
ATOM   3289  C  CG2   . THR E 1  108  ? 307.693 296.138 237.441 1.00 53.03  ? 107  THR E CG2   1 
ATOM   3290  N  N     . ASN E 1  109  ? 312.156 296.005 236.672 1.00 50.90  ? 108  ASN E N     1 
ATOM   3291  C  CA    . ASN E 1  109  ? 313.402 295.914 235.938 1.00 50.90  ? 108  ASN E CA    1 
ATOM   3292  C  C     . ASN E 1  109  ? 314.061 294.574 236.171 1.00 50.90  ? 108  ASN E C     1 
ATOM   3293  O  O     . ASN E 1  109  ? 314.664 294.012 235.257 1.00 50.90  ? 108  ASN E O     1 
ATOM   3294  C  CB    . ASN E 1  109  ? 314.343 297.032 236.323 1.00 50.90  ? 108  ASN E CB    1 
ATOM   3295  C  CG    . ASN E 1  109  ? 315.385 297.246 235.293 1.00 50.90  ? 108  ASN E CG    1 
ATOM   3296  O  OD1   . ASN E 1  109  ? 315.218 296.842 234.149 1.00 50.90  ? 108  ASN E OD1   1 
ATOM   3297  N  ND2   . ASN E 1  109  ? 316.478 297.883 235.675 1.00 50.90  ? 108  ASN E ND2   1 
ATOM   3298  N  N     . LEU E 1  110  ? 313.927 294.031 237.378 1.00 50.23  ? 109  LEU E N     1 
ATOM   3299  C  CA    . LEU E 1  110  ? 314.425 292.684 237.620 1.00 50.23  ? 109  LEU E CA    1 
ATOM   3300  C  C     . LEU E 1  110  ? 313.651 291.660 236.814 1.00 50.23  ? 109  LEU E C     1 
ATOM   3301  O  O     . LEU E 1  110  ? 314.235 290.712 236.278 1.00 50.23  ? 109  LEU E O     1 
ATOM   3302  C  CB    . LEU E 1  110  ? 314.339 292.345 239.094 1.00 50.23  ? 109  LEU E CB    1 
ATOM   3303  C  CG    . LEU E 1  110  ? 315.262 293.181 239.944 1.00 50.23  ? 109  LEU E CG    1 
ATOM   3304  C  CD1   . LEU E 1  110  ? 315.036 292.829 241.376 1.00 50.23  ? 109  LEU E CD1   1 
ATOM   3305  C  CD2   . LEU E 1  110  ? 316.674 292.905 239.545 1.00 50.23  ? 109  LEU E CD2   1 
ATOM   3306  N  N     . CYS E 1  111  ? 312.339 291.847 236.705 1.00 52.34  ? 110  CYS E N     1 
ATOM   3307  C  CA    . CYS E 1  111  ? 311.526 290.921 235.929 1.00 52.34  ? 110  CYS E CA    1 
ATOM   3308  C  C     . CYS E 1  111  ? 311.847 291.007 234.450 1.00 52.34  ? 110  CYS E C     1 
ATOM   3309  O  O     . CYS E 1  111  ? 311.802 290.002 233.742 1.00 52.34  ? 110  CYS E O     1 
ATOM   3310  C  CB    . CYS E 1  111  ? 310.049 291.198 236.145 1.00 52.34  ? 110  CYS E CB    1 
ATOM   3311  S  SG    . CYS E 1  111  ? 309.500 291.064 237.810 1.00 52.34  ? 110  CYS E SG    1 
ATOM   3312  N  N     . ALA E 1  112  ? 312.169 292.195 233.961 1.00 52.25  ? 111  ALA E N     1 
ATOM   3313  C  CA    . ALA E 1  112  ? 312.470 292.325 232.550 1.00 52.25  ? 111  ALA E CA    1 
ATOM   3314  C  C     . ALA E 1  112  ? 313.846 291.786 232.232 1.00 52.25  ? 111  ALA E C     1 
ATOM   3315  O  O     . ALA E 1  112  ? 314.048 291.203 231.168 1.00 52.25  ? 111  ALA E O     1 
ATOM   3316  C  CB    . ALA E 1  112  ? 312.363 293.771 232.120 1.00 52.25  ? 111  ALA E CB    1 
ATOM   3317  N  N     . ILE E 1  113  ? 314.802 291.969 233.139 1.00 51.08  ? 112  ILE E N     1 
ATOM   3318  C  CA    . ILE E 1  113  ? 316.124 291.384 232.960 1.00 51.08  ? 112  ILE E CA    1 
ATOM   3319  C  C     . ILE E 1  113  ? 316.036 289.869 232.989 1.00 51.08  ? 112  ILE E C     1 
ATOM   3320  O  O     . ILE E 1  113  ? 316.706 289.177 232.218 1.00 51.08  ? 112  ILE E O     1 
ATOM   3321  C  CB    . ILE E 1  113  ? 317.066 291.938 234.038 1.00 51.08  ? 112  ILE E CB    1 
ATOM   3322  C  CG1   . ILE E 1  113  ? 317.440 293.374 233.717 1.00 51.08  ? 112  ILE E CG1   1 
ATOM   3323  C  CG2   . ILE E 1  113  ? 318.322 291.146 234.139 1.00 51.08  ? 112  ILE E CG2   1 
ATOM   3324  C  CD1   . ILE E 1  113  ? 318.027 293.549 232.360 1.00 51.08  ? 112  ILE E CD1   1 
ATOM   3325  N  N     . HIS E 1  114  ? 315.138 289.341 233.821 1.00 52.20  ? 113  HIS E N     1 
ATOM   3326  C  CA    . HIS E 1  114  ? 314.954 287.902 233.934 1.00 52.20  ? 113  HIS E CA    1 
ATOM   3327  C  C     . HIS E 1  114  ? 314.434 287.285 232.654 1.00 52.20  ? 113  HIS E C     1 
ATOM   3328  O  O     . HIS E 1  114  ? 314.774 286.149 232.333 1.00 52.20  ? 113  HIS E O     1 
ATOM   3329  C  CB    . HIS E 1  114  ? 313.988 287.598 235.053 1.00 52.20  ? 113  HIS E CB    1 
ATOM   3330  C  CG    . HIS E 1  114  ? 313.833 286.146 235.320 1.00 52.20  ? 113  HIS E CG    1 
ATOM   3331  N  ND1   . HIS E 1  114  ? 314.654 285.466 236.187 1.00 52.20  ? 113  HIS E ND1   1 
ATOM   3332  C  CD2   . HIS E 1  114  ? 312.945 285.243 234.857 1.00 52.20  ? 113  HIS E CD2   1 
ATOM   3333  C  CE1   . HIS E 1  114  ? 314.285 284.204 236.239 1.00 52.20  ? 113  HIS E CE1   1 
ATOM   3334  N  NE2   . HIS E 1  114  ? 313.250 284.041 235.438 1.00 52.20  ? 113  HIS E NE2   1 
ATOM   3335  N  N     . ALA E 1  115  ? 313.633 288.010 231.909 1.00 51.64  ? 114  ALA E N     1 
ATOM   3336  C  CA    . ALA E 1  115  ? 313.134 287.495 230.647 1.00 51.64  ? 114  ALA E CA    1 
ATOM   3337  C  C     . ALA E 1  115  ? 314.060 287.753 229.507 1.00 51.64  ? 114  ALA E C     1 
ATOM   3338  O  O     . ALA E 1  115  ? 313.632 287.590 228.368 1.00 51.64  ? 114  ALA E O     1 
ATOM   3339  C  CB    . ALA E 1  115  ? 311.771 288.098 230.337 1.00 51.64  ? 114  ALA E CB    1 
ATOM   3340  N  N     . LYS E 1  116  ? 315.290 288.166 229.817 1.00 51.80  ? 115  LYS E N     1 
ATOM   3341  C  CA    . LYS E 1  116  ? 316.361 288.408 228.858 1.00 51.80  ? 115  LYS E CA    1 
ATOM   3342  C  C     . LYS E 1  116  ? 315.972 289.490 227.861 1.00 51.80  ? 115  LYS E C     1 
ATOM   3343  O  O     . LYS E 1  116  ? 316.042 289.305 226.653 1.00 51.80  ? 115  LYS E O     1 
ATOM   3344  C  CB    . LYS E 1  116  ? 316.777 287.121 228.148 1.00 51.80  ? 115  LYS E CB    1 
ATOM   3345  C  CG    . LYS E 1  116  ? 317.502 286.150 229.046 1.00 51.80  ? 115  LYS E CG    1 
ATOM   3346  C  CD    . LYS E 1  116  ? 319.001 286.316 228.927 1.00 51.80  ? 115  LYS E CD    1 
ATOM   3347  C  CE    . LYS E 1  116  ? 319.742 285.659 230.086 1.00 51.80  ? 115  LYS E CE    1 
ATOM   3348  N  NZ    . LYS E 1  116  ? 319.894 284.181 229.950 1.00 51.80  ? 115  LYS E NZ    1 
ATOM   3349  N  N     . ARG E 1  117  ? 315.550 290.627 228.388 1.00 53.27  ? 116  ARG E N     1 
ATOM   3350  C  CA    . ARG E 1  117  ? 315.288 291.797 227.576 1.00 53.27  ? 116  ARG E CA    1 
ATOM   3351  C  C     . ARG E 1  117  ? 315.552 293.028 228.414 1.00 53.27  ? 116  ARG E C     1 
ATOM   3352  O  O     . ARG E 1  117  ? 315.622 292.956 229.635 1.00 53.27  ? 116  ARG E O     1 
ATOM   3353  C  CB    . ARG E 1  117  ? 313.864 291.805 227.058 1.00 53.27  ? 116  ARG E CB    1 
ATOM   3354  C  CG    . ARG E 1  117  ? 312.866 291.905 228.124 1.00 53.27  ? 116  ARG E CG    1 
ATOM   3355  C  CD    . ARG E 1  117  ? 311.538 292.197 227.565 1.00 53.27  ? 116  ARG E CD    1 
ATOM   3356  N  NE    . ARG E 1  117  ? 310.588 292.215 228.646 1.00 53.27  ? 116  ARG E NE    1 
ATOM   3357  C  CZ    . ARG E 1  117  ? 309.835 291.178 228.950 1.00 53.27  ? 116  ARG E CZ    1 
ATOM   3358  N  NH1   . ARG E 1  117  ? 309.926 290.079 228.234 1.00 53.27  ? 116  ARG E NH1   1 
ATOM   3359  N  NH2   . ARG E 1  117  ? 308.990 291.242 229.951 1.00 53.27  ? 116  ARG E NH2   1 
ATOM   3360  N  N     . VAL E 1  118  ? 315.716 294.167 227.762 1.00 53.89  ? 117  VAL E N     1 
ATOM   3361  C  CA    . VAL E 1  118  ? 316.098 295.380 228.467 1.00 53.89  ? 117  VAL E CA    1 
ATOM   3362  C  C     . VAL E 1  118  ? 314.892 296.268 228.724 1.00 53.89  ? 117  VAL E C     1 
ATOM   3363  O  O     . VAL E 1  118  ? 314.825 296.954 229.746 1.00 53.89  ? 117  VAL E O     1 
ATOM   3364  C  CB    . VAL E 1  118  ? 317.214 296.138 227.719 1.00 53.89  ? 117  VAL E CB    1 
ATOM   3365  C  CG1   . VAL E 1  118  ? 316.747 296.714 226.431 1.00 53.89  ? 117  VAL E CG1   1 
ATOM   3366  C  CG2   . VAL E 1  118  ? 317.803 297.208 228.572 1.00 53.89  ? 117  VAL E CG2   1 
ATOM   3367  N  N     . THR E 1  119  ? 313.885 296.201 227.863 1.00 53.90  ? 118  THR E N     1 
ATOM   3368  C  CA    . THR E 1  119  ? 312.753 297.086 228.026 1.00 53.90  ? 118  THR E CA    1 
ATOM   3369  C  C     . THR E 1  119  ? 311.739 296.445 228.946 1.00 53.90  ? 118  THR E C     1 
ATOM   3370  O  O     . THR E 1  119  ? 311.765 295.238 229.166 1.00 53.90  ? 118  THR E O     1 
ATOM   3371  C  CB    . THR E 1  119  ? 312.141 297.436 226.683 1.00 53.90  ? 118  THR E CB    1 
ATOM   3372  O  OG1   . THR E 1  119  ? 311.425 298.657 226.817 1.00 53.90  ? 118  THR E OG1   1 
ATOM   3373  C  CG2   . THR E 1  119  ? 311.183 296.426 226.250 1.00 53.90  ? 118  THR E CG2   1 
ATOM   3374  N  N     . ILE E 1  120  ? 310.895 297.238 229.531 1.00 51.44  ? 119  ILE E N     1 
ATOM   3375  C  CA    . ILE E 1  120  ? 309.933 296.675 230.456 1.00 51.44  ? 119  ILE E CA    1 
ATOM   3376  C  C     . ILE E 1  120  ? 308.558 296.694 229.816 1.00 51.44  ? 119  ILE E C     1 
ATOM   3377  O  O     . ILE E 1  120  ? 308.103 297.712 229.310 1.00 51.44  ? 119  ILE E O     1 
ATOM   3378  C  CB    . ILE E 1  120  ? 309.974 297.391 231.818 1.00 51.44  ? 119  ILE E CB    1 
ATOM   3379  C  CG1   . ILE E 1  120  ? 309.734 298.875 231.735 1.00 51.44  ? 119  ILE E CG1   1 
ATOM   3380  C  CG2   . ILE E 1  120  ? 311.324 297.300 232.377 1.00 51.44  ? 119  ILE E CG2   1 
ATOM   3381  C  CD1   . ILE E 1  120  ? 309.502 299.481 233.073 1.00 51.44  ? 119  ILE E CD1   1 
ATOM   3382  N  N     . MET E 1  121  ? 307.920 295.543 229.767 1.00 55.00  ? 120  MET E N     1 
ATOM   3383  C  CA    . MET E 1  121  ? 306.591 295.448 229.208 1.00 55.00  ? 120  MET E CA    1 
ATOM   3384  C  C     . MET E 1  121  ? 305.619 295.467 230.374 1.00 55.00  ? 120  MET E C     1 
ATOM   3385  O  O     . MET E 1  121  ? 306.069 295.414 231.515 1.00 55.00  ? 120  MET E O     1 
ATOM   3386  C  CB    . MET E 1  121  ? 306.463 294.174 228.377 1.00 55.00  ? 120  MET E CB    1 
ATOM   3387  C  CG    . MET E 1  121  ? 307.725 293.781 227.699 1.00 55.00  ? 120  MET E CG    1 
ATOM   3388  S  SD    . MET E 1  121  ? 308.000 294.633 226.162 1.00 55.00  ? 120  MET E SD    1 
ATOM   3389  C  CE    . MET E 1  121  ? 306.711 293.889 225.212 1.00 55.00  ? 120  MET E CE    1 
ATOM   3390  N  N     . PRO E 1  122  ? 304.309 295.604 230.162 1.00 55.38  ? 121  PRO E N     1 
ATOM   3391  C  CA    . PRO E 1  122  ? 303.403 295.589 231.318 1.00 55.38  ? 121  PRO E CA    1 
ATOM   3392  C  C     . PRO E 1  122  ? 303.294 294.253 232.017 1.00 55.38  ? 121  PRO E C     1 
ATOM   3393  O  O     . PRO E 1  122  ? 302.896 294.214 233.190 1.00 55.38  ? 121  PRO E O     1 
ATOM   3394  C  CB    . PRO E 1  122  ? 302.069 295.995 230.705 1.00 55.38  ? 121  PRO E CB    1 
ATOM   3395  C  CG    . PRO E 1  122  ? 302.436 296.786 229.570 1.00 55.38  ? 121  PRO E CG    1 
ATOM   3396  C  CD    . PRO E 1  122  ? 303.636 296.186 228.995 1.00 55.38  ? 121  PRO E CD    1 
ATOM   3397  N  N     . LYS E 1  123  ? 303.644 293.154 231.347 1.00 56.22  ? 122  LYS E N     1 
ATOM   3398  C  CA    . LYS E 1  123  ? 303.576 291.857 231.997 1.00 56.22  ? 122  LYS E CA    1 
ATOM   3399  C  C     . LYS E 1  123  ? 304.610 291.738 233.100 1.00 56.22  ? 122  LYS E C     1 
ATOM   3400  O  O     . LYS E 1  123  ? 304.398 290.999 234.063 1.00 56.22  ? 122  LYS E O     1 
ATOM   3401  C  CB    . LYS E 1  123  ? 303.744 290.731 230.989 1.00 56.22  ? 122  LYS E CB    1 
ATOM   3402  C  CG    . LYS E 1  123  ? 304.712 290.971 229.887 1.00 56.22  ? 122  LYS E CG    1 
ATOM   3403  C  CD    . LYS E 1  123  ? 304.944 289.674 229.144 1.00 56.22  ? 122  LYS E CD    1 
ATOM   3404  C  CE    . LYS E 1  123  ? 306.022 289.776 228.084 1.00 56.22  ? 122  LYS E CE    1 
ATOM   3405  N  NZ    . LYS E 1  123  ? 305.536 290.394 226.826 1.00 56.22  ? 122  LYS E NZ    1 
ATOM   3406  N  N     . ASP E 1  124  ? 305.693 292.506 233.011 1.00 56.16  ? 123  ASP E N     1 
ATOM   3407  C  CA    . ASP E 1  124  ? 306.608 292.640 234.136 1.00 56.16  ? 123  ASP E CA    1 
ATOM   3408  C  C     . ASP E 1  124  ? 305.929 293.279 235.327 1.00 56.16  ? 123  ASP E C     1 
ATOM   3409  O  O     . ASP E 1  124  ? 306.160 292.877 236.468 1.00 56.16  ? 123  ASP E O     1 
ATOM   3410  C  CB    . ASP E 1  124  ? 307.801 293.470 233.723 1.00 56.16  ? 123  ASP E CB    1 
ATOM   3411  C  CG    . ASP E 1  124  ? 308.281 293.098 232.383 1.00 56.16  ? 123  ASP E CG    1 
ATOM   3412  O  OD1   . ASP E 1  124  ? 308.381 291.899 232.115 1.00 56.16  ? 123  ASP E OD1   1 
ATOM   3413  O  OD2   . ASP E 1  124  ? 308.532 293.977 231.563 1.00 56.16  ? 123  ASP E OD2   1 
ATOM   3414  N  N     . ILE E 1  125  ? 305.075 294.262 235.079 1.00 57.21  ? 124  ILE E N     1 
ATOM   3415  C  CA    . ILE E 1  125  ? 304.454 294.970 236.181 1.00 57.21  ? 124  ILE E CA    1 
ATOM   3416  C  C     . ILE E 1  125  ? 303.441 294.084 236.866 1.00 57.21  ? 124  ILE E C     1 
ATOM   3417  O  O     . ILE E 1  125  ? 303.421 293.986 238.099 1.00 57.21  ? 124  ILE E O     1 
ATOM   3418  C  CB    . ILE E 1  125  ? 303.829 296.281 235.696 1.00 57.21  ? 124  ILE E CB    1 
ATOM   3419  C  CG1   . ILE E 1  125  ? 304.923 297.185 235.163 1.00 57.21  ? 124  ILE E CG1   1 
ATOM   3420  C  CG2   . ILE E 1  125  ? 303.140 296.964 236.832 1.00 57.21  ? 124  ILE E CG2   1 
ATOM   3421  C  CD1   . ILE E 1  125  ? 304.468 298.536 234.786 1.00 57.21  ? 124  ILE E CD1   1 
ATOM   3422  N  N     . GLN E 1  126  ? 302.622 293.375 236.094 1.00 57.29  ? 125  GLN E N     1 
ATOM   3423  C  CA    . GLN E 1  126  ? 301.695 292.492 236.783 1.00 57.29  ? 125  GLN E CA    1 
ATOM   3424  C  C     . GLN E 1  126  ? 302.384 291.268 237.359 1.00 57.29  ? 125  GLN E C     1 
ATOM   3425  O  O     . GLN E 1  126  ? 301.899 290.716 238.344 1.00 57.29  ? 125  GLN E O     1 
ATOM   3426  C  CB    . GLN E 1  126  ? 300.505 292.085 235.920 1.00 57.29  ? 125  GLN E CB    1 
ATOM   3427  C  CG    . GLN E 1  126  ? 300.758 291.583 234.560 1.00 57.29  ? 125  GLN E CG    1 
ATOM   3428  C  CD    . GLN E 1  126  ? 300.326 292.599 233.555 1.00 57.29  ? 125  GLN E CD    1 
ATOM   3429  O  OE1   . GLN E 1  126  ? 300.139 293.759 233.892 1.00 57.29  ? 125  GLN E OE1   1 
ATOM   3430  N  NE2   . GLN E 1  126  ? 300.115 292.171 232.324 1.00 57.29  ? 125  GLN E NE2   1 
ATOM   3431  N  N     . LEU E 1  127  ? 303.550 290.882 236.844 1.00 54.96  ? 126  LEU E N     1 
ATOM   3432  C  CA    . LEU E 1  127  ? 304.273 289.789 237.481 1.00 54.96  ? 126  LEU E CA    1 
ATOM   3433  C  C     . LEU E 1  127  ? 304.836 290.212 238.825 1.00 54.96  ? 126  LEU E C     1 
ATOM   3434  O  O     . LEU E 1  127  ? 304.701 289.488 239.814 1.00 54.96  ? 126  LEU E O     1 
ATOM   3435  C  CB    . LEU E 1  127  ? 305.386 289.283 236.578 1.00 54.96  ? 126  LEU E CB    1 
ATOM   3436  C  CG    . LEU E 1  127  ? 306.331 288.329 237.291 1.00 54.96  ? 126  LEU E CG    1 
ATOM   3437  C  CD1   . LEU E 1  127  ? 305.644 287.034 237.497 1.00 54.96  ? 126  LEU E CD1   1 
ATOM   3438  C  CD2   . LEU E 1  127  ? 307.586 288.127 236.526 1.00 54.96  ? 126  LEU E CD2   1 
ATOM   3439  N  N     . ALA E 1  128  ? 305.443 291.392 238.888 1.00 55.47  ? 127  ALA E N     1 
ATOM   3440  C  CA    . ALA E 1  128  ? 306.009 291.853 240.145 1.00 55.47  ? 127  ALA E CA    1 
ATOM   3441  C  C     . ALA E 1  128  ? 304.922 292.155 241.155 1.00 55.47  ? 127  ALA E C     1 
ATOM   3442  O  O     . ALA E 1  128  ? 305.088 291.909 242.352 1.00 55.47  ? 127  ALA E O     1 
ATOM   3443  C  CB    . ALA E 1  128  ? 306.866 293.084 239.913 1.00 55.47  ? 127  ALA E CB    1 
ATOM   3444  N  N     . ARG E 1  129  ? 303.781 292.650 240.693 1.00 58.63  ? 128  ARG E N     1 
ATOM   3445  C  CA    . ARG E 1  129  ? 302.687 292.885 241.615 1.00 58.63  ? 128  ARG E CA    1 
ATOM   3446  C  C     . ARG E 1  129  ? 302.030 291.586 242.043 1.00 58.63  ? 128  ARG E C     1 
ATOM   3447  O  O     . ARG E 1  129  ? 301.442 291.515 243.120 1.00 58.63  ? 128  ARG E O     1 
ATOM   3448  C  CB    . ARG E 1  129  ? 301.670 293.808 240.979 1.00 58.63  ? 128  ARG E CB    1 
ATOM   3449  C  CG    . ARG E 1  129  ? 302.125 295.211 240.929 1.00 58.63  ? 128  ARG E CG    1 
ATOM   3450  C  CD    . ARG E 1  129  ? 301.107 296.063 240.251 1.00 58.63  ? 128  ARG E CD    1 
ATOM   3451  N  NE    . ARG E 1  129  ? 299.758 295.812 240.726 1.00 58.63  ? 128  ARG E NE    1 
ATOM   3452  C  CZ    . ARG E 1  129  ? 299.244 296.344 241.825 1.00 58.63  ? 128  ARG E CZ    1 
ATOM   3453  N  NH1   . ARG E 1  129  ? 299.969 297.150 242.577 1.00 58.63  ? 128  ARG E NH1   1 
ATOM   3454  N  NH2   . ARG E 1  129  ? 298.002 296.065 242.177 1.00 58.63  ? 128  ARG E NH2   1 
ATOM   3455  N  N     . ARG E 1  130  ? 302.117 290.548 241.217 1.00 59.74  ? 129  ARG E N     1 
ATOM   3456  C  CA    . ARG E 1  130  ? 301.550 289.269 241.602 1.00 59.74  ? 129  ARG E CA    1 
ATOM   3457  C  C     . ARG E 1  130  ? 302.447 288.568 242.609 1.00 59.74  ? 129  ARG E C     1 
ATOM   3458  O  O     . ARG E 1  130  ? 301.956 287.941 243.550 1.00 59.74  ? 129  ARG E O     1 
ATOM   3459  C  CB    . ARG E 1  130  ? 301.330 288.421 240.355 1.00 59.74  ? 129  ARG E CB    1 
ATOM   3460  C  CG    . ARG E 1  130  ? 300.874 286.999 240.581 1.00 59.74  ? 129  ARG E CG    1 
ATOM   3461  C  CD    . ARG E 1  130  ? 299.644 286.885 241.462 1.00 59.74  ? 129  ARG E CD    1 
ATOM   3462  N  NE    . ARG E 1  130  ? 298.454 287.487 240.875 1.00 59.74  ? 129  ARG E NE    1 
ATOM   3463  C  CZ    . ARG E 1  130  ? 297.423 287.948 241.581 1.00 59.74  ? 129  ARG E CZ    1 
ATOM   3464  N  NH1   . ARG E 1  130  ? 297.437 287.888 242.907 1.00 59.74  ? 129  ARG E NH1   1 
ATOM   3465  N  NH2   . ARG E 1  130  ? 296.377 288.480 240.964 1.00 59.74  ? 129  ARG E NH2   1 
ATOM   3466  N  N     . ILE E 1  131  ? 303.760 288.688 242.450 1.00 55.61  ? 130  ILE E N     1 
ATOM   3467  C  CA    . ILE E 1  131  ? 304.672 288.047 243.388 1.00 55.61  ? 130  ILE E CA    1 
ATOM   3468  C  C     . ILE E 1  131  ? 304.651 288.766 244.723 1.00 55.61  ? 130  ILE E C     1 
ATOM   3469  O  O     . ILE E 1  131  ? 304.627 288.135 245.782 1.00 55.61  ? 130  ILE E O     1 
ATOM   3470  C  CB    . ILE E 1  131  ? 306.082 287.988 242.801 1.00 55.61  ? 130  ILE E CB    1 
ATOM   3471  C  CG1   . ILE E 1  131  ? 306.093 287.044 241.627 1.00 55.61  ? 130  ILE E CG1   1 
ATOM   3472  C  CG2   . ILE E 1  131  ? 307.039 287.464 243.789 1.00 55.61  ? 130  ILE E CG2   1 
ATOM   3473  C  CD1   . ILE E 1  131  ? 307.349 287.116 240.876 1.00 55.61  ? 130  ILE E CD1   1 
ATOM   3474  N  N     . ARG E 1  132  ? 304.577 290.095 244.700 1.00 57.23  ? 131  ARG E N     1 
ATOM   3475  C  CA    . ARG E 1  132  ? 304.476 290.830 245.955 1.00 57.23  ? 131  ARG E CA    1 
ATOM   3476  C  C     . ARG E 1  132  ? 303.121 290.677 246.626 1.00 57.23  ? 131  ARG E C     1 
ATOM   3477  O  O     . ARG E 1  132  ? 302.952 291.146 247.751 1.00 57.23  ? 131  ARG E O     1 
ATOM   3478  C  CB    . ARG E 1  132  ? 304.748 292.303 245.725 1.00 57.23  ? 131  ARG E CB    1 
ATOM   3479  C  CG    . ARG E 1  132  ? 306.164 292.607 245.399 1.00 57.23  ? 131  ARG E CG    1 
ATOM   3480  C  CD    . ARG E 1  132  ? 306.272 293.916 244.666 1.00 57.23  ? 131  ARG E CD    1 
ATOM   3481  N  NE    . ARG E 1  132  ? 306.698 294.990 245.544 1.00 57.23  ? 131  ARG E NE    1 
ATOM   3482  C  CZ    . ARG E 1  132  ? 306.565 296.274 245.252 1.00 57.23  ? 131  ARG E CZ    1 
ATOM   3483  N  NH1   . ARG E 1  132  ? 306.015 296.630 244.111 1.00 57.23  ? 131  ARG E NH1   1 
ATOM   3484  N  NH2   . ARG E 1  132  ? 306.975 297.200 246.099 1.00 57.23  ? 131  ARG E NH2   1 
ATOM   3485  N  N     . GLY E 1  133  ? 302.157 290.045 245.975 1.00 58.00  ? 132  GLY E N     1 
ATOM   3486  C  CA    . GLY E 1  133  ? 300.854 289.855 246.557 1.00 58.00  ? 132  GLY E CA    1 
ATOM   3487  C  C     . GLY E 1  133  ? 299.930 291.032 246.412 1.00 58.00  ? 132  GLY E C     1 
ATOM   3488  O  O     . GLY E 1  133  ? 298.828 291.002 246.963 1.00 58.00  ? 132  GLY E O     1 
ATOM   3489  N  N     . GLU E 1  134  ? 300.329 292.057 245.665 1.00 60.28  ? 133  GLU E N     1 
ATOM   3490  C  CA    . GLU E 1  134  ? 299.565 293.296 245.615 1.00 60.28  ? 133  GLU E CA    1 
ATOM   3491  C  C     . GLU E 1  134  ? 298.398 293.211 244.656 1.00 60.28  ? 133  GLU E C     1 
ATOM   3492  O  O     . GLU E 1  134  ? 297.596 294.146 244.571 1.00 60.28  ? 133  GLU E O     1 
ATOM   3493  C  CB    . GLU E 1  134  ? 300.469 294.450 245.213 1.00 60.28  ? 133  GLU E CB    1 
ATOM   3494  C  CG    . GLU E 1  134  ? 301.412 294.895 246.279 1.00 60.28  ? 133  GLU E CG    1 
ATOM   3495  C  CD    . GLU E 1  134  ? 302.500 295.755 245.711 1.00 60.28  ? 133  GLU E CD    1 
ATOM   3496  O  OE1   . GLU E 1  134  ? 303.674 295.537 246.059 1.00 60.28  ? 133  GLU E OE1   1 
ATOM   3497  O  OE2   . GLU E 1  134  ? 302.179 296.639 244.898 1.00 60.28  ? 133  GLU E OE2   1 
ATOM   3498  N  N     . ARG E 1  135  ? 298.280 292.123 243.921 1.00 62.27  ? 134  ARG E N     1 
ATOM   3499  C  CA    . ARG E 1  135  ? 297.266 292.073 242.893 1.00 62.27  ? 134  ARG E CA    1 
ATOM   3500  C  C     . ARG E 1  135  ? 296.036 291.318 243.370 1.00 62.27  ? 134  ARG E C     1 
ATOM   3501  O  O     . ARG E 1  135  ? 295.145 291.900 243.988 1.00 62.27  ? 134  ARG E O     1 
ATOM   3502  C  CB    . ARG E 1  135  ? 297.840 291.442 241.636 1.00 62.27  ? 134  ARG E CB    1 
ATOM   3503  C  CG    . ARG E 1  135  ? 297.092 291.793 240.378 1.00 62.27  ? 134  ARG E CG    1 
ATOM   3504  C  CD    . ARG E 1  135  ? 298.017 291.760 239.176 1.00 62.27  ? 134  ARG E CD    1 
ATOM   3505  N  NE    . ARG E 1  135  ? 298.648 293.049 238.921 1.00 62.27  ? 134  ARG E NE    1 
ATOM   3506  C  CZ    . ARG E 1  135  ? 298.114 293.996 238.160 1.00 62.27  ? 134  ARG E CZ    1 
ATOM   3507  N  NH1   . ARG E 1  135  ? 296.936 293.795 237.588 1.00 62.27  ? 134  ARG E NH1   1 
ATOM   3508  N  NH2   . ARG E 1  135  ? 298.752 295.137 237.965 1.00 62.27  ? 134  ARG E NH2   1 
ATOM   3509  N  N     . ASN F 2  26   ? 291.753 313.431 235.405 1.00 58.65  ? 25   ASN F N     1 
ATOM   3510  C  CA    . ASN F 2  26   ? 292.826 314.055 236.163 1.00 58.65  ? 25   ASN F CA    1 
ATOM   3511  C  C     . ASN F 2  26   ? 293.970 313.103 236.355 1.00 58.65  ? 25   ASN F C     1 
ATOM   3512  O  O     . ASN F 2  26   ? 295.042 313.504 236.775 1.00 58.65  ? 25   ASN F O     1 
ATOM   3513  C  CB    . ASN F 2  26   ? 292.346 314.526 237.527 1.00 58.65  ? 25   ASN F CB    1 
ATOM   3514  C  CG    . ASN F 2  26   ? 291.510 315.774 237.450 1.00 58.65  ? 25   ASN F CG    1 
ATOM   3515  O  OD1   . ASN F 2  26   ? 290.426 315.841 238.020 1.00 58.65  ? 25   ASN F OD1   1 
ATOM   3516  N  ND2   . ASN F 2  26   ? 292.001 316.772 236.732 1.00 58.65  ? 25   ASN F ND2   1 
ATOM   3517  N  N     . ILE F 2  27   ? 293.738 311.827 236.059 1.00 57.82  ? 26   ILE F N     1 
ATOM   3518  C  CA    . ILE F 2  27   ? 294.815 310.853 236.153 1.00 57.82  ? 26   ILE F CA    1 
ATOM   3519  C  C     . ILE F 2  27   ? 295.798 311.050 235.014 1.00 57.82  ? 26   ILE F C     1 
ATOM   3520  O  O     . ILE F 2  27   ? 296.974 310.718 235.140 1.00 57.82  ? 26   ILE F O     1 
ATOM   3521  C  CB    . ILE F 2  27   ? 294.232 309.429 236.205 1.00 57.82  ? 26   ILE F CB    1 
ATOM   3522  C  CG1   . ILE F 2  27   ? 295.293 308.376 236.490 1.00 57.82  ? 26   ILE F CG1   1 
ATOM   3523  C  CG2   . ILE F 2  27   ? 293.526 309.081 234.922 1.00 57.82  ? 26   ILE F CG2   1 
ATOM   3524  C  CD1   . ILE F 2  27   ? 296.161 308.666 237.643 1.00 57.82  ? 26   ILE F CD1   1 
ATOM   3525  N  N     . GLN F 2  28   ? 295.378 311.687 233.927 1.00 56.70  ? 27   GLN F N     1 
ATOM   3526  C  CA    . GLN F 2  28   ? 296.308 312.005 232.859 1.00 56.70  ? 27   GLN F CA    1 
ATOM   3527  C  C     . GLN F 2  28   ? 297.253 313.137 233.208 1.00 56.70  ? 27   GLN F C     1 
ATOM   3528  O  O     . GLN F 2  28   ? 298.108 313.468 232.389 1.00 56.70  ? 27   GLN F O     1 
ATOM   3529  C  CB    . GLN F 2  28   ? 295.553 312.370 231.602 1.00 56.70  ? 27   GLN F CB    1 
ATOM   3530  C  CG    . GLN F 2  28   ? 294.395 311.467 231.318 1.00 56.70  ? 27   GLN F CG    1 
ATOM   3531  C  CD    . GLN F 2  28   ? 294.818 310.155 230.726 1.00 56.70  ? 27   GLN F CD    1 
ATOM   3532  O  OE1   . GLN F 2  28   ? 295.787 310.079 229.983 1.00 56.70  ? 27   GLN F OE1   1 
ATOM   3533  N  NE2   . GLN F 2  28   ? 294.084 309.107 231.047 1.00 56.70  ? 27   GLN F NE2   1 
ATOM   3534  N  N     . GLY F 2  29   ? 297.120 313.745 234.384 1.00 57.13  ? 28   GLY F N     1 
ATOM   3535  C  CA    . GLY F 2  29   ? 298.083 314.727 234.840 1.00 57.13  ? 28   GLY F CA    1 
ATOM   3536  C  C     . GLY F 2  29   ? 299.376 314.119 235.317 1.00 57.13  ? 28   GLY F C     1 
ATOM   3537  O  O     . GLY F 2  29   ? 300.335 314.846 235.570 1.00 57.13  ? 28   GLY F O     1 
ATOM   3538  N  N     . ILE F 2  30   ? 299.416 312.803 235.467 1.00 56.84  ? 29   ILE F N     1 
ATOM   3539  C  CA    . ILE F 2  30   ? 300.658 312.069 235.638 1.00 56.84  ? 29   ILE F CA    1 
ATOM   3540  C  C     . ILE F 2  30   ? 301.113 311.657 234.256 1.00 56.84  ? 29   ILE F C     1 
ATOM   3541  O  O     . ILE F 2  30   ? 300.592 310.709 233.676 1.00 56.84  ? 29   ILE F O     1 
ATOM   3542  C  CB    . ILE F 2  30   ? 300.459 310.863 236.540 1.00 56.84  ? 29   ILE F CB    1 
ATOM   3543  C  CG1   . ILE F 2  30   ? 300.078 311.383 237.896 1.00 56.84  ? 29   ILE F CG1   1 
ATOM   3544  C  CG2   . ILE F 2  30   ? 301.703 310.041 236.633 1.00 56.84  ? 29   ILE F CG2   1 
ATOM   3545  C  CD1   . ILE F 2  30   ? 299.352 310.421 238.637 1.00 56.84  ? 29   ILE F CD1   1 
ATOM   3546  N  N     . THR F 2  31   ? 302.070 312.374 233.720 1.00 55.91  ? 30   THR F N     1 
ATOM   3547  C  CA    . THR F 2  31   ? 302.318 312.341 232.300 1.00 55.91  ? 30   THR F CA    1 
ATOM   3548  C  C     . THR F 2  31   ? 303.291 311.236 231.946 1.00 55.91  ? 30   THR F C     1 
ATOM   3549  O  O     . THR F 2  31   ? 303.776 310.506 232.804 1.00 55.91  ? 30   THR F O     1 
ATOM   3550  C  CB    . THR F 2  31   ? 302.849 313.684 231.865 1.00 55.91  ? 30   THR F CB    1 
ATOM   3551  O  OG1   . THR F 2  31   ? 304.008 313.961 232.641 1.00 55.91  ? 30   THR F OG1   1 
ATOM   3552  C  CG2   . THR F 2  31   ? 301.842 314.716 232.173 1.00 55.91  ? 30   THR F CG2   1 
ATOM   3553  N  N     . LYS F 2  32   ? 303.536 311.096 230.652 1.00 53.55  ? 31   LYS F N     1 
ATOM   3554  C  CA    . LYS F 2  32   ? 304.597 310.205 230.208 1.00 53.55  ? 31   LYS F CA    1 
ATOM   3555  C  C     . LYS F 2  32   ? 305.984 310.635 230.673 1.00 53.55  ? 31   LYS F C     1 
ATOM   3556  O  O     . LYS F 2  32   ? 306.755 309.744 231.065 1.00 53.55  ? 31   LYS F O     1 
ATOM   3557  C  CB    . LYS F 2  32   ? 304.536 310.039 228.686 1.00 53.55  ? 31   LYS F CB    1 
ATOM   3558  C  CG    . LYS F 2  32   ? 305.446 308.961 228.125 1.00 53.55  ? 31   LYS F CG    1 
ATOM   3559  C  CD    . LYS F 2  32   ? 305.422 307.685 228.988 1.00 53.55  ? 31   LYS F CD    1 
ATOM   3560  C  CE    . LYS F 2  32   ? 306.111 306.494 228.386 1.00 53.55  ? 31   LYS F CE    1 
ATOM   3561  N  NZ    . LYS F 2  32   ? 305.849 305.327 229.230 1.00 53.55  ? 31   LYS F NZ    1 
ATOM   3562  N  N     . PRO F 2  33   ? 306.380 311.919 230.682 1.00 54.66  ? 32   PRO F N     1 
ATOM   3563  C  CA    . PRO F 2  33   ? 307.696 312.219 231.247 1.00 54.66  ? 32   PRO F CA    1 
ATOM   3564  C  C     . PRO F 2  33   ? 307.817 311.965 232.729 1.00 54.66  ? 32   PRO F C     1 
ATOM   3565  O  O     . PRO F 2  33   ? 308.879 311.525 233.157 1.00 54.66  ? 32   PRO F O     1 
ATOM   3566  C  CB    . PRO F 2  33   ? 307.886 313.694 230.912 1.00 54.66  ? 32   PRO F CB    1 
ATOM   3567  C  CG    . PRO F 2  33   ? 306.612 314.170 230.613 1.00 54.66  ? 32   PRO F CG    1 
ATOM   3568  C  CD    . PRO F 2  33   ? 305.942 313.092 229.917 1.00 54.66  ? 32   PRO F CD    1 
ATOM   3569  N  N     . ALA F 2  34   ? 306.777 312.182 233.525 1.00 52.90  ? 33   ALA F N     1 
ATOM   3570  C  CA    . ALA F 2  34   ? 306.910 311.946 234.956 1.00 52.90  ? 33   ALA F CA    1 
ATOM   3571  C  C     . ALA F 2  34   ? 307.004 310.465 235.264 1.00 52.90  ? 33   ALA F C     1 
ATOM   3572  O  O     . ALA F 2  34   ? 307.750 310.051 236.160 1.00 52.90  ? 33   ALA F O     1 
ATOM   3573  C  CB    . ALA F 2  34   ? 305.738 312.558 235.699 1.00 52.90  ? 33   ALA F CB    1 
ATOM   3574  N  N     . ILE F 2  35   ? 306.288 309.648 234.497 1.00 52.32  ? 34   ILE F N     1 
ATOM   3575  C  CA    . ILE F 2  35   ? 306.376 308.204 234.645 1.00 52.32  ? 34   ILE F CA    1 
ATOM   3576  C  C     . ILE F 2  35   ? 307.735 307.713 234.202 1.00 52.32  ? 34   ILE F C     1 
ATOM   3577  O  O     . ILE F 2  35   ? 308.333 306.836 234.833 1.00 52.32  ? 34   ILE F O     1 
ATOM   3578  C  CB    . ILE F 2  35   ? 305.244 307.541 233.858 1.00 52.32  ? 34   ILE F CB    1 
ATOM   3579  C  CG1   . ILE F 2  35   ? 303.958 307.698 234.617 1.00 52.32  ? 34   ILE F CG1   1 
ATOM   3580  C  CG2   . ILE F 2  35   ? 305.473 306.099 233.692 1.00 52.32  ? 34   ILE F CG2   1 
ATOM   3581  C  CD1   . ILE F 2  35   ? 302.789 307.324 233.831 1.00 52.32  ? 34   ILE F CD1   1 
ATOM   3582  N  N     . ARG F 2  36   ? 308.281 308.319 233.160 1.00 53.04  ? 35   ARG F N     1 
ATOM   3583  C  CA    . ARG F 2  36   ? 309.596 307.904 232.715 1.00 53.04  ? 35   ARG F CA    1 
ATOM   3584  C  C     . ARG F 2  36   ? 310.672 308.320 233.704 1.00 53.04  ? 35   ARG F C     1 
ATOM   3585  O  O     . ARG F 2  36   ? 311.632 307.585 233.916 1.00 53.04  ? 35   ARG F O     1 
ATOM   3586  C  CB    . ARG F 2  36   ? 309.876 308.475 231.345 1.00 53.04  ? 35   ARG F CB    1 
ATOM   3587  C  CG    . ARG F 2  36   ? 310.967 307.776 230.652 1.00 53.04  ? 35   ARG F CG    1 
ATOM   3588  C  CD    . ARG F 2  36   ? 311.200 308.444 229.373 1.00 53.04  ? 35   ARG F CD    1 
ATOM   3589  N  NE    . ARG F 2  36   ? 309.936 308.614 228.702 1.00 53.04  ? 35   ARG F NE    1 
ATOM   3590  C  CZ    . ARG F 2  36   ? 309.715 309.580 227.831 1.00 53.04  ? 35   ARG F CZ    1 
ATOM   3591  N  NH1   . ARG F 2  36   ? 308.538 309.699 227.243 1.00 53.04  ? 35   ARG F NH1   1 
ATOM   3592  N  NH2   . ARG F 2  36   ? 310.678 310.446 227.566 1.00 53.04  ? 35   ARG F NH2   1 
ATOM   3593  N  N     . ARG F 2  37   ? 310.510 309.463 234.355 1.00 53.48  ? 36   ARG F N     1 
ATOM   3594  C  CA    . ARG F 2  37   ? 311.473 309.858 235.373 1.00 53.48  ? 36   ARG F CA    1 
ATOM   3595  C  C     . ARG F 2  37   ? 311.398 308.950 236.584 1.00 53.48  ? 36   ARG F C     1 
ATOM   3596  O  O     . ARG F 2  37   ? 312.421 308.653 237.211 1.00 53.48  ? 36   ARG F O     1 
ATOM   3597  C  CB    . ARG F 2  37   ? 311.232 311.298 235.778 1.00 53.48  ? 36   ARG F CB    1 
ATOM   3598  C  CG    . ARG F 2  37   ? 311.594 312.270 234.708 1.00 53.48  ? 36   ARG F CG    1 
ATOM   3599  C  CD    . ARG F 2  37   ? 311.522 313.667 235.210 1.00 53.48  ? 36   ARG F CD    1 
ATOM   3600  N  NE    . ARG F 2  37   ? 310.239 313.971 235.797 1.00 53.48  ? 36   ARG F NE    1 
ATOM   3601  C  CZ    . ARG F 2  37   ? 309.497 314.990 235.413 1.00 53.48  ? 36   ARG F CZ    1 
ATOM   3602  N  NH1   . ARG F 2  37   ? 309.924 315.769 234.448 1.00 53.48  ? 36   ARG F NH1   1 
ATOM   3603  N  NH2   . ARG F 2  37   ? 308.337 315.228 235.978 1.00 53.48  ? 36   ARG F NH2   1 
ATOM   3604  N  N     . LEU F 2  38   ? 310.203 308.480 236.919 1.00 51.94  ? 37   LEU F N     1 
ATOM   3605  C  CA    . LEU F 2  38   ? 310.091 307.487 237.979 1.00 51.94  ? 37   LEU F CA    1 
ATOM   3606  C  C     . LEU F 2  38   ? 310.756 306.184 237.585 1.00 51.94  ? 37   LEU F C     1 
ATOM   3607  O  O     . LEU F 2  38   ? 311.372 305.521 238.419 1.00 51.94  ? 37   LEU F O     1 
ATOM   3608  C  CB    . LEU F 2  38   ? 308.636 307.240 238.312 1.00 51.94  ? 37   LEU F CB    1 
ATOM   3609  C  CG    . LEU F 2  38   ? 308.042 308.352 239.135 1.00 51.94  ? 37   LEU F CG    1 
ATOM   3610  C  CD1   . LEU F 2  38   ? 306.593 308.149 239.160 1.00 51.94  ? 37   LEU F CD1   1 
ATOM   3611  C  CD2   . LEU F 2  38   ? 308.594 308.259 240.508 1.00 51.94  ? 37   LEU F CD2   1 
ATOM   3612  N  N     . ALA F 2  39   ? 310.652 305.806 236.317 1.00 52.33  ? 38   ALA F N     1 
ATOM   3613  C  CA    . ALA F 2  39   ? 311.313 304.592 235.865 1.00 52.33  ? 38   ALA F CA    1 
ATOM   3614  C  C     . ALA F 2  39   ? 312.817 304.736 235.923 1.00 52.33  ? 38   ALA F C     1 
ATOM   3615  O  O     . ALA F 2  39   ? 313.524 303.775 236.227 1.00 52.33  ? 38   ALA F O     1 
ATOM   3616  C  CB    . ALA F 2  39   ? 310.875 304.252 234.450 1.00 52.33  ? 38   ALA F CB    1 
ATOM   3617  N  N     . ARG F 2  40   ? 313.326 305.931 235.647 1.00 54.69  ? 39   ARG F N     1 
ATOM   3618  C  CA    . ARG F 2  40   ? 314.765 306.136 235.684 1.00 54.69  ? 39   ARG F CA    1 
ATOM   3619  C  C     . ARG F 2  40   ? 315.296 306.118 237.100 1.00 54.69  ? 39   ARG F C     1 
ATOM   3620  O  O     . ARG F 2  40   ? 316.391 305.614 237.342 1.00 54.69  ? 39   ARG F O     1 
ATOM   3621  C  CB    . ARG F 2  40   ? 315.133 307.447 235.034 1.00 54.69  ? 39   ARG F CB    1 
ATOM   3622  C  CG    . ARG F 2  40   ? 314.785 307.494 233.618 1.00 54.69  ? 39   ARG F CG    1 
ATOM   3623  C  CD    . ARG F 2  40   ? 315.492 306.479 232.850 1.00 54.69  ? 39   ARG F CD    1 
ATOM   3624  N  NE    . ARG F 2  40   ? 315.674 307.003 231.525 1.00 54.69  ? 39   ARG F NE    1 
ATOM   3625  C  CZ    . ARG F 2  40   ? 314.866 306.726 230.527 1.00 54.69  ? 39   ARG F CZ    1 
ATOM   3626  N  NH1   . ARG F 2  40   ? 313.850 305.912 230.726 1.00 54.69  ? 39   ARG F NH1   1 
ATOM   3627  N  NH2   . ARG F 2  40   ? 315.084 307.249 229.336 1.00 54.69  ? 39   ARG F NH2   1 
ATOM   3628  N  N     . ARG F 2  41   ? 314.562 306.697 238.044 1.00 56.76  ? 40   ARG F N     1 
ATOM   3629  C  CA    . ARG F 2  41   ? 315.015 306.587 239.421 1.00 56.76  ? 40   ARG F CA    1 
ATOM   3630  C  C     . ARG F 2  41   ? 314.876 305.161 239.920 1.00 56.76  ? 40   ARG F C     1 
ATOM   3631  O  O     . ARG F 2  41   ? 315.685 304.706 240.726 1.00 56.76  ? 40   ARG F O     1 
ATOM   3632  C  CB    . ARG F 2  41   ? 314.270 307.551 240.325 1.00 56.76  ? 40   ARG F CB    1 
ATOM   3633  C  CG    . ARG F 2  41   ? 314.872 307.625 241.706 1.00 56.76  ? 40   ARG F CG    1 
ATOM   3634  C  CD    . ARG F 2  41   ? 314.135 308.526 242.624 1.00 56.76  ? 40   ARG F CD    1 
ATOM   3635  N  NE    . ARG F 2  41   ? 314.837 309.779 242.788 1.00 56.76  ? 40   ARG F NE    1 
ATOM   3636  C  CZ    . ARG F 2  41   ? 314.226 310.937 242.974 1.00 56.76  ? 40   ARG F CZ    1 
ATOM   3637  N  NH1   . ARG F 2  41   ? 312.910 310.990 243.010 1.00 56.76  ? 40   ARG F NH1   1 
ATOM   3638  N  NH2   . ARG F 2  41   ? 314.930 312.043 243.115 1.00 56.76  ? 40   ARG F NH2   1 
ATOM   3639  N  N     . GLY F 2  42   ? 313.909 304.418 239.407 1.00 54.22  ? 41   GLY F N     1 
ATOM   3640  C  CA    . GLY F 2  42   ? 313.954 302.982 239.606 1.00 54.22  ? 41   GLY F CA    1 
ATOM   3641  C  C     . GLY F 2  42   ? 315.093 302.272 238.904 1.00 54.22  ? 41   GLY F C     1 
ATOM   3642  O  O     . GLY F 2  42   ? 315.501 301.201 239.344 1.00 54.22  ? 41   GLY F O     1 
ATOM   3643  N  N     . GLY F 2  43   ? 315.623 302.838 237.835 1.00 53.38  ? 42   GLY F N     1 
ATOM   3644  C  CA    . GLY F 2  43   ? 316.791 302.266 237.214 1.00 53.38  ? 42   GLY F CA    1 
ATOM   3645  C  C     . GLY F 2  43   ? 316.488 301.553 235.924 1.00 53.38  ? 42   GLY F C     1 
ATOM   3646  O  O     . GLY F 2  43   ? 317.231 300.661 235.521 1.00 53.38  ? 42   GLY F O     1 
ATOM   3647  N  N     . VAL F 2  44   ? 315.418 301.941 235.255 1.00 51.85  ? 43   VAL F N     1 
ATOM   3648  C  CA    . VAL F 2  44   ? 314.975 301.288 234.036 1.00 51.85  ? 43   VAL F CA    1 
ATOM   3649  C  C     . VAL F 2  44   ? 315.682 301.940 232.868 1.00 51.85  ? 43   VAL F C     1 
ATOM   3650  O  O     . VAL F 2  44   ? 315.726 303.167 232.767 1.00 51.85  ? 43   VAL F O     1 
ATOM   3651  C  CB    . VAL F 2  44   ? 313.459 301.383 233.876 1.00 51.85  ? 43   VAL F CB    1 
ATOM   3652  C  CG1   . VAL F 2  44   ? 313.048 300.697 232.654 1.00 51.85  ? 43   VAL F CG1   1 
ATOM   3653  C  CG2   . VAL F 2  44   ? 312.805 300.732 235.030 1.00 51.85  ? 43   VAL F CG2   1 
ATOM   3654  N  N     . LYS F 2  45   ? 316.255 301.125 231.993 1.00 53.62  ? 44   LYS F N     1 
ATOM   3655  C  CA    . LYS F 2  45   ? 316.962 301.666 230.846 1.00 53.62  ? 44   LYS F CA    1 
ATOM   3656  C  C     . LYS F 2  45   ? 315.994 302.080 229.760 1.00 53.62  ? 44   LYS F C     1 
ATOM   3657  O  O     . LYS F 2  45   ? 316.176 303.107 229.102 1.00 53.62  ? 44   LYS F O     1 
ATOM   3658  C  CB    . LYS F 2  45   ? 317.942 300.632 230.315 1.00 53.62  ? 44   LYS F CB    1 
ATOM   3659  C  CG    . LYS F 2  45   ? 318.833 301.159 229.232 1.00 53.62  ? 44   LYS F CG    1 
ATOM   3660  C  CD    . LYS F 2  45   ? 319.975 300.216 228.956 1.00 53.62  ? 44   LYS F CD    1 
ATOM   3661  C  CE    . LYS F 2  45   ? 321.073 300.892 228.168 1.00 53.62  ? 44   LYS F CE    1 
ATOM   3662  N  NZ    . LYS F 2  45   ? 322.286 300.036 228.101 1.00 53.62  ? 44   LYS F NZ    1 
ATOM   3663  N  N     . ARG F 2  46   ? 314.941 301.309 229.576 1.00 53.69  ? 45   ARG F N     1 
ATOM   3664  C  CA    . ARG F 2  46   ? 314.117 301.391 228.388 1.00 53.69  ? 45   ARG F CA    1 
ATOM   3665  C  C     . ARG F 2  46   ? 312.737 300.910 228.778 1.00 53.69  ? 45   ARG F C     1 
ATOM   3666  O  O     . ARG F 2  46   ? 312.623 299.934 229.508 1.00 53.69  ? 45   ARG F O     1 
ATOM   3667  C  CB    . ARG F 2  46   ? 314.717 300.520 227.301 1.00 53.69  ? 45   ARG F CB    1 
ATOM   3668  C  CG    . ARG F 2  46   ? 314.059 300.591 226.020 1.00 53.69  ? 45   ARG F CG    1 
ATOM   3669  C  CD    . ARG F 2  46   ? 314.867 299.886 225.013 1.00 53.69  ? 45   ARG F CD    1 
ATOM   3670  N  NE    . ARG F 2  46   ? 313.982 299.477 223.953 1.00 53.69  ? 45   ARG F NE    1 
ATOM   3671  C  CZ    . ARG F 2  46   ? 314.054 299.926 222.715 1.00 53.69  ? 45   ARG F CZ    1 
ATOM   3672  N  NH1   . ARG F 2  46   ? 314.992 300.794 222.376 1.00 53.69  ? 45   ARG F NH1   1 
ATOM   3673  N  NH2   . ARG F 2  46   ? 313.182 299.498 221.817 1.00 53.69  ? 45   ARG F NH2   1 
ATOM   3674  N  N     . ILE F 2  47   ? 311.701 301.611 228.363 1.00 53.43  ? 46   ILE F N     1 
ATOM   3675  C  CA    . ILE F 2  47   ? 310.353 301.291 228.800 1.00 53.43  ? 46   ILE F CA    1 
ATOM   3676  C  C     . ILE F 2  47   ? 309.517 301.021 227.572 1.00 53.43  ? 46   ILE F C     1 
ATOM   3677  O  O     . ILE F 2  47   ? 309.872 301.440 226.475 1.00 53.43  ? 46   ILE F O     1 
ATOM   3678  C  CB    . ILE F 2  47   ? 309.743 302.428 229.613 1.00 53.43  ? 46   ILE F CB    1 
ATOM   3679  C  CG1   . ILE F 2  47   ? 309.806 303.680 228.794 1.00 53.43  ? 46   ILE F CG1   1 
ATOM   3680  C  CG2   . ILE F 2  47   ? 310.536 302.689 230.836 1.00 53.43  ? 46   ILE F CG2   1 
ATOM   3681  C  CD1   . ILE F 2  47   ? 309.162 304.807 229.439 1.00 53.43  ? 46   ILE F CD1   1 
ATOM   3682  N  N     . SER F 2  48   ? 308.424 300.297 227.738 1.00 53.85  ? 47   SER F N     1 
ATOM   3683  C  CA    . SER F 2  48   ? 307.586 300.102 226.575 1.00 53.85  ? 47   SER F CA    1 
ATOM   3684  C  C     . SER F 2  48   ? 306.665 301.288 226.399 1.00 53.85  ? 47   SER F C     1 
ATOM   3685  O  O     . SER F 2  48   ? 306.593 302.182 227.237 1.00 53.85  ? 47   SER F O     1 
ATOM   3686  C  CB    . SER F 2  48   ? 306.757 298.839 226.679 1.00 53.85  ? 47   SER F CB    1 
ATOM   3687  O  OG    . SER F 2  48   ? 306.217 298.505 225.426 1.00 53.85  ? 47   SER F OG    1 
ATOM   3688  N  N     . GLY F 2  49   ? 305.942 301.287 225.288 1.00 53.43  ? 48   GLY F N     1 
ATOM   3689  C  CA    . GLY F 2  49   ? 305.053 302.396 225.020 1.00 53.43  ? 48   GLY F CA    1 
ATOM   3690  C  C     . GLY F 2  49   ? 303.719 302.225 225.701 1.00 53.43  ? 48   GLY F C     1 
ATOM   3691  O  O     . GLY F 2  49   ? 302.939 303.164 225.810 1.00 53.43  ? 48   GLY F O     1 
ATOM   3692  N  N     . LEU F 2  50   ? 303.427 301.018 226.148 1.00 52.22  ? 49   LEU F N     1 
ATOM   3693  C  CA    . LEU F 2  50   ? 302.129 300.758 226.749 1.00 52.22  ? 49   LEU F CA    1 
ATOM   3694  C  C     . LEU F 2  50   ? 302.262 300.464 228.224 1.00 52.22  ? 49   LEU F C     1 
ATOM   3695  O  O     . LEU F 2  50   ? 301.386 299.886 228.845 1.00 52.22  ? 49   LEU F O     1 
ATOM   3696  C  CB    . LEU F 2  50   ? 301.419 299.632 226.009 1.00 52.22  ? 49   LEU F CB    1 
ATOM   3697  C  CG    . LEU F 2  50   ? 301.847 298.170 225.985 1.00 52.22  ? 49   LEU F CG    1 
ATOM   3698  C  CD1   . LEU F 2  50   ? 300.651 297.358 225.596 1.00 52.22  ? 49   LEU F CD1   1 
ATOM   3699  C  CD2   . LEU F 2  50   ? 302.937 297.926 224.973 1.00 52.22  ? 49   LEU F CD2   1 
ATOM   3700  N  N     . ILE F 2  51   ? 303.384 300.883 228.786 1.00 54.98  ? 50   ILE F N     1 
ATOM   3701  C  CA    . ILE F 2  51   ? 303.583 300.881 230.218 1.00 54.98  ? 50   ILE F CA    1 
ATOM   3702  C  C     . ILE F 2  51   ? 302.694 301.897 230.881 1.00 54.98  ? 50   ILE F C     1 
ATOM   3703  O  O     . ILE F 2  51   ? 302.003 301.589 231.852 1.00 54.98  ? 50   ILE F O     1 
ATOM   3704  C  CB    . ILE F 2  51   ? 305.060 301.164 230.558 1.00 54.98  ? 50   ILE F CB    1 
ATOM   3705  C  CG1   . ILE F 2  51   ? 305.910 299.941 230.316 1.00 54.98  ? 50   ILE F CG1   1 
ATOM   3706  C  CG2   . ILE F 2  51   ? 305.215 301.603 231.996 1.00 54.98  ? 50   ILE F CG2   1 
ATOM   3707  C  CD1   . ILE F 2  51   ? 305.725 298.875 231.334 1.00 54.98  ? 50   ILE F CD1   1 
ATOM   3708  N  N     . TYR F 2  52   ? 302.663 303.107 230.334 1.00 59.26  ? 51   TYR F N     1 
ATOM   3709  C  CA    . TYR F 2  52   ? 302.319 304.238 231.171 1.00 59.26  ? 51   TYR F CA    1 
ATOM   3710  C  C     . TYR F 2  52   ? 300.830 304.335 231.406 1.00 59.26  ? 51   TYR F C     1 
ATOM   3711  O  O     . TYR F 2  52   ? 300.410 304.464 232.557 1.00 59.26  ? 51   TYR F O     1 
ATOM   3712  C  CB    . TYR F 2  52   ? 302.906 305.519 230.616 1.00 59.26  ? 51   TYR F CB    1 
ATOM   3713  C  CG    . TYR F 2  52   ? 302.435 306.070 229.312 1.00 59.26  ? 51   TYR F CG    1 
ATOM   3714  C  CD1   . TYR F 2  52   ? 302.777 305.491 228.109 1.00 59.26  ? 51   TYR F CD1   1 
ATOM   3715  C  CD2   . TYR F 2  52   ? 301.744 307.272 229.279 1.00 59.26  ? 51   TYR F CD2   1 
ATOM   3716  C  CE1   . TYR F 2  52   ? 302.387 306.075 226.898 1.00 59.26  ? 51   TYR F CE1   1 
ATOM   3717  C  CE2   . TYR F 2  52   ? 301.344 307.859 228.086 1.00 59.26  ? 51   TYR F CE2   1 
ATOM   3718  C  CZ    . TYR F 2  52   ? 301.666 307.256 226.903 1.00 59.26  ? 51   TYR F CZ    1 
ATOM   3719  O  OH    . TYR F 2  52   ? 301.262 307.837 225.729 1.00 59.26  ? 51   TYR F OH    1 
ATOM   3720  N  N     . GLU F 2  53   ? 300.012 304.108 230.385 1.00 60.12  ? 52   GLU F N     1 
ATOM   3721  C  CA    . GLU F 2  53   ? 298.571 304.035 230.618 1.00 60.12  ? 52   GLU F CA    1 
ATOM   3722  C  C     . GLU F 2  53   ? 298.187 302.814 231.433 1.00 60.12  ? 52   GLU F C     1 
ATOM   3723  O  O     . GLU F 2  53   ? 297.059 302.698 231.902 1.00 60.12  ? 52   GLU F O     1 
ATOM   3724  C  CB    . GLU F 2  53   ? 297.795 304.023 229.306 1.00 60.12  ? 52   GLU F CB    1 
ATOM   3725  C  CG    . GLU F 2  53   ? 297.378 305.405 228.833 1.00 60.12  ? 52   GLU F CG    1 
ATOM   3726  C  CD    . GLU F 2  53   ? 298.408 306.019 227.922 1.00 60.12  ? 52   GLU F CD    1 
ATOM   3727  O  OE1   . GLU F 2  53   ? 298.220 307.163 227.462 1.00 60.12  ? 52   GLU F OE1   1 
ATOM   3728  O  OE2   . GLU F 2  53   ? 299.407 305.327 227.657 1.00 60.12  ? 52   GLU F OE2   1 
ATOM   3729  N  N     . GLU F 2  54   ? 299.118 301.896 231.586 1.00 58.43  ? 53   GLU F N     1 
ATOM   3730  C  CA    . GLU F 2  54   ? 299.055 300.851 232.579 1.00 58.43  ? 53   GLU F CA    1 
ATOM   3731  C  C     . GLU F 2  54   ? 299.374 301.359 233.970 1.00 58.43  ? 53   GLU F C     1 
ATOM   3732  O  O     . GLU F 2  54   ? 298.561 301.188 234.873 1.00 58.43  ? 53   GLU F O     1 
ATOM   3733  C  CB    . GLU F 2  54   ? 300.029 299.738 232.196 1.00 58.43  ? 53   GLU F CB    1 
ATOM   3734  C  CG    . GLU F 2  54   ? 299.724 298.397 232.766 1.00 58.43  ? 53   GLU F CG    1 
ATOM   3735  C  CD    . GLU F 2  54   ? 300.262 298.250 234.140 1.00 58.43  ? 53   GLU F CD    1 
ATOM   3736  O  OE1   . GLU F 2  54   ? 301.220 298.978 234.450 1.00 58.43  ? 53   GLU F OE1   1 
ATOM   3737  O  OE2   . GLU F 2  54   ? 299.731 297.423 234.908 1.00 58.43  ? 53   GLU F OE2   1 
ATOM   3738  N  N     . THR F 2  55   ? 300.536 301.983 234.176 1.00 56.83  ? 54   THR F N     1 
ATOM   3739  C  CA    . THR F 2  55   ? 300.978 302.224 235.544 1.00 56.83  ? 54   THR F CA    1 
ATOM   3740  C  C     . THR F 2  55   ? 300.216 303.330 236.234 1.00 56.83  ? 54   THR F C     1 
ATOM   3741  O  O     . THR F 2  55   ? 300.231 303.371 237.468 1.00 56.83  ? 54   THR F O     1 
ATOM   3742  C  CB    . THR F 2  55   ? 302.451 302.568 235.627 1.00 56.83  ? 54   THR F CB    1 
ATOM   3743  O  OG1   . THR F 2  55   ? 302.746 302.917 236.975 1.00 56.83  ? 54   THR F OG1   1 
ATOM   3744  C  CG2   . THR F 2  55   ? 302.764 303.733 234.798 1.00 56.83  ? 54   THR F CG2   1 
ATOM   3745  N  N     . ARG F 2  56   ? 299.557 304.212 235.480 1.00 55.33  ? 55   ARG F N     1 
ATOM   3746  C  CA    . ARG F 2  56   ? 298.601 305.138 236.067 1.00 55.33  ? 55   ARG F CA    1 
ATOM   3747  C  C     . ARG F 2  56   ? 297.546 304.379 236.836 1.00 55.33  ? 55   ARG F C     1 
ATOM   3748  O  O     . ARG F 2  56   ? 297.255 304.706 237.992 1.00 55.33  ? 55   ARG F O     1 
ATOM   3749  C  CB    . ARG F 2  56   ? 297.952 305.978 234.983 1.00 55.33  ? 55   ARG F CB    1 
ATOM   3750  C  CG    . ARG F 2  56   ? 298.922 306.776 234.226 1.00 55.33  ? 55   ARG F CG    1 
ATOM   3751  C  CD    . ARG F 2  56   ? 298.251 307.778 233.397 1.00 55.33  ? 55   ARG F CD    1 
ATOM   3752  N  NE    . ARG F 2  56   ? 299.249 308.642 232.835 1.00 55.33  ? 55   ARG F NE    1 
ATOM   3753  C  CZ    . ARG F 2  56   ? 299.452 308.761 231.547 1.00 55.33  ? 55   ARG F CZ    1 
ATOM   3754  N  NH1   . ARG F 2  56   ? 298.703 308.082 230.717 1.00 55.33  ? 55   ARG F NH1   1 
ATOM   3755  N  NH2   . ARG F 2  56   ? 300.381 309.570 231.096 1.00 55.33  ? 55   ARG F NH2   1 
ATOM   3756  N  N     . GLY F 2  57   ? 297.042 303.303 236.228 1.00 56.31  ? 56   GLY F N     1 
ATOM   3757  C  CA    . GLY F 2  57   ? 296.117 302.426 236.911 1.00 56.31  ? 56   GLY F CA    1 
ATOM   3758  C  C     . GLY F 2  57   ? 296.695 301.860 238.185 1.00 56.31  ? 56   GLY F C     1 
ATOM   3759  O  O     . GLY F 2  57   ? 296.035 301.897 239.226 1.00 56.31  ? 56   GLY F O     1 
ATOM   3760  N  N     . VAL F 2  58   ? 297.971 301.461 238.148 1.00 55.09  ? 57   VAL F N     1 
ATOM   3761  C  CA    . VAL F 2  58   ? 298.632 300.948 239.341 1.00 55.09  ? 57   VAL F CA    1 
ATOM   3762  C  C     . VAL F 2  58   ? 298.691 302.022 240.401 1.00 55.09  ? 57   VAL F C     1 
ATOM   3763  O  O     . VAL F 2  58   ? 298.308 301.791 241.554 1.00 55.09  ? 57   VAL F O     1 
ATOM   3764  C  CB    . VAL F 2  58   ? 300.035 300.428 239.004 1.00 55.09  ? 57   VAL F CB    1 
ATOM   3765  C  CG1   . VAL F 2  58   ? 300.781 300.135 240.253 1.00 55.09  ? 57   VAL F CG1   1 
ATOM   3766  C  CG2   . VAL F 2  58   ? 299.942 299.192 238.177 1.00 55.09  ? 57   VAL F CG2   1 
ATOM   3767  N  N     . LEU F 2  59   ? 299.006 303.248 239.983 1.00 56.05  ? 58   LEU F N     1 
ATOM   3768  C  CA    . LEU F 2  59   ? 299.083 304.333 240.942 1.00 56.05  ? 58   LEU F CA    1 
ATOM   3769  C  C     . LEU F 2  59   ? 297.721 304.635 241.511 1.00 56.05  ? 58   LEU F C     1 
ATOM   3770  O  O     . LEU F 2  59   ? 297.601 304.873 242.718 1.00 56.05  ? 58   LEU F O     1 
ATOM   3771  C  CB    . LEU F 2  59   ? 299.673 305.578 240.307 1.00 56.05  ? 58   LEU F CB    1 
ATOM   3772  C  CG    . LEU F 2  59   ? 299.912 306.720 241.287 1.00 56.05  ? 58   LEU F CG    1 
ATOM   3773  C  CD1   . LEU F 2  59   ? 300.586 306.258 242.553 1.00 56.05  ? 58   LEU F CD1   1 
ATOM   3774  C  CD2   . LEU F 2  59   ? 300.776 307.719 240.629 1.00 56.05  ? 58   LEU F CD2   1 
ATOM   3775  N  N     . LYS F 2  60   ? 296.681 304.505 240.685 1.00 57.88  ? 59   LYS F N     1 
ATOM   3776  C  CA    . LYS F 2  60   ? 295.325 304.703 241.164 1.00 57.88  ? 59   LYS F CA    1 
ATOM   3777  C  C     . LYS F 2  60   ? 295.006 303.701 242.251 1.00 57.88  ? 59   LYS F C     1 
ATOM   3778  O  O     . LYS F 2  60   ? 294.683 304.084 243.378 1.00 57.88  ? 59   LYS F O     1 
ATOM   3779  C  CB    . LYS F 2  60   ? 294.350 304.572 240.009 1.00 57.88  ? 59   LYS F CB    1 
ATOM   3780  C  CG    . LYS F 2  60   ? 293.146 305.438 240.105 1.00 57.88  ? 59   LYS F CG    1 
ATOM   3781  C  CD    . LYS F 2  60   ? 292.410 305.413 238.791 1.00 57.88  ? 59   LYS F CD    1 
ATOM   3782  C  CE    . LYS F 2  60   ? 291.006 305.951 238.930 1.00 57.88  ? 59   LYS F CE    1 
ATOM   3783  N  NZ    . LYS F 2  60   ? 290.059 304.911 239.404 1.00 57.88  ? 59   LYS F NZ    1 
ATOM   3784  N  N     . VAL F 2  61   ? 295.310 302.431 242.004 1.00 56.68  ? 60   VAL F N     1 
ATOM   3785  C  CA    . VAL F 2  61   ? 294.956 301.456 243.011 1.00 56.68  ? 60   VAL F CA    1 
ATOM   3786  C  C     . VAL F 2  61   ? 295.961 301.456 244.130 1.00 56.68  ? 60   VAL F C     1 
ATOM   3787  O  O     . VAL F 2  61   ? 295.716 300.822 245.155 1.00 56.68  ? 60   VAL F O     1 
ATOM   3788  C  CB    . VAL F 2  61   ? 294.811 300.052 242.418 1.00 56.68  ? 60   VAL F CB    1 
ATOM   3789  C  CG1   . VAL F 2  61   ? 294.021 300.118 241.136 1.00 56.68  ? 60   VAL F CG1   1 
ATOM   3790  C  CG2   . VAL F 2  61   ? 296.145 299.420 242.192 1.00 56.68  ? 60   VAL F CG2   1 
ATOM   3791  N  N     . PHE F 2  62   ? 297.078 302.168 243.986 1.00 56.10  ? 61   PHE F N     1 
ATOM   3792  C  CA    . PHE F 2  62   ? 297.899 302.304 245.168 1.00 56.10  ? 61   PHE F CA    1 
ATOM   3793  C  C     . PHE F 2  62   ? 297.310 303.328 246.095 1.00 56.10  ? 61   PHE F C     1 
ATOM   3794  O  O     . PHE F 2  62   ? 297.411 303.192 247.314 1.00 56.10  ? 61   PHE F O     1 
ATOM   3795  C  CB    . PHE F 2  62   ? 299.327 302.711 244.850 1.00 56.10  ? 61   PHE F CB    1 
ATOM   3796  C  CG    . PHE F 2  62   ? 300.107 303.070 246.071 1.00 56.10  ? 61   PHE F CG    1 
ATOM   3797  C  CD1   . PHE F 2  62   ? 300.414 302.111 246.998 1.00 56.10  ? 61   PHE F CD1   1 
ATOM   3798  C  CD2   . PHE F 2  62   ? 300.456 304.370 246.336 1.00 56.10  ? 61   PHE F CD2   1 
ATOM   3799  C  CE1   . PHE F 2  62   ? 301.092 302.426 248.131 1.00 56.10  ? 61   PHE F CE1   1 
ATOM   3800  C  CE2   . PHE F 2  62   ? 301.128 304.685 247.477 1.00 56.10  ? 61   PHE F CE2   1 
ATOM   3801  C  CZ    . PHE F 2  62   ? 301.448 303.710 248.367 1.00 56.10  ? 61   PHE F CZ    1 
ATOM   3802  N  N     . LEU F 2  63   ? 296.725 304.379 245.561 1.00 57.79  ? 62   LEU F N     1 
ATOM   3803  C  CA    . LEU F 2  63   ? 296.448 305.438 246.499 1.00 57.79  ? 62   LEU F CA    1 
ATOM   3804  C  C     . LEU F 2  63   ? 294.994 305.533 246.885 1.00 57.79  ? 62   LEU F C     1 
ATOM   3805  O  O     . LEU F 2  63   ? 294.729 306.076 247.958 1.00 57.79  ? 62   LEU F O     1 
ATOM   3806  C  CB    . LEU F 2  63   ? 296.992 306.767 245.991 1.00 57.79  ? 62   LEU F CB    1 
ATOM   3807  C  CG    . LEU F 2  63   ? 296.738 307.375 244.640 1.00 57.79  ? 62   LEU F CG    1 
ATOM   3808  C  CD1   . LEU F 2  63   ? 295.499 308.145 244.654 1.00 57.79  ? 62   LEU F CD1   1 
ATOM   3809  C  CD2   . LEU F 2  63   ? 297.874 308.286 244.367 1.00 57.79  ? 62   LEU F CD2   1 
ATOM   3810  N  N     . GLU F 2  64   ? 294.085 304.998 246.057 1.00 60.56  ? 63   GLU F N     1 
ATOM   3811  C  CA    . GLU F 2  64   ? 292.670 304.901 246.402 1.00 60.56  ? 63   GLU F CA    1 
ATOM   3812  C  C     . GLU F 2  64   ? 292.486 304.314 247.776 1.00 60.56  ? 63   GLU F C     1 
ATOM   3813  O  O     . GLU F 2  64   ? 292.064 305.021 248.692 1.00 60.56  ? 63   GLU F O     1 
ATOM   3814  C  CB    . GLU F 2  64   ? 291.916 304.050 245.388 1.00 60.56  ? 63   GLU F CB    1 
ATOM   3815  C  CG    . GLU F 2  64   ? 291.643 304.720 244.066 1.00 60.56  ? 63   GLU F CG    1 
ATOM   3816  C  CD    . GLU F 2  64   ? 290.320 304.317 243.455 1.00 60.56  ? 63   GLU F CD    1 
ATOM   3817  O  OE1   . GLU F 2  64   ? 289.476 305.209 243.213 1.00 60.56  ? 63   GLU F OE1   1 
ATOM   3818  O  OE2   . GLU F 2  64   ? 290.123 303.109 243.212 1.00 60.56  ? 63   GLU F OE2   1 
ATOM   3819  N  N     . ASN F 2  65   ? 292.947 303.082 247.965 1.00 58.71  ? 64   ASN F N     1 
ATOM   3820  C  CA    . ASN F 2  65   ? 292.895 302.441 249.270 1.00 58.71  ? 64   ASN F CA    1 
ATOM   3821  C  C     . ASN F 2  65   ? 293.655 303.214 250.324 1.00 58.71  ? 64   ASN F C     1 
ATOM   3822  O  O     . ASN F 2  65   ? 293.137 303.362 251.435 1.00 58.71  ? 64   ASN F O     1 
ATOM   3823  C  CB    . ASN F 2  65   ? 293.445 301.035 249.198 1.00 58.71  ? 64   ASN F CB    1 
ATOM   3824  C  CG    . ASN F 2  65   ? 294.627 300.957 248.338 1.00 58.71  ? 64   ASN F CG    1 
ATOM   3825  O  OD1   . ASN F 2  65   ? 294.985 301.938 247.725 1.00 58.71  ? 64   ASN F OD1   1 
ATOM   3826  N  ND2   . ASN F 2  65   ? 295.247 299.800 248.266 1.00 58.71  ? 64   ASN F ND2   1 
ATOM   3827  N  N     . VAL F 2  66   ? 294.797 303.808 249.970 1.00 55.53  ? 65   VAL F N     1 
ATOM   3828  C  CA    . VAL F 2  66   ? 295.531 304.583 250.962 1.00 55.53  ? 65   VAL F CA    1 
ATOM   3829  C  C     . VAL F 2  66   ? 294.729 305.800 251.365 1.00 55.53  ? 65   VAL F C     1 
ATOM   3830  O  O     . VAL F 2  66   ? 294.494 306.024 252.558 1.00 55.53  ? 65   VAL F O     1 
ATOM   3831  C  CB    . VAL F 2  66   ? 296.915 304.959 250.435 1.00 55.53  ? 65   VAL F CB    1 
ATOM   3832  C  CG1   . VAL F 2  66   ? 297.461 306.106 251.204 1.00 55.53  ? 65   VAL F CG1   1 
ATOM   3833  C  CG2   . VAL F 2  66   ? 297.819 303.799 250.589 1.00 55.53  ? 65   VAL F CG2   1 
ATOM   3834  N  N     . ILE F 2  67   ? 294.158 306.495 250.377 1.00 56.37  ? 66   ILE F N     1 
ATOM   3835  C  CA    . ILE F 2  67   ? 293.331 307.651 250.668 1.00 56.37  ? 66   ILE F CA    1 
ATOM   3836  C  C     . ILE F 2  67   ? 292.106 307.209 251.412 1.00 56.37  ? 66   ILE F C     1 
ATOM   3837  O  O     . ILE F 2  67   ? 291.720 307.855 252.391 1.00 56.37  ? 66   ILE F O     1 
ATOM   3838  C  CB    . ILE F 2  67   ? 292.980 308.400 249.378 1.00 56.37  ? 66   ILE F CB    1 
ATOM   3839  C  CG1   . ILE F 2  67   ? 294.180 309.197 248.913 1.00 56.37  ? 66   ILE F CG1   1 
ATOM   3840  C  CG2   . ILE F 2  67   ? 291.834 309.328 249.571 1.00 56.37  ? 66   ILE F CG2   1 
ATOM   3841  C  CD1   . ILE F 2  67   ? 293.935 309.959 247.671 1.00 56.37  ? 66   ILE F CD1   1 
ATOM   3842  N  N     . ARG F 2  68   ? 291.603 306.017 251.081 1.00 58.39  ? 67   ARG F N     1 
ATOM   3843  C  CA    . ARG F 2  68   ? 290.408 305.508 251.728 1.00 58.39  ? 67   ARG F CA    1 
ATOM   3844  C  C     . ARG F 2  68   ? 290.654 305.315 253.200 1.00 58.39  ? 67   ARG F C     1 
ATOM   3845  O  O     . ARG F 2  68   ? 289.884 305.821 254.025 1.00 58.39  ? 67   ARG F O     1 
ATOM   3846  C  CB    . ARG F 2  68   ? 289.978 304.206 251.087 1.00 58.39  ? 67   ARG F CB    1 
ATOM   3847  C  CG    . ARG F 2  68   ? 288.995 303.455 251.886 1.00 58.39  ? 67   ARG F CG    1 
ATOM   3848  C  CD    . ARG F 2  68   ? 288.946 302.048 251.429 1.00 58.39  ? 67   ARG F CD    1 
ATOM   3849  N  NE    . ARG F 2  68   ? 288.895 301.983 249.981 1.00 58.39  ? 67   ARG F NE    1 
ATOM   3850  C  CZ    . ARG F 2  68   ? 289.518 301.063 249.259 1.00 58.39  ? 67   ARG F CZ    1 
ATOM   3851  N  NH1   . ARG F 2  68   ? 290.243 300.134 249.859 1.00 58.39  ? 67   ARG F NH1   1 
ATOM   3852  N  NH2   . ARG F 2  68   ? 289.414 301.069 247.939 1.00 58.39  ? 67   ARG F NH2   1 
ATOM   3853  N  N     . ASP F 2  69   ? 291.822 304.772 253.541 1.00 57.83  ? 68   ASP F N     1 
ATOM   3854  C  CA    . ASP F 2  69   ? 292.124 304.575 254.946 1.00 57.83  ? 68   ASP F CA    1 
ATOM   3855  C  C     . ASP F 2  69   ? 292.343 305.899 255.638 1.00 57.83  ? 68   ASP F C     1 
ATOM   3856  O  O     . ASP F 2  69   ? 291.838 306.098 256.746 1.00 57.83  ? 68   ASP F O     1 
ATOM   3857  C  CB    . ASP F 2  69   ? 293.331 303.674 255.099 1.00 57.83  ? 68   ASP F CB    1 
ATOM   3858  C  CG    . ASP F 2  69   ? 293.115 302.326 254.474 1.00 57.83  ? 68   ASP F CG    1 
ATOM   3859  O  OD1   . ASP F 2  69   ? 291.948 301.925 254.340 1.00 57.83  ? 68   ASP F OD1   1 
ATOM   3860  O  OD2   . ASP F 2  69   ? 294.104 301.663 254.112 1.00 57.83  ? 68   ASP F OD2   1 
ATOM   3861  N  N     . ALA F 2  70   ? 292.965 306.847 254.940 1.00 55.04  ? 69   ALA F N     1 
ATOM   3862  C  CA    . ALA F 2  70   ? 293.143 308.175 255.495 1.00 55.04  ? 69   ALA F CA    1 
ATOM   3863  C  C     . ALA F 2  70   ? 291.809 308.849 255.705 1.00 55.04  ? 69   ALA F C     1 
ATOM   3864  O  O     . ALA F 2  70   ? 291.592 309.485 256.741 1.00 55.04  ? 69   ALA F O     1 
ATOM   3865  C  CB    . ALA F 2  70   ? 294.013 309.009 254.576 1.00 55.04  ? 69   ALA F CB    1 
ATOM   3866  N  N     . VAL F 2  71   ? 290.874 308.635 254.780 1.00 54.21  ? 70   VAL F N     1 
ATOM   3867  C  CA    . VAL F 2  71   ? 289.555 309.216 254.946 1.00 54.21  ? 70   VAL F CA    1 
ATOM   3868  C  C     . VAL F 2  71   ? 288.853 308.568 256.114 1.00 54.21  ? 70   VAL F C     1 
ATOM   3869  O  O     . VAL F 2  71   ? 288.244 309.257 256.942 1.00 54.21  ? 70   VAL F O     1 
ATOM   3870  C  CB    . VAL F 2  71   ? 288.762 309.089 253.645 1.00 54.21  ? 70   VAL F CB    1 
ATOM   3871  C  CG1   . VAL F 2  71   ? 287.330 309.412 253.875 1.00 54.21  ? 70   VAL F CG1   1 
ATOM   3872  C  CG2   . VAL F 2  71   ? 289.317 310.045 252.646 1.00 54.21  ? 70   VAL F CG2   1 
ATOM   3873  N  N     . THR F 2  72   ? 289.045 307.259 256.277 1.00 52.75  ? 71   THR F N     1 
ATOM   3874  C  CA    . THR F 2  72   ? 288.510 306.580 257.442 1.00 52.75  ? 71   THR F CA    1 
ATOM   3875  C  C     . THR F 2  72   ? 289.127 307.128 258.703 1.00 52.75  ? 71   THR F C     1 
ATOM   3876  O  O     . THR F 2  72   ? 288.414 307.454 259.655 1.00 52.75  ? 71   THR F O     1 
ATOM   3877  C  CB    . THR F 2  72   ? 288.758 305.091 257.336 1.00 52.75  ? 71   THR F CB    1 
ATOM   3878  O  OG1   . THR F 2  72   ? 288.273 304.619 256.079 1.00 52.75  ? 71   THR F OG1   1 
ATOM   3879  C  CG2   . THR F 2  72   ? 288.066 304.385 258.442 1.00 52.75  ? 71   THR F CG2   1 
ATOM   3880  N  N     . TYR F 2  73   ? 290.423 307.416 258.652 1.00 54.56  ? 72   TYR F N     1 
ATOM   3881  C  CA    . TYR F 2  73   ? 291.106 307.883 259.841 1.00 54.56  ? 72   TYR F CA    1 
ATOM   3882  C  C     . TYR F 2  73   ? 290.702 309.298 260.168 1.00 54.56  ? 72   TYR F C     1 
ATOM   3883  O  O     . TYR F 2  73   ? 290.832 309.735 261.312 1.00 54.56  ? 72   TYR F O     1 
ATOM   3884  C  CB    . TYR F 2  73   ? 292.602 307.797 259.642 1.00 54.56  ? 72   TYR F CB    1 
ATOM   3885  C  CG    . TYR F 2  73   ? 293.201 306.576 260.229 1.00 54.56  ? 72   TYR F CG    1 
ATOM   3886  C  CD1   . TYR F 2  73   ? 293.255 306.412 261.586 1.00 54.56  ? 72   TYR F CD1   1 
ATOM   3887  C  CD2   . TYR F 2  73   ? 293.709 305.591 259.432 1.00 54.56  ? 72   TYR F CD2   1 
ATOM   3888  C  CE1   . TYR F 2  73   ? 293.806 305.305 262.135 1.00 54.56  ? 72   TYR F CE1   1 
ATOM   3889  C  CE2   . TYR F 2  73   ? 294.257 304.470 259.973 1.00 54.56  ? 72   TYR F CE2   1 
ATOM   3890  C  CZ    . TYR F 2  73   ? 294.299 304.333 261.332 1.00 54.56  ? 72   TYR F CZ    1 
ATOM   3891  O  OH    . TYR F 2  73   ? 294.855 303.213 261.896 1.00 54.56  ? 72   TYR F OH    1 
ATOM   3892  N  N     . THR F 2  74   ? 290.182 310.023 259.188 1.00 55.06  ? 73   THR F N     1 
ATOM   3893  C  CA    . THR F 2  74   ? 289.751 311.362 259.505 1.00 55.06  ? 73   THR F CA    1 
ATOM   3894  C  C     . THR F 2  74   ? 288.255 311.451 259.606 1.00 55.06  ? 73   THR F C     1 
ATOM   3895  O  O     . THR F 2  74   ? 287.734 312.520 259.911 1.00 55.06  ? 73   THR F O     1 
ATOM   3896  C  CB    . THR F 2  74   ? 290.274 312.355 258.487 1.00 55.06  ? 73   THR F CB    1 
ATOM   3897  O  OG1   . THR F 2  74   ? 290.089 313.675 258.990 1.00 55.06  ? 73   THR F OG1   1 
ATOM   3898  C  CG2   . THR F 2  74   ? 289.546 312.226 257.209 1.00 55.06  ? 73   THR F CG2   1 
ATOM   3899  N  N     . GLU F 2  75   ? 287.551 310.361 259.374 1.00 55.95  ? 74   GLU F N     1 
ATOM   3900  C  CA    . GLU F 2  75   ? 286.137 310.397 259.668 1.00 55.95  ? 74   GLU F CA    1 
ATOM   3901  C  C     . GLU F 2  75   ? 285.841 309.866 261.045 1.00 55.95  ? 74   GLU F C     1 
ATOM   3902  O  O     . GLU F 2  75   ? 284.790 310.181 261.596 1.00 55.95  ? 74   GLU F O     1 
ATOM   3903  C  CB    . GLU F 2  75   ? 285.352 309.604 258.637 1.00 55.95  ? 74   GLU F CB    1 
ATOM   3904  C  CG    . GLU F 2  75   ? 284.944 310.423 257.460 1.00 55.95  ? 74   GLU F CG    1 
ATOM   3905  C  CD    . GLU F 2  75   ? 283.992 311.526 257.834 1.00 55.95  ? 74   GLU F CD    1 
ATOM   3906  O  OE1   . GLU F 2  75   ? 284.190 312.672 257.383 1.00 55.95  ? 74   GLU F OE1   1 
ATOM   3907  O  OE2   . GLU F 2  75   ? 283.037 311.250 258.583 1.00 55.95  ? 74   GLU F OE2   1 
ATOM   3908  N  N     . HIS F 2  76   ? 286.742 309.070 261.609 1.00 52.99  ? 75   HIS F N     1 
ATOM   3909  C  CA    . HIS F 2  76   ? 286.586 308.713 263.003 1.00 52.99  ? 75   HIS F CA    1 
ATOM   3910  C  C     . HIS F 2  76   ? 286.890 309.893 263.900 1.00 52.99  ? 75   HIS F C     1 
ATOM   3911  O  O     . HIS F 2  76   ? 286.281 310.039 264.962 1.00 52.99  ? 75   HIS F O     1 
ATOM   3912  C  CB    . HIS F 2  76   ? 287.482 307.552 263.373 1.00 52.99  ? 75   HIS F CB    1 
ATOM   3913  C  CG    . HIS F 2  76   ? 287.285 307.099 264.777 1.00 52.99  ? 75   HIS F CG    1 
ATOM   3914  N  ND1   . HIS F 2  76   ? 288.322 306.716 265.589 1.00 52.99  ? 75   HIS F ND1   1 
ATOM   3915  C  CD2   . HIS F 2  76   ? 286.168 306.999 265.526 1.00 52.99  ? 75   HIS F CD2   1 
ATOM   3916  C  CE1   . HIS F 2  76   ? 287.852 306.394 266.776 1.00 52.99  ? 75   HIS F CE1   1 
ATOM   3917  N  NE2   . HIS F 2  76   ? 286.546 306.559 266.765 1.00 52.99  ? 75   HIS F NE2   1 
ATOM   3918  N  N     . ALA F 2  77   ? 287.796 310.762 263.492 1.00 54.16  ? 76   ALA F N     1 
ATOM   3919  C  CA    . ALA F 2  77   ? 288.006 311.948 264.295 1.00 54.16  ? 76   ALA F CA    1 
ATOM   3920  C  C     . ALA F 2  77   ? 287.000 313.020 263.991 1.00 54.16  ? 76   ALA F C     1 
ATOM   3921  O  O     . ALA F 2  77   ? 287.104 314.104 264.564 1.00 54.16  ? 76   ALA F O     1 
ATOM   3922  C  CB    . ALA F 2  77   ? 289.414 312.486 264.084 1.00 54.16  ? 76   ALA F CB    1 
ATOM   3923  N  N     . LYS F 2  78   ? 286.083 312.758 263.057 1.00 56.93  ? 77   LYS F N     1 
ATOM   3924  C  CA    . LYS F 2  78   ? 284.932 313.585 262.686 1.00 56.93  ? 77   LYS F CA    1 
ATOM   3925  C  C     . LYS F 2  78   ? 285.321 314.883 261.990 1.00 56.93  ? 77   LYS F C     1 
ATOM   3926  O  O     . LYS F 2  78   ? 284.447 315.619 261.536 1.00 56.93  ? 77   LYS F O     1 
ATOM   3927  C  CB    . LYS F 2  78   ? 284.024 313.895 263.884 1.00 56.93  ? 77   LYS F CB    1 
ATOM   3928  C  CG    . LYS F 2  78   ? 283.575 312.685 264.667 1.00 56.93  ? 77   LYS F CG    1 
ATOM   3929  C  CD    . LYS F 2  78   ? 282.779 313.072 265.896 1.00 56.93  ? 77   LYS F CD    1 
ATOM   3930  C  CE    . LYS F 2  78   ? 282.373 311.841 266.702 1.00 56.93  ? 77   LYS F CE    1 
ATOM   3931  N  NZ    . LYS F 2  78   ? 281.562 312.191 267.907 1.00 56.93  ? 77   LYS F NZ    1 
ATOM   3932  N  N     . ARG F 2  79   ? 286.601 315.182 261.854 1.00 58.56  ? 78   ARG F N     1 
ATOM   3933  C  CA    . ARG F 2  79   ? 287.031 316.468 261.353 1.00 58.56  ? 78   ARG F CA    1 
ATOM   3934  C  C     . ARG F 2  79   ? 287.117 316.415 259.844 1.00 58.56  ? 78   ARG F C     1 
ATOM   3935  O  O     . ARG F 2  79   ? 287.167 315.336 259.259 1.00 58.56  ? 78   ARG F O     1 
ATOM   3936  C  CB    . ARG F 2  79   ? 288.355 316.864 261.944 1.00 58.56  ? 78   ARG F CB    1 
ATOM   3937  C  CG    . ARG F 2  79   ? 289.324 315.772 261.939 1.00 58.56  ? 78   ARG F CG    1 
ATOM   3938  C  CD    . ARG F 2  79   ? 290.678 316.252 262.354 1.00 58.56  ? 78   ARG F CD    1 
ATOM   3939  N  NE    . ARG F 2  79   ? 291.560 315.126 262.596 1.00 58.56  ? 78   ARG F NE    1 
ATOM   3940  C  CZ    . ARG F 2  79   ? 292.182 314.438 261.645 1.00 58.56  ? 78   ARG F CZ    1 
ATOM   3941  N  NH1   . ARG F 2  79   ? 292.037 314.748 260.368 1.00 58.56  ? 78   ARG F NH1   1 
ATOM   3942  N  NH2   . ARG F 2  79   ? 292.958 313.427 261.975 1.00 58.56  ? 78   ARG F NH2   1 
ATOM   3943  N  N     . LYS F 2  80   ? 287.126 317.583 259.219 1.00 60.22  ? 79   LYS F N     1 
ATOM   3944  C  CA    . LYS F 2  80   ? 286.929 317.677 257.780 1.00 60.22  ? 79   LYS F CA    1 
ATOM   3945  C  C     . LYS F 2  80   ? 288.231 317.876 257.032 1.00 60.22  ? 79   LYS F C     1 
ATOM   3946  O  O     . LYS F 2  80   ? 288.232 318.117 255.835 1.00 60.22  ? 79   LYS F O     1 
ATOM   3947  C  CB    . LYS F 2  80   ? 285.962 318.806 257.486 1.00 60.22  ? 79   LYS F CB    1 
ATOM   3948  C  CG    . LYS F 2  80   ? 284.643 318.671 258.196 1.00 60.22  ? 79   LYS F CG    1 
ATOM   3949  C  CD    . LYS F 2  80   ? 283.657 317.892 257.332 1.00 60.22  ? 79   LYS F CD    1 
ATOM   3950  C  CE    . LYS F 2  80   ? 282.269 317.898 257.927 1.00 60.22  ? 79   LYS F CE    1 
ATOM   3951  N  NZ    . LYS F 2  80   ? 281.338 317.035 257.160 1.00 60.22  ? 79   LYS F NZ    1 
ATOM   3952  N  N     . THR F 2  81   ? 289.359 317.764 257.718 1.00 59.70  ? 80   THR F N     1 
ATOM   3953  C  CA    . THR F 2  81   ? 290.646 318.024 257.092 1.00 59.70  ? 80   THR F CA    1 
ATOM   3954  C  C     . THR F 2  81   ? 291.486 316.779 257.217 1.00 59.70  ? 80   THR F C     1 
ATOM   3955  O  O     . THR F 2  81   ? 291.666 316.275 258.323 1.00 59.70  ? 80   THR F O     1 
ATOM   3956  C  CB    . THR F 2  81   ? 291.371 319.177 257.751 1.00 59.70  ? 80   THR F CB    1 
ATOM   3957  O  OG1   . THR F 2  81   ? 290.524 320.318 257.774 1.00 59.70  ? 80   THR F OG1   1 
ATOM   3958  C  CG2   . THR F 2  81   ? 292.581 319.521 256.961 1.00 59.70  ? 80   THR F CG2   1 
ATOM   3959  N  N     . VAL F 2  82   ? 292.006 316.291 256.107 1.00 56.31  ? 81   VAL F N     1 
ATOM   3960  C  CA    . VAL F 2  82   ? 292.886 315.139 256.131 1.00 56.31  ? 81   VAL F CA    1 
ATOM   3961  C  C     . VAL F 2  82   ? 294.270 315.624 256.507 1.00 56.31  ? 81   VAL F C     1 
ATOM   3962  O  O     . VAL F 2  82   ? 294.974 316.188 255.678 1.00 56.31  ? 81   VAL F O     1 
ATOM   3963  C  CB    . VAL F 2  82   ? 292.900 314.428 254.788 1.00 56.31  ? 81   VAL F CB    1 
ATOM   3964  C  CG1   . VAL F 2  82   ? 293.776 313.236 254.882 1.00 56.31  ? 81   VAL F CG1   1 
ATOM   3965  C  CG2   . VAL F 2  82   ? 291.531 314.024 254.457 1.00 56.31  ? 81   VAL F CG2   1 
ATOM   3966  N  N     . THR F 2  83   ? 294.667 315.404 257.749 1.00 56.61  ? 82   THR F N     1 
ATOM   3967  C  CA    . THR F 2  83   ? 295.985 315.814 258.188 1.00 56.61  ? 82   THR F CA    1 
ATOM   3968  C  C     . THR F 2  83   ? 297.031 314.879 257.607 1.00 56.61  ? 82   THR F C     1 
ATOM   3969  O  O     . THR F 2  83   ? 296.720 313.860 256.997 1.00 56.61  ? 82   THR F O     1 
ATOM   3970  C  CB    . THR F 2  83   ? 296.062 315.805 259.699 1.00 56.61  ? 82   THR F CB    1 
ATOM   3971  O  OG1   . THR F 2  83   ? 295.623 314.536 260.162 1.00 56.61  ? 82   THR F OG1   1 
ATOM   3972  C  CG2   . THR F 2  83   ? 295.141 316.839 260.264 1.00 56.61  ? 82   THR F CG2   1 
ATOM   3973  N  N     . ALA F 2  84   ? 298.292 315.216 257.788 1.00 57.06  ? 83   ALA F N     1 
ATOM   3974  C  CA    . ALA F 2  84   ? 299.340 314.338 257.316 1.00 57.06  ? 83   ALA F CA    1 
ATOM   3975  C  C     . ALA F 2  84   ? 299.520 313.135 258.202 1.00 57.06  ? 83   ALA F C     1 
ATOM   3976  O  O     . ALA F 2  84   ? 300.026 312.113 257.736 1.00 57.06  ? 83   ALA F O     1 
ATOM   3977  C  CB    . ALA F 2  84   ? 300.659 315.083 257.223 1.00 57.06  ? 83   ALA F CB    1 
ATOM   3978  N  N     . MET F 2  85   ? 299.108 313.227 259.464 1.00 59.42  ? 84   MET F N     1 
ATOM   3979  C  CA    . MET F 2  85   ? 299.210 312.082 260.351 1.00 59.42  ? 84   MET F CA    1 
ATOM   3980  C  C     . MET F 2  85   ? 298.237 311.004 259.956 1.00 59.42  ? 84   MET F C     1 
ATOM   3981  O  O     . MET F 2  85   ? 298.500 309.823 260.164 1.00 59.42  ? 84   MET F O     1 
ATOM   3982  C  CB    . MET F 2  85   ? 298.965 312.499 261.791 1.00 59.42  ? 84   MET F CB    1 
ATOM   3983  C  CG    . MET F 2  85   ? 300.162 313.127 262.418 1.00 59.42  ? 84   MET F CG    1 
ATOM   3984  S  SD    . MET F 2  85   ? 301.657 312.270 261.928 1.00 59.42  ? 84   MET F SD    1 
ATOM   3985  C  CE    . MET F 2  85   ? 301.559 310.790 262.913 1.00 59.42  ? 84   MET F CE    1 
ATOM   3986  N  N     . ASP F 2  86   ? 297.112 311.388 259.373 1.00 57.79  ? 85   ASP F N     1 
ATOM   3987  C  CA    . ASP F 2  86   ? 296.177 310.399 258.869 1.00 57.79  ? 85   ASP F CA    1 
ATOM   3988  C  C     . ASP F 2  86   ? 296.779 309.632 257.712 1.00 57.79  ? 85   ASP F C     1 
ATOM   3989  O  O     . ASP F 2  86   ? 296.601 308.419 257.606 1.00 57.79  ? 85   ASP F O     1 
ATOM   3990  C  CB    . ASP F 2  86   ? 294.904 311.098 258.446 1.00 57.79  ? 85   ASP F CB    1 
ATOM   3991  C  CG    . ASP F 2  86   ? 294.296 311.854 259.572 1.00 57.79  ? 85   ASP F CG    1 
ATOM   3992  O  OD1   . ASP F 2  86   ? 294.515 311.445 260.718 1.00 57.79  ? 85   ASP F OD1   1 
ATOM   3993  O  OD2   . ASP F 2  86   ? 293.641 312.883 259.347 1.00 57.79  ? 85   ASP F OD2   1 
ATOM   3994  N  N     . VAL F 2  87   ? 297.553 310.310 256.879 1.00 56.23  ? 86   VAL F N     1 
ATOM   3995  C  CA    . VAL F 2  87   ? 298.233 309.637 255.790 1.00 56.23  ? 86   VAL F CA    1 
ATOM   3996  C  C     . VAL F 2  87   ? 299.331 308.740 256.316 1.00 56.23  ? 86   VAL F C     1 
ATOM   3997  O  O     . VAL F 2  87   ? 299.525 307.628 255.826 1.00 56.23  ? 86   VAL F O     1 
ATOM   3998  C  CB    . VAL F 2  87   ? 298.779 310.673 254.814 1.00 56.23  ? 86   VAL F CB    1 
ATOM   3999  C  CG1   . VAL F 2  87   ? 299.315 309.993 253.636 1.00 56.23  ? 86   VAL F CG1   1 
ATOM   4000  C  CG2   . VAL F 2  87   ? 297.676 311.576 254.413 1.00 56.23  ? 86   VAL F CG2   1 
ATOM   4001  N  N     . VAL F 2  88   ? 300.047 309.192 257.338 1.00 57.53  ? 87   VAL F N     1 
ATOM   4002  C  CA    . VAL F 2  88   ? 301.118 308.390 257.913 1.00 57.53  ? 87   VAL F CA    1 
ATOM   4003  C  C     . VAL F 2  88   ? 300.559 307.139 258.564 1.00 57.53  ? 87   VAL F C     1 
ATOM   4004  O  O     . VAL F 2  88   ? 301.093 306.042 258.384 1.00 57.53  ? 87   VAL F O     1 
ATOM   4005  C  CB    . VAL F 2  88   ? 301.921 309.241 258.901 1.00 57.53  ? 87   VAL F CB    1 
ATOM   4006  C  CG1   . VAL F 2  88   ? 302.785 308.388 259.766 1.00 57.53  ? 87   VAL F CG1   1 
ATOM   4007  C  CG2   . VAL F 2  88   ? 302.765 310.203 258.139 1.00 57.53  ? 87   VAL F CG2   1 
ATOM   4008  N  N     . TYR F 2  89   ? 299.436 307.269 259.266 1.00 56.31  ? 88   TYR F N     1 
ATOM   4009  C  CA    . TYR F 2  89   ? 298.802 306.117 259.889 1.00 56.31  ? 88   TYR F CA    1 
ATOM   4010  C  C     . TYR F 2  89   ? 298.231 305.175 258.854 1.00 56.31  ? 88   TYR F C     1 
ATOM   4011  O  O     . TYR F 2  89   ? 298.260 303.958 259.037 1.00 56.31  ? 88   TYR F O     1 
ATOM   4012  C  CB    . TYR F 2  89   ? 297.689 306.568 260.807 1.00 56.31  ? 88   TYR F CB    1 
ATOM   4013  C  CG    . TYR F 2  89   ? 298.149 307.298 262.007 1.00 56.31  ? 88   TYR F CG    1 
ATOM   4014  C  CD1   . TYR F 2  89   ? 299.386 307.052 262.545 1.00 56.31  ? 88   TYR F CD1   1 
ATOM   4015  C  CD2   . TYR F 2  89   ? 297.341 308.229 262.611 1.00 56.31  ? 88   TYR F CD2   1 
ATOM   4016  C  CE1   . TYR F 2  89   ? 299.815 307.719 263.653 1.00 56.31  ? 88   TYR F CE1   1 
ATOM   4017  C  CE2   . TYR F 2  89   ? 297.754 308.905 263.721 1.00 56.31  ? 88   TYR F CE2   1 
ATOM   4018  C  CZ    . TYR F 2  89   ? 298.996 308.647 264.240 1.00 56.31  ? 88   TYR F CZ    1 
ATOM   4019  O  OH    . TYR F 2  89   ? 299.425 309.317 265.357 1.00 56.31  ? 88   TYR F OH    1 
ATOM   4020  N  N     . ALA F 2  90   ? 297.708 305.715 257.762 1.00 56.74  ? 89   ALA F N     1 
ATOM   4021  C  CA    . ALA F 2  90   ? 297.181 304.865 256.713 1.00 56.74  ? 89   ALA F CA    1 
ATOM   4022  C  C     . ALA F 2  90   ? 298.292 304.140 255.991 1.00 56.74  ? 89   ALA F C     1 
ATOM   4023  O  O     . ALA F 2  90   ? 298.098 303.032 255.498 1.00 56.74  ? 89   ALA F O     1 
ATOM   4024  C  CB    . ALA F 2  90   ? 296.378 305.687 255.724 1.00 56.74  ? 89   ALA F CB    1 
ATOM   4025  N  N     . LEU F 2  91   ? 299.461 304.747 255.909 1.00 55.32  ? 90   LEU F N     1 
ATOM   4026  C  CA    . LEU F 2  91   ? 300.559 304.082 255.234 1.00 55.32  ? 90   LEU F CA    1 
ATOM   4027  C  C     . LEU F 2  91   ? 301.193 303.043 256.134 1.00 55.32  ? 90   LEU F C     1 
ATOM   4028  O  O     . LEU F 2  91   ? 301.635 301.995 255.670 1.00 55.32  ? 90   LEU F O     1 
ATOM   4029  C  CB    . LEU F 2  91   ? 301.577 305.108 254.794 1.00 55.32  ? 90   LEU F CB    1 
ATOM   4030  C  CG    . LEU F 2  91   ? 301.158 305.851 253.553 1.00 55.32  ? 90   LEU F CG    1 
ATOM   4031  C  CD1   . LEU F 2  91   ? 301.886 307.133 253.543 1.00 55.32  ? 90   LEU F CD1   1 
ATOM   4032  C  CD2   . LEU F 2  91   ? 301.497 305.038 252.365 1.00 55.32  ? 90   LEU F CD2   1 
ATOM   4033  N  N     . LYS F 2  92   ? 301.240 303.318 257.431 1.00 55.73  ? 91   LYS F N     1 
ATOM   4034  C  CA    . LYS F 2  92   ? 301.681 302.321 258.392 1.00 55.73  ? 91   LYS F CA    1 
ATOM   4035  C  C     . LYS F 2  92   ? 300.722 301.156 258.437 1.00 55.73  ? 91   LYS F C     1 
ATOM   4036  O  O     . LYS F 2  92   ? 301.112 300.032 258.751 1.00 55.73  ? 91   LYS F O     1 
ATOM   4037  C  CB    . LYS F 2  92   ? 301.780 302.952 259.771 1.00 55.73  ? 91   LYS F CB    1 
ATOM   4038  C  CG    . LYS F 2  92   ? 302.548 302.165 260.788 1.00 55.73  ? 91   LYS F CG    1 
ATOM   4039  C  CD    . LYS F 2  92   ? 302.270 302.679 262.178 1.00 55.73  ? 91   LYS F CD    1 
ATOM   4040  C  CE    . LYS F 2  92   ? 302.556 304.156 262.302 1.00 55.73  ? 91   LYS F CE    1 
ATOM   4041  N  NZ    . LYS F 2  92   ? 302.004 304.718 263.561 1.00 55.73  ? 91   LYS F NZ    1 
ATOM   4042  N  N     . ARG F 2  93   ? 299.462 301.413 258.127 1.00 56.61  ? 92   ARG F N     1 
ATOM   4043  C  CA    . ARG F 2  93   ? 298.467 300.364 258.030 1.00 56.61  ? 92   ARG F CA    1 
ATOM   4044  C  C     . ARG F 2  93   ? 298.751 299.438 256.855 1.00 56.61  ? 92   ARG F C     1 
ATOM   4045  O  O     . ARG F 2  93   ? 298.594 298.222 256.970 1.00 56.61  ? 92   ARG F O     1 
ATOM   4046  C  CB    . ARG F 2  93   ? 297.101 301.029 257.921 1.00 56.61  ? 92   ARG F CB    1 
ATOM   4047  C  CG    . ARG F 2  93   ? 296.014 300.135 257.590 1.00 56.61  ? 92   ARG F CG    1 
ATOM   4048  C  CD    . ARG F 2  93   ? 295.648 299.275 258.748 1.00 56.61  ? 92   ARG F CD    1 
ATOM   4049  N  NE    . ARG F 2  93   ? 295.401 297.927 258.277 1.00 56.61  ? 92   ARG F NE    1 
ATOM   4050  C  CZ    . ARG F 2  93   ? 294.287 297.524 257.687 1.00 56.61  ? 92   ARG F CZ    1 
ATOM   4051  N  NH1   . ARG F 2  93   ? 293.291 298.367 257.484 1.00 56.61  ? 92   ARG F NH1   1 
ATOM   4052  N  NH2   . ARG F 2  93   ? 294.179 296.272 257.281 1.00 56.61  ? 92   ARG F NH2   1 
ATOM   4053  N  N     . GLN F 2  94   ? 299.218 299.978 255.731 1.00 57.82  ? 93   GLN F N     1 
ATOM   4054  C  CA    . GLN F 2  94   ? 299.539 299.131 254.582 1.00 57.82  ? 93   GLN F CA    1 
ATOM   4055  C  C     . GLN F 2  94   ? 300.833 298.374 254.739 1.00 57.82  ? 93   GLN F C     1 
ATOM   4056  O  O     . GLN F 2  94   ? 301.165 297.590 253.851 1.00 57.82  ? 93   GLN F O     1 
ATOM   4057  C  CB    . GLN F 2  94   ? 299.660 299.936 253.291 1.00 57.82  ? 93   GLN F CB    1 
ATOM   4058  C  CG    . GLN F 2  94   ? 298.641 300.997 253.084 1.00 57.82  ? 93   GLN F CG    1 
ATOM   4059  C  CD    . GLN F 2  94   ? 297.314 300.441 252.731 1.00 57.82  ? 93   GLN F CD    1 
ATOM   4060  O  OE1   . GLN F 2  94   ? 297.194 299.653 251.802 1.00 57.82  ? 93   GLN F OE1   1 
ATOM   4061  N  NE2   . GLN F 2  94   ? 296.295 300.831 253.474 1.00 57.82  ? 93   GLN F NE2   1 
ATOM   4062  N  N     . GLY F 2  95   ? 301.585 298.594 255.801 1.00 58.59  ? 94   GLY F N     1 
ATOM   4063  C  CA    . GLY F 2  95   ? 302.898 298.026 255.905 1.00 58.59  ? 94   GLY F CA    1 
ATOM   4064  C  C     . GLY F 2  95   ? 303.977 298.866 255.283 1.00 58.59  ? 94   GLY F C     1 
ATOM   4065  O  O     . GLY F 2  95   ? 305.106 298.394 255.166 1.00 58.59  ? 94   GLY F O     1 
ATOM   4066  N  N     . ARG F 2  96   ? 303.669 300.091 254.875 1.00 58.56  ? 95   ARG F N     1 
ATOM   4067  C  CA    . ARG F 2  96   ? 304.640 301.004 254.284 1.00 58.56  ? 95   ARG F CA    1 
ATOM   4068  C  C     . ARG F 2  96   ? 304.805 302.207 255.182 1.00 58.56  ? 95   ARG F C     1 
ATOM   4069  O  O     . ARG F 2  96   ? 304.183 303.232 254.935 1.00 58.56  ? 95   ARG F O     1 
ATOM   4070  C  CB    . ARG F 2  96   ? 304.196 301.435 252.959 1.00 58.56  ? 95   ARG F CB    1 
ATOM   4071  C  CG    . ARG F 2  96   ? 304.201 300.333 252.006 1.00 58.56  ? 95   ARG F CG    1 
ATOM   4072  C  CD    . ARG F 2  96   ? 303.808 300.769 250.641 1.00 58.56  ? 95   ARG F CD    1 
ATOM   4073  N  NE    . ARG F 2  96   ? 303.899 299.626 249.756 1.00 58.56  ? 95   ARG F NE    1 
ATOM   4074  C  CZ    . ARG F 2  96   ? 302.895 298.799 249.533 1.00 58.56  ? 95   ARG F CZ    1 
ATOM   4075  N  NH1   . ARG F 2  96   ? 301.727 299.011 250.112 1.00 58.56  ? 95   ARG F NH1   1 
ATOM   4076  N  NH2   . ARG F 2  96   ? 303.054 297.771 248.725 1.00 58.56  ? 95   ARG F NH2   1 
ATOM   4077  N  N     . THR F 2  97   ? 305.659 302.120 256.184 1.00 57.55  ? 96   THR F N     1 
ATOM   4078  C  CA    . THR F 2  97   ? 305.784 303.234 257.104 1.00 57.55  ? 96   THR F CA    1 
ATOM   4079  C  C     . THR F 2  97   ? 306.596 304.342 256.469 1.00 57.55  ? 96   THR F C     1 
ATOM   4080  O  O     . THR F 2  97   ? 307.543 304.088 255.730 1.00 57.55  ? 96   THR F O     1 
ATOM   4081  C  CB    . THR F 2  97   ? 306.454 302.792 258.376 1.00 57.55  ? 96   THR F CB    1 
ATOM   4082  O  OG1   . THR F 2  97   ? 307.855 302.756 258.140 1.00 57.55  ? 96   THR F OG1   1 
ATOM   4083  C  CG2   . THR F 2  97   ? 306.004 301.410 258.731 1.00 57.55  ? 96   THR F CG2   1 
ATOM   4084  N  N     . LEU F 2  98   ? 306.234 305.577 256.766 1.00 56.23  ? 97   LEU F N     1 
ATOM   4085  C  CA    . LEU F 2  98   ? 306.784 306.736 256.080 1.00 56.23  ? 97   LEU F CA    1 
ATOM   4086  C  C     . LEU F 2  98   ? 307.400 307.666 257.104 1.00 56.23  ? 97   LEU F C     1 
ATOM   4087  O  O     . LEU F 2  98   ? 306.708 308.143 258.000 1.00 56.23  ? 97   LEU F O     1 
ATOM   4088  C  CB    . LEU F 2  98   ? 305.694 307.441 255.300 1.00 56.23  ? 97   LEU F CB    1 
ATOM   4089  C  CG    . LEU F 2  98   ? 305.972 308.857 254.844 1.00 56.23  ? 97   LEU F CG    1 
ATOM   4090  C  CD1   . LEU F 2  98   ? 306.910 308.890 253.674 1.00 56.23  ? 97   LEU F CD1   1 
ATOM   4091  C  CD2   . LEU F 2  98   ? 304.671 309.474 254.476 1.00 56.23  ? 97   LEU F CD2   1 
ATOM   4092  N  N     . TYR F 2  99   ? 308.674 307.987 256.932 1.00 55.89  ? 98   TYR F N     1 
ATOM   4093  C  CA    . TYR F 2  99   ? 309.342 308.845 257.934 1.00 55.89  ? 98   TYR F CA    1 
ATOM   4094  C  C     . TYR F 2  99   ? 309.361 310.290 257.455 1.00 55.89  ? 98   TYR F C     1 
ATOM   4095  O  O     . TYR F 2  99   ? 309.262 310.508 256.252 1.00 55.89  ? 98   TYR F O     1 
ATOM   4096  C  CB    . TYR F 2  99   ? 310.778 308.390 258.171 1.00 55.89  ? 98   TYR F CB    1 
ATOM   4097  C  CG    . TYR F 2  99   ? 310.940 307.161 259.026 1.00 55.89  ? 98   TYR F CG    1 
ATOM   4098  C  CD1   . TYR F 2  99   ? 309.861 306.591 259.676 1.00 55.89  ? 98   TYR F CD1   1 
ATOM   4099  C  CD2   . TYR F 2  99   ? 312.187 306.589 259.207 1.00 55.89  ? 98   TYR F CD2   1 
ATOM   4100  C  CE1   . TYR F 2  99   ? 310.012 305.466 260.470 1.00 55.89  ? 98   TYR F CE1   1 
ATOM   4101  C  CE2   . TYR F 2  99   ? 312.356 305.468 259.999 1.00 55.89  ? 98   TYR F CE2   1 
ATOM   4102  C  CZ    . TYR F 2  99   ? 311.265 304.905 260.629 1.00 55.89  ? 98   TYR F CZ    1 
ATOM   4103  O  OH    . TYR F 2  99   ? 311.433 303.799 261.405 1.00 55.89  ? 98   TYR F OH    1 
ATOM   4104  N  N     . GLY F 2  100  ? 309.464 311.239 258.378 1.00 59.56  ? 99   GLY F N     1 
ATOM   4105  C  CA    . GLY F 2  100  ? 309.602 312.658 258.009 1.00 59.56  ? 99   GLY F CA    1 
ATOM   4106  C  C     . GLY F 2  100  ? 308.325 313.461 258.082 1.00 59.56  ? 99   GLY F C     1 
ATOM   4107  O  O     . GLY F 2  100  ? 308.427 314.698 258.061 1.00 59.56  ? 99   GLY F O     1 
ATOM   4108  N  N     . PHE F 2  101  ? 307.168 312.812 258.157 1.00 59.39  ? 100  PHE F N     1 
ATOM   4109  C  CA    . PHE F 2  101  ? 305.911 313.598 258.116 1.00 59.39  ? 100  PHE F CA    1 
ATOM   4110  C  C     . PHE F 2  101  ? 305.221 313.633 259.479 1.00 59.39  ? 100  PHE F C     1 
ATOM   4111  O  O     . PHE F 2  101  ? 304.176 314.287 259.597 1.00 59.39  ? 100  PHE F O     1 
ATOM   4112  C  CB    . PHE F 2  101  ? 305.066 313.201 256.907 1.00 59.39  ? 100  PHE F CB    1 
ATOM   4113  C  CG    . PHE F 2  101  ? 305.497 313.904 255.649 1.00 59.39  ? 100  PHE F CG    1 
ATOM   4114  C  CD1   . PHE F 2  101  ? 304.942 315.122 255.297 1.00 59.39  ? 100  PHE F CD1   1 
ATOM   4115  C  CD2   . PHE F 2  101  ? 306.486 313.372 254.844 1.00 59.39  ? 100  PHE F CD2   1 
ATOM   4116  C  CE1   . PHE F 2  101  ? 305.349 315.781 254.149 1.00 59.39  ? 100  PHE F CE1   1 
ATOM   4117  C  CE2   . PHE F 2  101  ? 306.896 314.035 253.701 1.00 59.39  ? 100  PHE F CE2   1 
ATOM   4118  C  CZ    . PHE F 2  101  ? 306.325 315.235 253.352 1.00 59.39  ? 100  PHE F CZ    1 
ATOM   4119  N  N     . GLY F 2  102  ? 305.812 312.989 260.482 1.00 63.96  ? 101  GLY F N     1 
ATOM   4120  C  CA    . GLY F 2  102  ? 305.237 313.010 261.839 1.00 63.96  ? 101  GLY F CA    1 
ATOM   4121  C  C     . GLY F 2  102  ? 305.882 311.968 262.736 1.00 63.96  ? 101  GLY F C     1 
ATOM   4122  O  O     . GLY F 2  102  ? 305.498 311.912 263.919 1.00 63.96  ? 101  GLY F O     1 
ATOM   4123  N  N     . LYS G 3  16   ? 267.869 287.382 279.031 1.00 71.37  ? 15   LYS G N     1 
ATOM   4124  C  CA    . LYS G 3  16   ? 268.712 287.437 280.217 1.00 71.37  ? 15   LYS G CA    1 
ATOM   4125  C  C     . LYS G 3  16   ? 270.150 287.770 279.868 1.00 71.37  ? 15   LYS G C     1 
ATOM   4126  O  O     . LYS G 3  16   ? 270.633 288.842 280.209 1.00 71.37  ? 15   LYS G O     1 
ATOM   4127  C  CB    . LYS G 3  16   ? 268.652 286.116 280.989 1.00 71.37  ? 15   LYS G CB    1 
ATOM   4128  C  CG    . LYS G 3  16   ? 269.612 286.019 282.181 1.00 71.37  ? 15   LYS G CG    1 
ATOM   4129  C  CD    . LYS G 3  16   ? 269.427 287.135 283.225 1.00 71.37  ? 15   LYS G CD    1 
ATOM   4130  C  CE    . LYS G 3  16   ? 268.147 286.995 284.028 1.00 71.37  ? 15   LYS G CE    1 
ATOM   4131  N  NZ    . LYS G 3  16   ? 268.219 285.887 285.013 1.00 71.37  ? 15   LYS G NZ    1 
ATOM   4132  N  N     . THR G 3  17   ? 270.840 286.862 279.197 1.00 65.73  ? 16   THR G N     1 
ATOM   4133  C  CA    . THR G 3  17   ? 272.250 287.064 278.946 1.00 65.73  ? 16   THR G CA    1 
ATOM   4134  C  C     . THR G 3  17   ? 272.459 287.991 277.775 1.00 65.73  ? 16   THR G C     1 
ATOM   4135  O  O     . THR G 3  17   ? 271.594 288.133 276.910 1.00 65.73  ? 16   THR G O     1 
ATOM   4136  C  CB    . THR G 3  17   ? 272.961 285.756 278.672 1.00 65.73  ? 16   THR G CB    1 
ATOM   4137  O  OG1   . THR G 3  17   ? 274.290 286.048 278.242 1.00 65.73  ? 16   THR G OG1   1 
ATOM   4138  C  CG2   . THR G 3  17   ? 272.261 285.001 277.601 1.00 65.73  ? 16   THR G CG2   1 
ATOM   4139  N  N     . ARG G 3  18   ? 273.637 288.606 277.743 1.00 63.91  ? 17   ARG G N     1 
ATOM   4140  C  CA    . ARG G 3  18   ? 273.873 289.705 276.821 1.00 63.91  ? 17   ARG G CA    1 
ATOM   4141  C  C     . ARG G 3  18   ? 274.003 289.232 275.387 1.00 63.91  ? 17   ARG G C     1 
ATOM   4142  O  O     . ARG G 3  18   ? 273.781 290.011 274.463 1.00 63.91  ? 17   ARG G O     1 
ATOM   4143  C  CB    . ARG G 3  18   ? 275.114 290.469 277.238 1.00 63.91  ? 17   ARG G CB    1 
ATOM   4144  C  CG    . ARG G 3  18   ? 274.974 291.168 278.548 1.00 63.91  ? 17   ARG G CG    1 
ATOM   4145  C  CD    . ARG G 3  18   ? 275.970 292.271 278.657 1.00 63.91  ? 17   ARG G CD    1 
ATOM   4146  N  NE    . ARG G 3  18   ? 277.274 291.759 279.022 1.00 63.91  ? 17   ARG G NE    1 
ATOM   4147  C  CZ    . ARG G 3  18   ? 278.395 292.449 278.908 1.00 63.91  ? 17   ARG G CZ    1 
ATOM   4148  N  NH1   . ARG G 3  18   ? 278.365 293.676 278.426 1.00 63.91  ? 17   ARG G NH1   1 
ATOM   4149  N  NH2   . ARG G 3  18   ? 279.542 291.913 279.275 1.00 63.91  ? 17   ARG G NH2   1 
ATOM   4150  N  N     . SER G 3  19   ? 274.358 287.976 275.175 1.00 60.12  ? 18   SER G N     1 
ATOM   4151  C  CA    . SER G 3  19   ? 274.328 287.450 273.823 1.00 60.12  ? 18   SER G CA    1 
ATOM   4152  C  C     . SER G 3  19   ? 272.907 287.223 273.364 1.00 60.12  ? 18   SER G C     1 
ATOM   4153  O  O     . SER G 3  19   ? 272.612 287.336 272.174 1.00 60.12  ? 18   SER G O     1 
ATOM   4154  C  CB    . SER G 3  19   ? 275.101 286.147 273.753 1.00 60.12  ? 18   SER G CB    1 
ATOM   4155  O  OG    . SER G 3  19   ? 276.484 286.384 273.769 1.00 60.12  ? 18   SER G OG    1 
ATOM   4156  N  N     . SER G 3  20   ? 272.021 286.883 274.285 1.00 63.45  ? 19   SER G N     1 
ATOM   4157  C  CA    . SER G 3  20   ? 270.636 286.695 273.901 1.00 63.45  ? 19   SER G CA    1 
ATOM   4158  C  C     . SER G 3  20   ? 269.895 288.012 273.893 1.00 63.45  ? 19   SER G C     1 
ATOM   4159  O  O     . SER G 3  20   ? 268.923 288.168 273.149 1.00 63.45  ? 19   SER G O     1 
ATOM   4160  C  CB    . SER G 3  20   ? 269.952 285.732 274.850 1.00 63.45  ? 19   SER G CB    1 
ATOM   4161  O  OG    . SER G 3  20   ? 269.462 286.448 275.963 1.00 63.45  ? 19   SER G OG    1 
ATOM   4162  N  N     . ARG G 3  21   ? 270.324 288.952 274.737 1.00 63.30  ? 20   ARG G N     1 
ATOM   4163  C  CA    . ARG G 3  21   ? 269.754 290.291 274.724 1.00 63.30  ? 20   ARG G CA    1 
ATOM   4164  C  C     . ARG G 3  21   ? 269.995 290.970 273.385 1.00 63.30  ? 20   ARG G C     1 
ATOM   4165  O  O     . ARG G 3  21   ? 269.089 291.574 272.806 1.00 63.30  ? 20   ARG G O     1 
ATOM   4166  C  CB    . ARG G 3  21   ? 270.354 291.110 275.852 1.00 63.30  ? 20   ARG G CB    1 
ATOM   4167  C  CG    . ARG G 3  21   ? 269.755 292.464 276.013 1.00 63.30  ? 20   ARG G CG    1 
ATOM   4168  C  CD    . ARG G 3  21   ? 270.262 293.105 277.267 1.00 63.30  ? 20   ARG G CD    1 
ATOM   4169  N  NE    . ARG G 3  21   ? 269.916 292.292 278.419 1.00 63.30  ? 20   ARG G NE    1 
ATOM   4170  C  CZ    . ARG G 3  21   ? 270.746 291.990 279.409 1.00 63.30  ? 20   ARG G CZ    1 
ATOM   4171  N  NH1   . ARG G 3  21   ? 271.986 292.444 279.403 1.00 63.30  ? 20   ARG G NH1   1 
ATOM   4172  N  NH2   . ARG G 3  21   ? 270.330 291.234 280.411 1.00 63.30  ? 20   ARG G NH2   1 
ATOM   4173  N  N     . ALA G 3  22   ? 271.204 290.855 272.866 1.00 58.28  ? 21   ALA G N     1 
ATOM   4174  C  CA    . ALA G 3  22   ? 271.512 291.353 271.540 1.00 58.28  ? 21   ALA G CA    1 
ATOM   4175  C  C     . ALA G 3  22   ? 271.105 290.393 270.455 1.00 58.28  ? 21   ALA G C     1 
ATOM   4176  O  O     . ALA G 3  22   ? 271.157 290.763 269.283 1.00 58.28  ? 21   ALA G O     1 
ATOM   4177  C  CB    . ALA G 3  22   ? 273.000 291.631 271.409 1.00 58.28  ? 21   ALA G CB    1 
ATOM   4178  N  N     . GLY G 3  23   ? 270.704 289.185 270.805 1.00 58.78  ? 22   GLY G N     1 
ATOM   4179  C  CA    . GLY G 3  23   ? 270.376 288.208 269.797 1.00 58.78  ? 22   GLY G CA    1 
ATOM   4180  C  C     . GLY G 3  23   ? 271.608 287.790 269.039 1.00 58.78  ? 22   GLY G C     1 
ATOM   4181  O  O     . GLY G 3  23   ? 271.765 288.144 267.873 1.00 58.78  ? 22   GLY G O     1 
ATOM   4182  N  N     . LEU G 3  24   ? 272.515 287.095 269.711 1.00 57.60  ? 23   LEU G N     1 
ATOM   4183  C  CA    . LEU G 3  24   ? 273.722 286.595 269.089 1.00 57.60  ? 23   LEU G CA    1 
ATOM   4184  C  C     . LEU G 3  24   ? 273.966 285.180 269.559 1.00 57.60  ? 23   LEU G C     1 
ATOM   4185  O  O     . LEU G 3  24   ? 273.255 284.649 270.410 1.00 57.60  ? 23   LEU G O     1 
ATOM   4186  C  CB    . LEU G 3  24   ? 274.941 287.431 269.445 1.00 57.60  ? 23   LEU G CB    1 
ATOM   4187  C  CG    . LEU G 3  24   ? 274.990 288.837 268.918 1.00 57.60  ? 23   LEU G CG    1 
ATOM   4188  C  CD1   . LEU G 3  24   ? 276.198 289.492 269.469 1.00 57.60  ? 23   LEU G CD1   1 
ATOM   4189  C  CD2   . LEU G 3  24   ? 275.060 288.794 267.439 1.00 57.60  ? 23   LEU G CD2   1 
ATOM   4190  N  N     . GLN G 3  25   ? 275.002 284.577 269.004 1.00 60.98  ? 24   GLN G N     1 
ATOM   4191  C  CA    . GLN G 3  25   ? 275.506 283.316 269.501 1.00 60.98  ? 24   GLN G CA    1 
ATOM   4192  C  C     . GLN G 3  25   ? 276.860 283.444 270.154 1.00 60.98  ? 24   GLN G C     1 
ATOM   4193  O  O     . GLN G 3  25   ? 277.144 282.696 271.077 1.00 60.98  ? 24   GLN G O     1 
ATOM   4194  C  CB    . GLN G 3  25   ? 275.595 282.297 268.370 1.00 60.98  ? 24   GLN G CB    1 
ATOM   4195  C  CG    . GLN G 3  25   ? 274.361 282.260 267.511 1.00 60.98  ? 24   GLN G CG    1 
ATOM   4196  C  CD    . GLN G 3  25   ? 273.111 282.021 268.313 1.00 60.98  ? 24   GLN G CD    1 
ATOM   4197  O  OE1   . GLN G 3  25   ? 273.036 281.089 269.104 1.00 60.98  ? 24   GLN G OE1   1 
ATOM   4198  N  NE2   . GLN G 3  25   ? 272.117 282.867 268.115 1.00 60.98  ? 24   GLN G NE2   1 
ATOM   4199  N  N     . PHE G 3  26   ? 277.683 284.382 269.716 1.00 58.60  ? 25   PHE G N     1 
ATOM   4200  C  CA    . PHE G 3  26   ? 278.982 284.567 270.320 1.00 58.60  ? 25   PHE G CA    1 
ATOM   4201  C  C     . PHE G 3  26   ? 278.841 285.208 271.691 1.00 58.60  ? 25   PHE G C     1 
ATOM   4202  O  O     . PHE G 3  26   ? 277.871 285.915 271.949 1.00 58.60  ? 25   PHE G O     1 
ATOM   4203  C  CB    . PHE G 3  26   ? 279.838 285.423 269.426 1.00 58.60  ? 25   PHE G CB    1 
ATOM   4204  C  CG    . PHE G 3  26   ? 280.724 284.636 268.580 1.00 58.60  ? 25   PHE G CG    1 
ATOM   4205  C  CD1   . PHE G 3  26   ? 280.200 283.796 267.634 1.00 58.60  ? 25   PHE G CD1   1 
ATOM   4206  C  CD2   . PHE G 3  26   ? 282.073 284.691 268.742 1.00 58.60  ? 25   PHE G CD2   1 
ATOM   4207  C  CE1   . PHE G 3  26   ? 281.010 283.043 266.844 1.00 58.60  ? 25   PHE G CE1   1 
ATOM   4208  C  CE2   . PHE G 3  26   ? 282.889 283.943 267.951 1.00 58.60  ? 25   PHE G CE2   1 
ATOM   4209  C  CZ    . PHE G 3  26   ? 282.353 283.117 267.001 1.00 58.60  ? 25   PHE G CZ    1 
ATOM   4210  N  N     . PRO G 3  27   ? 279.767 284.955 272.601 1.00 59.70  ? 26   PRO G N     1 
ATOM   4211  C  CA    . PRO G 3  27   ? 279.618 285.488 273.954 1.00 59.70  ? 26   PRO G CA    1 
ATOM   4212  C  C     . PRO G 3  27   ? 279.957 286.964 273.997 1.00 59.70  ? 26   PRO G C     1 
ATOM   4213  O  O     . PRO G 3  27   ? 281.067 287.375 273.655 1.00 59.70  ? 26   PRO G O     1 
ATOM   4214  C  CB    . PRO G 3  27   ? 280.609 284.646 274.765 1.00 59.70  ? 26   PRO G CB    1 
ATOM   4215  C  CG    . PRO G 3  27   ? 281.588 284.221 273.824 1.00 59.70  ? 26   PRO G CG    1 
ATOM   4216  C  CD    . PRO G 3  27   ? 280.913 284.040 272.525 1.00 59.70  ? 26   PRO G CD    1 
ATOM   4217  N  N     . VAL G 3  28   ? 278.982 287.776 274.388 1.00 57.93  ? 27   VAL G N     1 
ATOM   4218  C  CA    . VAL G 3  28   ? 279.267 289.170 274.663 1.00 57.93  ? 27   VAL G CA    1 
ATOM   4219  C  C     . VAL G 3  28   ? 280.117 289.278 275.903 1.00 57.93  ? 27   VAL G C     1 
ATOM   4220  O  O     . VAL G 3  28   ? 281.050 290.079 275.966 1.00 57.93  ? 27   VAL G O     1 
ATOM   4221  C  CB    . VAL G 3  28   ? 277.957 289.947 274.797 1.00 57.93  ? 27   VAL G CB    1 
ATOM   4222  C  CG1   . VAL G 3  28   ? 278.194 291.302 275.338 1.00 57.93  ? 27   VAL G CG1   1 
ATOM   4223  C  CG2   . VAL G 3  28   ? 277.311 290.048 273.467 1.00 57.93  ? 27   VAL G CG2   1 
ATOM   4224  N  N     . GLY G 3  29   ? 279.857 288.422 276.883 1.00 62.41  ? 28   GLY G N     1 
ATOM   4225  C  CA    . GLY G 3  29   ? 280.552 288.537 278.145 1.00 62.41  ? 28   GLY G CA    1 
ATOM   4226  C  C     . GLY G 3  29   ? 282.009 288.164 278.046 1.00 62.41  ? 28   GLY G C     1 
ATOM   4227  O  O     . GLY G 3  29   ? 282.865 288.843 278.605 1.00 62.41  ? 28   GLY G O     1 
ATOM   4228  N  N     . ARG G 3  30   ? 282.315 287.105 277.308 1.00 63.77  ? 29   ARG G N     1 
ATOM   4229  C  CA    . ARG G 3  30   ? 283.705 286.707 277.148 1.00 63.77  ? 29   ARG G CA    1 
ATOM   4230  C  C     . ARG G 3  30   ? 284.451 287.666 276.257 1.00 63.77  ? 29   ARG G C     1 
ATOM   4231  O  O     . ARG G 3  30   ? 285.646 287.866 276.443 1.00 63.77  ? 29   ARG G O     1 
ATOM   4232  C  CB    . ARG G 3  30   ? 283.794 285.309 276.575 1.00 63.77  ? 29   ARG G CB    1 
ATOM   4233  C  CG    . ARG G 3  30   ? 285.093 284.622 276.839 1.00 63.77  ? 29   ARG G CG    1 
ATOM   4234  C  CD    . ARG G 3  30   ? 285.319 283.506 275.843 1.00 63.77  ? 29   ARG G CD    1 
ATOM   4235  N  NE    . ARG G 3  30   ? 284.269 282.500 275.892 1.00 63.77  ? 29   ARG G NE    1 
ATOM   4236  C  CZ    . ARG G 3  30   ? 284.361 281.384 276.594 1.00 63.77  ? 29   ARG G CZ    1 
ATOM   4237  N  NH1   . ARG G 3  30   ? 285.447 281.149 277.295 1.00 63.77  ? 29   ARG G NH1   1 
ATOM   4238  N  NH2   . ARG G 3  30   ? 283.378 280.507 276.600 1.00 63.77  ? 29   ARG G NH2   1 
ATOM   4239  N  N     . VAL G 3  31   ? 283.766 288.298 275.311 1.00 57.33  ? 30   VAL G N     1 
ATOM   4240  C  CA    . VAL G 3  31   ? 284.427 289.300 274.489 1.00 57.33  ? 30   VAL G CA    1 
ATOM   4241  C  C     . VAL G 3  31   ? 284.707 290.542 275.310 1.00 57.33  ? 30   VAL G C     1 
ATOM   4242  O  O     . VAL G 3  31   ? 285.787 291.132 275.213 1.00 57.33  ? 30   VAL G O     1 
ATOM   4243  C  CB    . VAL G 3  31   ? 283.582 289.594 273.241 1.00 57.33  ? 30   VAL G CB    1 
ATOM   4244  C  CG1   . VAL G 3  31   ? 283.947 290.888 272.639 1.00 57.33  ? 30   VAL G CG1   1 
ATOM   4245  C  CG2   . VAL G 3  31   ? 283.794 288.515 272.229 1.00 57.33  ? 30   VAL G CG2   1 
ATOM   4246  N  N     . HIS G 3  32   ? 283.781 290.909 276.188 1.00 57.90  ? 31   HIS G N     1 
ATOM   4247  C  CA    . HIS G 3  32   ? 284.018 292.029 277.087 1.00 57.90  ? 31   HIS G CA    1 
ATOM   4248  C  C     . HIS G 3  32   ? 285.147 291.728 278.043 1.00 57.90  ? 31   HIS G C     1 
ATOM   4249  O  O     . HIS G 3  32   ? 285.970 292.597 278.326 1.00 57.90  ? 31   HIS G O     1 
ATOM   4250  C  CB    . HIS G 3  32   ? 282.759 292.354 277.866 1.00 57.90  ? 31   HIS G CB    1 
ATOM   4251  C  CG    . HIS G 3  32   ? 282.816 293.658 278.583 1.00 57.90  ? 31   HIS G CG    1 
ATOM   4252  N  ND1   . HIS G 3  32   ? 281.884 294.031 279.522 1.00 57.90  ? 31   HIS G ND1   1 
ATOM   4253  C  CD2   . HIS G 3  32   ? 283.686 294.685 278.491 1.00 57.90  ? 31   HIS G CD2   1 
ATOM   4254  C  CE1   . HIS G 3  32   ? 282.182 295.230 279.983 1.00 57.90  ? 31   HIS G CE1   1 
ATOM   4255  N  NE2   . HIS G 3  32   ? 283.270 295.650 279.373 1.00 57.90  ? 31   HIS G NE2   1 
ATOM   4256  N  N     . ARG G 3  33   ? 285.236 290.493 278.510 1.00 60.36  ? 32   ARG G N     1 
ATOM   4257  C  CA    . ARG G 3  33   ? 286.315 290.146 279.417 1.00 60.36  ? 32   ARG G CA    1 
ATOM   4258  C  C     . ARG G 3  33   ? 287.638 290.098 278.692 1.00 60.36  ? 32   ARG G C     1 
ATOM   4259  O  O     . ARG G 3  33   ? 288.668 290.470 279.251 1.00 60.36  ? 32   ARG G O     1 
ATOM   4260  C  CB    . ARG G 3  33   ? 286.037 288.813 280.083 1.00 60.36  ? 32   ARG G CB    1 
ATOM   4261  C  CG    . ARG G 3  33   ? 286.879 288.574 281.285 1.00 60.36  ? 32   ARG G CG    1 
ATOM   4262  C  CD    . ARG G 3  33   ? 286.991 287.112 281.568 1.00 60.36  ? 32   ARG G CD    1 
ATOM   4263  N  NE    . ARG G 3  33   ? 287.710 286.413 280.524 1.00 60.36  ? 32   ARG G NE    1 
ATOM   4264  C  CZ    . ARG G 3  33   ? 287.365 285.215 280.085 1.00 60.36  ? 32   ARG G CZ    1 
ATOM   4265  N  NH1   . ARG G 3  33   ? 286.308 284.612 280.591 1.00 60.36  ? 32   ARG G NH1   1 
ATOM   4266  N  NH2   . ARG G 3  33   ? 288.063 284.625 279.134 1.00 60.36  ? 32   ARG G NH2   1 
ATOM   4267  N  N     . LEU G 3  34   ? 287.635 289.692 277.438 1.00 57.19  ? 33   LEU G N     1 
ATOM   4268  C  CA    . LEU G 3  34   ? 288.889 289.646 276.721 1.00 57.19  ? 33   LEU G CA    1 
ATOM   4269  C  C     . LEU G 3  34   ? 289.345 291.021 276.289 1.00 57.19  ? 33   LEU G C     1 
ATOM   4270  O  O     . LEU G 3  34   ? 290.544 291.238 276.137 1.00 57.19  ? 33   LEU G O     1 
ATOM   4271  C  CB    . LEU G 3  34   ? 288.761 288.728 275.527 1.00 57.19  ? 33   LEU G CB    1 
ATOM   4272  C  CG    . LEU G 3  34   ? 288.836 287.281 275.968 1.00 57.19  ? 33   LEU G CG    1 
ATOM   4273  C  CD1   . LEU G 3  34   ? 288.440 286.403 274.846 1.00 57.19  ? 33   LEU G CD1   1 
ATOM   4274  C  CD2   . LEU G 3  34   ? 290.224 286.957 276.417 1.00 57.19  ? 33   LEU G CD2   1 
ATOM   4275  N  N     . LEU G 3  35   ? 288.433 291.965 276.127 1.00 56.58  ? 34   LEU G N     1 
ATOM   4276  C  CA    . LEU G 3  35   ? 288.871 293.333 275.921 1.00 56.58  ? 34   LEU G CA    1 
ATOM   4277  C  C     . LEU G 3  35   ? 289.309 293.976 277.225 1.00 56.58  ? 34   LEU G C     1 
ATOM   4278  O  O     . LEU G 3  35   ? 290.177 294.847 277.230 1.00 56.58  ? 34   LEU G O     1 
ATOM   4279  C  CB    . LEU G 3  35   ? 287.756 294.151 275.299 1.00 56.58  ? 34   LEU G CB    1 
ATOM   4280  C  CG    . LEU G 3  35   ? 287.303 293.739 273.918 1.00 56.58  ? 34   LEU G CG    1 
ATOM   4281  C  CD1   . LEU G 3  35   ? 286.194 294.634 273.514 1.00 56.58  ? 34   LEU G CD1   1 
ATOM   4282  C  CD2   . LEU G 3  35   ? 288.438 293.875 272.981 1.00 56.58  ? 34   LEU G CD2   1 
ATOM   4283  N  N     . ARG G 3  36   ? 288.697 293.586 278.335 1.00 61.38  ? 35   ARG G N     1 
ATOM   4284  C  CA    . ARG G 3  36   ? 289.089 294.152 279.614 1.00 61.38  ? 35   ARG G CA    1 
ATOM   4285  C  C     . ARG G 3  36   ? 290.448 293.648 280.042 1.00 61.38  ? 35   ARG G C     1 
ATOM   4286  O  O     . ARG G 3  36   ? 291.193 294.367 280.708 1.00 61.38  ? 35   ARG G O     1 
ATOM   4287  C  CB    . ARG G 3  36   ? 288.064 293.804 280.681 1.00 61.38  ? 35   ARG G CB    1 
ATOM   4288  C  CG    . ARG G 3  36   ? 287.027 294.848 280.957 1.00 61.38  ? 35   ARG G CG    1 
ATOM   4289  C  CD    . ARG G 3  36   ? 286.091 294.322 282.022 1.00 61.38  ? 35   ARG G CD    1 
ATOM   4290  N  NE    . ARG G 3  36   ? 285.101 295.310 282.426 1.00 61.38  ? 35   ARG G NE    1 
ATOM   4291  C  CZ    . ARG G 3  36   ? 285.155 296.015 283.554 1.00 61.38  ? 35   ARG G CZ    1 
ATOM   4292  N  NH1   . ARG G 3  36   ? 286.161 295.841 284.401 1.00 61.38  ? 35   ARG G NH1   1 
ATOM   4293  N  NH2   . ARG G 3  36   ? 284.201 296.895 283.836 1.00 61.38  ? 35   ARG G NH2   1 
ATOM   4294  N  N     . LYS G 3  37   ? 290.790 292.419 279.686 1.00 59.99  ? 36   LYS G N     1 
ATOM   4295  C  CA    . LYS G 3  37   ? 292.060 291.865 280.104 1.00 59.99  ? 36   LYS G CA    1 
ATOM   4296  C  C     . LYS G 3  37   ? 293.124 291.940 279.030 1.00 59.99  ? 36   LYS G C     1 
ATOM   4297  O  O     . LYS G 3  37   ? 294.304 291.816 279.351 1.00 59.99  ? 36   LYS G O     1 
ATOM   4298  C  CB    . LYS G 3  37   ? 291.890 290.409 280.549 1.00 59.99  ? 36   LYS G CB    1 
ATOM   4299  C  CG    . LYS G 3  37   ? 291.976 289.402 279.428 1.00 59.99  ? 36   LYS G CG    1 
ATOM   4300  C  CD    . LYS G 3  37   ? 291.992 287.968 279.914 1.00 59.99  ? 36   LYS G CD    1 
ATOM   4301  C  CE    . LYS G 3  37   ? 293.384 287.518 280.292 1.00 59.99  ? 36   LYS G CE    1 
ATOM   4302  N  NZ    . LYS G 3  37   ? 293.516 286.040 280.149 1.00 59.99  ? 36   LYS G NZ    1 
ATOM   4303  N  N     . GLY G 3  38   ? 292.756 292.171 277.776 1.00 59.48  ? 37   GLY G N     1 
ATOM   4304  C  CA    . GLY G 3  38   ? 293.773 292.273 276.753 1.00 59.48  ? 37   GLY G CA    1 
ATOM   4305  C  C     . GLY G 3  38   ? 294.515 293.580 276.770 1.00 59.48  ? 37   GLY G C     1 
ATOM   4306  O  O     . GLY G 3  38   ? 295.508 293.716 276.048 1.00 59.48  ? 37   GLY G O     1 
ATOM   4307  N  N     . ASN G 3  39   ? 294.033 294.532 277.568 1.00 60.79  ? 38   ASN G N     1 
ATOM   4308  C  CA    . ASN G 3  39   ? 294.638 295.830 277.820 1.00 60.79  ? 38   ASN G CA    1 
ATOM   4309  C  C     . ASN G 3  39   ? 294.810 296.597 276.511 1.00 60.79  ? 38   ASN G C     1 
ATOM   4310  O  O     . ASN G 3  39   ? 295.916 296.848 276.051 1.00 60.79  ? 38   ASN G O     1 
ATOM   4311  C  CB    . ASN G 3  39   ? 295.977 295.683 278.537 1.00 60.79  ? 38   ASN G CB    1 
ATOM   4312  C  CG    . ASN G 3  39   ? 296.287 296.858 279.410 1.00 60.79  ? 38   ASN G CG    1 
ATOM   4313  O  OD1   . ASN G 3  39   ? 295.475 297.762 279.582 1.00 60.79  ? 38   ASN G OD1   1 
ATOM   4314  N  ND2   . ASN G 3  39   ? 297.464 296.844 279.994 1.00 60.79  ? 38   ASN G ND2   1 
ATOM   4315  N  N     . TYR G 3  40   ? 293.678 296.910 275.905 1.00 55.79  ? 39   TYR G N     1 
ATOM   4316  C  CA    . TYR G 3  40   ? 293.658 297.680 274.677 1.00 55.79  ? 39   TYR G CA    1 
ATOM   4317  C  C     . TYR G 3  40   ? 293.421 299.156 274.911 1.00 55.79  ? 39   TYR G C     1 
ATOM   4318  O  O     . TYR G 3  40   ? 293.994 299.980 274.201 1.00 55.79  ? 39   TYR G O     1 
ATOM   4319  C  CB    . TYR G 3  40   ? 292.587 297.136 273.752 1.00 55.79  ? 39   TYR G CB    1 
ATOM   4320  C  CG    . TYR G 3  40   ? 292.785 295.692 273.435 1.00 55.79  ? 39   TYR G CG    1 
ATOM   4321  C  CD1   . TYR G 3  40   ? 293.795 295.293 272.599 1.00 55.79  ? 39   TYR G CD1   1 
ATOM   4322  C  CD2   . TYR G 3  40   ? 291.958 294.734 273.958 1.00 55.79  ? 39   TYR G CD2   1 
ATOM   4323  C  CE1   . TYR G 3  40   ? 293.975 293.984 272.295 1.00 55.79  ? 39   TYR G CE1   1 
ATOM   4324  C  CE2   . TYR G 3  40   ? 292.137 293.422 273.664 1.00 55.79  ? 39   TYR G CE2   1 
ATOM   4325  C  CZ    . TYR G 3  40   ? 293.145 293.057 272.835 1.00 55.79  ? 39   TYR G CZ    1 
ATOM   4326  O  OH    . TYR G 3  40   ? 293.323 291.738 272.540 1.00 55.79  ? 39   TYR G OH    1 
ATOM   4327  N  N     . ALA G 3  41   ? 292.591 299.509 275.882 1.00 58.49  ? 40   ALA G N     1 
ATOM   4328  C  CA    . ALA G 3  41   ? 292.478 300.886 276.323 1.00 58.49  ? 40   ALA G CA    1 
ATOM   4329  C  C     . ALA G 3  41   ? 292.098 300.866 277.787 1.00 58.49  ? 40   ALA G C     1 
ATOM   4330  O  O     . ALA G 3  41   ? 291.858 299.808 278.364 1.00 58.49  ? 40   ALA G O     1 
ATOM   4331  C  CB    . ALA G 3  41   ? 291.458 301.662 275.508 1.00 58.49  ? 40   ALA G CB    1 
ATOM   4332  N  N     . GLU G 3  42   ? 292.058 302.048 278.389 1.00 62.91  ? 41   GLU G N     1 
ATOM   4333  C  CA    . GLU G 3  42   ? 291.727 302.132 279.800 1.00 62.91  ? 41   GLU G CA    1 
ATOM   4334  C  C     . GLU G 3  42   ? 290.278 301.818 280.075 1.00 62.91  ? 41   GLU G C     1 
ATOM   4335  O  O     . GLU G 3  42   ? 289.979 301.174 281.080 1.00 62.91  ? 41   GLU G O     1 
ATOM   4336  C  CB    . GLU G 3  42   ? 292.045 303.520 280.333 1.00 62.91  ? 41   GLU G CB    1 
ATOM   4337  C  CG    . GLU G 3  42   ? 293.477 303.683 280.757 1.00 62.91  ? 41   GLU G CG    1 
ATOM   4338  C  CD    . GLU G 3  42   ? 294.377 304.092 279.620 1.00 62.91  ? 41   GLU G CD    1 
ATOM   4339  O  OE1   . GLU G 3  42   ? 293.849 304.353 278.523 1.00 62.91  ? 41   GLU G OE1   1 
ATOM   4340  O  OE2   . GLU G 3  42   ? 295.610 304.146 279.815 1.00 62.91  ? 41   GLU G OE2   1 
ATOM   4341  N  N     . ARG G 3  43   ? 289.384 302.217 279.192 1.00 61.62  ? 42   ARG G N     1 
ATOM   4342  C  CA    . ARG G 3  43   ? 287.970 301.991 279.390 1.00 61.62  ? 42   ARG G CA    1 
ATOM   4343  C  C     . ARG G 3  43   ? 287.440 301.291 278.159 1.00 61.62  ? 42   ARG G C     1 
ATOM   4344  O  O     . ARG G 3  43   ? 287.917 301.545 277.058 1.00 61.62  ? 42   ARG G O     1 
ATOM   4345  C  CB    . ARG G 3  43   ? 287.257 303.312 279.633 1.00 61.62  ? 42   ARG G CB    1 
ATOM   4346  C  CG    . ARG G 3  43   ? 287.468 303.843 281.015 1.00 61.62  ? 42   ARG G CG    1 
ATOM   4347  C  CD    . ARG G 3  43   ? 287.057 305.276 281.182 1.00 61.62  ? 42   ARG G CD    1 
ATOM   4348  N  NE    . ARG G 3  43   ? 285.658 305.528 280.875 1.00 61.62  ? 42   ARG G NE    1 
ATOM   4349  C  CZ    . ARG G 3  43   ? 284.993 306.591 281.313 1.00 61.62  ? 42   ARG G CZ    1 
ATOM   4350  N  NH1   . ARG G 3  43   ? 285.603 307.465 282.094 1.00 61.62  ? 42   ARG G NH1   1 
ATOM   4351  N  NH2   . ARG G 3  43   ? 283.723 306.780 280.998 1.00 61.62  ? 42   ARG G NH2   1 
ATOM   4352  N  N     . VAL G 3  44   ? 286.504 300.374 278.315 1.00 57.11  ? 43   VAL G N     1 
ATOM   4353  C  CA    . VAL G 3  44   ? 285.860 299.777 277.163 1.00 57.11  ? 43   VAL G CA    1 
ATOM   4354  C  C     . VAL G 3  44   ? 284.363 299.985 277.304 1.00 57.11  ? 43   VAL G C     1 
ATOM   4355  O  O     . VAL G 3  44   ? 283.787 299.840 278.378 1.00 57.11  ? 43   VAL G O     1 
ATOM   4356  C  CB    . VAL G 3  44   ? 286.250 298.294 276.988 1.00 57.11  ? 43   VAL G CB    1 
ATOM   4357  C  CG1   . VAL G 3  44   ? 285.906 297.476 278.193 1.00 57.11  ? 43   VAL G CG1   1 
ATOM   4358  C  CG2   . VAL G 3  44   ? 285.608 297.706 275.767 1.00 57.11  ? 43   VAL G CG2   1 
ATOM   4359  N  N     . GLY G 3  45   ? 283.745 300.421 276.221 1.00 54.07  ? 44   GLY G N     1 
ATOM   4360  C  CA    . GLY G 3  45   ? 282.369 300.846 276.257 1.00 54.07  ? 44   GLY G CA    1 
ATOM   4361  C  C     . GLY G 3  45   ? 281.411 299.697 276.419 1.00 54.07  ? 44   GLY G C     1 
ATOM   4362  O  O     . GLY G 3  45   ? 281.786 298.534 276.520 1.00 54.07  ? 44   GLY G O     1 
ATOM   4363  N  N     . ALA G 3  46   ? 280.132 300.035 276.456 1.00 52.99  ? 45   ALA G N     1 
ATOM   4364  C  CA    . ALA G 3  46   ? 279.136 298.994 276.634 1.00 52.99  ? 45   ALA G CA    1 
ATOM   4365  C  C     . ALA G 3  46   ? 278.870 298.269 275.334 1.00 52.99  ? 45   ALA G C     1 
ATOM   4366  O  O     . ALA G 3  46   ? 278.828 297.040 275.302 1.00 52.99  ? 45   ALA G O     1 
ATOM   4367  C  CB    . ALA G 3  46   ? 277.845 299.588 277.177 1.00 52.99  ? 45   ALA G CB    1 
ATOM   4368  N  N     . GLY G 3  47   ? 278.685 299.008 274.257 1.00 50.76  ? 46   GLY G N     1 
ATOM   4369  C  CA    . GLY G 3  47   ? 278.369 298.417 272.985 1.00 50.76  ? 46   GLY G CA    1 
ATOM   4370  C  C     . GLY G 3  47   ? 279.550 297.921 272.212 1.00 50.76  ? 46   GLY G C     1 
ATOM   4371  O  O     . GLY G 3  47   ? 279.390 297.362 271.124 1.00 50.76  ? 46   GLY G O     1 
ATOM   4372  N  N     . ALA G 3  48   ? 280.748 298.109 272.736 1.00 49.48  ? 47   ALA G N     1 
ATOM   4373  C  CA    . ALA G 3  48   ? 281.919 297.608 272.025 1.00 49.48  ? 47   ALA G CA    1 
ATOM   4374  C  C     . ALA G 3  48   ? 282.011 296.090 272.028 1.00 49.48  ? 47   ALA G C     1 
ATOM   4375  O  O     . ALA G 3  48   ? 282.317 295.523 270.966 1.00 49.48  ? 47   ALA G O     1 
ATOM   4376  C  CB    . ALA G 3  48   ? 283.180 298.268 272.574 1.00 49.48  ? 47   ALA G CB    1 
ATOM   4377  N  N     . PRO G 3  49   ? 281.747 295.365 273.128 1.00 49.86  ? 48   PRO G N     1 
ATOM   4378  C  CA    . PRO G 3  49   ? 281.684 293.915 272.981 1.00 49.86  ? 48   PRO G CA    1 
ATOM   4379  C  C     . PRO G 3  49   ? 280.520 293.415 272.163 1.00 49.86  ? 48   PRO G C     1 
ATOM   4380  O  O     . PRO G 3  49   ? 280.665 292.368 271.535 1.00 49.86  ? 48   PRO G O     1 
ATOM   4381  C  CB    . PRO G 3  49   ? 281.602 293.432 274.424 1.00 49.86  ? 48   PRO G CB    1 
ATOM   4382  C  CG    . PRO G 3  49   ? 281.146 294.532 275.147 1.00 49.86  ? 48   PRO G CG    1 
ATOM   4383  C  CD    . PRO G 3  49   ? 281.825 295.665 274.562 1.00 49.86  ? 48   PRO G CD    1 
ATOM   4384  N  N     . VAL G 3  50   ? 279.383 294.108 272.110 1.00 49.98  ? 49   VAL G N     1 
ATOM   4385  C  CA    . VAL G 3  50   ? 278.323 293.549 271.283 1.00 49.98  ? 49   VAL G CA    1 
ATOM   4386  C  C     . VAL G 3  50   ? 278.629 293.790 269.819 1.00 49.98  ? 49   VAL G C     1 
ATOM   4387  O  O     . VAL G 3  50   ? 278.327 292.941 268.975 1.00 49.98  ? 49   VAL G O     1 
ATOM   4388  C  CB    . VAL G 3  50   ? 276.935 294.072 271.689 1.00 49.98  ? 49   VAL G CB    1 
ATOM   4389  C  CG1   . VAL G 3  50   ? 276.735 293.891 273.150 1.00 49.98  ? 49   VAL G CG1   1 
ATOM   4390  C  CG2   . VAL G 3  50   ? 276.731 295.483 271.350 1.00 49.98  ? 49   VAL G CG2   1 
ATOM   4391  N  N     . TYR G 3  51   ? 279.337 294.871 269.505 1.00 51.00  ? 50   TYR G N     1 
ATOM   4392  C  CA    . TYR G 3  51   ? 279.778 295.075 268.140 1.00 51.00  ? 50   TYR G CA    1 
ATOM   4393  C  C     . TYR G 3  51   ? 280.809 294.040 267.751 1.00 51.00  ? 50   TYR G C     1 
ATOM   4394  O  O     . TYR G 3  51   ? 280.744 293.480 266.654 1.00 51.00  ? 50   TYR G O     1 
ATOM   4395  C  CB    . TYR G 3  51   ? 280.371 296.457 267.993 1.00 51.00  ? 50   TYR G CB    1 
ATOM   4396  C  CG    . TYR G 3  51   ? 280.195 297.069 266.639 1.00 51.00  ? 50   TYR G CG    1 
ATOM   4397  C  CD1   . TYR G 3  51   ? 280.860 296.576 265.546 1.00 51.00  ? 50   TYR G CD1   1 
ATOM   4398  C  CD2   . TYR G 3  51   ? 279.333 298.121 266.455 1.00 51.00  ? 50   TYR G CD2   1 
ATOM   4399  C  CE1   . TYR G 3  51   ? 280.691 297.124 264.340 1.00 51.00  ? 50   TYR G CE1   1 
ATOM   4400  C  CE2   . TYR G 3  51   ? 279.175 298.682 265.251 1.00 51.00  ? 50   TYR G CE2   1 
ATOM   4401  C  CZ    . TYR G 3  51   ? 279.851 298.175 264.200 1.00 51.00  ? 50   TYR G CZ    1 
ATOM   4402  O  OH    . TYR G 3  51   ? 279.680 298.739 262.976 1.00 51.00  ? 50   TYR G OH    1 
ATOM   4403  N  N     . LEU G 3  52   ? 281.748 293.755 268.649 1.00 50.83  ? 51   LEU G N     1 
ATOM   4404  C  CA    . LEU G 3  52   ? 282.766 292.760 268.361 1.00 50.83  ? 51   LEU G CA    1 
ATOM   4405  C  C     . LEU G 3  52   ? 282.177 291.379 268.235 1.00 50.83  ? 51   LEU G C     1 
ATOM   4406  O  O     . LEU G 3  52   ? 282.550 290.626 267.338 1.00 50.83  ? 51   LEU G O     1 
ATOM   4407  C  CB    . LEU G 3  52   ? 283.834 292.756 269.433 1.00 50.83  ? 51   LEU G CB    1 
ATOM   4408  C  CG    . LEU G 3  52   ? 285.159 293.268 268.932 1.00 50.83  ? 51   LEU G CG    1 
ATOM   4409  C  CD1   . LEU G 3  52   ? 286.130 293.294 270.046 1.00 50.83  ? 51   LEU G CD1   1 
ATOM   4410  C  CD2   . LEU G 3  52   ? 285.634 292.315 267.894 1.00 50.83  ? 51   LEU G CD2   1 
ATOM   4411  N  N     . ALA G 3  53   ? 281.260 291.023 269.125 1.00 52.89  ? 52   ALA G N     1 
ATOM   4412  C  CA    . ALA G 3  53   ? 280.674 289.696 269.081 1.00 52.89  ? 52   ALA G CA    1 
ATOM   4413  C  C     . ALA G 3  53   ? 279.874 289.499 267.811 1.00 52.89  ? 52   ALA G C     1 
ATOM   4414  O  O     . ALA G 3  53   ? 279.958 288.445 267.181 1.00 52.89  ? 52   ALA G O     1 
ATOM   4415  C  CB    . ALA G 3  53   ? 279.805 289.479 270.305 1.00 52.89  ? 52   ALA G CB    1 
ATOM   4416  N  N     . ALA G 3  54   ? 279.172 290.540 267.367 1.00 52.72  ? 53   ALA G N     1 
ATOM   4417  C  CA    . ALA G 3  54   ? 278.408 290.433 266.141 1.00 52.72  ? 53   ALA G CA    1 
ATOM   4418  C  C     . ALA G 3  54   ? 279.302 290.326 264.926 1.00 52.72  ? 53   ALA G C     1 
ATOM   4419  O  O     . ALA G 3  54   ? 279.000 289.557 264.016 1.00 52.72  ? 53   ALA G O     1 
ATOM   4420  C  CB    . ALA G 3  54   ? 277.495 291.624 265.998 1.00 52.72  ? 53   ALA G CB    1 
ATOM   4421  N  N     . VAL G 3  55   ? 280.408 291.066 264.876 1.00 53.57  ? 54   VAL G N     1 
ATOM   4422  C  CA    . VAL G 3  55   ? 281.230 290.983 263.673 1.00 53.57  ? 54   VAL G CA    1 
ATOM   4423  C  C     . VAL G 3  55   ? 282.020 289.680 263.649 1.00 53.57  ? 54   VAL G C     1 
ATOM   4424  O  O     . VAL G 3  55   ? 282.211 289.081 262.584 1.00 53.57  ? 54   VAL G O     1 
ATOM   4425  C  CB    . VAL G 3  55   ? 282.125 292.225 263.524 1.00 53.57  ? 54   VAL G CB    1 
ATOM   4426  C  CG1   . VAL G 3  55   ? 283.045 292.387 264.654 1.00 53.57  ? 54   VAL G CG1   1 
ATOM   4427  C  CG2   . VAL G 3  55   ? 282.935 292.155 262.287 1.00 53.57  ? 54   VAL G CG2   1 
ATOM   4428  N  N     . LEU G 3  56   ? 282.406 289.163 264.817 1.00 54.38  ? 55   LEU G N     1 
ATOM   4429  C  CA    . LEU G 3  56   ? 283.056 287.855 264.849 1.00 54.38  ? 55   LEU G CA    1 
ATOM   4430  C  C     . LEU G 3  56   ? 282.086 286.765 264.444 1.00 54.38  ? 55   LEU G C     1 
ATOM   4431  O  O     . LEU G 3  56   ? 282.446 285.849 263.702 1.00 54.38  ? 55   LEU G O     1 
ATOM   4432  C  CB    . LEU G 3  56   ? 283.600 287.558 266.242 1.00 54.38  ? 55   LEU G CB    1 
ATOM   4433  C  CG    . LEU G 3  56   ? 284.739 288.354 266.854 1.00 54.38  ? 55   LEU G CG    1 
ATOM   4434  C  CD1   . LEU G 3  56   ? 285.306 287.577 267.984 1.00 54.38  ? 55   LEU G CD1   1 
ATOM   4435  C  CD2   . LEU G 3  56   ? 285.781 288.659 265.843 1.00 54.38  ? 55   LEU G CD2   1 
ATOM   4436  N  N     . GLU G 3  57   ? 280.840 286.880 264.894 1.00 58.61  ? 56   GLU G N     1 
ATOM   4437  C  CA    . GLU G 3  57   ? 279.821 285.910 264.544 1.00 58.61  ? 56   GLU G CA    1 
ATOM   4438  C  C     . GLU G 3  57   ? 279.503 285.964 263.067 1.00 58.61  ? 56   GLU G C     1 
ATOM   4439  O  O     . GLU G 3  57   ? 279.296 284.927 262.437 1.00 58.61  ? 56   GLU G O     1 
ATOM   4440  C  CB    . GLU G 3  57   ? 278.571 286.174 265.361 1.00 58.61  ? 56   GLU G CB    1 
ATOM   4441  C  CG    . GLU G 3  57   ? 277.462 285.242 265.054 1.00 58.61  ? 56   GLU G CG    1 
ATOM   4442  C  CD    . GLU G 3  57   ? 276.135 285.784 265.462 1.00 58.61  ? 56   GLU G CD    1 
ATOM   4443  O  OE1   . GLU G 3  57   ? 275.403 286.294 264.596 1.00 58.61  ? 56   GLU G OE1   1 
ATOM   4444  O  OE2   . GLU G 3  57   ? 275.820 285.693 266.658 1.00 58.61  ? 56   GLU G OE2   1 
ATOM   4445  N  N     . TYR G 3  58   ? 279.501 287.161 262.491 1.00 58.67  ? 57   TYR G N     1 
ATOM   4446  C  CA    . TYR G 3  58   ? 279.224 287.291 261.072 1.00 58.67  ? 57   TYR G CA    1 
ATOM   4447  C  C     . TYR G 3  58   ? 280.328 286.668 260.247 1.00 58.67  ? 57   TYR G C     1 
ATOM   4448  O  O     . TYR G 3  58   ? 280.057 285.947 259.285 1.00 58.67  ? 57   TYR G O     1 
ATOM   4449  C  CB    . TYR G 3  58   ? 279.047 288.747 260.682 1.00 58.67  ? 57   TYR G CB    1 
ATOM   4450  C  CG    . TYR G 3  58   ? 279.006 288.879 259.202 1.00 58.67  ? 57   TYR G CG    1 
ATOM   4451  C  CD1   . TYR G 3  58   ? 277.973 288.324 258.478 1.00 58.67  ? 57   TYR G CD1   1 
ATOM   4452  C  CD2   . TYR G 3  58   ? 280.011 289.517 258.516 1.00 58.67  ? 57   TYR G CD2   1 
ATOM   4453  C  CE1   . TYR G 3  58   ? 277.937 288.407 257.122 1.00 58.67  ? 57   TYR G CE1   1 
ATOM   4454  C  CE2   . TYR G 3  58   ? 279.984 289.602 257.151 1.00 58.67  ? 57   TYR G CE2   1 
ATOM   4455  C  CZ    . TYR G 3  58   ? 278.945 289.047 256.464 1.00 58.67  ? 57   TYR G CZ    1 
ATOM   4456  O  OH    . TYR G 3  58   ? 278.916 289.136 255.101 1.00 58.67  ? 57   TYR G OH    1 
ATOM   4457  N  N     . LEU G 3  59   ? 281.581 286.923 260.611 1.00 56.97  ? 58   LEU G N     1 
ATOM   4458  C  CA    . LEU G 3  59   ? 282.686 286.369 259.839 1.00 56.97  ? 58   LEU G CA    1 
ATOM   4459  C  C     . LEU G 3  59   ? 282.739 284.860 259.970 1.00 56.97  ? 58   LEU G C     1 
ATOM   4460  O  O     . LEU G 3  59   ? 282.988 284.148 258.989 1.00 56.97  ? 58   LEU G O     1 
ATOM   4461  C  CB    . LEU G 3  59   ? 283.988 286.986 260.298 1.00 56.97  ? 58   LEU G CB    1 
ATOM   4462  C  CG    . LEU G 3  59   ? 284.094 288.420 259.848 1.00 56.97  ? 58   LEU G CG    1 
ATOM   4463  C  CD1   . LEU G 3  59   ? 285.267 289.047 260.509 1.00 56.97  ? 58   LEU G CD1   1 
ATOM   4464  C  CD2   . LEU G 3  59   ? 284.265 288.439 258.376 1.00 56.97  ? 58   LEU G CD2   1 
ATOM   4465  N  N     . THR G 3  60   ? 282.471 284.359 261.171 1.00 59.04  ? 59   THR G N     1 
ATOM   4466  C  CA    . THR G 3  60   ? 282.418 282.928 261.403 1.00 59.04  ? 59   THR G CA    1 
ATOM   4467  C  C     . THR G 3  60   ? 281.308 282.286 260.604 1.00 59.04  ? 59   THR G C     1 
ATOM   4468  O  O     . THR G 3  60   ? 281.496 281.224 260.015 1.00 59.04  ? 59   THR G O     1 
ATOM   4469  C  CB    . THR G 3  60   ? 282.205 282.682 262.883 1.00 59.04  ? 59   THR G CB    1 
ATOM   4470  O  OG1   . THR G 3  60   ? 283.261 283.308 263.609 1.00 59.04  ? 59   THR G OG1   1 
ATOM   4471  C  CG2   . THR G 3  60   ? 282.206 281.238 263.188 1.00 59.04  ? 59   THR G CG2   1 
ATOM   4472  N  N     . ALA G 3  61   ? 280.160 282.940 260.531 1.00 60.49  ? 60   ALA G N     1 
ATOM   4473  C  CA    . ALA G 3  61   ? 279.046 282.369 259.801 1.00 60.49  ? 60   ALA G CA    1 
ATOM   4474  C  C     . ALA G 3  61   ? 279.294 282.408 258.315 1.00 60.49  ? 60   ALA G C     1 
ATOM   4475  O  O     . ALA G 3  61   ? 278.871 281.505 257.593 1.00 60.49  ? 60   ALA G O     1 
ATOM   4476  C  CB    . ALA G 3  61   ? 277.779 283.118 260.136 1.00 60.49  ? 60   ALA G CB    1 
ATOM   4477  N  N     . GLU G 3  62   ? 280.014 283.421 257.846 1.00 62.63  ? 61   GLU G N     1 
ATOM   4478  C  CA    . GLU G 3  62   ? 280.371 283.495 256.435 1.00 62.63  ? 61   GLU G CA    1 
ATOM   4479  C  C     . GLU G 3  62   ? 281.282 282.353 256.042 1.00 62.63  ? 61   GLU G C     1 
ATOM   4480  O  O     . GLU G 3  62   ? 280.995 281.602 255.100 1.00 62.63  ? 61   GLU G O     1 
ATOM   4481  C  CB    . GLU G 3  62   ? 281.052 284.820 256.147 1.00 62.63  ? 61   GLU G CB    1 
ATOM   4482  C  CG    . GLU G 3  62   ? 280.858 285.267 254.751 1.00 62.63  ? 61   GLU G CG    1 
ATOM   4483  C  CD    . GLU G 3  62   ? 279.408 285.228 254.344 1.00 62.63  ? 61   GLU G CD    1 
ATOM   4484  O  OE1   . GLU G 3  62   ? 278.613 286.034 254.869 1.00 62.63  ? 61   GLU G OE1   1 
ATOM   4485  O  OE2   . GLU G 3  62   ? 279.057 284.385 253.503 1.00 62.63  ? 61   GLU G OE2   1 
ATOM   4486  N  N     . ILE G 3  63   ? 282.370 282.181 256.789 1.00 60.28  ? 62   ILE G N     1 
ATOM   4487  C  CA    . ILE G 3  63   ? 283.336 281.154 256.442 1.00 60.28  ? 62   ILE G CA    1 
ATOM   4488  C  C     . ILE G 3  63   ? 282.768 279.771 256.701 1.00 60.28  ? 62   ILE G C     1 
ATOM   4489  O  O     . ILE G 3  63   ? 283.077 278.831 255.974 1.00 60.28  ? 62   ILE G O     1 
ATOM   4490  C  CB    . ILE G 3  63   ? 284.652 281.413 257.189 1.00 60.28  ? 62   ILE G CB    1 
ATOM   4491  C  CG1   . ILE G 3  63   ? 285.732 280.455 256.751 1.00 60.28  ? 62   ILE G CG1   1 
ATOM   4492  C  CG2   . ILE G 3  63   ? 284.493 281.283 258.644 1.00 60.28  ? 62   ILE G CG2   1 
ATOM   4493  C  CD1   . ILE G 3  63   ? 287.064 280.884 257.207 1.00 60.28  ? 62   ILE G CD1   1 
ATOM   4494  N  N     . LEU G 3  64   ? 281.838 279.638 257.632 1.00 59.79  ? 63   LEU G N     1 
ATOM   4495  C  CA    . LEU G 3  64   ? 281.259 278.332 257.874 1.00 59.79  ? 63   LEU G CA    1 
ATOM   4496  C  C     . LEU G 3  64   ? 280.226 277.973 256.838 1.00 59.79  ? 63   LEU G C     1 
ATOM   4497  O  O     . LEU G 3  64   ? 280.073 276.800 256.512 1.00 59.79  ? 63   LEU G O     1 
ATOM   4498  C  CB    . LEU G 3  64   ? 280.628 278.293 259.239 1.00 59.79  ? 63   LEU G CB    1 
ATOM   4499  C  CG    . LEU G 3  64   ? 281.668 277.898 260.240 1.00 59.79  ? 63   LEU G CG    1 
ATOM   4500  C  CD1   . LEU G 3  64   ? 281.044 278.043 261.554 1.00 59.79  ? 63   LEU G CD1   1 
ATOM   4501  C  CD2   . LEU G 3  64   ? 282.052 276.483 259.983 1.00 59.79  ? 63   LEU G CD2   1 
ATOM   4502  N  N     . GLU G 3  65   ? 279.507 278.948 256.304 1.00 61.93  ? 64   GLU G N     1 
ATOM   4503  C  CA    . GLU G 3  65   ? 278.559 278.612 255.264 1.00 61.93  ? 64   GLU G CA    1 
ATOM   4504  C  C     . GLU G 3  65   ? 279.285 278.261 253.990 1.00 61.93  ? 64   GLU G C     1 
ATOM   4505  O  O     . GLU G 3  65   ? 278.891 277.331 253.276 1.00 61.93  ? 64   GLU G O     1 
ATOM   4506  C  CB    . GLU G 3  65   ? 277.603 279.763 255.044 1.00 61.93  ? 64   GLU G CB    1 
ATOM   4507  C  CG    . GLU G 3  65   ? 276.312 279.330 254.427 1.00 61.93  ? 64   GLU G CG    1 
ATOM   4508  C  CD    . GLU G 3  65   ? 275.145 280.168 254.903 1.00 61.93  ? 64   GLU G CD    1 
ATOM   4509  O  OE1   . GLU G 3  65   ? 275.382 281.135 255.656 1.00 61.93  ? 64   GLU G OE1   1 
ATOM   4510  O  OE2   . GLU G 3  65   ? 273.993 279.856 254.532 1.00 61.93  ? 64   GLU G OE2   1 
ATOM   4511  N  N     . LEU G 3  66   ? 280.394 278.941 253.722 1.00 59.57  ? 65   LEU G N     1 
ATOM   4512  C  CA    . LEU G 3  66   ? 281.158 278.584 252.537 1.00 59.57  ? 65   LEU G CA    1 
ATOM   4513  C  C     . LEU G 3  66   ? 281.854 277.242 252.705 1.00 59.57  ? 65   LEU G C     1 
ATOM   4514  O  O     . LEU G 3  66   ? 281.937 276.462 251.754 1.00 59.57  ? 65   LEU G O     1 
ATOM   4515  C  CB    . LEU G 3  66   ? 282.152 279.678 252.220 1.00 59.57  ? 65   LEU G CB    1 
ATOM   4516  C  CG    . LEU G 3  66   ? 281.478 280.917 251.684 1.00 59.57  ? 65   LEU G CG    1 
ATOM   4517  C  CD1   . LEU G 3  66   ? 282.514 281.933 251.376 1.00 59.57  ? 65   LEU G CD1   1 
ATOM   4518  C  CD2   . LEU G 3  66   ? 280.718 280.577 250.454 1.00 59.57  ? 65   LEU G CD2   1 
ATOM   4519  N  N     . ALA G 3  67   ? 282.308 276.925 253.911 1.00 59.57  ? 66   ALA G N     1 
ATOM   4520  C  CA    . ALA G 3  67   ? 282.905 275.619 254.129 1.00 59.57  ? 66   ALA G CA    1 
ATOM   4521  C  C     . ALA G 3  67   ? 281.857 274.528 254.109 1.00 59.57  ? 66   ALA G C     1 
ATOM   4522  O  O     . ALA G 3  67   ? 282.149 273.398 253.731 1.00 59.57  ? 66   ALA G O     1 
ATOM   4523  C  CB    . ALA G 3  67   ? 283.656 275.600 255.445 1.00 59.57  ? 66   ALA G CB    1 
ATOM   4524  N  N     . GLY G 3  68   ? 280.629 274.842 254.481 1.00 62.93  ? 67   GLY G N     1 
ATOM   4525  C  CA    . GLY G 3  68   ? 279.580 273.853 254.374 1.00 62.93  ? 67   GLY G CA    1 
ATOM   4526  C  C     . GLY G 3  68   ? 279.230 273.568 252.935 1.00 62.93  ? 67   GLY G C     1 
ATOM   4527  O  O     . GLY G 3  68   ? 278.955 272.423 252.570 1.00 62.93  ? 67   GLY G O     1 
ATOM   4528  N  N     . ASN G 3  69   ? 279.268 274.591 252.091 1.00 64.98  ? 68   ASN G N     1 
ATOM   4529  C  CA    . ASN G 3  69   ? 279.062 274.348 250.671 1.00 64.98  ? 68   ASN G CA    1 
ATOM   4530  C  C     . ASN G 3  69   ? 280.210 273.547 250.074 1.00 64.98  ? 68   ASN G C     1 
ATOM   4531  O  O     . ASN G 3  69   ? 279.992 272.668 249.231 1.00 64.98  ? 68   ASN G O     1 
ATOM   4532  C  CB    . ASN G 3  69   ? 278.892 275.667 249.944 1.00 64.98  ? 68   ASN G CB    1 
ATOM   4533  C  CG    . ASN G 3  69   ? 277.689 276.405 250.409 1.00 64.98  ? 68   ASN G CG    1 
ATOM   4534  O  OD1   . ASN G 3  69   ? 276.762 275.809 250.936 1.00 64.98  ? 68   ASN G OD1   1 
ATOM   4535  N  ND2   . ASN G 3  69   ? 277.687 277.709 250.227 1.00 64.98  ? 68   ASN G ND2   1 
ATOM   4536  N  N     . ALA G 3  70   ? 281.438 273.811 250.524 1.00 64.55  ? 69   ALA G N     1 
ATOM   4537  C  CA    . ALA G 3  70   ? 282.577 273.044 250.041 1.00 64.55  ? 69   ALA G CA    1 
ATOM   4538  C  C     . ALA G 3  70   ? 282.549 271.615 250.545 1.00 64.55  ? 69   ALA G C     1 
ATOM   4539  O  O     . ALA G 3  70   ? 283.096 270.726 249.897 1.00 64.55  ? 69   ALA G O     1 
ATOM   4540  C  CB    . ALA G 3  70   ? 283.877 273.711 250.459 1.00 64.55  ? 69   ALA G CB    1 
ATOM   4541  N  N     . ALA G 3  71   ? 281.927 271.371 251.687 1.00 67.28  ? 70   ALA G N     1 
ATOM   4542  C  CA    . ALA G 3  71   ? 281.791 270.003 252.149 1.00 67.28  ? 70   ALA G CA    1 
ATOM   4543  C  C     . ALA G 3  71   ? 280.674 269.284 251.421 1.00 67.28  ? 70   ALA G C     1 
ATOM   4544  O  O     . ALA G 3  71   ? 280.728 268.067 251.254 1.00 67.28  ? 70   ALA G O     1 
ATOM   4545  C  CB    . ALA G 3  71   ? 281.538 269.974 253.644 1.00 67.28  ? 70   ALA G CB    1 
ATOM   4546  N  N     . ARG G 3  72   ? 279.641 270.008 251.007 1.00 69.68  ? 71   ARG G N     1 
ATOM   4547  C  CA    . ARG G 3  72   ? 278.624 269.386 250.174 1.00 69.68  ? 71   ARG G CA    1 
ATOM   4548  C  C     . ARG G 3  72   ? 279.127 269.098 248.778 1.00 69.68  ? 71   ARG G C     1 
ATOM   4549  O  O     . ARG G 3  72   ? 278.579 268.222 248.109 1.00 69.68  ? 71   ARG G O     1 
ATOM   4550  C  CB    . ARG G 3  72   ? 277.395 270.268 250.055 1.00 69.68  ? 71   ARG G CB    1 
ATOM   4551  C  CG    . ARG G 3  72   ? 276.338 270.026 251.074 1.00 69.68  ? 71   ARG G CG    1 
ATOM   4552  C  CD    . ARG G 3  72   ? 275.090 270.750 250.646 1.00 69.68  ? 71   ARG G CD    1 
ATOM   4553  N  NE    . ARG G 3  72   ? 275.385 272.144 250.342 1.00 69.68  ? 71   ARG G NE    1 
ATOM   4554  C  CZ    . ARG G 3  72   ? 274.467 273.089 250.195 1.00 69.68  ? 71   ARG G CZ    1 
ATOM   4555  N  NH1   . ARG G 3  72   ? 273.185 272.799 250.335 1.00 69.68  ? 71   ARG G NH1   1 
ATOM   4556  N  NH2   . ARG G 3  72   ? 274.830 274.330 249.926 1.00 69.68  ? 71   ARG G NH2   1 
ATOM   4557  N  N     . ASP G 3  73   ? 280.125 269.839 248.308 1.00 71.68  ? 72   ASP G N     1 
ATOM   4558  C  CA    . ASP G 3  73   ? 280.698 269.532 247.004 1.00 71.68  ? 72   ASP G CA    1 
ATOM   4559  C  C     . ASP G 3  73   ? 281.526 268.259 247.049 1.00 71.68  ? 72   ASP G C     1 
ATOM   4560  O  O     . ASP G 3  73   ? 281.435 267.420 246.149 1.00 71.68  ? 72   ASP G O     1 
ATOM   4561  C  CB    . ASP G 3  73   ? 281.548 270.696 246.521 1.00 71.68  ? 72   ASP G CB    1 
ATOM   4562  C  CG    . ASP G 3  73   ? 280.739 271.933 246.291 1.00 71.68  ? 72   ASP G CG    1 
ATOM   4563  O  OD1   . ASP G 3  73   ? 279.506 271.862 246.426 1.00 71.68  ? 72   ASP G OD1   1 
ATOM   4564  O  OD2   . ASP G 3  73   ? 281.334 272.979 245.983 1.00 71.68  ? 72   ASP G OD2   1 
ATOM   4565  N  N     . ASN G 3  74   ? 282.328 268.082 248.092 1.00 72.26  ? 73   ASN G N     1 
ATOM   4566  C  CA    . ASN G 3  74   ? 283.149 266.892 248.228 1.00 72.26  ? 73   ASN G CA    1 
ATOM   4567  C  C     . ASN G 3  74   ? 282.399 265.753 248.871 1.00 72.26  ? 73   ASN G C     1 
ATOM   4568  O  O     . ASN G 3  74   ? 283.026 264.789 249.310 1.00 72.26  ? 73   ASN G O     1 
ATOM   4569  C  CB    . ASN G 3  74   ? 284.405 267.200 249.031 1.00 72.26  ? 73   ASN G CB    1 
ATOM   4570  C  CG    . ASN G 3  74   ? 285.144 268.406 248.511 1.00 72.26  ? 73   ASN G CG    1 
ATOM   4571  O  OD1   . ASN G 3  74   ? 285.696 269.183 249.279 1.00 72.26  ? 73   ASN G OD1   1 
ATOM   4572  N  ND2   . ASN G 3  74   ? 285.162 268.569 247.200 1.00 72.26  ? 73   ASN G ND2   1 
ATOM   4573  N  N     . LYS G 3  75   ? 281.077 265.855 248.947 1.00 74.70  ? 74   LYS G N     1 
ATOM   4574  C  CA    . LYS G 3  75   ? 280.133 264.861 249.443 1.00 74.70  ? 74   LYS G CA    1 
ATOM   4575  C  C     . LYS G 3  75   ? 280.400 264.431 250.876 1.00 74.70  ? 74   LYS G C     1 
ATOM   4576  O  O     . LYS G 3  75   ? 279.991 263.338 251.268 1.00 74.70  ? 74   LYS G O     1 
ATOM   4577  C  CB    . LYS G 3  75   ? 280.078 263.629 248.541 1.00 74.70  ? 74   LYS G CB    1 
ATOM   4578  C  CG    . LYS G 3  75   ? 280.166 263.910 247.049 1.00 74.70  ? 74   LYS G CG    1 
ATOM   4579  C  CD    . LYS G 3  75   ? 278.986 264.705 246.538 1.00 74.70  ? 74   LYS G CD    1 
ATOM   4580  C  CE    . LYS G 3  75   ? 278.711 264.386 245.070 1.00 74.70  ? 74   LYS G CE    1 
ATOM   4581  N  NZ    . LYS G 3  75   ? 277.846 265.405 244.413 1.00 74.70  ? 74   LYS G NZ    1 
ATOM   4582  N  N     . LYS G 3  76   ? 281.069 265.252 251.671 1.00 83.27  ? 75   LYS G N     1 
ATOM   4583  C  CA    . LYS G 3  76   ? 281.267 264.936 253.070 1.00 83.27  ? 75   LYS G CA    1 
ATOM   4584  C  C     . LYS G 3  76   ? 280.191 265.603 253.903 1.00 83.27  ? 75   LYS G C     1 
ATOM   4585  O  O     . LYS G 3  76   ? 279.468 266.479 253.441 1.00 83.27  ? 75   LYS G O     1 
ATOM   4586  C  CB    . LYS G 3  76   ? 282.636 265.398 253.545 1.00 83.27  ? 75   LYS G CB    1 
ATOM   4587  C  CG    . LYS G 3  76   ? 283.785 264.950 252.686 1.00 83.27  ? 75   LYS G CG    1 
ATOM   4588  C  CD    . LYS G 3  76   ? 284.230 263.552 253.031 1.00 83.27  ? 75   LYS G CD    1 
ATOM   4589  C  CE    . LYS G 3  76   ? 285.533 263.216 252.345 1.00 83.27  ? 75   LYS G CE    1 
ATOM   4590  N  NZ    . LYS G 3  76   ? 286.043 261.882 252.750 1.00 83.27  ? 75   LYS G NZ    1 
ATOM   4591  N  N     . THR G 3  77   ? 280.077 265.165 255.150 1.00 85.56  ? 76   THR G N     1 
ATOM   4592  C  CA    . THR G 3  77   ? 279.270 265.861 256.139 1.00 85.56  ? 76   THR G CA    1 
ATOM   4593  C  C     . THR G 3  77   ? 280.103 266.312 257.322 1.00 85.56  ? 76   THR G C     1 
ATOM   4594  O  O     . THR G 3  77   ? 279.546 266.657 258.361 1.00 85.56  ? 76   THR G O     1 
ATOM   4595  C  CB    . THR G 3  77   ? 278.128 264.992 256.658 1.00 85.56  ? 76   THR G CB    1 
ATOM   4596  O  OG1   . THR G 3  77   ? 278.634 264.101 257.655 1.00 85.56  ? 76   THR G OG1   1 
ATOM   4597  C  CG2   . THR G 3  77   ? 277.494 264.197 255.546 1.00 85.56  ? 76   THR G CG2   1 
ATOM   4598  N  N     . ARG G 3  78   ? 281.416 266.280 257.214 1.00 86.32  ? 77   ARG G N     1 
ATOM   4599  C  CA    . ARG G 3  78   ? 282.274 266.850 258.228 1.00 86.32  ? 77   ARG G CA    1 
ATOM   4600  C  C     . ARG G 3  78   ? 283.144 267.892 257.576 1.00 86.32  ? 77   ARG G C     1 
ATOM   4601  O  O     . ARG G 3  78   ? 283.801 267.616 256.575 1.00 86.32  ? 77   ARG G O     1 
ATOM   4602  C  CB    . ARG G 3  78   ? 283.146 265.808 258.894 1.00 86.32  ? 77   ARG G CB    1 
ATOM   4603  C  CG    . ARG G 3  78   ? 282.391 264.891 259.743 1.00 86.32  ? 77   ARG G CG    1 
ATOM   4604  C  CD    . ARG G 3  78   ? 283.104 264.639 261.022 1.00 86.32  ? 77   ARG G CD    1 
ATOM   4605  N  NE    . ARG G 3  78   ? 282.917 263.259 261.427 1.00 86.32  ? 77   ARG G NE    1 
ATOM   4606  C  CZ    . ARG G 3  78   ? 281.818 262.785 262.005 1.00 86.32  ? 77   ARG G CZ    1 
ATOM   4607  N  NH1   . ARG G 3  78   ? 280.792 263.577 262.282 1.00 86.32  ? 77   ARG G NH1   1 
ATOM   4608  N  NH2   . ARG G 3  78   ? 281.755 261.506 262.338 1.00 86.32  ? 77   ARG G NH2   1 
ATOM   4609  N  N     . ILE G 3  79   ? 283.144 269.086 258.140 1.00 71.18  ? 78   ILE G N     1 
ATOM   4610  C  CA    . ILE G 3  79   ? 284.052 270.105 257.668 1.00 71.18  ? 78   ILE G CA    1 
ATOM   4611  C  C     . ILE G 3  79   ? 285.457 269.741 258.117 1.00 71.18  ? 78   ILE G C     1 
ATOM   4612  O  O     . ILE G 3  79   ? 285.755 269.704 259.313 1.00 71.18  ? 78   ILE G O     1 
ATOM   4613  C  CB    . ILE G 3  79   ? 283.617 271.468 258.184 1.00 71.18  ? 78   ILE G CB    1 
ATOM   4614  C  CG1   . ILE G 3  79   ? 282.255 271.773 257.605 1.00 71.18  ? 78   ILE G CG1   1 
ATOM   4615  C  CG2   . ILE G 3  79   ? 284.580 272.492 257.777 1.00 71.18  ? 78   ILE G CG2   1 
ATOM   4616  C  CD1   . ILE G 3  79   ? 281.570 272.912 258.269 1.00 71.18  ? 78   ILE G CD1   1 
ATOM   4617  N  N     . ILE G 3  80   ? 286.309 269.417 257.160 1.00 65.67  ? 79   ILE G N     1 
ATOM   4618  C  CA    . ILE G 3  80   ? 287.711 269.106 257.405 1.00 65.67  ? 79   ILE G CA    1 
ATOM   4619  C  C     . ILE G 3  80   ? 288.489 270.343 256.987 1.00 65.67  ? 79   ILE G C     1 
ATOM   4620  O  O     . ILE G 3  80   ? 287.926 271.211 256.305 1.00 65.67  ? 79   ILE G O     1 
ATOM   4621  C  CB    . ILE G 3  80   ? 288.139 267.829 256.651 1.00 65.67  ? 79   ILE G CB    1 
ATOM   4622  C  CG1   . ILE G 3  80   ? 288.320 268.110 255.176 1.00 65.67  ? 79   ILE G CG1   1 
ATOM   4623  C  CG2   . ILE G 3  80   ? 287.084 266.795 256.800 1.00 65.67  ? 79   ILE G CG2   1 
ATOM   4624  C  CD1   . ILE G 3  80   ? 289.035 267.000 254.455 1.00 65.67  ? 79   ILE G CD1   1 
ATOM   4625  N  N     . PRO G 3  81   ? 289.759 270.499 257.403 1.00 61.45  ? 80   PRO G N     1 
ATOM   4626  C  CA    . PRO G 3  81   ? 290.463 271.750 257.087 1.00 61.45  ? 80   PRO G CA    1 
ATOM   4627  C  C     . PRO G 3  81   ? 290.711 271.993 255.619 1.00 61.45  ? 80   PRO G C     1 
ATOM   4628  O  O     . PRO G 3  81   ? 290.964 273.140 255.233 1.00 61.45  ? 80   PRO G O     1 
ATOM   4629  C  CB    . PRO G 3  81   ? 291.780 271.592 257.837 1.00 61.45  ? 80   PRO G CB    1 
ATOM   4630  C  CG    . PRO G 3  81   ? 291.464 270.765 258.920 1.00 61.45  ? 80   PRO G CG    1 
ATOM   4631  C  CD    . PRO G 3  81   ? 290.519 269.760 258.421 1.00 61.45  ? 80   PRO G CD    1 
ATOM   4632  N  N     . ARG G 3  82   ? 290.640 270.956 254.790 1.00 63.75  ? 81   ARG G N     1 
ATOM   4633  C  CA    . ARG G 3  82   ? 290.645 271.152 253.351 1.00 63.75  ? 81   ARG G CA    1 
ATOM   4634  C  C     . ARG G 3  82   ? 289.450 271.973 252.915 1.00 63.75  ? 81   ARG G C     1 
ATOM   4635  O  O     . ARG G 3  82   ? 289.556 272.815 252.017 1.00 63.75  ? 81   ARG G O     1 
ATOM   4636  C  CB    . ARG G 3  82   ? 290.643 269.805 252.657 1.00 63.75  ? 81   ARG G CB    1 
ATOM   4637  C  CG    . ARG G 3  82   ? 290.556 269.874 251.172 1.00 63.75  ? 81   ARG G CG    1 
ATOM   4638  C  CD    . ARG G 3  82   ? 291.691 270.671 250.630 1.00 63.75  ? 81   ARG G CD    1 
ATOM   4639  N  NE    . ARG G 3  82   ? 291.781 270.577 249.193 1.00 63.75  ? 81   ARG G NE    1 
ATOM   4640  C  CZ    . ARG G 3  82   ? 292.668 271.247 248.486 1.00 63.75  ? 81   ARG G CZ    1 
ATOM   4641  N  NH1   . ARG G 3  82   ? 293.520 272.049 249.096 1.00 63.75  ? 81   ARG G NH1   1 
ATOM   4642  N  NH2   . ARG G 3  82   ? 292.705 271.121 247.174 1.00 63.75  ? 81   ARG G NH2   1 
ATOM   4643  N  N     . HIS G 3  83   ? 288.317 271.787 253.580 1.00 65.20  ? 82   HIS G N     1 
ATOM   4644  C  CA    . HIS G 3  83   ? 287.129 272.533 253.208 1.00 65.20  ? 82   HIS G CA    1 
ATOM   4645  C  C     . HIS G 3  83   ? 287.250 273.977 253.630 1.00 65.20  ? 82   HIS G C     1 
ATOM   4646  O  O     . HIS G 3  83   ? 286.826 274.870 252.897 1.00 65.20  ? 82   HIS G O     1 
ATOM   4647  C  CB    . HIS G 3  83   ? 285.907 271.883 253.811 1.00 65.20  ? 82   HIS G CB    1 
ATOM   4648  C  CG    . HIS G 3  83   ? 285.716 270.479 253.356 1.00 65.20  ? 82   HIS G CG    1 
ATOM   4649  N  ND1   . HIS G 3  83   ? 284.905 269.589 254.010 1.00 65.20  ? 82   HIS G ND1   1 
ATOM   4650  C  CD2   . HIS G 3  83   ? 286.240 269.812 252.307 1.00 65.20  ? 82   HIS G CD2   1 
ATOM   4651  C  CE1   . HIS G 3  83   ? 284.941 268.428 253.387 1.00 65.20  ? 82   HIS G CE1   1 
ATOM   4652  N  NE2   . HIS G 3  83   ? 285.745 268.537 252.351 1.00 65.20  ? 82   HIS G NE2   1 
ATOM   4653  N  N     . LEU G 3  84   ? 287.875 274.225 254.777 1.00 61.70  ? 83   LEU G N     1 
ATOM   4654  C  CA    . LEU G 3  84   ? 288.103 275.594 255.215 1.00 61.70  ? 83   LEU G CA    1 
ATOM   4655  C  C     . LEU G 3  84   ? 289.074 276.313 254.297 1.00 61.70  ? 83   LEU G C     1 
ATOM   4656  O  O     . LEU G 3  84   ? 288.882 277.488 253.981 1.00 61.70  ? 83   LEU G O     1 
ATOM   4657  C  CB    . LEU G 3  84   ? 288.628 275.606 256.638 1.00 61.70  ? 83   LEU G CB    1 
ATOM   4658  C  CG    . LEU G 3  84   ? 287.599 275.238 257.687 1.00 61.70  ? 83   LEU G CG    1 
ATOM   4659  C  CD1   . LEU G 3  84   ? 288.247 275.139 259.016 1.00 61.70  ? 83   LEU G CD1   1 
ATOM   4660  C  CD2   . LEU G 3  84   ? 286.527 276.276 257.723 1.00 61.70  ? 83   LEU G CD2   1 
ATOM   4661  N  N     . GLN G 3  85   ? 290.108 275.614 253.840 1.00 63.71  ? 84   GLN G N     1 
ATOM   4662  C  CA    . GLN G 3  85   ? 291.058 276.226 252.923 1.00 63.71  ? 84   GLN G CA    1 
ATOM   4663  C  C     . GLN G 3  85   ? 290.420 276.511 251.580 1.00 63.71  ? 84   GLN G C     1 
ATOM   4664  O  O     . GLN G 3  85   ? 290.679 277.555 250.975 1.00 63.71  ? 84   GLN G O     1 
ATOM   4665  C  CB    . GLN G 3  85   ? 292.268 275.325 252.763 1.00 63.71  ? 84   GLN G CB    1 
ATOM   4666  C  CG    . GLN G 3  85   ? 293.226 275.708 251.678 1.00 63.71  ? 84   GLN G CG    1 
ATOM   4667  C  CD    . GLN G 3  85   ? 294.061 276.902 252.022 1.00 63.71  ? 84   GLN G CD    1 
ATOM   4668  O  OE1   . GLN G 3  85   ? 294.111 277.331 253.166 1.00 63.71  ? 84   GLN G OE1   1 
ATOM   4669  N  NE2   . GLN G 3  85   ? 294.787 277.408 251.046 1.00 63.71  ? 84   GLN G NE2   1 
ATOM   4670  N  N     . LEU G 3  86   ? 289.542 275.621 251.123 1.00 64.36  ? 85   LEU G N     1 
ATOM   4671  C  CA    . LEU G 3  86   ? 288.831 275.858 249.875 1.00 64.36  ? 85   LEU G CA    1 
ATOM   4672  C  C     . LEU G 3  86   ? 287.883 277.039 249.995 1.00 64.36  ? 85   LEU G C     1 
ATOM   4673  O  O     . LEU G 3  86   ? 287.780 277.865 249.079 1.00 64.36  ? 85   LEU G O     1 
ATOM   4674  C  CB    . LEU G 3  86   ? 288.059 274.613 249.484 1.00 64.36  ? 85   LEU G CB    1 
ATOM   4675  C  CG    . LEU G 3  86   ? 288.883 273.559 248.795 1.00 64.36  ? 85   LEU G CG    1 
ATOM   4676  C  CD1   . LEU G 3  86   ? 287.999 272.383 248.560 1.00 64.36  ? 85   LEU G CD1   1 
ATOM   4677  C  CD2   . LEU G 3  86   ? 289.363 274.129 247.505 1.00 64.36  ? 85   LEU G CD2   1 
ATOM   4678  N  N     . ALA G 3  87   ? 287.197 277.146 251.127 1.00 62.86  ? 86   ALA G N     1 
ATOM   4679  C  CA    . ALA G 3  87   ? 286.254 278.234 251.309 1.00 62.86  ? 86   ALA G CA    1 
ATOM   4680  C  C     . ALA G 3  87   ? 286.967 279.561 251.453 1.00 62.86  ? 86   ALA G C     1 
ATOM   4681  O  O     . ALA G 3  87   ? 286.446 280.596 251.038 1.00 62.86  ? 86   ALA G O     1 
ATOM   4682  C  CB    . ALA G 3  87   ? 285.391 277.977 252.532 1.00 62.86  ? 86   ALA G CB    1 
ATOM   4683  N  N     . VAL G 3  88   ? 288.160 279.556 252.036 1.00 61.79  ? 87   VAL G N     1 
ATOM   4684  C  CA    . VAL G 3  88   ? 288.915 280.795 252.159 1.00 61.79  ? 87   VAL G CA    1 
ATOM   4685  C  C     . VAL G 3  88   ? 289.417 281.233 250.799 1.00 61.79  ? 87   VAL G C     1 
ATOM   4686  O  O     . VAL G 3  88   ? 289.232 282.380 250.391 1.00 61.79  ? 87   VAL G O     1 
ATOM   4687  C  CB    . VAL G 3  88   ? 290.071 280.627 253.153 1.00 61.79  ? 87   VAL G CB    1 
ATOM   4688  C  CG1   . VAL G 3  88   ? 291.097 281.682 252.956 1.00 61.79  ? 87   VAL G CG1   1 
ATOM   4689  C  CG2   . VAL G 3  88   ? 289.562 280.732 254.532 1.00 61.79  ? 87   VAL G CG2   1 
ATOM   4690  N  N     . ARG G 3  89   ? 290.026 280.318 250.061 1.00 64.19  ? 88   ARG G N     1 
ATOM   4691  C  CA    . ARG G 3  89   ? 290.676 280.750 248.840 1.00 64.19  ? 88   ARG G CA    1 
ATOM   4692  C  C     . ARG G 3  89   ? 289.694 280.990 247.712 1.00 64.19  ? 88   ARG G C     1 
ATOM   4693  O  O     . ARG G 3  89   ? 290.042 281.679 246.752 1.00 64.19  ? 88   ARG G O     1 
ATOM   4694  C  CB    . ARG G 3  89   ? 291.727 279.738 248.420 1.00 64.19  ? 88   ARG G CB    1 
ATOM   4695  C  CG    . ARG G 3  89   ? 292.821 279.537 249.437 1.00 64.19  ? 88   ARG G CG    1 
ATOM   4696  C  CD    . ARG G 3  89   ? 293.343 280.829 250.051 1.00 64.19  ? 88   ARG G CD    1 
ATOM   4697  N  NE    . ARG G 3  89   ? 294.154 280.552 251.233 1.00 64.19  ? 88   ARG G NE    1 
ATOM   4698  C  CZ    . ARG G 3  89   ? 294.531 281.458 252.127 1.00 64.19  ? 88   ARG G CZ    1 
ATOM   4699  N  NH1   . ARG G 3  89   ? 294.177 282.719 251.988 1.00 64.19  ? 88   ARG G NH1   1 
ATOM   4700  N  NH2   . ARG G 3  89   ? 295.269 281.099 253.161 1.00 64.19  ? 88   ARG G NH2   1 
ATOM   4701  N  N     . ASN G 3  90   ? 288.474 280.478 247.806 1.00 67.32  ? 89   ASN G N     1 
ATOM   4702  C  CA    . ASN G 3  90   ? 287.554 280.735 246.710 1.00 67.32  ? 89   ASN G CA    1 
ATOM   4703  C  C     . ASN G 3  90   ? 286.862 282.081 246.850 1.00 67.32  ? 89   ASN G C     1 
ATOM   4704  O  O     . ASN G 3  90   ? 286.649 282.768 245.849 1.00 67.32  ? 89   ASN G O     1 
ATOM   4705  C  CB    . ASN G 3  90   ? 286.538 279.619 246.618 1.00 67.32  ? 89   ASN G CB    1 
ATOM   4706  C  CG    . ASN G 3  90   ? 287.112 278.397 245.988 1.00 67.32  ? 89   ASN G CG    1 
ATOM   4707  O  OD1   . ASN G 3  90   ? 287.298 278.343 244.780 1.00 67.32  ? 89   ASN G OD1   1 
ATOM   4708  N  ND2   . ASN G 3  90   ? 287.409 277.397 246.800 1.00 67.32  ? 89   ASN G ND2   1 
ATOM   4709  N  N     . ASP G 3  91   ? 286.492 282.477 248.062 1.00 72.00  ? 90   ASP G N     1 
ATOM   4710  C  CA    . ASP G 3  91   ? 285.897 283.788 248.266 1.00 72.00  ? 90   ASP G CA    1 
ATOM   4711  C  C     . ASP G 3  91   ? 286.989 284.833 248.157 1.00 72.00  ? 90   ASP G C     1 
ATOM   4712  O  O     . ASP G 3  91   ? 288.018 284.724 248.824 1.00 72.00  ? 90   ASP G O     1 
ATOM   4713  C  CB    . ASP G 3  91   ? 285.232 283.875 249.637 1.00 72.00  ? 90   ASP G CB    1 
ATOM   4714  C  CG    . ASP G 3  91   ? 284.304 285.083 249.775 1.00 72.00  ? 90   ASP G CG    1 
ATOM   4715  O  OD1   . ASP G 3  91   ? 284.283 285.954 248.881 1.00 72.00  ? 90   ASP G OD1   1 
ATOM   4716  O  OD2   . ASP G 3  91   ? 283.538 285.135 250.760 1.00 72.00  ? 90   ASP G OD2   1 
ATOM   4717  N  N     . GLU G 3  92   ? 286.751 285.856 247.342 1.00 75.58  ? 91   GLU G N     1 
ATOM   4718  C  CA    . GLU G 3  92   ? 287.787 286.841 247.078 1.00 75.58  ? 91   GLU G CA    1 
ATOM   4719  C  C     . GLU G 3  92   ? 288.073 287.706 248.294 1.00 75.58  ? 91   GLU G C     1 
ATOM   4720  O  O     . GLU G 3  92   ? 289.240 287.949 248.621 1.00 75.58  ? 91   GLU G O     1 
ATOM   4721  C  CB    . GLU G 3  92   ? 287.392 287.725 245.909 1.00 75.58  ? 91   GLU G CB    1 
ATOM   4722  C  CG    . GLU G 3  92   ? 288.468 288.714 245.529 1.00 75.58  ? 91   GLU G CG    1 
ATOM   4723  C  CD    . GLU G 3  92   ? 287.965 289.801 244.609 1.00 75.58  ? 91   GLU G CD    1 
ATOM   4724  O  OE1   . GLU G 3  92   ? 288.423 290.955 244.741 1.00 75.58  ? 91   GLU G OE1   1 
ATOM   4725  O  OE2   . GLU G 3  92   ? 287.113 289.499 243.747 1.00 75.58  ? 91   GLU G OE2   1 
ATOM   4726  N  N     . GLU G 3  93   ? 287.029 288.168 248.985 1.00 70.96  ? 92   GLU G N     1 
ATOM   4727  C  CA    . GLU G 3  93   ? 287.249 289.042 250.127 1.00 70.96  ? 92   GLU G CA    1 
ATOM   4728  C  C     . GLU G 3  93   ? 287.818 288.274 251.305 1.00 70.96  ? 92   GLU G C     1 
ATOM   4729  O  O     . GLU G 3  93   ? 288.614 288.813 252.075 1.00 70.96  ? 92   GLU G O     1 
ATOM   4730  C  CB    . GLU G 3  93   ? 285.951 289.730 250.506 1.00 70.96  ? 92   GLU G CB    1 
ATOM   4731  C  CG    . GLU G 3  93   ? 285.221 290.339 249.338 1.00 70.96  ? 92   GLU G CG    1 
ATOM   4732  C  CD    . GLU G 3  93   ? 285.689 291.737 248.982 1.00 70.96  ? 92   GLU G CD    1 
ATOM   4733  O  OE1   . GLU G 3  93   ? 286.685 292.216 249.549 1.00 70.96  ? 92   GLU G OE1   1 
ATOM   4734  O  OE2   . GLU G 3  93   ? 285.057 292.367 248.114 1.00 70.96  ? 92   GLU G OE2   1 
ATOM   4735  N  N     . LEU G 3  94   ? 287.432 287.012 251.455 1.00 65.91  ? 93   LEU G N     1 
ATOM   4736  C  CA    . LEU G 3  94   ? 288.009 286.202 252.513 1.00 65.91  ? 93   LEU G CA    1 
ATOM   4737  C  C     . LEU G 3  94   ? 289.458 285.891 252.218 1.00 65.91  ? 93   LEU G C     1 
ATOM   4738  O  O     . LEU G 3  94   ? 290.274 285.779 253.132 1.00 65.91  ? 93   LEU G O     1 
ATOM   4739  C  CB    . LEU G 3  94   ? 287.216 284.916 252.677 1.00 65.91  ? 93   LEU G CB    1 
ATOM   4740  C  CG    . LEU G 3  94   ? 285.925 285.032 253.461 1.00 65.91  ? 93   LEU G CG    1 
ATOM   4741  C  CD1   . LEU G 3  94   ? 285.225 283.713 253.474 1.00 65.91  ? 93   LEU G CD1   1 
ATOM   4742  C  CD2   . LEU G 3  94   ? 286.245 285.467 254.848 1.00 65.91  ? 93   LEU G CD2   1 
ATOM   4743  N  N     . ASN G 3  95   ? 289.793 285.745 250.943 1.00 65.25  ? 94   ASN G N     1 
ATOM   4744  C  CA    . ASN G 3  95   ? 291.184 285.609 250.555 1.00 65.25  ? 94   ASN G CA    1 
ATOM   4745  C  C     . ASN G 3  95   ? 291.961 286.874 250.858 1.00 65.25  ? 94   ASN G C     1 
ATOM   4746  O  O     . ASN G 3  95   ? 293.143 286.814 251.186 1.00 65.25  ? 94   ASN G O     1 
ATOM   4747  C  CB    . ASN G 3  95   ? 291.268 285.292 249.074 1.00 65.25  ? 94   ASN G CB    1 
ATOM   4748  C  CG    . ASN G 3  95   ? 292.577 284.679 248.684 1.00 65.25  ? 94   ASN G CG    1 
ATOM   4749  O  OD1   . ASN G 3  95   ? 293.470 284.508 249.503 1.00 65.25  ? 94   ASN G OD1   1 
ATOM   4750  N  ND2   . ASN G 3  95   ? 292.707 284.352 247.413 1.00 65.25  ? 94   ASN G ND2   1 
ATOM   4751  N  N     . LYS G 3  96   ? 291.324 288.033 250.738 1.00 66.39  ? 95   LYS G N     1 
ATOM   4752  C  CA    . LYS G 3  96   ? 292.025 289.263 251.078 1.00 66.39  ? 95   LYS G CA    1 
ATOM   4753  C  C     . LYS G 3  96   ? 292.196 289.393 252.577 1.00 66.39  ? 95   LYS G C     1 
ATOM   4754  O  O     . LYS G 3  96   ? 293.210 289.913 253.048 1.00 66.39  ? 95   LYS G O     1 
ATOM   4755  C  CB    . LYS G 3  96   ? 291.281 290.465 250.520 1.00 66.39  ? 95   LYS G CB    1 
ATOM   4756  C  CG    . LYS G 3  96   ? 291.267 290.473 249.023 1.00 66.39  ? 95   LYS G CG    1 
ATOM   4757  C  CD    . LYS G 3  96   ? 290.873 291.806 248.451 1.00 66.39  ? 95   LYS G CD    1 
ATOM   4758  C  CE    . LYS G 3  96   ? 291.022 291.783 246.942 1.00 66.39  ? 95   LYS G CE    1 
ATOM   4759  N  NZ    . LYS G 3  96   ? 289.986 292.606 246.268 1.00 66.39  ? 95   LYS G NZ    1 
ATOM   4760  N  N     . LEU G 3  97   ? 291.222 288.918 253.342 1.00 62.27  ? 96   LEU G N     1 
ATOM   4761  C  CA    . LEU G 3  97   ? 291.322 289.003 254.788 1.00 62.27  ? 96   LEU G CA    1 
ATOM   4762  C  C     . LEU G 3  97   ? 292.323 287.997 255.322 1.00 62.27  ? 96   LEU G C     1 
ATOM   4763  O  O     . LEU G 3  97   ? 293.066 288.288 256.262 1.00 62.27  ? 96   LEU G O     1 
ATOM   4764  C  CB    . LEU G 3  97   ? 289.954 288.776 255.404 1.00 62.27  ? 96   LEU G CB    1 
ATOM   4765  C  CG    . LEU G 3  97   ? 289.883 288.700 256.912 1.00 62.27  ? 96   LEU G CG    1 
ATOM   4766  C  CD1   . LEU G 3  97   ? 290.254 290.023 257.489 1.00 62.27  ? 96   LEU G CD1   1 
ATOM   4767  C  CD2   . LEU G 3  97   ? 288.500 288.321 257.325 1.00 62.27  ? 96   LEU G CD2   1 
ATOM   4768  N  N     . LEU G 3  98   ? 292.377 286.823 254.715 1.00 62.03  ? 97   LEU G N     1 
ATOM   4769  C  CA    . LEU G 3  98   ? 293.254 285.769 255.187 1.00 62.03  ? 97   LEU G CA    1 
ATOM   4770  C  C     . LEU G 3  98   ? 294.303 285.466 254.137 1.00 62.03  ? 97   LEU G C     1 
ATOM   4771  O  O     . LEU G 3  98   ? 294.508 284.310 253.764 1.00 62.03  ? 97   LEU G O     1 
ATOM   4772  C  CB    . LEU G 3  98   ? 292.450 284.530 255.534 1.00 62.03  ? 97   LEU G CB    1 
ATOM   4773  C  CG    . LEU G 3  98   ? 291.386 284.800 256.584 1.00 62.03  ? 97   LEU G CG    1 
ATOM   4774  C  CD1   . LEU G 3  98   ? 290.573 283.577 256.845 1.00 62.03  ? 97   LEU G CD1   1 
ATOM   4775  C  CD2   . LEU G 3  98   ? 292.042 285.247 257.845 1.00 62.03  ? 97   LEU G CD2   1 
ATOM   4776  N  N     . GLY G 3  99   ? 294.934 286.514 253.615 1.00 64.99  ? 98   GLY G N     1 
ATOM   4777  C  CA    . GLY G 3  99   ? 295.979 286.313 252.629 1.00 64.99  ? 98   GLY G CA    1 
ATOM   4778  C  C     . GLY G 3  99   ? 297.215 285.677 253.222 1.00 64.99  ? 98   GLY G C     1 
ATOM   4779  O  O     . GLY G 3  99   ? 297.632 284.602 252.793 1.00 64.99  ? 98   GLY G O     1 
ATOM   4780  N  N     . GLY G 3  100  ? 297.799 286.315 254.232 1.00 64.70  ? 99   GLY G N     1 
ATOM   4781  C  CA    . GLY G 3  100  ? 299.020 285.823 254.837 1.00 64.70  ? 99   GLY G CA    1 
ATOM   4782  C  C     . GLY G 3  100  ? 298.892 284.514 255.567 1.00 64.70  ? 99   GLY G C     1 
ATOM   4783  O  O     . GLY G 3  100  ? 299.902 283.851 255.800 1.00 64.70  ? 99   GLY G O     1 
ATOM   4784  N  N     . VAL G 3  101  ? 297.681 284.109 255.887 1.00 62.19  ? 100  VAL G N     1 
ATOM   4785  C  CA    . VAL G 3  101  ? 297.431 282.976 256.763 1.00 62.19  ? 100  VAL G CA    1 
ATOM   4786  C  C     . VAL G 3  101  ? 297.618 281.674 256.006 1.00 62.19  ? 100  VAL G C     1 
ATOM   4787  O  O     . VAL G 3  101  ? 297.090 281.499 254.905 1.00 62.19  ? 100  VAL G O     1 
ATOM   4788  C  CB    . VAL G 3  101  ? 296.015 283.078 257.339 1.00 62.19  ? 100  VAL G CB    1 
ATOM   4789  C  CG1   . VAL G 3  101  ? 295.676 281.851 258.074 1.00 62.19  ? 100  VAL G CG1   1 
ATOM   4790  C  CG2   . VAL G 3  101  ? 295.922 284.255 258.242 1.00 62.19  ? 100  VAL G CG2   1 
ATOM   4791  N  N     . THR G 3  102  ? 298.382 280.758 256.587 1.00 60.63  ? 101  THR G N     1 
ATOM   4792  C  CA    . THR G 3  102  ? 298.406 279.376 256.145 1.00 60.63  ? 101  THR G CA    1 
ATOM   4793  C  C     . THR G 3  102  ? 297.494 278.581 257.055 1.00 60.63  ? 101  THR G C     1 
ATOM   4794  O  O     . THR G 3  102  ? 297.410 278.866 258.249 1.00 60.63  ? 101  THR G O     1 
ATOM   4795  C  CB    . THR G 3  102  ? 299.806 278.786 256.192 1.00 60.63  ? 101  THR G CB    1 
ATOM   4796  O  OG1   . THR G 3  102  ? 300.066 278.338 257.519 1.00 60.63  ? 101  THR G OG1   1 
ATOM   4797  C  CG2   . THR G 3  102  ? 300.823 279.824 255.815 1.00 60.63  ? 101  THR G CG2   1 
ATOM   4798  N  N     . ILE G 3  103  ? 296.817 277.595 256.496 1.00 61.31  ? 102  ILE G N     1 
ATOM   4799  C  CA    . ILE G 3  103  ? 295.853 276.788 257.223 1.00 61.31  ? 102  ILE G CA    1 
ATOM   4800  C  C     . ILE G 3  103  ? 296.383 275.371 257.281 1.00 61.31  ? 102  ILE G C     1 
ATOM   4801  O  O     . ILE G 3  103  ? 296.622 274.754 256.239 1.00 61.31  ? 102  ILE G O     1 
ATOM   4802  C  CB    . ILE G 3  103  ? 294.478 276.842 256.557 1.00 61.31  ? 102  ILE G CB    1 
ATOM   4803  C  CG1   . ILE G 3  103  ? 293.855 278.195 256.828 1.00 61.31  ? 102  ILE G CG1   1 
ATOM   4804  C  CG2   . ILE G 3  103  ? 293.591 275.780 257.097 1.00 61.31  ? 102  ILE G CG2   1 
ATOM   4805  C  CD1   . ILE G 3  103  ? 292.578 278.421 256.125 1.00 61.31  ? 102  ILE G CD1   1 
ATOM   4806  N  N     . ALA G 3  104  ? 296.580 274.860 258.489 1.00 61.66  ? 103  ALA G N     1 
ATOM   4807  C  CA    . ALA G 3  104  ? 297.233 273.573 258.654 1.00 61.66  ? 103  ALA G CA    1 
ATOM   4808  C  C     . ALA G 3  104  ? 296.319 272.453 258.213 1.00 61.66  ? 103  ALA G C     1 
ATOM   4809  O  O     . ALA G 3  104  ? 295.110 272.501 258.425 1.00 61.66  ? 103  ALA G O     1 
ATOM   4810  C  CB    . ALA G 3  104  ? 297.639 273.365 260.102 1.00 61.66  ? 103  ALA G CB    1 
ATOM   4811  N  N     . GLN G 3  105  ? 296.910 271.461 257.559 1.00 64.39  ? 104  GLN G N     1 
ATOM   4812  C  CA    . GLN G 3  105  ? 296.265 270.312 256.930 1.00 64.39  ? 104  GLN G CA    1 
ATOM   4813  C  C     . GLN G 3  105  ? 295.223 270.695 255.900 1.00 64.39  ? 104  GLN G C     1 
ATOM   4814  O  O     . GLN G 3  105  ? 294.384 269.869 255.548 1.00 64.39  ? 104  GLN G O     1 
ATOM   4815  C  CB    . GLN G 3  105  ? 295.642 269.364 257.953 1.00 64.39  ? 104  GLN G CB    1 
ATOM   4816  C  CG    . GLN G 3  105  ? 296.549 269.036 259.105 1.00 64.39  ? 104  GLN G CG    1 
ATOM   4817  C  CD    . GLN G 3  105  ? 297.689 268.130 258.715 1.00 64.39  ? 104  GLN G CD    1 
ATOM   4818  O  OE1   . GLN G 3  105  ? 297.618 267.420 257.716 1.00 64.39  ? 104  GLN G OE1   1 
ATOM   4819  N  NE2   . GLN G 3  105  ? 298.755 268.150 259.508 1.00 64.39  ? 104  GLN G NE2   1 
ATOM   4820  N  N     . GLY G 3  106  ? 295.256 271.914 255.393 1.00 63.29  ? 105  GLY G N     1 
ATOM   4821  C  CA    . GLY G 3  106  ? 294.441 272.269 254.262 1.00 63.29  ? 105  GLY G CA    1 
ATOM   4822  C  C     . GLY G 3  106  ? 295.313 272.057 253.062 1.00 63.29  ? 105  GLY G C     1 
ATOM   4823  O  O     . GLY G 3  106  ? 295.982 271.031 252.961 1.00 63.29  ? 105  GLY G O     1 
ATOM   4824  N  N     . GLY G 3  107  ? 295.363 273.011 252.162 1.00 64.47  ? 106  GLY G N     1 
ATOM   4825  C  CA    . GLY G 3  107  ? 296.282 272.825 251.068 1.00 64.47  ? 106  GLY G CA    1 
ATOM   4826  C  C     . GLY G 3  107  ? 296.255 273.942 250.062 1.00 64.47  ? 106  GLY G C     1 
ATOM   4827  O  O     . GLY G 3  107  ? 296.256 275.124 250.407 1.00 64.47  ? 106  GLY G O     1 
ATOM   4828  N  N     . VAL G 3  108  ? 296.219 273.560 248.803 1.00 63.20  ? 107  VAL G N     1 
ATOM   4829  C  CA    . VAL G 3  108  ? 296.280 274.487 247.693 1.00 63.20  ? 107  VAL G CA    1 
ATOM   4830  C  C     . VAL G 3  108  ? 294.950 274.470 246.969 1.00 63.20  ? 107  VAL G C     1 
ATOM   4831  O  O     . VAL G 3  108  ? 294.277 273.440 246.911 1.00 63.20  ? 107  VAL G O     1 
ATOM   4832  C  CB    . VAL G 3  108  ? 297.424 274.095 246.754 1.00 63.20  ? 107  VAL G CB    1 
ATOM   4833  C  CG1   . VAL G 3  108  ? 298.696 274.627 247.286 1.00 63.20  ? 107  VAL G CG1   1 
ATOM   4834  C  CG2   . VAL G 3  108  ? 297.513 272.608 246.727 1.00 63.20  ? 107  VAL G CG2   1 
ATOM   4835  N  N     . LEU G 3  109  ? 294.567 275.604 246.443 1.00 65.07  ? 108  LEU G N     1 
ATOM   4836  C  CA    . LEU G 3  109  ? 293.464 275.630 245.510 1.00 65.07  ? 108  LEU G CA    1 
ATOM   4837  C  C     . LEU G 3  109  ? 293.994 275.223 244.143 1.00 65.07  ? 108  LEU G C     1 
ATOM   4838  O  O     . LEU G 3  109  ? 294.875 275.902 243.609 1.00 65.07  ? 108  LEU G O     1 
ATOM   4839  C  CB    . LEU G 3  109  ? 292.837 277.019 245.489 1.00 65.07  ? 108  LEU G CB    1 
ATOM   4840  C  CG    . LEU G 3  109  ? 291.861 277.399 244.382 1.00 65.07  ? 108  LEU G CG    1 
ATOM   4841  C  CD1   . LEU G 3  109  ? 290.680 278.111 244.978 1.00 65.07  ? 108  LEU G CD1   1 
ATOM   4842  C  CD2   . LEU G 3  109  ? 292.538 278.315 243.382 1.00 65.07  ? 108  LEU G CD2   1 
ATOM   4843  N  N     . PRO G 3  110  ? 293.519 274.126 243.555 1.00 64.03  ? 109  PRO G N     1 
ATOM   4844  C  CA    . PRO G 3  110  ? 294.045 273.595 242.302 1.00 64.03  ? 109  PRO G CA    1 
ATOM   4845  C  C     . PRO G 3  110  ? 293.815 274.502 241.100 1.00 64.03  ? 109  PRO G C     1 
ATOM   4846  O  O     . PRO G 3  110  ? 294.655 274.541 240.199 1.00 64.03  ? 109  PRO G O     1 
ATOM   4847  C  CB    . PRO G 3  110  ? 293.268 272.292 242.130 1.00 64.03  ? 109  PRO G CB    1 
ATOM   4848  C  CG    . PRO G 3  110  ? 292.759 271.968 243.459 1.00 64.03  ? 109  PRO G CG    1 
ATOM   4849  C  CD    . PRO G 3  110  ? 292.476 273.257 244.107 1.00 64.03  ? 109  PRO G CD    1 
ATOM   4850  N  N     . LYS H 4  35   ? 290.865 275.268 280.587 1.00 75.37  ? 31   LYS H N     1 
ATOM   4851  C  CA    . LYS H 4  35   ? 291.057 276.061 279.383 1.00 75.37  ? 31   LYS H CA    1 
ATOM   4852  C  C     . LYS H 4  35   ? 289.719 276.499 278.845 1.00 75.37  ? 31   LYS H C     1 
ATOM   4853  O  O     . LYS H 4  35   ? 288.685 276.110 279.371 1.00 75.37  ? 31   LYS H O     1 
ATOM   4854  C  CB    . LYS H 4  35   ? 291.802 275.266 278.318 1.00 75.37  ? 31   LYS H CB    1 
ATOM   4855  C  CG    . LYS H 4  35   ? 293.131 274.707 278.773 1.00 75.37  ? 31   LYS H CG    1 
ATOM   4856  C  CD    . LYS H 4  35   ? 293.686 273.700 277.783 1.00 75.37  ? 31   LYS H CD    1 
ATOM   4857  C  CE    . LYS H 4  35   ? 294.010 274.353 276.451 1.00 75.37  ? 31   LYS H CE    1 
ATOM   4858  N  NZ    . LYS H 4  35   ? 295.334 275.028 276.450 1.00 75.37  ? 31   LYS H NZ    1 
ATOM   4859  N  N     . GLU H 4  36   ? 289.739 277.302 277.785 1.00 70.58  ? 32   GLU H N     1 
ATOM   4860  C  CA    . GLU H 4  36   ? 288.526 277.803 277.160 1.00 70.58  ? 32   GLU H CA    1 
ATOM   4861  C  C     . GLU H 4  36   ? 288.800 278.138 275.707 1.00 70.58  ? 32   GLU H C     1 
ATOM   4862  O  O     . GLU H 4  36   ? 289.949 278.321 275.303 1.00 70.58  ? 32   GLU H O     1 
ATOM   4863  C  CB    . GLU H 4  36   ? 287.998 279.034 277.879 1.00 70.58  ? 32   GLU H CB    1 
ATOM   4864  C  CG    . GLU H 4  36   ? 288.766 280.291 277.574 1.00 70.58  ? 32   GLU H CG    1 
ATOM   4865  C  CD    . GLU H 4  36   ? 288.546 281.364 278.602 1.00 70.58  ? 32   GLU H CD    1 
ATOM   4866  O  OE1   . GLU H 4  36   ? 289.037 281.200 279.735 1.00 70.58  ? 32   GLU H OE1   1 
ATOM   4867  O  OE2   . GLU H 4  36   ? 287.884 282.374 278.281 1.00 70.58  ? 32   GLU H OE2   1 
ATOM   4868  N  N     . SER H 4  37   ? 287.734 278.210 274.926 1.00 64.13  ? 33   SER H N     1 
ATOM   4869  C  CA    . SER H 4  37   ? 287.840 278.504 273.509 1.00 64.13  ? 33   SER H CA    1 
ATOM   4870  C  C     . SER H 4  37   ? 286.474 278.934 273.016 1.00 64.13  ? 33   SER H C     1 
ATOM   4871  O  O     . SER H 4  37   ? 285.562 279.188 273.806 1.00 64.13  ? 33   SER H O     1 
ATOM   4872  C  CB    . SER H 4  37   ? 288.320 277.294 272.714 1.00 64.13  ? 33   SER H CB    1 
ATOM   4873  O  OG    . SER H 4  37   ? 287.207 276.543 272.281 1.00 64.13  ? 33   SER H OG    1 
ATOM   4874  N  N     . TYR H 4  38   ? 286.334 279.018 271.703 1.00 62.21  ? 34   TYR H N     1 
ATOM   4875  C  CA    . TYR H 4  38   ? 285.060 279.267 271.060 1.00 62.21  ? 34   TYR H CA    1 
ATOM   4876  C  C     . TYR H 4  38   ? 284.767 278.012 270.266 1.00 62.21  ? 34   TYR H C     1 
ATOM   4877  O  O     . TYR H 4  38   ? 285.021 277.943 269.070 1.00 62.21  ? 34   TYR H O     1 
ATOM   4878  C  CB    . TYR H 4  38   ? 285.093 280.450 270.135 1.00 62.21  ? 34   TYR H CB    1 
ATOM   4879  C  CG    . TYR H 4  38   ? 285.609 281.752 270.684 1.00 62.21  ? 34   TYR H CG    1 
ATOM   4880  C  CD1   . TYR H 4  38   ? 286.962 282.003 270.774 1.00 62.21  ? 34   TYR H CD1   1 
ATOM   4881  C  CD2   . TYR H 4  38   ? 284.739 282.753 271.055 1.00 62.21  ? 34   TYR H CD2   1 
ATOM   4882  C  CE1   . TYR H 4  38   ? 287.427 283.185 271.245 1.00 62.21  ? 34   TYR H CE1   1 
ATOM   4883  C  CE2   . TYR H 4  38   ? 285.197 283.940 271.529 1.00 62.21  ? 34   TYR H CE2   1 
ATOM   4884  C  CZ    . TYR H 4  38   ? 286.540 284.148 271.618 1.00 62.21  ? 34   TYR H CZ    1 
ATOM   4885  O  OH    . TYR H 4  38   ? 287.006 285.341 272.089 1.00 62.21  ? 34   TYR H OH    1 
ATOM   4886  N  N     . ALA H 4  39   ? 284.218 277.012 270.925 1.00 61.82  ? 35   ALA H N     1 
ATOM   4887  C  CA    . ALA H 4  39   ? 283.842 275.803 270.226 1.00 61.82  ? 35   ALA H CA    1 
ATOM   4888  C  C     . ALA H 4  39   ? 282.333 275.643 270.212 1.00 61.82  ? 35   ALA H C     1 
ATOM   4889  O  O     . ALA H 4  39   ? 281.755 275.325 269.181 1.00 61.82  ? 35   ALA H O     1 
ATOM   4890  C  CB    . ALA H 4  39   ? 284.507 274.591 270.863 1.00 61.82  ? 35   ALA H CB    1 
ATOM   4891  N  N     . ILE H 4  40   ? 281.681 275.896 271.343 1.00 63.00  ? 36   ILE H N     1 
ATOM   4892  C  CA    . ILE H 4  40   ? 280.230 275.844 271.378 1.00 63.00  ? 36   ILE H CA    1 
ATOM   4893  C  C     . ILE H 4  40   ? 279.631 276.977 270.567 1.00 63.00  ? 36   ILE H C     1 
ATOM   4894  O  O     . ILE H 4  40   ? 278.605 276.807 269.899 1.00 63.00  ? 36   ILE H O     1 
ATOM   4895  C  CB    . ILE H 4  40   ? 279.769 275.841 272.841 1.00 63.00  ? 36   ILE H CB    1 
ATOM   4896  C  CG1   . ILE H 4  40   ? 278.252 275.758 272.917 1.00 63.00  ? 36   ILE H CG1   1 
ATOM   4897  C  CG2   . ILE H 4  40   ? 280.352 276.992 273.609 1.00 63.00  ? 36   ILE H CG2   1 
ATOM   4898  C  CD1   . ILE H 4  40   ? 277.679 274.478 272.314 1.00 63.00  ? 36   ILE H CD1   1 
ATOM   4899  N  N     . TYR H 4  41   ? 280.319 278.107 270.512 1.00 62.94  ? 37   TYR H N     1 
ATOM   4900  C  CA    . TYR H 4  41   ? 279.861 279.262 269.778 1.00 62.94  ? 37   TYR H CA    1 
ATOM   4901  C  C     . TYR H 4  41   ? 280.026 279.100 268.296 1.00 62.94  ? 37   TYR H C     1 
ATOM   4902  O  O     . TYR H 4  41   ? 279.599 279.974 267.549 1.00 62.94  ? 37   TYR H O     1 
ATOM   4903  C  CB    . TYR H 4  41   ? 280.641 280.459 270.232 1.00 62.94  ? 37   TYR H CB    1 
ATOM   4904  C  CG    . TYR H 4  41   ? 280.538 280.610 271.696 1.00 62.94  ? 37   TYR H CG    1 
ATOM   4905  C  CD1   . TYR H 4  41   ? 279.317 280.812 272.272 1.00 62.94  ? 37   TYR H CD1   1 
ATOM   4906  C  CD2   . TYR H 4  41   ? 281.639 280.515 272.509 1.00 62.94  ? 37   TYR H CD2   1 
ATOM   4907  C  CE1   . TYR H 4  41   ? 279.183 280.951 273.591 1.00 62.94  ? 37   TYR H CE1   1 
ATOM   4908  C  CE2   . TYR H 4  41   ? 281.513 280.646 273.847 1.00 62.94  ? 37   TYR H CE2   1 
ATOM   4909  C  CZ    . TYR H 4  41   ? 280.275 280.868 274.375 1.00 62.94  ? 37   TYR H CZ    1 
ATOM   4910  O  OH    . TYR H 4  41   ? 280.093 281.013 275.717 1.00 62.94  ? 37   TYR H OH    1 
ATOM   4911  N  N     . VAL H 4  42   ? 280.659 278.030 267.849 1.00 62.04  ? 38   VAL H N     1 
ATOM   4912  C  CA    . VAL H 4  42   ? 280.878 277.799 266.438 1.00 62.04  ? 38   VAL H CA    1 
ATOM   4913  C  C     . VAL H 4  42   ? 280.008 276.622 266.046 1.00 62.04  ? 38   VAL H C     1 
ATOM   4914  O  O     . VAL H 4  42   ? 279.538 276.536 264.913 1.00 62.04  ? 38   VAL H O     1 
ATOM   4915  C  CB    . VAL H 4  42   ? 282.369 277.584 266.166 1.00 62.04  ? 38   VAL H CB    1 
ATOM   4916  C  CG1   . VAL H 4  42   ? 282.632 277.231 264.764 1.00 62.04  ? 38   VAL H CG1   1 
ATOM   4917  C  CG2   . VAL H 4  42   ? 283.109 278.836 266.468 1.00 62.04  ? 38   VAL H CG2   1 
ATOM   4918  N  N     . TYR H 4  43   ? 279.720 275.746 267.001 1.00 66.36  ? 39   TYR H N     1 
ATOM   4919  C  CA    . TYR H 4  43   ? 278.671 274.765 266.763 1.00 66.36  ? 39   TYR H CA    1 
ATOM   4920  C  C     . TYR H 4  43   ? 277.325 275.439 266.591 1.00 66.36  ? 39   TYR H C     1 
ATOM   4921  O  O     . TYR H 4  43   ? 276.565 275.085 265.687 1.00 66.36  ? 39   TYR H O     1 
ATOM   4922  C  CB    . TYR H 4  43   ? 278.567 273.778 267.907 1.00 66.36  ? 39   TYR H CB    1 
ATOM   4923  C  CG    . TYR H 4  43   ? 279.400 272.555 267.762 1.00 66.36  ? 39   TYR H CG    1 
ATOM   4924  C  CD1   . TYR H 4  43   ? 280.718 272.555 268.153 1.00 66.36  ? 39   TYR H CD1   1 
ATOM   4925  C  CD2   . TYR H 4  43   ? 278.875 271.406 267.201 1.00 66.36  ? 39   TYR H CD2   1 
ATOM   4926  C  CE1   . TYR H 4  43   ? 281.492 271.445 268.036 1.00 66.36  ? 39   TYR H CE1   1 
ATOM   4927  C  CE2   . TYR H 4  43   ? 279.643 270.283 267.066 1.00 66.36  ? 39   TYR H CE2   1 
ATOM   4928  C  CZ    . TYR H 4  43   ? 280.960 270.310 267.488 1.00 66.36  ? 39   TYR H CZ    1 
ATOM   4929  O  OH    . TYR H 4  43   ? 281.764 269.201 267.371 1.00 66.36  ? 39   TYR H OH    1 
ATOM   4930  N  N     . LYS H 4  44   ? 277.014 276.397 267.463 1.00 63.57  ? 40   LYS H N     1 
ATOM   4931  C  CA    . LYS H 4  44   ? 275.725 277.073 267.415 1.00 63.57  ? 40   LYS H CA    1 
ATOM   4932  C  C     . LYS H 4  44   ? 275.544 277.817 266.114 1.00 63.57  ? 40   LYS H C     1 
ATOM   4933  O  O     . LYS H 4  44   ? 274.468 277.778 265.516 1.00 63.57  ? 40   LYS H O     1 
ATOM   4934  C  CB    . LYS H 4  44   ? 275.599 278.049 268.574 1.00 63.57  ? 40   LYS H CB    1 
ATOM   4935  C  CG    . LYS H 4  44   ? 275.332 277.426 269.903 1.00 63.57  ? 40   LYS H CG    1 
ATOM   4936  C  CD    . LYS H 4  44   ? 275.360 278.479 270.964 1.00 63.57  ? 40   LYS H CD    1 
ATOM   4937  C  CE    . LYS H 4  44   ? 275.045 277.891 272.308 1.00 63.57  ? 40   LYS H CE    1 
ATOM   4938  N  NZ    . LYS H 4  44   ? 275.270 278.887 273.383 1.00 63.57  ? 40   LYS H NZ    1 
ATOM   4939  N  N     . VAL H 4  45   ? 276.591 278.479 265.638 1.00 62.13  ? 41   VAL H N     1 
ATOM   4940  C  CA    . VAL H 4  45   ? 276.483 279.136 264.350 1.00 62.13  ? 41   VAL H CA    1 
ATOM   4941  C  C     . VAL H 4  45   ? 276.676 278.172 263.208 1.00 62.13  ? 41   VAL H C     1 
ATOM   4942  O  O     . VAL H 4  45   ? 276.480 278.562 262.054 1.00 62.13  ? 41   VAL H O     1 
ATOM   4943  C  CB    . VAL H 4  45   ? 277.487 280.284 264.167 1.00 62.13  ? 41   VAL H CB    1 
ATOM   4944  C  CG1   . VAL H 4  45   ? 277.470 281.186 265.351 1.00 62.13  ? 41   VAL H CG1   1 
ATOM   4945  C  CG2   . VAL H 4  45   ? 278.839 279.755 263.980 1.00 62.13  ? 41   VAL H CG2   1 
ATOM   4946  N  N     . LEU H 4  46   ? 277.054 276.930 263.476 1.00 63.99  ? 42   LEU H N     1 
ATOM   4947  C  CA    . LEU H 4  46   ? 277.135 275.967 262.391 1.00 63.99  ? 42   LEU H CA    1 
ATOM   4948  C  C     . LEU H 4  46   ? 275.802 275.285 262.170 1.00 63.99  ? 42   LEU H C     1 
ATOM   4949  O  O     . LEU H 4  46   ? 275.391 275.082 261.028 1.00 63.99  ? 42   LEU H O     1 
ATOM   4950  C  CB    . LEU H 4  46   ? 278.211 274.938 262.683 1.00 63.99  ? 42   LEU H CB    1 
ATOM   4951  C  CG    . LEU H 4  46   ? 278.394 273.889 261.604 1.00 63.99  ? 42   LEU H CG    1 
ATOM   4952  C  CD1   . LEU H 4  46   ? 278.689 274.531 260.283 1.00 63.99  ? 42   LEU H CD1   1 
ATOM   4953  C  CD2   . LEU H 4  46   ? 279.504 272.986 261.989 1.00 63.99  ? 42   LEU H CD2   1 
ATOM   4954  N  N     . LYS H 4  47   ? 275.094 274.958 263.241 1.00 64.41  ? 43   LYS H N     1 
ATOM   4955  C  CA    . LYS H 4  47   ? 273.766 274.409 263.075 1.00 64.41  ? 43   LYS H CA    1 
ATOM   4956  C  C     . LYS H 4  47   ? 272.739 275.463 262.715 1.00 64.41  ? 43   LYS H C     1 
ATOM   4957  O  O     . LYS H 4  47   ? 271.589 275.113 262.449 1.00 64.41  ? 43   LYS H O     1 
ATOM   4958  C  CB    . LYS H 4  47   ? 273.345 273.696 264.341 1.00 64.41  ? 43   LYS H CB    1 
ATOM   4959  C  CG    . LYS H 4  47   ? 274.304 272.626 264.751 1.00 64.41  ? 43   LYS H CG    1 
ATOM   4960  C  CD    . LYS H 4  47   ? 274.544 271.645 263.616 1.00 64.41  ? 43   LYS H CD    1 
ATOM   4961  C  CE    . LYS H 4  47   ? 275.599 270.614 263.981 1.00 64.41  ? 43   LYS H CE    1 
ATOM   4962  N  NZ    . LYS H 4  47   ? 275.772 269.612 262.906 1.00 64.41  ? 43   LYS H NZ    1 
ATOM   4963  N  N     . GLN H 4  48   ? 273.110 276.733 262.712 1.00 65.71  ? 44   GLN H N     1 
ATOM   4964  C  CA    . GLN H 4  48   ? 272.258 277.749 262.132 1.00 65.71  ? 44   GLN H CA    1 
ATOM   4965  C  C     . GLN H 4  48   ? 272.323 277.782 260.621 1.00 65.71  ? 44   GLN H C     1 
ATOM   4966  O  O     . GLN H 4  48   ? 271.424 278.344 260.002 1.00 65.71  ? 44   GLN H O     1 
ATOM   4967  C  CB    . GLN H 4  48   ? 272.646 279.122 262.642 1.00 65.71  ? 44   GLN H CB    1 
ATOM   4968  C  CG    . GLN H 4  48   ? 272.053 279.488 263.938 1.00 65.71  ? 44   GLN H CG    1 
ATOM   4969  C  CD    . GLN H 4  48   ? 272.295 280.929 264.255 1.00 65.71  ? 44   GLN H CD    1 
ATOM   4970  O  OE1   . GLN H 4  48   ? 272.933 281.638 263.490 1.00 65.71  ? 44   GLN H OE1   1 
ATOM   4971  N  NE2   . GLN H 4  48   ? 271.795 281.375 265.389 1.00 65.71  ? 44   GLN H NE2   1 
ATOM   4972  N  N     . VAL H 4  49   ? 273.370 277.245 260.007 1.00 62.55  ? 45   VAL H N     1 
ATOM   4973  C  CA    . VAL H 4  49   ? 273.539 277.438 258.577 1.00 62.55  ? 45   VAL H CA    1 
ATOM   4974  C  C     . VAL H 4  49   ? 273.547 276.103 257.862 1.00 62.55  ? 45   VAL H C     1 
ATOM   4975  O  O     . VAL H 4  49   ? 273.188 276.013 256.687 1.00 62.55  ? 45   VAL H O     1 
ATOM   4976  C  CB    . VAL H 4  49   ? 274.824 278.217 258.272 1.00 62.55  ? 45   VAL H CB    1 
ATOM   4977  C  CG1   . VAL H 4  49   ? 274.670 279.612 258.677 1.00 62.55  ? 45   VAL H CG1   1 
ATOM   4978  C  CG2   . VAL H 4  49   ? 275.972 277.638 259.002 1.00 62.55  ? 45   VAL H CG2   1 
ATOM   4979  N  N     . HIS H 4  50   ? 273.956 275.057 258.558 1.00 62.33  ? 46   HIS H N     1 
ATOM   4980  C  CA    . HIS H 4  50   ? 274.090 273.734 257.960 1.00 62.33  ? 46   HIS H CA    1 
ATOM   4981  C  C     . HIS H 4  50   ? 273.796 272.730 259.035 1.00 62.33  ? 46   HIS H C     1 
ATOM   4982  O  O     . HIS H 4  50   ? 274.705 272.168 259.646 1.00 62.33  ? 46   HIS H O     1 
ATOM   4983  C  CB    . HIS H 4  50   ? 275.488 273.508 257.414 1.00 62.33  ? 46   HIS H CB    1 
ATOM   4984  C  CG    . HIS H 4  50   ? 275.749 274.182 256.118 1.00 62.33  ? 46   HIS H CG    1 
ATOM   4985  N  ND1   . HIS H 4  50   ? 276.289 275.440 256.037 1.00 62.33  ? 46   HIS H ND1   1 
ATOM   4986  C  CD2   . HIS H 4  50   ? 275.568 273.765 254.850 1.00 62.33  ? 46   HIS H CD2   1 
ATOM   4987  C  CE1   . HIS H 4  50   ? 276.419 275.777 254.771 1.00 62.33  ? 46   HIS H CE1   1 
ATOM   4988  N  NE2   . HIS H 4  50   ? 275.987 274.777 254.029 1.00 62.33  ? 46   HIS H NE2   1 
ATOM   4989  N  N     . PRO H 4  51   ? 272.553 272.450 259.276 1.00 64.28  ? 47   PRO H N     1 
ATOM   4990  C  CA    . PRO H 4  51   ? 272.196 271.715 260.491 1.00 64.28  ? 47   PRO H CA    1 
ATOM   4991  C  C     . PRO H 4  51   ? 272.437 270.216 260.417 1.00 64.28  ? 47   PRO H C     1 
ATOM   4992  O  O     . PRO H 4  51   ? 272.029 269.479 261.313 1.00 64.28  ? 47   PRO H O     1 
ATOM   4993  C  CB    . PRO H 4  51   ? 270.715 272.042 260.656 1.00 64.28  ? 47   PRO H CB    1 
ATOM   4994  C  CG    . PRO H 4  51   ? 270.248 272.360 259.298 1.00 64.28  ? 47   PRO H CG    1 
ATOM   4995  C  CD    . PRO H 4  51   ? 271.380 272.829 258.482 1.00 64.28  ? 47   PRO H CD    1 
ATOM   4996  N  N     . ASP H 4  52   ? 273.116 269.757 259.370 1.00 67.77  ? 48   ASP H N     1 
ATOM   4997  C  CA    . ASP H 4  52   ? 273.462 268.359 259.200 1.00 67.77  ? 48   ASP H CA    1 
ATOM   4998  C  C     . ASP H 4  52   ? 274.946 268.102 259.030 1.00 67.77  ? 48   ASP H C     1 
ATOM   4999  O  O     . ASP H 4  52   ? 275.364 266.953 259.129 1.00 67.77  ? 48   ASP H O     1 
ATOM   5000  C  CB    . ASP H 4  52   ? 272.733 267.788 257.990 1.00 67.77  ? 48   ASP H CB    1 
ATOM   5001  C  CG    . ASP H 4  52   ? 271.274 268.103 258.014 1.00 67.77  ? 48   ASP H CG    1 
ATOM   5002  O  OD1   . ASP H 4  52   ? 270.669 267.946 259.089 1.00 67.77  ? 48   ASP H OD1   1 
ATOM   5003  O  OD2   . ASP H 4  52   ? 270.730 268.519 256.976 1.00 67.77  ? 48   ASP H OD2   1 
ATOM   5004  N  N     . THR H 4  53   ? 275.750 269.126 258.779 1.00 69.87  ? 49   THR H N     1 
ATOM   5005  C  CA    . THR H 4  53   ? 277.185 268.943 258.652 1.00 69.87  ? 49   THR H CA    1 
ATOM   5006  C  C     . THR H 4  53   ? 277.837 268.979 260.015 1.00 69.87  ? 49   THR H C     1 
ATOM   5007  O  O     . THR H 4  53   ? 277.670 269.940 260.761 1.00 69.87  ? 49   THR H O     1 
ATOM   5008  C  CB    . THR H 4  53   ? 277.815 270.042 257.828 1.00 69.87  ? 49   THR H CB    1 
ATOM   5009  O  OG1   . THR H 4  53   ? 277.579 271.272 258.497 1.00 69.87  ? 49   THR H OG1   1 
ATOM   5010  C  CG2   . THR H 4  53   ? 277.181 270.098 256.471 1.00 69.87  ? 49   THR H CG2   1 
ATOM   5011  N  N     . GLY H 4  54   ? 278.606 267.955 260.324 1.00 78.26  ? 50   GLY H N     1 
ATOM   5012  C  CA    . GLY H 4  54   ? 279.424 267.973 261.513 1.00 78.26  ? 50   GLY H CA    1 
ATOM   5013  C  C     . GLY H 4  54   ? 280.698 268.731 261.233 1.00 78.26  ? 50   GLY H C     1 
ATOM   5014  O  O     . GLY H 4  54   ? 280.937 269.193 260.119 1.00 78.26  ? 50   GLY H O     1 
ATOM   5015  N  N     . ILE H 4  55   ? 281.537 268.859 262.247 1.00 74.57  ? 51   ILE H N     1 
ATOM   5016  C  CA    . ILE H 4  55   ? 282.801 269.533 262.017 1.00 74.57  ? 51   ILE H CA    1 
ATOM   5017  C  C     . ILE H 4  55   ? 283.913 268.796 262.743 1.00 74.57  ? 51   ILE H C     1 
ATOM   5018  O  O     . ILE H 4  55   ? 283.749 268.356 263.883 1.00 74.57  ? 51   ILE H O     1 
ATOM   5019  C  CB    . ILE H 4  55   ? 282.704 271.014 262.415 1.00 74.57  ? 51   ILE H CB    1 
ATOM   5020  C  CG1   . ILE H 4  55   ? 284.008 271.736 262.143 1.00 74.57  ? 51   ILE H CG1   1 
ATOM   5021  C  CG2   . ILE H 4  55   ? 282.262 271.188 263.843 1.00 74.57  ? 51   ILE H CG2   1 
ATOM   5022  C  CD1   . ILE H 4  55   ? 283.836 273.206 261.992 1.00 74.57  ? 51   ILE H CD1   1 
ATOM   5023  N  N     . SER H 4  56   ? 285.037 268.598 262.066 1.00 72.99  ? 52   SER H N     1 
ATOM   5024  C  CA    . SER H 4  56   ? 286.124 267.812 262.614 1.00 72.99  ? 52   SER H CA    1 
ATOM   5025  C  C     . SER H 4  56   ? 286.833 268.579 263.712 1.00 72.99  ? 52   SER H C     1 
ATOM   5026  O  O     . SER H 4  56   ? 286.531 269.731 263.989 1.00 72.99  ? 52   SER H O     1 
ATOM   5027  C  CB    . SER H 4  56   ? 287.101 267.424 261.518 1.00 72.99  ? 52   SER H CB    1 
ATOM   5028  O  OG    . SER H 4  56   ? 287.322 268.512 260.652 1.00 72.99  ? 52   SER H OG    1 
ATOM   5029  N  N     . SER H 4  57   ? 287.779 267.932 264.365 1.00 68.55  ? 53   SER H N     1 
ATOM   5030  C  CA    . SER H 4  57   ? 288.380 268.611 265.497 1.00 68.55  ? 53   SER H CA    1 
ATOM   5031  C  C     . SER H 4  57   ? 289.514 269.514 265.069 1.00 68.55  ? 53   SER H C     1 
ATOM   5032  O  O     . SER H 4  57   ? 289.730 270.567 265.679 1.00 68.55  ? 53   SER H O     1 
ATOM   5033  C  CB    . SER H 4  57   ? 288.879 267.614 266.519 1.00 68.55  ? 53   SER H CB    1 
ATOM   5034  O  OG    . SER H 4  57   ? 289.256 268.307 267.689 1.00 68.55  ? 53   SER H OG    1 
ATOM   5035  N  N     . LYS H 4  58   ? 290.261 269.114 264.046 1.00 64.84  ? 54   LYS H N     1 
ATOM   5036  C  CA    . LYS H 4  58   ? 291.314 269.985 263.551 1.00 64.84  ? 54   LYS H CA    1 
ATOM   5037  C  C     . LYS H 4  58   ? 290.724 271.223 262.913 1.00 64.84  ? 54   LYS H C     1 
ATOM   5038  O  O     . LYS H 4  58   ? 291.217 272.326 263.145 1.00 64.84  ? 54   LYS H O     1 
ATOM   5039  C  CB    . LYS H 4  58   ? 292.208 269.253 262.560 1.00 64.84  ? 54   LYS H CB    1 
ATOM   5040  C  CG    . LYS H 4  58   ? 293.095 268.211 263.190 1.00 64.84  ? 54   LYS H CG    1 
ATOM   5041  C  CD    . LYS H 4  58   ? 294.082 268.808 264.185 1.00 64.84  ? 54   LYS H CD    1 
ATOM   5042  C  CE    . LYS H 4  58   ? 295.421 269.124 263.534 1.00 64.84  ? 54   LYS H CE    1 
ATOM   5043  N  NZ    . LYS H 4  58   ? 296.472 269.368 264.557 1.00 64.84  ? 54   LYS H NZ    1 
ATOM   5044  N  N     . ALA H 4  59   ? 289.644 271.069 262.155 1.00 64.44  ? 55   ALA H N     1 
ATOM   5045  C  CA    . ALA H 4  59   ? 288.980 272.227 261.578 1.00 64.44  ? 55   ALA H CA    1 
ATOM   5046  C  C     . ALA H 4  59   ? 288.339 273.086 262.644 1.00 64.44  ? 55   ALA H C     1 
ATOM   5047  O  O     . ALA H 4  59   ? 288.234 274.303 262.481 1.00 64.44  ? 55   ALA H O     1 
ATOM   5048  C  CB    . ALA H 4  59   ? 287.936 271.785 260.577 1.00 64.44  ? 55   ALA H CB    1 
ATOM   5049  N  N     . MET H 4  60   ? 287.939 272.482 263.754 1.00 65.60  ? 56   MET H N     1 
ATOM   5050  C  CA    . MET H 4  60   ? 287.481 273.261 264.889 1.00 65.60  ? 56   MET H CA    1 
ATOM   5051  C  C     . MET H 4  60   ? 288.600 274.088 265.465 1.00 65.60  ? 56   MET H C     1 
ATOM   5052  O  O     . MET H 4  60   ? 288.390 275.231 265.871 1.00 65.60  ? 56   MET H O     1 
ATOM   5053  C  CB    . MET H 4  60   ? 286.949 272.343 265.958 1.00 65.60  ? 56   MET H CB    1 
ATOM   5054  C  CG    . MET H 4  60   ? 285.943 272.992 266.749 1.00 65.60  ? 56   MET H CG    1 
ATOM   5055  S  SD    . MET H 4  60   ? 284.724 273.556 265.598 1.00 65.60  ? 56   MET H SD    1 
ATOM   5056  C  CE    . MET H 4  60   ? 283.619 274.217 266.787 1.00 65.60  ? 56   MET H CE    1 
ATOM   5057  N  N     . SER H 4  61   ? 289.797 273.523 265.516 1.00 63.74  ? 57   SER H N     1 
ATOM   5058  C  CA    . SER H 4  61   ? 290.934 274.283 266.001 1.00 63.74  ? 57   SER H CA    1 
ATOM   5059  C  C     . SER H 4  61   ? 291.304 275.401 265.047 1.00 63.74  ? 57   SER H C     1 
ATOM   5060  O  O     . SER H 4  61   ? 291.711 276.478 265.497 1.00 63.74  ? 57   SER H O     1 
ATOM   5061  C  CB    . SER H 4  61   ? 292.116 273.355 266.219 1.00 63.74  ? 57   SER H CB    1 
ATOM   5062  O  OG    . SER H 4  61   ? 291.697 272.177 266.879 1.00 63.74  ? 57   SER H OG    1 
ATOM   5063  N  N     . ILE H 4  62   ? 291.155 275.162 263.743 1.00 60.74  ? 58   ILE H N     1 
ATOM   5064  C  CA    . ILE H 4  62   ? 291.356 276.214 262.750 1.00 60.74  ? 58   ILE H CA    1 
ATOM   5065  C  C     . ILE H 4  62   ? 290.392 277.355 262.997 1.00 60.74  ? 58   ILE H C     1 
ATOM   5066  O  O     . ILE H 4  62   ? 290.785 278.521 263.030 1.00 60.74  ? 58   ILE H O     1 
ATOM   5067  C  CB    . ILE H 4  62   ? 291.167 275.671 261.331 1.00 60.74  ? 58   ILE H CB    1 
ATOM   5068  C  CG1   . ILE H 4  62   ? 292.105 274.523 261.032 1.00 60.74  ? 58   ILE H CG1   1 
ATOM   5069  C  CG2   . ILE H 4  62   ? 291.317 276.785 260.339 1.00 60.74  ? 58   ILE H CG2   1 
ATOM   5070  C  CD1   . ILE H 4  62   ? 293.459 274.903 260.716 1.00 60.74  ? 58   ILE H CD1   1 
ATOM   5071  N  N     . MET H 4  63   ? 289.118 277.031 263.209 1.00 61.90  ? 59   MET H N     1 
ATOM   5072  C  CA    . MET H 4  63   ? 288.115 278.074 263.378 1.00 61.90  ? 59   MET H CA    1 
ATOM   5073  C  C     . MET H 4  63   ? 288.308 278.830 264.679 1.00 61.90  ? 59   MET H C     1 
ATOM   5074  O  O     . MET H 4  63   ? 288.119 280.048 264.728 1.00 61.90  ? 59   MET H O     1 
ATOM   5075  C  CB    . MET H 4  63   ? 286.725 277.470 263.321 1.00 61.90  ? 59   MET H CB    1 
ATOM   5076  C  CG    . MET H 4  63   ? 286.363 276.964 261.972 1.00 61.90  ? 59   MET H CG    1 
ATOM   5077  S  SD    . MET H 4  63   ? 286.168 278.298 260.808 1.00 61.90  ? 59   MET H SD    1 
ATOM   5078  C  CE    . MET H 4  63   ? 284.986 279.266 261.704 1.00 61.90  ? 59   MET H CE    1 
ATOM   5079  N  N     . ASN H 4  64   ? 288.718 278.136 265.731 1.00 60.59  ? 60   ASN H N     1 
ATOM   5080  C  CA    . ASN H 4  64   ? 288.928 278.801 267.005 1.00 60.59  ? 60   ASN H CA    1 
ATOM   5081  C  C     . ASN H 4  64   ? 290.128 279.730 266.946 1.00 60.59  ? 60   ASN H C     1 
ATOM   5082  O  O     . ASN H 4  64   ? 290.084 280.861 267.454 1.00 60.59  ? 60   ASN H O     1 
ATOM   5083  C  CB    . ASN H 4  64   ? 289.107 277.764 268.093 1.00 60.59  ? 60   ASN H CB    1 
ATOM   5084  C  CG    . ASN H 4  64   ? 289.442 278.379 269.394 1.00 60.59  ? 60   ASN H CG    1 
ATOM   5085  O  OD1   . ASN H 4  64   ? 288.850 279.376 269.784 1.00 60.59  ? 60   ASN H OD1   1 
ATOM   5086  N  ND2   . ASN H 4  64   ? 290.404 277.804 270.088 1.00 60.59  ? 60   ASN H ND2   1 
ATOM   5087  N  N     . SER H 4  65   ? 291.194 279.299 266.273 1.00 62.04  ? 61   SER H N     1 
ATOM   5088  C  CA    . SER H 4  65   ? 292.346 280.176 266.144 1.00 62.04  ? 61   SER H CA    1 
ATOM   5089  C  C     . SER H 4  65   ? 292.065 281.308 265.182 1.00 62.04  ? 61   SER H C     1 
ATOM   5090  O  O     . SER H 4  65   ? 292.628 282.395 265.325 1.00 62.04  ? 61   SER H O     1 
ATOM   5091  C  CB    . SER H 4  65   ? 293.555 279.399 265.670 1.00 62.04  ? 61   SER H CB    1 
ATOM   5092  O  OG    . SER H 4  65   ? 293.617 279.467 264.268 1.00 62.04  ? 61   SER H OG    1 
ATOM   5093  N  N     . PHE H 4  66   ? 291.154 281.093 264.238 1.00 58.93  ? 62   PHE H N     1 
ATOM   5094  C  CA    . PHE H 4  66   ? 290.763 282.145 263.312 1.00 58.93  ? 62   PHE H CA    1 
ATOM   5095  C  C     . PHE H 4  66   ? 289.998 283.246 264.016 1.00 58.93  ? 62   PHE H C     1 
ATOM   5096  O  O     . PHE H 4  66   ? 290.246 284.432 263.777 1.00 58.93  ? 62   PHE H O     1 
ATOM   5097  C  CB    . PHE H 4  66   ? 289.923 281.550 262.198 1.00 58.93  ? 62   PHE H CB    1 
ATOM   5098  C  CG    . PHE H 4  66   ? 289.044 282.528 261.519 1.00 58.93  ? 62   PHE H CG    1 
ATOM   5099  C  CD1   . PHE H 4  66   ? 289.570 283.482 260.684 1.00 58.93  ? 62   PHE H CD1   1 
ATOM   5100  C  CD2   . PHE H 4  66   ? 287.685 282.469 261.679 1.00 58.93  ? 62   PHE H CD2   1 
ATOM   5101  C  CE1   . PHE H 4  66   ? 288.756 284.372 260.048 1.00 58.93  ? 62   PHE H CE1   1 
ATOM   5102  C  CE2   . PHE H 4  66   ? 286.877 283.361 261.046 1.00 58.93  ? 62   PHE H CE2   1 
ATOM   5103  C  CZ    . PHE H 4  66   ? 287.413 284.310 260.231 1.00 58.93  ? 62   PHE H CZ    1 
ATOM   5104  N  N     . VAL H 4  67   ? 289.047 282.881 264.870 1.00 57.74  ? 63   VAL H N     1 
ATOM   5105  C  CA    . VAL H 4  67   ? 288.295 283.932 265.540 1.00 57.74  ? 63   VAL H CA    1 
ATOM   5106  C  C     . VAL H 4  67   ? 289.150 284.618 266.583 1.00 57.74  ? 63   VAL H C     1 
ATOM   5107  O  O     . VAL H 4  67   ? 288.981 285.817 266.822 1.00 57.74  ? 63   VAL H O     1 
ATOM   5108  C  CB    . VAL H 4  67   ? 286.976 283.409 266.124 1.00 57.74  ? 63   VAL H CB    1 
ATOM   5109  C  CG1   . VAL H 4  67   ? 286.200 282.697 265.069 1.00 57.74  ? 63   VAL H CG1   1 
ATOM   5110  C  CG2   . VAL H 4  67   ? 287.205 282.485 267.252 1.00 57.74  ? 63   VAL H CG2   1 
ATOM   5111  N  N     . ASN H 4  68   ? 290.142 283.925 267.144 1.00 57.86  ? 64   ASN H N     1 
ATOM   5112  C  CA    . ASN H 4  68   ? 291.061 284.619 268.035 1.00 57.86  ? 64   ASN H CA    1 
ATOM   5113  C  C     . ASN H 4  68   ? 291.943 285.593 267.277 1.00 57.86  ? 64   ASN H C     1 
ATOM   5114  O  O     . ASN H 4  68   ? 292.203 286.700 267.759 1.00 57.86  ? 64   ASN H O     1 
ATOM   5115  C  CB    . ASN H 4  68   ? 291.903 283.617 268.793 1.00 57.86  ? 64   ASN H CB    1 
ATOM   5116  C  CG    . ASN H 4  68   ? 291.316 283.292 270.117 1.00 57.86  ? 64   ASN H CG    1 
ATOM   5117  O  OD1   . ASN H 4  68   ? 291.110 284.174 270.943 1.00 57.86  ? 64   ASN H OD1   1 
ATOM   5118  N  ND2   . ASN H 4  68   ? 291.006 282.028 270.332 1.00 57.86  ? 64   ASN H ND2   1 
ATOM   5119  N  N     . ASP H 4  69   ? 292.365 285.223 266.070 1.00 57.51  ? 65   ASP H N     1 
ATOM   5120  C  CA    . ASP H 4  69   ? 293.216 286.099 265.279 1.00 57.51  ? 65   ASP H CA    1 
ATOM   5121  C  C     . ASP H 4  69   ? 292.473 287.335 264.812 1.00 57.51  ? 65   ASP H C     1 
ATOM   5122  O  O     . ASP H 4  69   ? 293.005 288.447 264.868 1.00 57.51  ? 65   ASP H O     1 
ATOM   5123  C  CB    . ASP H 4  69   ? 293.775 285.335 264.095 1.00 57.51  ? 65   ASP H CB    1 
ATOM   5124  C  CG    . ASP H 4  69   ? 294.298 286.238 263.027 1.00 57.51  ? 65   ASP H CG    1 
ATOM   5125  O  OD1   . ASP H 4  69   ? 295.212 287.029 263.303 1.00 57.51  ? 65   ASP H OD1   1 
ATOM   5126  O  OD2   . ASP H 4  69   ? 293.820 286.138 261.889 1.00 57.51  ? 65   ASP H OD2   1 
ATOM   5127  N  N     . VAL H 4  70   ? 291.236 287.167 264.363 1.00 54.20  ? 66   VAL H N     1 
ATOM   5128  C  CA    . VAL H 4  70   ? 290.469 288.312 263.896 1.00 54.20  ? 66   VAL H CA    1 
ATOM   5129  C  C     . VAL H 4  70   ? 290.088 289.211 265.063 1.00 54.20  ? 66   VAL H C     1 
ATOM   5130  O  O     . VAL H 4  70   ? 290.100 290.443 264.941 1.00 54.20  ? 66   VAL H O     1 
ATOM   5131  C  CB    . VAL H 4  70   ? 289.258 287.815 263.097 1.00 54.20  ? 66   VAL H CB    1 
ATOM   5132  C  CG1   . VAL H 4  70   ? 288.207 288.854 262.956 1.00 54.20  ? 66   VAL H CG1   1 
ATOM   5133  C  CG2   . VAL H 4  70   ? 289.717 287.410 261.750 1.00 54.20  ? 66   VAL H CG2   1 
ATOM   5134  N  N     . PHE H 4  71   ? 289.818 288.615 266.226 1.00 54.38  ? 67   PHE H N     1 
ATOM   5135  C  CA    . PHE H 4  71   ? 289.584 289.387 267.436 1.00 54.38  ? 67   PHE H CA    1 
ATOM   5136  C  C     . PHE H 4  71   ? 290.786 290.233 267.784 1.00 54.38  ? 67   PHE H C     1 
ATOM   5137  O  O     . PHE H 4  71   ? 290.648 291.403 268.137 1.00 54.38  ? 67   PHE H O     1 
ATOM   5138  C  CB    . PHE H 4  71   ? 289.269 288.438 268.581 1.00 54.38  ? 67   PHE H CB    1 
ATOM   5139  C  CG    . PHE H 4  71   ? 289.018 289.112 269.891 1.00 54.38  ? 67   PHE H CG    1 
ATOM   5140  C  CD1   . PHE H 4  71   ? 287.767 289.556 270.209 1.00 54.38  ? 67   PHE H CD1   1 
ATOM   5141  C  CD2   . PHE H 4  71   ? 290.017 289.245 270.826 1.00 54.38  ? 67   PHE H CD2   1 
ATOM   5142  C  CE1   . PHE H 4  71   ? 287.534 290.143 271.398 1.00 54.38  ? 67   PHE H CE1   1 
ATOM   5143  C  CE2   . PHE H 4  71   ? 289.779 289.840 272.004 1.00 54.38  ? 67   PHE H CE2   1 
ATOM   5144  C  CZ    . PHE H 4  71   ? 288.540 290.288 272.292 1.00 54.38  ? 67   PHE H CZ    1 
ATOM   5145  N  N     . GLU H 4  72   ? 291.976 289.657 267.682 1.00 56.17  ? 68   GLU H N     1 
ATOM   5146  C  CA    . GLU H 4  72   ? 293.161 290.411 268.053 1.00 56.17  ? 68   GLU H CA    1 
ATOM   5147  C  C     . GLU H 4  72   ? 293.464 291.500 267.042 1.00 56.17  ? 68   GLU H C     1 
ATOM   5148  O  O     . GLU H 4  72   ? 293.908 292.585 267.423 1.00 56.17  ? 68   GLU H O     1 
ATOM   5149  C  CB    . GLU H 4  72   ? 294.356 289.485 268.219 1.00 56.17  ? 68   GLU H CB    1 
ATOM   5150  C  CG    . GLU H 4  72   ? 294.675 289.138 269.672 1.00 56.17  ? 68   GLU H CG    1 
ATOM   5151  C  CD    . GLU H 4  72   ? 295.259 290.298 270.510 1.00 56.17  ? 68   GLU H CD    1 
ATOM   5152  O  OE1   . GLU H 4  72   ? 295.484 290.089 271.721 1.00 56.17  ? 68   GLU H OE1   1 
ATOM   5153  O  OE2   . GLU H 4  72   ? 295.524 291.402 269.986 1.00 56.17  ? 68   GLU H OE2   1 
ATOM   5154  N  N     . ARG H 4  73   ? 293.182 291.253 265.762 1.00 54.34  ? 69   ARG H N     1 
ATOM   5155  C  CA    . ARG H 4  73   ? 293.350 292.285 264.744 1.00 54.34  ? 69   ARG H CA    1 
ATOM   5156  C  C     . ARG H 4  73   ? 292.439 293.473 264.994 1.00 54.34  ? 69   ARG H C     1 
ATOM   5157  O  O     . ARG H 4  73   ? 292.887 294.623 264.990 1.00 54.34  ? 69   ARG H O     1 
ATOM   5158  C  CB    . ARG H 4  73   ? 293.054 291.718 263.373 1.00 54.34  ? 69   ARG H CB    1 
ATOM   5159  C  CG    . ARG H 4  73   ? 294.148 290.926 262.766 1.00 54.34  ? 69   ARG H CG    1 
ATOM   5160  C  CD    . ARG H 4  73   ? 293.907 290.849 261.295 1.00 54.34  ? 69   ARG H CD    1 
ATOM   5161  N  NE    . ARG H 4  73   ? 294.096 289.509 260.786 1.00 54.34  ? 69   ARG H NE    1 
ATOM   5162  C  CZ    . ARG H 4  73   ? 294.034 289.206 259.501 1.00 54.34  ? 69   ARG H CZ    1 
ATOM   5163  N  NH1   . ARG H 4  73   ? 293.795 290.156 258.618 1.00 54.34  ? 69   ARG H NH1   1 
ATOM   5164  N  NH2   . ARG H 4  73   ? 294.218 287.967 259.099 1.00 54.34  ? 69   ARG H NH2   1 
ATOM   5165  N  N     . ILE H 4  74   ? 291.156 293.210 265.229 1.00 51.56  ? 70   ILE H N     1 
ATOM   5166  C  CA    . ILE H 4  74   ? 290.196 294.294 265.403 1.00 51.56  ? 70   ILE H CA    1 
ATOM   5167  C  C     . ILE H 4  74   ? 290.430 295.018 266.714 1.00 51.56  ? 70   ILE H C     1 
ATOM   5168  O  O     . ILE H 4  74   ? 290.341 296.245 266.777 1.00 51.56  ? 70   ILE H O     1 
ATOM   5169  C  CB    . ILE H 4  74   ? 288.768 293.751 265.290 1.00 51.56  ? 70   ILE H CB    1 
ATOM   5170  C  CG1   . ILE H 4  74   ? 288.510 293.273 263.876 1.00 51.56  ? 70   ILE H CG1   1 
ATOM   5171  C  CG2   . ILE H 4  74   ? 287.767 294.799 265.607 1.00 51.56  ? 70   ILE H CG2   1 
ATOM   5172  C  CD1   . ILE H 4  74   ? 287.184 292.613 263.710 1.00 51.56  ? 70   ILE H CD1   1 
ATOM   5173  N  N     . ALA H 4  75   ? 290.787 294.295 267.765 1.00 52.71  ? 71   ALA H N     1 
ATOM   5174  C  CA    . ALA H 4  75   ? 291.008 294.963 269.035 1.00 52.71  ? 71   ALA H CA    1 
ATOM   5175  C  C     . ALA H 4  75   ? 292.292 295.767 269.021 1.00 52.71  ? 71   ALA H C     1 
ATOM   5176  O  O     . ALA H 4  75   ? 292.362 296.833 269.637 1.00 52.71  ? 71   ALA H O     1 
ATOM   5177  C  CB    . ALA H 4  75   ? 291.026 293.944 270.158 1.00 52.71  ? 71   ALA H CB    1 
ATOM   5178  N  N     . GLY H 4  76   ? 293.293 295.319 268.268 1.00 52.81  ? 72   GLY H N     1 
ATOM   5179  C  CA    . GLY H 4  76   ? 294.489 296.121 268.115 1.00 52.81  ? 72   GLY H CA    1 
ATOM   5180  C  C     . GLY H 4  76   ? 294.249 297.373 267.298 1.00 52.81  ? 72   GLY H C     1 
ATOM   5181  O  O     . GLY H 4  76   ? 294.744 298.448 267.638 1.00 52.81  ? 72   GLY H O     1 
ATOM   5182  N  N     . GLU H 4  77   ? 293.459 297.258 266.234 1.00 53.46  ? 73   GLU H N     1 
ATOM   5183  C  CA    . GLU H 4  77   ? 293.180 298.423 265.413 1.00 53.46  ? 73   GLU H CA    1 
ATOM   5184  C  C     . GLU H 4  77   ? 292.300 299.419 266.145 1.00 53.46  ? 73   GLU H C     1 
ATOM   5185  O  O     . GLU H 4  77   ? 292.499 300.627 266.026 1.00 53.46  ? 73   GLU H O     1 
ATOM   5186  C  CB    . GLU H 4  77   ? 292.534 297.995 264.111 1.00 53.46  ? 73   GLU H CB    1 
ATOM   5187  C  CG    . GLU H 4  77   ? 292.343 299.109 263.133 1.00 53.46  ? 73   GLU H CG    1 
ATOM   5188  C  CD    . GLU H 4  77   ? 293.633 299.529 262.491 1.00 53.46  ? 73   GLU H CD    1 
ATOM   5189  O  OE1   . GLU H 4  77   ? 294.196 298.730 261.720 1.00 53.46  ? 73   GLU H OE1   1 
ATOM   5190  O  OE2   . GLU H 4  77   ? 294.087 300.661 262.753 1.00 53.46  ? 73   GLU H OE2   1 
ATOM   5191  N  N     . ALA H 4  78   ? 291.363 298.941 266.947 1.00 53.48  ? 74   ALA H N     1 
ATOM   5192  C  CA    . ALA H 4  78   ? 290.544 299.853 267.726 1.00 53.48  ? 74   ALA H CA    1 
ATOM   5193  C  C     . ALA H 4  78   ? 291.339 300.491 268.851 1.00 53.48  ? 74   ALA H C     1 
ATOM   5194  O  O     . ALA H 4  78   ? 291.096 301.646 269.208 1.00 53.48  ? 74   ALA H O     1 
ATOM   5195  C  CB    . ALA H 4  78   ? 289.337 299.124 268.286 1.00 53.48  ? 74   ALA H CB    1 
ATOM   5196  N  N     . SER H 4  79   ? 292.303 299.764 269.410 1.00 52.86  ? 75   SER H N     1 
ATOM   5197  C  CA    . SER H 4  79   ? 293.179 300.356 270.405 1.00 52.86  ? 75   SER H CA    1 
ATOM   5198  C  C     . SER H 4  79   ? 294.016 301.463 269.803 1.00 52.86  ? 75   SER H C     1 
ATOM   5199  O  O     . SER H 4  79   ? 294.181 302.528 270.407 1.00 52.86  ? 75   SER H O     1 
ATOM   5200  C  CB    . SER H 4  79   ? 294.088 299.291 270.977 1.00 52.86  ? 75   SER H CB    1 
ATOM   5201  O  OG    . SER H 4  79   ? 295.145 299.067 270.077 1.00 52.86  ? 75   SER H OG    1 
ATOM   5202  N  N     . ARG H 4  80   ? 294.531 301.233 268.600 1.00 52.79  ? 76   ARG H N     1 
ATOM   5203  C  CA    . ARG H 4  80   ? 295.325 302.248 267.930 1.00 52.79  ? 76   ARG H CA    1 
ATOM   5204  C  C     . ARG H 4  80   ? 294.477 303.453 267.571 1.00 52.79  ? 76   ARG H C     1 
ATOM   5205  O  O     . ARG H 4  80   ? 294.933 304.592 267.679 1.00 52.79  ? 76   ARG H O     1 
ATOM   5206  C  CB    . ARG H 4  80   ? 295.958 301.656 266.688 1.00 52.79  ? 76   ARG H CB    1 
ATOM   5207  C  CG    . ARG H 4  80   ? 297.381 302.036 266.517 1.00 52.79  ? 76   ARG H CG    1 
ATOM   5208  C  CD    . ARG H 4  80   ? 298.062 301.146 265.511 1.00 52.79  ? 76   ARG H CD    1 
ATOM   5209  N  NE    . ARG H 4  80   ? 297.884 299.752 265.877 1.00 52.79  ? 76   ARG H NE    1 
ATOM   5210  C  CZ    . ARG H 4  80   ? 297.341 298.847 265.082 1.00 52.79  ? 76   ARG H CZ    1 
ATOM   5211  N  NH1   . ARG H 4  80   ? 296.942 299.185 263.868 1.00 52.79  ? 76   ARG H NH1   1 
ATOM   5212  N  NH2   . ARG H 4  80   ? 297.203 297.601 265.502 1.00 52.79  ? 76   ARG H NH2   1 
ATOM   5213  N  N     . LEU H 4  81   ? 293.228 303.222 267.184 1.00 52.98  ? 77   LEU H N     1 
ATOM   5214  C  CA    . LEU H 4  81   ? 292.327 304.320 266.865 1.00 52.98  ? 77   LEU H CA    1 
ATOM   5215  C  C     . LEU H 4  81   ? 292.003 305.145 268.090 1.00 52.98  ? 77   LEU H C     1 
ATOM   5216  O  O     . LEU H 4  81   ? 291.822 306.358 268.001 1.00 52.98  ? 77   LEU H O     1 
ATOM   5217  C  CB    . LEU H 4  81   ? 291.049 303.781 266.265 1.00 52.98  ? 77   LEU H CB    1 
ATOM   5218  C  CG    . LEU H 4  81   ? 291.148 303.722 264.770 1.00 52.98  ? 77   LEU H CG    1 
ATOM   5219  C  CD1   . LEU H 4  81   ? 290.096 302.818 264.268 1.00 52.98  ? 77   LEU H CD1   1 
ATOM   5220  C  CD2   . LEU H 4  81   ? 290.943 305.092 264.259 1.00 52.98  ? 77   LEU H CD2   1 
ATOM   5221  N  N     . ALA H 4  82   ? 291.889 304.501 269.239 1.00 53.99  ? 78   ALA H N     1 
ATOM   5222  C  CA    . ALA H 4  82   ? 291.617 305.265 270.442 1.00 53.99  ? 78   ALA H CA    1 
ATOM   5223  C  C     . ALA H 4  82   ? 292.843 306.034 270.880 1.00 53.99  ? 78   ALA H C     1 
ATOM   5224  O  O     . ALA H 4  82   ? 292.730 307.120 271.451 1.00 53.99  ? 78   ALA H O     1 
ATOM   5225  C  CB    . ALA H 4  82   ? 291.142 304.339 271.552 1.00 53.99  ? 78   ALA H CB    1 
ATOM   5226  N  N     . HIS H 4  83   ? 294.025 305.482 270.633 1.00 55.58  ? 79   HIS H N     1 
ATOM   5227  C  CA    . HIS H 4  83   ? 295.236 306.179 271.037 1.00 55.58  ? 79   HIS H CA    1 
ATOM   5228  C  C     . HIS H 4  83   ? 295.505 307.366 270.143 1.00 55.58  ? 79   HIS H C     1 
ATOM   5229  O  O     . HIS H 4  83   ? 296.076 308.362 270.586 1.00 55.58  ? 79   HIS H O     1 
ATOM   5230  C  CB    . HIS H 4  83   ? 296.426 305.238 271.011 1.00 55.58  ? 79   HIS H CB    1 
ATOM   5231  C  CG    . HIS H 4  83   ? 296.425 304.261 272.131 1.00 55.58  ? 79   HIS H CG    1 
ATOM   5232  N  ND1   . HIS H 4  83   ? 295.702 304.461 273.284 1.00 55.58  ? 79   HIS H ND1   1 
ATOM   5233  C  CD2   . HIS H 4  83   ? 297.045 303.069 272.274 1.00 55.58  ? 79   HIS H CD2   1 
ATOM   5234  C  CE1   . HIS H 4  83   ? 295.879 303.436 274.094 1.00 55.58  ? 79   HIS H CE1   1 
ATOM   5235  N  NE2   . HIS H 4  83   ? 296.690 302.576 273.506 1.00 55.58  ? 79   HIS H NE2   1 
ATOM   5236  N  N     . TYR H 4  84   ? 295.102 307.275 268.881 1.00 55.97  ? 80   TYR H N     1 
ATOM   5237  C  CA    . TYR H 4  84   ? 295.415 308.334 267.938 1.00 55.97  ? 80   TYR H CA    1 
ATOM   5238  C  C     . TYR H 4  84   ? 294.623 309.587 268.235 1.00 55.97  ? 80   TYR H C     1 
ATOM   5239  O  O     . TYR H 4  84   ? 295.138 310.693 268.098 1.00 55.97  ? 80   TYR H O     1 
ATOM   5240  C  CB    . TYR H 4  84   ? 295.142 307.866 266.519 1.00 55.97  ? 80   TYR H CB    1 
ATOM   5241  C  CG    . TYR H 4  84   ? 296.170 306.898 266.006 1.00 55.97  ? 80   TYR H CG    1 
ATOM   5242  C  CD1   . TYR H 4  84   ? 297.393 306.752 266.640 1.00 55.97  ? 80   TYR H CD1   1 
ATOM   5243  C  CD2   . TYR H 4  84   ? 295.918 306.122 264.894 1.00 55.97  ? 80   TYR H CD2   1 
ATOM   5244  C  CE1   . TYR H 4  84   ? 298.329 305.869 266.175 1.00 55.97  ? 80   TYR H CE1   1 
ATOM   5245  C  CE2   . TYR H 4  84   ? 296.854 305.242 264.419 1.00 55.97  ? 80   TYR H CE2   1 
ATOM   5246  C  CZ    . TYR H 4  84   ? 298.054 305.125 265.061 1.00 55.97  ? 80   TYR H CZ    1 
ATOM   5247  O  OH    . TYR H 4  84   ? 298.991 304.240 264.596 1.00 55.97  ? 80   TYR H OH    1 
ATOM   5248  N  N     . ASN H 4  85   ? 293.384 309.441 268.668 1.00 53.99  ? 81   ASN H N     1 
ATOM   5249  C  CA    . ASN H 4  85   ? 292.543 310.595 268.894 1.00 53.99  ? 81   ASN H CA    1 
ATOM   5250  C  C     . ASN H 4  85   ? 292.579 311.071 270.319 1.00 53.99  ? 81   ASN H C     1 
ATOM   5251  O  O     . ASN H 4  85   ? 291.677 311.805 270.723 1.00 53.99  ? 81   ASN H O     1 
ATOM   5252  C  CB    . ASN H 4  85   ? 291.114 310.289 268.493 1.00 53.99  ? 81   ASN H CB    1 
ATOM   5253  C  CG    . ASN H 4  85   ? 291.045 309.577 267.200 1.00 53.99  ? 81   ASN H CG    1 
ATOM   5254  O  OD1   . ASN H 4  85   ? 291.972 309.630 266.410 1.00 53.99  ? 81   ASN H OD1   1 
ATOM   5255  N  ND2   . ASN H 4  85   ? 289.943 308.910 266.961 1.00 53.99  ? 81   ASN H ND2   1 
ATOM   5256  N  N     . LYS H 4  86   ? 293.590 310.656 271.083 1.00 55.56  ? 82   LYS H N     1 
ATOM   5257  C  CA    . LYS H 4  86   ? 293.797 311.035 272.486 1.00 55.56  ? 82   LYS H CA    1 
ATOM   5258  C  C     . LYS H 4  86   ? 292.582 310.723 273.345 1.00 55.56  ? 82   LYS H C     1 
ATOM   5259  O  O     . LYS H 4  86   ? 292.301 311.419 274.314 1.00 55.56  ? 82   LYS H O     1 
ATOM   5260  C  CB    . LYS H 4  86   ? 294.185 312.506 272.633 1.00 55.56  ? 82   LYS H CB    1 
ATOM   5261  C  CG    . LYS H 4  86   ? 295.276 312.988 271.685 1.00 55.56  ? 82   LYS H CG    1 
ATOM   5262  C  CD    . LYS H 4  86   ? 296.607 312.298 271.919 1.00 55.56  ? 82   LYS H CD    1 
ATOM   5263  C  CE    . LYS H 4  86   ? 297.672 312.790 270.945 1.00 55.56  ? 82   LYS H CE    1 
ATOM   5264  N  NZ    . LYS H 4  86   ? 298.935 311.989 271.010 1.00 55.56  ? 82   LYS H NZ    1 
ATOM   5265  N  N     . ARG H 4  87   ? 291.845 309.691 272.978 1.00 63.31  ? 83   ARG H N     1 
ATOM   5266  C  CA    . ARG H 4  87   ? 290.691 309.248 273.732 1.00 63.31  ? 83   ARG H CA    1 
ATOM   5267  C  C     . ARG H 4  87   ? 291.086 308.057 274.574 1.00 63.31  ? 83   ARG H C     1 
ATOM   5268  O  O     . ARG H 4  87   ? 292.179 307.515 274.449 1.00 63.31  ? 83   ARG H O     1 
ATOM   5269  C  CB    . ARG H 4  87   ? 289.535 308.882 272.809 1.00 63.31  ? 83   ARG H CB    1 
ATOM   5270  C  CG    . ARG H 4  87   ? 288.734 310.075 272.344 1.00 63.31  ? 83   ARG H CG    1 
ATOM   5271  C  CD    . ARG H 4  87   ? 287.650 309.645 271.420 1.00 63.31  ? 83   ARG H CD    1 
ATOM   5272  N  NE    . ARG H 4  87   ? 286.813 308.637 272.054 1.00 63.31  ? 83   ARG H NE    1 
ATOM   5273  C  CZ    . ARG H 4  87   ? 285.503 308.767 272.250 1.00 63.31  ? 83   ARG H CZ    1 
ATOM   5274  N  NH1   . ARG H 4  87   ? 284.869 309.865 271.850 1.00 63.31  ? 83   ARG H NH1   1 
ATOM   5275  N  NH2   . ARG H 4  87   ? 284.823 307.798 272.841 1.00 63.31  ? 83   ARG H NH2   1 
ATOM   5276  N  N     . SER H 4  88   ? 290.180 307.649 275.442 1.00 64.67  ? 84   SER H N     1 
ATOM   5277  C  CA    . SER H 4  88   ? 290.504 306.640 276.431 1.00 64.67  ? 84   SER H CA    1 
ATOM   5278  C  C     . SER H 4  88   ? 289.396 305.620 276.591 1.00 64.67  ? 84   SER H C     1 
ATOM   5279  O  O     . SER H 4  88   ? 289.182 305.121 277.689 1.00 64.67  ? 84   SER H O     1 
ATOM   5280  C  CB    . SER H 4  88   ? 290.803 307.310 277.763 1.00 64.67  ? 84   SER H CB    1 
ATOM   5281  O  OG    . SER H 4  88   ? 290.600 306.425 278.835 1.00 64.67  ? 84   SER H OG    1 
ATOM   5282  N  N     . THR H 4  89   ? 288.673 305.312 275.527 1.00 60.85  ? 85   THR H N     1 
ATOM   5283  C  CA    . THR H 4  89   ? 287.541 304.414 275.620 1.00 60.85  ? 85   THR H CA    1 
ATOM   5284  C  C     . THR H 4  89   ? 287.342 303.809 274.255 1.00 60.85  ? 85   THR H C     1 
ATOM   5285  O  O     . THR H 4  89   ? 287.334 304.520 273.255 1.00 60.85  ? 85   THR H O     1 
ATOM   5286  C  CB    . THR H 4  89   ? 286.261 305.135 276.062 1.00 60.85  ? 85   THR H CB    1 
ATOM   5287  O  OG1   . THR H 4  89   ? 286.385 305.557 277.421 1.00 60.85  ? 85   THR H OG1   1 
ATOM   5288  C  CG2   . THR H 4  89   ? 285.055 304.262 275.961 1.00 60.85  ? 85   THR H CG2   1 
ATOM   5289  N  N     . ILE H 4  90   ? 287.211 302.496 274.208 1.00 54.65  ? 86   ILE H N     1 
ATOM   5290  C  CA    . ILE H 4  90   ? 286.821 301.856 272.968 1.00 54.65  ? 86   ILE H CA    1 
ATOM   5291  C  C     . ILE H 4  90   ? 285.312 301.813 272.912 1.00 54.65  ? 86   ILE H C     1 
ATOM   5292  O  O     . ILE H 4  90   ? 284.697 300.943 273.516 1.00 54.65  ? 86   ILE H O     1 
ATOM   5293  C  CB    . ILE H 4  90   ? 287.395 300.449 272.870 1.00 54.65  ? 86   ILE H CB    1 
ATOM   5294  C  CG1   . ILE H 4  90   ? 288.876 300.489 273.111 1.00 54.65  ? 86   ILE H CG1   1 
ATOM   5295  C  CG2   . ILE H 4  90   ? 287.154 299.906 271.527 1.00 54.65  ? 86   ILE H CG2   1 
ATOM   5296  C  CD1   . ILE H 4  90   ? 289.458 299.152 273.239 1.00 54.65  ? 86   ILE H CD1   1 
ATOM   5297  N  N     . THR H 4  91   ? 284.694 302.748 272.215 1.00 52.75  ? 87   THR H N     1 
ATOM   5298  C  CA    . THR H 4  91   ? 283.267 302.629 272.006 1.00 52.75  ? 87   THR H CA    1 
ATOM   5299  C  C     . THR H 4  91   ? 283.006 301.727 270.818 1.00 52.75  ? 87   THR H C     1 
ATOM   5300  O  O     . THR H 4  91   ? 283.909 301.112 270.261 1.00 52.75  ? 87   THR H O     1 
ATOM   5301  C  CB    . THR H 4  91   ? 282.641 303.989 271.781 1.00 52.75  ? 87   THR H CB    1 
ATOM   5302  O  OG1   . THR H 4  91   ? 283.141 304.523 270.561 1.00 52.75  ? 87   THR H OG1   1 
ATOM   5303  C  CG2   . THR H 4  91   ? 283.009 304.906 272.873 1.00 52.75  ? 87   THR H CG2   1 
ATOM   5304  N  N     . SER H 4  92   ? 281.750 301.647 270.407 1.00 51.59  ? 88   SER H N     1 
ATOM   5305  C  CA    . SER H 4  92   ? 281.461 300.908 269.197 1.00 51.59  ? 88   SER H CA    1 
ATOM   5306  C  C     . SER H 4  92   ? 281.805 301.703 267.966 1.00 51.59  ? 88   SER H C     1 
ATOM   5307  O  O     . SER H 4  92   ? 281.871 301.135 266.885 1.00 51.59  ? 88   SER H O     1 
ATOM   5308  C  CB    . SER H 4  92   ? 280.001 300.536 269.142 1.00 51.59  ? 88   SER H CB    1 
ATOM   5309  O  OG    . SER H 4  92   ? 279.230 301.704 269.267 1.00 51.59  ? 88   SER H OG    1 
ATOM   5310  N  N     . ARG H 4  93   ? 282.001 303.006 268.088 1.00 52.93  ? 89   ARG H N     1 
ATOM   5311  C  CA    . ARG H 4  93   ? 282.468 303.770 266.948 1.00 52.93  ? 89   ARG H CA    1 
ATOM   5312  C  C     . ARG H 4  93   ? 283.895 303.392 266.610 1.00 52.93  ? 89   ARG H C     1 
ATOM   5313  O  O     . ARG H 4  93   ? 284.256 303.308 265.434 1.00 52.93  ? 89   ARG H O     1 
ATOM   5314  C  CB    . ARG H 4  93   ? 282.353 305.255 267.246 1.00 52.93  ? 89   ARG H CB    1 
ATOM   5315  C  CG    . ARG H 4  93   ? 282.575 306.119 266.053 1.00 52.93  ? 89   ARG H CG    1 
ATOM   5316  C  CD    . ARG H 4  93   ? 282.505 307.581 266.404 1.00 52.93  ? 89   ARG H CD    1 
ATOM   5317  N  NE    . ARG H 4  93   ? 282.782 308.412 265.238 1.00 52.93  ? 89   ARG H NE    1 
ATOM   5318  C  CZ    . ARG H 4  93   ? 281.850 308.849 264.405 1.00 52.93  ? 89   ARG H CZ    1 
ATOM   5319  N  NH1   . ARG H 4  93   ? 280.582 308.542 264.615 1.00 52.93  ? 89   ARG H NH1   1 
ATOM   5320  N  NH2   . ARG H 4  93   ? 282.178 309.595 263.366 1.00 52.93  ? 89   ARG H NH2   1 
ATOM   5321  N  N     . GLU H 4  94   ? 284.706 303.121 267.633 1.00 53.23  ? 90   GLU H N     1 
ATOM   5322  C  CA    . GLU H 4  94   ? 286.075 302.674 267.421 1.00 53.23  ? 90   GLU H CA    1 
ATOM   5323  C  C     . GLU H 4  94   ? 286.109 301.337 266.720 1.00 53.23  ? 90   GLU H C     1 
ATOM   5324  O  O     . GLU H 4  94   ? 286.864 301.150 265.765 1.00 53.23  ? 90   GLU H O     1 
ATOM   5325  C  CB    . GLU H 4  94   ? 286.807 302.558 268.745 1.00 53.23  ? 90   GLU H CB    1 
ATOM   5326  C  CG    . GLU H 4  94   ? 287.547 303.782 269.159 1.00 53.23  ? 90   GLU H CG    1 
ATOM   5327  C  CD    . GLU H 4  94   ? 286.722 304.661 270.056 1.00 53.23  ? 90   GLU H CD    1 
ATOM   5328  O  OE1   . GLU H 4  94   ? 285.560 304.312 270.313 1.00 53.23  ? 90   GLU H OE1   1 
ATOM   5329  O  OE2   . GLU H 4  94   ? 287.226 305.700 270.518 1.00 53.23  ? 90   GLU H OE2   1 
ATOM   5330  N  N     . ILE H 4  95   ? 285.269 300.404 267.153 1.00 50.98  ? 91   ILE H N     1 
ATOM   5331  C  CA    . ILE H 4  95   ? 285.263 299.091 266.537 1.00 50.98  ? 91   ILE H CA    1 
ATOM   5332  C  C     . ILE H 4  95   ? 284.599 299.144 265.181 1.00 50.98  ? 91   ILE H C     1 
ATOM   5333  O  O     . ILE H 4  95   ? 284.958 298.385 264.286 1.00 50.98  ? 91   ILE H O     1 
ATOM   5334  C  CB    . ILE H 4  95   ? 284.607 298.096 267.499 1.00 50.98  ? 91   ILE H CB    1 
ATOM   5335  C  CG1   . ILE H 4  95   ? 285.501 297.990 268.715 1.00 50.98  ? 91   ILE H CG1   1 
ATOM   5336  C  CG2   . ILE H 4  95   ? 284.463 296.742 266.905 1.00 50.98  ? 91   ILE H CG2   1 
ATOM   5337  C  CD1   . ILE H 4  95   ? 285.065 297.001 269.705 1.00 50.98  ? 91   ILE H CD1   1 
ATOM   5338  N  N     . GLN H 4  96   ? 283.690 300.087 264.971 1.00 51.14  ? 92   GLN H N     1 
ATOM   5339  C  CA    . GLN H 4  96   ? 283.091 300.234 263.658 1.00 51.14  ? 92   GLN H CA    1 
ATOM   5340  C  C     . GLN H 4  96   ? 284.116 300.703 262.652 1.00 51.14  ? 92   GLN H C     1 
ATOM   5341  O  O     . GLN H 4  96   ? 284.237 300.138 261.566 1.00 51.14  ? 92   GLN H O     1 
ATOM   5342  C  CB    . GLN H 4  96   ? 281.932 301.205 263.701 1.00 51.14  ? 92   GLN H CB    1 
ATOM   5343  C  CG    . GLN H 4  96   ? 281.429 301.524 262.343 1.00 51.14  ? 92   GLN H CG    1 
ATOM   5344  C  CD    . GLN H 4  96   ? 280.239 302.393 262.384 1.00 51.14  ? 92   GLN H CD    1 
ATOM   5345  O  OE1   . GLN H 4  96   ? 280.341 303.602 262.258 1.00 51.14  ? 92   GLN H OE1   1 
ATOM   5346  N  NE2   . GLN H 4  96   ? 279.088 301.793 262.576 1.00 51.14  ? 92   GLN H NE2   1 
ATOM   5347  N  N     . THR H 4  97   ? 284.919 301.687 263.025 1.00 52.18  ? 93   THR H N     1 
ATOM   5348  C  CA    . THR H 4  97   ? 285.956 302.112 262.103 1.00 52.18  ? 93   THR H CA    1 
ATOM   5349  C  C     . THR H 4  97   ? 287.084 301.098 262.021 1.00 52.18  ? 93   THR H C     1 
ATOM   5350  O  O     . THR H 4  97   ? 287.736 300.997 260.983 1.00 52.18  ? 93   THR H O     1 
ATOM   5351  C  CB    . THR H 4  97   ? 286.478 303.465 262.507 1.00 52.18  ? 93   THR H CB    1 
ATOM   5352  O  OG1   . THR H 4  97   ? 286.905 303.389 263.859 1.00 52.18  ? 93   THR H OG1   1 
ATOM   5353  C  CG2   . THR H 4  97   ? 285.370 304.448 262.430 1.00 52.18  ? 93   THR H CG2   1 
ATOM   5354  N  N     . ALA H 4  98   ? 287.292 300.295 263.061 1.00 51.40  ? 94   ALA H N     1 
ATOM   5355  C  CA    . ALA H 4  98   ? 288.316 299.262 262.984 1.00 51.40  ? 94   ALA H CA    1 
ATOM   5356  C  C     . ALA H 4  98   ? 287.896 298.148 262.044 1.00 51.40  ? 94   ALA H C     1 
ATOM   5357  O  O     . ALA H 4  98   ? 288.682 297.691 261.214 1.00 51.40  ? 94   ALA H O     1 
ATOM   5358  C  CB    . ALA H 4  98   ? 288.599 298.710 264.369 1.00 51.40  ? 94   ALA H CB    1 
ATOM   5359  N  N     . GLY H 4  99   ? 286.647 297.702 262.152 1.00 51.34  ? 95   GLY H N     1 
ATOM   5360  C  CA    . GLY H 4  99   ? 286.089 296.763 261.208 1.00 51.34  ? 95   GLY H CA    1 
ATOM   5361  C  C     . GLY H 4  99   ? 285.900 297.350 259.839 1.00 51.34  ? 95   GLY H C     1 
ATOM   5362  O  O     . GLY H 4  99   ? 285.723 296.603 258.883 1.00 51.34  ? 95   GLY H O     1 
ATOM   5363  N  N     . ARG H 4  100  ? 285.908 298.674 259.725 1.00 51.06  ? 96   ARG H N     1 
ATOM   5364  C  CA    . ARG H 4  100  ? 285.950 299.303 258.416 1.00 51.06  ? 96   ARG H CA    1 
ATOM   5365  C  C     . ARG H 4  100  ? 287.334 299.213 257.815 1.00 51.06  ? 96   ARG H C     1 
ATOM   5366  O  O     . ARG H 4  100  ? 287.481 299.007 256.608 1.00 51.06  ? 96   ARG H O     1 
ATOM   5367  C  CB    . ARG H 4  100  ? 285.542 300.760 258.523 1.00 51.06  ? 96   ARG H CB    1 
ATOM   5368  C  CG    . ARG H 4  100  ? 284.098 300.992 258.353 1.00 51.06  ? 96   ARG H CG    1 
ATOM   5369  C  CD    . ARG H 4  100  ? 283.828 302.450 258.277 1.00 51.06  ? 96   ARG H CD    1 
ATOM   5370  N  NE    . ARG H 4  100  ? 282.405 302.691 258.158 1.00 51.06  ? 96   ARG H NE    1 
ATOM   5371  C  CZ    . ARG H 4  100  ? 281.821 303.824 258.509 1.00 51.06  ? 96   ARG H CZ    1 
ATOM   5372  N  NH1   . ARG H 4  100  ? 282.551 304.813 258.994 1.00 51.06  ? 96   ARG H NH1   1 
ATOM   5373  N  NH2   . ARG H 4  100  ? 280.512 303.967 258.372 1.00 51.06  ? 96   ARG H NH2   1 
ATOM   5374  N  N     . LEU H 4  101  ? 288.359 299.402 258.632 1.00 53.18  ? 97   LEU H N     1 
ATOM   5375  C  CA    . LEU H 4  101  ? 289.707 299.437 258.096 1.00 53.18  ? 97   LEU H CA    1 
ATOM   5376  C  C     . LEU H 4  101  ? 290.220 298.048 257.798 1.00 53.18  ? 97   LEU H C     1 
ATOM   5377  O  O     . LEU H 4  101  ? 290.959 297.856 256.835 1.00 53.18  ? 97   LEU H O     1 
ATOM   5378  C  CB    . LEU H 4  101  ? 290.642 300.122 259.073 1.00 53.18  ? 97   LEU H CB    1 
ATOM   5379  C  CG    . LEU H 4  101  ? 290.590 301.633 259.064 1.00 53.18  ? 97   LEU H CG    1 
ATOM   5380  C  CD1   . LEU H 4  101  ? 290.854 302.153 260.437 1.00 53.18  ? 97   LEU H CD1   1 
ATOM   5381  C  CD2   . LEU H 4  101  ? 291.631 302.126 258.130 1.00 53.18  ? 97   LEU H CD2   1 
ATOM   5382  N  N     . LEU H 4  102  ? 289.863 297.072 258.613 1.00 54.72  ? 98   LEU H N     1 
ATOM   5383  C  CA    . LEU H 4  102  ? 290.441 295.752 258.431 1.00 54.72  ? 98   LEU H CA    1 
ATOM   5384  C  C     . LEU H 4  102  ? 289.711 294.957 257.366 1.00 54.72  ? 98   LEU H C     1 
ATOM   5385  O  O     . LEU H 4  102  ? 290.342 294.360 256.491 1.00 54.72  ? 98   LEU H O     1 
ATOM   5386  C  CB    . LEU H 4  102  ? 290.426 294.997 259.743 1.00 54.72  ? 98   LEU H CB    1 
ATOM   5387  C  CG    . LEU H 4  102  ? 291.493 295.549 260.648 1.00 54.72  ? 98   LEU H CG    1 
ATOM   5388  C  CD1   . LEU H 4  102  ? 291.291 295.016 261.993 1.00 54.72  ? 98   LEU H CD1   1 
ATOM   5389  C  CD2   . LEU H 4  102  ? 292.814 295.078 260.114 1.00 54.72  ? 98   LEU H CD2   1 
ATOM   5390  N  N     . LEU H 4  103  ? 288.413 294.916 257.444 1.00 55.99  ? 99   LEU H N     1 
ATOM   5391  C  CA    . LEU H 4  103  ? 287.653 294.061 256.564 1.00 55.99  ? 99   LEU H CA    1 
ATOM   5392  C  C     . LEU H 4  103  ? 287.640 294.665 255.174 1.00 55.99  ? 99   LEU H C     1 
ATOM   5393  O  O     . LEU H 4  103  ? 287.365 295.854 255.033 1.00 55.99  ? 99   LEU H O     1 
ATOM   5394  C  CB    . LEU H 4  103  ? 286.250 293.887 257.078 1.00 55.99  ? 99   LEU H CB    1 
ATOM   5395  C  CG    . LEU H 4  103  ? 285.969 292.692 257.975 1.00 55.99  ? 99   LEU H CG    1 
ATOM   5396  C  CD1   . LEU H 4  103  ? 286.325 291.456 257.243 1.00 55.99  ? 99   LEU H CD1   1 
ATOM   5397  C  CD2   . LEU H 4  103  ? 286.713 292.738 259.265 1.00 55.99  ? 99   LEU H CD2   1 
ATOM   5398  N  N     . PRO H 4  104  ? 287.978 293.905 254.160 1.00 61.30  ? 100  PRO H N     1 
ATOM   5399  C  CA    . PRO H 4  104  ? 288.341 294.495 252.872 1.00 61.30  ? 100  PRO H CA    1 
ATOM   5400  C  C     . PRO H 4  104  ? 287.248 295.210 252.100 1.00 61.30  ? 100  PRO H C     1 
ATOM   5401  O  O     . PRO H 4  104  ? 287.356 296.406 251.835 1.00 61.30  ? 100  PRO H O     1 
ATOM   5402  C  CB    . PRO H 4  104  ? 288.836 293.282 252.084 1.00 61.30  ? 100  PRO H CB    1 
ATOM   5403  C  CG    . PRO H 4  104  ? 288.249 292.121 252.762 1.00 61.30  ? 100  PRO H CG    1 
ATOM   5404  C  CD    . PRO H 4  104  ? 288.197 292.457 254.179 1.00 61.30  ? 100  PRO H CD    1 
ATOM   5405  N  N     . GLY H 4  105  ? 286.191 294.509 251.751 1.00 62.32  ? 101  GLY H N     1 
ATOM   5406  C  CA    . GLY H 4  105  ? 285.319 295.027 250.728 1.00 62.32  ? 101  GLY H CA    1 
ATOM   5407  C  C     . GLY H 4  105  ? 283.897 295.117 251.187 1.00 62.32  ? 101  GLY H C     1 
ATOM   5408  O  O     . GLY H 4  105  ? 283.547 295.909 252.058 1.00 62.32  ? 101  GLY H O     1 
ATOM   5409  N  N     . GLU H 4  106  ? 283.061 294.300 250.561 1.00 68.17  ? 102  GLU H N     1 
ATOM   5410  C  CA    . GLU H 4  106  ? 281.689 294.170 251.001 1.00 68.17  ? 102  GLU H CA    1 
ATOM   5411  C  C     . GLU H 4  106  ? 281.598 293.453 252.331 1.00 68.17  ? 102  GLU H C     1 
ATOM   5412  O  O     . GLU H 4  106  ? 280.556 293.517 252.988 1.00 68.17  ? 102  GLU H O     1 
ATOM   5413  C  CB    . GLU H 4  106  ? 280.877 293.425 249.951 1.00 68.17  ? 102  GLU H CB    1 
ATOM   5414  C  CG    . GLU H 4  106  ? 281.145 293.883 248.528 1.00 68.17  ? 102  GLU H CG    1 
ATOM   5415  C  CD    . GLU H 4  106  ? 280.428 295.168 248.171 1.00 68.17  ? 102  GLU H CD    1 
ATOM   5416  O  OE1   . GLU H 4  106  ? 279.245 295.319 248.540 1.00 68.17  ? 102  GLU H OE1   1 
ATOM   5417  O  OE2   . GLU H 4  106  ? 281.048 296.027 247.514 1.00 68.17  ? 102  GLU H OE2   1 
ATOM   5418  N  N     . LEU H 4  107  ? 282.659 292.744 252.731 1.00 62.54  ? 103  LEU H N     1 
ATOM   5419  C  CA    . LEU H 4  107  ? 282.728 292.205 254.083 1.00 62.54  ? 103  LEU H CA    1 
ATOM   5420  C  C     . LEU H 4  107  ? 282.631 293.299 255.125 1.00 62.54  ? 103  LEU H C     1 
ATOM   5421  O  O     . LEU H 4  107  ? 281.970 293.123 256.147 1.00 62.54  ? 103  LEU H O     1 
ATOM   5422  C  CB    . LEU H 4  107  ? 284.012 291.434 254.305 1.00 62.54  ? 103  LEU H CB    1 
ATOM   5423  C  CG    . LEU H 4  107  ? 284.095 290.016 253.826 1.00 62.54  ? 103  LEU H CG    1 
ATOM   5424  C  CD1   . LEU H 4  107  ? 285.450 289.536 254.172 1.00 62.54  ? 103  LEU H CD1   1 
ATOM   5425  C  CD2   . LEU H 4  107  ? 283.074 289.226 254.569 1.00 62.54  ? 103  LEU H CD2   1 
ATOM   5426  N  N     . ALA H 4  108  ? 283.284 294.430 254.888 1.00 61.03  ? 104  ALA H N     1 
ATOM   5427  C  CA    . ALA H 4  108  ? 283.204 295.535 255.831 1.00 61.03  ? 104  ALA H CA    1 
ATOM   5428  C  C     . ALA H 4  108  ? 281.802 296.085 255.900 1.00 61.03  ? 104  ALA H C     1 
ATOM   5429  O  O     . ALA H 4  108  ? 281.320 296.420 256.983 1.00 61.03  ? 104  ALA H O     1 
ATOM   5430  C  CB    . ALA H 4  108  ? 284.165 296.640 255.429 1.00 61.03  ? 104  ALA H CB    1 
ATOM   5431  N  N     . LYS H 4  109  ? 281.128 296.143 254.758 1.00 62.86  ? 105  LYS H N     1 
ATOM   5432  C  CA    . LYS H 4  109  ? 279.782 296.682 254.705 1.00 62.86  ? 105  LYS H CA    1 
ATOM   5433  C  C     . LYS H 4  109  ? 278.831 295.797 255.473 1.00 62.86  ? 105  LYS H C     1 
ATOM   5434  O  O     . LYS H 4  109  ? 278.079 296.265 256.335 1.00 62.86  ? 105  LYS H O     1 
ATOM   5435  C  CB    . LYS H 4  109  ? 279.330 296.792 253.262 1.00 62.86  ? 105  LYS H CB    1 
ATOM   5436  C  CG    . LYS H 4  109  ? 278.033 297.507 253.121 1.00 62.86  ? 105  LYS H CG    1 
ATOM   5437  C  CD    . LYS H 4  109  ? 277.614 297.585 251.673 1.00 62.86  ? 105  LYS H CD    1 
ATOM   5438  C  CE    . LYS H 4  109  ? 277.029 296.263 251.221 1.00 62.86  ? 105  LYS H CE    1 
ATOM   5439  N  NZ    . LYS H 4  109  ? 275.729 295.997 251.903 1.00 62.86  ? 105  LYS H NZ    1 
ATOM   5440  N  N     . HIS H 4  110  ? 278.903 294.500 255.221 1.00 63.58  ? 106  HIS H N     1 
ATOM   5441  C  CA    . HIS H 4  110  ? 277.999 293.592 255.895 1.00 63.58  ? 106  HIS H CA    1 
ATOM   5442  C  C     . HIS H 4  110  ? 278.368 293.422 257.345 1.00 63.58  ? 106  HIS H C     1 
ATOM   5443  O  O     . HIS H 4  110  ? 277.489 293.207 258.177 1.00 63.58  ? 106  HIS H O     1 
ATOM   5444  C  CB    . HIS H 4  110  ? 278.003 292.266 255.189 1.00 63.58  ? 106  HIS H CB    1 
ATOM   5445  C  CG    . HIS H 4  110  ? 277.197 292.274 253.945 1.00 63.58  ? 106  HIS H CG    1 
ATOM   5446  N  ND1   . HIS H 4  110  ? 277.646 291.742 252.762 1.00 63.58  ? 106  HIS H ND1   1 
ATOM   5447  C  CD2   . HIS H 4  110  ? 275.969 292.770 253.695 1.00 63.58  ? 106  HIS H CD2   1 
ATOM   5448  C  CE1   . HIS H 4  110  ? 276.722 291.904 251.835 1.00 63.58  ? 106  HIS H CE1   1 
ATOM   5449  N  NE2   . HIS H 4  110  ? 275.694 292.522 252.379 1.00 63.58  ? 106  HIS H NE2   1 
ATOM   5450  N  N     . ALA H 4  111  ? 279.640 293.580 257.675 1.00 57.84  ? 107  ALA H N     1 
ATOM   5451  C  CA    . ALA H 4  111  ? 280.075 293.436 259.051 1.00 57.84  ? 107  ALA H CA    1 
ATOM   5452  C  C     . ALA H 4  111  ? 279.592 294.593 259.903 1.00 57.84  ? 107  ALA H C     1 
ATOM   5453  O  O     . ALA H 4  111  ? 279.097 294.384 261.013 1.00 57.84  ? 107  ALA H O     1 
ATOM   5454  C  CB    . ALA H 4  111  ? 281.587 293.329 259.094 1.00 57.84  ? 107  ALA H CB    1 
ATOM   5455  N  N     . VAL H 4  112  ? 279.700 295.822 259.397 1.00 54.69  ? 108  VAL H N     1 
ATOM   5456  C  CA    . VAL H 4  112  ? 279.165 296.934 260.165 1.00 54.69  ? 108  VAL H CA    1 
ATOM   5457  C  C     . VAL H 4  112  ? 277.651 296.922 260.146 1.00 54.69  ? 108  VAL H C     1 
ATOM   5458  O  O     . VAL H 4  112  ? 277.025 297.420 261.081 1.00 54.69  ? 108  VAL H O     1 
ATOM   5459  C  CB    . VAL H 4  112  ? 279.721 298.283 259.692 1.00 54.69  ? 108  VAL H CB    1 
ATOM   5460  C  CG1   . VAL H 4  112  ? 281.202 298.253 259.717 1.00 54.69  ? 108  VAL H CG1   1 
ATOM   5461  C  CG2   . VAL H 4  112  ? 279.245 298.620 258.314 1.00 54.69  ? 108  VAL H CG2   1 
ATOM   5462  N  N     . SER H 4  113  ? 277.032 296.299 259.145 1.00 56.37  ? 109  SER H N     1 
ATOM   5463  C  CA    . SER H 4  113  ? 275.585 296.163 259.175 1.00 56.37  ? 109  SER H CA    1 
ATOM   5464  C  C     . SER H 4  113  ? 275.145 295.188 260.253 1.00 56.37  ? 109  SER H C     1 
ATOM   5465  O  O     . SER H 4  113  ? 274.149 295.418 260.944 1.00 56.37  ? 109  SER H O     1 
ATOM   5466  C  CB    . SER H 4  113  ? 275.089 295.713 257.821 1.00 56.37  ? 109  SER H CB    1 
ATOM   5467  O  OG    . SER H 4  113  ? 273.698 295.530 257.862 1.00 56.37  ? 109  SER H OG    1 
ATOM   5468  N  N     . GLU H 4  114  ? 275.903 294.114 260.444 1.00 56.31  ? 110  GLU H N     1 
ATOM   5469  C  CA    . GLU H 4  114  ? 275.549 293.151 261.480 1.00 56.31  ? 110  GLU H CA    1 
ATOM   5470  C  C     . GLU H 4  114  ? 275.842 293.701 262.857 1.00 56.31  ? 110  GLU H C     1 
ATOM   5471  O  O     . GLU H 4  114  ? 275.043 293.525 263.780 1.00 56.31  ? 110  GLU H O     1 
ATOM   5472  C  CB    . GLU H 4  114  ? 276.294 291.848 261.263 1.00 56.31  ? 110  GLU H CB    1 
ATOM   5473  C  CG    . GLU H 4  114  ? 275.683 290.996 260.189 1.00 56.31  ? 110  GLU H CG    1 
ATOM   5474  C  CD    . GLU H 4  114  ? 274.498 290.204 260.682 1.00 56.31  ? 110  GLU H CD    1 
ATOM   5475  O  OE1   . GLU H 4  114  ? 274.634 289.526 261.716 1.00 56.31  ? 110  GLU H OE1   1 
ATOM   5476  O  OE2   . GLU H 4  114  ? 273.431 290.258 260.040 1.00 56.31  ? 110  GLU H OE2   1 
ATOM   5477  N  N     . GLY H 4  115  ? 276.964 294.395 263.006 1.00 52.52  ? 111  GLY H N     1 
ATOM   5478  C  CA    . GLY H 4  115  ? 277.276 295.019 264.274 1.00 52.52  ? 111  GLY H CA    1 
ATOM   5479  C  C     . GLY H 4  115  ? 276.323 296.129 264.632 1.00 52.52  ? 111  GLY H C     1 
ATOM   5480  O  O     . GLY H 4  115  ? 275.977 296.295 265.800 1.00 52.52  ? 111  GLY H O     1 
ATOM   5481  N  N     . THR H 4  116  ? 275.832 296.856 263.637 1.00 50.86  ? 112  THR H N     1 
ATOM   5482  C  CA    . THR H 4  116  ? 274.892 297.921 263.916 1.00 50.86  ? 112  THR H CA    1 
ATOM   5483  C  C     . THR H 4  116  ? 273.532 297.367 264.286 1.00 50.86  ? 112  THR H C     1 
ATOM   5484  O  O     . THR H 4  116  ? 272.890 297.881 265.202 1.00 50.86  ? 112  THR H O     1 
ATOM   5485  C  CB    . THR H 4  116  ? 274.779 298.824 262.715 1.00 50.86  ? 112  THR H CB    1 
ATOM   5486  O  OG1   . THR H 4  116  ? 276.091 299.178 262.290 1.00 50.86  ? 112  THR H OG1   1 
ATOM   5487  C  CG2   . THR H 4  116  ? 274.090 300.067 263.111 1.00 50.86  ? 112  THR H CG2   1 
ATOM   5488  N  N     . LYS H 4  117  ? 273.089 296.304 263.617 1.00 51.58  ? 113  LYS H N     1 
ATOM   5489  C  CA    . LYS H 4  117  ? 271.840 295.670 264.011 1.00 51.58  ? 113  LYS H CA    1 
ATOM   5490  C  C     . LYS H 4  117  ? 271.930 295.092 265.410 1.00 51.58  ? 113  LYS H C     1 
ATOM   5491  O  O     . LYS H 4  117  ? 270.992 295.225 266.198 1.00 51.58  ? 113  LYS H O     1 
ATOM   5492  C  CB    . LYS H 4  117  ? 271.456 294.581 263.022 1.00 51.58  ? 113  LYS H CB    1 
ATOM   5493  C  CG    . LYS H 4  117  ? 270.212 293.783 263.412 1.00 51.58  ? 113  LYS H CG    1 
ATOM   5494  C  CD    . LYS H 4  117  ? 268.989 294.674 263.622 1.00 51.58  ? 113  LYS H CD    1 
ATOM   5495  C  CE    . LYS H 4  117  ? 267.722 293.858 263.803 1.00 51.58  ? 113  LYS H CE    1 
ATOM   5496  N  NZ    . LYS H 4  117  ? 266.507 294.700 263.659 1.00 51.58  ? 113  LYS H NZ    1 
ATOM   5497  N  N     . ALA H 4  118  ? 273.066 294.500 265.763 1.00 51.17  ? 114  ALA H N     1 
ATOM   5498  C  CA    . ALA H 4  118  ? 273.175 293.935 267.098 1.00 51.17  ? 114  ALA H CA    1 
ATOM   5499  C  C     . ALA H 4  118  ? 273.255 295.012 268.152 1.00 51.17  ? 114  ALA H C     1 
ATOM   5500  O  O     . ALA H 4  118  ? 272.696 294.853 269.236 1.00 51.17  ? 114  ALA H O     1 
ATOM   5501  C  CB    . ALA H 4  118  ? 274.385 293.036 267.211 1.00 51.17  ? 114  ALA H CB    1 
ATOM   5502  N  N     . VAL H 4  119  ? 273.913 296.128 267.860 1.00 51.89  ? 115  VAL H N     1 
ATOM   5503  C  CA    . VAL H 4  119  ? 274.008 297.119 268.916 1.00 51.89  ? 115  VAL H CA    1 
ATOM   5504  C  C     . VAL H 4  119  ? 272.690 297.867 269.073 1.00 51.89  ? 115  VAL H C     1 
ATOM   5505  O  O     . VAL H 4  119  ? 272.314 298.216 270.194 1.00 51.89  ? 115  VAL H O     1 
ATOM   5506  C  CB    . VAL H 4  119  ? 275.217 298.048 268.700 1.00 51.89  ? 115  VAL H CB    1 
ATOM   5507  C  CG1   . VAL H 4  119  ? 274.995 299.048 267.619 1.00 51.89  ? 115  VAL H CG1   1 
ATOM   5508  C  CG2   . VAL H 4  119  ? 275.536 298.756 269.967 1.00 51.89  ? 115  VAL H CG2   1 
ATOM   5509  N  N     . THR H 4  120  ? 271.907 298.033 268.003 1.00 52.78  ? 116  THR H N     1 
ATOM   5510  C  CA    . THR H 4  120  ? 270.612 298.663 268.211 1.00 52.78  ? 116  THR H CA    1 
ATOM   5511  C  C     . THR H 4  120  ? 269.624 297.691 268.812 1.00 52.78  ? 116  THR H C     1 
ATOM   5512  O  O     . THR H 4  120  ? 268.703 298.105 269.515 1.00 52.78  ? 116  THR H O     1 
ATOM   5513  C  CB    . THR H 4  120  ? 270.038 299.238 266.933 1.00 52.78  ? 116  THR H CB    1 
ATOM   5514  O  OG1   . THR H 4  120  ? 269.733 298.179 266.029 1.00 52.78  ? 116  THR H OG1   1 
ATOM   5515  C  CG2   . THR H 4  120  ? 270.980 300.232 266.323 1.00 52.78  ? 116  THR H CG2   1 
ATOM   5516  N  N     . LYS H 4  121  ? 269.792 296.398 268.571 1.00 54.01  ? 117  LYS H N     1 
ATOM   5517  C  CA    . LYS H 4  121  ? 268.940 295.436 269.252 1.00 54.01  ? 117  LYS H CA    1 
ATOM   5518  C  C     . LYS H 4  121  ? 269.296 295.367 270.726 1.00 54.01  ? 117  LYS H C     1 
ATOM   5519  O  O     . LYS H 4  121  ? 268.425 295.172 271.575 1.00 54.01  ? 117  LYS H O     1 
ATOM   5520  C  CB    . LYS H 4  121  ? 269.064 294.069 268.589 1.00 54.01  ? 117  LYS H CB    1 
ATOM   5521  C  CG    . LYS H 4  121  ? 267.853 293.195 268.724 1.00 54.01  ? 117  LYS H CG    1 
ATOM   5522  C  CD    . LYS H 4  121  ? 267.986 291.966 267.858 1.00 54.01  ? 117  LYS H CD    1 
ATOM   5523  C  CE    . LYS H 4  121  ? 266.629 291.374 267.512 1.00 54.01  ? 117  LYS H CE    1 
ATOM   5524  N  NZ    . LYS H 4  121  ? 266.570 290.804 266.137 1.00 54.01  ? 117  LYS H NZ    1 
ATOM   5525  N  N     . TYR H 4  122  ? 270.563 295.560 271.052 1.00 56.02  ? 118  TYR H N     1 
ATOM   5526  C  CA    . TYR H 4  122  ? 270.976 295.473 272.438 1.00 56.02  ? 118  TYR H CA    1 
ATOM   5527  C  C     . TYR H 4  122  ? 270.515 296.686 273.226 1.00 56.02  ? 118  TYR H C     1 
ATOM   5528  O  O     . TYR H 4  122  ? 270.034 296.547 274.353 1.00 56.02  ? 118  TYR H O     1 
ATOM   5529  C  CB    . TYR H 4  122  ? 272.487 295.323 272.501 1.00 56.02  ? 118  TYR H CB    1 
ATOM   5530  C  CG    . TYR H 4  122  ? 273.074 295.340 273.883 1.00 56.02  ? 118  TYR H CG    1 
ATOM   5531  C  CD1   . TYR H 4  122  ? 273.091 294.200 274.652 1.00 56.02  ? 118  TYR H CD1   1 
ATOM   5532  C  CD2   . TYR H 4  122  ? 273.648 296.486 274.397 1.00 56.02  ? 118  TYR H CD2   1 
ATOM   5533  C  CE1   . TYR H 4  122  ? 273.629 294.209 275.893 1.00 56.02  ? 118  TYR H CE1   1 
ATOM   5534  C  CE2   . TYR H 4  122  ? 274.186 296.502 275.631 1.00 56.02  ? 118  TYR H CE2   1 
ATOM   5535  C  CZ    . TYR H 4  122  ? 274.178 295.364 276.379 1.00 56.02  ? 118  TYR H CZ    1 
ATOM   5536  O  OH    . TYR H 4  122  ? 274.726 295.383 277.634 1.00 56.02  ? 118  TYR H OH    1 
ATOM   5537  N  N     . THR H 4  123  ? 270.661 297.887 272.666 1.00 56.30  ? 119  THR H N     1 
ATOM   5538  C  CA    . THR H 4  123  ? 270.280 299.074 273.425 1.00 56.30  ? 119  THR H CA    1 
ATOM   5539  C  C     . THR H 4  123  ? 268.774 299.233 273.542 1.00 56.30  ? 119  THR H C     1 
ATOM   5540  O  O     . THR H 4  123  ? 268.299 299.874 274.486 1.00 56.30  ? 119  THR H O     1 
ATOM   5541  C  CB    . THR H 4  123  ? 270.869 300.331 272.798 1.00 56.30  ? 119  THR H CB    1 
ATOM   5542  O  OG1   . THR H 4  123  ? 270.282 300.544 271.513 1.00 56.30  ? 119  THR H OG1   1 
ATOM   5543  C  CG2   . THR H 4  123  ? 272.357 300.241 272.682 1.00 56.30  ? 119  THR H CG2   1 
ATOM   5544  N  N     . SER H 4  124  ? 268.012 298.676 272.609 1.00 56.95  ? 120  SER H N     1 
ATOM   5545  C  CA    . SER H 4  124  ? 266.566 298.861 272.591 1.00 56.95  ? 120  SER H CA    1 
ATOM   5546  C  C     . SER H 4  124  ? 265.875 298.146 273.743 1.00 56.95  ? 120  SER H C     1 
ATOM   5547  O  O     . SER H 4  124  ? 265.612 298.747 274.782 1.00 56.95  ? 120  SER H O     1 
ATOM   5548  C  CB    . SER H 4  124  ? 265.989 298.375 271.275 1.00 56.95  ? 120  SER H CB    1 
ATOM   5549  O  OG    . SER H 4  124  ? 265.929 296.967 271.253 1.00 56.95  ? 120  SER H OG    1 
ATOM   5550  N  N     . SER I 5  350  ? 178.941 249.395 197.456 1.00 90.60  ? 350  SER I N     1 
ATOM   5551  C  CA    . SER I 5  350  ? 179.463 248.144 196.922 1.00 90.60  ? 350  SER I CA    1 
ATOM   5552  C  C     . SER I 5  350  ? 180.845 247.844 197.492 1.00 90.60  ? 350  SER I C     1 
ATOM   5553  O  O     . SER I 5  350  ? 181.081 248.006 198.686 1.00 90.60  ? 350  SER I O     1 
ATOM   5554  C  CB    . SER I 5  350  ? 179.520 248.194 195.393 1.00 90.60  ? 350  SER I CB    1 
ATOM   5555  O  OG    . SER I 5  350  ? 180.389 247.200 194.876 1.00 90.60  ? 350  SER I OG    1 
ATOM   5556  N  N     . ARG I 5  351  ? 181.758 247.403 196.626 1.00 88.38  ? 351  ARG I N     1 
ATOM   5557  C  CA    . ARG I 5  351  ? 183.124 247.094 197.027 1.00 88.38  ? 351  ARG I CA    1 
ATOM   5558  C  C     . ARG I 5  351  ? 184.156 247.684 196.072 1.00 88.38  ? 351  ARG I C     1 
ATOM   5559  O  O     . ARG I 5  351  ? 185.356 247.445 196.252 1.00 88.38  ? 351  ARG I O     1 
ATOM   5560  C  CB    . ARG I 5  351  ? 183.329 245.576 197.132 1.00 88.38  ? 351  ARG I CB    1 
ATOM   5561  C  CG    . ARG I 5  351  ? 183.115 245.003 198.521 1.00 88.38  ? 351  ARG I CG    1 
ATOM   5562  C  CD    . ARG I 5  351  ? 181.639 244.891 198.860 1.00 88.38  ? 351  ARG I CD    1 
ATOM   5563  N  NE    . ARG I 5  351  ? 181.425 244.513 200.254 1.00 88.38  ? 351  ARG I NE    1 
ATOM   5564  C  CZ    . ARG I 5  351  ? 180.230 244.324 200.802 1.00 88.38  ? 351  ARG I CZ    1 
ATOM   5565  N  NH1   . ARG I 5  351  ? 179.132 244.477 200.077 1.00 88.38  ? 351  ARG I NH1   1 
ATOM   5566  N  NH2   . ARG I 5  351  ? 180.133 243.980 202.077 1.00 88.38  ? 351  ARG I NH2   1 
ATOM   5567  N  N     . ILE I 5  352  ? 183.725 248.437 195.063 1.00 83.95  ? 352  ILE I N     1 
ATOM   5568  C  CA    . ILE I 5  352  ? 184.623 249.083 194.110 1.00 83.95  ? 352  ILE I CA    1 
ATOM   5569  C  C     . ILE I 5  352  ? 184.042 250.443 193.760 1.00 83.95  ? 352  ILE I C     1 
ATOM   5570  O  O     . ILE I 5  352  ? 182.844 250.564 193.491 1.00 83.95  ? 352  ILE I O     1 
ATOM   5571  C  CB    . ILE I 5  352  ? 184.827 248.253 192.825 1.00 83.95  ? 352  ILE I CB    1 
ATOM   5572  C  CG1   . ILE I 5  352  ? 185.338 246.845 193.141 1.00 83.95  ? 352  ILE I CG1   1 
ATOM   5573  C  CG2   . ILE I 5  352  ? 185.775 248.969 191.872 1.00 83.95  ? 352  ILE I CG2   1 
ATOM   5574  C  CD1   . ILE I 5  352  ? 185.895 246.108 191.940 1.00 83.95  ? 352  ILE I CD1   1 
ATOM   5575  N  N     . THR I 5  353  ? 184.882 251.466 193.770 1.00 82.38  ? 353  THR I N     1 
ATOM   5576  C  CA    . THR I 5  353  ? 184.383 252.745 193.296 1.00 82.38  ? 353  THR I CA    1 
ATOM   5577  C  C     . THR I 5  353  ? 184.390 252.757 191.768 1.00 82.38  ? 353  THR I C     1 
ATOM   5578  O  O     . THR I 5  353  ? 185.299 252.201 191.146 1.00 82.38  ? 353  THR I O     1 
ATOM   5579  C  CB    . THR I 5  353  ? 185.224 253.901 193.851 1.00 82.38  ? 353  THR I CB    1 
ATOM   5580  O  OG1   . THR I 5  353  ? 184.596 255.151 193.546 1.00 82.38  ? 353  THR I OG1   1 
ATOM   5581  C  CG2   . THR I 5  353  ? 186.625 253.897 193.276 1.00 82.38  ? 353  THR I CG2   1 
ATOM   5582  N  N     . PRO I 5  354  ? 183.372 253.342 191.132 1.00 86.41  ? 354  PRO I N     1 
ATOM   5583  C  CA    . PRO I 5  354  ? 183.316 253.317 189.667 1.00 86.41  ? 354  PRO I CA    1 
ATOM   5584  C  C     . PRO I 5  354  ? 184.378 254.173 189.007 1.00 86.41  ? 354  PRO I C     1 
ATOM   5585  O  O     . PRO I 5  354  ? 184.607 254.026 187.800 1.00 86.41  ? 354  PRO I O     1 
ATOM   5586  C  CB    . PRO I 5  354  ? 181.916 253.853 189.373 1.00 86.41  ? 354  PRO I CB    1 
ATOM   5587  C  CG    . PRO I 5  354  ? 181.698 254.831 190.465 1.00 86.41  ? 354  PRO I CG    1 
ATOM   5588  C  CD    . PRO I 5  354  ? 182.296 254.178 191.693 1.00 86.41  ? 354  PRO I CD    1 
ATOM   5589  N  N     . ILE I 5  355  ? 185.030 255.048 189.754 1.00 83.46  ? 355  ILE I N     1 
ATOM   5590  C  CA    . ILE I 5  355  ? 185.949 256.018 189.178 1.00 83.46  ? 355  ILE I CA    1 
ATOM   5591  C  C     . ILE I 5  355  ? 187.270 255.337 188.853 1.00 83.46  ? 355  ILE I C     1 
ATOM   5592  O  O     . ILE I 5  355  ? 187.775 254.514 189.624 1.00 83.46  ? 355  ILE I O     1 
ATOM   5593  C  CB    . ILE I 5  355  ? 186.137 257.203 190.142 1.00 83.46  ? 355  ILE I CB    1 
ATOM   5594  C  CG1   . ILE I 5  355  ? 184.887 258.076 190.143 1.00 83.46  ? 355  ILE I CG1   1 
ATOM   5595  C  CG2   . ILE I 5  355  ? 187.321 258.046 189.734 1.00 83.46  ? 355  ILE I CG2   1 
ATOM   5596  C  CD1   . ILE I 5  355  ? 184.498 258.557 188.769 1.00 83.46  ? 355  ILE I CD1   1 
ATOM   5597  N  N     . GLN I 5  356  ? 187.818 255.671 187.685 1.00 81.43  ? 356  GLN I N     1 
ATOM   5598  C  CA    . GLN I 5  356  ? 189.141 255.240 187.250 1.00 81.43  ? 356  GLN I CA    1 
ATOM   5599  C  C     . GLN I 5  356  ? 190.187 255.417 188.344 1.00 81.43  ? 356  GLN I C     1 
ATOM   5600  O  O     . GLN I 5  356  ? 190.091 256.339 189.161 1.00 81.43  ? 356  GLN I O     1 
ATOM   5601  C  CB    . GLN I 5  356  ? 189.556 256.027 186.004 1.00 81.43  ? 356  GLN I CB    1 
ATOM   5602  C  CG    . GLN I 5  356  ? 189.664 257.520 186.259 1.00 81.43  ? 356  GLN I CG    1 
ATOM   5603  C  CD    . GLN I 5  356  ? 191.067 257.953 186.634 1.00 81.43  ? 356  GLN I CD    1 
ATOM   5604  O  OE1   . GLN I 5  356  ? 192.000 257.839 185.842 1.00 81.43  ? 356  GLN I OE1   1 
ATOM   5605  N  NE2   . GLN I 5  356  ? 191.228 258.411 187.869 1.00 81.43  ? 356  GLN I NE2   1 
ATOM   5606  N  N     . LYS I 5  357  ? 191.183 254.541 188.377 1.00 78.58  ? 357  LYS I N     1 
ATOM   5607  C  CA    . LYS I 5  357  ? 192.274 254.719 189.327 1.00 78.58  ? 357  LYS I CA    1 
ATOM   5608  C  C     . LYS I 5  357  ? 193.202 255.824 188.832 1.00 78.58  ? 357  LYS I C     1 
ATOM   5609  O  O     . LYS I 5  357  ? 193.459 255.914 187.629 1.00 78.58  ? 357  LYS I O     1 
ATOM   5610  C  CB    . LYS I 5  357  ? 193.042 253.419 189.524 1.00 78.58  ? 357  LYS I CB    1 
ATOM   5611  C  CG    . LYS I 5  357  ? 192.303 252.420 190.397 1.00 78.58  ? 357  LYS I CG    1 
ATOM   5612  C  CD    . LYS I 5  357  ? 193.089 251.138 190.567 1.00 78.58  ? 357  LYS I CD    1 
ATOM   5613  C  CE    . LYS I 5  357  ? 194.198 251.305 191.589 1.00 78.58  ? 357  LYS I CE    1 
ATOM   5614  N  NZ    . LYS I 5  357  ? 193.700 251.081 192.971 1.00 78.58  ? 357  LYS I NZ    1 
ATOM   5615  N  N     . PRO I 5  358  ? 193.719 256.668 189.730 1.00 76.40  ? 358  PRO I N     1 
ATOM   5616  C  CA    . PRO I 5  358  ? 194.313 257.955 189.318 1.00 76.40  ? 358  PRO I CA    1 
ATOM   5617  C  C     . PRO I 5  358  ? 195.321 257.912 188.175 1.00 76.40  ? 358  PRO I C     1 
ATOM   5618  O  O     . PRO I 5  358  ? 195.475 258.930 187.487 1.00 76.40  ? 358  PRO I O     1 
ATOM   5619  C  CB    . PRO I 5  358  ? 194.978 258.438 190.610 1.00 76.40  ? 358  PRO I CB    1 
ATOM   5620  C  CG    . PRO I 5  358  ? 194.188 257.825 191.694 1.00 76.40  ? 358  PRO I CG    1 
ATOM   5621  C  CD    . PRO I 5  358  ? 193.710 256.500 191.191 1.00 76.40  ? 358  PRO I CD    1 
ATOM   5622  N  N     . ARG I 5  359  ? 196.016 256.788 187.965 1.00 74.28  ? 359  ARG I N     1 
ATOM   5623  C  CA    . ARG I 5  359  ? 197.138 256.643 187.029 1.00 74.28  ? 359  ARG I CA    1 
ATOM   5624  C  C     . ARG I 5  359  ? 198.421 257.262 187.569 1.00 74.28  ? 359  ARG I C     1 
ATOM   5625  O  O     . ARG I 5  359  ? 199.368 257.495 186.812 1.00 74.28  ? 359  ARG I O     1 
ATOM   5626  C  CB    . ARG I 5  359  ? 196.820 257.222 185.642 1.00 74.28  ? 359  ARG I CB    1 
ATOM   5627  C  CG    . ARG I 5  359  ? 197.622 256.646 184.479 1.00 74.28  ? 359  ARG I CG    1 
ATOM   5628  C  CD    . ARG I 5  359  ? 197.379 257.452 183.201 1.00 74.28  ? 359  ARG I CD    1 
ATOM   5629  N  NE    . ARG I 5  359  ? 197.584 258.891 183.381 1.00 74.28  ? 359  ARG I NE    1 
ATOM   5630  C  CZ    . ARG I 5  359  ? 198.741 259.465 183.707 1.00 74.28  ? 359  ARG I CZ    1 
ATOM   5631  N  NH1   . ARG I 5  359  ? 199.835 258.735 183.881 1.00 74.28  ? 359  ARG I NH1   1 
ATOM   5632  N  NH2   . ARG I 5  359  ? 198.808 260.782 183.847 1.00 74.28  ? 359  ARG I NH2   1 
ATOM   5633  N  N     . GLY I 5  360  ? 198.475 257.532 188.868 1.00 69.80  ? 360  GLY I N     1 
ATOM   5634  C  CA    . GLY I 5  360  ? 199.648 257.882 189.647 1.00 69.80  ? 360  GLY I CA    1 
ATOM   5635  C  C     . GLY I 5  360  ? 200.503 259.030 189.131 1.00 69.80  ? 360  GLY I C     1 
ATOM   5636  O  O     . GLY I 5  360  ? 200.091 259.858 188.318 1.00 69.80  ? 360  GLY I O     1 
ATOM   5637  N  N     . LEU I 5  361  ? 201.735 259.053 189.638 1.00 66.47  ? 361  LEU I N     1 
ATOM   5638  C  CA    . LEU I 5  361  ? 202.709 260.097 189.351 1.00 66.47  ? 361  LEU I CA    1 
ATOM   5639  C  C     . LEU I 5  361  ? 204.104 259.528 189.565 1.00 66.47  ? 361  LEU I C     1 
ATOM   5640  O  O     . LEU I 5  361  ? 204.316 258.681 190.436 1.00 66.47  ? 361  LEU I O     1 
ATOM   5641  C  CB    . LEU I 5  361  ? 202.484 261.322 190.242 1.00 66.47  ? 361  LEU I CB    1 
ATOM   5642  C  CG    . LEU I 5  361  ? 202.842 262.688 189.669 1.00 66.47  ? 361  LEU I CG    1 
ATOM   5643  C  CD1   . LEU I 5  361  ? 202.281 262.847 188.273 1.00 66.47  ? 361  LEU I CD1   1 
ATOM   5644  C  CD2   . LEU I 5  361  ? 202.316 263.776 190.582 1.00 66.47  ? 361  LEU I CD2   1 
ATOM   5645  N  N     . ASP I 5  362  ? 205.059 260.004 188.769 1.00 67.79  ? 362  ASP I N     1 
ATOM   5646  C  CA    . ASP I 5  362  ? 206.403 259.451 188.805 1.00 67.79  ? 362  ASP I CA    1 
ATOM   5647  C  C     . ASP I 5  362  ? 207.317 260.356 189.614 1.00 67.79  ? 362  ASP I C     1 
ATOM   5648  O  O     . ASP I 5  362  ? 207.608 261.478 189.175 1.00 67.79  ? 362  ASP I O     1 
ATOM   5649  C  CB    . ASP I 5  362  ? 206.950 259.274 187.393 1.00 67.79  ? 362  ASP I CB    1 
ATOM   5650  C  CG    . ASP I 5  362  ? 207.968 258.162 187.303 1.00 67.79  ? 362  ASP I CG    1 
ATOM   5651  O  OD1   . ASP I 5  362  ? 208.033 257.341 188.242 1.00 67.79  ? 362  ASP I OD1   1 
ATOM   5652  O  OD2   . ASP I 5  362  ? 208.704 258.108 186.296 1.00 67.79  ? 362  ASP I OD2   1 
ATOM   5653  N  N     . PRO I 5  363  ? 207.799 259.924 190.783 1.00 64.83  ? 363  PRO I N     1 
ATOM   5654  C  CA    . PRO I 5  363  ? 208.655 260.803 191.590 1.00 64.83  ? 363  PRO I CA    1 
ATOM   5655  C  C     . PRO I 5  363  ? 210.083 260.912 191.094 1.00 64.83  ? 363  PRO I C     1 
ATOM   5656  O  O     . PRO I 5  363  ? 210.751 261.901 191.420 1.00 64.83  ? 363  PRO I O     1 
ATOM   5657  C  CB    . PRO I 5  363  ? 208.610 260.148 192.975 1.00 64.83  ? 363  PRO I CB    1 
ATOM   5658  C  CG    . PRO I 5  363  ? 208.389 258.707 192.673 1.00 64.83  ? 363  PRO I CG    1 
ATOM   5659  C  CD    . PRO I 5  363  ? 207.452 258.688 191.500 1.00 64.83  ? 363  PRO I CD    1 
ATOM   5660  N  N     . VAL I 5  364  ? 210.575 259.951 190.313 1.00 65.56  ? 364  VAL I N     1 
ATOM   5661  C  CA    . VAL I 5  364  ? 211.941 260.051 189.811 1.00 65.56  ? 364  VAL I CA    1 
ATOM   5662  C  C     . VAL I 5  364  ? 212.028 261.105 188.716 1.00 65.56  ? 364  VAL I C     1 
ATOM   5663  O  O     . VAL I 5  364  ? 213.013 261.846 188.622 1.00 65.56  ? 364  VAL I O     1 
ATOM   5664  C  CB    . VAL I 5  364  ? 212.439 258.675 189.336 1.00 65.56  ? 364  VAL I CB    1 
ATOM   5665  C  CG1   . VAL I 5  364  ? 212.430 257.693 190.489 1.00 65.56  ? 364  VAL I CG1   1 
ATOM   5666  C  CG2   . VAL I 5  364  ? 211.578 258.149 188.204 1.00 65.56  ? 364  VAL I CG2   1 
ATOM   5667  N  N     . GLU I 5  365  ? 210.985 261.216 187.892 1.00 68.12  ? 365  GLU I N     1 
ATOM   5668  C  CA    . GLU I 5  365  ? 210.948 262.284 186.905 1.00 68.12  ? 365  GLU I CA    1 
ATOM   5669  C  C     . GLU I 5  365  ? 210.768 263.639 187.571 1.00 68.12  ? 365  GLU I C     1 
ATOM   5670  O  O     . GLU I 5  365  ? 211.334 264.634 187.111 1.00 68.12  ? 365  GLU I O     1 
ATOM   5671  C  CB    . GLU I 5  365  ? 209.832 262.028 185.896 1.00 68.12  ? 365  GLU I CB    1 
ATOM   5672  C  CG    . GLU I 5  365  ? 209.478 263.225 185.040 1.00 68.12  ? 365  GLU I CG    1 
ATOM   5673  C  CD    . GLU I 5  365  ? 208.430 262.901 183.998 1.00 68.12  ? 365  GLU I CD    1 
ATOM   5674  O  OE1   . GLU I 5  365  ? 207.622 261.979 184.232 1.00 68.12  ? 365  GLU I OE1   1 
ATOM   5675  O  OE2   . GLU I 5  365  ? 208.417 263.567 182.941 1.00 68.12  ? 365  GLU I OE2   1 
ATOM   5676  N  N     . ILE I 5  366  ? 210.007 263.696 188.663 1.00 66.06  ? 366  ILE I N     1 
ATOM   5677  C  CA    . ILE I 5  366  ? 209.876 264.942 189.407 1.00 66.06  ? 366  ILE I CA    1 
ATOM   5678  C  C     . ILE I 5  366  ? 211.215 265.342 190.013 1.00 66.06  ? 366  ILE I C     1 
ATOM   5679  O  O     . ILE I 5  366  ? 211.577 266.523 190.031 1.00 66.06  ? 366  ILE I O     1 
ATOM   5680  C  CB    . ILE I 5  366  ? 208.776 264.812 190.475 1.00 66.06  ? 366  ILE I CB    1 
ATOM   5681  C  CG1   . ILE I 5  366  ? 207.404 264.783 189.801 1.00 66.06  ? 366  ILE I CG1   1 
ATOM   5682  C  CG2   . ILE I 5  366  ? 208.850 265.949 191.475 1.00 66.06  ? 366  ILE I CG2   1 
ATOM   5683  C  CD1   . ILE I 5  366  ? 206.253 264.667 190.765 1.00 66.06  ? 366  ILE I CD1   1 
ATOM   5684  N  N     . LEU I 5  367  ? 211.984 264.364 190.492 1.00 65.75  ? 367  LEU I N     1 
ATOM   5685  C  CA    . LEU I 5  367  ? 213.321 264.652 191.000 1.00 65.75  ? 367  LEU I CA    1 
ATOM   5686  C  C     . LEU I 5  367  ? 214.224 265.193 189.902 1.00 65.75  ? 367  LEU I C     1 
ATOM   5687  O  O     . LEU I 5  367  ? 214.904 266.210 190.086 1.00 65.75  ? 367  LEU I O     1 
ATOM   5688  C  CB    . LEU I 5  367  ? 213.925 263.394 191.618 1.00 65.75  ? 367  LEU I CB    1 
ATOM   5689  C  CG    . LEU I 5  367  ? 215.136 263.612 192.518 1.00 65.75  ? 367  LEU I CG    1 
ATOM   5690  C  CD1   . LEU I 5  367  ? 214.722 264.237 193.831 1.00 65.75  ? 367  LEU I CD1   1 
ATOM   5691  C  CD2   . LEU I 5  367  ? 215.860 262.296 192.746 1.00 65.75  ? 367  LEU I CD2   1 
ATOM   5692  N  N     . GLN I 5  368  ? 214.279 264.498 188.765 1.00 68.13  ? 368  GLN I N     1 
ATOM   5693  C  CA    . GLN I 5  368  ? 215.042 264.986 187.621 1.00 68.13  ? 368  GLN I CA    1 
ATOM   5694  C  C     . GLN I 5  368  ? 214.649 266.411 187.256 1.00 68.13  ? 368  GLN I C     1 
ATOM   5695  O  O     . GLN I 5  368  ? 215.508 267.259 186.988 1.00 68.13  ? 368  GLN I O     1 
ATOM   5696  C  CB    . GLN I 5  368  ? 214.840 264.063 186.423 1.00 68.13  ? 368  GLN I CB    1 
ATOM   5697  C  CG    . GLN I 5  368  ? 215.693 262.821 186.438 1.00 68.13  ? 368  GLN I CG    1 
ATOM   5698  C  CD    . GLN I 5  368  ? 215.532 262.013 185.172 1.00 68.13  ? 368  GLN I CD    1 
ATOM   5699  O  OE1   . GLN I 5  368  ? 215.119 262.540 184.138 1.00 68.13  ? 368  GLN I OE1   1 
ATOM   5700  N  NE2   . GLN I 5  368  ? 215.850 260.727 185.242 1.00 68.13  ? 368  GLN I NE2   1 
ATOM   5701  N  N     . GLU I 5  369  ? 213.347 266.695 187.243 1.00 69.04  ? 369  GLU I N     1 
ATOM   5702  C  CA    . GLU I 5  369  ? 212.895 268.008 186.804 1.00 69.04  ? 369  GLU I CA    1 
ATOM   5703  C  C     . GLU I 5  369  ? 213.219 269.082 187.829 1.00 69.04  ? 369  GLU I C     1 
ATOM   5704  O  O     . GLU I 5  369  ? 213.525 270.216 187.453 1.00 69.04  ? 369  GLU I O     1 
ATOM   5705  C  CB    . GLU I 5  369  ? 211.398 267.976 186.511 1.00 69.04  ? 369  GLU I CB    1 
ATOM   5706  C  CG    . GLU I 5  369  ? 210.941 269.053 185.548 1.00 69.04  ? 369  GLU I CG    1 
ATOM   5707  C  CD    . GLU I 5  369  ? 210.247 270.203 186.247 1.00 69.04  ? 369  GLU I CD    1 
ATOM   5708  O  OE1   . GLU I 5  369  ? 209.760 270.005 187.382 1.00 69.04  ? 369  GLU I OE1   1 
ATOM   5709  O  OE2   . GLU I 5  369  ? 210.190 271.305 185.663 1.00 69.04  ? 369  GLU I OE2   1 
ATOM   5710  N  N     . ARG I 5  370  ? 213.169 268.753 189.119 1.00 67.34  ? 370  ARG I N     1 
ATOM   5711  C  CA    . ARG I 5  370  ? 213.591 269.712 190.134 1.00 67.34  ? 370  ARG I CA    1 
ATOM   5712  C  C     . ARG I 5  370  ? 215.077 270.009 190.011 1.00 67.34  ? 370  ARG I C     1 
ATOM   5713  O  O     . ARG I 5  370  ? 215.500 271.170 190.091 1.00 67.34  ? 370  ARG I O     1 
ATOM   5714  C  CB    . ARG I 5  370  ? 213.267 269.183 191.528 1.00 67.34  ? 370  ARG I CB    1 
ATOM   5715  C  CG    . ARG I 5  370  ? 214.229 269.657 192.597 1.00 67.34  ? 370  ARG I CG    1 
ATOM   5716  C  CD    . ARG I 5  370  ? 213.794 269.203 193.972 1.00 67.34  ? 370  ARG I CD    1 
ATOM   5717  N  NE    . ARG I 5  370  ? 214.676 269.711 195.019 1.00 67.34  ? 370  ARG I NE    1 
ATOM   5718  C  CZ    . ARG I 5  370  ? 215.880 269.218 195.289 1.00 67.34  ? 370  ARG I CZ    1 
ATOM   5719  N  NH1   . ARG I 5  370  ? 216.610 269.747 196.261 1.00 67.34  ? 370  ARG I NH1   1 
ATOM   5720  N  NH2   . ARG I 5  370  ? 216.356 268.195 194.594 1.00 67.34  ? 370  ARG I NH2   1 
ATOM   5721  N  N     . GLU I 5  371  ? 215.885 268.970 189.804 1.00 69.11  ? 371  GLU I N     1 
ATOM   5722  C  CA    . GLU I 5  371  ? 217.310 269.175 189.577 1.00 69.11  ? 371  GLU I CA    1 
ATOM   5723  C  C     . GLU I 5  371  ? 217.545 270.087 188.385 1.00 69.11  ? 371  GLU I C     1 
ATOM   5724  O  O     . GLU I 5  371  ? 218.392 270.986 188.431 1.00 69.11  ? 371  GLU I O     1 
ATOM   5725  C  CB    . GLU I 5  371  ? 218.006 267.834 189.363 1.00 69.11  ? 371  GLU I CB    1 
ATOM   5726  C  CG    . GLU I 5  371  ? 218.012 266.928 190.570 1.00 69.11  ? 371  GLU I CG    1 
ATOM   5727  C  CD    . GLU I 5  371  ? 218.342 265.500 190.201 1.00 69.11  ? 371  GLU I CD    1 
ATOM   5728  O  OE1   . GLU I 5  371  ? 218.926 265.292 189.116 1.00 69.11  ? 371  GLU I OE1   1 
ATOM   5729  O  OE2   . GLU I 5  371  ? 218.027 264.586 190.989 1.00 69.11  ? 371  GLU I OE2   1 
ATOM   5730  N  N     . TYR I 5  372  ? 216.810 269.860 187.296 1.00 67.61  ? 372  TYR I N     1 
ATOM   5731  C  CA    . TYR I 5  372  ? 217.036 270.648 186.090 1.00 67.61  ? 372  TYR I CA    1 
ATOM   5732  C  C     . TYR I 5  372  ? 216.557 272.080 186.261 1.00 67.61  ? 372  TYR I C     1 
ATOM   5733  O  O     . TYR I 5  372  ? 217.183 273.003 185.735 1.00 67.61  ? 372  TYR I O     1 
ATOM   5734  C  CB    . TYR I 5  372  ? 216.357 269.986 184.895 1.00 67.61  ? 372  TYR I CB    1 
ATOM   5735  C  CG    . TYR I 5  372  ? 216.953 268.645 184.525 1.00 67.61  ? 372  TYR I CG    1 
ATOM   5736  C  CD1   . TYR I 5  372  ? 218.080 268.165 185.173 1.00 67.61  ? 372  TYR I CD1   1 
ATOM   5737  C  CD2   . TYR I 5  372  ? 216.385 267.860 183.533 1.00 67.61  ? 372  TYR I CD2   1 
ATOM   5738  C  CE1   . TYR I 5  372  ? 218.625 266.947 184.845 1.00 67.61  ? 372  TYR I CE1   1 
ATOM   5739  C  CE2   . TYR I 5  372  ? 216.925 266.640 183.197 1.00 67.61  ? 372  TYR I CE2   1 
ATOM   5740  C  CZ    . TYR I 5  372  ? 218.045 266.188 183.858 1.00 67.61  ? 372  TYR I CZ    1 
ATOM   5741  O  OH    . TYR I 5  372  ? 218.592 264.969 183.529 1.00 67.61  ? 372  TYR I OH    1 
ATOM   5742  N  N     . ARG I 5  373  ? 215.470 272.287 187.002 1.00 67.88  ? 373  ARG I N     1 
ATOM   5743  C  CA    . ARG I 5  373  ? 215.086 273.642 187.376 1.00 67.88  ? 373  ARG I CA    1 
ATOM   5744  C  C     . ARG I 5  373  ? 216.196 274.325 188.155 1.00 67.88  ? 373  ARG I C     1 
ATOM   5745  O  O     . ARG I 5  373  ? 216.481 275.507 187.924 1.00 67.88  ? 373  ARG I O     1 
ATOM   5746  C  CB    . ARG I 5  373  ? 213.804 273.622 188.207 1.00 67.88  ? 373  ARG I CB    1 
ATOM   5747  C  CG    . ARG I 5  373  ? 212.538 273.320 187.427 1.00 67.88  ? 373  ARG I CG    1 
ATOM   5748  C  CD    . ARG I 5  373  ? 211.307 273.767 188.201 1.00 67.88  ? 373  ARG I CD    1 
ATOM   5749  N  NE    . ARG I 5  373  ? 211.058 272.936 189.377 1.00 67.88  ? 373  ARG I NE    1 
ATOM   5750  C  CZ    . ARG I 5  373  ? 211.078 273.383 190.630 1.00 67.88  ? 373  ARG I CZ    1 
ATOM   5751  N  NH1   . ARG I 5  373  ? 211.343 274.658 190.878 1.00 67.88  ? 373  ARG I NH1   1 
ATOM   5752  N  NH2   . ARG I 5  373  ? 210.837 272.554 191.639 1.00 67.88  ? 373  ARG I NH2   1 
ATOM   5753  N  N     . LEU I 5  374  ? 216.851 273.589 189.057 1.00 66.33  ? 374  LEU I N     1 
ATOM   5754  C  CA    . LEU I 5  374  ? 217.938 274.171 189.841 1.00 66.33  ? 374  LEU I CA    1 
ATOM   5755  C  C     . LEU I 5  374  ? 219.109 274.565 188.956 1.00 66.33  ? 374  LEU I C     1 
ATOM   5756  O  O     . LEU I 5  374  ? 219.624 275.683 189.051 1.00 66.33  ? 374  LEU I O     1 
ATOM   5757  C  CB    . LEU I 5  374  ? 218.390 273.189 190.917 1.00 66.33  ? 374  LEU I CB    1 
ATOM   5758  C  CG    . LEU I 5  374  ? 217.558 273.206 192.195 1.00 66.33  ? 374  LEU I CG    1 
ATOM   5759  C  CD1   . LEU I 5  374  ? 218.246 272.404 193.275 1.00 66.33  ? 374  LEU I CD1   1 
ATOM   5760  C  CD2   . LEU I 5  374  ? 217.311 274.632 192.647 1.00 66.33  ? 374  LEU I CD2   1 
ATOM   5761  N  N     . GLN I 5  375  ? 219.551 273.650 188.092 1.00 67.02  ? 375  GLN I N     1 
ATOM   5762  C  CA    . GLN I 5  375  ? 220.677 273.956 187.214 1.00 67.02  ? 375  GLN I CA    1 
ATOM   5763  C  C     . GLN I 5  375  ? 220.355 275.092 186.254 1.00 67.02  ? 375  GLN I C     1 
ATOM   5764  O  O     . GLN I 5  375  ? 221.223 275.921 185.967 1.00 67.02  ? 375  GLN I O     1 
ATOM   5765  C  CB    . GLN I 5  375  ? 221.103 272.716 186.434 1.00 67.02  ? 375  GLN I CB    1 
ATOM   5766  C  CG    . GLN I 5  375  ? 221.284 271.487 187.290 1.00 67.02  ? 375  GLN I CG    1 
ATOM   5767  C  CD    . GLN I 5  375  ? 221.213 270.213 186.485 1.00 67.02  ? 375  GLN I CD    1 
ATOM   5768  O  OE1   . GLN I 5  375  ? 221.174 270.246 185.257 1.00 67.02  ? 375  GLN I OE1   1 
ATOM   5769  N  NE2   . GLN I 5  375  ? 221.194 269.080 187.173 1.00 67.02  ? 375  GLN I NE2   1 
ATOM   5770  N  N     . ALA I 5  376  ? 219.120 275.166 185.762 1.00 67.58  ? 376  ALA I N     1 
ATOM   5771  C  CA    . ALA I 5  376  ? 218.759 276.259 184.868 1.00 67.58  ? 376  ALA I CA    1 
ATOM   5772  C  C     . ALA I 5  376  ? 218.755 277.591 185.605 1.00 67.58  ? 376  ALA I C     1 
ATOM   5773  O  O     . ALA I 5  376  ? 219.295 278.585 185.109 1.00 67.58  ? 376  ALA I O     1 
ATOM   5774  C  CB    . ALA I 5  376  ? 217.397 275.989 184.232 1.00 67.58  ? 376  ALA I CB    1 
ATOM   5775  N  N     . ARG I 5  377  ? 218.138 277.636 186.790 1.00 69.86  ? 377  ARG I N     1 
ATOM   5776  C  CA    . ARG I 5  377  ? 218.136 278.863 187.579 1.00 69.86  ? 377  ARG I CA    1 
ATOM   5777  C  C     . ARG I 5  377  ? 219.557 279.305 187.914 1.00 69.86  ? 377  ARG I C     1 
ATOM   5778  O  O     . ARG I 5  377  ? 219.874 280.504 187.906 1.00 69.86  ? 377  ARG I O     1 
ATOM   5779  C  CB    . ARG I 5  377  ? 217.319 278.644 188.847 1.00 69.86  ? 377  ARG I CB    1 
ATOM   5780  C  CG    . ARG I 5  377  ? 216.902 279.910 189.553 1.00 69.86  ? 377  ARG I CG    1 
ATOM   5781  C  CD    . ARG I 5  377  ? 216.241 279.571 190.867 1.00 69.86  ? 377  ARG I CD    1 
ATOM   5782  N  NE    . ARG I 5  377  ? 215.178 278.591 190.690 1.00 69.86  ? 377  ARG I NE    1 
ATOM   5783  C  CZ    . ARG I 5  377  ? 214.416 278.136 191.676 1.00 69.86  ? 377  ARG I CZ    1 
ATOM   5784  N  NH1   . ARG I 5  377  ? 214.604 278.572 192.914 1.00 69.86  ? 377  ARG I NH1   1 
ATOM   5785  N  NH2   . ARG I 5  377  ? 213.469 277.242 191.426 1.00 69.86  ? 377  ARG I NH2   1 
ATOM   5786  N  N     . ILE I 5  378  ? 220.438 278.339 188.169 1.00 67.40  ? 378  ILE I N     1 
ATOM   5787  C  CA    . ILE I 5  378  ? 221.818 278.662 188.502 1.00 67.40  ? 378  ILE I CA    1 
ATOM   5788  C  C     . ILE I 5  378  ? 222.540 279.231 187.289 1.00 67.40  ? 378  ILE I C     1 
ATOM   5789  O  O     . ILE I 5  378  ? 223.209 280.266 187.379 1.00 67.40  ? 378  ILE I O     1 
ATOM   5790  C  CB    . ILE I 5  378  ? 222.535 277.425 189.065 1.00 67.40  ? 378  ILE I CB    1 
ATOM   5791  C  CG1   . ILE I 5  378  ? 222.244 277.299 190.557 1.00 67.40  ? 378  ILE I CG1   1 
ATOM   5792  C  CG2   . ILE I 5  378  ? 224.025 277.511 188.822 1.00 67.40  ? 378  ILE I CG2   1 
ATOM   5793  C  CD1   . ILE I 5  378  ? 222.713 276.008 191.153 1.00 67.40  ? 378  ILE I CD1   1 
ATOM   5794  N  N     . ALA I 5  379  ? 222.430 278.561 186.140 1.00 65.99  ? 379  ALA I N     1 
ATOM   5795  C  CA    . ALA I 5  379  ? 223.034 279.107 184.932 1.00 65.99  ? 379  ALA I CA    1 
ATOM   5796  C  C     . ALA I 5  379  ? 222.451 280.467 184.570 1.00 65.99  ? 379  ALA I C     1 
ATOM   5797  O  O     . ALA I 5  379  ? 223.148 281.293 183.971 1.00 65.99  ? 379  ALA I O     1 
ATOM   5798  C  CB    . ALA I 5  379  ? 222.868 278.131 183.768 1.00 65.99  ? 379  ALA I CB    1 
ATOM   5799  N  N     . HIS I 5  380  ? 221.218 280.753 184.972 1.00 70.82  ? 380  HIS I N     1 
ATOM   5800  C  CA    . HIS I 5  380  ? 220.681 282.070 184.657 1.00 70.82  ? 380  HIS I CA    1 
ATOM   5801  C  C     . HIS I 5  380  ? 221.254 283.138 185.575 1.00 70.82  ? 380  HIS I C     1 
ATOM   5802  O  O     . HIS I 5  380  ? 221.488 284.271 185.139 1.00 70.82  ? 380  HIS I O     1 
ATOM   5803  C  CB    . HIS I 5  380  ? 219.158 282.076 184.738 1.00 70.82  ? 380  HIS I CB    1 
ATOM   5804  C  CG    . HIS I 5  380  ? 218.543 283.277 184.097 1.00 70.82  ? 380  HIS I CG    1 
ATOM   5805  N  ND1   . HIS I 5  380  ? 218.457 283.424 182.729 1.00 70.82  ? 380  HIS I ND1   1 
ATOM   5806  C  CD2   . HIS I 5  380  ? 218.011 284.400 184.630 1.00 70.82  ? 380  HIS I CD2   1 
ATOM   5807  C  CE1   . HIS I 5  380  ? 217.884 284.580 182.449 1.00 70.82  ? 380  HIS I CE1   1 
ATOM   5808  N  NE2   . HIS I 5  380  ? 217.603 285.192 183.585 1.00 70.82  ? 380  HIS I NE2   1 
ATOM   5809  N  N     . ARG I 5  381  ? 221.496 282.804 186.844 1.00 65.48  ? 381  ARG I N     1 
ATOM   5810  C  CA    . ARG I 5  381  ? 222.243 283.748 187.671 1.00 65.48  ? 381  ARG I CA    1 
ATOM   5811  C  C     . ARG I 5  381  ? 223.667 283.931 187.158 1.00 65.48  ? 381  ARG I C     1 
ATOM   5812  O  O     . ARG I 5  381  ? 224.203 285.043 187.193 1.00 65.48  ? 381  ARG I O     1 
ATOM   5813  C  CB    . ARG I 5  381  ? 222.251 283.298 189.127 1.00 65.48  ? 381  ARG I CB    1 
ATOM   5814  C  CG    . ARG I 5  381  ? 222.863 284.324 190.061 1.00 65.48  ? 381  ARG I CG    1 
ATOM   5815  C  CD    . ARG I 5  381  ? 222.345 285.713 189.762 1.00 65.48  ? 381  ARG I CD    1 
ATOM   5816  N  NE    . ARG I 5  381  ? 223.083 286.745 190.488 1.00 65.48  ? 381  ARG I NE    1 
ATOM   5817  C  CZ    . ARG I 5  381  ? 222.581 287.458 191.490 1.00 65.48  ? 381  ARG I CZ    1 
ATOM   5818  N  NH1   . ARG I 5  381  ? 221.332 287.259 191.887 1.00 65.48  ? 381  ARG I NH1   1 
ATOM   5819  N  NH2   . ARG I 5  381  ? 223.325 288.373 192.093 1.00 65.48  ? 381  ARG I NH2   1 
ATOM   5820  N  N     . ILE I 5  382  ? 224.282 282.863 186.643 1.00 63.43  ? 382  ILE I N     1 
ATOM   5821  C  CA    . ILE I 5  382  ? 225.624 282.975 186.083 1.00 63.43  ? 382  ILE I CA    1 
ATOM   5822  C  C     . ILE I 5  382  ? 225.626 283.818 184.817 1.00 63.43  ? 382  ILE I C     1 
ATOM   5823  O  O     . ILE I 5  382  ? 226.632 284.460 184.501 1.00 63.43  ? 382  ILE I O     1 
ATOM   5824  C  CB    . ILE I 5  382  ? 226.210 281.575 185.814 1.00 63.43  ? 382  ILE I CB    1 
ATOM   5825  C  CG1   . ILE I 5  382  ? 226.272 280.769 187.110 1.00 63.43  ? 382  ILE I CG1   1 
ATOM   5826  C  CG2   . ILE I 5  382  ? 227.588 281.670 185.188 1.00 63.43  ? 382  ILE I CG2   1 
ATOM   5827  C  CD1   . ILE I 5  382  ? 227.158 279.556 187.030 1.00 63.43  ? 382  ILE I CD1   1 
ATOM   5828  N  N     . GLN I 5  383  ? 224.505 283.874 184.101 1.00 67.18  ? 383  GLN I N     1 
ATOM   5829  C  CA    . GLN I 5  383  ? 224.436 284.779 182.961 1.00 67.18  ? 383  GLN I CA    1 
ATOM   5830  C  C     . GLN I 5  383  ? 224.173 286.212 183.403 1.00 67.18  ? 383  GLN I C     1 
ATOM   5831  O  O     . GLN I 5  383  ? 224.709 287.151 182.805 1.00 67.18  ? 383  GLN I O     1 
ATOM   5832  C  CB    . GLN I 5  383  ? 223.368 284.320 181.975 1.00 67.18  ? 383  GLN I CB    1 
ATOM   5833  C  CG    . GLN I 5  383  ? 223.872 283.263 181.029 1.00 67.18  ? 383  GLN I CG    1 
ATOM   5834  C  CD    . GLN I 5  383  ? 225.332 283.466 180.678 1.00 67.18  ? 383  GLN I CD    1 
ATOM   5835  O  OE1   . GLN I 5  383  ? 225.709 284.484 180.098 1.00 67.18  ? 383  GLN I OE1   1 
ATOM   5836  N  NE2   . GLN I 5  383  ? 226.166 282.496 181.036 1.00 67.18  ? 383  GLN I NE2   1 
ATOM   5837  N  N     . GLU I 5  384  ? 223.346 286.402 184.433 1.00 67.41  ? 384  GLU I N     1 
ATOM   5838  C  CA    . GLU I 5  384  ? 223.231 287.722 185.041 1.00 67.41  ? 384  GLU I CA    1 
ATOM   5839  C  C     . GLU I 5  384  ? 224.596 288.264 185.440 1.00 67.41  ? 384  GLU I C     1 
ATOM   5840  O  O     . GLU I 5  384  ? 224.870 289.458 185.286 1.00 67.41  ? 384  GLU I O     1 
ATOM   5841  C  CB    . GLU I 5  384  ? 222.317 287.681 186.264 1.00 67.41  ? 384  GLU I CB    1 
ATOM   5842  C  CG    . GLU I 5  384  ? 220.842 287.798 185.965 1.00 67.41  ? 384  GLU I CG    1 
ATOM   5843  C  CD    . GLU I 5  384  ? 220.008 287.881 187.226 1.00 67.41  ? 384  GLU I CD    1 
ATOM   5844  O  OE1   . GLU I 5  384  ? 220.596 287.956 188.323 1.00 67.41  ? 384  GLU I OE1   1 
ATOM   5845  O  OE2   . GLU I 5  384  ? 218.765 287.870 187.122 1.00 67.41  ? 384  GLU I OE2   1 
ATOM   5846  N  N     . LEU I 5  385  ? 225.468 287.396 185.950 1.00 64.78  ? 385  LEU I N     1 
ATOM   5847  C  CA    . LEU I 5  385  ? 226.721 287.852 186.537 1.00 64.78  ? 385  LEU I CA    1 
ATOM   5848  C  C     . LEU I 5  385  ? 227.882 287.931 185.557 1.00 64.78  ? 385  LEU I C     1 
ATOM   5849  O  O     . LEU I 5  385  ? 228.754 288.784 185.735 1.00 64.78  ? 385  LEU I O     1 
ATOM   5850  C  CB    . LEU I 5  385  ? 227.120 286.947 187.705 1.00 64.78  ? 385  LEU I CB    1 
ATOM   5851  C  CG    . LEU I 5  385  ? 226.142 287.001 188.872 1.00 64.78  ? 385  LEU I CG    1 
ATOM   5852  C  CD1   . LEU I 5  385  ? 226.580 286.067 189.970 1.00 64.78  ? 385  LEU I CD1   1 
ATOM   5853  C  CD2   . LEU I 5  385  ? 226.002 288.409 189.384 1.00 64.78  ? 385  LEU I CD2   1 
ATOM   5854  N  N     . GLU I 5  386  ? 227.911 287.108 184.515 1.00 68.30  ? 386  GLU I N     1 
ATOM   5855  C  CA    . GLU I 5  386  ? 229.070 287.233 183.601 1.00 68.30  ? 386  GLU I CA    1 
ATOM   5856  C  C     . GLU I 5  386  ? 228.903 288.466 182.704 1.00 68.30  ? 386  GLU I C     1 
ATOM   5857  O  O     . GLU I 5  386  ? 229.890 288.838 182.046 1.00 68.30  ? 386  GLU I O     1 
ATOM   5858  C  CB    . GLU I 5  386  ? 229.243 285.943 182.799 1.00 68.30  ? 386  GLU I CB    1 
ATOM   5859  C  CG    . GLU I 5  386  ? 230.449 285.953 181.883 1.00 68.30  ? 386  GLU I CG    1 
ATOM   5860  C  CD    . GLU I 5  386  ? 230.456 284.809 180.887 1.00 68.30  ? 386  GLU I CD    1 
ATOM   5861  O  OE1   . GLU I 5  386  ? 229.362 284.414 180.442 1.00 68.30  ? 386  GLU I OE1   1 
ATOM   5862  O  OE2   . GLU I 5  386  ? 231.553 284.313 180.566 1.00 68.30  ? 386  GLU I OE2   1 
ATOM   5863  N  N     . ASN I 5  387  ? 227.709 289.072 182.666 1.00 69.64  ? 387  ASN I N     1 
ATOM   5864  C  CA    . ASN I 5  387  ? 227.441 290.214 181.800 1.00 69.64  ? 387  ASN I CA    1 
ATOM   5865  C  C     . ASN I 5  387  ? 226.695 291.297 182.562 1.00 69.64  ? 387  ASN I C     1 
ATOM   5866  O  O     . ASN I 5  387  ? 225.681 291.835 182.111 1.00 69.64  ? 387  ASN I O     1 
ATOM   5867  C  CB    . ASN I 5  387  ? 226.672 289.762 180.565 1.00 69.64  ? 387  ASN I CB    1 
ATOM   5868  C  CG    . ASN I 5  387  ? 227.380 288.645 179.828 1.00 69.64  ? 387  ASN I CG    1 
ATOM   5869  O  OD1   . ASN I 5  387  ? 226.790 287.609 179.528 1.00 69.64  ? 387  ASN I OD1   1 
ATOM   5870  N  ND2   . ASN I 5  387  ? 228.662 288.847 179.548 1.00 69.64  ? 387  ASN I ND2   1 
ATOM   5871  N  N     . LEU I 5  388  ? 227.188 291.612 183.753 1.00 67.92  ? 388  LEU I N     1 
ATOM   5872  C  CA    . LEU I 5  388  ? 226.664 292.716 184.542 1.00 67.92  ? 388  LEU I CA    1 
ATOM   5873  C  C     . LEU I 5  388  ? 226.867 294.044 183.827 1.00 67.92  ? 388  LEU I C     1 
ATOM   5874  O  O     . LEU I 5  388  ? 227.736 294.832 184.197 1.00 67.92  ? 388  LEU I O     1 
ATOM   5875  C  CB    . LEU I 5  388  ? 227.334 292.755 185.913 1.00 67.92  ? 388  LEU I CB    1 
ATOM   5876  C  CG    . LEU I 5  388  ? 226.975 291.631 186.880 1.00 67.92  ? 388  LEU I CG    1 
ATOM   5877  C  CD1   . LEU I 5  388  ? 228.176 291.262 187.727 1.00 67.92  ? 388  LEU I CD1   1 
ATOM   5878  C  CD2   . LEU I 5  388  ? 225.806 292.043 187.760 1.00 67.92  ? 388  LEU I CD2   1 
ATOM   5879  N  N     . LEU I 5  396  ? 230.063 296.303 196.196 1.00 70.46  ? 396  LEU I N     1 
ATOM   5880  C  CA    . LEU I 5  396  ? 228.930 295.762 195.455 1.00 70.46  ? 396  LEU I CA    1 
ATOM   5881  C  C     . LEU I 5  396  ? 229.405 294.912 194.283 1.00 70.46  ? 396  LEU I C     1 
ATOM   5882  O  O     . LEU I 5  396  ? 228.814 293.884 193.968 1.00 70.46  ? 396  LEU I O     1 
ATOM   5883  C  CB    . LEU I 5  396  ? 228.027 296.891 194.959 1.00 70.46  ? 396  LEU I CB    1 
ATOM   5884  C  CG    . LEU I 5  396  ? 226.618 296.486 194.526 1.00 70.46  ? 396  LEU I CG    1 
ATOM   5885  C  CD1   . LEU I 5  396  ? 225.927 295.695 195.622 1.00 70.46  ? 396  LEU I CD1   1 
ATOM   5886  C  CD2   . LEU I 5  396  ? 225.807 297.713 194.154 1.00 70.46  ? 396  LEU I CD2   1 
ATOM   5887  N  N     . ARG I 5  397  ? 230.480 295.357 193.633 1.00 69.17  ? 397  ARG I N     1 
ATOM   5888  C  CA    . ARG I 5  397  ? 231.083 294.567 192.569 1.00 69.17  ? 397  ARG I CA    1 
ATOM   5889  C  C     . ARG I 5  397  ? 231.762 293.317 193.109 1.00 69.17  ? 397  ARG I C     1 
ATOM   5890  O  O     . ARG I 5  397  ? 231.704 292.256 192.472 1.00 69.17  ? 397  ARG I O     1 
ATOM   5891  C  CB    . ARG I 5  397  ? 232.088 295.418 191.796 1.00 69.17  ? 397  ARG I CB    1 
ATOM   5892  C  CG    . ARG I 5  397  ? 232.985 294.633 190.865 1.00 69.17  ? 397  ARG I CG    1 
ATOM   5893  C  CD    . ARG I 5  397  ? 232.191 294.046 189.715 1.00 69.17  ? 397  ARG I CD    1 
ATOM   5894  N  NE    . ARG I 5  397  ? 233.058 293.456 188.701 1.00 69.17  ? 397  ARG I NE    1 
ATOM   5895  C  CZ    . ARG I 5  397  ? 232.622 292.722 187.684 1.00 69.17  ? 397  ARG I CZ    1 
ATOM   5896  N  NH1   . ARG I 5  397  ? 231.326 292.483 187.543 1.00 69.17  ? 397  ARG I NH1   1 
ATOM   5897  N  NH2   . ARG I 5  397  ? 233.483 292.225 186.806 1.00 69.17  ? 397  ARG I NH2   1 
ATOM   5898  N  N     . THR I 5  398  ? 232.389 293.413 194.282 1.00 67.15  ? 398  THR I N     1 
ATOM   5899  C  CA    . THR I 5  398  ? 233.084 292.256 194.829 1.00 67.15  ? 398  THR I CA    1 
ATOM   5900  C  C     . THR I 5  398  ? 232.110 291.168 195.248 1.00 67.15  ? 398  THR I C     1 
ATOM   5901  O  O     . THR I 5  398  ? 232.405 289.981 195.083 1.00 67.15  ? 398  THR I O     1 
ATOM   5902  C  CB    . THR I 5  398  ? 233.955 292.664 196.016 1.00 67.15  ? 398  THR I CB    1 
ATOM   5903  O  OG1   . THR I 5  398  ? 233.141 292.795 197.187 1.00 67.15  ? 398  THR I OG1   1 
ATOM   5904  C  CG2   . THR I 5  398  ? 234.648 293.988 195.734 1.00 67.15  ? 398  THR I CG2   1 
ATOM   5905  N  N     . LYS I 5  399  ? 230.941 291.542 195.770 1.00 65.15  ? 399  LYS I N     1 
ATOM   5906  C  CA    . LYS I 5  399  ? 229.923 290.541 196.070 1.00 65.15  ? 399  LYS I CA    1 
ATOM   5907  C  C     . LYS I 5  399  ? 229.482 289.830 194.799 1.00 65.15  ? 399  LYS I C     1 
ATOM   5908  O  O     . LYS I 5  399  ? 229.381 288.599 194.761 1.00 65.15  ? 399  LYS I O     1 
ATOM   5909  C  CB    . LYS I 5  399  ? 228.730 291.195 196.764 1.00 65.15  ? 399  LYS I CB    1 
ATOM   5910  C  CG    . LYS I 5  399  ? 229.010 291.631 198.185 1.00 65.15  ? 399  LYS I CG    1 
ATOM   5911  C  CD    . LYS I 5  399  ? 227.754 292.165 198.846 1.00 65.15  ? 399  LYS I CD    1 
ATOM   5912  C  CE    . LYS I 5  399  ? 228.074 292.915 200.126 1.00 65.15  ? 399  LYS I CE    1 
ATOM   5913  N  NZ    . LYS I 5  399  ? 226.866 293.574 200.685 1.00 65.15  ? 399  LYS I NZ    1 
ATOM   5914  N  N     . ALA I 5  400  ? 229.223 290.602 193.742 1.00 63.56  ? 400  ALA I N     1 
ATOM   5915  C  CA    . ALA I 5  400  ? 228.841 290.018 192.462 1.00 63.56  ? 400  ALA I CA    1 
ATOM   5916  C  C     . ALA I 5  400  ? 229.881 289.023 191.972 1.00 63.56  ? 400  ALA I C     1 
ATOM   5917  O  O     . ALA I 5  400  ? 229.538 287.914 191.548 1.00 63.56  ? 400  ALA I O     1 
ATOM   5918  C  CB    . ALA I 5  400  ? 228.632 291.121 191.426 1.00 63.56  ? 400  ALA I CB    1 
ATOM   5919  N  N     . THR I 5  401  ? 231.161 289.384 192.045 1.00 60.14  ? 401  THR I N     1 
ATOM   5920  C  CA    . THR I 5  401  ? 232.153 288.497 191.454 1.00 60.14  ? 401  THR I CA    1 
ATOM   5921  C  C     . THR I 5  401  ? 232.454 287.290 192.335 1.00 60.14  ? 401  THR I C     1 
ATOM   5922  O  O     . THR I 5  401  ? 232.697 286.199 191.805 1.00 60.14  ? 401  THR I O     1 
ATOM   5923  C  CB    . THR I 5  401  ? 233.436 289.263 191.131 1.00 60.14  ? 401  THR I CB    1 
ATOM   5924  O  OG1   . THR I 5  401  ? 234.388 288.367 190.543 1.00 60.14  ? 401  THR I OG1   1 
ATOM   5925  C  CG2   . THR I 5  401  ? 234.026 289.883 192.369 1.00 60.14  ? 401  THR I CG2   1 
ATOM   5926  N  N     . ILE I 5  402  ? 232.406 287.429 193.663 1.00 59.55  ? 402  ILE I N     1 
ATOM   5927  C  CA    . ILE I 5  402  ? 232.580 286.243 194.496 1.00 59.55  ? 402  ILE I CA    1 
ATOM   5928  C  C     . ILE I 5  402  ? 231.397 285.302 194.319 1.00 59.55  ? 402  ILE I C     1 
ATOM   5929  O  O     . ILE I 5  402  ? 231.561 284.079 194.310 1.00 59.55  ? 402  ILE I O     1 
ATOM   5930  C  CB    . ILE I 5  402  ? 232.802 286.610 195.977 1.00 59.55  ? 402  ILE I CB    1 
ATOM   5931  C  CG1   . ILE I 5  402  ? 231.565 287.259 196.594 1.00 59.55  ? 402  ILE I CG1   1 
ATOM   5932  C  CG2   . ILE I 5  402  ? 234.012 287.504 196.141 1.00 59.55  ? 402  ILE I CG2   1 
ATOM   5933  C  CD1   . ILE I 5  402  ? 231.672 287.442 198.090 1.00 59.55  ? 402  ILE I CD1   1 
ATOM   5934  N  N     . GLU I 5  403  ? 230.195 285.850 194.136 1.00 61.31  ? 403  GLU I N     1 
ATOM   5935  C  CA    . GLU I 5  403  ? 229.038 284.992 193.908 1.00 61.31  ? 403  GLU I CA    1 
ATOM   5936  C  C     . GLU I 5  403  ? 229.134 284.292 192.561 1.00 61.31  ? 403  GLU I C     1 
ATOM   5937  O  O     . GLU I 5  403  ? 228.778 283.115 192.443 1.00 61.31  ? 403  GLU I O     1 
ATOM   5938  C  CB    . GLU I 5  403  ? 227.754 285.808 194.003 1.00 61.31  ? 403  GLU I CB    1 
ATOM   5939  C  CG    . GLU I 5  403  ? 226.549 285.126 193.405 1.00 61.31  ? 403  GLU I CG    1 
ATOM   5940  C  CD    . GLU I 5  403  ? 225.249 285.664 193.955 1.00 61.31  ? 403  GLU I CD    1 
ATOM   5941  O  OE1   . GLU I 5  403  ? 225.238 286.122 195.117 1.00 61.31  ? 403  GLU I OE1   1 
ATOM   5942  O  OE2   . GLU I 5  403  ? 224.237 285.626 193.226 1.00 61.31  ? 403  GLU I OE2   1 
ATOM   5943  N  N     . LEU I 5  404  ? 229.627 284.988 191.537 1.00 55.85  ? 404  LEU I N     1 
ATOM   5944  C  CA    . LEU I 5  404  ? 229.832 284.344 190.245 1.00 55.85  ? 404  LEU I CA    1 
ATOM   5945  C  C     . LEU I 5  404  ? 230.832 283.201 190.355 1.00 55.85  ? 404  LEU I C     1 
ATOM   5946  O  O     . LEU I 5  404  ? 230.590 282.096 189.852 1.00 55.85  ? 404  LEU I O     1 
ATOM   5947  C  CB    . LEU I 5  404  ? 230.302 285.367 189.213 1.00 55.85  ? 404  LEU I CB    1 
ATOM   5948  C  CG    . LEU I 5  404  ? 230.932 284.731 187.974 1.00 55.85  ? 404  LEU I CG    1 
ATOM   5949  C  CD1   . LEU I 5  404  ? 229.876 284.072 187.111 1.00 55.85  ? 404  LEU I CD1   1 
ATOM   5950  C  CD2   . LEU I 5  404  ? 231.717 285.747 187.172 1.00 55.85  ? 404  LEU I CD2   1 
ATOM   5951  N  N     . LYS I 5  405  ? 231.967 283.447 191.010 1.00 54.71  ? 405  LYS I N     1 
ATOM   5952  C  CA    . LYS I 5  405  ? 232.974 282.399 191.136 1.00 54.71  ? 405  LYS I CA    1 
ATOM   5953  C  C     . LYS I 5  405  ? 232.466 281.232 191.972 1.00 54.71  ? 405  LYS I C     1 
ATOM   5954  O  O     . LYS I 5  405  ? 232.796 280.076 191.686 1.00 54.71  ? 405  LYS I O     1 
ATOM   5955  C  CB    . LYS I 5  405  ? 234.252 282.973 191.739 1.00 54.71  ? 405  LYS I CB    1 
ATOM   5956  C  CG    . LYS I 5  405  ? 234.861 284.115 190.942 1.00 54.71  ? 405  LYS I CG    1 
ATOM   5957  C  CD    . LYS I 5  405  ? 236.131 284.623 191.605 1.00 54.71  ? 405  LYS I CD    1 
ATOM   5958  C  CE    . LYS I 5  405  ? 237.077 285.282 190.610 1.00 54.71  ? 405  LYS I CE    1 
ATOM   5959  N  NZ    . LYS I 5  405  ? 237.536 284.366 189.533 1.00 54.71  ? 405  LYS I NZ    1 
ATOM   5960  N  N     . ALA I 5  406  ? 231.656 281.511 192.992 1.00 54.16  ? 406  ALA I N     1 
ATOM   5961  C  CA    . ALA I 5  406  ? 231.033 280.447 193.769 1.00 54.16  ? 406  ALA I CA    1 
ATOM   5962  C  C     . ALA I 5  406  ? 230.129 279.590 192.894 1.00 54.16  ? 406  ALA I C     1 
ATOM   5963  O  O     . ALA I 5  406  ? 230.210 278.358 192.912 1.00 54.16  ? 406  ALA I O     1 
ATOM   5964  C  CB    . ALA I 5  406  ? 230.249 281.044 194.937 1.00 54.16  ? 406  ALA I CB    1 
ATOM   5965  N  N     . LEU I 5  407  ? 229.202 280.229 192.177 1.00 55.40  ? 407  LEU I N     1 
ATOM   5966  C  CA    . LEU I 5  407  ? 228.338 279.490 191.266 1.00 55.40  ? 407  LEU I CA    1 
ATOM   5967  C  C     . LEU I 5  407  ? 229.138 278.669 190.267 1.00 55.40  ? 407  LEU I C     1 
ATOM   5968  O  O     . LEU I 5  407  ? 228.715 277.570 189.890 1.00 55.40  ? 407  LEU I O     1 
ATOM   5969  C  CB    . LEU I 5  407  ? 227.403 280.445 190.535 1.00 55.40  ? 407  LEU I CB    1 
ATOM   5970  C  CG    . LEU I 5  407  ? 226.482 281.235 191.456 1.00 55.40  ? 407  LEU I CG    1 
ATOM   5971  C  CD1   . LEU I 5  407  ? 225.506 282.047 190.647 1.00 55.40  ? 407  LEU I CD1   1 
ATOM   5972  C  CD2   . LEU I 5  407  ? 225.759 280.296 192.397 1.00 55.40  ? 407  LEU I CD2   1 
ATOM   5973  N  N     . ARG I 5  408  ? 230.292 279.159 189.819 1.00 55.22  ? 408  ARG I N     1 
ATOM   5974  C  CA    . ARG I 5  408  ? 231.132 278.370 188.881 1.00 55.22  ? 408  ARG I CA    1 
ATOM   5975  C  C     . ARG I 5  408  ? 231.736 277.168 189.604 1.00 55.22  ? 408  ARG I C     1 
ATOM   5976  O  O     . ARG I 5  408  ? 231.743 276.081 189.012 1.00 55.22  ? 408  ARG I O     1 
ATOM   5977  C  CB    . ARG I 5  408  ? 232.216 279.240 188.244 1.00 55.22  ? 408  ARG I CB    1 
ATOM   5978  C  CG    . ARG I 5  408  ? 231.685 280.257 187.247 1.00 55.22  ? 408  ARG I CG    1 
ATOM   5979  C  CD    . ARG I 5  408  ? 232.814 280.950 186.511 1.00 55.22  ? 408  ARG I CD    1 
ATOM   5980  N  NE    . ARG I 5  408  ? 232.327 282.001 185.631 1.00 55.22  ? 408  ARG I NE    1 
ATOM   5981  C  CZ    . ARG I 5  408  ? 231.695 281.787 184.484 1.00 55.22  ? 408  ARG I CZ    1 
ATOM   5982  N  NH1   . ARG I 5  408  ? 231.291 282.810 183.750 1.00 55.22  ? 408  ARG I NH1   1 
ATOM   5983  N  NH2   . ARG I 5  408  ? 231.466 280.553 184.075 1.00 55.22  ? 408  ARG I NH2   1 
ATOM   5984  N  N     . LEU I 5  409  ? 232.187 277.346 190.846 1.00 51.97  ? 409  LEU I N     1 
ATOM   5985  C  CA    . LEU I 5  409  ? 232.833 276.268 191.582 1.00 51.97  ? 409  LEU I CA    1 
ATOM   5986  C  C     . LEU I 5  409  ? 231.852 275.450 192.410 1.00 51.97  ? 409  LEU I C     1 
ATOM   5987  O  O     . LEU I 5  409  ? 232.275 274.736 193.323 1.00 51.97  ? 409  LEU I O     1 
ATOM   5988  C  CB    . LEU I 5  409  ? 233.925 276.832 192.489 1.00 51.97  ? 409  LEU I CB    1 
ATOM   5989  C  CG    . LEU I 5  409  ? 235.168 277.367 191.787 1.00 51.97  ? 409  LEU I CG    1 
ATOM   5990  C  CD1   . LEU I 5  409  ? 236.275 277.509 192.786 1.00 51.97  ? 409  LEU I CD1   1 
ATOM   5991  C  CD2   . LEU I 5  409  ? 235.583 276.448 190.659 1.00 51.97  ? 409  LEU I CD2   1 
ATOM   5992  N  N     . LEU I 5  410  ? 230.555 275.575 192.145 1.00 50.39  ? 410  LEU I N     1 
ATOM   5993  C  CA    . LEU I 5  410  ? 229.586 274.735 192.844 1.00 50.39  ? 410  LEU I CA    1 
ATOM   5994  C  C     . LEU I 5  410  ? 229.815 273.257 192.559 1.00 50.39  ? 410  LEU I C     1 
ATOM   5995  O  O     . LEU I 5  410  ? 229.712 272.423 193.465 1.00 50.39  ? 410  LEU I O     1 
ATOM   5996  C  CB    . LEU I 5  410  ? 228.164 275.132 192.458 1.00 50.39  ? 410  LEU I CB    1 
ATOM   5997  C  CG    . LEU I 5  410  ? 227.043 274.338 193.130 1.00 50.39  ? 410  LEU I CG    1 
ATOM   5998  C  CD1   . LEU I 5  410  ? 227.278 274.192 194.621 1.00 50.39  ? 410  LEU I CD1   1 
ATOM   5999  C  CD2   . LEU I 5  410  ? 225.715 275.008 192.875 1.00 50.39  ? 410  LEU I CD2   1 
ATOM   6000  N  N     . ASN I 5  411  ? 230.122 272.907 191.310 1.00 49.24  ? 411  ASN I N     1 
ATOM   6001  C  CA    . ASN I 5  411  ? 230.351 271.504 190.991 1.00 49.24  ? 411  ASN I CA    1 
ATOM   6002  C  C     . ASN I 5  411  ? 231.640 270.977 191.600 1.00 49.24  ? 411  ASN I C     1 
ATOM   6003  O  O     . ASN I 5  411  ? 231.794 269.762 191.736 1.00 49.24  ? 411  ASN I O     1 
ATOM   6004  C  CB    . ASN I 5  411  ? 230.375 271.296 189.480 1.00 49.24  ? 411  ASN I CB    1 
ATOM   6005  C  CG    . ASN I 5  411  ? 229.001 271.017 188.910 1.00 49.24  ? 411  ASN I CG    1 
ATOM   6006  O  OD1   . ASN I 5  411  ? 228.159 270.405 189.567 1.00 49.24  ? 411  ASN I OD1   1 
ATOM   6007  N  ND2   . ASN I 5  411  ? 228.770 271.455 187.679 1.00 49.24  ? 411  ASN I ND2   1 
ATOM   6008  N  N     . PHE I 5  412  ? 232.566 271.860 191.961 1.00 46.82  ? 412  PHE I N     1 
ATOM   6009  C  CA    . PHE I 5  412  ? 233.773 271.443 192.661 1.00 46.82  ? 412  PHE I CA    1 
ATOM   6010  C  C     . PHE I 5  412  ? 233.520 271.317 194.156 1.00 46.82  ? 412  PHE I C     1 
ATOM   6011  O  O     . PHE I 5  412  ? 234.019 270.387 194.804 1.00 46.82  ? 412  PHE I O     1 
ATOM   6012  C  CB    . PHE I 5  412  ? 234.894 272.439 192.372 1.00 46.82  ? 412  PHE I CB    1 
ATOM   6013  C  CG    . PHE I 5  412  ? 236.181 272.125 193.064 1.00 46.82  ? 412  PHE I CG    1 
ATOM   6014  C  CD1   . PHE I 5  412  ? 237.067 271.212 192.536 1.00 46.82  ? 412  PHE I CD1   1 
ATOM   6015  C  CD2   . PHE I 5  412  ? 236.515 272.762 194.238 1.00 46.82  ? 412  PHE I CD2   1 
ATOM   6016  C  CE1   . PHE I 5  412  ? 238.250 270.934 193.174 1.00 46.82  ? 412  PHE I CE1   1 
ATOM   6017  C  CE2   . PHE I 5  412  ? 237.692 272.485 194.877 1.00 46.82  ? 412  PHE I CE2   1 
ATOM   6018  C  CZ    . PHE I 5  412  ? 238.561 271.574 194.346 1.00 46.82  ? 412  PHE I CZ    1 
ATOM   6019  N  N     . GLN I 5  413  ? 232.746 272.247 194.712 1.00 44.49  ? 413  GLN I N     1 
ATOM   6020  C  CA    . GLN I 5  413  ? 232.344 272.137 196.106 1.00 44.49  ? 413  GLN I CA    1 
ATOM   6021  C  C     . GLN I 5  413  ? 231.551 270.867 196.345 1.00 44.49  ? 413  GLN I C     1 
ATOM   6022  O  O     . GLN I 5  413  ? 231.696 270.231 197.390 1.00 44.49  ? 413  GLN I O     1 
ATOM   6023  C  CB    . GLN I 5  413  ? 231.516 273.347 196.521 1.00 44.49  ? 413  GLN I CB    1 
ATOM   6024  C  CG    . GLN I 5  413  ? 231.317 273.444 198.011 1.00 44.49  ? 413  GLN I CG    1 
ATOM   6025  C  CD    . GLN I 5  413  ? 230.216 274.394 198.385 1.00 44.49  ? 413  GLN I CD    1 
ATOM   6026  O  OE1   . GLN I 5  413  ? 229.356 274.711 197.573 1.00 44.49  ? 413  GLN I OE1   1 
ATOM   6027  N  NE2   . GLN I 5  413  ? 230.228 274.849 199.627 1.00 44.49  ? 413  GLN I NE2   1 
ATOM   6028  N  N     . ARG I 5  414  ? 230.694 270.491 195.398 1.00 47.99  ? 414  ARG I N     1 
ATOM   6029  C  CA    . ARG I 5  414  ? 229.913 269.270 195.553 1.00 47.99  ? 414  ARG I CA    1 
ATOM   6030  C  C     . ARG I 5  414  ? 230.824 268.059 195.673 1.00 47.99  ? 414  ARG I C     1 
ATOM   6031  O  O     . ARG I 5  414  ? 230.621 267.196 196.533 1.00 47.99  ? 414  ARG I O     1 
ATOM   6032  C  CB    . ARG I 5  414  ? 228.961 269.109 194.374 1.00 47.99  ? 414  ARG I CB    1 
ATOM   6033  C  CG    . ARG I 5  414  ? 227.588 269.676 194.630 1.00 47.99  ? 414  ARG I CG    1 
ATOM   6034  C  CD    . ARG I 5  414  ? 226.527 268.866 193.928 1.00 47.99  ? 414  ARG I CD    1 
ATOM   6035  N  NE    . ARG I 5  414  ? 225.325 269.655 193.708 1.00 47.99  ? 414  ARG I NE    1 
ATOM   6036  C  CZ    . ARG I 5  414  ? 225.114 270.391 192.626 1.00 47.99  ? 414  ARG I CZ    1 
ATOM   6037  N  NH1   . ARG I 5  414  ? 226.027 270.433 191.666 1.00 47.99  ? 414  ARG I NH1   1 
ATOM   6038  N  NH2   . ARG I 5  414  ? 223.991 271.084 192.501 1.00 47.99  ? 414  ARG I NH2   1 
ATOM   6039  N  N     . GLN I 5  415  ? 231.838 267.990 194.814 1.00 47.24  ? 415  GLN I N     1 
ATOM   6040  C  CA    . GLN I 5  415  ? 232.770 266.872 194.836 1.00 47.24  ? 415  GLN I CA    1 
ATOM   6041  C  C     . GLN I 5  415  ? 233.543 266.832 196.143 1.00 47.24  ? 415  GLN I C     1 
ATOM   6042  O  O     . GLN I 5  415  ? 233.675 265.772 196.768 1.00 47.24  ? 415  GLN I O     1 
ATOM   6043  C  CB    . GLN I 5  415  ? 233.719 266.985 193.648 1.00 47.24  ? 415  GLN I CB    1 
ATOM   6044  C  CG    . GLN I 5  415  ? 234.462 265.722 193.314 1.00 47.24  ? 415  GLN I CG    1 
ATOM   6045  C  CD    . GLN I 5  415  ? 234.714 265.599 191.829 1.00 47.24  ? 415  GLN I CD    1 
ATOM   6046  O  OE1   . GLN I 5  415  ? 234.005 266.200 191.020 1.00 47.24  ? 415  GLN I OE1   1 
ATOM   6047  N  NE2   . GLN I 5  415  ? 235.729 264.826 191.460 1.00 47.24  ? 415  GLN I NE2   1 
ATOM   6048  N  N     . LEU I 5  416  ? 234.077 267.980 196.568 1.00 45.11  ? 416  LEU I N     1 
ATOM   6049  C  CA    . LEU I 5  416  ? 234.760 268.052 197.856 1.00 45.11  ? 416  LEU I CA    1 
ATOM   6050  C  C     . LEU I 5  416  ? 233.868 267.587 198.995 1.00 45.11  ? 416  LEU I C     1 
ATOM   6051  O  O     . LEU I 5  416  ? 234.273 266.763 199.821 1.00 45.11  ? 416  LEU I O     1 
ATOM   6052  C  CB    . LEU I 5  416  ? 235.254 269.474 198.115 1.00 45.11  ? 416  LEU I CB    1 
ATOM   6053  C  CG    . LEU I 5  416  ? 236.719 269.721 197.794 1.00 45.11  ? 416  LEU I CG    1 
ATOM   6054  C  CD1   . LEU I 5  416  ? 237.562 269.008 198.823 1.00 45.11  ? 416  LEU I CD1   1 
ATOM   6055  C  CD2   . LEU I 5  416  ? 237.044 269.203 196.412 1.00 45.11  ? 416  LEU I CD2   1 
ATOM   6056  N  N     . ARG I 5  417  ? 232.664 268.145 199.082 1.00 45.57  ? 417  ARG I N     1 
ATOM   6057  C  CA    . ARG I 5  417  ? 231.763 267.781 200.161 1.00 45.57  ? 417  ARG I CA    1 
ATOM   6058  C  C     . ARG I 5  417  ? 231.479 266.292 200.157 1.00 45.57  ? 417  ARG I C     1 
ATOM   6059  O  O     . ARG I 5  417  ? 231.566 265.642 201.200 1.00 45.57  ? 417  ARG I O     1 
ATOM   6060  C  CB    . ARG I 5  417  ? 230.459 268.565 200.053 1.00 45.57  ? 417  ARG I CB    1 
ATOM   6061  C  CG    . ARG I 5  417  ? 230.612 270.052 200.189 1.00 45.57  ? 417  ARG I CG    1 
ATOM   6062  C  CD    . ARG I 5  417  ? 229.282 270.732 200.007 1.00 45.57  ? 417  ARG I CD    1 
ATOM   6063  N  NE    . ARG I 5  417  ? 229.073 271.773 200.999 1.00 45.57  ? 417  ARG I NE    1 
ATOM   6064  C  CZ    . ARG I 5  417  ? 228.036 272.596 201.000 1.00 45.57  ? 417  ARG I CZ    1 
ATOM   6065  N  NH1   . ARG I 5  417  ? 227.112 272.497 200.059 1.00 45.57  ? 417  ARG I NH1   1 
ATOM   6066  N  NH2   . ARG I 5  417  ? 227.925 273.521 201.940 1.00 45.57  ? 417  ARG I NH2   1 
ATOM   6067  N  N     . GLN I 5  418  ? 231.162 265.723 198.996 1.00 47.57  ? 418  GLN I N     1 
ATOM   6068  C  CA    . GLN I 5  418  ? 230.774 264.321 198.994 1.00 47.57  ? 418  GLN I CA    1 
ATOM   6069  C  C     . GLN I 5  418  ? 231.960 263.422 199.299 1.00 47.57  ? 418  GLN I C     1 
ATOM   6070  O  O     . GLN I 5  418  ? 231.800 262.409 199.982 1.00 47.57  ? 418  GLN I O     1 
ATOM   6071  C  CB    . GLN I 5  418  ? 230.117 263.949 197.665 1.00 47.57  ? 418  GLN I CB    1 
ATOM   6072  C  CG    . GLN I 5  418  ? 231.059 263.831 196.492 1.00 47.57  ? 418  GLN I CG    1 
ATOM   6073  C  CD    . GLN I 5  418  ? 231.495 262.406 196.247 1.00 47.57  ? 418  GLN I CD    1 
ATOM   6074  O  OE1   . GLN I 5  418  ? 231.062 261.489 196.942 1.00 47.57  ? 418  GLN I OE1   1 
ATOM   6075  N  NE2   . GLN I 5  418  ? 232.352 262.209 195.252 1.00 47.57  ? 418  GLN I NE2   1 
ATOM   6076  N  N     . GLU I 5  419  ? 233.163 263.810 198.881 1.00 47.31  ? 419  GLU I N     1 
ATOM   6077  C  CA    . GLU I 5  419  ? 234.346 263.027 199.219 1.00 47.31  ? 419  GLU I CA    1 
ATOM   6078  C  C     . GLU I 5  419  ? 234.615 263.052 200.719 1.00 47.31  ? 419  GLU I C     1 
ATOM   6079  O  O     . GLU I 5  419  ? 234.769 261.998 201.355 1.00 47.31  ? 419  GLU I O     1 
ATOM   6080  C  CB    . GLU I 5  419  ? 235.544 263.560 198.442 1.00 47.31  ? 419  GLU I CB    1 
ATOM   6081  C  CG    . GLU I 5  419  ? 236.875 263.299 199.083 1.00 47.31  ? 419  GLU I CG    1 
ATOM   6082  C  CD    . GLU I 5  419  ? 238.016 263.615 198.147 1.00 47.31  ? 419  GLU I CD    1 
ATOM   6083  O  OE1   . GLU I 5  419  ? 237.812 264.438 197.232 1.00 47.31  ? 419  GLU I OE1   1 
ATOM   6084  O  OE2   . GLU I 5  419  ? 239.111 263.041 198.318 1.00 47.31  ? 419  GLU I OE2   1 
ATOM   6085  N  N     . VAL I 5  420  ? 234.676 264.248 201.305 1.00 44.02  ? 420  VAL I N     1 
ATOM   6086  C  CA    . VAL I 5  420  ? 234.945 264.351 202.735 1.00 44.02  ? 420  VAL I CA    1 
ATOM   6087  C  C     . VAL I 5  420  ? 233.861 263.645 203.535 1.00 44.02  ? 420  VAL I C     1 
ATOM   6088  O  O     . VAL I 5  420  ? 234.143 262.978 204.538 1.00 44.02  ? 420  VAL I O     1 
ATOM   6089  C  CB    . VAL I 5  420  ? 235.087 265.824 203.148 1.00 44.02  ? 420  VAL I CB    1 
ATOM   6090  C  CG1   . VAL I 5  420  ? 235.370 265.927 204.626 1.00 44.02  ? 420  VAL I CG1   1 
ATOM   6091  C  CG2   . VAL I 5  420  ? 236.190 266.483 202.356 1.00 44.02  ? 420  VAL I CG2   1 
ATOM   6092  N  N     . VAL I 5  421  ? 232.609 263.739 203.084 1.00 45.67  ? 421  VAL I N     1 
ATOM   6093  C  CA    . VAL I 5  421  ? 231.514 263.145 203.839 1.00 45.67  ? 421  VAL I CA    1 
ATOM   6094  C  C     . VAL I 5  421  ? 231.539 261.630 203.741 1.00 45.67  ? 421  VAL I C     1 
ATOM   6095  O  O     . VAL I 5  421  ? 231.294 260.942 204.731 1.00 45.67  ? 421  VAL I O     1 
ATOM   6096  C  CB    . VAL I 5  421  ? 230.164 263.720 203.385 1.00 45.67  ? 421  VAL I CB    1 
ATOM   6097  C  CG1   . VAL I 5  421  ? 229.036 262.979 204.056 1.00 45.67  ? 421  VAL I CG1   1 
ATOM   6098  C  CG2   . VAL I 5  421  ? 230.075 265.176 203.775 1.00 45.67  ? 421  VAL I CG2   1 
ATOM   6099  N  N     . VAL I 5  422  ? 231.844 261.071 202.567 1.00 45.55  ? 422  VAL I N     1 
ATOM   6100  C  CA    . VAL I 5  422  ? 231.872 259.616 202.488 1.00 45.55  ? 422  VAL I CA    1 
ATOM   6101  C  C     . VAL I 5  422  ? 233.029 259.066 203.305 1.00 45.55  ? 422  VAL I C     1 
ATOM   6102  O  O     . VAL I 5  422  ? 232.886 258.046 203.989 1.00 45.55  ? 422  VAL I O     1 
ATOM   6103  C  CB    . VAL I 5  422  ? 231.910 259.125 201.029 1.00 45.55  ? 422  VAL I CB    1 
ATOM   6104  C  CG1   . VAL I 5  422  ? 230.673 259.584 200.284 1.00 45.55  ? 422  VAL I CG1   1 
ATOM   6105  C  CG2   . VAL I 5  422  ? 233.164 259.575 200.320 1.00 45.55  ? 422  VAL I CG2   1 
ATOM   6106  N  N     . CYS I 5  423  ? 234.177 259.750 203.298 1.00 47.41  ? 423  CYS I N     1 
ATOM   6107  C  CA    . CYS I 5  423  ? 235.292 259.248 204.097 1.00 47.41  ? 423  CYS I CA    1 
ATOM   6108  C  C     . CYS I 5  423  ? 235.004 259.359 205.590 1.00 47.41  ? 423  CYS I C     1 
ATOM   6109  O  O     . CYS I 5  423  ? 235.281 258.423 206.351 1.00 47.41  ? 423  CYS I O     1 
ATOM   6110  C  CB    . CYS I 5  423  ? 236.578 259.979 203.733 1.00 47.41  ? 423  CYS I CB    1 
ATOM   6111  S  SG    . CYS I 5  423  ? 236.953 259.939 201.972 1.00 47.41  ? 423  CYS I SG    1 
ATOM   6112  N  N     . MET I 5  424  ? 234.415 260.470 206.029 1.00 45.13  ? 424  MET I N     1 
ATOM   6113  C  CA    . MET I 5  424  ? 234.106 260.599 207.444 1.00 45.13  ? 424  MET I CA    1 
ATOM   6114  C  C     . MET I 5  424  ? 232.942 259.722 207.868 1.00 45.13  ? 424  MET I C     1 
ATOM   6115  O  O     . MET I 5  424  ? 232.850 259.372 209.045 1.00 45.13  ? 424  MET I O     1 
ATOM   6116  C  CB    . MET I 5  424  ? 233.805 262.053 207.789 1.00 45.13  ? 424  MET I CB    1 
ATOM   6117  C  CG    . MET I 5  424  ? 233.935 262.361 209.261 1.00 45.13  ? 424  MET I CG    1 
ATOM   6118  S  SD    . MET I 5  424  ? 235.560 261.941 209.898 1.00 45.13  ? 424  MET I SD    1 
ATOM   6119  C  CE    . MET I 5  424  ? 235.440 262.623 211.540 1.00 45.13  ? 424  MET I CE    1 
ATOM   6120  N  N     . ARG I 5  425  ? 232.054 259.351 206.950 1.00 47.15  ? 425  ARG I N     1 
ATOM   6121  C  CA    . ARG I 5  425  ? 230.966 258.459 207.320 1.00 47.15  ? 425  ARG I CA    1 
ATOM   6122  C  C     . ARG I 5  425  ? 231.467 257.034 207.441 1.00 47.15  ? 425  ARG I C     1 
ATOM   6123  O  O     . ARG I 5  425  ? 231.084 256.309 208.363 1.00 47.15  ? 425  ARG I O     1 
ATOM   6124  C  CB    . ARG I 5  425  ? 229.833 258.549 206.300 1.00 47.15  ? 425  ARG I CB    1 
ATOM   6125  C  CG    . ARG I 5  425  ? 228.456 258.535 206.932 1.00 47.15  ? 425  ARG I CG    1 
ATOM   6126  C  CD    . ARG I 5  425  ? 227.373 258.207 205.930 1.00 47.15  ? 425  ARG I CD    1 
ATOM   6127  N  NE    . ARG I 5  425  ? 227.098 259.324 205.038 1.00 47.15  ? 425  ARG I NE    1 
ATOM   6128  C  CZ    . ARG I 5  425  ? 227.407 259.332 203.747 1.00 47.15  ? 425  ARG I CZ    1 
ATOM   6129  N  NH1   . ARG I 5  425  ? 227.999 258.281 203.200 1.00 47.15  ? 425  ARG I NH1   1 
ATOM   6130  N  NH2   . ARG I 5  425  ? 227.124 260.392 203.003 1.00 47.15  ? 425  ARG I NH2   1 
ATOM   6131  N  N     . ARG I 5  426  ? 232.321 256.615 206.505 1.00 49.31  ? 426  ARG I N     1 
ATOM   6132  C  CA    . ARG I 5  426  ? 232.987 255.328 206.639 1.00 49.31  ? 426  ARG I CA    1 
ATOM   6133  C  C     . ARG I 5  426  ? 233.785 255.253 207.932 1.00 49.31  ? 426  ARG I C     1 
ATOM   6134  O  O     . ARG I 5  426  ? 233.789 254.221 208.609 1.00 49.31  ? 426  ARG I O     1 
ATOM   6135  C  CB    . ARG I 5  426  ? 233.896 255.093 205.440 1.00 49.31  ? 426  ARG I CB    1 
ATOM   6136  C  CG    . ARG I 5  426  ? 234.451 253.694 205.343 1.00 49.31  ? 426  ARG I CG    1 
ATOM   6137  C  CD    . ARG I 5  426  ? 235.701 253.717 204.506 1.00 49.31  ? 426  ARG I CD    1 
ATOM   6138  N  NE    . ARG I 5  426  ? 236.545 254.842 204.893 1.00 49.31  ? 426  ARG I NE    1 
ATOM   6139  C  CZ    . ARG I 5  426  ? 237.520 255.337 204.144 1.00 49.31  ? 426  ARG I CZ    1 
ATOM   6140  N  NH1   . ARG I 5  426  ? 237.776 254.812 202.954 1.00 49.31  ? 426  ARG I NH1   1 
ATOM   6141  N  NH2   . ARG I 5  426  ? 238.234 256.364 204.583 1.00 49.31  ? 426  ARG I NH2   1 
ATOM   6142  N  N     . ASP I 5  427  ? 234.465 256.343 208.295 1.00 47.93  ? 427  ASP I N     1 
ATOM   6143  C  CA    . ASP I 5  427  ? 235.335 256.302 209.466 1.00 47.93  ? 427  ASP I CA    1 
ATOM   6144  C  C     . ASP I 5  427  ? 234.558 256.365 210.772 1.00 47.93  ? 427  ASP I C     1 
ATOM   6145  O  O     . ASP I 5  427  ? 234.982 255.768 211.765 1.00 47.93  ? 427  ASP I O     1 
ATOM   6146  C  CB    . ASP I 5  427  ? 236.346 257.442 209.406 1.00 47.93  ? 427  ASP I CB    1 
ATOM   6147  C  CG    . ASP I 5  427  ? 237.460 257.174 208.424 1.00 47.93  ? 427  ASP I CG    1 
ATOM   6148  O  OD1   . ASP I 5  427  ? 237.682 255.993 208.091 1.00 47.93  ? 427  ASP I OD1   1 
ATOM   6149  O  OD2   . ASP I 5  427  ? 238.116 258.142 207.985 1.00 47.93  ? 427  ASP I OD2   1 
ATOM   6150  N  N     . THR I 5  428  ? 233.434 257.073 210.803 1.00 45.01  ? 428  THR I N     1 
ATOM   6151  C  CA    . THR I 5  428  ? 232.722 257.335 212.045 1.00 45.01  ? 428  THR I CA    1 
ATOM   6152  C  C     . THR I 5  428  ? 231.583 256.357 212.292 1.00 45.01  ? 428  THR I C     1 
ATOM   6153  O  O     . THR I 5  428  ? 230.659 256.671 213.046 1.00 45.01  ? 428  THR I O     1 
ATOM   6154  C  CB    . THR I 5  428  ? 232.185 258.763 212.053 1.00 45.01  ? 428  THR I CB    1 
ATOM   6155  O  OG1   . THR I 5  428  ? 231.534 259.028 210.807 1.00 45.01  ? 428  THR I OG1   1 
ATOM   6156  C  CG2   . THR I 5  428  ? 233.318 259.742 212.226 1.00 45.01  ? 428  THR I CG2   1 
ATOM   6157  N  N     . ALA I 5  429  ? 231.629 255.180 211.678 1.00 47.07  ? 429  ALA I N     1 
ATOM   6158  C  CA    . ALA I 5  429  ? 230.584 254.176 211.820 1.00 47.07  ? 429  ALA I CA    1 
ATOM   6159  C  C     . ALA I 5  429  ? 231.197 252.929 212.430 1.00 47.07  ? 429  ALA I C     1 
ATOM   6160  O  O     . ALA I 5  429  ? 232.102 252.328 211.841 1.00 47.07  ? 429  ALA I O     1 
ATOM   6161  C  CB    . ALA I 5  429  ? 229.944 253.855 210.470 1.00 47.07  ? 429  ALA I CB    1 
ATOM   6162  N  N     . LEU I 5  430  ? 230.711 252.545 213.608 1.00 46.45  ? 430  LEU I N     1 
ATOM   6163  C  CA    . LEU I 5  430  ? 231.279 251.405 214.314 1.00 46.45  ? 430  LEU I CA    1 
ATOM   6164  C  C     . LEU I 5  430  ? 231.058 250.124 213.531 1.00 46.45  ? 430  LEU I C     1 
ATOM   6165  O  O     . LEU I 5  430  ? 229.927 249.777 213.188 1.00 46.45  ? 430  LEU I O     1 
ATOM   6166  C  CB    . LEU I 5  430  ? 230.658 251.276 215.701 1.00 46.45  ? 430  LEU I CB    1 
ATOM   6167  C  CG    . LEU I 5  430  ? 230.833 252.438 216.669 1.00 46.45  ? 430  LEU I CG    1 
ATOM   6168  C  CD1   . LEU I 5  430  ? 229.662 252.470 217.605 1.00 46.45  ? 430  LEU I CD1   1 
ATOM   6169  C  CD2   . LEU I 5  430  ? 232.117 252.302 217.453 1.00 46.45  ? 430  LEU I CD2   1 
ATOM   6170  N  N     . GLU I 5  431  ? 232.149 249.414 213.252 1.00 52.92  ? 431  GLU I N     1 
ATOM   6171  C  CA    . GLU I 5  431  ? 232.031 248.115 212.606 1.00 52.92  ? 431  GLU I CA    1 
ATOM   6172  C  C     . GLU I 5  431  ? 231.389 247.101 213.538 1.00 52.92  ? 431  GLU I C     1 
ATOM   6173  O  O     . GLU I 5  431  ? 230.530 246.317 213.119 1.00 52.92  ? 431  GLU I O     1 
ATOM   6174  C  CB    . GLU I 5  431  ? 233.406 247.629 212.153 1.00 52.92  ? 431  GLU I CB    1 
ATOM   6175  C  CG    . GLU I 5  431  ? 233.393 246.264 211.498 1.00 52.92  ? 431  GLU I CG    1 
ATOM   6176  C  CD    . GLU I 5  431  ? 232.637 246.250 210.190 1.00 52.92  ? 431  GLU I CD    1 
ATOM   6177  O  OE1   . GLU I 5  431  ? 232.551 247.312 209.540 1.00 52.92  ? 431  GLU I OE1   1 
ATOM   6178  O  OE2   . GLU I 5  431  ? 232.127 245.175 209.813 1.00 52.92  ? 431  GLU I OE2   1 
ATOM   6179  N  N     . THR I 5  432  ? 231.778 247.113 214.806 1.00 49.99  ? 432  THR I N     1 
ATOM   6180  C  CA    . THR I 5  432  ? 231.248 246.178 215.787 1.00 49.99  ? 432  THR I CA    1 
ATOM   6181  C  C     . THR I 5  432  ? 229.803 246.457 216.159 1.00 49.99  ? 432  THR I C     1 
ATOM   6182  O  O     . THR I 5  432  ? 229.278 245.779 217.046 1.00 49.99  ? 432  THR I O     1 
ATOM   6183  C  CB    . THR I 5  432  ? 232.115 246.205 217.043 1.00 49.99  ? 432  THR I CB    1 
ATOM   6184  O  OG1   . THR I 5  432  ? 231.933 247.452 217.719 1.00 49.99  ? 432  THR I OG1   1 
ATOM   6185  C  CG2   . THR I 5  432  ? 233.571 246.059 216.667 1.00 49.99  ? 432  THR I CG2   1 
ATOM   6186  N  N     . ALA I 5  433  ? 229.151 247.427 215.526 1.00 52.13  ? 433  ALA I N     1 
ATOM   6187  C  CA    . ALA I 5  433  ? 227.756 247.733 215.805 1.00 52.13  ? 433  ALA I CA    1 
ATOM   6188  C  C     . ALA I 5  433  ? 226.855 247.572 214.592 1.00 52.13  ? 433  ALA I C     1 
ATOM   6189  O  O     . ALA I 5  433  ? 225.645 247.796 214.707 1.00 52.13  ? 433  ALA I O     1 
ATOM   6190  C  CB    . ALA I 5  433  ? 227.621 249.157 216.355 1.00 52.13  ? 433  ALA I CB    1 
ATOM   6191  N  N     . LEU I 5  434  ? 227.400 247.194 213.434 1.00 55.62  ? 434  LEU I N     1 
ATOM   6192  C  CA    . LEU I 5  434  ? 226.562 246.934 212.272 1.00 55.62  ? 434  LEU I CA    1 
ATOM   6193  C  C     . LEU I 5  434  ? 225.697 245.697 212.454 1.00 55.62  ? 434  LEU I C     1 
ATOM   6194  O  O     . LEU I 5  434  ? 224.718 245.528 211.722 1.00 55.62  ? 434  LEU I O     1 
ATOM   6195  C  CB    . LEU I 5  434  ? 227.419 246.782 211.016 1.00 55.62  ? 434  LEU I CB    1 
ATOM   6196  C  CG    . LEU I 5  434  ? 228.423 247.894 210.721 1.00 55.62  ? 434  LEU I CG    1 
ATOM   6197  C  CD1   . LEU I 5  434  ? 228.983 247.737 209.322 1.00 55.62  ? 434  LEU I CD1   1 
ATOM   6198  C  CD2   . LEU I 5  434  ? 227.764 249.254 210.876 1.00 55.62  ? 434  LEU I CD2   1 
ATOM   6199  N  N     . ASN I 5  435  ? 226.045 244.833 213.386 1.00 57.57  ? 435  ASN I N     1 
ATOM   6200  C  CA    . ASN I 5  435  ? 225.257 243.654 213.718 1.00 57.57  ? 435  ASN I CA    1 
ATOM   6201  C  C     . ASN I 5  435  ? 224.937 243.567 215.200 1.00 57.57  ? 435  ASN I C     1 
ATOM   6202  O  O     . ASN I 5  435  ? 223.853 243.103 215.560 1.00 57.57  ? 435  ASN I O     1 
ATOM   6203  C  CB    . ASN I 5  435  ? 226.007 242.400 213.267 1.00 57.57  ? 435  ASN I CB    1 
ATOM   6204  C  CG    . ASN I 5  435  ? 227.492 242.489 213.539 1.00 57.57  ? 435  ASN I CG    1 
ATOM   6205  O  OD1   . ASN I 5  435  ? 227.908 242.861 214.635 1.00 57.57  ? 435  ASN I OD1   1 
ATOM   6206  N  ND2   . ASN I 5  435  ? 228.301 242.169 212.536 1.00 57.57  ? 435  ASN I ND2   1 
ATOM   6207  N  N     . ALA I 5  436  ? 225.861 243.983 216.064 1.00 55.88  ? 436  ALA I N     1 
ATOM   6208  C  CA    . ALA I 5  436  ? 225.761 244.103 217.513 1.00 55.88  ? 436  ALA I CA    1 
ATOM   6209  C  C     . ALA I 5  436  ? 225.781 242.752 218.216 1.00 55.88  ? 436  ALA I C     1 
ATOM   6210  O  O     . ALA I 5  436  ? 225.822 242.721 219.444 1.00 55.88  ? 436  ALA I O     1 
ATOM   6211  C  CB    . ALA I 5  436  ? 224.513 244.879 217.976 1.00 55.88  ? 436  ALA I CB    1 
ATOM   6212  N  N     . LYS I 5  437  ? 225.761 241.638 217.492 1.00 55.78  ? 437  LYS I N     1 
ATOM   6213  C  CA    . LYS I 5  437  ? 225.862 240.324 218.100 1.00 55.78  ? 437  LYS I CA    1 
ATOM   6214  C  C     . LYS I 5  437  ? 227.080 239.542 217.651 1.00 55.78  ? 437  LYS I C     1 
ATOM   6215  O  O     . LYS I 5  437  ? 227.419 238.545 218.293 1.00 55.78  ? 437  LYS I O     1 
ATOM   6216  C  CB    . LYS I 5  437  ? 224.605 239.494 217.806 1.00 55.78  ? 437  LYS I CB    1 
ATOM   6217  C  CG    . LYS I 5  437  ? 223.457 239.761 218.758 1.00 55.78  ? 437  LYS I CG    1 
ATOM   6218  C  CD    . LYS I 5  437  ? 222.272 238.867 218.451 1.00 55.78  ? 437  LYS I CD    1 
ATOM   6219  C  CE    . LYS I 5  437  ? 221.709 239.162 217.075 1.00 55.78  ? 437  LYS I CE    1 
ATOM   6220  N  NZ    . LYS I 5  437  ? 220.453 238.406 216.821 1.00 55.78  ? 437  LYS I NZ    1 
ATOM   6221  N  N     . ALA I 5  438  ? 227.740 239.956 216.568 1.00 52.20  ? 438  ALA I N     1 
ATOM   6222  C  CA    . ALA I 5  438  ? 228.927 239.250 216.114 1.00 52.20  ? 438  ALA I CA    1 
ATOM   6223  C  C     . ALA I 5  438  ? 230.103 239.441 217.054 1.00 52.20  ? 438  ALA I C     1 
ATOM   6224  O  O     . ALA I 5  438  ? 231.012 238.608 217.063 1.00 52.20  ? 438  ALA I O     1 
ATOM   6225  C  CB    . ALA I 5  438  ? 229.309 239.712 214.709 1.00 52.20  ? 438  ALA I CB    1 
ATOM   6226  N  N     . TYR I 5  439  ? 230.108 240.512 217.838 1.00 47.59  ? 439  TYR I N     1 
ATOM   6227  C  CA    . TYR I 5  439  ? 231.149 240.776 218.819 1.00 47.59  ? 439  TYR I CA    1 
ATOM   6228  C  C     . TYR I 5  439  ? 230.546 240.871 220.208 1.00 47.59  ? 439  TYR I C     1 
ATOM   6229  O  O     . TYR I 5  439  ? 230.911 241.724 221.014 1.00 47.59  ? 439  TYR I O     1 
ATOM   6230  C  CB    . TYR I 5  439  ? 231.922 242.043 218.474 1.00 47.59  ? 439  TYR I CB    1 
ATOM   6231  C  CG    . TYR I 5  439  ? 232.401 242.087 217.048 1.00 47.59  ? 439  TYR I CG    1 
ATOM   6232  C  CD1   . TYR I 5  439  ? 233.581 241.471 216.676 1.00 47.59  ? 439  TYR I CD1   1 
ATOM   6233  C  CD2   . TYR I 5  439  ? 231.671 242.742 216.077 1.00 47.59  ? 439  TYR I CD2   1 
ATOM   6234  C  CE1   . TYR I 5  439  ? 234.019 241.508 215.376 1.00 47.59  ? 439  TYR I CE1   1 
ATOM   6235  C  CE2   . TYR I 5  439  ? 232.099 242.787 214.777 1.00 47.59  ? 439  TYR I CE2   1 
ATOM   6236  C  CZ    . TYR I 5  439  ? 233.273 242.168 214.431 1.00 47.59  ? 439  TYR I CZ    1 
ATOM   6237  O  OH    . TYR I 5  439  ? 233.703 242.213 213.129 1.00 47.59  ? 439  TYR I OH    1 
ATOM   6238  N  N     . LYS I 5  440  ? 229.610 239.982 220.493 1.00 47.12  ? 440  LYS I N     1 
ATOM   6239  C  CA    . LYS I 5  440  ? 228.944 239.898 221.785 1.00 47.12  ? 440  LYS I CA    1 
ATOM   6240  C  C     . LYS I 5  440  ? 229.436 238.631 222.470 1.00 47.12  ? 440  LYS I C     1 
ATOM   6241  O  O     . LYS I 5  440  ? 228.951 237.535 222.181 1.00 47.12  ? 440  LYS I O     1 
ATOM   6242  C  CB    . LYS I 5  440  ? 227.433 239.888 221.604 1.00 47.12  ? 440  LYS I CB    1 
ATOM   6243  C  CG    . LYS I 5  440  ? 226.642 239.873 222.888 1.00 47.12  ? 440  LYS I CG    1 
ATOM   6244  C  CD    . LYS I 5  440  ? 225.161 239.806 222.584 1.00 47.12  ? 440  LYS I CD    1 
ATOM   6245  C  CE    . LYS I 5  440  ? 224.351 239.613 223.840 1.00 47.12  ? 440  LYS I CE    1 
ATOM   6246  N  NZ    . LYS I 5  440  ? 222.927 239.323 223.530 1.00 47.12  ? 440  LYS I NZ    1 
ATOM   6247  N  N     . ARG I 5  441  ? 230.410 238.781 223.360 1.00 48.56  ? 441  ARG I N     1 
ATOM   6248  C  CA    . ARG I 5  441  ? 230.918 237.650 224.124 1.00 48.56  ? 441  ARG I CA    1 
ATOM   6249  C  C     . ARG I 5  441  ? 229.785 236.974 224.883 1.00 48.56  ? 441  ARG I C     1 
ATOM   6250  O  O     . ARG I 5  441  ? 229.071 237.620 225.655 1.00 48.56  ? 441  ARG I O     1 
ATOM   6251  C  CB    . ARG I 5  441  ? 232.011 238.112 225.082 1.00 48.56  ? 441  ARG I CB    1 
ATOM   6252  C  CG    . ARG I 5  441  ? 232.529 237.014 225.972 1.00 48.56  ? 441  ARG I CG    1 
ATOM   6253  C  CD    . ARG I 5  441  ? 233.168 235.915 225.179 1.00 48.56  ? 441  ARG I CD    1 
ATOM   6254  N  NE    . ARG I 5  441  ? 234.342 236.379 224.461 1.00 48.56  ? 441  ARG I NE    1 
ATOM   6255  C  CZ    . ARG I 5  441  ? 235.558 236.382 224.982 1.00 48.56  ? 441  ARG I CZ    1 
ATOM   6256  N  NH1   . ARG I 5  441  ? 235.747 235.932 226.210 1.00 48.56  ? 441  ARG I NH1   1 
ATOM   6257  N  NH2   . ARG I 5  441  ? 236.583 236.811 224.270 1.00 48.56  ? 441  ARG I NH2   1 
ATOM   6258  N  N     . SER I 5  442  ? 229.625 235.677 224.658 1.00 50.07  ? 442  SER I N     1 
ATOM   6259  C  CA    . SER I 5  442  ? 228.456 234.956 225.133 1.00 50.07  ? 442  SER I CA    1 
ATOM   6260  C  C     . SER I 5  442  ? 228.539 234.681 226.626 1.00 50.07  ? 442  SER I C     1 
ATOM   6261  O  O     . SER I 5  442  ? 229.623 234.557 227.200 1.00 50.07  ? 442  SER I O     1 
ATOM   6262  C  CB    . SER I 5  442  ? 228.308 233.637 224.386 1.00 50.07  ? 442  SER I CB    1 
ATOM   6263  O  OG    . SER I 5  442  ? 227.311 232.833 224.980 1.00 50.07  ? 442  SER I OG    1 
ATOM   6264  N  N     . LYS I 5  443  ? 227.371 234.568 227.252 1.00 48.66  ? 443  LYS I N     1 
ATOM   6265  C  CA    . LYS I 5  443  ? 227.257 234.250 228.666 1.00 48.66  ? 443  LYS I CA    1 
ATOM   6266  C  C     . LYS I 5  443  ? 226.545 232.915 228.804 1.00 48.66  ? 443  LYS I C     1 
ATOM   6267  O  O     . LYS I 5  443  ? 225.410 232.765 228.342 1.00 48.66  ? 443  LYS I O     1 
ATOM   6268  C  CB    . LYS I 5  443  ? 226.497 235.338 229.420 1.00 48.66  ? 443  LYS I CB    1 
ATOM   6269  C  CG    . LYS I 5  443  ? 226.166 234.961 230.845 1.00 48.66  ? 443  LYS I CG    1 
ATOM   6270  C  CD    . LYS I 5  443  ? 227.425 234.850 231.674 1.00 48.66  ? 443  LYS I CD    1 
ATOM   6271  C  CE    . LYS I 5  443  ? 227.118 234.913 233.147 1.00 48.66  ? 443  LYS I CE    1 
ATOM   6272  N  NZ    . LYS I 5  443  ? 228.278 234.461 233.953 1.00 48.66  ? 443  LYS I NZ    1 
ATOM   6273  N  N     . ARG I 5  444  ? 227.207 231.954 229.438 1.00 60.46  ? 444  ARG I N     1 
ATOM   6274  C  CA    . ARG I 5  444  ? 226.658 230.619 229.619 1.00 60.46  ? 444  ARG I CA    1 
ATOM   6275  C  C     . ARG I 5  444  ? 226.678 230.276 231.096 1.00 60.46  ? 444  ARG I C     1 
ATOM   6276  O  O     . ARG I 5  444  ? 227.713 230.409 231.752 1.00 60.46  ? 444  ARG I O     1 
ATOM   6277  C  CB    . ARG I 5  444  ? 227.448 229.579 228.829 1.00 60.46  ? 444  ARG I CB    1 
ATOM   6278  C  CG    . ARG I 5  444  ? 227.115 229.547 227.357 1.00 60.46  ? 444  ARG I CG    1 
ATOM   6279  C  CD    . ARG I 5  444  ? 228.133 228.721 226.605 1.00 60.46  ? 444  ARG I CD    1 
ATOM   6280  N  NE    . ARG I 5  444  ? 229.414 229.408 226.504 1.00 60.46  ? 444  ARG I NE    1 
ATOM   6281  C  CZ    . ARG I 5  444  ? 230.028 229.676 225.358 1.00 60.46  ? 444  ARG I CZ    1 
ATOM   6282  N  NH1   . ARG I 5  444  ? 229.479 229.314 224.208 1.00 60.46  ? 444  ARG I NH1   1 
ATOM   6283  N  NH2   . ARG I 5  444  ? 231.192 230.307 225.363 1.00 60.46  ? 444  ARG I NH2   1 
ATOM   6284  N  N     . GLN I 5  445  ? 225.535 229.833 231.612 1.00 56.07  ? 445  GLN I N     1 
ATOM   6285  C  CA    . GLN I 5  445  ? 225.405 229.466 233.016 1.00 56.07  ? 445  GLN I CA    1 
ATOM   6286  C  C     . GLN I 5  445  ? 225.511 227.949 233.118 1.00 56.07  ? 445  GLN I C     1 
ATOM   6287  O  O     . GLN I 5  445  ? 224.517 227.228 233.165 1.00 56.07  ? 445  GLN I O     1 
ATOM   6288  C  CB    . GLN I 5  445  ? 224.089 229.978 233.579 1.00 56.07  ? 445  GLN I CB    1 
ATOM   6289  C  CG    . GLN I 5  445  ? 224.151 231.389 234.101 1.00 56.07  ? 445  GLN I CG    1 
ATOM   6290  C  CD    . GLN I 5  445  ? 222.945 231.733 234.934 1.00 56.07  ? 445  GLN I CD    1 
ATOM   6291  O  OE1   . GLN I 5  445  ? 221.892 231.114 234.800 1.00 56.07  ? 445  GLN I OE1   1 
ATOM   6292  N  NE2   . GLN I 5  445  ? 223.086 232.724 235.799 1.00 56.07  ? 445  GLN I NE2   1 
ATOM   6293  N  N     . SER I 5  446  ? 226.746 227.459 233.138 1.00 63.78  ? 446  SER I N     1 
ATOM   6294  C  CA    . SER I 5  446  ? 226.969 226.032 233.262 1.00 63.78  ? 446  SER I CA    1 
ATOM   6295  C  C     . SER I 5  446  ? 227.210 225.678 234.727 1.00 63.78  ? 446  SER I C     1 
ATOM   6296  O  O     . SER I 5  446  ? 227.247 226.539 235.606 1.00 63.78  ? 446  SER I O     1 
ATOM   6297  C  CB    . SER I 5  446  ? 228.121 225.582 232.366 1.00 63.78  ? 446  SER I CB    1 
ATOM   6298  O  OG    . SER I 5  446  ? 229.362 226.108 232.794 1.00 63.78  ? 446  SER I OG    1 
ATOM   6299  N  N     . LEU I 5  447  ? 227.377 224.385 234.991 1.00 65.90  ? 447  LEU I N     1 
ATOM   6300  C  CA    . LEU I 5  447  ? 227.372 223.885 236.362 1.00 65.90  ? 447  LEU I CA    1 
ATOM   6301  C  C     . LEU I 5  447  ? 228.728 224.063 237.035 1.00 65.90  ? 447  LEU I C     1 
ATOM   6302  O  O     . LEU I 5  447  ? 228.844 224.735 238.072 1.00 65.90  ? 447  LEU I O     1 
ATOM   6303  C  CB    . LEU I 5  447  ? 226.966 222.411 236.360 1.00 65.90  ? 447  LEU I CB    1 
ATOM   6304  C  CG    . LEU I 5  447  ? 226.559 221.789 237.690 1.00 65.90  ? 447  LEU I CG    1 
ATOM   6305  C  CD1   . LEU I 5  447  ? 225.709 222.761 238.471 1.00 65.90  ? 447  LEU I CD1   1 
ATOM   6306  C  CD2   . LEU I 5  447  ? 225.806 220.495 237.447 1.00 65.90  ? 447  LEU I CD2   1 
ATOM   6307  N  N     . ARG I 5  448  ? 229.764 223.452 236.456 1.00 74.04  ? 448  ARG I N     1 
ATOM   6308  C  CA    . ARG I 5  448  ? 231.064 223.409 237.111 1.00 74.04  ? 448  ARG I CA    1 
ATOM   6309  C  C     . ARG I 5  448  ? 231.643 224.801 237.310 1.00 74.04  ? 448  ARG I C     1 
ATOM   6310  O  O     . ARG I 5  448  ? 232.330 225.042 238.309 1.00 74.04  ? 448  ARG I O     1 
ATOM   6311  C  CB    . ARG I 5  448  ? 232.034 222.525 236.319 1.00 74.04  ? 448  ARG I CB    1 
ATOM   6312  C  CG    . ARG I 5  448  ? 232.557 223.114 235.010 1.00 74.04  ? 448  ARG I CG    1 
ATOM   6313  C  CD    . ARG I 5  448  ? 231.582 222.907 233.861 1.00 74.04  ? 448  ARG I CD    1 
ATOM   6314  N  NE    . ARG I 5  448  ? 232.182 223.222 232.569 1.00 74.04  ? 448  ARG I NE    1 
ATOM   6315  C  CZ    . ARG I 5  448  ? 231.502 223.296 231.429 1.00 74.04  ? 448  ARG I CZ    1 
ATOM   6316  N  NH1   . ARG I 5  448  ? 230.196 223.073 231.422 1.00 74.04  ? 448  ARG I NH1   1 
ATOM   6317  N  NH2   . ARG I 5  448  ? 232.126 223.589 230.296 1.00 74.04  ? 448  ARG I NH2   1 
ATOM   6318  N  N     . GLU I 5  449  ? 231.350 225.739 236.405 1.00 70.23  ? 449  GLU I N     1 
ATOM   6319  C  CA    . GLU I 5  449  ? 231.875 227.088 236.564 1.00 70.23  ? 449  GLU I CA    1 
ATOM   6320  C  C     . GLU I 5  449  ? 231.359 227.710 237.855 1.00 70.23  ? 449  GLU I C     1 
ATOM   6321  O  O     . GLU I 5  449  ? 232.144 228.094 238.730 1.00 70.23  ? 449  GLU I O     1 
ATOM   6322  C  CB    . GLU I 5  449  ? 231.523 227.954 235.349 1.00 70.23  ? 449  GLU I CB    1 
ATOM   6323  C  CG    . GLU I 5  449  ? 230.045 228.062 235.010 1.00 70.23  ? 449  GLU I CG    1 
ATOM   6324  C  CD    . GLU I 5  449  ? 229.772 229.013 233.863 1.00 70.23  ? 449  GLU I CD    1 
ATOM   6325  O  OE1   . GLU I 5  449  ? 229.364 230.163 234.132 1.00 70.23  ? 449  GLU I OE1   1 
ATOM   6326  O  OE2   . GLU I 5  449  ? 229.967 228.611 232.698 1.00 70.23  ? 449  GLU I OE2   1 
ATOM   6327  N  N     . ALA I 5  450  ? 230.035 227.797 237.996 1.00 68.58  ? 450  ALA I N     1 
ATOM   6328  C  CA    . ALA I 5  450  ? 229.423 228.279 239.228 1.00 68.58  ? 450  ALA I CA    1 
ATOM   6329  C  C     . ALA I 5  450  ? 229.994 227.561 240.443 1.00 68.58  ? 450  ALA I C     1 
ATOM   6330  O  O     . ALA I 5  450  ? 230.493 228.195 241.379 1.00 68.58  ? 450  ALA I O     1 
ATOM   6331  C  CB    . ALA I 5  450  ? 227.906 228.099 239.156 1.00 68.58  ? 450  ALA I CB    1 
ATOM   6332  N  N     . ARG I 5  451  ? 229.892 226.232 240.454 1.00 67.69  ? 451  ARG I N     1 
ATOM   6333  C  CA    . ARG I 5  451  ? 230.325 225.389 241.564 1.00 67.69  ? 451  ARG I CA    1 
ATOM   6334  C  C     . ARG I 5  451  ? 231.741 225.690 242.058 1.00 67.69  ? 451  ARG I C     1 
ATOM   6335  O  O     . ARG I 5  451  ? 231.948 226.124 243.210 1.00 67.69  ? 451  ARG I O     1 
ATOM   6336  C  CB    . ARG I 5  451  ? 230.199 223.933 241.116 1.00 67.69  ? 451  ARG I CB    1 
ATOM   6337  C  CG    . ARG I 5  451  ? 230.915 222.903 241.934 1.00 67.69  ? 451  ARG I CG    1 
ATOM   6338  C  CD    . ARG I 5  451  ? 230.650 221.546 241.316 1.00 67.69  ? 451  ARG I CD    1 
ATOM   6339  N  NE    . ARG I 5  451  ? 229.294 221.092 241.602 1.00 67.69  ? 451  ARG I NE    1 
ATOM   6340  C  CZ    . ARG I 5  451  ? 228.635 220.190 240.881 1.00 67.69  ? 451  ARG I CZ    1 
ATOM   6341  N  NH1   . ARG I 5  451  ? 229.204 219.642 239.818 1.00 67.69  ? 451  ARG I NH1   1 
ATOM   6342  N  NH2   . ARG I 5  451  ? 227.405 219.840 241.226 1.00 67.69  ? 451  ARG I NH2   1 
ATOM   6343  N  N     . ILE I 5  452  ? 232.733 225.479 241.185 1.00 72.97  ? 452  ILE I N     1 
ATOM   6344  C  CA    . ILE I 5  452  ? 234.105 225.666 241.626 1.00 72.97  ? 452  ILE I CA    1 
ATOM   6345  C  C     . ILE I 5  452  ? 234.377 227.135 241.875 1.00 72.97  ? 452  ILE I C     1 
ATOM   6346  O  O     . ILE I 5  452  ? 235.242 227.469 242.693 1.00 72.97  ? 452  ILE I O     1 
ATOM   6347  C  CB    . ILE I 5  452  ? 235.122 225.084 240.623 1.00 72.97  ? 452  ILE I CB    1 
ATOM   6348  C  CG1   . ILE I 5  452  ? 235.143 225.891 239.327 1.00 72.97  ? 452  ILE I CG1   1 
ATOM   6349  C  CG2   . ILE I 5  452  ? 234.804 223.628 240.322 1.00 72.97  ? 452  ILE I CG2   1 
ATOM   6350  C  CD1   . ILE I 5  452  ? 236.285 225.527 238.403 1.00 72.97  ? 452  ILE I CD1   1 
ATOM   6351  N  N     . THR I 5  453  ? 233.627 228.029 241.225 1.00 69.99  ? 453  THR I N     1 
ATOM   6352  C  CA    . THR I 5  453  ? 233.753 229.445 241.519 1.00 69.99  ? 453  THR I CA    1 
ATOM   6353  C  C     . THR I 5  453  ? 233.385 229.743 242.963 1.00 69.99  ? 453  THR I C     1 
ATOM   6354  O  O     . THR I 5  453  ? 234.128 230.452 243.652 1.00 69.99  ? 453  THR I O     1 
ATOM   6355  C  CB    . THR I 5  453  ? 232.880 230.234 240.547 1.00 69.99  ? 453  THR I CB    1 
ATOM   6356  O  OG1   . THR I 5  453  ? 233.422 230.115 239.226 1.00 69.99  ? 453  THR I OG1   1 
ATOM   6357  C  CG2   . THR I 5  453  ? 232.833 231.686 240.924 1.00 69.99  ? 453  THR I CG2   1 
ATOM   6358  N  N     . GLU I 5  454  ? 232.273 229.188 243.451 1.00 67.34  ? 454  GLU I N     1 
ATOM   6359  C  CA    . GLU I 5  454  ? 231.903 229.457 244.837 1.00 67.34  ? 454  GLU I CA    1 
ATOM   6360  C  C     . GLU I 5  454  ? 232.921 228.867 245.796 1.00 67.34  ? 454  GLU I C     1 
ATOM   6361  O  O     . GLU I 5  454  ? 233.293 229.512 246.786 1.00 67.34  ? 454  GLU I O     1 
ATOM   6362  C  CB    . GLU I 5  454  ? 230.509 228.930 245.195 1.00 67.34  ? 454  GLU I CB    1 
ATOM   6363  C  CG    . GLU I 5  454  ? 229.336 229.666 244.578 1.00 67.34  ? 454  GLU I CG    1 
ATOM   6364  C  CD    . GLU I 5  454  ? 228.656 228.880 243.484 1.00 67.34  ? 454  GLU I CD    1 
ATOM   6365  O  OE1   . GLU I 5  454  ? 228.940 227.671 243.368 1.00 67.34  ? 454  GLU I OE1   1 
ATOM   6366  O  OE2   . GLU I 5  454  ? 227.843 229.464 242.734 1.00 67.34  ? 454  GLU I OE2   1 
ATOM   6367  N  N     . LYS I 5  455  ? 233.401 227.652 245.518 1.00 71.58  ? 455  LYS I N     1 
ATOM   6368  C  CA    . LYS I 5  455  ? 234.323 227.064 246.491 1.00 71.58  ? 455  LYS I CA    1 
ATOM   6369  C  C     . LYS I 5  455  ? 235.647 227.831 246.521 1.00 71.58  ? 455  LYS I C     1 
ATOM   6370  O  O     . LYS I 5  455  ? 236.180 228.131 247.603 1.00 71.58  ? 455  LYS I O     1 
ATOM   6371  C  CB    . LYS I 5  455  ? 234.531 225.570 246.215 1.00 71.58  ? 455  LYS I CB    1 
ATOM   6372  C  CG    . LYS I 5  455  ? 235.363 225.202 245.001 1.00 71.58  ? 455  LYS I CG    1 
ATOM   6373  C  CD    . LYS I 5  455  ? 236.809 224.945 245.407 1.00 71.58  ? 455  LYS I CD    1 
ATOM   6374  C  CE    . LYS I 5  455  ? 237.654 224.470 244.246 1.00 71.58  ? 455  LYS I CE    1 
ATOM   6375  N  NZ    . LYS I 5  455  ? 239.062 224.246 244.675 1.00 71.58  ? 455  LYS I NZ    1 
ATOM   6376  N  N     . LEU I 5  456  ? 236.161 228.211 245.350 1.00 71.69  ? 456  LEU I N     1 
ATOM   6377  C  CA    . LEU I 5  456  ? 237.404 228.969 245.291 1.00 71.69  ? 456  LEU I CA    1 
ATOM   6378  C  C     . LEU I 5  456  ? 237.252 230.328 245.959 1.00 71.69  ? 456  LEU I C     1 
ATOM   6379  O  O     . LEU I 5  456  ? 238.146 230.779 246.685 1.00 71.69  ? 456  LEU I O     1 
ATOM   6380  C  CB    . LEU I 5  456  ? 237.849 229.131 243.839 1.00 71.69  ? 456  LEU I CB    1 
ATOM   6381  C  CG    . LEU I 5  456  ? 238.555 227.924 243.221 1.00 71.69  ? 456  LEU I CG    1 
ATOM   6382  C  CD1   . LEU I 5  456  ? 238.301 227.865 241.730 1.00 71.69  ? 456  LEU I CD1   1 
ATOM   6383  C  CD2   . LEU I 5  456  ? 240.044 227.976 243.509 1.00 71.69  ? 456  LEU I CD2   1 
ATOM   6384  N  N     . GLU I 5  457  ? 236.130 231.004 245.716 1.00 68.59  ? 457  GLU I N     1 
ATOM   6385  C  CA    . GLU I 5  457  ? 235.958 232.328 246.293 1.00 68.59  ? 457  GLU I CA    1 
ATOM   6386  C  C     . GLU I 5  457  ? 235.790 232.268 247.799 1.00 68.59  ? 457  GLU I C     1 
ATOM   6387  O  O     . GLU I 5  457  ? 236.252 233.170 248.504 1.00 68.59  ? 457  GLU I O     1 
ATOM   6388  C  CB    . GLU I 5  457  ? 234.776 233.036 245.648 1.00 68.59  ? 457  GLU I CB    1 
ATOM   6389  C  CG    . GLU I 5  457  ? 235.094 233.554 244.273 1.00 68.59  ? 457  GLU I CG    1 
ATOM   6390  C  CD    . GLU I 5  457  ? 233.871 233.693 243.411 1.00 68.59  ? 457  GLU I CD    1 
ATOM   6391  O  OE1   . GLU I 5  457  ? 232.785 233.261 243.845 1.00 68.59  ? 457  GLU I OE1   1 
ATOM   6392  O  OE2   . GLU I 5  457  ? 233.997 234.240 242.296 1.00 68.59  ? 457  GLU I OE2   1 
ATOM   6393  N  N     . LYS I 5  458  ? 235.158 231.218 248.322 1.00 73.62  ? 458  LYS I N     1 
ATOM   6394  C  CA    . LYS I 5  458  ? 235.091 231.105 249.773 1.00 73.62  ? 458  LYS I CA    1 
ATOM   6395  C  C     . LYS I 5  458  ? 236.466 230.831 250.362 1.00 73.62  ? 458  LYS I C     1 
ATOM   6396  O  O     . LYS I 5  458  ? 236.796 231.332 251.446 1.00 73.62  ? 458  LYS I O     1 
ATOM   6397  C  CB    . LYS I 5  458  ? 234.093 230.027 250.179 1.00 73.62  ? 458  LYS I CB    1 
ATOM   6398  C  CG    . LYS I 5  458  ? 233.880 229.965 251.675 1.00 73.62  ? 458  LYS I CG    1 
ATOM   6399  C  CD    . LYS I 5  458  ? 232.758 229.022 252.029 1.00 73.62  ? 458  LYS I CD    1 
ATOM   6400  C  CE    . LYS I 5  458  ? 231.427 229.629 251.626 1.00 73.62  ? 458  LYS I CE    1 
ATOM   6401  N  NZ    . LYS I 5  458  ? 231.108 230.856 252.410 1.00 73.62  ? 458  LYS I NZ    1 
ATOM   6402  N  N     . GLN I 5  459  ? 237.291 230.048 249.661 1.00 78.14  ? 459  GLN I N     1 
ATOM   6403  C  CA    . GLN I 5  459  ? 238.680 229.893 250.084 1.00 78.14  ? 459  GLN I CA    1 
ATOM   6404  C  C     . GLN I 5  459  ? 239.384 231.247 250.158 1.00 78.14  ? 459  GLN I C     1 
ATOM   6405  O  O     . GLN I 5  459  ? 240.014 231.584 251.172 1.00 78.14  ? 459  GLN I O     1 
ATOM   6406  C  CB    . GLN I 5  459  ? 239.417 228.954 249.130 1.00 78.14  ? 459  GLN I CB    1 
ATOM   6407  C  CG    . GLN I 5  459  ? 239.123 227.481 249.363 1.00 78.14  ? 459  GLN I CG    1 
ATOM   6408  C  CD    . GLN I 5  459  ? 239.905 226.568 248.434 1.00 78.14  ? 459  GLN I CD    1 
ATOM   6409  O  OE1   . GLN I 5  459  ? 240.237 226.943 247.310 1.00 78.14  ? 459  GLN I OE1   1 
ATOM   6410  N  NE2   . GLN I 5  459  ? 240.199 225.361 248.902 1.00 78.14  ? 459  GLN I NE2   1 
ATOM   6411  N  N     . GLN I 5  460  ? 239.309 232.021 249.075 1.00 79.33  ? 460  GLN I N     1 
ATOM   6412  C  CA    . GLN I 5  460  ? 239.923 233.347 249.046 1.00 79.33  ? 460  GLN I CA    1 
ATOM   6413  C  C     . GLN I 5  460  ? 239.428 234.214 250.196 1.00 79.33  ? 460  GLN I C     1 
ATOM   6414  O  O     . GLN I 5  460  ? 240.204 234.944 250.825 1.00 79.33  ? 460  GLN I O     1 
ATOM   6415  C  CB    . GLN I 5  460  ? 239.640 234.027 247.707 1.00 79.33  ? 460  GLN I CB    1 
ATOM   6416  C  CG    . GLN I 5  460  ? 240.096 233.235 246.498 1.00 79.33  ? 460  GLN I CG    1 
ATOM   6417  C  CD    . GLN I 5  460  ? 239.863 233.980 245.198 1.00 79.33  ? 460  GLN I CD    1 
ATOM   6418  O  OE1   . GLN I 5  460  ? 239.442 235.136 245.201 1.00 79.33  ? 460  GLN I OE1   1 
ATOM   6419  N  NE2   . GLN I 5  460  ? 240.140 233.321 244.080 1.00 79.33  ? 460  GLN I NE2   1 
ATOM   6420  N  N     . LYS I 5  461  ? 238.129 234.144 250.489 1.00 79.89  ? 461  LYS I N     1 
ATOM   6421  C  CA    . LYS I 5  461  ? 237.578 234.988 251.542 1.00 79.89  ? 461  LYS I CA    1 
ATOM   6422  C  C     . LYS I 5  461  ? 238.084 234.580 252.918 1.00 79.89  ? 461  LYS I C     1 
ATOM   6423  O  O     . LYS I 5  461  ? 238.403 235.450 253.738 1.00 79.89  ? 461  LYS I O     1 
ATOM   6424  C  CB    . LYS I 5  461  ? 236.054 234.951 251.520 1.00 79.89  ? 461  LYS I CB    1 
ATOM   6425  C  CG    . LYS I 5  461  ? 235.436 235.857 252.564 1.00 79.89  ? 461  LYS I CG    1 
ATOM   6426  C  CD    . LYS I 5  461  ? 233.927 235.810 252.551 1.00 79.89  ? 461  LYS I CD    1 
ATOM   6427  C  CE    . LYS I 5  461  ? 233.363 236.798 253.559 1.00 79.89  ? 461  LYS I CE    1 
ATOM   6428  N  NZ    . LYS I 5  461  ? 233.680 236.417 254.959 1.00 79.89  ? 461  LYS I NZ    1 
ATOM   6429  N  N     . ILE I 5  462  ? 238.160 233.277 253.203 1.00 87.87  ? 462  ILE I N     1 
ATOM   6430  C  CA    . ILE I 5  462  ? 238.662 232.891 254.519 1.00 87.87  ? 462  ILE I CA    1 
ATOM   6431  C  C     . ILE I 5  462  ? 240.141 233.230 254.644 1.00 87.87  ? 462  ILE I C     1 
ATOM   6432  O  O     . ILE I 5  462  ? 240.617 233.560 255.737 1.00 87.87  ? 462  ILE I O     1 
ATOM   6433  C  CB    . ILE I 5  462  ? 238.388 231.403 254.824 1.00 87.87  ? 462  ILE I CB    1 
ATOM   6434  C  CG1   . ILE I 5  462  ? 239.228 230.485 253.937 1.00 87.87  ? 462  ILE I CG1   1 
ATOM   6435  C  CG2   . ILE I 5  462  ? 236.908 231.088 254.682 1.00 87.87  ? 462  ILE I CG2   1 
ATOM   6436  C  CD1   . ILE I 5  462  ? 239.302 229.061 254.440 1.00 87.87  ? 462  ILE I CD1   1 
ATOM   6437  N  N     . GLU I 5  463  ? 240.886 233.187 253.536 1.00 90.94  ? 463  GLU I N     1 
ATOM   6438  C  CA    . GLU I 5  463  ? 242.277 233.632 253.592 1.00 90.94  ? 463  GLU I CA    1 
ATOM   6439  C  C     . GLU I 5  463  ? 242.366 235.122 253.899 1.00 90.94  ? 463  GLU I C     1 
ATOM   6440  O  O     . GLU I 5  463  ? 243.202 235.553 254.705 1.00 90.94  ? 463  GLU I O     1 
ATOM   6441  C  CB    . GLU I 5  463  ? 242.994 233.311 252.283 1.00 90.94  ? 463  GLU I CB    1 
ATOM   6442  C  CG    . GLU I 5  463  ? 243.191 231.831 252.040 1.00 90.94  ? 463  GLU I CG    1 
ATOM   6443  C  CD    . GLU I 5  463  ? 243.504 231.523 250.595 1.00 90.94  ? 463  GLU I CD    1 
ATOM   6444  O  OE1   . GLU I 5  463  ? 243.512 232.467 249.778 1.00 90.94  ? 463  GLU I OE1   1 
ATOM   6445  O  OE2   . GLU I 5  463  ? 243.739 230.340 250.274 1.00 90.94  ? 463  GLU I OE2   1 
ATOM   6446  N  N     . GLN I 5  464  ? 241.514 235.928 253.266 1.00 96.93  ? 464  GLN I N     1 
ATOM   6447  C  CA    . GLN I 5  464  ? 241.500 237.354 253.578 1.00 96.93  ? 464  GLN I CA    1 
ATOM   6448  C  C     . GLN I 5  464  ? 241.147 237.595 255.041 1.00 96.93  ? 464  GLN I C     1 
ATOM   6449  O  O     . GLN I 5  464  ? 241.729 238.470 255.697 1.00 96.93  ? 464  GLN I O     1 
ATOM   6450  C  CB    . GLN I 5  464  ? 240.519 238.082 252.661 1.00 96.93  ? 464  GLN I CB    1 
ATOM   6451  C  CG    . GLN I 5  464  ? 240.794 239.567 252.527 1.00 96.93  ? 464  GLN I CG    1 
ATOM   6452  C  CD    . GLN I 5  464  ? 242.216 239.856 252.095 1.00 96.93  ? 464  GLN I CD    1 
ATOM   6453  O  OE1   . GLN I 5  464  ? 242.781 239.150 251.260 1.00 96.93  ? 464  GLN I OE1   1 
ATOM   6454  N  NE2   . GLN I 5  464  ? 242.806 240.898 252.667 1.00 96.93  ? 464  GLN I NE2   1 
ATOM   6455  N  N     . GLU I 5  465  ? 240.209 236.817 255.578 1.00 99.00  ? 465  GLU I N     1 
ATOM   6456  C  CA    . GLU I 5  465  ? 239.801 237.038 256.961 1.00 99.00  ? 465  GLU I CA    1 
ATOM   6457  C  C     . GLU I 5  465  ? 240.866 236.586 257.954 1.00 99.00  ? 465  GLU I C     1 
ATOM   6458  O  O     . GLU I 5  465  ? 241.014 237.198 259.017 1.00 99.00  ? 465  GLU I O     1 
ATOM   6459  C  CB    . GLU I 5  465  ? 238.469 236.348 257.240 1.00 99.00  ? 465  GLU I CB    1 
ATOM   6460  C  CG    . GLU I 5  465  ? 237.279 237.287 257.106 1.00 99.00  ? 465  GLU I CG    1 
ATOM   6461  C  CD    . GLU I 5  465  ? 235.952 236.565 257.144 1.00 99.00  ? 465  GLU I CD    1 
ATOM   6462  O  OE1   . GLU I 5  465  ? 235.852 235.472 256.551 1.00 99.00  ? 465  GLU I OE1   1 
ATOM   6463  O  OE2   . GLU I 5  465  ? 235.005 237.095 257.762 1.00 99.00  ? 465  GLU I OE2   1 
ATOM   6464  N  N     . ARG I 5  466  ? 241.636 235.542 257.634 1.00 104.71 ? 466  ARG I N     1 
ATOM   6465  C  CA    . ARG I 5  466  ? 242.750 235.211 258.520 1.00 104.71 ? 466  ARG I CA    1 
ATOM   6466  C  C     . ARG I 5  466  ? 243.867 236.240 258.405 1.00 104.71 ? 466  ARG I C     1 
ATOM   6467  O  O     . ARG I 5  466  ? 244.581 236.493 259.384 1.00 104.71 ? 466  ARG I O     1 
ATOM   6468  C  CB    . ARG I 5  466  ? 243.273 233.795 258.251 1.00 104.71 ? 466  ARG I CB    1 
ATOM   6469  C  CG    . ARG I 5  466  ? 243.794 233.533 256.851 1.00 104.71 ? 466  ARG I CG    1 
ATOM   6470  C  CD    . ARG I 5  466  ? 245.272 233.879 256.709 1.00 104.71 ? 466  ARG I CD    1 
ATOM   6471  N  NE    . ARG I 5  466  ? 245.788 233.552 255.384 1.00 104.71 ? 466  ARG I NE    1 
ATOM   6472  C  CZ    . ARG I 5  466  ? 246.979 233.932 254.935 1.00 104.71 ? 466  ARG I CZ    1 
ATOM   6473  N  NH1   . ARG I 5  466  ? 247.775 234.663 255.704 1.00 104.71 ? 466  ARG I NH1   1 
ATOM   6474  N  NH2   . ARG I 5  466  ? 247.370 233.589 253.716 1.00 104.71 ? 466  ARG I NH2   1 
ATOM   6475  N  N     . LYS I 5  467  ? 244.036 236.846 257.226 1.00 106.46 ? 467  LYS I N     1 
ATOM   6476  C  CA    . LYS I 5  467  ? 244.939 237.989 257.123 1.00 106.46 ? 467  LYS I CA    1 
ATOM   6477  C  C     . LYS I 5  467  ? 244.493 239.112 258.049 1.00 106.46 ? 467  LYS I C     1 
ATOM   6478  O  O     . LYS I 5  467  ? 245.319 239.747 258.716 1.00 106.46 ? 467  LYS I O     1 
ATOM   6479  C  CB    . LYS I 5  467  ? 245.009 238.479 255.678 1.00 106.46 ? 467  LYS I CB    1 
ATOM   6480  C  CG    . LYS I 5  467  ? 246.308 239.185 255.333 1.00 106.46 ? 467  LYS I CG    1 
ATOM   6481  C  CD    . LYS I 5  467  ? 246.369 239.540 253.857 1.00 106.46 ? 467  LYS I CD    1 
ATOM   6482  C  CE    . LYS I 5  467  ? 246.407 238.293 252.989 1.00 106.46 ? 467  LYS I CE    1 
ATOM   6483  N  NZ    . LYS I 5  467  ? 247.629 237.484 253.232 1.00 106.46 ? 467  LYS I NZ    1 
ATOM   6484  N  N     . ARG I 5  468  ? 243.184 239.370 258.104 1.00 110.55 ? 468  ARG I N     1 
ATOM   6485  C  CA    . ARG I 5  468  ? 242.666 240.363 259.042 1.00 110.55 ? 468  ARG I CA    1 
ATOM   6486  C  C     . ARG I 5  468  ? 242.931 239.952 260.487 1.00 110.55 ? 468  ARG I C     1 
ATOM   6487  O  O     . ARG I 5  468  ? 243.253 240.796 261.332 1.00 110.55 ? 468  ARG I O     1 
ATOM   6488  C  CB    . ARG I 5  468  ? 241.170 240.579 258.823 1.00 110.55 ? 468  ARG I CB    1 
ATOM   6489  C  CG    . ARG I 5  468  ? 240.558 241.529 259.841 1.00 110.55 ? 468  ARG I CG    1 
ATOM   6490  C  CD    . ARG I 5  468  ? 239.120 241.885 259.516 1.00 110.55 ? 468  ARG I CD    1 
ATOM   6491  N  NE    . ARG I 5  468  ? 238.575 242.827 260.489 1.00 110.55 ? 468  ARG I NE    1 
ATOM   6492  C  CZ    . ARG I 5  468  ? 237.950 242.470 261.607 1.00 110.55 ? 468  ARG I CZ    1 
ATOM   6493  N  NH1   . ARG I 5  468  ? 237.788 241.186 261.900 1.00 110.55 ? 468  ARG I NH1   1 
ATOM   6494  N  NH2   . ARG I 5  468  ? 237.488 243.398 262.434 1.00 110.55 ? 468  ARG I NH2   1 
ATOM   6495  N  N     . ARG I 5  469  ? 242.757 238.665 260.797 1.00 110.50 ? 469  ARG I N     1 
ATOM   6496  C  CA    . ARG I 5  469  ? 243.103 238.150 262.121 1.00 110.50 ? 469  ARG I CA    1 
ATOM   6497  C  C     . ARG I 5  469  ? 244.539 238.497 262.490 1.00 110.50 ? 469  ARG I C     1 
ATOM   6498  O  O     . ARG I 5  469  ? 244.820 238.972 263.597 1.00 110.50 ? 469  ARG I O     1 
ATOM   6499  C  CB    . ARG I 5  469  ? 242.913 236.633 262.166 1.00 110.50 ? 469  ARG I CB    1 
ATOM   6500  C  CG    . ARG I 5  469  ? 241.483 236.150 262.298 1.00 110.50 ? 469  ARG I CG    1 
ATOM   6501  C  CD    . ARG I 5  469  ? 241.469 234.634 262.417 1.00 110.50 ? 469  ARG I CD    1 
ATOM   6502  N  NE    . ARG I 5  469  ? 240.122 234.075 262.374 1.00 110.50 ? 469  ARG I NE    1 
ATOM   6503  C  CZ    . ARG I 5  469  ? 239.487 233.746 261.254 1.00 110.50 ? 469  ARG I CZ    1 
ATOM   6504  N  NH1   . ARG I 5  469  ? 240.078 233.919 260.081 1.00 110.50 ? 469  ARG I NH1   1 
ATOM   6505  N  NH2   . ARG I 5  469  ? 238.263 233.241 261.308 1.00 110.50 ? 469  ARG I NH2   1 
ATOM   6506  N  N     . GLN I 5  470  ? 245.470 238.229 261.572 1.00 112.06 ? 470  GLN I N     1 
ATOM   6507  C  CA    . GLN I 5  470  ? 246.877 238.494 261.852 1.00 112.06 ? 470  GLN I CA    1 
ATOM   6508  C  C     . GLN I 5  470  ? 247.143 239.988 261.988 1.00 112.06 ? 470  GLN I C     1 
ATOM   6509  O  O     . GLN I 5  470  ? 247.967 240.402 262.811 1.00 112.06 ? 470  GLN I O     1 
ATOM   6510  C  CB    . GLN I 5  470  ? 247.758 237.883 260.765 1.00 112.06 ? 470  GLN I CB    1 
ATOM   6511  C  CG    . GLN I 5  470  ? 247.790 236.366 260.792 1.00 112.06 ? 470  GLN I CG    1 
ATOM   6512  C  CD    . GLN I 5  470  ? 248.934 235.794 259.983 1.00 112.06 ? 470  GLN I CD    1 
ATOM   6513  O  OE1   . GLN I 5  470  ? 249.728 236.533 259.404 1.00 112.06 ? 470  GLN I OE1   1 
ATOM   6514  N  NE2   . GLN I 5  470  ? 249.024 234.471 259.941 1.00 112.06 ? 470  GLN I NE2   1 
ATOM   6515  N  N     . LYS I 5  471  ? 246.456 240.815 261.194 1.00 114.17 ? 471  LYS I N     1 
ATOM   6516  C  CA    . LYS I 5  471  ? 246.560 242.261 261.382 1.00 114.17 ? 471  LYS I CA    1 
ATOM   6517  C  C     . LYS I 5  471  ? 246.122 242.656 262.786 1.00 114.17 ? 471  LYS I C     1 
ATOM   6518  O  O     . LYS I 5  471  ? 246.801 243.431 263.470 1.00 114.17 ? 471  LYS I O     1 
ATOM   6519  C  CB    . LYS I 5  471  ? 245.719 242.999 260.339 1.00 114.17 ? 471  LYS I CB    1 
ATOM   6520  C  CG    . LYS I 5  471  ? 246.145 242.786 258.899 1.00 114.17 ? 471  LYS I CG    1 
ATOM   6521  C  CD    . LYS I 5  471  ? 244.963 242.983 257.961 1.00 114.17 ? 471  LYS I CD    1 
ATOM   6522  C  CE    . LYS I 5  471  ? 245.194 242.323 256.616 1.00 114.17 ? 471  LYS I CE    1 
ATOM   6523  N  NZ    . LYS I 5  471  ? 243.911 241.965 255.951 1.00 114.17 ? 471  LYS I NZ    1 
ATOM   6524  N  N     . HIS I 5  472  ? 244.981 242.124 263.231 1.00 115.70 ? 472  HIS I N     1 
ATOM   6525  C  CA    . HIS I 5  472  ? 244.493 242.404 264.579 1.00 115.70 ? 472  HIS I CA    1 
ATOM   6526  C  C     . HIS I 5  472  ? 245.524 242.012 265.627 1.00 115.70 ? 472  HIS I C     1 
ATOM   6527  O  O     . HIS I 5  472  ? 245.819 242.784 266.546 1.00 115.70 ? 472  HIS I O     1 
ATOM   6528  C  CB    . HIS I 5  472  ? 243.174 241.672 264.828 1.00 115.70 ? 472  HIS I CB    1 
ATOM   6529  C  CG    . HIS I 5  472  ? 241.959 242.505 264.566 1.00 115.70 ? 472  HIS I CG    1 
ATOM   6530  N  ND1   . HIS I 5  472  ? 240.714 242.178 265.055 1.00 115.70 ? 472  HIS I ND1   1 
ATOM   6531  C  CD2   . HIS I 5  472  ? 241.799 243.654 263.868 1.00 115.70 ? 472  HIS I CD2   1 
ATOM   6532  C  CE1   . HIS I 5  472  ? 239.838 243.089 264.672 1.00 115.70 ? 472  HIS I CE1   1 
ATOM   6533  N  NE2   . HIS I 5  472  ? 240.470 243.996 263.949 1.00 115.70 ? 472  HIS I NE2   1 
ATOM   6534  N  N     . GLN I 5  473  ? 246.086 240.800 265.491 1.00 116.96 ? 473  GLN I N     1 
ATOM   6535  C  CA    . GLN I 5  473  ? 247.085 240.276 266.463 1.00 116.96 ? 473  GLN I CA    1 
ATOM   6536  C  C     . GLN I 5  473  ? 248.376 241.096 266.419 1.00 116.96 ? 473  GLN I C     1 
ATOM   6537  O  O     . GLN I 5  473  ? 249.075 241.113 267.442 1.00 116.96 ? 473  GLN I O     1 
ATOM   6538  C  CB    . GLN I 5  473  ? 247.398 238.813 266.148 1.00 116.96 ? 473  GLN I CB    1 
ATOM   6539  C  CG    . GLN I 5  473  ? 247.214 237.880 267.335 1.00 116.96 ? 473  GLN I CG    1 
ATOM   6540  C  CD    . GLN I 5  473  ? 247.944 236.572 267.152 1.00 116.96 ? 473  GLN I CD    1 
ATOM   6541  O  OE1   . GLN I 5  473  ? 248.346 236.211 266.048 1.00 116.96 ? 473  GLN I OE1   1 
ATOM   6542  N  NE2   . GLN I 5  473  ? 248.126 235.849 268.245 1.00 116.96 ? 473  GLN I NE2   1 
ATOM   6543  N  N     . GLU I 5  474  ? 248.702 241.720 265.281 1.00 118.78 ? 474  GLU I N     1 
ATOM   6544  C  CA    . GLU I 5  474  ? 249.876 242.581 265.204 1.00 118.78 ? 474  GLU I CA    1 
ATOM   6545  C  C     . GLU I 5  474  ? 249.594 243.970 265.762 1.00 118.78 ? 474  GLU I C     1 
ATOM   6546  O  O     . GLU I 5  474  ? 250.525 244.671 266.173 1.00 118.78 ? 474  GLU I O     1 
ATOM   6547  C  CB    . GLU I 5  474  ? 250.375 242.677 263.764 1.00 118.78 ? 474  GLU I CB    1 
ATOM   6548  C  CG    . GLU I 5  474  ? 251.196 241.481 263.323 1.00 118.78 ? 474  GLU I CG    1 
ATOM   6549  C  CD    . GLU I 5  474  ? 252.271 241.859 262.326 1.00 118.78 ? 474  GLU I CD    1 
ATOM   6550  O  OE1   . GLU I 5  474  ? 252.299 243.031 261.896 1.00 118.78 ? 474  GLU I OE1   1 
ATOM   6551  O  OE2   . GLU I 5  474  ? 253.091 240.985 261.977 1.00 118.78 ? 474  GLU I OE2   1 
ATOM   6552  N  N     . TYR I 5  475  ? 248.332 244.374 265.651 1.00 119.94 ? 475  TYR I N     1 
ATOM   6553  C  CA    . TYR I 5  475  ? 247.942 245.685 266.197 1.00 119.94 ? 475  TYR I CA    1 
ATOM   6554  C  C     . TYR I 5  475  ? 248.163 245.590 267.686 1.00 119.94 ? 475  TYR I C     1 
ATOM   6555  O  O     . TYR I 5  475  ? 248.540 246.568 268.383 1.00 119.94 ? 475  TYR I O     1 
ATOM   6556  C  CB    . TYR I 5  475  ? 246.431 245.798 266.064 1.00 119.94 ? 475  TYR I CB    1 
ATOM   6557  C  CG    . TYR I 5  475  ? 245.958 245.983 264.647 1.00 119.94 ? 475  TYR I CG    1 
ATOM   6558  C  CD1   . TYR I 5  475  ? 246.822 246.435 263.664 1.00 119.94 ? 475  TYR I CD1   1 
ATOM   6559  C  CD2   . TYR I 5  475  ? 244.647 245.723 264.287 1.00 119.94 ? 475  TYR I CD2   1 
ATOM   6560  C  CE1   . TYR I 5  475  ? 246.404 246.596 262.354 1.00 119.94 ? 475  TYR I CE1   1 
ATOM   6561  C  CE2   . TYR I 5  475  ? 244.212 245.878 262.982 1.00 119.94 ? 475  TYR I CE2   1 
ATOM   6562  C  CZ    . TYR I 5  475  ? 245.093 246.320 262.012 1.00 119.94 ? 475  TYR I CZ    1 
ATOM   6563  O  OH    . TYR I 5  475  ? 244.668 246.483 260.726 1.00 119.94 ? 475  TYR I OH    1 
ATOM   6564  N  N     . LEU I 5  476  ? 247.893 244.393 268.153 1.00 117.47 ? 476  LEU I N     1 
ATOM   6565  C  CA    . LEU I 5  476  ? 248.010 244.223 269.598 1.00 117.47 ? 476  LEU I CA    1 
ATOM   6566  C  C     . LEU I 5  476  ? 249.460 244.515 269.892 1.00 117.47 ? 476  LEU I C     1 
ATOM   6567  O  O     . LEU I 5  476  ? 249.771 245.098 270.931 1.00 117.47 ? 476  LEU I O     1 
ATOM   6568  C  CB    . LEU I 5  476  ? 247.683 242.764 269.878 1.00 117.47 ? 476  LEU I CB    1 
ATOM   6569  C  CG    . LEU I 5  476  ? 247.712 242.352 271.346 1.00 117.47 ? 476  LEU I CG    1 
ATOM   6570  C  CD1   . LEU I 5  476  ? 246.380 242.652 272.009 1.00 117.47 ? 476  LEU I CD1   1 
ATOM   6571  C  CD2   . LEU I 5  476  ? 248.050 240.876 271.481 1.00 117.47 ? 476  LEU I CD2   1 
ATOM   6572  N  N     . ASN I 5  477  ? 250.309 244.056 269.004 1.00 128.83 ? 477  ASN I N     1 
ATOM   6573  C  CA    . ASN I 5  477  ? 251.728 244.078 269.389 1.00 128.83 ? 477  ASN I CA    1 
ATOM   6574  C  C     . ASN I 5  477  ? 252.107 245.537 269.545 1.00 128.83 ? 477  ASN I C     1 
ATOM   6575  O  O     . ASN I 5  477  ? 252.773 245.909 270.536 1.00 128.83 ? 477  ASN I O     1 
ATOM   6576  C  CB    . ASN I 5  477  ? 252.570 243.430 268.292 1.00 128.83 ? 477  ASN I CB    1 
ATOM   6577  C  CG    . ASN I 5  477  ? 252.139 242.012 267.983 1.00 128.83 ? 477  ASN I CG    1 
ATOM   6578  O  OD1   . ASN I 5  477  ? 252.585 241.424 267.002 1.00 128.83 ? 477  ASN I OD1   1 
ATOM   6579  N  ND2   . ASN I 5  477  ? 251.266 241.455 268.807 1.00 128.83 ? 477  ASN I ND2   1 
ATOM   6580  N  N     . SER I 5  478  ? 251.669 246.328 268.593 1.00 135.23 ? 478  SER I N     1 
ATOM   6581  C  CA    . SER I 5  478  ? 252.043 247.751 268.617 1.00 135.23 ? 478  SER I CA    1 
ATOM   6582  C  C     . SER I 5  478  ? 251.470 248.448 269.855 1.00 135.23 ? 478  SER I C     1 
ATOM   6583  O  O     . SER I 5  478  ? 252.152 249.333 270.436 1.00 135.23 ? 478  SER I O     1 
ATOM   6584  C  CB    . SER I 5  478  ? 251.524 248.350 267.377 1.00 135.23 ? 478  SER I CB    1 
ATOM   6585  O  OG    . SER I 5  478  ? 250.200 247.904 267.142 1.00 135.23 ? 478  SER I OG    1 
ATOM   6586  N  N     . ILE I 5  479  ? 250.237 248.127 270.218 1.00 137.94 ? 479  ILE I N     1 
ATOM   6587  C  CA    . ILE I 5  479  ? 249.720 248.772 271.456 1.00 137.94 ? 479  ILE I CA    1 
ATOM   6588  C  C     . ILE I 5  479  ? 250.513 248.350 272.695 1.00 137.94 ? 479  ILE I C     1 
ATOM   6589  O  O     . ILE I 5  479  ? 250.707 249.179 273.593 1.00 137.94 ? 479  ILE I O     1 
ATOM   6590  C  CB    . ILE I 5  479  ? 248.204 248.581 271.622 1.00 137.94 ? 479  ILE I CB    1 
ATOM   6591  C  CG1   . ILE I 5  479  ? 247.591 249.686 272.485 1.00 137.94 ? 479  ILE I CG1   1 
ATOM   6592  C  CG2   . ILE I 5  479  ? 247.845 247.205 272.157 1.00 137.94 ? 479  ILE I CG2   1 
ATOM   6593  C  CD1   . ILE I 5  479  ? 247.701 251.066 271.884 1.00 137.94 ? 479  ILE I CD1   1 
ATOM   6594  N  N     . LEU I 5  480  ? 250.892 247.090 272.792 1.00 127.75 ? 480  LEU I N     1 
ATOM   6595  C  CA    . LEU I 5  480  ? 251.700 246.742 273.974 1.00 127.75 ? 480  LEU I CA    1 
ATOM   6596  C  C     . LEU I 5  480  ? 253.042 247.462 273.923 1.00 127.75 ? 480  LEU I C     1 
ATOM   6597  O  O     . LEU I 5  480  ? 253.658 247.580 274.962 1.00 127.75 ? 480  LEU I O     1 
ATOM   6598  C  CB    . LEU I 5  480  ? 251.873 245.232 274.000 1.00 127.75 ? 480  LEU I CB    1 
ATOM   6599  C  CG    . LEU I 5  480  ? 250.579 244.458 273.787 1.00 127.75 ? 480  LEU I CG    1 
ATOM   6600  C  CD1   . LEU I 5  480  ? 250.861 243.012 273.431 1.00 127.75 ? 480  LEU I CD1   1 
ATOM   6601  C  CD2   . LEU I 5  480  ? 249.678 244.565 275.001 1.00 127.75 ? 480  LEU I CD2   1 
ATOM   6602  N  N     . GLN I 5  481  ? 253.562 247.704 272.731 1.00 127.48 ? 481  GLN I N     1 
ATOM   6603  C  CA    . GLN I 5  481  ? 254.832 248.450 272.588 1.00 127.48 ? 481  GLN I CA    1 
ATOM   6604  C  C     . GLN I 5  481  ? 254.646 249.854 273.129 1.00 127.48 ? 481  GLN I C     1 
ATOM   6605  O  O     . GLN I 5  481  ? 255.584 250.439 273.734 1.00 127.48 ? 481  GLN I O     1 
ATOM   6606  C  CB    . GLN I 5  481  ? 255.069 248.622 271.100 1.00 127.48 ? 481  GLN I CB    1 
ATOM   6607  C  CG    . GLN I 5  481  ? 255.581 247.354 270.435 1.00 127.48 ? 481  GLN I CG    1 
ATOM   6608  C  CD    . GLN I 5  481  ? 255.350 247.361 268.945 1.00 127.48 ? 481  GLN I CD    1 
ATOM   6609  O  OE1   . GLN I 5  481  ? 255.219 248.413 268.323 1.00 127.48 ? 481  GLN I OE1   1 
ATOM   6610  N  NE2   . GLN I 5  481  ? 255.286 246.175 268.359 1.00 127.48 ? 481  GLN I NE2   1 
ATOM   6611  N  N     . HIS I 5  482  ? 253.498 250.417 272.820 1.00 146.42 ? 482  HIS I N     1 
ATOM   6612  C  CA    . HIS I 5  482  ? 253.208 251.739 273.421 1.00 146.42 ? 482  HIS I CA    1 
ATOM   6613  C  C     . HIS I 5  482  ? 253.138 251.615 274.950 1.00 146.42 ? 482  HIS I C     1 
ATOM   6614  O  O     . HIS I 5  482  ? 253.452 252.595 275.676 1.00 146.42 ? 482  HIS I O     1 
ATOM   6615  C  CB    . HIS I 5  482  ? 251.875 252.271 272.894 1.00 146.42 ? 482  HIS I CB    1 
ATOM   6616  C  CG    . HIS I 5  482  ? 250.990 252.799 273.972 1.00 146.42 ? 482  HIS I CG    1 
ATOM   6617  N  ND1   . HIS I 5  482  ? 250.059 252.007 274.616 1.00 146.42 ? 482  HIS I ND1   1 
ATOM   6618  C  CD2   . HIS I 5  482  ? 250.906 254.020 274.542 1.00 146.42 ? 482  HIS I CD2   1 
ATOM   6619  C  CE1   . HIS I 5  482  ? 249.430 252.719 275.528 1.00 146.42 ? 482  HIS I CE1   1 
ATOM   6620  N  NE2   . HIS I 5  482  ? 249.930 253.959 275.502 1.00 146.42 ? 482  HIS I NE2   1 
ATOM   6621  N  N     . ALA I 5  483  ? 252.575 250.515 275.427 1.00 130.86 ? 483  ALA I N     1 
ATOM   6622  C  CA    . ALA I 5  483  ? 252.489 250.328 276.887 1.00 130.86 ? 483  ALA I CA    1 
ATOM   6623  C  C     . ALA I 5  483  ? 253.907 250.219 277.447 1.00 130.86 ? 483  ALA I C     1 
ATOM   6624  O  O     . ALA I 5  483  ? 254.126 250.469 278.655 1.00 130.86 ? 483  ALA I O     1 
ATOM   6625  C  CB    . ALA I 5  483  ? 251.679 249.100 277.146 1.00 130.86 ? 483  ALA I CB    1 
ATOM   6626  N  N     . LYS I 5  484  ? 254.792 249.641 276.659 1.00 119.52 ? 484  LYS I N     1 
ATOM   6627  C  CA    . LYS I 5  484  ? 256.207 249.516 277.058 1.00 119.52 ? 484  LYS I CA    1 
ATOM   6628  C  C     . LYS I 5  484  ? 256.787 250.916 277.185 1.00 119.52 ? 484  LYS I C     1 
ATOM   6629  O  O     . LYS I 5  484  ? 257.569 251.185 278.111 1.00 119.52 ? 484  LYS I O     1 
ATOM   6630  C  CB    . LYS I 5  484  ? 256.911 248.794 275.912 1.00 119.52 ? 484  LYS I CB    1 
ATOM   6631  C  CG    . LYS I 5  484  ? 256.613 247.305 275.824 1.00 119.52 ? 484  LYS I CG    1 
ATOM   6632  C  CD    . LYS I 5  484  ? 257.027 246.675 274.513 1.00 119.52 ? 484  LYS I CD    1 
ATOM   6633  C  CE    . LYS I 5  484  ? 256.210 245.446 274.171 1.00 119.52 ? 484  LYS I CE    1 
ATOM   6634  N  NZ    . LYS I 5  484  ? 256.529 244.939 272.816 1.00 119.52 ? 484  LYS I NZ    1 
ATOM   6635  N  N     . ASP I 5  485  ? 256.425 251.769 276.250 1.00 131.57 ? 485  ASP I N     1 
ATOM   6636  C  CA    . ASP I 5  485  ? 256.871 253.175 276.382 1.00 131.57 ? 485  ASP I CA    1 
ATOM   6637  C  C     . ASP I 5  485  ? 256.320 253.744 277.683 1.00 131.57 ? 485  ASP I C     1 
ATOM   6638  O  O     . ASP I 5  485  ? 256.980 254.608 278.309 1.00 131.57 ? 485  ASP I O     1 
ATOM   6639  C  CB    . ASP I 5  485  ? 256.212 253.986 275.277 1.00 131.57 ? 485  ASP I CB    1 
ATOM   6640  C  CG    . ASP I 5  485  ? 256.447 253.378 273.908 1.00 131.57 ? 485  ASP I CG    1 
ATOM   6641  O  OD1   . ASP I 5  485  ? 257.380 252.558 273.788 1.00 131.57 ? 485  ASP I OD1   1 
ATOM   6642  O  OD2   . ASP I 5  485  ? 255.695 253.720 272.977 1.00 131.57 ? 485  ASP I OD2   1 
ATOM   6643  N  N     . PHE I 5  486  ? 255.096 253.365 278.009 1.00 121.59 ? 486  PHE I N     1 
ATOM   6644  C  CA    . PHE I 5  486  ? 254.485 253.816 279.289 1.00 121.59 ? 486  PHE I CA    1 
ATOM   6645  C  C     . PHE I 5  486  ? 255.288 253.327 280.513 1.00 121.59 ? 486  PHE I C     1 
ATOM   6646  O  O     . PHE I 5  486  ? 255.462 254.083 281.512 1.00 121.59 ? 486  PHE I O     1 
ATOM   6647  C  CB    . PHE I 5  486  ? 253.040 253.318 279.344 1.00 121.59 ? 486  PHE I CB    1 
ATOM   6648  C  CG    . PHE I 5  486  ? 252.141 254.029 280.320 1.00 121.59 ? 486  PHE I CG    1 
ATOM   6649  C  CD1   . PHE I 5  486  ? 251.848 255.373 280.165 1.00 121.59 ? 486  PHE I CD1   1 
ATOM   6650  C  CD2   . PHE I 5  486  ? 251.565 253.346 281.377 1.00 121.59 ? 486  PHE I CD2   1 
ATOM   6651  C  CE1   . PHE I 5  486  ? 251.013 256.020 281.061 1.00 121.59 ? 486  PHE I CE1   1 
ATOM   6652  C  CE2   . PHE I 5  486  ? 250.729 253.994 282.271 1.00 121.59 ? 486  PHE I CE2   1 
ATOM   6653  C  CZ    . PHE I 5  486  ? 250.455 255.330 282.111 1.00 121.59 ? 486  PHE I CZ    1 
ATOM   6654  N  N     . LYS I 5  487  ? 255.740 252.083 280.512 1.00 126.04 ? 487  LYS I N     1 
ATOM   6655  C  CA    . LYS I 5  487  ? 256.585 251.671 281.659 1.00 126.04 ? 487  LYS I CA    1 
ATOM   6656  C  C     . LYS I 5  487  ? 257.930 252.386 281.632 1.00 126.04 ? 487  LYS I C     1 
ATOM   6657  O  O     . LYS I 5  487  ? 258.662 252.304 282.624 1.00 126.04 ? 487  LYS I O     1 
ATOM   6658  C  CB    . LYS I 5  487  ? 256.846 250.174 281.603 1.00 126.04 ? 487  LYS I CB    1 
ATOM   6659  C  CG    . LYS I 5  487  ? 255.701 249.296 282.083 1.00 126.04 ? 487  LYS I CG    1 
ATOM   6660  C  CD    . LYS I 5  487  ? 255.235 249.597 283.490 1.00 126.04 ? 487  LYS I CD    1 
ATOM   6661  C  CE    . LYS I 5  487  ? 254.296 250.780 283.576 1.00 126.04 ? 487  LYS I CE    1 
ATOM   6662  N  NZ    . LYS I 5  487  ? 253.619 250.834 284.892 1.00 126.04 ? 487  LYS I NZ    1 
ATOM   6663  N  N     . GLU I 5  488  ? 258.361 252.780 280.452 1.00 131.67 ? 488  GLU I N     1 
ATOM   6664  C  CA    . GLU I 5  488  ? 259.611 253.566 280.347 1.00 131.67 ? 488  GLU I CA    1 
ATOM   6665  C  C     . GLU I 5  488  ? 259.401 254.899 281.044 1.00 131.67 ? 488  GLU I C     1 
ATOM   6666  O  O     . GLU I 5  488  ? 260.359 255.480 281.594 1.00 131.67 ? 488  GLU I O     1 
ATOM   6667  C  CB    . GLU I 5  488  ? 259.877 253.827 278.871 1.00 131.67 ? 488  GLU I CB    1 
ATOM   6668  C  CG    . GLU I 5  488  ? 260.406 252.608 278.145 1.00 131.67 ? 488  GLU I CG    1 
ATOM   6669  C  CD    . GLU I 5  488  ? 260.265 252.649 276.635 1.00 131.67 ? 488  GLU I CD    1 
ATOM   6670  O  OE1   . GLU I 5  488  ? 260.406 253.744 276.062 1.00 131.67 ? 488  GLU I OE1   1 
ATOM   6671  O  OE2   . GLU I 5  488  ? 259.999 251.587 276.039 1.00 131.67 ? 488  GLU I OE2   1 
ATOM   6672  N  N     . TYR I 5  489  ? 258.189 255.456 280.894 1.00 140.01 ? 489  TYR I N     1 
ATOM   6673  C  CA    . TYR I 5  489  ? 257.840 256.711 281.604 1.00 140.01 ? 489  TYR I CA    1 
ATOM   6674  C  C     . TYR I 5  489  ? 257.793 256.367 283.089 1.00 140.01 ? 489  TYR I C     1 
ATOM   6675  O  O     . TYR I 5  489  ? 257.995 257.267 283.925 1.00 140.01 ? 489  TYR I O     1 
ATOM   6676  C  CB    . TYR I 5  489  ? 256.483 257.247 281.148 1.00 140.01 ? 489  TYR I CB    1 
ATOM   6677  C  CG    . TYR I 5  489  ? 255.852 258.178 282.150 1.00 140.01 ? 489  TYR I CG    1 
ATOM   6678  C  CD1   . TYR I 5  489  ? 256.318 259.473 282.303 1.00 140.01 ? 489  TYR I CD1   1 
ATOM   6679  C  CD2   . TYR I 5  489  ? 254.820 257.757 282.972 1.00 140.01 ? 489  TYR I CD2   1 
ATOM   6680  C  CE1   . TYR I 5  489  ? 255.761 260.335 283.231 1.00 140.01 ? 489  TYR I CE1   1 
ATOM   6681  C  CE2   . TYR I 5  489  ? 254.250 258.607 283.905 1.00 140.01 ? 489  TYR I CE2   1 
ATOM   6682  C  CZ    . TYR I 5  489  ? 254.723 259.900 284.034 1.00 140.01 ? 489  TYR I CZ    1 
ATOM   6683  O  OH    . TYR I 5  489  ? 254.174 260.751 284.948 1.00 140.01 ? 489  TYR I OH    1 
ATOM   6684  N  N     . HIS I 5  490  ? 257.498 255.103 283.412 1.00 139.68 ? 490  HIS I N     1 
ATOM   6685  C  CA    . HIS I 5  490  ? 257.596 254.692 284.837 1.00 139.68 ? 490  HIS I CA    1 
ATOM   6686  C  C     . HIS I 5  490  ? 259.052 254.659 285.297 1.00 139.68 ? 490  HIS I C     1 
ATOM   6687  O  O     . HIS I 5  490  ? 259.320 254.963 286.483 1.00 139.68 ? 490  HIS I O     1 
ATOM   6688  C  CB    . HIS I 5  490  ? 256.856 253.389 285.103 1.00 139.68 ? 490  HIS I CB    1 
ATOM   6689  C  CG    . HIS I 5  490  ? 255.560 253.613 285.797 1.00 139.68 ? 490  HIS I CG    1 
ATOM   6690  N  ND1   . HIS I 5  490  ? 255.413 253.419 287.152 1.00 139.68 ? 490  HIS I ND1   1 
ATOM   6691  C  CD2   . HIS I 5  490  ? 254.365 254.043 285.339 1.00 139.68 ? 490  HIS I CD2   1 
ATOM   6692  C  CE1   . HIS I 5  490  ? 254.175 253.701 287.501 1.00 139.68 ? 490  HIS I CE1   1 
ATOM   6693  N  NE2   . HIS I 5  490  ? 253.511 254.088 286.406 1.00 139.68 ? 490  HIS I NE2   1 
ATOM   6694  N  N     . ARG I 5  491  ? 259.947 254.214 284.431 1.00 132.90 ? 491  ARG I N     1 
ATOM   6695  C  CA    . ARG I 5  491  ? 261.395 254.241 284.764 1.00 132.90 ? 491  ARG I CA    1 
ATOM   6696  C  C     . ARG I 5  491  ? 261.817 255.696 284.970 1.00 132.90 ? 491  ARG I C     1 
ATOM   6697  O  O     . ARG I 5  491  ? 262.760 255.981 285.746 1.00 132.90 ? 491  ARG I O     1 
ATOM   6698  C  CB    . ARG I 5  491  ? 262.157 253.646 283.579 1.00 132.90 ? 491  ARG I CB    1 
ATOM   6699  C  CG    . ARG I 5  491  ? 261.772 252.206 283.274 1.00 132.90 ? 491  ARG I CG    1 
ATOM   6700  C  CD    . ARG I 5  491  ? 262.209 251.702 281.912 1.00 132.90 ? 491  ARG I CD    1 
ATOM   6701  N  NE    . ARG I 5  491  ? 261.327 250.650 281.416 1.00 132.90 ? 491  ARG I NE    1 
ATOM   6702  C  CZ    . ARG I 5  491  ? 261.504 249.980 280.282 1.00 132.90 ? 491  ARG I CZ    1 
ATOM   6703  N  NH1   . ARG I 5  491  ? 262.543 250.246 279.509 1.00 132.90 ? 491  ARG I NH1   1 
ATOM   6704  N  NH2   . ARG I 5  491  ? 260.643 249.043 279.922 1.00 132.90 ? 491  ARG I NH2   1 
ATOM   6705  N  N     . SER I 5  492  ? 261.232 256.577 284.180 1.00 142.13 ? 492  SER I N     1 
ATOM   6706  C  CA    . SER I 5  492  ? 261.538 258.019 284.330 1.00 142.13 ? 492  SER I CA    1 
ATOM   6707  C  C     . SER I 5  492  ? 261.107 258.503 285.705 1.00 142.13 ? 492  SER I C     1 
ATOM   6708  O  O     . SER I 5  492  ? 261.756 259.414 286.260 1.00 142.13 ? 492  SER I O     1 
ATOM   6709  C  CB    . SER I 5  492  ? 260.782 258.773 283.295 1.00 142.13 ? 492  SER I CB    1 
ATOM   6710  O  OG    . SER I 5  492  ? 259.533 259.208 283.802 1.00 142.13 ? 492  SER I OG    1 
ATOM   6711  N  N     . VAL I 5  493  ? 259.954 258.023 286.148 1.00 127.78 ? 493  VAL I N     1 
ATOM   6712  C  CA    . VAL I 5  493  ? 259.502 258.403 287.513 1.00 127.78 ? 493  VAL I CA    1 
ATOM   6713  C  C     . VAL I 5  493  ? 260.482 257.827 288.514 1.00 127.78 ? 493  VAL I C     1 
ATOM   6714  O  O     . VAL I 5  493  ? 260.742 258.490 289.533 1.00 127.78 ? 493  VAL I O     1 
ATOM   6715  C  CB    . VAL I 5  493  ? 258.043 258.047 287.840 1.00 127.78 ? 493  VAL I CB    1 
ATOM   6716  C  CG1   . VAL I 5  493  ? 257.914 256.768 288.651 1.00 127.78 ? 493  VAL I CG1   1 
ATOM   6717  C  CG2   . VAL I 5  493  ? 257.355 259.187 288.572 1.00 127.78 ? 493  VAL I CG2   1 
ATOM   6718  N  N     . THR I 5  494  ? 260.987 256.635 288.238 1.00 125.90 ? 494  THR I N     1 
ATOM   6719  C  CA    . THR I 5  494  ? 262.003 256.125 289.181 1.00 125.90 ? 494  THR I CA    1 
ATOM   6720  C  C     . THR I 5  494  ? 263.165 257.117 289.239 1.00 125.90 ? 494  THR I C     1 
ATOM   6721  O  O     . THR I 5  494  ? 263.649 257.478 290.365 1.00 125.90 ? 494  THR I O     1 
ATOM   6722  C  CB    . THR I 5  494  ? 262.562 254.785 288.702 1.00 125.90 ? 494  THR I CB    1 
ATOM   6723  O  OG1   . THR I 5  494  ? 263.486 254.999 287.638 1.00 125.90 ? 494  THR I OG1   1 
ATOM   6724  C  CG2   . THR I 5  494  ? 261.498 253.780 288.325 1.00 125.90 ? 494  THR I CG2   1 
ATOM   6725  N  N     . GLY I 5  495  ? 263.564 257.603 288.076 1.00 129.50 ? 495  GLY I N     1 
ATOM   6726  C  CA    . GLY I 5  495  ? 264.640 258.611 288.076 1.00 129.50 ? 495  GLY I CA    1 
ATOM   6727  C  C     . GLY I 5  495  ? 264.313 259.900 288.832 1.00 129.50 ? 495  GLY I C     1 
ATOM   6728  O  O     . GLY I 5  495  ? 265.247 260.495 289.433 1.00 129.50 ? 495  GLY I O     1 
ATOM   6729  N  N     . LYS I 5  496  ? 263.097 260.416 288.684 1.00 110.04 ? 496  LYS I N     1 
ATOM   6730  C  CA    . LYS I 5  496  ? 262.801 261.699 289.349 1.00 110.04 ? 496  LYS I CA    1 
ATOM   6731  C  C     . LYS I 5  496  ? 262.888 261.417 290.827 1.00 110.04 ? 496  LYS I C     1 
ATOM   6732  O  O     . LYS I 5  496  ? 263.328 262.278 291.578 1.00 110.04 ? 496  LYS I O     1 
ATOM   6733  C  CB    . LYS I 5  496  ? 261.364 262.121 289.073 1.00 110.04 ? 496  LYS I CB    1 
ATOM   6734  C  CG    . LYS I 5  496  ? 261.120 262.870 287.770 1.00 110.04 ? 496  LYS I CG    1 
ATOM   6735  C  CD    . LYS I 5  496  ? 259.645 263.123 287.502 1.00 110.04 ? 496  LYS I CD    1 
ATOM   6736  C  CE    . LYS I 5  496  ? 259.387 264.055 286.336 1.00 110.04 ? 496  LYS I CE    1 
ATOM   6737  N  NZ    . LYS I 5  496  ? 257.939 264.203 286.051 1.00 110.04 ? 496  LYS I NZ    1 
ATOM   6738  N  N     . ILE I 5  497  ? 262.409 260.251 291.202 1.00 114.24 ? 497  ILE I N     1 
ATOM   6739  C  CA    . ILE I 5  497  ? 262.389 259.981 292.653 1.00 114.24 ? 497  ILE I CA    1 
ATOM   6740  C  C     . ILE I 5  497  ? 263.830 260.078 293.090 1.00 114.24 ? 497  ILE I C     1 
ATOM   6741  O  O     . ILE I 5  497  ? 264.122 260.757 294.076 1.00 114.24 ? 497  ILE I O     1 
ATOM   6742  C  CB    . ILE I 5  497  ? 261.905 258.550 292.887 1.00 114.24 ? 497  ILE I CB    1 
ATOM   6743  C  CG1   . ILE I 5  497  ? 260.393 258.428 292.685 1.00 114.24 ? 497  ILE I CG1   1 
ATOM   6744  C  CG2   . ILE I 5  497  ? 262.324 258.064 294.265 1.00 114.24 ? 497  ILE I CG2   1 
ATOM   6745  C  CD1   . ILE I 5  497  ? 259.910 257.005 292.508 1.00 114.24 ? 497  ILE I CD1   1 
ATOM   6746  N  N     . GLN I 5  498  ? 264.696 259.451 292.322 1.00 121.19 ? 498  GLN I N     1 
ATOM   6747  C  CA    . GLN I 5  498  ? 266.106 259.444 292.765 1.00 121.19 ? 498  GLN I CA    1 
ATOM   6748  C  C     . GLN I 5  498  ? 266.680 260.857 292.853 1.00 121.19 ? 498  GLN I C     1 
ATOM   6749  O  O     . GLN I 5  498  ? 267.478 261.121 293.769 1.00 121.19 ? 498  GLN I O     1 
ATOM   6750  C  CB    . GLN I 5  498  ? 266.949 258.737 291.715 1.00 121.19 ? 498  GLN I CB    1 
ATOM   6751  C  CG    . GLN I 5  498  ? 268.431 258.736 292.054 1.00 121.19 ? 498  GLN I CG    1 
ATOM   6752  C  CD    . GLN I 5  498  ? 268.689 258.422 293.508 1.00 121.19 ? 498  GLN I CD    1 
ATOM   6753  O  OE1   . GLN I 5  498  ? 267.811 257.966 294.237 1.00 121.19 ? 498  GLN I OE1   1 
ATOM   6754  N  NE2   . GLN I 5  498  ? 269.912 258.667 293.947 1.00 121.19 ? 498  GLN I NE2   1 
ATOM   6755  N  N     . LYS I 5  499  ? 266.405 261.698 291.868 1.00 109.05 ? 499  LYS I N     1 
ATOM   6756  C  CA    . LYS I 5  499  ? 267.043 263.036 291.911 1.00 109.05 ? 499  LYS I CA    1 
ATOM   6757  C  C     . LYS I 5  499  ? 266.520 263.768 293.133 1.00 109.05 ? 499  LYS I C     1 
ATOM   6758  O  O     . LYS I 5  499  ? 267.300 264.461 293.828 1.00 109.05 ? 499  LYS I O     1 
ATOM   6759  C  CB    . LYS I 5  499  ? 266.625 263.824 290.673 1.00 109.05 ? 499  LYS I CB    1 
ATOM   6760  C  CG    . LYS I 5  499  ? 267.055 265.282 290.619 1.00 109.05 ? 499  LYS I CG    1 
ATOM   6761  C  CD    . LYS I 5  499  ? 266.544 265.985 289.376 1.00 109.05 ? 499  LYS I CD    1 
ATOM   6762  C  CE    . LYS I 5  499  ? 265.110 265.633 289.041 1.00 109.05 ? 499  LYS I CE    1 
ATOM   6763  N  NZ    . LYS I 5  499  ? 264.557 266.497 287.973 1.00 109.05 ? 499  LYS I NZ    1 
ATOM   6764  N  N     . LEU I 5  500  ? 265.225 263.634 293.367 1.00 102.44 ? 500  LEU I N     1 
ATOM   6765  C  CA    . LEU I 5  500  ? 264.676 264.414 294.487 1.00 102.44 ? 500  LEU I CA    1 
ATOM   6766  C  C     . LEU I 5  500  ? 265.390 263.916 295.720 1.00 102.44 ? 500  LEU I C     1 
ATOM   6767  O  O     . LEU I 5  500  ? 265.718 264.730 296.581 1.00 102.44 ? 500  LEU I O     1 
ATOM   6768  C  CB    . LEU I 5  500  ? 263.184 264.137 294.607 1.00 102.44 ? 500  LEU I CB    1 
ATOM   6769  C  CG    . LEU I 5  500  ? 262.293 265.192 293.965 1.00 102.44 ? 500  LEU I CG    1 
ATOM   6770  C  CD1   . LEU I 5  500  ? 260.827 264.898 294.238 1.00 102.44 ? 500  LEU I CD1   1 
ATOM   6771  C  CD2   . LEU I 5  500  ? 262.665 266.577 294.466 1.00 102.44 ? 500  LEU I CD2   1 
ATOM   6772  N  N     . THR I 5  501  ? 265.593 262.611 295.796 1.00 113.02 ? 501  THR I N     1 
ATOM   6773  C  CA    . THR I 5  501  ? 266.226 262.036 297.006 1.00 113.02 ? 501  THR I CA    1 
ATOM   6774  C  C     . THR I 5  501  ? 267.655 262.542 297.196 1.00 113.02 ? 501  THR I C     1 
ATOM   6775  O  O     . THR I 5  501  ? 268.037 262.813 298.344 1.00 113.02 ? 501  THR I O     1 
ATOM   6776  C  CB    . THR I 5  501  ? 266.320 260.518 296.892 1.00 113.02 ? 501  THR I CB    1 
ATOM   6777  O  OG1   . THR I 5  501  ? 267.122 260.152 295.773 1.00 113.02 ? 501  THR I OG1   1 
ATOM   6778  C  CG2   . THR I 5  501  ? 264.974 259.830 296.863 1.00 113.02 ? 501  THR I CG2   1 
ATOM   6779  N  N     . LYS I 5  502  ? 268.423 262.628 296.116 1.00 111.00 ? 502  LYS I N     1 
ATOM   6780  C  CA    . LYS I 5  502  ? 269.800 263.177 296.222 1.00 111.00 ? 502  LYS I CA    1 
ATOM   6781  C  C     . LYS I 5  502  ? 269.746 264.617 296.737 1.00 111.00 ? 502  LYS I C     1 
ATOM   6782  O  O     . LYS I 5  502  ? 270.664 265.044 297.476 1.00 111.00 ? 502  LYS I O     1 
ATOM   6783  C  CB    . LYS I 5  502  ? 270.380 263.350 294.820 1.00 111.00 ? 502  LYS I CB    1 
ATOM   6784  C  CG    . LYS I 5  502  ? 270.779 262.081 294.086 1.00 111.00 ? 502  LYS I CG    1 
ATOM   6785  C  CD    . LYS I 5  502  ? 271.545 262.413 292.830 1.00 111.00 ? 502  LYS I CD    1 
ATOM   6786  C  CE    . LYS I 5  502  ? 271.050 263.691 292.188 1.00 111.00 ? 502  LYS I CE    1 
ATOM   6787  N  NZ    . LYS I 5  502  ? 272.087 264.324 291.341 1.00 111.00 ? 502  LYS I NZ    1 
ATOM   6788  N  N     . ALA I 5  503  ? 268.793 265.387 296.229 1.00 111.57 ? 503  ALA I N     1 
ATOM   6789  C  CA    . ALA I 5  503  ? 268.728 266.799 296.658 1.00 111.57 ? 503  ALA I CA    1 
ATOM   6790  C  C     . ALA I 5  503  ? 268.387 266.839 298.142 1.00 111.57 ? 503  ALA I C     1 
ATOM   6791  O  O     . ALA I 5  503  ? 268.811 267.747 298.879 1.00 111.57 ? 503  ALA I O     1 
ATOM   6792  C  CB    . ALA I 5  503  ? 267.679 267.491 295.844 1.00 111.57 ? 503  ALA I CB    1 
ATOM   6793  N  N     . VAL I 5  504  ? 267.539 265.926 298.529 1.00 104.30 ? 504  VAL I N     1 
ATOM   6794  C  CA    . VAL I 5  504  ? 267.090 265.913 299.931 1.00 104.30 ? 504  VAL I CA    1 
ATOM   6795  C  C     . VAL I 5  504  ? 268.333 265.660 300.740 1.00 104.30 ? 504  VAL I C     1 
ATOM   6796  O  O     . VAL I 5  504  ? 268.485 266.180 301.886 1.00 104.30 ? 504  VAL I O     1 
ATOM   6797  C  CB    . VAL I 5  504  ? 266.137 264.718 300.031 1.00 104.30 ? 504  VAL I CB    1 
ATOM   6798  C  CG1   . VAL I 5  504  ? 266.268 263.938 301.327 1.00 104.30 ? 504  VAL I CG1   1 
ATOM   6799  C  CG2   . VAL I 5  504  ? 264.703 265.147 299.788 1.00 104.30 ? 504  VAL I CG2   1 
ATOM   6800  N  N     . ALA I 5  505  ? 269.132 264.791 300.187 1.00 100.32 ? 505  ALA I N     1 
ATOM   6801  C  CA    . ALA I 5  505  ? 270.323 264.419 300.939 1.00 100.32 ? 505  ALA I CA    1 
ATOM   6802  C  C     . ALA I 5  505  ? 271.181 265.647 301.122 1.00 100.32 ? 505  ALA I C     1 
ATOM   6803  O  O     . ALA I 5  505  ? 271.624 265.948 302.246 1.00 100.32 ? 505  ALA I O     1 
ATOM   6804  C  CB    . ALA I 5  505  ? 271.045 263.450 300.079 1.00 100.32 ? 505  ALA I CB    1 
ATOM   6805  N  N     . THR I 5  506  ? 271.484 266.332 300.010 1.00 107.80 ? 506  THR I N     1 
ATOM   6806  C  CA    . THR I 5  506  ? 272.343 267.541 300.062 1.00 107.80 ? 506  THR I CA    1 
ATOM   6807  C  C     . THR I 5  506  ? 271.724 268.587 300.989 1.00 107.80 ? 506  THR I C     1 
ATOM   6808  O  O     . THR I 5  506  ? 272.496 269.421 301.499 1.00 107.80 ? 506  THR I O     1 
ATOM   6809  C  CB    . THR I 5  506  ? 272.595 268.124 298.666 1.00 107.80 ? 506  THR I CB    1 
ATOM   6810  O  OG1   . THR I 5  506  ? 271.345 268.542 298.118 1.00 107.80 ? 506  THR I OG1   1 
ATOM   6811  C  CG2   . THR I 5  506  ? 273.282 267.153 297.733 1.00 107.80 ? 506  THR I CG2   1 
ATOM   6812  N  N     . TYR I 5  507  ? 270.392 268.575 301.142 1.00 113.83 ? 507  TYR I N     1 
ATOM   6813  C  CA    . TYR I 5  507  ? 269.716 269.523 302.056 1.00 113.83 ? 507  TYR I CA    1 
ATOM   6814  C  C     . TYR I 5  507  ? 269.992 269.149 303.510 1.00 113.83 ? 507  TYR I C     1 
ATOM   6815  O  O     . TYR I 5  507  ? 270.451 270.052 304.219 1.00 113.83 ? 507  TYR I O     1 
ATOM   6816  C  CB    . TYR I 5  507  ? 268.214 269.648 301.803 1.00 113.83 ? 507  TYR I CB    1 
ATOM   6817  C  CG    . TYR I 5  507  ? 267.612 270.735 302.653 1.00 113.83 ? 507  TYR I CG    1 
ATOM   6818  C  CD1   . TYR I 5  507  ? 267.352 270.525 303.996 1.00 113.83 ? 507  TYR I CD1   1 
ATOM   6819  C  CD2   . TYR I 5  507  ? 267.375 271.997 302.137 1.00 113.83 ? 507  TYR I CD2   1 
ATOM   6820  C  CE1   . TYR I 5  507  ? 266.839 271.530 304.798 1.00 113.83 ? 507  TYR I CE1   1 
ATOM   6821  C  CE2   . TYR I 5  507  ? 266.857 273.012 302.923 1.00 113.83 ? 507  TYR I CE2   1 
ATOM   6822  C  CZ    . TYR I 5  507  ? 266.580 272.776 304.258 1.00 113.83 ? 507  TYR I CZ    1 
ATOM   6823  O  OH    . TYR I 5  507  ? 266.065 273.768 305.040 1.00 113.83 ? 507  TYR I OH    1 
ATOM   6824  N  N     . HIS I 5  508  ? 269.793 267.884 303.938 1.00 108.50 ? 508  HIS I N     1 
ATOM   6825  C  CA    . HIS I 5  508  ? 269.952 267.567 305.371 1.00 108.50 ? 508  HIS I CA    1 
ATOM   6826  C  C     . HIS I 5  508  ? 271.418 267.795 305.666 1.00 108.50 ? 508  HIS I C     1 
ATOM   6827  O  O     . HIS I 5  508  ? 271.760 268.301 306.748 1.00 108.50 ? 508  HIS I O     1 
ATOM   6828  C  CB    . HIS I 5  508  ? 269.515 266.139 305.638 1.00 108.50 ? 508  HIS I CB    1 
ATOM   6829  C  CG    . HIS I 5  508  ? 268.154 265.889 305.096 1.00 108.50 ? 508  HIS I CG    1 
ATOM   6830  N  ND1   . HIS I 5  508  ? 267.213 266.893 305.020 1.00 108.50 ? 508  HIS I ND1   1 
ATOM   6831  C  CD2   . HIS I 5  508  ? 267.575 264.782 304.590 1.00 108.50 ? 508  HIS I CD2   1 
ATOM   6832  C  CE1   . HIS I 5  508  ? 266.105 266.413 304.494 1.00 108.50 ? 508  HIS I CE1   1 
ATOM   6833  N  NE2   . HIS I 5  508  ? 266.299 265.120 304.232 1.00 108.50 ? 508  HIS I NE2   1 
ATOM   6834  N  N     . ALA I 5  509  ? 272.253 267.423 304.712 1.00 117.57 ? 509  ALA I N     1 
ATOM   6835  C  CA    . ALA I 5  509  ? 273.699 267.523 304.994 1.00 117.57 ? 509  ALA I CA    1 
ATOM   6836  C  C     . ALA I 5  509  ? 274.147 268.971 305.208 1.00 117.57 ? 509  ALA I C     1 
ATOM   6837  O  O     . ALA I 5  509  ? 274.949 269.226 306.143 1.00 117.57 ? 509  ALA I O     1 
ATOM   6838  C  CB    . ALA I 5  509  ? 274.442 266.905 303.836 1.00 117.57 ? 509  ALA I CB    1 
ATOM   6839  N  N     . ASN I 5  510  ? 273.774 269.849 304.267 1.00 111.97 ? 510  ASN I N     1 
ATOM   6840  C  CA    . ASN I 5  510  ? 274.188 271.274 304.336 1.00 111.97 ? 510  ASN I CA    1 
ATOM   6841  C  C     . ASN I 5  510  ? 273.586 271.886 305.598 1.00 111.97 ? 510  ASN I C     1 
ATOM   6842  O  O     . ASN I 5  510  ? 274.151 272.879 306.094 1.00 111.97 ? 510  ASN I O     1 
ATOM   6843  C  CB    . ASN I 5  510  ? 273.776 272.051 303.083 1.00 111.97 ? 510  ASN I CB    1 
ATOM   6844  C  CG    . ASN I 5  510  ? 272.586 272.959 303.311 1.00 111.97 ? 510  ASN I CG    1 
ATOM   6845  O  OD1   . ASN I 5  510  ? 272.738 274.078 303.796 1.00 111.97 ? 510  ASN I OD1   1 
ATOM   6846  N  ND2   . ASN I 5  510  ? 271.399 272.485 302.973 1.00 111.97 ? 510  ASN I ND2   1 
ATOM   6847  N  N     . THR I 5  511  ? 272.491 271.307 306.102 1.00 112.96 ? 511  THR I N     1 
ATOM   6848  C  CA    . THR I 5  511  ? 271.947 271.811 307.376 1.00 112.96 ? 511  THR I CA    1 
ATOM   6849  C  C     . THR I 5  511  ? 272.851 271.379 308.529 1.00 112.96 ? 511  THR I C     1 
ATOM   6850  O  O     . THR I 5  511  ? 273.331 272.235 309.264 1.00 112.96 ? 511  THR I O     1 
ATOM   6851  C  CB    . THR I 5  511  ? 270.547 271.226 307.566 1.00 112.96 ? 511  THR I CB    1 
ATOM   6852  O  OG1   . THR I 5  511  ? 269.963 271.122 306.269 1.00 112.96 ? 511  THR I OG1   1 
ATOM   6853  C  CG2   . THR I 5  511  ? 269.669 272.075 308.457 1.00 112.96 ? 511  THR I CG2   1 
ATOM   6854  N  N     . GLU I 5  512  ? 273.189 270.112 308.590 1.00 112.04 ? 512  GLU I N     1 
ATOM   6855  C  CA    . GLU I 5  512  ? 273.990 269.719 309.756 1.00 112.04 ? 512  GLU I CA    1 
ATOM   6856  C  C     . GLU I 5  512  ? 275.327 270.434 309.742 1.00 112.04 ? 512  GLU I C     1 
ATOM   6857  O  O     . GLU I 5  512  ? 275.832 270.747 310.794 1.00 112.04 ? 512  GLU I O     1 
ATOM   6858  C  CB    . GLU I 5  512  ? 274.377 268.267 309.550 1.00 112.04 ? 512  GLU I CB    1 
ATOM   6859  C  CG    . GLU I 5  512  ? 273.190 267.331 309.449 1.00 112.04 ? 512  GLU I CG    1 
ATOM   6860  C  CD    . GLU I 5  512  ? 272.318 267.245 310.691 1.00 112.04 ? 512  GLU I CD    1 
ATOM   6861  O  OE1   . GLU I 5  512  ? 272.534 268.043 311.621 1.00 112.04 ? 512  GLU I OE1   1 
ATOM   6862  O  OE2   . GLU I 5  512  ? 271.422 266.379 310.721 1.00 112.04 ? 512  GLU I OE2   1 
ATOM   6863  N  N     . ARG I 5  513  ? 275.945 270.540 308.587 1.00 111.00 ? 513  ARG I N     1 
ATOM   6864  C  CA    . ARG I 5  513  ? 277.321 271.087 308.610 1.00 111.00 ? 513  ARG I CA    1 
ATOM   6865  C  C     . ARG I 5  513  ? 277.363 272.579 308.869 1.00 111.00 ? 513  ARG I C     1 
ATOM   6866  O  O     . ARG I 5  513  ? 278.461 273.116 309.083 1.00 111.00 ? 513  ARG I O     1 
ATOM   6867  C  CB    . ARG I 5  513  ? 278.049 270.777 307.305 1.00 111.00 ? 513  ARG I CB    1 
ATOM   6868  C  CG    . ARG I 5  513  ? 278.287 269.292 307.069 1.00 111.00 ? 513  ARG I CG    1 
ATOM   6869  C  CD    . ARG I 5  513  ? 279.126 268.631 308.149 1.00 111.00 ? 513  ARG I CD    1 
ATOM   6870  N  NE    . ARG I 5  513  ? 278.527 268.715 309.474 1.00 111.00 ? 513  ARG I NE    1 
ATOM   6871  C  CZ    . ARG I 5  513  ? 278.988 268.096 310.555 1.00 111.00 ? 513  ARG I CZ    1 
ATOM   6872  N  NH1   . ARG I 5  513  ? 280.065 267.333 310.475 1.00 111.00 ? 513  ARG I NH1   1 
ATOM   6873  N  NH2   . ARG I 5  513  ? 278.370 268.242 311.713 1.00 111.00 ? 513  ARG I NH2   1 
ATOM   6874  N  N     . GLU I 5  514  ? 276.282 273.260 308.566 1.00 114.76 ? 514  GLU I N     1 
ATOM   6875  C  CA    . GLU I 5  514  ? 276.405 274.725 308.743 1.00 114.76 ? 514  GLU I CA    1 
ATOM   6876  C  C     . GLU I 5  514  ? 275.946 274.915 310.160 1.00 114.76 ? 514  GLU I C     1 
ATOM   6877  O  O     . GLU I 5  514  ? 275.971 276.034 310.702 1.00 114.76 ? 514  GLU I O     1 
ATOM   6878  C  CB    . GLU I 5  514  ? 275.527 275.468 307.730 1.00 114.76 ? 514  GLU I CB    1 
ATOM   6879  C  CG    . GLU I 5  514  ? 275.282 276.927 308.071 1.00 114.76 ? 514  GLU I CG    1 
ATOM   6880  C  CD    . GLU I 5  514  ? 274.342 277.163 309.243 1.00 114.76 ? 514  GLU I CD    1 
ATOM   6881  O  OE1   . GLU I 5  514  ? 273.443 276.326 309.456 1.00 114.76 ? 514  GLU I OE1   1 
ATOM   6882  O  OE2   . GLU I 5  514  ? 274.534 278.164 309.960 1.00 114.76 ? 514  GLU I OE2   1 
ATOM   6883  N  N     . GLN I 5  515  ? 275.318 273.859 310.624 1.00 117.37 ? 515  GLN I N     1 
ATOM   6884  C  CA    . GLN I 5  515  ? 274.981 273.911 312.035 1.00 117.37 ? 515  GLN I CA    1 
ATOM   6885  C  C     . GLN I 5  515  ? 276.385 273.914 312.578 1.00 117.37 ? 515  GLN I C     1 
ATOM   6886  O  O     . GLN I 5  515  ? 276.747 274.767 313.411 1.00 117.37 ? 515  GLN I O     1 
ATOM   6887  C  CB    . GLN I 5  515  ? 274.279 272.604 312.367 1.00 117.37 ? 515  GLN I CB    1 
ATOM   6888  C  CG    . GLN I 5  515  ? 273.870 272.484 313.827 1.00 117.37 ? 515  GLN I CG    1 
ATOM   6889  C  CD    . GLN I 5  515  ? 272.735 273.411 314.184 1.00 117.37 ? 515  GLN I CD    1 
ATOM   6890  O  OE1   . GLN I 5  515  ? 272.476 273.688 315.354 1.00 117.37 ? 515  GLN I OE1   1 
ATOM   6891  N  NE2   . GLN I 5  515  ? 272.041 273.901 313.169 1.00 117.37 ? 515  GLN I NE2   1 
ATOM   6892  N  N     . LYS I 5  516  ? 277.174 273.064 311.955 1.00 102.80 ? 516  LYS I N     1 
ATOM   6893  C  CA    . LYS I 5  516  ? 278.527 272.960 312.485 1.00 102.80 ? 516  LYS I CA    1 
ATOM   6894  C  C     . LYS I 5  516  ? 279.069 274.369 312.391 1.00 102.80 ? 516  LYS I C     1 
ATOM   6895  O  O     . LYS I 5  516  ? 279.528 274.886 313.418 1.00 102.80 ? 516  LYS I O     1 
ATOM   6896  C  CB    . LYS I 5  516  ? 279.331 271.988 311.622 1.00 102.80 ? 516  LYS I CB    1 
ATOM   6897  C  CG    . LYS I 5  516  ? 280.716 271.633 312.145 1.00 102.80 ? 516  LYS I CG    1 
ATOM   6898  C  CD    . LYS I 5  516  ? 281.518 270.776 311.189 1.00 102.80 ? 516  LYS I CD    1 
ATOM   6899  C  CE    . LYS I 5  516  ? 282.002 271.537 309.976 1.00 102.80 ? 516  LYS I CE    1 
ATOM   6900  N  NZ    . LYS I 5  516  ? 282.936 272.625 310.348 1.00 102.80 ? 516  LYS I NZ    1 
ATOM   6901  N  N     . LYS I 5  517  ? 278.893 275.014 311.258 1.00 83.76  ? 517  LYS I N     1 
ATOM   6902  C  CA    . LYS I 5  517  ? 279.480 276.355 311.269 1.00 83.76  ? 517  LYS I CA    1 
ATOM   6903  C  C     . LYS I 5  517  ? 278.617 277.246 312.151 1.00 83.76  ? 517  LYS I C     1 
ATOM   6904  O  O     . LYS I 5  517  ? 279.195 277.766 313.145 1.00 83.76  ? 517  LYS I O     1 
ATOM   6905  C  CB    . LYS I 5  517  ? 279.763 276.845 309.862 1.00 83.76  ? 517  LYS I CB    1 
ATOM   6906  C  CG    . LYS I 5  517  ? 280.762 277.987 309.784 1.00 83.76  ? 517  LYS I CG    1 
ATOM   6907  C  CD    . LYS I 5  517  ? 282.162 277.600 310.186 1.00 83.76  ? 517  LYS I CD    1 
ATOM   6908  C  CE    . LYS I 5  517  ? 283.123 278.757 310.037 1.00 83.76  ? 517  LYS I CE    1 
ATOM   6909  N  NZ    . LYS I 5  517  ? 284.528 278.311 310.147 1.00 83.76  ? 517  LYS I NZ    1 
ATOM   6910  N  N     . LYS I 5  755  ? 308.211 230.391 306.502 1.00 200.45 ? 755  LYS I N     1 
ATOM   6911  C  CA    . LYS I 5  755  ? 307.952 230.004 307.880 1.00 200.45 ? 755  LYS I CA    1 
ATOM   6912  C  C     . LYS I 5  755  ? 309.239 229.585 308.544 1.00 200.45 ? 755  LYS I C     1 
ATOM   6913  O  O     . LYS I 5  755  ? 309.240 229.285 309.731 1.00 200.45 ? 755  LYS I O     1 
ATOM   6914  C  CB    . LYS I 5  755  ? 306.965 228.845 307.958 1.00 200.45 ? 755  LYS I CB    1 
ATOM   6915  C  CG    . LYS I 5  755  ? 307.563 227.570 307.394 1.00 200.45 ? 755  LYS I CG    1 
ATOM   6916  C  CD    . LYS I 5  755  ? 306.632 226.393 307.471 1.00 200.45 ? 755  LYS I CD    1 
ATOM   6917  C  CE    . LYS I 5  755  ? 307.285 225.184 306.840 1.00 200.45 ? 755  LYS I CE    1 
ATOM   6918  N  NZ    . LYS I 5  755  ? 307.466 225.387 305.379 1.00 200.45 ? 755  LYS I NZ    1 
ATOM   6919  N  N     . GLN I 5  756  ? 310.327 229.569 307.765 1.00 212.33 ? 756  GLN I N     1 
ATOM   6920  C  CA    . GLN I 5  756  ? 311.513 228.791 308.112 1.00 212.33 ? 756  GLN I CA    1 
ATOM   6921  C  C     . GLN I 5  756  ? 312.209 229.324 309.356 1.00 212.33 ? 756  GLN I C     1 
ATOM   6922  O  O     . GLN I 5  756  ? 312.266 228.641 310.383 1.00 212.33 ? 756  GLN I O     1 
ATOM   6923  C  CB    . GLN I 5  756  ? 312.490 228.784 306.940 1.00 212.33 ? 756  GLN I CB    1 
ATOM   6924  C  CG    . GLN I 5  756  ? 311.993 228.035 305.734 1.00 212.33 ? 756  GLN I CG    1 
ATOM   6925  C  CD    . GLN I 5  756  ? 313.086 227.792 304.725 1.00 212.33 ? 756  GLN I CD    1 
ATOM   6926  O  OE1   . GLN I 5  756  ? 314.243 228.142 304.948 1.00 212.33 ? 756  GLN I OE1   1 
ATOM   6927  N  NE2   . GLN I 5  756  ? 312.726 227.188 303.603 1.00 212.33 ? 756  GLN I NE2   1 
ATOM   6928  N  N     . TYR I 5  757  ? 312.736 230.546 309.277 1.00 218.46 ? 757  TYR I N     1 
ATOM   6929  C  CA    . TYR I 5  757  ? 313.060 231.293 310.487 1.00 218.46 ? 757  TYR I CA    1 
ATOM   6930  C  C     . TYR I 5  757  ? 311.788 231.879 311.091 1.00 218.46 ? 757  TYR I C     1 
ATOM   6931  O  O     . TYR I 5  757  ? 311.739 232.218 312.287 1.00 218.46 ? 757  TYR I O     1 
ATOM   6932  C  CB    . TYR I 5  757  ? 314.073 232.408 310.173 1.00 218.46 ? 757  TYR I CB    1 
ATOM   6933  C  CG    . TYR I 5  757  ? 315.256 232.016 309.300 1.00 218.46 ? 757  TYR I CG    1 
ATOM   6934  C  CD1   . TYR I 5  757  ? 315.187 232.114 307.915 1.00 218.46 ? 757  TYR I CD1   1 
ATOM   6935  C  CD2   . TYR I 5  757  ? 316.445 231.577 309.859 1.00 218.46 ? 757  TYR I CD2   1 
ATOM   6936  C  CE1   . TYR I 5  757  ? 316.261 231.767 307.108 1.00 218.46 ? 757  TYR I CE1   1 
ATOM   6937  C  CE2   . TYR I 5  757  ? 317.531 231.231 309.057 1.00 218.46 ? 757  TYR I CE2   1 
ATOM   6938  C  CZ    . TYR I 5  757  ? 317.427 231.329 307.682 1.00 218.46 ? 757  TYR I CZ    1 
ATOM   6939  O  OH    . TYR I 5  757  ? 318.489 230.990 306.878 1.00 218.46 ? 757  TYR I OH    1 
ATOM   6940  N  N     . GLN I 5  758  ? 310.738 231.978 310.279 1.00 210.86 ? 758  GLN I N     1 
ATOM   6941  C  CA    . GLN I 5  758  ? 309.592 232.775 310.663 1.00 210.86 ? 758  GLN I CA    1 
ATOM   6942  C  C     . GLN I 5  758  ? 308.667 232.070 311.633 1.00 210.86 ? 758  GLN I C     1 
ATOM   6943  O  O     . GLN I 5  758  ? 307.801 232.730 312.199 1.00 210.86 ? 758  GLN I O     1 
ATOM   6944  C  CB    . GLN I 5  758  ? 308.818 233.210 309.428 1.00 210.86 ? 758  GLN I CB    1 
ATOM   6945  C  CG    . GLN I 5  758  ? 309.345 234.491 308.836 1.00 210.86 ? 758  GLN I CG    1 
ATOM   6946  C  CD    . GLN I 5  758  ? 309.060 235.674 309.717 1.00 210.86 ? 758  GLN I CD    1 
ATOM   6947  O  OE1   . GLN I 5  758  ? 308.119 235.652 310.493 1.00 210.86 ? 758  GLN I OE1   1 
ATOM   6948  N  NE2   . GLN I 5  758  ? 309.877 236.711 309.613 1.00 210.86 ? 758  GLN I NE2   1 
ATOM   6949  N  N     . ILE I 5  759  ? 308.841 230.776 311.875 1.00 214.69 ? 759  ILE I N     1 
ATOM   6950  C  CA    . ILE I 5  759  ? 308.112 230.165 312.981 1.00 214.69 ? 759  ILE I CA    1 
ATOM   6951  C  C     . ILE I 5  759  ? 308.697 230.638 314.318 1.00 214.69 ? 759  ILE I C     1 
ATOM   6952  O  O     . ILE I 5  759  ? 307.961 230.944 315.272 1.00 214.69 ? 759  ILE I O     1 
ATOM   6953  C  CB    . ILE I 5  759  ? 308.097 228.630 312.805 1.00 214.69 ? 759  ILE I CB    1 
ATOM   6954  C  CG1   . ILE I 5  759  ? 306.948 228.239 311.854 1.00 214.69 ? 759  ILE I CG1   1 
ATOM   6955  C  CG2   . ILE I 5  759  ? 308.003 227.887 314.138 1.00 214.69 ? 759  ILE I CG2   1 
ATOM   6956  C  CD1   . ILE I 5  759  ? 306.936 226.789 311.412 1.00 214.69 ? 759  ILE I CD1   1 
ATOM   6957  N  N     . LYS I 5  760  ? 310.019 230.806 314.383 1.00 217.17 ? 760  LYS I N     1 
ATOM   6958  C  CA    . LYS I 5  760  ? 310.592 231.449 315.561 1.00 217.17 ? 760  LYS I CA    1 
ATOM   6959  C  C     . LYS I 5  760  ? 310.249 232.938 315.599 1.00 217.17 ? 760  LYS I C     1 
ATOM   6960  O  O     . LYS I 5  760  ? 310.092 233.513 316.685 1.00 217.17 ? 760  LYS I O     1 
ATOM   6961  C  CB    . LYS I 5  760  ? 312.107 231.214 315.602 1.00 217.17 ? 760  LYS I CB    1 
ATOM   6962  C  CG    . LYS I 5  760  ? 312.836 231.881 316.769 1.00 217.17 ? 760  LYS I CG    1 
ATOM   6963  C  CD    . LYS I 5  760  ? 312.241 231.498 318.115 1.00 217.17 ? 760  LYS I CD    1 
ATOM   6964  C  CE    . LYS I 5  760  ? 312.341 232.656 319.097 1.00 217.17 ? 760  LYS I CE    1 
ATOM   6965  N  NZ    . LYS I 5  760  ? 311.366 233.736 318.788 1.00 217.17 ? 760  LYS I NZ    1 
ATOM   6966  N  N     . GLY I 5  761  ? 310.075 233.565 314.434 1.00 218.20 ? 761  GLY I N     1 
ATOM   6967  C  CA    . GLY I 5  761  ? 309.676 234.971 314.422 1.00 218.20 ? 761  GLY I CA    1 
ATOM   6968  C  C     . GLY I 5  761  ? 308.248 235.202 314.893 1.00 218.20 ? 761  GLY I C     1 
ATOM   6969  O  O     . GLY I 5  761  ? 307.949 236.217 315.537 1.00 218.20 ? 761  GLY I O     1 
ATOM   6970  N  N     . LEU I 5  762  ? 307.343 234.299 314.505 1.00 215.07 ? 762  LEU I N     1 
ATOM   6971  C  CA    . LEU I 5  762  ? 306.055 234.086 315.146 1.00 215.07 ? 762  LEU I CA    1 
ATOM   6972  C  C     . LEU I 5  762  ? 306.185 234.059 316.655 1.00 215.07 ? 762  LEU I C     1 
ATOM   6973  O  O     . LEU I 5  762  ? 305.512 234.823 317.354 1.00 215.07 ? 762  LEU I O     1 
ATOM   6974  C  CB    . LEU I 5  762  ? 305.471 232.763 314.642 1.00 215.07 ? 762  LEU I CB    1 
ATOM   6975  C  CG    . LEU I 5  762  ? 304.294 232.047 315.305 1.00 215.07 ? 762  LEU I CG    1 
ATOM   6976  C  CD1   . LEU I 5  762  ? 302.954 232.664 314.988 1.00 215.07 ? 762  LEU I CD1   1 
ATOM   6977  C  CD2   . LEU I 5  762  ? 304.329 230.562 314.978 1.00 215.07 ? 762  LEU I CD2   1 
ATOM   6978  N  N     . GLU I 5  763  ? 307.063 233.179 317.157 1.00 211.05 ? 763  GLU I N     1 
ATOM   6979  C  CA    . GLU I 5  763  ? 307.231 233.031 318.605 1.00 211.05 ? 763  GLU I CA    1 
ATOM   6980  C  C     . GLU I 5  763  ? 307.697 234.334 319.258 1.00 211.05 ? 763  GLU I C     1 
ATOM   6981  O  O     . GLU I 5  763  ? 307.167 234.735 320.302 1.00 211.05 ? 763  GLU I O     1 
ATOM   6982  C  CB    . GLU I 5  763  ? 308.201 231.885 318.903 1.00 211.05 ? 763  GLU I CB    1 
ATOM   6983  C  CG    . GLU I 5  763  ? 307.639 230.491 318.604 1.00 211.05 ? 763  GLU I CG    1 
ATOM   6984  C  CD    . GLU I 5  763  ? 308.643 229.374 318.839 1.00 211.05 ? 763  GLU I CD    1 
ATOM   6985  O  OE1   . GLU I 5  763  ? 309.333 229.397 319.877 1.00 211.05 ? 763  GLU I OE1   1 
ATOM   6986  O  OE2   . GLU I 5  763  ? 308.736 228.467 317.983 1.00 211.05 ? 763  GLU I OE2   1 
ATOM   6987  N  N     . TRP I 5  764  ? 308.602 235.049 318.598 1.00 198.63 ? 764  TRP I N     1 
ATOM   6988  C  CA    . TRP I 5  764  ? 309.059 236.364 319.037 1.00 198.63 ? 764  TRP I CA    1 
ATOM   6989  C  C     . TRP I 5  764  ? 307.924 237.380 319.116 1.00 198.63 ? 764  TRP I C     1 
ATOM   6990  O  O     . TRP I 5  764  ? 307.608 237.905 320.192 1.00 198.63 ? 764  TRP I O     1 
ATOM   6991  C  CB    . TRP I 5  764  ? 310.138 236.892 318.086 1.00 198.63 ? 764  TRP I CB    1 
ATOM   6992  C  CG    . TRP I 5  764  ? 310.563 238.327 318.327 1.00 198.63 ? 764  TRP I CG    1 
ATOM   6993  C  CD1   . TRP I 5  764  ? 309.995 239.460 317.815 1.00 198.63 ? 764  TRP I CD1   1 
ATOM   6994  C  CD2   . TRP I 5  764  ? 311.664 238.765 319.111 1.00 198.63 ? 764  TRP I CD2   1 
ATOM   6995  N  NE1   . TRP I 5  764  ? 310.663 240.565 318.245 1.00 198.63 ? 764  TRP I NE1   1 
ATOM   6996  C  CE2   . TRP I 5  764  ? 311.695 240.167 319.044 1.00 198.63 ? 764  TRP I CE2   1 
ATOM   6997  C  CE3   . TRP I 5  764  ? 312.627 238.107 319.869 1.00 198.63 ? 764  TRP I CE3   1 
ATOM   6998  C  CZ2   . TRP I 5  764  ? 312.646 240.919 319.705 1.00 198.63 ? 764  TRP I CZ2   1 
ATOM   6999  C  CZ3   . TRP I 5  764  ? 313.571 238.855 320.525 1.00 198.63 ? 764  TRP I CZ3   1 
ATOM   7000  C  CH2   . TRP I 5  764  ? 313.576 240.247 320.441 1.00 198.63 ? 764  TRP I CH2   1 
ATOM   7001  N  N     . LEU I 5  765  ? 307.308 237.682 317.982 1.00 196.56 ? 765  LEU I N     1 
ATOM   7002  C  CA    . LEU I 5  765  ? 306.427 238.836 318.001 1.00 196.56 ? 765  LEU I CA    1 
ATOM   7003  C  C     . LEU I 5  765  ? 305.046 238.494 318.549 1.00 196.56 ? 765  LEU I C     1 
ATOM   7004  O  O     . LEU I 5  765  ? 304.240 239.402 318.762 1.00 196.56 ? 765  LEU I O     1 
ATOM   7005  C  CB    . LEU I 5  765  ? 306.350 239.459 316.609 1.00 196.56 ? 765  LEU I CB    1 
ATOM   7006  C  CG    . LEU I 5  765  ? 306.054 240.961 316.580 1.00 196.56 ? 765  LEU I CG    1 
ATOM   7007  C  CD1   . LEU I 5  765  ? 307.134 241.701 317.315 1.00 196.56 ? 765  LEU I CD1   1 
ATOM   7008  C  CD2   . LEU I 5  765  ? 306.027 241.464 315.181 1.00 196.56 ? 765  LEU I CD2   1 
ATOM   7009  N  N     . VAL I 5  766  ? 304.770 237.221 318.849 1.00 211.69 ? 766  VAL I N     1 
ATOM   7010  C  CA    . VAL I 5  766  ? 303.613 236.873 319.667 1.00 211.69 ? 766  VAL I CA    1 
ATOM   7011  C  C     . VAL I 5  766  ? 303.968 236.845 321.154 1.00 211.69 ? 766  VAL I C     1 
ATOM   7012  O  O     . VAL I 5  766  ? 303.109 237.146 322.001 1.00 211.69 ? 766  VAL I O     1 
ATOM   7013  C  CB    . VAL I 5  766  ? 302.993 235.541 319.172 1.00 211.69 ? 766  VAL I CB    1 
ATOM   7014  C  CG1   . VAL I 5  766  ? 301.846 235.044 320.038 1.00 211.69 ? 766  VAL I CG1   1 
ATOM   7015  C  CG2   . VAL I 5  766  ? 302.437 235.722 317.782 1.00 211.69 ? 766  VAL I CG2   1 
ATOM   7016  N  N     . SER I 5  767  ? 305.247 236.651 321.494 1.00 211.66 ? 767  SER I N     1 
ATOM   7017  C  CA    . SER I 5  767  ? 305.663 237.035 322.837 1.00 211.66 ? 767  SER I CA    1 
ATOM   7018  C  C     . SER I 5  767  ? 305.699 238.551 323.021 1.00 211.66 ? 767  SER I C     1 
ATOM   7019  O  O     . SER I 5  767  ? 305.826 239.014 324.159 1.00 211.66 ? 767  SER I O     1 
ATOM   7020  C  CB    . SER I 5  767  ? 307.033 236.436 323.181 1.00 211.66 ? 767  SER I CB    1 
ATOM   7021  O  OG    . SER I 5  767  ? 307.967 236.583 322.132 1.00 211.66 ? 767  SER I OG    1 
ATOM   7022  N  N     . LEU I 5  768  ? 305.611 239.329 321.931 1.00 203.37 ? 768  LEU I N     1 
ATOM   7023  C  CA    . LEU I 5  768  ? 305.456 240.783 322.035 1.00 203.37 ? 768  LEU I CA    1 
ATOM   7024  C  C     . LEU I 5  768  ? 304.161 241.287 321.368 1.00 203.37 ? 768  LEU I C     1 
ATOM   7025  O  O     . LEU I 5  768  ? 304.065 242.462 320.993 1.00 203.37 ? 768  LEU I O     1 
ATOM   7026  C  CB    . LEU I 5  768  ? 306.689 241.509 321.479 1.00 203.37 ? 768  LEU I CB    1 
ATOM   7027  C  CG    . LEU I 5  768  ? 307.960 241.580 322.363 1.00 203.37 ? 768  LEU I CG    1 
ATOM   7028  C  CD1   . LEU I 5  768  ? 308.780 240.287 322.384 1.00 203.37 ? 768  LEU I CD1   1 
ATOM   7029  C  CD2   . LEU I 5  768  ? 308.853 242.749 321.989 1.00 203.37 ? 768  LEU I CD2   1 
ATOM   7030  N  N     . TYR I 5  769  ? 303.069 240.516 321.502 1.00 184.20 ? 769  TYR I N     1 
ATOM   7031  C  CA    . TYR I 5  769  ? 301.732 240.982 321.026 1.00 184.20 ? 769  TYR I CA    1 
ATOM   7032  C  C     . TYR I 5  769  ? 300.643 240.452 321.968 1.00 184.20 ? 769  TYR I C     1 
ATOM   7033  O  O     . TYR I 5  769  ? 299.486 240.904 321.848 1.00 184.20 ? 769  TYR I O     1 
ATOM   7034  C  CB    . TYR I 5  769  ? 301.421 240.433 319.632 1.00 184.20 ? 769  TYR I CB    1 
ATOM   7035  C  CG    . TYR I 5  769  ? 299.987 240.009 319.431 1.00 184.20 ? 769  TYR I CG    1 
ATOM   7036  C  CD1   . TYR I 5  769  ? 298.985 240.944 319.229 1.00 184.20 ? 769  TYR I CD1   1 
ATOM   7037  C  CD2   . TYR I 5  769  ? 299.624 238.673 319.460 1.00 184.20 ? 769  TYR I CD2   1 
ATOM   7038  C  CE1   . TYR I 5  769  ? 297.665 240.568 319.051 1.00 184.20 ? 769  TYR I CE1   1 
ATOM   7039  C  CE2   . TYR I 5  769  ? 298.308 238.278 319.285 1.00 184.20 ? 769  TYR I CE2   1 
ATOM   7040  C  CZ    . TYR I 5  769  ? 297.324 239.228 319.079 1.00 184.20 ? 769  TYR I CZ    1 
ATOM   7041  O  OH    . TYR I 5  769  ? 296.024 238.852 318.904 1.00 184.20 ? 769  TYR I OH    1 
ATOM   7042  N  N     . ASN I 5  770  ? 300.991 239.552 322.893 1.00 198.82 ? 770  ASN I N     1 
ATOM   7043  C  CA    . ASN I 5  770  ? 299.993 238.870 323.769 1.00 198.82 ? 770  ASN I CA    1 
ATOM   7044  C  C     . ASN I 5  770  ? 299.277 239.769 324.789 1.00 198.82 ? 770  ASN I C     1 
ATOM   7045  O  O     . ASN I 5  770  ? 298.190 239.358 325.238 1.00 198.82 ? 770  ASN I O     1 
ATOM   7046  C  CB    . ASN I 5  770  ? 300.620 237.662 324.470 1.00 198.82 ? 770  ASN I CB    1 
ATOM   7047  C  CG    . ASN I 5  770  ? 302.013 237.952 324.989 1.00 198.82 ? 770  ASN I CG    1 
ATOM   7048  O  OD1   . ASN I 5  770  ? 302.525 239.058 324.824 1.00 198.82 ? 770  ASN I OD1   1 
ATOM   7049  N  ND2   . ASN I 5  770  ? 302.637 236.966 325.610 1.00 198.82 ? 770  ASN I ND2   1 
ATOM   7050  N  N     . ASN I 5  771  ? 299.841 240.917 325.171 1.00 187.44 ? 771  ASN I N     1 
ATOM   7051  C  CA    . ASN I 5  771  ? 299.251 241.727 326.279 1.00 187.44 ? 771  ASN I CA    1 
ATOM   7052  C  C     . ASN I 5  771  ? 297.807 242.160 325.989 1.00 187.44 ? 771  ASN I C     1 
ATOM   7053  O  O     . ASN I 5  771  ? 297.003 242.071 326.938 1.00 187.44 ? 771  ASN I O     1 
ATOM   7054  C  CB    . ASN I 5  771  ? 300.120 242.950 326.579 1.00 187.44 ? 771  ASN I CB    1 
ATOM   7055  C  CG    . ASN I 5  771  ? 300.426 243.774 325.346 1.00 187.44 ? 771  ASN I CG    1 
ATOM   7056  O  OD1   . ASN I 5  771  ? 300.125 243.363 324.228 1.00 187.44 ? 771  ASN I OD1   1 
ATOM   7057  N  ND2   . ASN I 5  771  ? 301.021 244.940 325.539 1.00 187.44 ? 771  ASN I ND2   1 
ATOM   7058  N  N     . ASN I 5  772  ? 297.466 242.445 324.719 1.00 172.21 ? 772  ASN I N     1 
ATOM   7059  C  CA    . ASN I 5  772  ? 296.131 242.967 324.303 1.00 172.21 ? 772  ASN I CA    1 
ATOM   7060  C  C     . ASN I 5  772  ? 296.147 244.485 324.477 1.00 172.21 ? 772  ASN I C     1 
ATOM   7061  O  O     . ASN I 5  772  ? 295.366 245.167 323.786 1.00 172.21 ? 772  ASN I O     1 
ATOM   7062  C  CB    . ASN I 5  772  ? 294.908 242.190 324.805 1.00 172.21 ? 772  ASN I CB    1 
ATOM   7063  C  CG    . ASN I 5  772  ? 293.652 242.500 324.019 1.00 172.21 ? 772  ASN I CG    1 
ATOM   7064  O  OD1   . ASN I 5  772  ? 293.677 243.303 323.089 1.00 172.21 ? 772  ASN I OD1   1 
ATOM   7065  N  ND2   . ASN I 5  772  ? 292.549 241.867 324.383 1.00 172.21 ? 772  ASN I ND2   1 
ATOM   7066  N  N     . LEU I 5  773  ? 297.005 244.990 325.367 1.00 160.77 ? 773  LEU I N     1 
ATOM   7067  C  CA    . LEU I 5  773  ? 297.170 246.461 325.476 1.00 160.77 ? 773  LEU I CA    1 
ATOM   7068  C  C     . LEU I 5  773  ? 297.963 246.881 324.239 1.00 160.77 ? 773  LEU I C     1 
ATOM   7069  O  O     . LEU I 5  773  ? 299.127 246.457 324.123 1.00 160.77 ? 773  LEU I O     1 
ATOM   7070  C  CB    . LEU I 5  773  ? 297.943 246.784 326.757 1.00 160.77 ? 773  LEU I CB    1 
ATOM   7071  C  CG    . LEU I 5  773  ? 298.071 248.273 327.070 1.00 160.77 ? 773  LEU I CG    1 
ATOM   7072  C  CD1   . LEU I 5  773  ? 296.704 248.938 327.083 1.00 160.77 ? 773  LEU I CD1   1 
ATOM   7073  C  CD2   . LEU I 5  773  ? 298.781 248.488 328.397 1.00 160.77 ? 773  LEU I CD2   1 
ATOM   7074  N  N     . ASN I 5  774  ? 297.363 247.672 323.348 1.00 150.97 ? 774  ASN I N     1 
ATOM   7075  C  CA    . ASN I 5  774  ? 298.037 248.010 322.066 1.00 150.97 ? 774  ASN I CA    1 
ATOM   7076  C  C     . ASN I 5  774  ? 299.339 248.776 322.279 1.00 150.97 ? 774  ASN I C     1 
ATOM   7077  O  O     . ASN I 5  774  ? 299.494 249.434 323.323 1.00 150.97 ? 774  ASN I O     1 
ATOM   7078  C  CB    . ASN I 5  774  ? 297.109 248.729 321.090 1.00 150.97 ? 774  ASN I CB    1 
ATOM   7079  C  CG    . ASN I 5  774  ? 295.810 247.979 320.913 1.00 150.97 ? 774  ASN I CG    1 
ATOM   7080  O  OD1   . ASN I 5  774  ? 295.727 246.798 321.240 1.00 150.97 ? 774  ASN I OD1   1 
ATOM   7081  N  ND2   . ASN I 5  774  ? 294.792 248.659 320.416 1.00 150.97 ? 774  ASN I ND2   1 
ATOM   7082  N  N     . GLY I 5  775  ? 300.238 248.689 321.301 1.00 132.99 ? 775  GLY I N     1 
ATOM   7083  C  CA    . GLY I 5  775  ? 301.495 249.402 321.379 1.00 132.99 ? 775  GLY I CA    1 
ATOM   7084  C  C     . GLY I 5  775  ? 302.350 249.170 320.160 1.00 132.99 ? 775  GLY I C     1 
ATOM   7085  O  O     . GLY I 5  775  ? 301.871 248.702 319.124 1.00 132.99 ? 775  GLY I O     1 
ATOM   7086  N  N     . ILE I 5  776  ? 303.634 249.495 320.304 1.00 116.60 ? 776  ILE I N     1 
ATOM   7087  C  CA    . ILE I 5  776  ? 304.560 249.468 319.185 1.00 116.60 ? 776  ILE I CA    1 
ATOM   7088  C  C     . ILE I 5  776  ? 305.973 249.418 319.749 1.00 116.60 ? 776  ILE I C     1 
ATOM   7089  O  O     . ILE I 5  776  ? 306.195 249.734 320.920 1.00 116.60 ? 776  ILE I O     1 
ATOM   7090  C  CB    . ILE I 5  776  ? 304.318 250.687 318.262 1.00 116.60 ? 776  ILE I CB    1 
ATOM   7091  C  CG1   . ILE I 5  776  ? 304.565 250.296 316.823 1.00 116.60 ? 776  ILE I CG1   1 
ATOM   7092  C  CG2   . ILE I 5  776  ? 305.181 251.839 318.634 1.00 116.60 ? 776  ILE I CG2   1 
ATOM   7093  C  CD1   . ILE I 5  776  ? 304.137 251.341 315.853 1.00 116.60 ? 776  ILE I CD1   1 
ATOM   7094  N  N     . LEU I 5  777  ? 306.925 248.978 318.913 1.00 124.07 ? 777  LEU I N     1 
ATOM   7095  C  CA    . LEU I 5  777  ? 308.295 248.630 319.302 1.00 124.07 ? 777  LEU I CA    1 
ATOM   7096  C  C     . LEU I 5  777  ? 309.174 248.397 318.066 1.00 124.07 ? 777  LEU I C     1 
ATOM   7097  O  O     . LEU I 5  777  ? 308.701 247.838 317.073 1.00 124.07 ? 777  LEU I O     1 
ATOM   7098  C  CB    . LEU I 5  777  ? 308.254 247.417 320.243 1.00 124.07 ? 777  LEU I CB    1 
ATOM   7099  C  CG    . LEU I 5  777  ? 307.398 246.217 319.815 1.00 124.07 ? 777  LEU I CG    1 
ATOM   7100  C  CD1   . LEU I 5  777  ? 308.215 245.113 319.168 1.00 124.07 ? 777  LEU I CD1   1 
ATOM   7101  C  CD2   . LEU I 5  777  ? 306.505 245.695 320.943 1.00 124.07 ? 777  LEU I CD2   1 
ATOM   7102  N  N     . ALA I 5  778  ? 310.453 248.805 318.107 1.00 130.67 ? 778  ALA I N     1 
ATOM   7103  C  CA    . ALA I 5  778  ? 311.275 248.917 316.897 1.00 130.67 ? 778  ALA I CA    1 
ATOM   7104  C  C     . ALA I 5  778  ? 312.661 248.297 316.936 1.00 130.67 ? 778  ALA I C     1 
ATOM   7105  O  O     . ALA I 5  778  ? 313.651 248.986 316.661 1.00 130.67 ? 778  ALA I O     1 
ATOM   7106  C  CB    . ALA I 5  778  ? 311.487 250.370 316.503 1.00 130.67 ? 778  ALA I CB    1 
ATOM   7107  N  N     . ASP I 5  779  ? 312.766 247.022 317.277 1.00 143.77 ? 779  ASP I N     1 
ATOM   7108  C  CA    . ASP I 5  779  ? 313.888 246.274 316.752 1.00 143.77 ? 779  ASP I CA    1 
ATOM   7109  C  C     . ASP I 5  779  ? 313.814 246.321 315.229 1.00 143.77 ? 779  ASP I C     1 
ATOM   7110  O  O     . ASP I 5  779  ? 312.727 246.300 314.643 1.00 143.77 ? 779  ASP I O     1 
ATOM   7111  C  CB    . ASP I 5  779  ? 313.885 244.830 317.265 1.00 143.77 ? 779  ASP I CB    1 
ATOM   7112  C  CG    . ASP I 5  779  ? 312.497 244.246 317.371 1.00 143.77 ? 779  ASP I CG    1 
ATOM   7113  O  OD1   . ASP I 5  779  ? 311.534 245.024 317.458 1.00 143.77 ? 779  ASP I OD1   1 
ATOM   7114  O  OD2   . ASP I 5  779  ? 312.363 243.010 317.327 1.00 143.77 ? 779  ASP I OD2   1 
ATOM   7115  N  N     . GLU I 5  780  ? 314.971 246.407 314.586 1.00 162.60 ? 780  GLU I N     1 
ATOM   7116  C  CA    . GLU I 5  780  ? 315.026 246.605 313.145 1.00 162.60 ? 780  GLU I CA    1 
ATOM   7117  C  C     . GLU I 5  780  ? 314.712 245.286 312.433 1.00 162.60 ? 780  GLU I C     1 
ATOM   7118  O  O     . GLU I 5  780  ? 314.381 244.280 313.062 1.00 162.60 ? 780  GLU I O     1 
ATOM   7119  C  CB    . GLU I 5  780  ? 316.380 247.205 312.793 1.00 162.60 ? 780  GLU I CB    1 
ATOM   7120  C  CG    . GLU I 5  780  ? 316.724 248.345 313.733 1.00 162.60 ? 780  GLU I CG    1 
ATOM   7121  C  CD    . GLU I 5  780  ? 317.935 249.126 313.304 1.00 162.60 ? 780  GLU I CD    1 
ATOM   7122  O  OE1   . GLU I 5  780  ? 318.577 248.721 312.324 1.00 162.60 ? 780  GLU I OE1   1 
ATOM   7123  O  OE2   . GLU I 5  780  ? 318.238 250.153 313.941 1.00 162.60 ? 780  GLU I OE2   1 
ATOM   7124  N  N     . MET I 5  781  ? 314.806 245.260 311.107 1.00 205.41 ? 781  MET I N     1 
ATOM   7125  C  CA    . MET I 5  781  ? 314.526 244.037 310.350 1.00 205.41 ? 781  MET I CA    1 
ATOM   7126  C  C     . MET I 5  781  ? 315.782 243.144 310.377 1.00 205.41 ? 781  MET I C     1 
ATOM   7127  O  O     . MET I 5  781  ? 316.701 243.382 311.169 1.00 205.41 ? 781  MET I O     1 
ATOM   7128  C  CB    . MET I 5  781  ? 314.061 244.401 308.913 1.00 205.41 ? 781  MET I CB    1 
ATOM   7129  C  CG    . MET I 5  781  ? 313.257 243.331 308.112 1.00 205.41 ? 781  MET I CG    1 
ATOM   7130  S  SD    . MET I 5  781  ? 312.778 243.766 306.433 1.00 205.41 ? 781  MET I SD    1 
ATOM   7131  C  CE    . MET I 5  781  ? 312.208 242.180 305.805 1.00 205.41 ? 781  MET I CE    1 
ATOM   7132  N  N     . GLY I 5  782  ? 315.844 242.119 309.530 1.00 224.14 ? 782  GLY I N     1 
ATOM   7133  C  CA    . GLY I 5  782  ? 316.964 241.208 309.446 1.00 224.14 ? 782  GLY I CA    1 
ATOM   7134  C  C     . GLY I 5  782  ? 316.451 239.813 309.200 1.00 224.14 ? 782  GLY I C     1 
ATOM   7135  O  O     . GLY I 5  782  ? 317.057 239.059 308.436 1.00 224.14 ? 782  GLY I O     1 
ATOM   7136  N  N     . LEU I 5  783  ? 315.322 239.478 309.812 1.00 213.74 ? 783  LEU I N     1 
ATOM   7137  C  CA    . LEU I 5  783  ? 314.513 238.346 309.392 1.00 213.74 ? 783  LEU I CA    1 
ATOM   7138  C  C     . LEU I 5  783  ? 313.035 238.677 309.548 1.00 213.74 ? 783  LEU I C     1 
ATOM   7139  O  O     . LEU I 5  783  ? 312.245 237.879 310.048 1.00 213.74 ? 783  LEU I O     1 
ATOM   7140  C  CB    . LEU I 5  783  ? 314.881 237.076 310.143 1.00 213.74 ? 783  LEU I CB    1 
ATOM   7141  C  CG    . LEU I 5  783  ? 315.894 236.234 309.366 1.00 213.74 ? 783  LEU I CG    1 
ATOM   7142  C  CD1   . LEU I 5  783  ? 316.539 235.151 310.216 1.00 213.74 ? 783  LEU I CD1   1 
ATOM   7143  C  CD2   . LEU I 5  783  ? 315.265 235.691 308.107 1.00 213.74 ? 783  LEU I CD2   1 
ATOM   7144  N  N     . GLY I 5  784  ? 312.643 239.874 309.125 1.00 189.80 ? 784  GLY I N     1 
ATOM   7145  C  CA    . GLY I 5  784  ? 311.251 240.114 308.782 1.00 189.80 ? 784  GLY I CA    1 
ATOM   7146  C  C     . GLY I 5  784  ? 310.224 240.315 309.875 1.00 189.80 ? 784  GLY I C     1 
ATOM   7147  O  O     . GLY I 5  784  ? 309.405 239.431 310.123 1.00 189.80 ? 784  GLY I O     1 
ATOM   7148  N  N     . LYS I 5  785  ? 310.275 241.453 310.556 1.00 166.95 ? 785  LYS I N     1 
ATOM   7149  C  CA    . LYS I 5  785  ? 309.269 241.743 311.568 1.00 166.95 ? 785  LYS I CA    1 
ATOM   7150  C  C     . LYS I 5  785  ? 307.887 241.974 310.962 1.00 166.95 ? 785  LYS I C     1 
ATOM   7151  O  O     . LYS I 5  785  ? 306.873 241.650 311.598 1.00 166.95 ? 785  LYS I O     1 
ATOM   7152  C  CB    . LYS I 5  785  ? 309.706 242.944 312.392 1.00 166.95 ? 785  LYS I CB    1 
ATOM   7153  C  CG    . LYS I 5  785  ? 309.242 242.883 313.822 1.00 166.95 ? 785  LYS I CG    1 
ATOM   7154  C  CD    . LYS I 5  785  ? 309.919 243.917 314.665 1.00 166.95 ? 785  LYS I CD    1 
ATOM   7155  C  CE    . LYS I 5  785  ? 308.925 244.540 315.592 1.00 166.95 ? 785  LYS I CE    1 
ATOM   7156  N  NZ    . LYS I 5  785  ? 309.538 245.778 316.107 1.00 166.95 ? 785  LYS I NZ    1 
ATOM   7157  N  N     . THR I 5  786  ? 307.816 242.544 309.753 1.00 173.50 ? 786  THR I N     1 
ATOM   7158  C  CA    . THR I 5  786  ? 306.555 242.515 309.016 1.00 173.50 ? 786  THR I CA    1 
ATOM   7159  C  C     . THR I 5  786  ? 306.141 241.075 308.771 1.00 173.50 ? 786  THR I C     1 
ATOM   7160  O  O     . THR I 5  786  ? 305.015 240.677 309.088 1.00 173.50 ? 786  THR I O     1 
ATOM   7161  C  CB    . THR I 5  786  ? 306.645 243.303 307.688 1.00 173.50 ? 786  THR I CB    1 
ATOM   7162  O  OG1   . THR I 5  786  ? 305.518 242.993 306.854 1.00 173.50 ? 786  THR I OG1   1 
ATOM   7163  C  CG2   . THR I 5  786  ? 307.947 243.057 306.916 1.00 173.50 ? 786  THR I CG2   1 
ATOM   7164  N  N     . ILE I 5  787  ? 307.096 240.251 308.349 1.00 181.99 ? 787  ILE I N     1 
ATOM   7165  C  CA    . ILE I 5  787  ? 306.854 238.846 308.113 1.00 181.99 ? 787  ILE I CA    1 
ATOM   7166  C  C     . ILE I 5  787  ? 306.603 238.115 309.428 1.00 181.99 ? 787  ILE I C     1 
ATOM   7167  O  O     . ILE I 5  787  ? 305.892 237.100 309.439 1.00 181.99 ? 787  ILE I O     1 
ATOM   7168  C  CB    . ILE I 5  787  ? 308.041 238.333 307.273 1.00 181.99 ? 787  ILE I CB    1 
ATOM   7169  C  CG1   . ILE I 5  787  ? 308.372 239.390 306.188 1.00 181.99 ? 787  ILE I CG1   1 
ATOM   7170  C  CG2   . ILE I 5  787  ? 307.717 236.986 306.643 1.00 181.99 ? 787  ILE I CG2   1 
ATOM   7171  C  CD1   . ILE I 5  787  ? 309.728 239.264 305.483 1.00 181.99 ? 787  ILE I CD1   1 
ATOM   7172  N  N     . GLN I 5  788  ? 307.088 238.663 310.551 1.00 189.85 ? 788  GLN I N     1 
ATOM   7173  C  CA    . GLN I 5  788  ? 306.649 238.185 311.861 1.00 189.85 ? 788  GLN I CA    1 
ATOM   7174  C  C     . GLN I 5  788  ? 305.161 238.438 312.067 1.00 189.85 ? 788  GLN I C     1 
ATOM   7175  O  O     . GLN I 5  788  ? 304.433 237.553 312.536 1.00 189.85 ? 788  GLN I O     1 
ATOM   7176  C  CB    . GLN I 5  788  ? 307.454 238.839 312.989 1.00 189.85 ? 788  GLN I CB    1 
ATOM   7177  C  CG    . GLN I 5  788  ? 308.839 238.300 313.208 1.00 189.85 ? 788  GLN I CG    1 
ATOM   7178  C  CD    . GLN I 5  788  ? 309.453 238.832 314.473 1.00 189.85 ? 788  GLN I CD    1 
ATOM   7179  O  OE1   . GLN I 5  788  ? 309.044 239.867 314.970 1.00 189.85 ? 788  GLN I OE1   1 
ATOM   7180  N  NE2   . GLN I 5  788  ? 310.462 238.147 314.980 1.00 189.85 ? 788  GLN I NE2   1 
ATOM   7181  N  N     . THR I 5  789  ? 304.690 239.639 311.711 1.00 175.37 ? 789  THR I N     1 
ATOM   7182  C  CA    . THR I 5  789  ? 303.272 239.951 311.876 1.00 175.37 ? 789  THR I CA    1 
ATOM   7183  C  C     . THR I 5  789  ? 302.407 239.072 310.977 1.00 175.37 ? 789  THR I C     1 
ATOM   7184  O  O     . THR I 5  789  ? 301.303 238.653 311.354 1.00 175.37 ? 789  THR I O     1 
ATOM   7185  C  CB    . THR I 5  789  ? 303.055 241.429 311.569 1.00 175.37 ? 789  THR I CB    1 
ATOM   7186  O  OG1   . THR I 5  789  ? 304.072 242.190 312.218 1.00 175.37 ? 789  THR I OG1   1 
ATOM   7187  C  CG2   . THR I 5  789  ? 301.709 241.891 312.078 1.00 175.37 ? 789  THR I CG2   1 
ATOM   7188  N  N     . ILE I 5  790  ? 302.932 238.711 309.816 1.00 163.74 ? 790  ILE I N     1 
ATOM   7189  C  CA    . ILE I 5  790  ? 302.151 237.905 308.883 1.00 163.74 ? 790  ILE I CA    1 
ATOM   7190  C  C     . ILE I 5  790  ? 302.098 236.436 309.301 1.00 163.74 ? 790  ILE I C     1 
ATOM   7191  O  O     . ILE I 5  790  ? 301.040 235.812 309.224 1.00 163.74 ? 790  ILE I O     1 
ATOM   7192  C  CB    . ILE I 5  790  ? 302.689 238.083 307.453 1.00 163.74 ? 790  ILE I CB    1 
ATOM   7193  C  CG1   . ILE I 5  790  ? 302.673 239.561 307.075 1.00 163.74 ? 790  ILE I CG1   1 
ATOM   7194  C  CG2   . ILE I 5  790  ? 301.823 237.340 306.471 1.00 163.74 ? 790  ILE I CG2   1 
ATOM   7195  C  CD1   . ILE I 5  790  ? 303.804 239.954 306.228 1.00 163.74 ? 790  ILE I CD1   1 
ATOM   7196  N  N     . ALA I 5  791  ? 303.244 235.889 309.733 1.00 174.85 ? 791  ALA I N     1 
ATOM   7197  C  CA    . ALA I 5  791  ? 303.279 234.497 310.243 1.00 174.85 ? 791  ALA I CA    1 
ATOM   7198  C  C     . ALA I 5  791  ? 302.476 234.443 311.544 1.00 174.85 ? 791  ALA I C     1 
ATOM   7199  O  O     . ALA I 5  791  ? 301.953 233.362 311.871 1.00 174.85 ? 791  ALA I O     1 
ATOM   7200  C  CB    . ALA I 5  791  ? 304.707 234.062 310.459 1.00 174.85 ? 791  ALA I CB    1 
ATOM   7201  N  N     . LEU I 5  792  ? 302.381 235.571 312.254 1.00 181.42 ? 792  LEU I N     1 
ATOM   7202  C  CA    . LEU I 5  792  ? 301.543 235.636 313.482 1.00 181.42 ? 792  LEU I CA    1 
ATOM   7203  C  C     . LEU I 5  792  ? 300.100 235.370 313.053 1.00 181.42 ? 792  LEU I C     1 
ATOM   7204  O  O     . LEU I 5  792  ? 299.376 234.683 313.800 1.00 181.42 ? 792  LEU I O     1 
ATOM   7205  C  CB    . LEU I 5  792  ? 301.683 237.044 314.073 1.00 181.42 ? 792  LEU I CB    1 
ATOM   7206  C  CG    . LEU I 5  792  ? 300.760 237.410 315.234 1.00 181.42 ? 792  LEU I CG    1 
ATOM   7207  C  CD1   . LEU I 5  792  ? 301.318 238.604 315.991 1.00 181.42 ? 792  LEU I CD1   1 
ATOM   7208  C  CD2   . LEU I 5  792  ? 299.350 237.714 314.754 1.00 181.42 ? 792  LEU I CD2   1 
ATOM   7209  N  N     . ILE I 5  793  ? 299.711 235.893 311.888 1.00 154.49 ? 793  ILE I N     1 
ATOM   7210  C  CA    . ILE I 5  793  ? 298.305 235.756 311.410 1.00 154.49 ? 793  ILE I CA    1 
ATOM   7211  C  C     . ILE I 5  793  ? 298.167 234.527 310.507 1.00 154.49 ? 793  ILE I C     1 
ATOM   7212  O  O     . ILE I 5  793  ? 297.015 234.192 310.161 1.00 154.49 ? 793  ILE I O     1 
ATOM   7213  C  CB    . ILE I 5  793  ? 297.896 237.053 310.679 1.00 154.49 ? 793  ILE I CB    1 
ATOM   7214  C  CG1   . ILE I 5  793  ? 297.390 238.120 311.652 1.00 154.49 ? 793  ILE I CG1   1 
ATOM   7215  C  CG2   . ILE I 5  793  ? 296.903 236.785 309.559 1.00 154.49 ? 793  ILE I CG2   1 
ATOM   7216  C  CD1   . ILE I 5  793  ? 297.918 239.506 311.371 1.00 154.49 ? 793  ILE I CD1   1 
ATOM   7217  N  N     . THR I 5  794  ? 299.267 233.840 310.165 1.00 174.55 ? 794  THR I N     1 
ATOM   7218  C  CA    . THR I 5  794  ? 299.113 232.751 309.205 1.00 174.55 ? 794  THR I CA    1 
ATOM   7219  C  C     . THR I 5  794  ? 298.564 231.478 309.807 1.00 174.55 ? 794  THR I C     1 
ATOM   7220  O  O     . THR I 5  794  ? 298.114 230.612 309.053 1.00 174.55 ? 794  THR I O     1 
ATOM   7221  C  CB    . THR I 5  794  ? 300.420 232.370 308.493 1.00 174.55 ? 794  THR I CB    1 
ATOM   7222  O  OG1   . THR I 5  794  ? 300.075 231.553 307.372 1.00 174.55 ? 794  THR I OG1   1 
ATOM   7223  C  CG2   . THR I 5  794  ? 301.310 231.467 309.341 1.00 174.55 ? 794  THR I CG2   1 
ATOM   7224  N  N     . TYR I 5  795  ? 298.559 231.334 311.130 1.00 181.29 ? 795  TYR I N     1 
ATOM   7225  C  CA    . TYR I 5  795  ? 298.041 230.091 311.698 1.00 181.29 ? 795  TYR I CA    1 
ATOM   7226  C  C     . TYR I 5  795  ? 296.556 230.200 312.012 1.00 181.29 ? 795  TYR I C     1 
ATOM   7227  O  O     . TYR I 5  795  ? 296.074 229.804 313.082 1.00 181.29 ? 795  TYR I O     1 
ATOM   7228  C  CB    . TYR I 5  795  ? 298.874 229.701 312.912 1.00 181.29 ? 795  TYR I CB    1 
ATOM   7229  C  CG    . TYR I 5  795  ? 300.202 229.161 312.439 1.00 181.29 ? 795  TYR I CG    1 
ATOM   7230  C  CD1   . TYR I 5  795  ? 300.274 227.955 311.760 1.00 181.29 ? 795  TYR I CD1   1 
ATOM   7231  C  CD2   . TYR I 5  795  ? 301.365 229.900 312.584 1.00 181.29 ? 795  TYR I CD2   1 
ATOM   7232  C  CE1   . TYR I 5  795  ? 301.475 227.472 311.290 1.00 181.29 ? 795  TYR I CE1   1 
ATOM   7233  C  CE2   . TYR I 5  795  ? 302.570 229.425 312.110 1.00 181.29 ? 795  TYR I CE2   1 
ATOM   7234  C  CZ    . TYR I 5  795  ? 302.617 228.211 311.470 1.00 181.29 ? 795  TYR I CZ    1 
ATOM   7235  O  OH    . TYR I 5  795  ? 303.814 227.734 311.002 1.00 181.29 ? 795  TYR I OH    1 
ATOM   7236  N  N     . LEU I 5  796  ? 295.830 230.738 311.006 1.00 162.17 ? 796  LEU I N     1 
ATOM   7237  C  CA    . LEU I 5  796  ? 294.384 230.925 311.025 1.00 162.17 ? 796  LEU I CA    1 
ATOM   7238  C  C     . LEU I 5  796  ? 293.762 230.570 309.672 1.00 162.17 ? 796  LEU I C     1 
ATOM   7239  O  O     . LEU I 5  796  ? 292.814 231.254 309.267 1.00 162.17 ? 796  LEU I O     1 
ATOM   7240  C  CB    . LEU I 5  796  ? 294.023 232.394 311.407 1.00 162.17 ? 796  LEU I CB    1 
ATOM   7241  C  CG    . LEU I 5  796  ? 294.115 232.897 312.859 1.00 162.17 ? 796  LEU I CG    1 
ATOM   7242  C  CD1   . LEU I 5  796  ? 295.508 233.373 313.275 1.00 162.17 ? 796  LEU I CD1   1 
ATOM   7243  C  CD2   . LEU I 5  796  ? 293.086 233.958 313.143 1.00 162.17 ? 796  LEU I CD2   1 
ATOM   7244  N  N     . MET I 5  797  ? 294.251 229.546 308.952 1.00 134.58 ? 797  MET I N     1 
ATOM   7245  C  CA    . MET I 5  797  ? 294.161 229.506 307.491 1.00 134.58 ? 797  MET I CA    1 
ATOM   7246  C  C     . MET I 5  797  ? 292.783 229.242 306.874 1.00 134.58 ? 797  MET I C     1 
ATOM   7247  O  O     . MET I 5  797  ? 292.208 230.160 306.279 1.00 134.58 ? 797  MET I O     1 
ATOM   7248  C  CB    . MET I 5  797  ? 295.142 228.455 306.958 1.00 134.58 ? 797  MET I CB    1 
ATOM   7249  C  CG    . MET I 5  797  ? 295.318 227.195 307.812 1.00 134.58 ? 797  MET I CG    1 
ATOM   7250  S  SD    . MET I 5  797  ? 296.293 225.957 306.931 1.00 134.58 ? 797  MET I SD    1 
ATOM   7251  C  CE    . MET I 5  797  ? 296.490 224.709 308.187 1.00 134.58 ? 797  MET I CE    1 
ATOM   7252  N  N     . GLU I 5  798  ? 292.230 228.033 307.011 1.00 99.08  ? 798  GLU I N     1 
ATOM   7253  C  CA    . GLU I 5  798  ? 290.903 227.695 306.459 1.00 99.08  ? 798  GLU I CA    1 
ATOM   7254  C  C     . GLU I 5  798  ? 290.391 226.393 307.084 1.00 99.08  ? 798  GLU I C     1 
ATOM   7255  O  O     . GLU I 5  798  ? 289.715 226.406 308.116 1.00 99.08  ? 798  GLU I O     1 
ATOM   7256  C  CB    . GLU I 5  798  ? 290.931 227.564 304.925 1.00 99.08  ? 798  GLU I CB    1 
ATOM   7257  C  CG    . GLU I 5  798  ? 289.601 227.867 304.247 1.00 99.08  ? 798  GLU I CG    1 
ATOM   7258  C  CD    . GLU I 5  798  ? 289.246 229.333 304.292 1.00 99.08  ? 798  GLU I CD    1 
ATOM   7259  O  OE1   . GLU I 5  798  ? 290.164 230.168 304.210 1.00 99.08  ? 798  GLU I OE1   1 
ATOM   7260  O  OE2   . GLU I 5  798  ? 288.049 229.648 304.421 1.00 99.08  ? 798  GLU I OE2   1 
ATOM   7261  N  N     . PHE I 5  806  ? 291.571 241.604 308.764 1.00 106.53 ? 806  PHE I N     1 
ATOM   7262  C  CA    . PHE I 5  806  ? 292.269 240.616 307.945 1.00 106.53 ? 806  PHE I CA    1 
ATOM   7263  C  C     . PHE I 5  806  ? 292.252 240.972 306.439 1.00 106.53 ? 806  PHE I C     1 
ATOM   7264  O  O     . PHE I 5  806  ? 291.648 240.269 305.628 1.00 106.53 ? 806  PHE I O     1 
ATOM   7265  C  CB    . PHE I 5  806  ? 291.671 239.222 308.195 1.00 106.53 ? 806  PHE I CB    1 
ATOM   7266  C  CG    . PHE I 5  806  ? 292.239 238.501 309.418 1.00 106.53 ? 806  PHE I CG    1 
ATOM   7267  C  CD1   . PHE I 5  806  ? 293.421 238.909 310.009 1.00 106.53 ? 806  PHE I CD1   1 
ATOM   7268  C  CD2   . PHE I 5  806  ? 291.580 237.409 309.957 1.00 106.53 ? 806  PHE I CD2   1 
ATOM   7269  C  CE1   . PHE I 5  806  ? 293.926 238.240 311.095 1.00 106.53 ? 806  PHE I CE1   1 
ATOM   7270  C  CE2   . PHE I 5  806  ? 292.088 236.749 311.042 1.00 106.53 ? 806  PHE I CE2   1 
ATOM   7271  C  CZ    . PHE I 5  806  ? 293.264 237.151 311.591 1.00 106.53 ? 806  PHE I CZ    1 
ATOM   7272  N  N     . LEU I 5  807  ? 292.941 242.062 306.109 1.00 85.30  ? 807  LEU I N     1 
ATOM   7273  C  CA    . LEU I 5  807  ? 293.218 242.507 304.740 1.00 85.30  ? 807  LEU I CA    1 
ATOM   7274  C  C     . LEU I 5  807  ? 294.664 242.973 304.736 1.00 85.30  ? 807  LEU I C     1 
ATOM   7275  O  O     . LEU I 5  807  ? 295.459 242.602 305.601 1.00 85.30  ? 807  LEU I O     1 
ATOM   7276  C  CB    . LEU I 5  807  ? 292.358 243.681 304.267 1.00 85.30  ? 807  LEU I CB    1 
ATOM   7277  C  CG    . LEU I 5  807  ? 290.873 243.627 304.049 1.00 85.30  ? 807  LEU I CG    1 
ATOM   7278  C  CD1   . LEU I 5  807  ? 290.564 242.360 303.365 1.00 85.30  ? 807  LEU I CD1   1 
ATOM   7279  C  CD2   . LEU I 5  807  ? 290.188 243.763 305.348 1.00 85.30  ? 807  LEU I CD2   1 
ATOM   7280  N  N     . ILE I 5  808  ? 295.027 243.774 303.743 1.00 75.74  ? 808  ILE I N     1 
ATOM   7281  C  CA    . ILE I 5  808  ? 296.120 244.729 303.867 1.00 75.74  ? 808  ILE I CA    1 
ATOM   7282  C  C     . ILE I 5  808  ? 295.528 246.108 303.574 1.00 75.74  ? 808  ILE I C     1 
ATOM   7283  O  O     . ILE I 5  808  ? 294.764 246.255 302.616 1.00 75.74  ? 808  ILE I O     1 
ATOM   7284  C  CB    . ILE I 5  808  ? 297.290 244.398 302.922 1.00 75.74  ? 808  ILE I CB    1 
ATOM   7285  C  CG1   . ILE I 5  808  ? 297.485 242.889 302.764 1.00 75.74  ? 808  ILE I CG1   1 
ATOM   7286  C  CG2   . ILE I 5  808  ? 298.550 244.959 303.471 1.00 75.74  ? 808  ILE I CG2   1 
ATOM   7287  C  CD1   . ILE I 5  808  ? 298.176 242.186 303.899 1.00 75.74  ? 808  ILE I CD1   1 
ATOM   7288  N  N     . ILE I 5  809  ? 295.820 247.104 304.429 1.00 91.49  ? 809  ILE I N     1 
ATOM   7289  C  CA    . ILE I 5  809  ? 295.185 248.432 304.363 1.00 91.49  ? 809  ILE I CA    1 
ATOM   7290  C  C     . ILE I 5  809  ? 296.284 249.499 304.337 1.00 91.49  ? 809  ILE I C     1 
ATOM   7291  O  O     . ILE I 5  809  ? 296.617 250.094 305.369 1.00 91.49  ? 809  ILE I O     1 
ATOM   7292  C  CB    . ILE I 5  809  ? 294.223 248.681 305.528 1.00 91.49  ? 809  ILE I CB    1 
ATOM   7293  C  CG1   . ILE I 5  809  ? 293.303 247.479 305.780 1.00 91.49  ? 809  ILE I CG1   1 
ATOM   7294  C  CG2   . ILE I 5  809  ? 293.372 249.877 305.235 1.00 91.49  ? 809  ILE I CG2   1 
ATOM   7295  C  CD1   . ILE I 5  809  ? 292.298 247.239 304.690 1.00 91.49  ? 809  ILE I CD1   1 
ATOM   7296  N  N     . VAL I 5  810  ? 296.780 249.824 303.134 1.00 93.94  ? 810  VAL I N     1 
ATOM   7297  C  CA    . VAL I 5  810  ? 298.121 250.392 302.893 1.00 93.94  ? 810  VAL I CA    1 
ATOM   7298  C  C     . VAL I 5  810  ? 298.186 251.511 301.848 1.00 93.94  ? 810  VAL I C     1 
ATOM   7299  O  O     . VAL I 5  810  ? 297.240 251.690 301.070 1.00 93.94  ? 810  VAL I O     1 
ATOM   7300  C  CB    . VAL I 5  810  ? 299.108 249.263 302.514 1.00 93.94  ? 810  VAL I CB    1 
ATOM   7301  C  CG1   . VAL I 5  810  ? 299.475 248.462 303.734 1.00 93.94  ? 810  VAL I CG1   1 
ATOM   7302  C  CG2   . VAL I 5  810  ? 298.535 248.373 301.418 1.00 93.94  ? 810  VAL I CG2   1 
ATOM   7303  N  N     . PRO I 5  811  ? 299.238 252.363 301.816 1.00 92.64  ? 811  PRO I N     1 
ATOM   7304  C  CA    . PRO I 5  811  ? 299.243 253.524 300.918 1.00 92.64  ? 811  PRO I CA    1 
ATOM   7305  C  C     . PRO I 5  811  ? 299.309 253.252 299.408 1.00 92.64  ? 811  PRO I C     1 
ATOM   7306  O  O     . PRO I 5  811  ? 298.263 253.273 298.781 1.00 92.64  ? 811  PRO I O     1 
ATOM   7307  C  CB    . PRO I 5  811  ? 300.418 254.372 301.416 1.00 92.64  ? 811  PRO I CB    1 
ATOM   7308  C  CG    . PRO I 5  811  ? 301.363 253.382 302.054 1.00 92.64  ? 811  PRO I CG    1 
ATOM   7309  C  CD    . PRO I 5  811  ? 300.474 252.291 302.606 1.00 92.64  ? 811  PRO I CD    1 
ATOM   7310  N  N     . LEU I 5  812  ? 300.509 253.027 298.863 1.00 73.37  ? 812  LEU I N     1 
ATOM   7311  C  CA    . LEU I 5  812  ? 300.637 252.869 297.391 1.00 73.37  ? 812  LEU I CA    1 
ATOM   7312  C  C     . LEU I 5  812  ? 301.834 251.981 297.043 1.00 73.37  ? 812  LEU I C     1 
ATOM   7313  O  O     . LEU I 5  812  ? 301.879 250.834 297.535 1.00 73.37  ? 812  LEU I O     1 
ATOM   7314  C  CB    . LEU I 5  812  ? 300.794 254.262 296.772 1.00 73.37  ? 812  LEU I CB    1 
ATOM   7315  C  CG    . LEU I 5  812  ? 299.820 254.568 295.640 1.00 73.37  ? 812  LEU I CG    1 
ATOM   7316  C  CD1   . LEU I 5  812  ? 300.552 255.168 294.450 1.00 73.37  ? 812  LEU I CD1   1 
ATOM   7317  C  CD2   . LEU I 5  812  ? 299.091 253.300 295.232 1.00 73.37  ? 812  LEU I CD2   1 
ATOM   7318  N  N     . SER I 5  813  ? 302.764 252.497 296.232 1.00 66.11  ? 813  SER I N     1 
ATOM   7319  C  CA    . SER I 5  813  ? 303.939 251.704 295.784 1.00 66.11  ? 813  SER I CA    1 
ATOM   7320  C  C     . SER I 5  813  ? 304.736 251.185 296.982 1.00 66.11  ? 813  SER I C     1 
ATOM   7321  O  O     . SER I 5  813  ? 305.239 250.050 296.893 1.00 66.11  ? 813  SER I O     1 
ATOM   7322  C  CB    . SER I 5  813  ? 304.808 252.506 294.855 1.00 66.11  ? 813  SER I CB    1 
ATOM   7323  O  OG    . SER I 5  813  ? 305.959 251.764 294.478 1.00 66.11  ? 813  SER I OG    1 
ATOM   7324  N  N     . THR I 5  814  ? 304.912 252.017 298.021 1.00 54.75  ? 814  THR I N     1 
ATOM   7325  C  CA    . THR I 5  814  ? 305.719 251.672 299.224 1.00 54.75  ? 814  THR I CA    1 
ATOM   7326  C  C     . THR I 5  814  ? 305.490 250.229 299.672 1.00 54.75  ? 814  THR I C     1 
ATOM   7327  O  O     . THR I 5  814  ? 306.487 249.552 299.983 1.00 54.75  ? 814  THR I O     1 
ATOM   7328  C  CB    . THR I 5  814  ? 305.390 252.627 300.379 1.00 54.75  ? 814  THR I CB    1 
ATOM   7329  O  OG1   . THR I 5  814  ? 305.822 253.936 300.004 1.00 54.75  ? 814  THR I OG1   1 
ATOM   7330  C  CG2   . THR I 5  814  ? 306.038 252.226 301.686 1.00 54.75  ? 814  THR I CG2   1 
ATOM   7331  N  N     . LEU I 5  815  ? 304.234 249.787 299.734 1.00 51.38  ? 815  LEU I N     1 
ATOM   7332  C  CA    . LEU I 5  815  ? 303.974 248.424 300.261 1.00 51.38  ? 815  LEU I CA    1 
ATOM   7333  C  C     . LEU I 5  815  ? 303.512 247.498 299.136 1.00 51.38  ? 815  LEU I C     1 
ATOM   7334  O  O     . LEU I 5  815  ? 303.149 246.357 299.450 1.00 51.38  ? 815  LEU I O     1 
ATOM   7335  C  CB    . LEU I 5  815  ? 302.960 248.498 301.405 1.00 51.38  ? 815  LEU I CB    1 
ATOM   7336  C  CG    . LEU I 5  815  ? 303.563 248.299 302.795 1.00 51.38  ? 815  LEU I CG    1 
ATOM   7337  C  CD1   . LEU I 5  815  ? 303.229 249.467 303.710 1.00 51.38  ? 815  LEU I CD1   1 
ATOM   7338  C  CD2   . LEU I 5  815  ? 303.105 246.983 303.405 1.00 51.38  ? 815  LEU I CD2   1 
ATOM   7339  N  N     . SER I 5  816  ? 303.538 247.969 297.885 1.00 52.78  ? 816  SER I N     1 
ATOM   7340  C  CA    . SER I 5  816  ? 303.197 247.091 296.735 1.00 52.78  ? 816  SER I CA    1 
ATOM   7341  C  C     . SER I 5  816  ? 304.357 246.123 296.491 1.00 52.78  ? 816  SER I C     1 
ATOM   7342  O  O     . SER I 5  816  ? 304.094 244.983 296.064 1.00 52.78  ? 816  SER I O     1 
ATOM   7343  C  CB    . SER I 5  816  ? 302.885 247.896 295.505 1.00 52.78  ? 816  SER I CB    1 
ATOM   7344  O  OG    . SER I 5  816  ? 304.077 248.274 294.833 1.00 52.78  ? 816  SER I OG    1 
ATOM   7345  N  N     . ASN I 5  817  ? 305.592 246.570 296.737 1.00 53.19  ? 817  ASN I N     1 
ATOM   7346  C  CA    . ASN I 5  817  ? 306.762 245.660 296.617 1.00 53.19  ? 817  ASN I CA    1 
ATOM   7347  C  C     . ASN I 5  817  ? 306.611 244.564 297.673 1.00 53.19  ? 817  ASN I C     1 
ATOM   7348  O  O     . ASN I 5  817  ? 306.876 243.391 297.345 1.00 53.19  ? 817  ASN I O     1 
ATOM   7349  C  CB    . ASN I 5  817  ? 308.081 246.413 296.795 1.00 53.19  ? 817  ASN I CB    1 
ATOM   7350  C  CG    . ASN I 5  817  ? 308.009 247.468 297.878 1.00 53.19  ? 817  ASN I CG    1 
ATOM   7351  O  OD1   . ASN I 5  817  ? 308.270 247.183 299.045 1.00 53.19  ? 817  ASN I OD1   1 
ATOM   7352  N  ND2   . ASN I 5  817  ? 307.645 248.683 297.504 1.00 53.19  ? 817  ASN I ND2   1 
ATOM   7353  N  N     . TRP I 5  818  ? 306.180 244.932 298.886 1.00 57.62  ? 818  TRP I N     1 
ATOM   7354  C  CA    . TRP I 5  818  ? 305.953 243.944 299.941 1.00 57.62  ? 818  TRP I CA    1 
ATOM   7355  C  C     . TRP I 5  818  ? 304.604 243.231 299.790 1.00 57.62  ? 818  TRP I C     1 
ATOM   7356  O  O     . TRP I 5  818  ? 304.490 242.111 300.264 1.00 57.62  ? 818  TRP I O     1 
ATOM   7357  C  CB    . TRP I 5  818  ? 306.140 244.570 301.343 1.00 57.62  ? 818  TRP I CB    1 
ATOM   7358  C  CG    . TRP I 5  818  ? 307.631 244.866 301.652 1.00 57.62  ? 818  TRP I CG    1 
ATOM   7359  C  CD1   . TRP I 5  818  ? 308.707 244.326 301.014 1.00 57.62  ? 818  TRP I CD1   1 
ATOM   7360  C  CD2   . TRP I 5  818  ? 308.177 245.760 302.641 1.00 57.62  ? 818  TRP I CD2   1 
ATOM   7361  N  NE1   . TRP I 5  818  ? 309.878 244.818 301.533 1.00 57.62  ? 818  TRP I NE1   1 
ATOM   7362  C  CE2   . TRP I 5  818  ? 309.581 245.702 302.529 1.00 57.62  ? 818  TRP I CE2   1 
ATOM   7363  C  CE3   . TRP I 5  818  ? 307.619 246.605 303.603 1.00 57.62  ? 818  TRP I CE3   1 
ATOM   7364  C  CZ2   . TRP I 5  818  ? 310.427 246.451 303.336 1.00 57.62  ? 818  TRP I CZ2   1 
ATOM   7365  C  CZ3   . TRP I 5  818  ? 308.469 247.356 304.405 1.00 57.62  ? 818  TRP I CZ3   1 
ATOM   7366  C  CH2   . TRP I 5  818  ? 309.853 247.270 304.266 1.00 57.62  ? 818  TRP I CH2   1 
ATOM   7367  N  N     . ALA I 5  819  ? 303.658 243.756 299.000 1.00 59.02  ? 819  ALA I N     1 
ATOM   7368  C  CA    . ALA I 5  819  ? 302.447 243.019 298.645 1.00 59.02  ? 819  ALA I CA    1 
ATOM   7369  C  C     . ALA I 5  819  ? 302.758 241.852 297.724 1.00 59.02  ? 819  ALA I C     1 
ATOM   7370  O  O     . ALA I 5  819  ? 302.318 240.717 297.966 1.00 59.02  ? 819  ALA I O     1 
ATOM   7371  C  CB    . ALA I 5  819  ? 301.448 243.960 297.990 1.00 59.02  ? 819  ALA I CB    1 
ATOM   7372  N  N     . TYR I 5  820  ? 303.530 242.115 296.666 1.00 61.90  ? 820  TYR I N     1 
ATOM   7373  C  CA    . TYR I 5  820  ? 304.005 241.052 295.784 1.00 61.90  ? 820  TYR I CA    1 
ATOM   7374  C  C     . TYR I 5  820  ? 304.902 240.038 296.528 1.00 61.90  ? 820  TYR I C     1 
ATOM   7375  O  O     . TYR I 5  820  ? 304.926 238.847 296.161 1.00 61.90  ? 820  TYR I O     1 
ATOM   7376  C  CB    . TYR I 5  820  ? 304.729 241.690 294.579 1.00 61.90  ? 820  TYR I CB    1 
ATOM   7377  C  CG    . TYR I 5  820  ? 303.859 242.256 293.421 1.00 61.90  ? 820  TYR I CG    1 
ATOM   7378  C  CD1   . TYR I 5  820  ? 302.470 242.250 293.473 1.00 61.90  ? 820  TYR I CD1   1 
ATOM   7379  C  CD2   . TYR I 5  820  ? 304.459 242.788 292.273 1.00 61.90  ? 820  TYR I CD2   1 
ATOM   7380  C  CE1   . TYR I 5  820  ? 301.729 242.746 292.443 1.00 61.90  ? 820  TYR I CE1   1 
ATOM   7381  C  CE2   . TYR I 5  820  ? 303.717 243.277 291.248 1.00 61.90  ? 820  TYR I CE2   1 
ATOM   7382  C  CZ    . TYR I 5  820  ? 302.356 243.251 291.349 1.00 61.90  ? 820  TYR I CZ    1 
ATOM   7383  O  OH    . TYR I 5  820  ? 301.594 243.736 290.339 1.00 61.90  ? 820  TYR I OH    1 
ATOM   7384  N  N     . GLU I 5  821  ? 305.590 240.480 297.600 1.00 64.57  ? 821  GLU I N     1 
ATOM   7385  C  CA    . GLU I 5  821  ? 306.366 239.586 298.480 1.00 64.57  ? 821  GLU I CA    1 
ATOM   7386  C  C     . GLU I 5  821  ? 305.486 238.651 299.319 1.00 64.57  ? 821  GLU I C     1 
ATOM   7387  O  O     . GLU I 5  821  ? 305.795 237.451 299.421 1.00 64.57  ? 821  GLU I O     1 
ATOM   7388  C  CB    . GLU I 5  821  ? 307.277 240.409 299.405 1.00 64.57  ? 821  GLU I CB    1 
ATOM   7389  C  CG    . GLU I 5  821  ? 307.854 239.688 300.671 1.00 64.57  ? 821  GLU I CG    1 
ATOM   7390  C  CD    . GLU I 5  821  ? 309.183 238.968 300.467 1.00 64.57  ? 821  GLU I CD    1 
ATOM   7391  O  OE1   . GLU I 5  821  ? 309.864 239.199 299.449 1.00 64.57  ? 821  GLU I OE1   1 
ATOM   7392  O  OE2   . GLU I 5  821  ? 309.562 238.176 301.354 1.00 64.57  ? 821  GLU I OE2   1 
ATOM   7393  N  N     . PHE I 5  822  ? 304.415 239.180 299.953 1.00 66.20  ? 822  PHE I N     1 
ATOM   7394  C  CA    . PHE I 5  822  ? 303.468 238.309 300.664 1.00 66.20  ? 822  PHE I CA    1 
ATOM   7395  C  C     . PHE I 5  822  ? 302.859 237.291 299.701 1.00 66.20  ? 822  PHE I C     1 
ATOM   7396  O  O     . PHE I 5  822  ? 302.630 236.127 300.067 1.00 66.20  ? 822  PHE I O     1 
ATOM   7397  C  CB    . PHE I 5  822  ? 302.294 239.067 301.327 1.00 66.20  ? 822  PHE I CB    1 
ATOM   7398  C  CG    . PHE I 5  822  ? 302.613 240.416 301.944 1.00 66.20  ? 822  PHE I CG    1 
ATOM   7399  C  CD1   . PHE I 5  822  ? 303.695 240.632 302.772 1.00 66.20  ? 822  PHE I CD1   1 
ATOM   7400  C  CD2   . PHE I 5  822  ? 301.739 241.468 301.733 1.00 66.20  ? 822  PHE I CD2   1 
ATOM   7401  C  CE1   . PHE I 5  822  ? 303.918 241.914 303.305 1.00 66.20  ? 822  PHE I CE1   1 
ATOM   7402  C  CE2   . PHE I 5  822  ? 301.962 242.700 302.262 1.00 66.20  ? 822  PHE I CE2   1 
ATOM   7403  C  CZ    . PHE I 5  822  ? 303.041 242.932 303.040 1.00 66.20  ? 822  PHE I CZ    1 
ATOM   7404  N  N     . ASP I 5  823  ? 302.593 237.736 298.463 1.00 63.85  ? 823  ASP I N     1 
ATOM   7405  C  CA    . ASP I 5  823  ? 302.039 236.923 297.384 1.00 63.85  ? 823  ASP I CA    1 
ATOM   7406  C  C     . ASP I 5  823  ? 302.911 235.707 297.110 1.00 63.85  ? 823  ASP I C     1 
ATOM   7407  O  O     . ASP I 5  823  ? 302.527 234.580 297.443 1.00 63.85  ? 823  ASP I O     1 
ATOM   7408  C  CB    . ASP I 5  823  ? 301.886 237.804 296.131 1.00 63.85  ? 823  ASP I CB    1 
ATOM   7409  C  CG    . ASP I 5  823  ? 301.437 237.042 294.901 1.00 63.85  ? 823  ASP I CG    1 
ATOM   7410  O  OD1   . ASP I 5  823  ? 300.215 236.906 294.707 1.00 63.85  ? 823  ASP I OD1   1 
ATOM   7411  O  OD2   . ASP I 5  823  ? 302.294 236.632 294.098 1.00 63.85  ? 823  ASP I OD2   1 
ATOM   7412  N  N     . LYS I 5  824  ? 304.141 235.929 296.649 1.00 58.13  ? 824  LYS I N     1 
ATOM   7413  C  CA    . LYS I 5  824  ? 305.072 234.798 296.400 1.00 58.13  ? 824  LYS I CA    1 
ATOM   7414  C  C     . LYS I 5  824  ? 305.354 234.014 297.688 1.00 58.13  ? 824  LYS I C     1 
ATOM   7415  O  O     . LYS I 5  824  ? 305.057 232.805 297.707 1.00 58.13  ? 824  LYS I O     1 
ATOM   7416  C  CB    . LYS I 5  824  ? 306.376 235.314 295.788 1.00 58.13  ? 824  LYS I CB    1 
ATOM   7417  C  CG    . LYS I 5  824  ? 306.218 236.061 294.470 1.00 58.13  ? 824  LYS I CG    1 
ATOM   7418  C  CD    . LYS I 5  824  ? 305.459 235.272 293.423 1.00 58.13  ? 824  LYS I CD    1 
ATOM   7419  C  CE    . LYS I 5  824  ? 305.226 236.047 292.143 1.00 58.13  ? 824  LYS I CE    1 
ATOM   7420  N  NZ    . LYS I 5  824  ? 304.487 235.243 291.140 1.00 58.13  ? 824  LYS I NZ    1 
ATOM   7421  N  N     . TRP I 5  825  ? 305.897 234.664 298.722 1.00 55.84  ? 825  TRP I N     1 
ATOM   7422  C  CA    . TRP I 5  825  ? 306.326 233.923 299.941 1.00 55.84  ? 825  TRP I CA    1 
ATOM   7423  C  C     . TRP I 5  825  ? 305.174 233.223 300.670 1.00 55.84  ? 825  TRP I C     1 
ATOM   7424  O  O     . TRP I 5  825  ? 305.352 232.040 301.014 1.00 55.84  ? 825  TRP I O     1 
ATOM   7425  C  CB    . TRP I 5  825  ? 307.109 234.848 300.877 1.00 55.84  ? 825  TRP I CB    1 
ATOM   7426  C  CG    . TRP I 5  825  ? 308.545 235.002 300.483 1.00 55.84  ? 825  TRP I CG    1 
ATOM   7427  C  CD1   . TRP I 5  825  ? 309.033 235.647 299.384 1.00 55.84  ? 825  TRP I CD1   1 
ATOM   7428  C  CD2   . TRP I 5  825  ? 309.688 234.487 301.186 1.00 55.84  ? 825  TRP I CD2   1 
ATOM   7429  N  NE1   . TRP I 5  825  ? 310.400 235.575 299.359 1.00 55.84  ? 825  TRP I NE1   1 
ATOM   7430  C  CE2   . TRP I 5  825  ? 310.830 234.868 300.451 1.00 55.84  ? 825  TRP I CE2   1 
ATOM   7431  C  CE3   . TRP I 5  825  ? 309.858 233.745 302.360 1.00 55.84  ? 825  TRP I CE3   1 
ATOM   7432  C  CZ2   . TRP I 5  825  ? 312.120 234.527 300.855 1.00 55.84  ? 825  TRP I CZ2   1 
ATOM   7433  C  CZ3   . TRP I 5  825  ? 311.134 233.413 302.759 1.00 55.84  ? 825  TRP I CZ3   1 
ATOM   7434  C  CH2   . TRP I 5  825  ? 312.248 233.800 302.016 1.00 55.84  ? 825  TRP I CH2   1 
ATOM   7435  N  N     . ALA I 5  826  ? 304.034 233.887 300.868 1.00 51.61  ? 826  ALA I N     1 
ATOM   7436  C  CA    . ALA I 5  826  ? 302.969 233.239 301.671 1.00 51.61  ? 826  ALA I CA    1 
ATOM   7437  C  C     . ALA I 5  826  ? 301.775 232.887 300.783 1.00 51.61  ? 826  ALA I C     1 
ATOM   7438  O  O     . ALA I 5  826  ? 301.153 233.800 300.218 1.00 51.61  ? 826  ALA I O     1 
ATOM   7439  C  CB    . ALA I 5  826  ? 302.574 234.116 302.829 1.00 51.61  ? 826  ALA I CB    1 
ATOM   7440  N  N     . LYS I 5  831  ? 293.308 234.702 298.401 1.00 72.65  ? 831  LYS I N     1 
ATOM   7441  C  CA    . LYS I 5  831  ? 293.944 236.042 298.215 1.00 72.65  ? 831  LYS I CA    1 
ATOM   7442  C  C     . LYS I 5  831  ? 293.868 236.670 296.808 1.00 72.65  ? 831  LYS I C     1 
ATOM   7443  O  O     . LYS I 5  831  ? 293.726 235.899 295.838 1.00 72.65  ? 831  LYS I O     1 
ATOM   7444  C  CB    . LYS I 5  831  ? 295.386 235.883 298.705 1.00 72.65  ? 831  LYS I CB    1 
ATOM   7445  C  CG    . LYS I 5  831  ? 296.079 234.601 298.262 1.00 72.65  ? 831  LYS I CG    1 
ATOM   7446  C  CD    . LYS I 5  831  ? 296.962 233.998 299.335 1.00 72.65  ? 831  LYS I CD    1 
ATOM   7447  C  CE    . LYS I 5  831  ? 298.027 234.949 299.835 1.00 72.65  ? 831  LYS I CE    1 
ATOM   7448  N  NZ    . LYS I 5  831  ? 299.116 235.124 298.845 1.00 72.65  ? 831  LYS I NZ    1 
ATOM   7449  N  N     . VAL I 5  832  ? 293.903 238.012 296.703 1.00 75.09  ? 832  VAL I N     1 
ATOM   7450  C  CA    . VAL I 5  832  ? 293.955 238.723 295.381 1.00 75.09  ? 832  VAL I CA    1 
ATOM   7451  C  C     . VAL I 5  832  ? 295.032 239.807 295.477 1.00 75.09  ? 832  VAL I C     1 
ATOM   7452  O  O     . VAL I 5  832  ? 295.361 240.209 296.608 1.00 75.09  ? 832  VAL I O     1 
ATOM   7453  C  CB    . VAL I 5  832  ? 292.613 239.344 294.942 1.00 75.09  ? 832  VAL I CB    1 
ATOM   7454  C  CG1   . VAL I 5  832  ? 292.422 240.743 295.506 1.00 75.09  ? 832  VAL I CG1   1 
ATOM   7455  C  CG2   . VAL I 5  832  ? 292.506 239.395 293.426 1.00 75.09  ? 832  VAL I CG2   1 
ATOM   7456  N  N     . SER I 5  833  ? 295.586 240.242 294.345 1.00 57.90  ? 833  SER I N     1 
ATOM   7457  C  CA    . SER I 5  833  ? 296.702 241.221 294.392 1.00 57.90  ? 833  SER I CA    1 
ATOM   7458  C  C     . SER I 5  833  ? 296.442 242.395 293.450 1.00 57.90  ? 833  SER I C     1 
ATOM   7459  O  O     . SER I 5  833  ? 295.411 242.371 292.751 1.00 57.90  ? 833  SER I O     1 
ATOM   7460  C  CB    . SER I 5  833  ? 298.012 240.551 294.072 1.00 57.90  ? 833  SER I CB    1 
ATOM   7461  O  OG    . SER I 5  833  ? 299.044 241.511 293.899 1.00 57.90  ? 833  SER I OG    1 
ATOM   7462  N  N     . TYR I 5  834  ? 297.287 243.439 293.435 1.00 58.15  ? 834  TYR I N     1 
ATOM   7463  C  CA    . TYR I 5  834  ? 297.067 244.538 292.447 1.00 58.15  ? 834  TYR I CA    1 
ATOM   7464  C  C     . TYR I 5  834  ? 298.192 245.575 292.438 1.00 58.15  ? 834  TYR I C     1 
ATOM   7465  O  O     . TYR I 5  834  ? 298.551 246.042 293.540 1.00 58.15  ? 834  TYR I O     1 
ATOM   7466  C  CB    . TYR I 5  834  ? 295.811 245.355 292.770 1.00 58.15  ? 834  TYR I CB    1 
ATOM   7467  C  CG    . TYR I 5  834  ? 295.616 246.553 291.876 1.00 58.15  ? 834  TYR I CG    1 
ATOM   7468  C  CD1   . TYR I 5  834  ? 295.357 246.400 290.524 1.00 58.15  ? 834  TYR I CD1   1 
ATOM   7469  C  CD2   . TYR I 5  834  ? 295.731 247.841 292.370 1.00 58.15  ? 834  TYR I CD2   1 
ATOM   7470  C  CE1   . TYR I 5  834  ? 295.197 247.495 289.691 1.00 58.15  ? 834  TYR I CE1   1 
ATOM   7471  C  CE2   . TYR I 5  834  ? 295.572 248.947 291.552 1.00 58.15  ? 834  TYR I CE2   1 
ATOM   7472  C  CZ    . TYR I 5  834  ? 295.304 248.774 290.207 1.00 58.15  ? 834  TYR I CZ    1 
ATOM   7473  O  OH    . TYR I 5  834  ? 295.145 249.861 289.400 1.00 58.15  ? 834  TYR I OH    1 
ATOM   7474  N  N     . LYS I 5  835  ? 298.680 245.956 291.246 1.00 56.29  ? 835  LYS I N     1 
ATOM   7475  C  CA    . LYS I 5  835  ? 299.676 247.059 291.133 1.00 56.29  ? 835  LYS I CA    1 
ATOM   7476  C  C     . LYS I 5  835  ? 299.834 247.496 289.672 1.00 56.29  ? 835  LYS I C     1 
ATOM   7477  O  O     . LYS I 5  835  ? 300.835 247.086 289.050 1.00 56.29  ? 835  LYS I O     1 
ATOM   7478  C  CB    . LYS I 5  835  ? 301.037 246.708 291.743 1.00 56.29  ? 835  LYS I CB    1 
ATOM   7479  C  CG    . LYS I 5  835  ? 302.063 247.835 291.728 1.00 56.29  ? 835  LYS I CG    1 
ATOM   7480  C  CD    . LYS I 5  835  ? 301.464 249.229 291.639 1.00 56.29  ? 835  LYS I CD    1 
ATOM   7481  C  CE    . LYS I 5  835  ? 300.578 249.601 292.810 1.00 56.29  ? 835  LYS I CE    1 
ATOM   7482  N  NZ    . LYS I 5  835  ? 301.139 250.729 293.592 1.00 56.29  ? 835  LYS I NZ    1 
ATOM   7483  N  N     . GLY I 5  836  ? 298.892 248.282 289.136 1.00 61.57  ? 836  GLY I N     1 
ATOM   7484  C  CA    . GLY I 5  836  ? 299.085 248.835 287.778 1.00 61.57  ? 836  GLY I CA    1 
ATOM   7485  C  C     . GLY I 5  836  ? 298.050 248.417 286.748 1.00 61.57  ? 836  GLY I C     1 
ATOM   7486  O  O     . GLY I 5  836  ? 298.462 247.761 285.768 1.00 61.57  ? 836  GLY I O     1 
ATOM   7487  N  N     . SER I 5  837  ? 296.780 248.804 286.924 1.00 54.90  ? 837  SER I N     1 
ATOM   7488  C  CA    . SER I 5  837  ? 295.722 248.535 285.906 1.00 54.90  ? 837  SER I CA    1 
ATOM   7489  C  C     . SER I 5  837  ? 294.476 249.372 286.219 1.00 54.90  ? 837  SER I C     1 
ATOM   7490  O  O     . SER I 5  837  ? 293.395 248.773 286.289 1.00 54.90  ? 837  SER I O     1 
ATOM   7491  C  CB    . SER I 5  837  ? 295.372 247.065 285.857 1.00 54.90  ? 837  SER I CB    1 
ATOM   7492  O  OG    . SER I 5  837  ? 294.053 246.870 285.367 1.00 54.90  ? 837  SER I OG    1 
ATOM   7493  N  N     . PRO I 5  838  ? 294.537 250.721 286.314 1.00 54.32  ? 838  PRO I N     1 
ATOM   7494  C  CA    . PRO I 5  838  ? 293.382 251.519 286.764 1.00 54.32  ? 838  PRO I CA    1 
ATOM   7495  C  C     . PRO I 5  838  ? 292.196 251.678 285.801 1.00 54.32  ? 838  PRO I C     1 
ATOM   7496  O  O     . PRO I 5  838  ? 291.353 252.512 286.078 1.00 54.32  ? 838  PRO I O     1 
ATOM   7497  C  CB    . PRO I 5  838  ? 294.010 252.890 287.043 1.00 54.32  ? 838  PRO I CB    1 
ATOM   7498  C  CG    . PRO I 5  838  ? 295.112 252.988 286.017 1.00 54.32  ? 838  PRO I CG    1 
ATOM   7499  C  CD    . PRO I 5  838  ? 295.656 251.579 285.905 1.00 54.32  ? 838  PRO I CD    1 
ATOM   7500  N  N     . ALA I 5  839  ? 292.138 250.887 284.724 1.00 62.05  ? 839  ALA I N     1 
ATOM   7501  C  CA    . ALA I 5  839  ? 291.010 250.967 283.821 1.00 62.05  ? 839  ALA I CA    1 
ATOM   7502  C  C     . ALA I 5  839  ? 289.986 249.890 284.131 1.00 62.05  ? 839  ALA I C     1 
ATOM   7503  O  O     . ALA I 5  839  ? 288.899 250.163 284.656 1.00 62.05  ? 839  ALA I O     1 
ATOM   7504  C  CB    . ALA I 5  839  ? 291.510 250.830 282.389 1.00 62.05  ? 839  ALA I CB    1 
ATOM   7505  N  N     . ALA I 5  840  ? 290.371 248.643 283.873 1.00 69.05  ? 840  ALA I N     1 
ATOM   7506  C  CA    . ALA I 5  840  ? 289.507 247.521 284.193 1.00 69.05  ? 840  ALA I CA    1 
ATOM   7507  C  C     . ALA I 5  840  ? 289.353 247.339 285.684 1.00 69.05  ? 840  ALA I C     1 
ATOM   7508  O  O     . ALA I 5  840  ? 288.395 246.706 286.118 1.00 69.05  ? 840  ALA I O     1 
ATOM   7509  C  CB    . ALA I 5  840  ? 290.051 246.233 283.592 1.00 69.05  ? 840  ALA I CB    1 
ATOM   7510  N  N     . ARG I 5  841  ? 290.279 247.864 286.474 1.00 63.71  ? 841  ARG I N     1 
ATOM   7511  C  CA    . ARG I 5  841  ? 290.097 247.840 287.915 1.00 63.71  ? 841  ARG I CA    1 
ATOM   7512  C  C     . ARG I 5  841  ? 288.945 248.752 288.325 1.00 63.71  ? 841  ARG I C     1 
ATOM   7513  O  O     . ARG I 5  841  ? 288.099 248.361 289.139 1.00 63.71  ? 841  ARG I O     1 
ATOM   7514  C  CB    . ARG I 5  841  ? 291.415 248.219 288.590 1.00 63.71  ? 841  ARG I CB    1 
ATOM   7515  C  CG    . ARG I 5  841  ? 291.511 247.810 290.025 1.00 63.71  ? 841  ARG I CG    1 
ATOM   7516  C  CD    . ARG I 5  841  ? 291.389 249.028 290.883 1.00 63.71  ? 841  ARG I CD    1 
ATOM   7517  N  NE    . ARG I 5  841  ? 290.936 248.738 292.237 1.00 63.71  ? 841  ARG I NE    1 
ATOM   7518  C  CZ    . ARG I 5  841  ? 289.660 248.565 292.555 1.00 63.71  ? 841  ARG I CZ    1 
ATOM   7519  N  NH1   . ARG I 5  841  ? 288.749 248.625 291.609 1.00 63.71  ? 841  ARG I NH1   1 
ATOM   7520  N  NH2   . ARG I 5  841  ? 289.292 248.322 293.800 1.00 63.71  ? 841  ARG I NH2   1 
ATOM   7521  N  N     . ARG I 5  842  ? 288.853 249.941 287.722 1.00 56.96  ? 842  ARG I N     1 
ATOM   7522  C  CA    . ARG I 5  842  ? 287.673 250.751 287.967 1.00 56.96  ? 842  ARG I CA    1 
ATOM   7523  C  C     . ARG I 5  842  ? 286.441 250.143 287.329 1.00 56.96  ? 842  ARG I C     1 
ATOM   7524  O  O     . ARG I 5  842  ? 285.330 250.429 287.771 1.00 56.96  ? 842  ARG I O     1 
ATOM   7525  C  CB    . ARG I 5  842  ? 287.863 252.179 287.465 1.00 56.96  ? 842  ARG I CB    1 
ATOM   7526  C  CG    . ARG I 5  842  ? 286.980 253.207 288.207 1.00 56.96  ? 842  ARG I CG    1 
ATOM   7527  C  CD    . ARG I 5  842  ? 286.896 254.571 287.497 1.00 56.96  ? 842  ARG I CD    1 
ATOM   7528  N  NE    . ARG I 5  842  ? 285.921 255.493 288.093 1.00 56.96  ? 842  ARG I NE    1 
ATOM   7529  C  CZ    . ARG I 5  842  ? 284.927 256.083 287.424 1.00 56.96  ? 842  ARG I CZ    1 
ATOM   7530  N  NH1   . ARG I 5  842  ? 284.762 255.855 286.129 1.00 56.96  ? 842  ARG I NH1   1 
ATOM   7531  N  NH2   . ARG I 5  842  ? 284.092 256.909 288.043 1.00 56.96  ? 842  ARG I NH2   1 
ATOM   7532  N  N     . ALA I 5  843  ? 286.605 249.294 286.320 1.00 64.68  ? 843  ALA I N     1 
ATOM   7533  C  CA    . ALA I 5  843  ? 285.444 248.588 285.795 1.00 64.68  ? 843  ALA I CA    1 
ATOM   7534  C  C     . ALA I 5  843  ? 284.947 247.545 286.788 1.00 64.68  ? 843  ALA I C     1 
ATOM   7535  O  O     . ALA I 5  843  ? 283.779 247.553 287.185 1.00 64.68  ? 843  ALA I O     1 
ATOM   7536  C  CB    . ALA I 5  843  ? 285.778 247.939 284.455 1.00 64.68  ? 843  ALA I CB    1 
ATOM   7537  N  N     . PHE I 5  844  ? 285.834 246.657 287.220 1.00 75.50  ? 844  PHE I N     1 
ATOM   7538  C  CA    . PHE I 5  844  ? 285.507 245.535 288.095 1.00 75.50  ? 844  PHE I CA    1 
ATOM   7539  C  C     . PHE I 5  844  ? 285.702 245.894 289.548 1.00 75.50  ? 844  PHE I C     1 
ATOM   7540  O  O     . PHE I 5  844  ? 286.042 245.029 290.354 1.00 75.50  ? 844  PHE I O     1 
ATOM   7541  C  CB    . PHE I 5  844  ? 286.349 244.309 287.755 1.00 75.50  ? 844  PHE I CB    1 
ATOM   7542  C  CG    . PHE I 5  844  ? 285.882 243.547 286.539 1.00 75.50  ? 844  PHE I CG    1 
ATOM   7543  C  CD1   . PHE I 5  844  ? 284.746 243.926 285.840 1.00 75.50  ? 844  PHE I CD1   1 
ATOM   7544  C  CD2   . PHE I 5  844  ? 286.588 242.439 286.097 1.00 75.50  ? 844  PHE I CD2   1 
ATOM   7545  C  CE1   . PHE I 5  844  ? 284.332 243.212 284.717 1.00 75.50  ? 844  PHE I CE1   1 
ATOM   7546  C  CE2   . PHE I 5  844  ? 286.184 241.726 284.977 1.00 75.50  ? 844  PHE I CE2   1 
ATOM   7547  C  CZ    . PHE I 5  844  ? 285.054 242.112 284.290 1.00 75.50  ? 844  PHE I CZ    1 
ATOM   7548  N  N     . VAL I 5  845  ? 285.563 247.169 289.889 1.00 72.59  ? 845  VAL I N     1 
ATOM   7549  C  CA    . VAL I 5  845  ? 285.525 247.565 291.292 1.00 72.59  ? 845  VAL I CA    1 
ATOM   7550  C  C     . VAL I 5  845  ? 284.421 246.886 292.121 1.00 72.59  ? 845  VAL I C     1 
ATOM   7551  O  O     . VAL I 5  845  ? 284.743 246.476 293.248 1.00 72.59  ? 845  VAL I O     1 
ATOM   7552  C  CB    . VAL I 5  845  ? 285.531 249.109 291.418 1.00 72.59  ? 845  VAL I CB    1 
ATOM   7553  C  CG1   . VAL I 5  845  ? 284.345 249.814 290.813 1.00 72.59  ? 845  VAL I CG1   1 
ATOM   7554  C  CG2   . VAL I 5  845  ? 285.743 249.534 292.859 1.00 72.59  ? 845  VAL I CG2   1 
ATOM   7555  N  N     . PRO I 5  846  ? 283.165 246.650 291.677 1.00 78.77  ? 846  PRO I N     1 
ATOM   7556  C  CA    . PRO I 5  846  ? 282.284 245.883 292.558 1.00 78.77  ? 846  PRO I CA    1 
ATOM   7557  C  C     . PRO I 5  846  ? 282.602 244.413 292.539 1.00 78.77  ? 846  PRO I C     1 
ATOM   7558  O  O     . PRO I 5  846  ? 282.251 243.715 293.493 1.00 78.77  ? 846  PRO I O     1 
ATOM   7559  C  CB    . PRO I 5  846  ? 280.880 246.151 291.996 1.00 78.77  ? 846  PRO I CB    1 
ATOM   7560  C  CG    . PRO I 5  846  ? 281.050 247.157 290.972 1.00 78.77  ? 846  PRO I CG    1 
ATOM   7561  C  CD    . PRO I 5  846  ? 282.405 246.909 290.439 1.00 78.77  ? 846  PRO I CD    1 
ATOM   7562  N  N     . GLN I 5  847  ? 283.297 243.926 291.510 1.00 87.00  ? 847  GLN I N     1 
ATOM   7563  C  CA    . GLN I 5  847  ? 283.472 242.491 291.342 1.00 87.00  ? 847  GLN I CA    1 
ATOM   7564  C  C     . GLN I 5  847  ? 284.573 241.915 292.228 1.00 87.00  ? 847  GLN I C     1 
ATOM   7565  O  O     . GLN I 5  847  ? 284.788 240.701 292.190 1.00 87.00  ? 847  GLN I O     1 
ATOM   7566  C  CB    . GLN I 5  847  ? 283.734 242.148 289.854 1.00 87.00  ? 847  GLN I CB    1 
ATOM   7567  C  CG    . GLN I 5  847  ? 282.446 241.915 288.967 1.00 87.00  ? 847  GLN I CG    1 
ATOM   7568  C  CD    . GLN I 5  847  ? 282.646 240.995 287.728 1.00 87.00  ? 847  GLN I CD    1 
ATOM   7569  O  OE1   . GLN I 5  847  ? 283.714 240.417 287.524 1.00 87.00  ? 847  GLN I OE1   1 
ATOM   7570  N  NE2   . GLN I 5  847  ? 281.601 240.867 286.909 1.00 87.00  ? 847  GLN I NE2   1 
ATOM   7571  N  N     . LEU I 5  848  ? 285.263 242.724 293.038 1.00 83.80  ? 848  LEU I N     1 
ATOM   7572  C  CA    . LEU I 5  848  ? 286.245 242.176 293.970 1.00 83.80  ? 848  LEU I CA    1 
ATOM   7573  C  C     . LEU I 5  848  ? 285.659 241.966 295.354 1.00 83.80  ? 848  LEU I C     1 
ATOM   7574  O  O     . LEU I 5  848  ? 286.358 242.128 296.355 1.00 83.80  ? 848  LEU I O     1 
ATOM   7575  C  CB    . LEU I 5  848  ? 287.492 243.065 294.031 1.00 83.80  ? 848  LEU I CB    1 
ATOM   7576  C  CG    . LEU I 5  848  ? 288.868 242.452 294.388 1.00 83.80  ? 848  LEU I CG    1 
ATOM   7577  C  CD1   . LEU I 5  848  ? 289.222 241.268 293.497 1.00 83.80  ? 848  LEU I CD1   1 
ATOM   7578  C  CD2   . LEU I 5  848  ? 289.968 243.501 294.336 1.00 83.80  ? 848  LEU I CD2   1 
ATOM   7579  N  N     . ARG I 5  849  ? 284.373 241.643 295.439 1.00 91.54  ? 849  ARG I N     1 
ATOM   7580  C  CA    . ARG I 5  849  ? 283.773 241.334 296.724 1.00 91.54  ? 849  ARG I CA    1 
ATOM   7581  C  C     . ARG I 5  849  ? 284.353 240.055 297.325 1.00 91.54  ? 849  ARG I C     1 
ATOM   7582  O  O     . ARG I 5  849  ? 285.099 240.121 298.305 1.00 91.54  ? 849  ARG I O     1 
ATOM   7583  C  CB    . ARG I 5  849  ? 282.262 241.216 296.569 1.00 91.54  ? 849  ARG I CB    1 
ATOM   7584  C  CG    . ARG I 5  849  ? 281.524 241.194 297.881 1.00 91.54  ? 849  ARG I CG    1 
ATOM   7585  C  CD    . ARG I 5  849  ? 281.018 239.795 298.251 1.00 91.54  ? 849  ARG I CD    1 
ATOM   7586  N  NE    . ARG I 5  849  ? 280.693 239.717 299.671 1.00 91.54  ? 849  ARG I NE    1 
ATOM   7587  C  CZ    . ARG I 5  849  ? 281.516 239.244 300.594 1.00 91.54  ? 849  ARG I CZ    1 
ATOM   7588  N  NH1   . ARG I 5  849  ? 282.709 238.790 300.245 1.00 91.54  ? 849  ARG I NH1   1 
ATOM   7589  N  NH2   . ARG I 5  849  ? 281.144 239.226 301.863 1.00 91.54  ? 849  ARG I NH2   1 
ATOM   7590  N  N     . SER I 5  850  ? 284.045 238.888 296.751 1.00 89.95  ? 850  SER I N     1 
ATOM   7591  C  CA    . SER I 5  850  ? 284.721 237.654 297.153 1.00 89.95  ? 850  SER I CA    1 
ATOM   7592  C  C     . SER I 5  850  ? 285.459 237.007 295.987 1.00 89.95  ? 850  SER I C     1 
ATOM   7593  O  O     . SER I 5  850  ? 286.683 236.959 296.006 1.00 89.95  ? 850  SER I O     1 
ATOM   7594  C  CB    . SER I 5  850  ? 283.730 236.674 297.777 1.00 89.95  ? 850  SER I CB    1 
ATOM   7595  O  OG    . SER I 5  850  ? 284.395 235.473 298.118 1.00 89.95  ? 850  SER I OG    1 
ATOM   7596  N  N     . GLY I 5  851  ? 284.759 236.572 294.943 1.00 81.82  ? 851  GLY I N     1 
ATOM   7597  C  CA    . GLY I 5  851  ? 285.388 236.040 293.744 1.00 81.82  ? 851  GLY I CA    1 
ATOM   7598  C  C     . GLY I 5  851  ? 286.289 234.823 293.877 1.00 81.82  ? 851  GLY I C     1 
ATOM   7599  O  O     . GLY I 5  851  ? 286.470 234.273 294.968 1.00 81.82  ? 851  GLY I O     1 
ATOM   7600  N  N     . LYS I 5  852  ? 286.870 234.404 292.748 1.00 75.53  ? 852  LYS I N     1 
ATOM   7601  C  CA    . LYS I 5  852  ? 287.817 233.296 292.733 1.00 75.53  ? 852  LYS I CA    1 
ATOM   7602  C  C     . LYS I 5  852  ? 289.181 233.702 293.295 1.00 75.53  ? 852  LYS I C     1 
ATOM   7603  O  O     . LYS I 5  852  ? 289.985 232.832 293.650 1.00 75.53  ? 852  LYS I O     1 
ATOM   7604  C  CB    . LYS I 5  852  ? 287.917 232.754 291.298 1.00 75.53  ? 852  LYS I CB    1 
ATOM   7605  C  CG    . LYS I 5  852  ? 288.679 231.444 291.109 1.00 75.53  ? 852  LYS I CG    1 
ATOM   7606  C  CD    . LYS I 5  852  ? 288.099 230.325 291.946 1.00 75.53  ? 852  LYS I CD    1 
ATOM   7607  C  CE    . LYS I 5  852  ? 288.754 229.005 291.596 1.00 75.53  ? 852  LYS I CE    1 
ATOM   7608  N  NZ    . LYS I 5  852  ? 290.195 228.988 291.919 1.00 75.53  ? 852  LYS I NZ    1 
ATOM   7609  N  N     . PHE I 5  853  ? 289.446 234.999 293.430 1.00 75.11  ? 853  PHE I N     1 
ATOM   7610  C  CA    . PHE I 5  853  ? 290.676 235.501 294.035 1.00 75.11  ? 853  PHE I CA    1 
ATOM   7611  C  C     . PHE I 5  853  ? 290.296 236.605 295.026 1.00 75.11  ? 853  PHE I C     1 
ATOM   7612  O  O     . PHE I 5  853  ? 289.929 237.709 294.617 1.00 75.11  ? 853  PHE I O     1 
ATOM   7613  C  CB    . PHE I 5  853  ? 291.644 236.005 292.958 1.00 75.11  ? 853  PHE I CB    1 
ATOM   7614  C  CG    . PHE I 5  853  ? 291.736 235.112 291.744 1.00 75.11  ? 853  PHE I CG    1 
ATOM   7615  C  CD1   . PHE I 5  853  ? 292.373 233.883 291.814 1.00 75.11  ? 853  PHE I CD1   1 
ATOM   7616  C  CD2   . PHE I 5  853  ? 291.189 235.507 290.531 1.00 75.11  ? 853  PHE I CD2   1 
ATOM   7617  C  CE1   . PHE I 5  853  ? 292.460 233.059 290.701 1.00 75.11  ? 853  PHE I CE1   1 
ATOM   7618  C  CE2   . PHE I 5  853  ? 291.269 234.690 289.412 1.00 75.11  ? 853  PHE I CE2   1 
ATOM   7619  C  CZ    . PHE I 5  853  ? 291.907 233.464 289.500 1.00 75.11  ? 853  PHE I CZ    1 
ATOM   7620  N  N     . ASN I 5  854  ? 290.369 236.315 296.329 1.00 76.58  ? 854  ASN I N     1 
ATOM   7621  C  CA    . ASN I 5  854  ? 289.586 237.099 297.281 1.00 76.58  ? 854  ASN I CA    1 
ATOM   7622  C  C     . ASN I 5  854  ? 290.261 238.249 298.017 1.00 76.58  ? 854  ASN I C     1 
ATOM   7623  O  O     . ASN I 5  854  ? 289.874 239.394 297.790 1.00 76.58  ? 854  ASN I O     1 
ATOM   7624  C  CB    . ASN I 5  854  ? 288.986 236.159 298.325 1.00 76.58  ? 854  ASN I CB    1 
ATOM   7625  C  CG    . ASN I 5  854  ? 287.645 236.642 298.861 1.00 76.58  ? 854  ASN I CG    1 
ATOM   7626  O  OD1   . ASN I 5  854  ? 287.428 237.832 299.085 1.00 76.58  ? 854  ASN I OD1   1 
ATOM   7627  N  ND2   . ASN I 5  854  ? 286.731 235.703 299.057 1.00 76.58  ? 854  ASN I ND2   1 
ATOM   7628  N  N     . VAL I 5  855  ? 291.068 237.941 299.046 1.00 85.19  ? 855  VAL I N     1 
ATOM   7629  C  CA    . VAL I 5  855  ? 291.643 238.988 299.953 1.00 85.19  ? 855  VAL I CA    1 
ATOM   7630  C  C     . VAL I 5  855  ? 292.339 240.111 299.187 1.00 85.19  ? 855  VAL I C     1 
ATOM   7631  O  O     . VAL I 5  855  ? 293.369 239.830 298.573 1.00 85.19  ? 855  VAL I O     1 
ATOM   7632  C  CB    . VAL I 5  855  ? 292.568 238.370 301.019 1.00 85.19  ? 855  VAL I CB    1 
ATOM   7633  C  CG1   . VAL I 5  855  ? 293.046 239.407 302.025 1.00 85.19  ? 855  VAL I CG1   1 
ATOM   7634  C  CG2   . VAL I 5  855  ? 291.902 237.202 301.729 1.00 85.19  ? 855  VAL I CG2   1 
ATOM   7635  N  N     . LEU I 5  856  ? 291.851 241.348 299.325 1.00 76.84  ? 856  LEU I N     1 
ATOM   7636  C  CA    . LEU I 5  856  ? 292.405 242.484 298.539 1.00 76.84  ? 856  LEU I CA    1 
ATOM   7637  C  C     . LEU I 5  856  ? 293.311 243.389 299.375 1.00 76.84  ? 856  LEU I C     1 
ATOM   7638  O  O     . LEU I 5  856  ? 293.169 243.391 300.615 1.00 76.84  ? 856  LEU I O     1 
ATOM   7639  C  CB    . LEU I 5  856  ? 291.230 243.295 297.984 1.00 76.84  ? 856  LEU I CB    1 
ATOM   7640  C  CG    . LEU I 5  856  ? 290.379 244.005 299.034 1.00 76.84  ? 856  LEU I CG    1 
ATOM   7641  C  CD1   . LEU I 5  856  ? 289.588 245.144 298.410 1.00 76.84  ? 856  LEU I CD1   1 
ATOM   7642  C  CD2   . LEU I 5  856  ? 289.445 243.026 299.724 1.00 76.84  ? 856  LEU I CD2   1 
ATOM   7643  N  N     . LEU I 5  857  ? 294.205 244.131 298.711 1.00 71.82  ? 857  LEU I N     1 
ATOM   7644  C  CA    . LEU I 5  857  ? 295.049 245.133 299.420 1.00 71.82  ? 857  LEU I CA    1 
ATOM   7645  C  C     . LEU I 5  857  ? 294.450 246.513 299.127 1.00 71.82  ? 857  LEU I C     1 
ATOM   7646  O  O     . LEU I 5  857  ? 293.333 246.555 298.570 1.00 71.82  ? 857  LEU I O     1 
ATOM   7647  C  CB    . LEU I 5  857  ? 296.492 245.037 298.916 1.00 71.82  ? 857  LEU I CB    1 
ATOM   7648  C  CG    . LEU I 5  857  ? 296.737 244.022 297.802 1.00 71.82  ? 857  LEU I CG    1 
ATOM   7649  C  CD1   . LEU I 5  857  ? 297.688 244.589 296.762 1.00 71.82  ? 857  LEU I CD1   1 
ATOM   7650  C  CD2   . LEU I 5  857  ? 297.280 242.720 298.369 1.00 71.82  ? 857  LEU I CD2   1 
ATOM   7651  N  N     . THR I 5  858  ? 295.145 247.604 299.472 1.00 88.36  ? 858  THR I N     1 
ATOM   7652  C  CA    . THR I 5  858  ? 294.525 248.921 299.286 1.00 88.36  ? 858  THR I CA    1 
ATOM   7653  C  C     . THR I 5  858  ? 295.468 249.901 298.597 1.00 88.36  ? 858  THR I C     1 
ATOM   7654  O  O     . THR I 5  858  ? 296.654 249.967 298.931 1.00 88.36  ? 858  THR I O     1 
ATOM   7655  C  CB    . THR I 5  858  ? 294.049 249.572 300.600 1.00 88.36  ? 858  THR I CB    1 
ATOM   7656  O  OG1   . THR I 5  858  ? 295.175 249.911 301.409 1.00 88.36  ? 858  THR I OG1   1 
ATOM   7657  C  CG2   . THR I 5  858  ? 293.022 248.742 301.370 1.00 88.36  ? 858  THR I CG2   1 
ATOM   7658  N  N     . THR I 5  859  ? 294.923 250.660 297.643 1.00 79.41  ? 859  THR I N     1 
ATOM   7659  C  CA    . THR I 5  859  ? 295.554 251.797 296.966 1.00 79.41  ? 859  THR I CA    1 
ATOM   7660  C  C     . THR I 5  859  ? 294.757 253.059 297.289 1.00 79.41  ? 859  THR I C     1 
ATOM   7661  O  O     . THR I 5  859  ? 293.864 253.434 296.534 1.00 79.41  ? 859  THR I O     1 
ATOM   7662  C  CB    . THR I 5  859  ? 295.582 251.597 295.472 1.00 79.41  ? 859  THR I CB    1 
ATOM   7663  O  OG1   . THR I 5  859  ? 294.235 251.588 295.003 1.00 79.41  ? 859  THR I OG1   1 
ATOM   7664  C  CG2   . THR I 5  859  ? 296.219 250.276 295.112 1.00 79.41  ? 859  THR I CG2   1 
ATOM   7665  N  N     . TYR I 5  860  ? 295.006 253.635 298.472 1.00 94.79  ? 860  TYR I N     1 
ATOM   7666  C  CA    . TYR I 5  860  ? 294.162 254.762 298.958 1.00 94.79  ? 860  TYR I CA    1 
ATOM   7667  C  C     . TYR I 5  860  ? 294.226 256.011 298.082 1.00 94.79  ? 860  TYR I C     1 
ATOM   7668  O  O     . TYR I 5  860  ? 293.469 256.956 298.354 1.00 94.79  ? 860  TYR I O     1 
ATOM   7669  C  CB    . TYR I 5  860  ? 294.333 254.973 300.462 1.00 94.79  ? 860  TYR I CB    1 
ATOM   7670  C  CG    . TYR I 5  860  ? 293.399 254.114 301.274 1.00 94.79  ? 860  TYR I CG    1 
ATOM   7671  C  CD1   . TYR I 5  860  ? 292.132 253.808 300.807 1.00 94.79  ? 860  TYR I CD1   1 
ATOM   7672  C  CD2   . TYR I 5  860  ? 293.783 253.589 302.495 1.00 94.79  ? 860  TYR I CD2   1 
ATOM   7673  C  CE1   . TYR I 5  860  ? 291.264 253.012 301.536 1.00 94.79  ? 860  TYR I CE1   1 
ATOM   7674  C  CE2   . TYR I 5  860  ? 292.927 252.794 303.239 1.00 94.79  ? 860  TYR I CE2   1 
ATOM   7675  C  CZ    . TYR I 5  860  ? 291.664 252.502 302.757 1.00 94.79  ? 860  TYR I CZ    1 
ATOM   7676  O  OH    . TYR I 5  860  ? 290.814 251.718 303.482 1.00 94.79  ? 860  TYR I OH    1 
ATOM   7677  N  N     . GLU I 5  861  ? 295.114 256.041 297.095 1.00 66.40  ? 861  GLU I N     1 
ATOM   7678  C  CA    . GLU I 5  861  ? 295.079 257.187 296.152 1.00 66.40  ? 861  GLU I CA    1 
ATOM   7679  C  C     . GLU I 5  861  ? 294.061 256.806 295.080 1.00 66.40  ? 861  GLU I C     1 
ATOM   7680  O  O     . GLU I 5  861  ? 293.643 257.706 294.327 1.00 66.40  ? 861  GLU I O     1 
ATOM   7681  C  CB    . GLU I 5  861  ? 296.464 257.388 295.536 1.00 66.40  ? 861  GLU I CB    1 
ATOM   7682  C  CG    . GLU I 5  861  ? 296.610 258.700 294.789 1.00 66.40  ? 861  GLU I CG    1 
ATOM   7683  C  CD    . GLU I 5  861  ? 297.922 258.857 294.038 1.00 66.40  ? 861  GLU I CD    1 
ATOM   7684  O  OE1   . GLU I 5  861  ? 297.899 259.404 292.918 1.00 66.40  ? 861  GLU I OE1   1 
ATOM   7685  O  OE2   . GLU I 5  861  ? 298.962 258.430 294.575 1.00 66.40  ? 861  GLU I OE2   1 
ATOM   7686  N  N     . TYR I 5  862  ? 293.634 255.536 295.059 1.00 64.83  ? 862  TYR I N     1 
ATOM   7687  C  CA    . TYR I 5  862  ? 292.769 255.020 294.003 1.00 64.83  ? 862  TYR I CA    1 
ATOM   7688  C  C     . TYR I 5  862  ? 291.555 254.260 294.556 1.00 64.83  ? 862  TYR I C     1 
ATOM   7689  O  O     . TYR I 5  862  ? 290.406 254.500 294.156 1.00 64.83  ? 862  TYR I O     1 
ATOM   7690  C  CB    . TYR I 5  862  ? 293.631 254.091 293.155 1.00 64.83  ? 862  TYR I CB    1 
ATOM   7691  C  CG    . TYR I 5  862  ? 294.931 254.705 292.654 1.00 64.83  ? 862  TYR I CG    1 
ATOM   7692  C  CD1   . TYR I 5  862  ? 294.962 255.954 292.031 1.00 64.83  ? 862  TYR I CD1   1 
ATOM   7693  C  CD2   . TYR I 5  862  ? 296.145 254.102 292.950 1.00 64.83  ? 862  TYR I CD2   1 
ATOM   7694  C  CE1   . TYR I 5  862  ? 296.155 256.518 291.612 1.00 64.83  ? 862  TYR I CE1   1 
ATOM   7695  C  CE2   . TYR I 5  862  ? 297.330 254.659 292.538 1.00 64.83  ? 862  TYR I CE2   1 
ATOM   7696  C  CZ    . TYR I 5  862  ? 297.331 255.875 291.883 1.00 64.83  ? 862  TYR I CZ    1 
ATOM   7697  O  OH    . TYR I 5  862  ? 298.506 256.477 291.472 1.00 64.83  ? 862  TYR I OH    1 
ATOM   7698  N  N     . ILE I 5  863  ? 291.777 253.404 295.561 1.00 75.08  ? 863  ILE I N     1 
ATOM   7699  C  CA    . ILE I 5  863  ? 290.766 252.443 296.018 1.00 75.08  ? 863  ILE I CA    1 
ATOM   7700  C  C     . ILE I 5  863  ? 289.814 253.103 297.008 1.00 75.08  ? 863  ILE I C     1 
ATOM   7701  O  O     . ILE I 5  863  ? 288.912 252.471 297.582 1.00 75.08  ? 863  ILE I O     1 
ATOM   7702  C  CB    . ILE I 5  863  ? 291.398 251.167 296.599 1.00 75.08  ? 863  ILE I CB    1 
ATOM   7703  C  CG1   . ILE I 5  863  ? 290.441 249.994 296.413 1.00 75.08  ? 863  ILE I CG1   1 
ATOM   7704  C  CG2   . ILE I 5  863  ? 291.781 251.334 298.047 1.00 75.08  ? 863  ILE I CG2   1 
ATOM   7705  C  CD1   . ILE I 5  863  ? 291.010 248.706 296.789 1.00 75.08  ? 863  ILE I CD1   1 
ATOM   7706  N  N     . ILE I 5  864  ? 289.902 254.422 297.090 1.00 73.77  ? 864  ILE I N     1 
ATOM   7707  C  CA    . ILE I 5  864  ? 288.810 255.246 297.573 1.00 73.77  ? 864  ILE I CA    1 
ATOM   7708  C  C     . ILE I 5  864  ? 287.549 255.065 296.737 1.00 73.77  ? 864  ILE I C     1 
ATOM   7709  O  O     . ILE I 5  864  ? 286.464 255.462 297.160 1.00 73.77  ? 864  ILE I O     1 
ATOM   7710  C  CB    . ILE I 5  864  ? 289.255 256.698 297.568 1.00 73.77  ? 864  ILE I CB    1 
ATOM   7711  C  CG1   . ILE I 5  864  ? 289.843 256.985 296.201 1.00 73.77  ? 864  ILE I CG1   1 
ATOM   7712  C  CG2   . ILE I 5  864  ? 290.270 256.887 298.636 1.00 73.77  ? 864  ILE I CG2   1 
ATOM   7713  C  CD1   . ILE I 5  864  ? 290.307 258.378 296.032 1.00 73.77  ? 864  ILE I CD1   1 
ATOM   7714  N  N     . LYS I 5  865  ? 287.665 254.466 295.557 1.00 76.31  ? 865  LYS I N     1 
ATOM   7715  C  CA    . LYS I 5  865  ? 286.560 253.695 295.003 1.00 76.31  ? 865  LYS I CA    1 
ATOM   7716  C  C     . LYS I 5  865  ? 286.549 252.304 295.654 1.00 76.31  ? 865  LYS I C     1 
ATOM   7717  O  O     . LYS I 5  865  ? 287.162 251.373 295.133 1.00 76.31  ? 865  LYS I O     1 
ATOM   7718  C  CB    . LYS I 5  865  ? 286.698 253.596 293.511 1.00 76.31  ? 865  LYS I CB    1 
ATOM   7719  C  CG    . LYS I 5  865  ? 286.324 254.856 292.794 1.00 76.31  ? 865  LYS I CG    1 
ATOM   7720  C  CD    . LYS I 5  865  ? 287.540 255.682 292.467 1.00 76.31  ? 865  LYS I CD    1 
ATOM   7721  C  CE    . LYS I 5  865  ? 287.216 256.723 291.415 1.00 76.31  ? 865  LYS I CE    1 
ATOM   7722  N  NZ    . LYS I 5  865  ? 288.282 257.755 291.299 1.00 76.31  ? 865  LYS I NZ    1 
ATOM   7723  N  N     . ASP I 5  866  ? 285.910 252.198 296.830 1.00 95.00  ? 866  ASP I N     1 
ATOM   7724  C  CA    . ASP I 5  866  ? 285.388 250.994 297.498 1.00 95.00  ? 866  ASP I CA    1 
ATOM   7725  C  C     . ASP I 5  866  ? 284.656 251.439 298.760 1.00 95.00  ? 866  ASP I C     1 
ATOM   7726  O  O     . ASP I 5  866  ? 284.988 252.485 299.322 1.00 95.00  ? 866  ASP I O     1 
ATOM   7727  C  CB    . ASP I 5  866  ? 286.465 249.967 297.868 1.00 95.00  ? 866  ASP I CB    1 
ATOM   7728  C  CG    . ASP I 5  866  ? 285.924 248.545 297.894 1.00 95.00  ? 866  ASP I CG    1 
ATOM   7729  O  OD1   . ASP I 5  866  ? 284.700 248.369 298.028 1.00 95.00  ? 866  ASP I OD1   1 
ATOM   7730  O  OD2   . ASP I 5  866  ? 286.717 247.601 297.772 1.00 95.00  ? 866  ASP I OD2   1 
ATOM   7731  N  N     . LYS I 5  867  ? 283.677 250.632 299.220 1.00 113.79 ? 867  LYS I N     1 
ATOM   7732  C  CA    . LYS I 5  867  ? 282.680 251.130 300.180 1.00 113.79 ? 867  LYS I CA    1 
ATOM   7733  C  C     . LYS I 5  867  ? 282.596 250.399 301.520 1.00 113.79 ? 867  LYS I C     1 
ATOM   7734  O  O     . LYS I 5  867  ? 282.621 251.065 302.563 1.00 113.79 ? 867  LYS I O     1 
ATOM   7735  C  CB    . LYS I 5  867  ? 281.279 251.166 299.528 1.00 113.79 ? 867  LYS I CB    1 
ATOM   7736  C  CG    . LYS I 5  867  ? 280.791 249.906 298.836 1.00 113.79 ? 867  LYS I CG    1 
ATOM   7737  C  CD    . LYS I 5  867  ? 279.293 249.799 298.999 1.00 113.79 ? 867  LYS I CD    1 
ATOM   7738  C  CE    . LYS I 5  867  ? 278.783 248.477 298.504 1.00 113.79 ? 867  LYS I CE    1 
ATOM   7739  N  NZ    . LYS I 5  867  ? 279.104 248.318 297.076 1.00 113.79 ? 867  LYS I NZ    1 
ATOM   7740  N  N     . HIS I 5  868  ? 282.465 249.058 301.555 1.00 122.85 ? 868  HIS I N     1 
ATOM   7741  C  CA    . HIS I 5  868  ? 282.056 248.356 302.780 1.00 122.85 ? 868  HIS I CA    1 
ATOM   7742  C  C     . HIS I 5  868  ? 282.938 247.178 303.161 1.00 122.85 ? 868  HIS I C     1 
ATOM   7743  O  O     . HIS I 5  868  ? 282.952 246.797 304.349 1.00 122.85 ? 868  HIS I O     1 
ATOM   7744  C  CB    . HIS I 5  868  ? 280.639 247.781 302.635 1.00 122.85 ? 868  HIS I CB    1 
ATOM   7745  C  CG    . HIS I 5  868  ? 280.606 246.492 301.876 1.00 122.85 ? 868  HIS I CG    1 
ATOM   7746  N  ND1   . HIS I 5  868  ? 280.780 246.432 300.512 1.00 122.85 ? 868  HIS I ND1   1 
ATOM   7747  C  CD2   . HIS I 5  868  ? 280.476 245.213 302.294 1.00 122.85 ? 868  HIS I CD2   1 
ATOM   7748  C  CE1   . HIS I 5  868  ? 280.742 245.172 300.120 1.00 122.85 ? 868  HIS I CE1   1 
ATOM   7749  N  NE2   . HIS I 5  868  ? 280.559 244.413 301.183 1.00 122.85 ? 868  HIS I NE2   1 
ATOM   7750  N  N     . ILE I 5  869  ? 283.663 246.605 302.187 1.00 115.29 ? 869  ILE I N     1 
ATOM   7751  C  CA    . ILE I 5  869  ? 284.188 245.236 302.200 1.00 115.29 ? 869  ILE I CA    1 
ATOM   7752  C  C     . ILE I 5  869  ? 285.154 245.005 303.351 1.00 115.29 ? 869  ILE I C     1 
ATOM   7753  O  O     . ILE I 5  869  ? 285.225 243.903 303.901 1.00 115.29 ? 869  ILE I O     1 
ATOM   7754  C  CB    . ILE I 5  869  ? 284.837 244.948 300.816 1.00 115.29 ? 869  ILE I CB    1 
ATOM   7755  C  CG1   . ILE I 5  869  ? 285.272 243.501 300.684 1.00 115.29 ? 869  ILE I CG1   1 
ATOM   7756  C  CG2   . ILE I 5  869  ? 286.001 245.904 300.491 1.00 115.29 ? 869  ILE I CG2   1 
ATOM   7757  C  CD1   . ILE I 5  869  ? 285.687 243.176 299.324 1.00 115.29 ? 869  ILE I CD1   1 
ATOM   7758  N  N     . LEU I 5  870  ? 285.805 246.071 303.799 1.00 115.49 ? 870  LEU I N     1 
ATOM   7759  C  CA    . LEU I 5  870  ? 286.822 246.065 304.823 1.00 115.49 ? 870  LEU I CA    1 
ATOM   7760  C  C     . LEU I 5  870  ? 286.421 246.809 306.089 1.00 115.49 ? 870  LEU I C     1 
ATOM   7761  O  O     . LEU I 5  870  ? 287.080 246.634 307.120 1.00 115.49 ? 870  LEU I O     1 
ATOM   7762  C  CB    . LEU I 5  870  ? 288.106 246.662 304.229 1.00 115.49 ? 870  LEU I CB    1 
ATOM   7763  C  CG    . LEU I 5  870  ? 287.807 247.788 303.217 1.00 115.49 ? 870  LEU I CG    1 
ATOM   7764  C  CD1   . LEU I 5  870  ? 287.591 249.159 303.823 1.00 115.49 ? 870  LEU I CD1   1 
ATOM   7765  C  CD2   . LEU I 5  870  ? 288.878 247.849 302.135 1.00 115.49 ? 870  LEU I CD2   1 
ATOM   7766  N  N     . ALA I 5  871  ? 285.352 247.607 306.055 1.00 121.01 ? 871  ALA I N     1 
ATOM   7767  C  CA    . ALA I 5  871  ? 284.941 248.385 307.216 1.00 121.01 ? 871  ALA I CA    1 
ATOM   7768  C  C     . ALA I 5  871  ? 283.831 247.743 308.037 1.00 121.01 ? 871  ALA I C     1 
ATOM   7769  O  O     . ALA I 5  871  ? 283.741 248.020 309.240 1.00 121.01 ? 871  ALA I O     1 
ATOM   7770  C  CB    . ALA I 5  871  ? 284.485 249.783 306.781 1.00 121.01 ? 871  ALA I CB    1 
ATOM   7771  N  N     . LYS I 5  872  ? 282.979 246.900 307.433 1.00 125.91 ? 872  LYS I N     1 
ATOM   7772  C  CA    . LYS I 5  872  ? 281.854 246.480 308.270 1.00 125.91 ? 872  LYS I CA    1 
ATOM   7773  C  C     . LYS I 5  872  ? 281.758 244.980 308.491 1.00 125.91 ? 872  LYS I C     1 
ATOM   7774  O  O     . LYS I 5  872  ? 281.490 244.554 309.614 1.00 125.91 ? 872  LYS I O     1 
ATOM   7775  C  CB    . LYS I 5  872  ? 280.546 246.982 307.672 1.00 125.91 ? 872  LYS I CB    1 
ATOM   7776  C  CG    . LYS I 5  872  ? 279.339 246.697 308.531 1.00 125.91 ? 872  LYS I CG    1 
ATOM   7777  C  CD    . LYS I 5  872  ? 279.511 247.238 309.949 1.00 125.91 ? 872  LYS I CD    1 
ATOM   7778  C  CE    . LYS I 5  872  ? 279.076 248.692 310.051 1.00 125.91 ? 872  LYS I CE    1 
ATOM   7779  N  NZ    . LYS I 5  872  ? 278.609 249.045 311.423 1.00 125.91 ? 872  LYS I NZ    1 
ATOM   7780  N  N     . ILE I 5  873  ? 281.994 244.168 307.461 1.00 129.81 ? 873  ILE I N     1 
ATOM   7781  C  CA    . ILE I 5  873  ? 281.610 242.761 307.503 1.00 129.81 ? 873  ILE I CA    1 
ATOM   7782  C  C     . ILE I 5  873  ? 282.569 241.889 308.316 1.00 129.81 ? 873  ILE I C     1 
ATOM   7783  O  O     . ILE I 5  873  ? 282.316 240.686 308.470 1.00 129.81 ? 873  ILE I O     1 
ATOM   7784  C  CB    . ILE I 5  873  ? 281.465 242.283 306.041 1.00 129.81 ? 873  ILE I CB    1 
ATOM   7785  C  CG1   . ILE I 5  873  ? 280.459 241.123 305.912 1.00 129.81 ? 873  ILE I CG1   1 
ATOM   7786  C  CG2   . ILE I 5  873  ? 282.843 241.948 305.449 1.00 129.81 ? 873  ILE I CG2   1 
ATOM   7787  C  CD1   . ILE I 5  873  ? 279.019 241.514 306.197 1.00 129.81 ? 873  ILE I CD1   1 
ATOM   7788  N  N     . ARG I 5  874  ? 283.604 242.487 308.937 1.00 118.30 ? 874  ARG I N     1 
ATOM   7789  C  CA    . ARG I 5  874  ? 284.517 241.797 309.898 1.00 118.30 ? 874  ARG I CA    1 
ATOM   7790  C  C     . ARG I 5  874  ? 285.111 240.463 309.441 1.00 118.30 ? 874  ARG I C     1 
ATOM   7791  O  O     . ARG I 5  874  ? 284.488 239.413 309.703 1.00 118.30 ? 874  ARG I O     1 
ATOM   7792  C  CB    . ARG I 5  874  ? 283.856 241.644 311.272 1.00 118.30 ? 874  ARG I CB    1 
ATOM   7793  C  CG    . ARG I 5  874  ? 283.459 242.958 311.928 1.00 118.30 ? 874  ARG I CG    1 
ATOM   7794  C  CD    . ARG I 5  874  ? 282.136 242.832 312.660 1.00 118.30 ? 874  ARG I CD    1 
ATOM   7795  N  NE    . ARG I 5  874  ? 280.989 242.946 311.771 1.00 118.30 ? 874  ARG I NE    1 
ATOM   7796  C  CZ    . ARG I 5  874  ? 280.356 241.918 311.216 1.00 118.30 ? 874  ARG I CZ    1 
ATOM   7797  N  NH1   . ARG I 5  874  ? 280.763 240.682 311.450 1.00 118.30 ? 874  ARG I NH1   1 
ATOM   7798  N  NH2   . ARG I 5  874  ? 279.323 242.131 310.420 1.00 118.30 ? 874  ARG I NH2   1 
ATOM   7799  N  N     . TRP I 5  875  ? 286.322 240.485 308.881 1.00 100.46 ? 875  TRP I N     1 
ATOM   7800  C  CA    . TRP I 5  875  ? 287.003 239.201 308.568 1.00 100.46 ? 875  TRP I CA    1 
ATOM   7801  C  C     . TRP I 5  875  ? 287.765 238.789 309.832 1.00 100.46 ? 875  TRP I C     1 
ATOM   7802  O  O     . TRP I 5  875  ? 288.970 239.002 309.847 1.00 100.46 ? 875  TRP I O     1 
ATOM   7803  C  CB    . TRP I 5  875  ? 287.977 239.360 307.392 1.00 100.46 ? 875  TRP I CB    1 
ATOM   7804  C  CG    . TRP I 5  875  ? 287.416 240.017 306.170 1.00 100.46 ? 875  TRP I CG    1 
ATOM   7805  C  CD1   . TRP I 5  875  ? 286.472 241.000 306.122 1.00 100.46 ? 875  TRP I CD1   1 
ATOM   7806  C  CD2   . TRP I 5  875  ? 287.784 239.748 304.805 1.00 100.46 ? 875  TRP I CD2   1 
ATOM   7807  N  NE1   . TRP I 5  875  ? 286.219 241.350 304.824 1.00 100.46 ? 875  TRP I NE1   1 
ATOM   7808  C  CE2   . TRP I 5  875  ? 287.009 240.603 303.992 1.00 100.46 ? 875  TRP I CE2   1 
ATOM   7809  C  CE3   . TRP I 5  875  ? 288.682 238.870 304.189 1.00 100.46 ? 875  TRP I CE3   1 
ATOM   7810  C  CZ2   . TRP I 5  875  ? 287.107 240.603 302.602 1.00 100.46 ? 875  TRP I CZ2   1 
ATOM   7811  C  CZ3   . TRP I 5  875  ? 288.777 238.871 302.814 1.00 100.46 ? 875  TRP I CZ3   1 
ATOM   7812  C  CH2   . TRP I 5  875  ? 288.001 239.727 302.033 1.00 100.46 ? 875  TRP I CH2   1 
ATOM   7813  N  N     . LYS I 5  876  ? 287.082 238.277 310.863 1.00 105.23 ? 876  LYS I N     1 
ATOM   7814  C  CA    . LYS I 5  876  ? 287.739 237.912 312.154 1.00 105.23 ? 876  LYS I CA    1 
ATOM   7815  C  C     . LYS I 5  876  ? 288.605 239.072 312.672 1.00 105.23 ? 876  LYS I C     1 
ATOM   7816  O  O     . LYS I 5  876  ? 288.026 240.128 312.992 1.00 105.23 ? 876  LYS I O     1 
ATOM   7817  C  CB    . LYS I 5  876  ? 288.497 236.586 312.038 1.00 105.23 ? 876  LYS I CB    1 
ATOM   7818  C  CG    . LYS I 5  876  ? 288.404 235.674 313.253 1.00 105.23 ? 876  LYS I CG    1 
ATOM   7819  C  CD    . LYS I 5  876  ? 289.692 235.605 314.044 1.00 105.23 ? 876  LYS I CD    1 
ATOM   7820  C  CE    . LYS I 5  876  ? 289.501 235.071 315.447 1.00 105.23 ? 876  LYS I CE    1 
ATOM   7821  N  NZ    . LYS I 5  876  ? 290.795 234.711 316.073 1.00 105.23 ? 876  LYS I NZ    1 
ATOM   7822  N  N     . TYR I 5  877  ? 289.931 238.885 312.759 1.00 110.64 ? 877  TYR I N     1 
ATOM   7823  C  CA    . TYR I 5  877  ? 290.839 239.937 313.301 1.00 110.64 ? 877  TYR I CA    1 
ATOM   7824  C  C     . TYR I 5  877  ? 291.201 240.952 312.211 1.00 110.64 ? 877  TYR I C     1 
ATOM   7825  O  O     . TYR I 5  877  ? 290.705 240.820 311.088 1.00 110.64 ? 877  TYR I O     1 
ATOM   7826  C  CB    . TYR I 5  877  ? 292.053 239.339 314.012 1.00 110.64 ? 877  TYR I CB    1 
ATOM   7827  C  CG    . TYR I 5  877  ? 291.777 238.797 315.390 1.00 110.64 ? 877  TYR I CG    1 
ATOM   7828  C  CD1   . TYR I 5  877  ? 290.545 238.976 315.996 1.00 110.64 ? 877  TYR I CD1   1 
ATOM   7829  C  CD2   . TYR I 5  877  ? 292.751 238.106 316.092 1.00 110.64 ? 877  TYR I CD2   1 
ATOM   7830  C  CE1   . TYR I 5  877  ? 290.285 238.480 317.262 1.00 110.64 ? 877  TYR I CE1   1 
ATOM   7831  C  CE2   . TYR I 5  877  ? 292.509 237.606 317.361 1.00 110.64 ? 877  TYR I CE2   1 
ATOM   7832  C  CZ    . TYR I 5  877  ? 291.270 237.791 317.947 1.00 110.64 ? 877  TYR I CZ    1 
ATOM   7833  O  OH    . TYR I 5  877  ? 291.024 237.302 319.197 1.00 110.64 ? 877  TYR I OH    1 
ATOM   7834  N  N     . MET I 5  878  ? 292.006 241.972 312.538 1.00 108.72 ? 878  MET I N     1 
ATOM   7835  C  CA    . MET I 5  878  ? 292.266 243.054 311.545 1.00 108.72 ? 878  MET I CA    1 
ATOM   7836  C  C     . MET I 5  878  ? 293.736 243.401 311.288 1.00 108.72 ? 878  MET I C     1 
ATOM   7837  O  O     . MET I 5  878  ? 294.590 243.007 312.107 1.00 108.72 ? 878  MET I O     1 
ATOM   7838  C  CB    . MET I 5  878  ? 291.511 244.330 311.931 1.00 108.72 ? 878  MET I CB    1 
ATOM   7839  C  CG    . MET I 5  878  ? 289.999 244.178 311.940 1.00 108.72 ? 878  MET I CG    1 
ATOM   7840  S  SD    . MET I 5  878  ? 289.379 243.310 313.404 1.00 108.72 ? 878  MET I SD    1 
ATOM   7841  C  CE    . MET I 5  878  ? 290.385 244.061 314.683 1.00 108.72 ? 878  MET I CE    1 
ATOM   7842  N  N     . ILE I 5  879  ? 294.006 244.087 310.166 1.00 115.43 ? 879  ILE I N     1 
ATOM   7843  C  CA    . ILE I 5  879  ? 295.386 244.573 309.847 1.00 115.43 ? 879  ILE I CA    1 
ATOM   7844  C  C     . ILE I 5  879  ? 295.320 246.071 309.525 1.00 115.43 ? 879  ILE I C     1 
ATOM   7845  O  O     . ILE I 5  879  ? 294.506 246.443 308.660 1.00 115.43 ? 879  ILE I O     1 
ATOM   7846  C  CB    . ILE I 5  879  ? 296.003 243.785 308.677 1.00 115.43 ? 879  ILE I CB    1 
ATOM   7847  C  CG1   . ILE I 5  879  ? 296.933 242.685 309.183 1.00 115.43 ? 879  ILE I CG1   1 
ATOM   7848  C  CG2   . ILE I 5  879  ? 296.739 244.725 307.732 1.00 115.43 ? 879  ILE I CG2   1 
ATOM   7849  C  CD1   . ILE I 5  879  ? 298.196 243.211 309.821 1.00 115.43 ? 879  ILE I CD1   1 
ATOM   7850  N  N     . VAL I 5  880  ? 296.145 246.894 310.183 1.00 126.48 ? 880  VAL I N     1 
ATOM   7851  C  CA    . VAL I 5  880  ? 296.206 248.362 309.897 1.00 126.48 ? 880  VAL I CA    1 
ATOM   7852  C  C     . VAL I 5  880  ? 297.677 248.712 309.640 1.00 126.48 ? 880  VAL I C     1 
ATOM   7853  O  O     . VAL I 5  880  ? 298.506 248.356 310.501 1.00 126.48 ? 880  VAL I O     1 
ATOM   7854  C  CB    . VAL I 5  880  ? 295.631 249.152 311.089 1.00 126.48 ? 880  VAL I CB    1 
ATOM   7855  C  CG1   . VAL I 5  880  ? 296.309 250.498 311.286 1.00 126.48 ? 880  VAL I CG1   1 
ATOM   7856  C  CG2   . VAL I 5  880  ? 294.120 249.301 311.001 1.00 126.48 ? 880  VAL I CG2   1 
ATOM   7857  N  N     . ASP I 5  881  ? 298.023 249.370 308.524 1.00 113.84 ? 881  ASP I N     1 
ATOM   7858  C  CA    . ASP I 5  881  ? 299.472 249.592 308.239 1.00 113.84 ? 881  ASP I CA    1 
ATOM   7859  C  C     . ASP I 5  881  ? 299.799 251.050 307.884 1.00 113.84 ? 881  ASP I C     1 
ATOM   7860  O  O     . ASP I 5  881  ? 299.519 251.910 308.747 1.00 113.84 ? 881  ASP I O     1 
ATOM   7861  C  CB    . ASP I 5  881  ? 300.011 248.568 307.238 1.00 113.84 ? 881  ASP I CB    1 
ATOM   7862  C  CG    . ASP I 5  881  ? 301.494 248.285 307.398 1.00 113.84 ? 881  ASP I CG    1 
ATOM   7863  O  OD1   . ASP I 5  881  ? 302.236 249.226 307.745 1.00 113.84 ? 881  ASP I OD1   1 
ATOM   7864  O  OD2   . ASP I 5  881  ? 301.896 247.128 307.167 1.00 113.84 ? 881  ASP I OD2   1 
ATOM   7865  N  N     . GLU I 5  882  ? 300.414 251.313 306.710 1.00 88.83  ? 882  GLU I N     1 
ATOM   7866  C  CA    . GLU I 5  882  ? 300.814 252.677 306.244 1.00 88.83  ? 882  GLU I CA    1 
ATOM   7867  C  C     . GLU I 5  882  ? 301.845 253.319 307.172 1.00 88.83  ? 882  GLU I C     1 
ATOM   7868  O  O     . GLU I 5  882  ? 302.001 254.519 307.033 1.00 88.83  ? 882  GLU I O     1 
ATOM   7869  C  CB    . GLU I 5  882  ? 299.596 253.599 306.127 1.00 88.83  ? 882  GLU I CB    1 
ATOM   7870  C  CG    . GLU I 5  882  ? 298.371 252.924 305.542 1.00 88.83  ? 882  GLU I CG    1 
ATOM   7871  C  CD    . GLU I 5  882  ? 297.524 253.800 304.638 1.00 88.83  ? 882  GLU I CD    1 
ATOM   7872  O  OE1   . GLU I 5  882  ? 297.861 254.986 304.484 1.00 88.83  ? 882  GLU I OE1   1 
ATOM   7873  O  OE2   . GLU I 5  882  ? 296.535 253.288 304.090 1.00 88.83  ? 882  GLU I OE2   1 
ATOM   7874  N  N     . GLY I 5  883  ? 302.700 252.553 307.855 1.00 76.07  ? 883  GLY I N     1 
ATOM   7875  C  CA    . GLY I 5  883  ? 303.577 253.114 308.913 1.00 76.07  ? 883  GLY I CA    1 
ATOM   7876  C  C     . GLY I 5  883  ? 304.534 254.251 308.565 1.00 76.07  ? 883  GLY I C     1 
ATOM   7877  O  O     . GLY I 5  883  ? 304.552 255.216 309.348 1.00 76.07  ? 883  GLY I O     1 
ATOM   7878  N  N     . HIS I 5  884  ? 305.328 254.092 307.499 1.00 74.02  ? 884  HIS I N     1 
ATOM   7879  C  CA    . HIS I 5  884  ? 306.300 255.134 307.073 1.00 74.02  ? 884  HIS I CA    1 
ATOM   7880  C  C     . HIS I 5  884  ? 305.546 256.245 306.341 1.00 74.02  ? 884  HIS I C     1 
ATOM   7881  O  O     . HIS I 5  884  ? 305.843 257.420 306.605 1.00 74.02  ? 884  HIS I O     1 
ATOM   7882  C  CB    . HIS I 5  884  ? 307.403 254.525 306.196 1.00 74.02  ? 884  HIS I CB    1 
ATOM   7883  C  CG    . HIS I 5  884  ? 307.676 255.312 304.958 1.00 74.02  ? 884  HIS I CG    1 
ATOM   7884  N  ND1   . HIS I 5  884  ? 308.098 256.627 304.998 1.00 74.02  ? 884  HIS I ND1   1 
ATOM   7885  C  CD2   . HIS I 5  884  ? 307.559 254.990 303.652 1.00 74.02  ? 884  HIS I CD2   1 
ATOM   7886  C  CE1   . HIS I 5  884  ? 308.243 257.076 303.769 1.00 74.02  ? 884  HIS I CE1   1 
ATOM   7887  N  NE2   . HIS I 5  884  ? 307.920 256.090 302.924 1.00 74.02  ? 884  HIS I NE2   1 
ATOM   7888  N  N     . ARG I 5  885  ? 304.596 255.883 305.472 1.00 84.81  ? 885  ARG I N     1 
ATOM   7889  C  CA    . ARG I 5  885  ? 303.768 256.916 304.795 1.00 84.81  ? 885  ARG I CA    1 
ATOM   7890  C  C     . ARG I 5  885  ? 302.957 257.643 305.866 1.00 84.81  ? 885  ARG I C     1 
ATOM   7891  O  O     . ARG I 5  885  ? 302.618 258.821 305.642 1.00 84.81  ? 885  ARG I O     1 
ATOM   7892  C  CB    . ARG I 5  885  ? 302.868 256.291 303.730 1.00 84.81  ? 885  ARG I CB    1 
ATOM   7893  C  CG    . ARG I 5  885  ? 302.901 257.030 302.401 1.00 84.81  ? 885  ARG I CG    1 
ATOM   7894  C  CD    . ARG I 5  885  ? 304.102 256.640 301.560 1.00 84.81  ? 885  ARG I CD    1 
ATOM   7895  N  NE    . ARG I 5  885  ? 303.975 257.125 300.194 1.00 84.81  ? 885  ARG I NE    1 
ATOM   7896  C  CZ    . ARG I 5  885  ? 303.531 256.401 299.172 1.00 84.81  ? 885  ARG I CZ    1 
ATOM   7897  N  NH1   . ARG I 5  885  ? 303.174 255.142 299.356 1.00 84.81  ? 885  ARG I NH1   1 
ATOM   7898  N  NH2   . ARG I 5  885  ? 303.451 256.936 297.967 1.00 84.81  ? 885  ARG I NH2   1 
ATOM   7899  N  N     . MET I 5  886  ? 302.636 256.955 306.966 1.00 93.10  ? 886  MET I N     1 
ATOM   7900  C  CA    . MET I 5  886  ? 301.961 257.631 308.099 1.00 93.10  ? 886  MET I CA    1 
ATOM   7901  C  C     . MET I 5  886  ? 302.983 258.573 308.732 1.00 93.10  ? 886  MET I C     1 
ATOM   7902  O  O     . MET I 5  886  ? 303.148 258.493 309.957 1.00 93.10  ? 886  MET I O     1 
ATOM   7903  C  CB    . MET I 5  886  ? 301.521 256.628 309.174 1.00 93.10  ? 886  MET I CB    1 
ATOM   7904  C  CG    . MET I 5  886  ? 300.119 256.074 308.986 1.00 93.10  ? 886  MET I CG    1 
ATOM   7905  S  SD    . MET I 5  886  ? 299.622 254.980 310.337 1.00 93.10  ? 886  MET I SD    1 
ATOM   7906  C  CE    . MET I 5  886  ? 300.912 255.329 311.531 1.00 93.10  ? 886  MET I CE    1 
ATOM   7907  N  N     . LYS I 5  887  ? 303.657 259.422 307.940 1.00 113.78 ? 887  LYS I N     1 
ATOM   7908  C  CA    . LYS I 5  887  ? 304.571 260.409 308.515 1.00 113.78 ? 887  LYS I CA    1 
ATOM   7909  C  C     . LYS I 5  887  ? 303.912 261.321 309.548 1.00 113.78 ? 887  LYS I C     1 
ATOM   7910  O  O     . LYS I 5  887  ? 304.549 261.632 310.557 1.00 113.78 ? 887  LYS I O     1 
ATOM   7911  C  CB    . LYS I 5  887  ? 305.195 261.321 307.447 1.00 113.78 ? 887  LYS I CB    1 
ATOM   7912  C  CG    . LYS I 5  887  ? 306.403 260.787 306.713 1.00 113.78 ? 887  LYS I CG    1 
ATOM   7913  C  CD    . LYS I 5  887  ? 307.435 260.222 307.665 1.00 113.78 ? 887  LYS I CD    1 
ATOM   7914  C  CE    . LYS I 5  887  ? 308.506 261.204 308.008 1.00 113.78 ? 887  LYS I CE    1 
ATOM   7915  N  NZ    . LYS I 5  887  ? 309.500 260.550 308.865 1.00 113.78 ? 887  LYS I NZ    1 
ATOM   7916  N  N     . ASN I 5  888  ? 302.672 261.766 309.335 1.00 147.69 ? 888  ASN I N     1 
ATOM   7917  C  CA    . ASN I 5  888  ? 302.177 262.949 310.040 1.00 147.69 ? 888  ASN I CA    1 
ATOM   7918  C  C     . ASN I 5  888  ? 300.935 262.663 310.867 1.00 147.69 ? 888  ASN I C     1 
ATOM   7919  O  O     . ASN I 5  888  ? 299.834 262.569 310.321 1.00 147.69 ? 888  ASN I O     1 
ATOM   7920  C  CB    . ASN I 5  888  ? 301.874 264.085 309.066 1.00 147.69 ? 888  ASN I CB    1 
ATOM   7921  C  CG    . ASN I 5  888  ? 301.463 265.348 309.783 1.00 147.69 ? 888  ASN I CG    1 
ATOM   7922  O  OD1   . ASN I 5  888  ? 300.487 265.993 309.422 1.00 147.69 ? 888  ASN I OD1   1 
ATOM   7923  N  ND2   . ASN I 5  888  ? 302.206 265.699 310.823 1.00 147.69 ? 888  ASN I ND2   1 
ATOM   7924  N  N     . HIS I 5  889  ? 301.115 262.627 312.192 1.00 142.89 ? 889  HIS I N     1 
ATOM   7925  C  CA    . HIS I 5  889  ? 299.999 262.586 313.133 1.00 142.89 ? 889  HIS I CA    1 
ATOM   7926  C  C     . HIS I 5  889  ? 299.096 263.790 312.997 1.00 142.89 ? 889  HIS I C     1 
ATOM   7927  O  O     . HIS I 5  889  ? 297.902 263.704 313.284 1.00 142.89 ? 889  HIS I O     1 
ATOM   7928  C  CB    . HIS I 5  889  ? 300.522 262.551 314.550 1.00 142.89 ? 889  HIS I CB    1 
ATOM   7929  C  CG    . HIS I 5  889  ? 301.642 263.510 314.797 1.00 142.89 ? 889  HIS I CG    1 
ATOM   7930  N  ND1   . HIS I 5  889  ? 302.968 263.159 314.672 1.00 142.89 ? 889  HIS I ND1   1 
ATOM   7931  C  CD2   . HIS I 5  889  ? 301.634 264.816 315.151 1.00 142.89 ? 889  HIS I CD2   1 
ATOM   7932  C  CE1   . HIS I 5  889  ? 303.728 264.202 314.942 1.00 142.89 ? 889  HIS I CE1   1 
ATOM   7933  N  NE2   . HIS I 5  889  ? 302.942 265.223 315.232 1.00 142.89 ? 889  HIS I NE2   1 
ATOM   7934  N  N     . HIS I 5  890  ? 299.654 264.932 312.597 1.00 148.62 ? 890  HIS I N     1 
ATOM   7935  C  CA    . HIS I 5  890  ? 298.843 266.126 312.433 1.00 148.62 ? 890  HIS I CA    1 
ATOM   7936  C  C     . HIS I 5  890  ? 297.954 266.039 311.200 1.00 148.62 ? 890  HIS I C     1 
ATOM   7937  O  O     . HIS I 5  890  ? 297.028 266.845 311.058 1.00 148.62 ? 890  HIS I O     1 
ATOM   7938  C  CB    . HIS I 5  890  ? 299.730 267.368 312.351 1.00 148.62 ? 890  HIS I CB    1 
ATOM   7939  C  CG    . HIS I 5  890  ? 299.001 268.645 312.624 1.00 148.62 ? 890  HIS I CG    1 
ATOM   7940  N  ND1   . HIS I 5  890  ? 298.236 269.284 311.674 1.00 148.62 ? 890  HIS I ND1   1 
ATOM   7941  C  CD2   . HIS I 5  890  ? 298.942 269.418 313.735 1.00 148.62 ? 890  HIS I CD2   1 
ATOM   7942  C  CE1   . HIS I 5  890  ? 297.721 270.384 312.192 1.00 148.62 ? 890  HIS I CE1   1 
ATOM   7943  N  NE2   . HIS I 5  890  ? 298.136 270.488 313.442 1.00 148.62 ? 890  HIS I NE2   1 
ATOM   7944  N  N     . CYS I 5  891  ? 298.215 265.090 310.305 1.00 156.63 ? 891  CYS I N     1 
ATOM   7945  C  CA    . CYS I 5  891  ? 297.260 264.765 309.260 1.00 156.63 ? 891  CYS I CA    1 
ATOM   7946  C  C     . CYS I 5  891  ? 296.147 263.875 309.807 1.00 156.63 ? 891  CYS I C     1 
ATOM   7947  O  O     . CYS I 5  891  ? 296.090 263.545 310.993 1.00 156.63 ? 891  CYS I O     1 
ATOM   7948  C  CB    . CYS I 5  891  ? 297.946 264.066 308.085 1.00 156.63 ? 891  CYS I CB    1 
ATOM   7949  S  SG    . CYS I 5  891  ? 298.700 265.161 306.867 1.00 156.63 ? 891  CYS I SG    1 
ATOM   7950  N  N     . LYS I 5  892  ? 295.254 263.479 308.911 1.00 155.09 ? 892  LYS I N     1 
ATOM   7951  C  CA    . LYS I 5  892  ? 294.154 262.604 309.268 1.00 155.09 ? 892  LYS I CA    1 
ATOM   7952  C  C     . LYS I 5  892  ? 294.382 261.151 308.863 1.00 155.09 ? 892  LYS I C     1 
ATOM   7953  O  O     . LYS I 5  892  ? 293.694 260.288 309.390 1.00 155.09 ? 892  LYS I O     1 
ATOM   7954  C  CB    . LYS I 5  892  ? 292.857 263.141 308.632 1.00 155.09 ? 892  LYS I CB    1 
ATOM   7955  C  CG    . LYS I 5  892  ? 291.509 262.537 309.091 1.00 155.09 ? 892  LYS I CG    1 
ATOM   7956  C  CD    . LYS I 5  892  ? 291.423 262.350 310.594 1.00 155.09 ? 892  LYS I CD    1 
ATOM   7957  C  CE    . LYS I 5  892  ? 290.064 261.821 310.992 1.00 155.09 ? 892  LYS I CE    1 
ATOM   7958  N  NZ    . LYS I 5  892  ? 289.837 260.505 310.353 1.00 155.09 ? 892  LYS I NZ    1 
ATOM   7959  N  N     . LEU I 5  893  ? 295.345 260.853 307.973 1.00 146.54 ? 893  LEU I N     1 
ATOM   7960  C  CA    . LEU I 5  893  ? 295.495 259.497 307.421 1.00 146.54 ? 893  LEU I CA    1 
ATOM   7961  C  C     . LEU I 5  893  ? 296.001 258.504 308.465 1.00 146.54 ? 893  LEU I C     1 
ATOM   7962  O  O     . LEU I 5  893  ? 295.487 257.380 308.591 1.00 146.54 ? 893  LEU I O     1 
ATOM   7963  C  CB    . LEU I 5  893  ? 296.434 259.526 306.213 1.00 146.54 ? 893  LEU I CB    1 
ATOM   7964  C  CG    . LEU I 5  893  ? 297.050 258.217 305.720 1.00 146.54 ? 893  LEU I CG    1 
ATOM   7965  C  CD1   . LEU I 5  893  ? 297.071 258.247 304.230 1.00 146.54 ? 893  LEU I CD1   1 
ATOM   7966  C  CD2   . LEU I 5  893  ? 298.496 258.014 306.194 1.00 146.54 ? 893  LEU I CD2   1 
ATOM   7967  N  N     . THR I 5  894  ? 297.060 258.901 309.179 1.00 143.56 ? 894  THR I N     1 
ATOM   7968  C  CA    . THR I 5  894  ? 297.458 258.279 310.435 1.00 143.56 ? 894  THR I CA    1 
ATOM   7969  C  C     . THR I 5  894  ? 296.287 258.190 311.402 1.00 143.56 ? 894  THR I C     1 
ATOM   7970  O  O     . THR I 5  894  ? 296.171 257.236 312.180 1.00 143.56 ? 894  THR I O     1 
ATOM   7971  C  CB    . THR I 5  894  ? 298.579 259.112 311.049 1.00 143.56 ? 894  THR I CB    1 
ATOM   7972  O  OG1   . THR I 5  894  ? 298.046 260.364 311.502 1.00 143.56 ? 894  THR I OG1   1 
ATOM   7973  C  CG2   . THR I 5  894  ? 299.591 259.420 309.998 1.00 143.56 ? 894  THR I CG2   1 
ATOM   7974  N  N     . GLN I 5  895  ? 295.413 259.195 311.364 1.00 149.27 ? 895  GLN I N     1 
ATOM   7975  C  CA    . GLN I 5  895  ? 294.191 259.247 312.139 1.00 149.27 ? 895  GLN I CA    1 
ATOM   7976  C  C     . GLN I 5  895  ? 292.973 258.739 311.362 1.00 149.27 ? 895  GLN I C     1 
ATOM   7977  O  O     . GLN I 5  895  ? 291.849 259.162 311.648 1.00 149.27 ? 895  GLN I O     1 
ATOM   7978  C  CB    . GLN I 5  895  ? 293.983 260.681 312.621 1.00 149.27 ? 895  GLN I CB    1 
ATOM   7979  C  CG    . GLN I 5  895  ? 295.236 261.273 313.252 1.00 149.27 ? 895  GLN I CG    1 
ATOM   7980  C  CD    . GLN I 5  895  ? 295.022 262.673 313.779 1.00 149.27 ? 895  GLN I CD    1 
ATOM   7981  O  OE1   . GLN I 5  895  ? 293.993 263.295 313.532 1.00 149.27 ? 895  GLN I OE1   1 
ATOM   7982  N  NE2   . GLN I 5  895  ? 295.993 263.170 314.531 1.00 149.27 ? 895  GLN I NE2   1 
ATOM   7983  N  N     . VAL I 5  896  ? 293.163 257.895 310.349 1.00 145.76 ? 896  VAL I N     1 
ATOM   7984  C  CA    . VAL I 5  896  ? 292.029 257.245 309.700 1.00 145.76 ? 896  VAL I CA    1 
ATOM   7985  C  C     . VAL I 5  896  ? 292.289 255.781 309.406 1.00 145.76 ? 896  VAL I C     1 
ATOM   7986  O  O     . VAL I 5  896  ? 291.342 255.028 309.105 1.00 145.76 ? 896  VAL I O     1 
ATOM   7987  C  CB    . VAL I 5  896  ? 291.601 257.991 308.416 1.00 145.76 ? 896  VAL I CB    1 
ATOM   7988  C  CG1   . VAL I 5  896  ? 292.418 257.548 307.217 1.00 145.76 ? 896  VAL I CG1   1 
ATOM   7989  C  CG2   . VAL I 5  896  ? 290.094 257.868 308.168 1.00 145.76 ? 896  VAL I CG2   1 
ATOM   7990  N  N     . LEU I 5  897  ? 293.532 255.317 309.480 1.00 123.27 ? 897  LEU I N     1 
ATOM   7991  C  CA    . LEU I 5  897  ? 293.741 253.879 309.588 1.00 123.27 ? 897  LEU I CA    1 
ATOM   7992  C  C     . LEU I 5  897  ? 293.176 253.350 310.895 1.00 123.27 ? 897  LEU I C     1 
ATOM   7993  O  O     . LEU I 5  897  ? 292.634 252.241 310.935 1.00 123.27 ? 897  LEU I O     1 
ATOM   7994  C  CB    . LEU I 5  897  ? 295.219 253.551 309.447 1.00 123.27 ? 897  LEU I CB    1 
ATOM   7995  C  CG    . LEU I 5  897  ? 295.623 252.999 308.093 1.00 123.27 ? 897  LEU I CG    1 
ATOM   7996  C  CD1   . LEU I 5  897  ? 295.052 251.633 307.979 1.00 123.27 ? 897  LEU I CD1   1 
ATOM   7997  C  CD2   . LEU I 5  897  ? 295.057 253.846 307.016 1.00 123.27 ? 897  LEU I CD2   1 
ATOM   7998  N  N     . ASN I 5  898  ? 293.232 254.171 311.945 1.00 133.17 ? 898  ASN I N     1 
ATOM   7999  C  CA    . ASN I 5  898  ? 292.703 253.807 313.249 1.00 133.17 ? 898  ASN I CA    1 
ATOM   8000  C  C     . ASN I 5  898  ? 291.182 253.762 313.235 1.00 133.17 ? 898  ASN I C     1 
ATOM   8001  O  O     . ASN I 5  898  ? 290.582 252.747 313.601 1.00 133.17 ? 898  ASN I O     1 
ATOM   8002  C  CB    . ASN I 5  898  ? 293.212 254.818 314.259 1.00 133.17 ? 898  ASN I CB    1 
ATOM   8003  C  CG    . ASN I 5  898  ? 294.598 255.281 313.923 1.00 133.17 ? 898  ASN I CG    1 
ATOM   8004  O  OD1   . ASN I 5  898  ? 295.427 254.504 313.461 1.00 133.17 ? 898  ASN I OD1   1 
ATOM   8005  N  ND2   . ASN I 5  898  ? 294.846 256.564 314.091 1.00 133.17 ? 898  ASN I ND2   1 
ATOM   8006  N  N     . THR I 5  899  ? 290.531 254.844 312.776 1.00 145.98 ? 899  THR I N     1 
ATOM   8007  C  CA    . THR I 5  899  ? 289.067 254.910 312.781 1.00 145.98 ? 899  THR I CA    1 
ATOM   8008  C  C     . THR I 5  899  ? 288.425 254.202 311.601 1.00 145.98 ? 899  THR I C     1 
ATOM   8009  O  O     . THR I 5  899  ? 287.251 254.462 311.299 1.00 145.98 ? 899  THR I O     1 
ATOM   8010  C  CB    . THR I 5  899  ? 288.559 256.359 312.841 1.00 145.98 ? 899  THR I CB    1 
ATOM   8011  O  OG1   . THR I 5  899  ? 287.126 256.362 312.860 1.00 145.98 ? 899  THR I OG1   1 
ATOM   8012  C  CG2   . THR I 5  899  ? 288.993 257.152 311.656 1.00 145.98 ? 899  THR I CG2   1 
ATOM   8013  N  N     . HIS I 5  900  ? 289.164 253.337 310.913 1.00 134.61 ? 900  HIS I N     1 
ATOM   8014  C  CA    . HIS I 5  900  ? 288.521 252.285 310.144 1.00 134.61 ? 900  HIS I CA    1 
ATOM   8015  C  C     . HIS I 5  900  ? 287.655 251.442 311.056 1.00 134.61 ? 900  HIS I C     1 
ATOM   8016  O  O     . HIS I 5  900  ? 286.451 251.280 310.830 1.00 134.61 ? 900  HIS I O     1 
ATOM   8017  C  CB    . HIS I 5  900  ? 289.570 251.404 309.475 1.00 134.61 ? 900  HIS I CB    1 
ATOM   8018  C  CG    . HIS I 5  900  ? 290.232 252.044 308.309 1.00 134.61 ? 900  HIS I CG    1 
ATOM   8019  N  ND1   . HIS I 5  900  ? 291.571 251.885 308.037 1.00 134.61 ? 900  HIS I ND1   1 
ATOM   8020  C  CD2   . HIS I 5  900  ? 289.738 252.854 307.348 1.00 134.61 ? 900  HIS I CD2   1 
ATOM   8021  C  CE1   . HIS I 5  900  ? 291.869 252.568 306.950 1.00 134.61 ? 900  HIS I CE1   1 
ATOM   8022  N  NE2   . HIS I 5  900  ? 290.780 253.168 306.515 1.00 134.61 ? 900  HIS I NE2   1 
ATOM   8023  N  N     . TYR I 5  901  ? 288.256 250.912 312.112 1.00 132.56 ? 901  TYR I N     1 
ATOM   8024  C  CA    . TYR I 5  901  ? 287.528 250.067 313.039 1.00 132.56 ? 901  TYR I CA    1 
ATOM   8025  C  C     . TYR I 5  901  ? 288.267 250.145 314.368 1.00 132.56 ? 901  TYR I C     1 
ATOM   8026  O  O     . TYR I 5  901  ? 289.283 249.471 314.553 1.00 132.56 ? 901  TYR I O     1 
ATOM   8027  C  CB    . TYR I 5  901  ? 287.452 248.647 312.506 1.00 132.56 ? 901  TYR I CB    1 
ATOM   8028  C  CG    . TYR I 5  901  ? 286.368 247.821 313.131 1.00 132.56 ? 901  TYR I CG    1 
ATOM   8029  C  CD1   . TYR I 5  901  ? 285.036 248.054 312.808 1.00 132.56 ? 901  TYR I CD1   1 
ATOM   8030  C  CD2   . TYR I 5  901  ? 286.671 246.797 314.018 1.00 132.56 ? 901  TYR I CD2   1 
ATOM   8031  C  CE1   . TYR I 5  901  ? 284.051 247.310 313.356 1.00 132.56 ? 901  TYR I CE1   1 
ATOM   8032  C  CE2   . TYR I 5  901  ? 285.686 246.042 314.565 1.00 132.56 ? 901  TYR I CE2   1 
ATOM   8033  C  CZ    . TYR I 5  901  ? 284.383 246.308 314.230 1.00 132.56 ? 901  TYR I CZ    1 
ATOM   8034  O  OH    . TYR I 5  901  ? 283.389 245.566 314.776 1.00 132.56 ? 901  TYR I OH    1 
ATOM   8035  N  N     . VAL I 5  902  ? 287.761 250.979 315.277 1.00 133.82 ? 902  VAL I N     1 
ATOM   8036  C  CA    . VAL I 5  902  ? 288.321 251.106 316.618 1.00 133.82 ? 902  VAL I CA    1 
ATOM   8037  C  C     . VAL I 5  902  ? 287.788 249.994 317.516 1.00 133.82 ? 902  VAL I C     1 
ATOM   8038  O  O     . VAL I 5  902  ? 286.716 250.106 318.119 1.00 133.82 ? 902  VAL I O     1 
ATOM   8039  C  CB    . VAL I 5  902  ? 288.056 252.506 317.200 1.00 133.82 ? 902  VAL I CB    1 
ATOM   8040  C  CG1   . VAL I 5  902  ? 289.082 253.460 316.679 1.00 133.82 ? 902  VAL I CG1   1 
ATOM   8041  C  CG2   . VAL I 5  902  ? 286.697 253.018 316.749 1.00 133.82 ? 902  VAL I CG2   1 
ATOM   8042  N  N     . ALA I 5  903  ? 288.535 248.903 317.596 1.00 157.55 ? 903  ALA I N     1 
ATOM   8043  C  CA    . ALA I 5  903  ? 288.183 247.772 318.439 1.00 157.55 ? 903  ALA I CA    1 
ATOM   8044  C  C     . ALA I 5  903  ? 289.457 247.242 319.084 1.00 157.55 ? 903  ALA I C     1 
ATOM   8045  O  O     . ALA I 5  903  ? 290.463 247.072 318.388 1.00 157.55 ? 903  ALA I O     1 
ATOM   8046  C  CB    . ALA I 5  903  ? 287.474 246.695 317.622 1.00 157.55 ? 903  ALA I CB    1 
ATOM   8047  N  N     . PRO I 5  904  ? 289.451 246.953 320.392 1.00 163.43 ? 904  PRO I N     1 
ATOM   8048  C  CA    . PRO I 5  904  ? 290.719 246.929 321.163 1.00 163.43 ? 904  PRO I CA    1 
ATOM   8049  C  C     . PRO I 5  904  ? 291.715 245.794 320.841 1.00 163.43 ? 904  PRO I C     1 
ATOM   8050  O  O     . PRO I 5  904  ? 292.896 245.941 321.189 1.00 163.43 ? 904  PRO I O     1 
ATOM   8051  C  CB    . PRO I 5  904  ? 290.242 246.838 322.626 1.00 163.43 ? 904  PRO I CB    1 
ATOM   8052  C  CG    . PRO I 5  904  ? 288.760 246.549 322.582 1.00 163.43 ? 904  PRO I CG    1 
ATOM   8053  C  CD    . PRO I 5  904  ? 288.257 247.001 321.259 1.00 163.43 ? 904  PRO I CD    1 
ATOM   8054  N  N     . ARG I 5  905  ? 291.309 244.695 320.195 1.00 153.69 ? 905  ARG I N     1 
ATOM   8055  C  CA    . ARG I 5  905  ? 292.185 243.528 320.007 1.00 153.69 ? 905  ARG I CA    1 
ATOM   8056  C  C     . ARG I 5  905  ? 293.162 243.808 318.869 1.00 153.69 ? 905  ARG I C     1 
ATOM   8057  O  O     . ARG I 5  905  ? 292.860 243.576 317.700 1.00 153.69 ? 905  ARG I O     1 
ATOM   8058  C  CB    . ARG I 5  905  ? 291.354 242.277 319.739 1.00 153.69 ? 905  ARG I CB    1 
ATOM   8059  C  CG    . ARG I 5  905  ? 292.157 240.985 319.583 1.00 153.69 ? 905  ARG I CG    1 
ATOM   8060  C  CD    . ARG I 5  905  ? 292.639 240.408 320.918 1.00 153.69 ? 905  ARG I CD    1 
ATOM   8061  N  NE    . ARG I 5  905  ? 293.248 239.088 320.756 1.00 153.69 ? 905  ARG I NE    1 
ATOM   8062  C  CZ    . ARG I 5  905  ? 294.059 238.518 321.638 1.00 153.69 ? 905  ARG I CZ    1 
ATOM   8063  N  NH1   . ARG I 5  905  ? 294.382 239.146 322.753 1.00 153.69 ? 905  ARG I NH1   1 
ATOM   8064  N  NH2   . ARG I 5  905  ? 294.563 237.324 321.390 1.00 153.69 ? 905  ARG I NH2   1 
ATOM   8065  N  N     . ARG I 5  906  ? 294.351 244.325 319.204 1.00 158.04 ? 906  ARG I N     1 
ATOM   8066  C  CA    . ARG I 5  906  ? 295.239 244.895 318.190 1.00 158.04 ? 906  ARG I CA    1 
ATOM   8067  C  C     . ARG I 5  906  ? 296.713 244.674 318.559 1.00 158.04 ? 906  ARG I C     1 
ATOM   8068  O  O     . ARG I 5  906  ? 297.040 244.006 319.546 1.00 158.04 ? 906  ARG I O     1 
ATOM   8069  C  CB    . ARG I 5  906  ? 294.956 246.402 317.991 1.00 158.04 ? 906  ARG I CB    1 
ATOM   8070  C  CG    . ARG I 5  906  ? 293.594 246.823 317.342 1.00 158.04 ? 906  ARG I CG    1 
ATOM   8071  C  CD    . ARG I 5  906  ? 293.311 248.349 317.435 1.00 158.04 ? 906  ARG I CD    1 
ATOM   8072  N  NE    . ARG I 5  906  ? 292.252 248.689 318.389 1.00 158.04 ? 906  ARG I NE    1 
ATOM   8073  C  CZ    . ARG I 5  906  ? 291.717 249.901 318.525 1.00 158.04 ? 906  ARG I CZ    1 
ATOM   8074  N  NH1   . ARG I 5  906  ? 292.127 250.906 317.766 1.00 158.04 ? 906  ARG I NH1   1 
ATOM   8075  N  NH2   . ARG I 5  906  ? 290.763 250.105 319.419 1.00 158.04 ? 906  ARG I NH2   1 
ATOM   8076  N  N     . LEU I 5  907  ? 297.597 245.258 317.729 1.00 135.17 ? 907  LEU I N     1 
ATOM   8077  C  CA    . LEU I 5  907  ? 299.058 245.227 317.826 1.00 135.17 ? 907  LEU I CA    1 
ATOM   8078  C  C     . LEU I 5  907  ? 299.629 246.208 316.816 1.00 135.17 ? 907  LEU I C     1 
ATOM   8079  O  O     . LEU I 5  907  ? 299.079 246.376 315.727 1.00 135.17 ? 907  LEU I O     1 
ATOM   8080  C  CB    . LEU I 5  907  ? 299.627 243.843 317.511 1.00 135.17 ? 907  LEU I CB    1 
ATOM   8081  C  CG    . LEU I 5  907  ? 301.077 243.614 317.075 1.00 135.17 ? 907  LEU I CG    1 
ATOM   8082  C  CD1   . LEU I 5  907  ? 302.031 243.845 318.220 1.00 135.17 ? 907  LEU I CD1   1 
ATOM   8083  C  CD2   . LEU I 5  907  ? 301.243 242.248 316.521 1.00 135.17 ? 907  LEU I CD2   1 
ATOM   8084  N  N     . LEU I 5  908  ? 300.754 246.839 317.147 1.00 123.46 ? 908  LEU I N     1 
ATOM   8085  C  CA    . LEU I 5  908  ? 301.576 247.354 316.061 1.00 123.46 ? 908  LEU I CA    1 
ATOM   8086  C  C     . LEU I 5  908  ? 303.044 247.120 316.398 1.00 123.46 ? 908  LEU I C     1 
ATOM   8087  O  O     . LEU I 5  908  ? 303.397 246.791 317.534 1.00 123.46 ? 908  LEU I O     1 
ATOM   8088  C  CB    . LEU I 5  908  ? 301.256 248.820 315.759 1.00 123.46 ? 908  LEU I CB    1 
ATOM   8089  C  CG    . LEU I 5  908  ? 301.419 249.163 314.266 1.00 123.46 ? 908  LEU I CG    1 
ATOM   8090  C  CD1   . LEU I 5  908  ? 300.669 248.173 313.376 1.00 123.46 ? 908  LEU I CD1   1 
ATOM   8091  C  CD2   . LEU I 5  908  ? 300.977 250.579 313.961 1.00 123.46 ? 908  LEU I CD2   1 
ATOM   8092  N  N     . LEU I 5  909  ? 303.918 247.348 315.413 1.00 134.17 ? 909  LEU I N     1 
ATOM   8093  C  CA    . LEU I 5  909  ? 305.374 247.115 315.606 1.00 134.17 ? 909  LEU I CA    1 
ATOM   8094  C  C     . LEU I 5  909  ? 306.114 247.884 314.510 1.00 134.17 ? 909  LEU I C     1 
ATOM   8095  O  O     . LEU I 5  909  ? 305.429 248.392 313.601 1.00 134.17 ? 909  LEU I O     1 
ATOM   8096  C  CB    . LEU I 5  909  ? 305.608 245.626 315.378 1.00 134.17 ? 909  LEU I CB    1 
ATOM   8097  C  CG    . LEU I 5  909  ? 304.966 245.144 314.083 1.00 134.17 ? 909  LEU I CG    1 
ATOM   8098  C  CD1   . LEU I 5  909  ? 305.969 244.449 313.180 1.00 134.17 ? 909  LEU I CD1   1 
ATOM   8099  C  CD2   . LEU I 5  909  ? 303.739 244.294 314.362 1.00 134.17 ? 909  LEU I CD2   1 
ATOM   8100  N  N     . THR I 5  910  ? 307.449 247.967 314.586 1.00 136.13 ? 910  THR I N     1 
ATOM   8101  C  CA    . THR I 5  910  ? 308.226 248.618 313.493 1.00 136.13 ? 910  THR I CA    1 
ATOM   8102  C  C     . THR I 5  910  ? 309.649 248.053 313.391 1.00 136.13 ? 910  THR I C     1 
ATOM   8103  O  O     . THR I 5  910  ? 310.123 247.491 314.387 1.00 136.13 ? 910  THR I O     1 
ATOM   8104  C  CB    . THR I 5  910  ? 308.174 250.150 313.582 1.00 136.13 ? 910  THR I CB    1 
ATOM   8105  O  OG1   . THR I 5  910  ? 309.258 250.681 312.820 1.00 136.13 ? 910  THR I OG1   1 
ATOM   8106  C  CG2   . THR I 5  910  ? 308.235 250.673 315.000 1.00 136.13 ? 910  THR I CG2   1 
ATOM   8107  N  N     . GLY I 5  911  ? 310.276 248.148 312.214 1.00 146.11 ? 911  GLY I N     1 
ATOM   8108  C  CA    . GLY I 5  911  ? 311.680 247.720 312.036 1.00 146.11 ? 911  GLY I CA    1 
ATOM   8109  C  C     . GLY I 5  911  ? 312.532 248.896 311.597 1.00 146.11 ? 911  GLY I C     1 
ATOM   8110  O  O     . GLY I 5  911  ? 313.636 248.663 311.073 1.00 146.11 ? 911  GLY I O     1 
ATOM   8111  N  N     . THR I 5  912  ? 312.050 250.119 311.819 1.00 155.39 ? 912  THR I N     1 
ATOM   8112  C  CA    . THR I 5  912  ? 312.745 251.323 311.293 1.00 155.39 ? 912  THR I CA    1 
ATOM   8113  C  C     . THR I 5  912  ? 314.145 251.513 311.866 1.00 155.39 ? 912  THR I C     1 
ATOM   8114  O  O     . THR I 5  912  ? 314.301 251.395 313.098 1.00 155.39 ? 912  THR I O     1 
ATOM   8115  C  CB    . THR I 5  912  ? 311.968 252.586 311.684 1.00 155.39 ? 912  THR I CB    1 
ATOM   8116  O  OG1   . THR I 5  912  ? 312.643 253.712 311.123 1.00 155.39 ? 912  THR I OG1   1 
ATOM   8117  C  CG2   . THR I 5  912  ? 311.849 252.768 313.181 1.00 155.39 ? 912  THR I CG2   1 
ATOM   8118  N  N     . PRO I 5  913  ? 315.166 251.829 311.038 1.00 154.44 ? 913  PRO I N     1 
ATOM   8119  C  CA    . PRO I 5  913  ? 316.482 252.208 311.556 1.00 154.44 ? 913  PRO I CA    1 
ATOM   8120  C  C     . PRO I 5  913  ? 316.149 253.604 312.094 1.00 154.44 ? 913  PRO I C     1 
ATOM   8121  O  O     . PRO I 5  913  ? 315.235 254.217 311.574 1.00 154.44 ? 913  PRO I O     1 
ATOM   8122  C  CB    . PRO I 5  913  ? 317.359 252.355 310.307 1.00 154.44 ? 913  PRO I CB    1 
ATOM   8123  C  CG    . PRO I 5  913  ? 316.598 251.617 309.227 1.00 154.44 ? 913  PRO I CG    1 
ATOM   8124  C  CD    . PRO I 5  913  ? 315.135 251.794 309.578 1.00 154.44 ? 913  PRO I CD    1 
ATOM   8125  N  N     . LEU I 5  914  ? 316.898 254.106 313.072 1.00 163.79 ? 914  LEU I N     1 
ATOM   8126  C  CA    . LEU I 5  914  ? 316.491 255.399 313.685 1.00 163.79 ? 914  LEU I CA    1 
ATOM   8127  C  C     . LEU I 5  914  ? 316.349 256.458 312.584 1.00 163.79 ? 914  LEU I C     1 
ATOM   8128  O  O     . LEU I 5  914  ? 317.290 256.601 311.777 1.00 163.79 ? 914  LEU I O     1 
ATOM   8129  C  CB    . LEU I 5  914  ? 317.565 255.795 314.700 1.00 163.79 ? 914  LEU I CB    1 
ATOM   8130  C  CG    . LEU I 5  914  ? 318.193 254.625 315.459 1.00 163.79 ? 914  LEU I CG    1 
ATOM   8131  C  CD1   . LEU I 5  914  ? 319.151 255.124 316.529 1.00 163.79 ? 914  LEU I CD1   1 
ATOM   8132  C  CD2   . LEU I 5  914  ? 317.118 253.739 316.070 1.00 163.79 ? 914  LEU I CD2   1 
ATOM   8133  N  N     . GLN I 5  915  ? 315.215 257.176 312.563 1.00 177.01 ? 915  GLN I N     1 
ATOM   8134  C  CA    . GLN I 5  915  ? 314.957 258.208 311.517 1.00 177.01 ? 915  GLN I CA    1 
ATOM   8135  C  C     . GLN I 5  915  ? 315.071 259.631 312.085 1.00 177.01 ? 915  GLN I C     1 
ATOM   8136  O  O     . GLN I 5  915  ? 314.815 260.573 311.308 1.00 177.01 ? 915  GLN I O     1 
ATOM   8137  C  CB    . GLN I 5  915  ? 313.610 257.960 310.834 1.00 177.01 ? 915  GLN I CB    1 
ATOM   8138  C  CG    . GLN I 5  915  ? 313.725 257.482 309.394 1.00 177.01 ? 915  GLN I CG    1 
ATOM   8139  C  CD    . GLN I 5  915  ? 314.398 256.138 309.260 1.00 177.01 ? 915  GLN I CD    1 
ATOM   8140  O  OE1   . GLN I 5  915  ? 313.749 255.122 309.016 1.00 177.01 ? 915  GLN I OE1   1 
ATOM   8141  N  NE2   . GLN I 5  915  ? 315.710 256.120 309.422 1.00 177.01 ? 915  GLN I NE2   1 
ATOM   8142  N  N     . ASN I 5  916  ? 315.410 259.790 313.370 1.00 173.23 ? 916  ASN I N     1 
ATOM   8143  C  CA    . ASN I 5  916  ? 315.654 261.138 313.962 1.00 173.23 ? 916  ASN I CA    1 
ATOM   8144  C  C     . ASN I 5  916  ? 314.384 261.997 314.052 1.00 173.23 ? 916  ASN I C     1 
ATOM   8145  O  O     . ASN I 5  916  ? 314.497 263.136 314.546 1.00 173.23 ? 916  ASN I O     1 
ATOM   8146  C  CB    . ASN I 5  916  ? 316.812 261.873 313.277 1.00 173.23 ? 916  ASN I CB    1 
ATOM   8147  C  CG    . ASN I 5  916  ? 317.054 263.259 313.834 1.00 173.23 ? 916  ASN I CG    1 
ATOM   8148  O  OD1   . ASN I 5  916  ? 317.032 263.460 315.047 1.00 173.23 ? 916  ASN I OD1   1 
ATOM   8149  N  ND2   . ASN I 5  916  ? 317.290 264.221 312.957 1.00 173.23 ? 916  ASN I ND2   1 
ATOM   8150  N  N     . LYS I 5  917  ? 313.216 261.491 313.640 1.00 142.84 ? 917  LYS I N     1 
ATOM   8151  C  CA    . LYS I 5  917  ? 312.004 262.292 313.811 1.00 142.84 ? 917  LYS I CA    1 
ATOM   8152  C  C     . LYS I 5  917  ? 311.373 261.974 315.159 1.00 142.84 ? 917  LYS I C     1 
ATOM   8153  O  O     . LYS I 5  917  ? 310.199 261.637 315.264 1.00 142.84 ? 917  LYS I O     1 
ATOM   8154  C  CB    . LYS I 5  917  ? 311.032 262.071 312.670 1.00 142.84 ? 917  LYS I CB    1 
ATOM   8155  C  CG    . LYS I 5  917  ? 311.242 263.032 311.510 1.00 142.84 ? 917  LYS I CG    1 
ATOM   8156  C  CD    . LYS I 5  917  ? 311.566 264.463 311.949 1.00 142.84 ? 917  LYS I CD    1 
ATOM   8157  C  CE    . LYS I 5  917  ? 312.129 265.285 310.787 1.00 142.84 ? 917  LYS I CE    1 
ATOM   8158  N  NZ    . LYS I 5  917  ? 312.643 266.618 311.214 1.00 142.84 ? 917  LYS I NZ    1 
ATOM   8159  N  N     . LEU I 5  918  ? 312.187 262.142 316.198 1.00 138.33 ? 918  LEU I N     1 
ATOM   8160  C  CA    . LEU I 5  918  ? 311.770 261.922 317.580 1.00 138.33 ? 918  LEU I CA    1 
ATOM   8161  C  C     . LEU I 5  918  ? 310.561 262.748 318.054 1.00 138.33 ? 918  LEU I C     1 
ATOM   8162  O  O     . LEU I 5  918  ? 309.679 262.154 318.704 1.00 138.33 ? 918  LEU I O     1 
ATOM   8163  C  CB    . LEU I 5  918  ? 313.014 262.130 318.451 1.00 138.33 ? 918  LEU I CB    1 
ATOM   8164  C  CG    . LEU I 5  918  ? 312.985 262.555 319.906 1.00 138.33 ? 918  LEU I CG    1 
ATOM   8165  C  CD1   . LEU I 5  918  ? 312.339 261.531 320.793 1.00 138.33 ? 918  LEU I CD1   1 
ATOM   8166  C  CD2   . LEU I 5  918  ? 314.415 262.811 320.340 1.00 138.33 ? 918  LEU I CD2   1 
ATOM   8167  N  N     . PRO I 5  919  ? 310.441 264.069 317.796 1.00 139.20 ? 919  PRO I N     1 
ATOM   8168  C  CA    . PRO I 5  919  ? 309.180 264.727 318.177 1.00 139.20 ? 919  PRO I CA    1 
ATOM   8169  C  C     . PRO I 5  919  ? 308.000 264.220 317.378 1.00 139.20 ? 919  PRO I C     1 
ATOM   8170  O  O     . PRO I 5  919  ? 306.921 263.980 317.942 1.00 139.20 ? 919  PRO I O     1 
ATOM   8171  C  CB    . PRO I 5  919  ? 309.458 266.214 317.903 1.00 139.20 ? 919  PRO I CB    1 
ATOM   8172  C  CG    . PRO I 5  919  ? 310.509 266.225 316.888 1.00 139.20 ? 919  PRO I CG    1 
ATOM   8173  C  CD    . PRO I 5  919  ? 311.385 265.072 317.253 1.00 139.20 ? 919  PRO I CD    1 
ATOM   8174  N  N     . GLU I 5  920  ? 308.207 264.009 316.076 1.00 133.99 ? 920  GLU I N     1 
ATOM   8175  C  CA    . GLU I 5  920  ? 307.224 263.345 315.237 1.00 133.99 ? 920  GLU I CA    1 
ATOM   8176  C  C     . GLU I 5  920  ? 306.934 261.946 315.731 1.00 133.99 ? 920  GLU I C     1 
ATOM   8177  O  O     . GLU I 5  920  ? 305.786 261.505 315.659 1.00 133.99 ? 920  GLU I O     1 
ATOM   8178  C  CB    . GLU I 5  920  ? 307.718 263.300 313.798 1.00 133.99 ? 920  GLU I CB    1 
ATOM   8179  C  CG    . GLU I 5  920  ? 307.547 264.595 313.072 1.00 133.99 ? 920  GLU I CG    1 
ATOM   8180  C  CD    . GLU I 5  920  ? 306.109 264.821 312.744 1.00 133.99 ? 920  GLU I CD    1 
ATOM   8181  O  OE1   . GLU I 5  920  ? 305.430 263.834 312.397 1.00 133.99 ? 920  GLU I OE1   1 
ATOM   8182  O  OE2   . GLU I 5  920  ? 305.643 265.970 312.850 1.00 133.99 ? 920  GLU I OE2   1 
ATOM   8183  N  N     . LEU I 5  921  ? 307.948 261.258 316.262 1.00 135.90 ? 921  LEU I N     1 
ATOM   8184  C  CA    . LEU I 5  921  ? 307.774 259.876 316.766 1.00 135.90 ? 921  LEU I CA    1 
ATOM   8185  C  C     . LEU I 5  921  ? 306.778 259.853 317.921 1.00 135.90 ? 921  LEU I C     1 
ATOM   8186  O  O     . LEU I 5  921  ? 305.813 259.094 317.813 1.00 135.90 ? 921  LEU I O     1 
ATOM   8187  C  CB    . LEU I 5  921  ? 309.134 259.336 317.210 1.00 135.90 ? 921  LEU I CB    1 
ATOM   8188  C  CG    . LEU I 5  921  ? 309.101 258.018 317.969 1.00 135.90 ? 921  LEU I CG    1 
ATOM   8189  C  CD1   . LEU I 5  921  ? 308.981 256.867 316.988 1.00 135.90 ? 921  LEU I CD1   1 
ATOM   8190  C  CD2   . LEU I 5  921  ? 310.353 257.880 318.817 1.00 135.90 ? 921  LEU I CD2   1 
ATOM   8191  N  N     . TRP I 5  922  ? 306.959 260.682 318.961 1.00 132.91 ? 922  TRP I N     1 
ATOM   8192  C  CA    . TRP I 5  922  ? 306.059 260.532 320.106 1.00 132.91 ? 922  TRP I CA    1 
ATOM   8193  C  C     . TRP I 5  922  ? 304.742 261.260 319.889 1.00 132.91 ? 922  TRP I C     1 
ATOM   8194  O  O     . TRP I 5  922  ? 303.686 260.795 320.334 1.00 132.91 ? 922  TRP I O     1 
ATOM   8195  C  CB    . TRP I 5  922  ? 306.740 260.969 321.405 1.00 132.91 ? 922  TRP I CB    1 
ATOM   8196  C  CG    . TRP I 5  922  ? 307.919 260.082 321.758 1.00 132.91 ? 922  TRP I CG    1 
ATOM   8197  C  CD1   . TRP I 5  922  ? 309.200 260.487 321.976 1.00 132.91 ? 922  TRP I CD1   1 
ATOM   8198  C  CD2   . TRP I 5  922  ? 307.925 258.659 321.918 1.00 132.91 ? 922  TRP I CD2   1 
ATOM   8199  N  NE1   . TRP I 5  922  ? 309.997 259.419 322.248 1.00 132.91 ? 922  TRP I NE1   1 
ATOM   8200  C  CE2   . TRP I 5  922  ? 309.233 258.286 322.230 1.00 132.91 ? 922  TRP I CE2   1 
ATOM   8201  C  CE3   . TRP I 5  922  ? 306.949 257.668 321.842 1.00 132.91 ? 922  TRP I CE3   1 
ATOM   8202  C  CZ2   . TRP I 5  922  ? 309.593 256.980 322.444 1.00 132.91 ? 922  TRP I CZ2   1 
ATOM   8203  C  CZ3   . TRP I 5  922  ? 307.310 256.388 322.056 1.00 132.91 ? 922  TRP I CZ3   1 
ATOM   8204  C  CH2   . TRP I 5  922  ? 308.615 256.039 322.354 1.00 132.91 ? 922  TRP I CH2   1 
ATOM   8205  N  N     . ALA I 5  923  ? 304.763 262.374 319.152 1.00 139.21 ? 923  ALA I N     1 
ATOM   8206  C  CA    . ALA I 5  923  ? 303.504 263.035 318.839 1.00 139.21 ? 923  ALA I CA    1 
ATOM   8207  C  C     . ALA I 5  923  ? 302.705 262.244 317.809 1.00 139.21 ? 923  ALA I C     1 
ATOM   8208  O  O     . ALA I 5  923  ? 301.500 262.460 317.673 1.00 139.21 ? 923  ALA I O     1 
ATOM   8209  C  CB    . ALA I 5  923  ? 303.765 264.466 318.375 1.00 139.21 ? 923  ALA I CB    1 
ATOM   8210  N  N     . LEU I 5  924  ? 303.352 261.299 317.112 1.00 139.14 ? 924  LEU I N     1 
ATOM   8211  C  CA    . LEU I 5  924  ? 302.639 260.279 316.352 1.00 139.14 ? 924  LEU I CA    1 
ATOM   8212  C  C     . LEU I 5  924  ? 302.180 259.126 317.225 1.00 139.14 ? 924  LEU I C     1 
ATOM   8213  O  O     . LEU I 5  924  ? 301.081 258.597 317.029 1.00 139.14 ? 924  LEU I O     1 
ATOM   8214  C  CB    . LEU I 5  924  ? 303.524 259.754 315.231 1.00 139.14 ? 924  LEU I CB    1 
ATOM   8215  C  CG    . LEU I 5  924  ? 303.072 259.955 313.796 1.00 139.14 ? 924  LEU I CG    1 
ATOM   8216  C  CD1   . LEU I 5  924  ? 304.091 259.359 312.873 1.00 139.14 ? 924  LEU I CD1   1 
ATOM   8217  C  CD2   . LEU I 5  924  ? 301.757 259.241 313.614 1.00 139.14 ? 924  LEU I CD2   1 
ATOM   8218  N  N     . LEU I 5  925  ? 303.082 258.592 318.054 1.00 135.62 ? 925  LEU I N     1 
ATOM   8219  C  CA    . LEU I 5  925  ? 302.711 257.406 318.867 1.00 135.62 ? 925  LEU I CA    1 
ATOM   8220  C  C     . LEU I 5  925  ? 301.800 257.877 319.998 1.00 135.62 ? 925  LEU I C     1 
ATOM   8221  O  O     . LEU I 5  925  ? 301.583 257.099 320.943 1.00 135.62 ? 925  LEU I O     1 
ATOM   8222  C  CB    . LEU I 5  925  ? 303.976 256.716 319.381 1.00 135.62 ? 925  LEU I CB    1 
ATOM   8223  C  CG    . LEU I 5  925  ? 304.842 256.111 318.279 1.00 135.62 ? 925  LEU I CG    1 
ATOM   8224  C  CD1   . LEU I 5  925  ? 306.019 255.345 318.850 1.00 135.62 ? 925  LEU I CD1   1 
ATOM   8225  C  CD2   . LEU I 5  925  ? 304.014 255.238 317.350 1.00 135.62 ? 925  LEU I CD2   1 
ATOM   8226  N  N     . ASN I 5  926  ? 301.258 259.091 319.869 1.00 139.70 ? 926  ASN I N     1 
ATOM   8227  C  CA    . ASN I 5  926  ? 300.382 259.669 320.920 1.00 139.70 ? 926  ASN I CA    1 
ATOM   8228  C  C     . ASN I 5  926  ? 298.999 259.020 320.883 1.00 139.70 ? 926  ASN I C     1 
ATOM   8229  O  O     . ASN I 5  926  ? 298.199 259.348 321.767 1.00 139.70 ? 926  ASN I O     1 
ATOM   8230  C  CB    . ASN I 5  926  ? 300.185 261.169 320.704 1.00 139.70 ? 926  ASN I CB    1 
ATOM   8231  C  CG    . ASN I 5  926  ? 300.945 262.023 321.693 1.00 139.70 ? 926  ASN I CG    1 
ATOM   8232  O  OD1   . ASN I 5  926  ? 301.424 261.529 322.711 1.00 139.70 ? 926  ASN I OD1   1 
ATOM   8233  N  ND2   . ASN I 5  926  ? 301.058 263.307 321.400 1.00 139.70 ? 926  ASN I ND2   1 
ATOM   8234  N  N     . PHE I 5  927  ? 298.708 258.182 319.881 1.00 134.76 ? 927  PHE I N     1 
ATOM   8235  C  CA    . PHE I 5  927  ? 297.330 257.638 319.771 1.00 134.76 ? 927  PHE I CA    1 
ATOM   8236  C  C     . PHE I 5  927  ? 297.296 256.248 319.144 1.00 134.76 ? 927  PHE I C     1 
ATOM   8237  O  O     . PHE I 5  927  ? 297.277 256.169 317.898 1.00 134.76 ? 927  PHE I O     1 
ATOM   8238  C  CB    . PHE I 5  927  ? 296.485 258.471 318.802 1.00 134.76 ? 927  PHE I CB    1 
ATOM   8239  C  CG    . PHE I 5  927  ? 297.076 259.772 318.323 1.00 134.76 ? 927  PHE I CG    1 
ATOM   8240  C  CD1   . PHE I 5  927  ? 298.000 259.790 317.294 1.00 134.76 ? 927  PHE I CD1   1 
ATOM   8241  C  CD2   . PHE I 5  927  ? 296.688 260.978 318.884 1.00 134.76 ? 927  PHE I CD2   1 
ATOM   8242  C  CE1   . PHE I 5  927  ? 298.534 260.987 316.850 1.00 134.76 ? 927  PHE I CE1   1 
ATOM   8243  C  CE2   . PHE I 5  927  ? 297.224 262.175 318.439 1.00 134.76 ? 927  PHE I CE2   1 
ATOM   8244  C  CZ    . PHE I 5  927  ? 298.147 262.177 317.421 1.00 134.76 ? 927  PHE I CZ    1 
ATOM   8245  N  N     . LEU I 5  928  ? 297.185 255.191 319.958 1.00 137.14 ? 928  LEU I N     1 
ATOM   8246  C  CA    . LEU I 5  928  ? 297.002 253.816 319.406 1.00 137.14 ? 928  LEU I CA    1 
ATOM   8247  C  C     . LEU I 5  928  ? 295.706 253.247 319.999 1.00 137.14 ? 928  LEU I C     1 
ATOM   8248  O  O     . LEU I 5  928  ? 294.632 253.572 319.454 1.00 137.14 ? 928  LEU I O     1 
ATOM   8249  C  CB    . LEU I 5  928  ? 298.217 252.946 319.743 1.00 137.14 ? 928  LEU I CB    1 
ATOM   8250  C  CG    . LEU I 5  928  ? 299.316 252.915 318.682 1.00 137.14 ? 928  LEU I CG    1 
ATOM   8251  C  CD1   . LEU I 5  928  ? 300.525 253.723 319.128 1.00 137.14 ? 928  LEU I CD1   1 
ATOM   8252  C  CD2   . LEU I 5  928  ? 299.719 251.484 318.363 1.00 137.14 ? 928  LEU I CD2   1 
ATOM   8253  N  N     . LEU I 5  929  ? 295.788 252.441 321.066 1.00 138.04 ? 929  LEU I N     1 
ATOM   8254  C  CA    . LEU I 5  929  ? 294.552 251.970 321.755 1.00 138.04 ? 929  LEU I CA    1 
ATOM   8255  C  C     . LEU I 5  929  ? 293.895 253.199 322.384 1.00 138.04 ? 929  LEU I C     1 
ATOM   8256  O  O     . LEU I 5  929  ? 294.643 254.117 322.770 1.00 138.04 ? 929  LEU I O     1 
ATOM   8257  C  CB    . LEU I 5  929  ? 294.924 250.959 322.849 1.00 138.04 ? 929  LEU I CB    1 
ATOM   8258  C  CG    . LEU I 5  929  ? 293.780 250.103 323.405 1.00 138.04 ? 929  LEU I CG    1 
ATOM   8259  C  CD1   . LEU I 5  929  ? 294.264 248.723 323.816 1.00 138.04 ? 929  LEU I CD1   1 
ATOM   8260  C  CD2   . LEU I 5  929  ? 293.110 250.770 324.592 1.00 138.04 ? 929  LEU I CD2   1 
ATOM   8261  N  N     . PRO I 5  930  ? 292.550 253.306 322.448 1.00 133.98 ? 930  PRO I N     1 
ATOM   8262  C  CA    . PRO I 5  930  ? 291.900 254.412 323.150 1.00 133.98 ? 930  PRO I CA    1 
ATOM   8263  C  C     . PRO I 5  930  ? 292.654 254.840 324.421 1.00 133.98 ? 930  PRO I C     1 
ATOM   8264  O  O     . PRO I 5  930  ? 292.421 255.945 324.875 1.00 133.98 ? 930  PRO I O     1 
ATOM   8265  C  CB    . PRO I 5  930  ? 290.544 253.792 323.505 1.00 133.98 ? 930  PRO I CB    1 
ATOM   8266  C  CG    . PRO I 5  930  ? 290.231 252.909 322.314 1.00 133.98 ? 930  PRO I CG    1 
ATOM   8267  C  CD    . PRO I 5  930  ? 291.573 252.428 321.797 1.00 133.98 ? 930  PRO I CD    1 
ATOM   8268  N  N     . THR I 5  931  ? 293.525 253.975 324.963 1.00 146.09 ? 931  THR I N     1 
ATOM   8269  C  CA    . THR I 5  931  ? 294.221 254.332 326.227 1.00 146.09 ? 931  THR I CA    1 
ATOM   8270  C  C     . THR I 5  931  ? 295.731 254.407 326.005 1.00 146.09 ? 931  THR I C     1 
ATOM   8271  O  O     . THR I 5  931  ? 296.460 254.538 327.000 1.00 146.09 ? 931  THR I O     1 
ATOM   8272  C  CB    . THR I 5  931  ? 293.826 253.401 327.380 1.00 146.09 ? 931  THR I CB    1 
ATOM   8273  O  OG1   . THR I 5  931  ? 293.839 254.180 328.577 1.00 146.09 ? 931  THR I OG1   1 
ATOM   8274  C  CG2   . THR I 5  931  ? 294.757 252.219 327.536 1.00 146.09 ? 931  THR I CG2   1 
ATOM   8275  N  N     . ILE I 5  932  ? 296.193 254.298 324.757 1.00 147.68 ? 932  ILE I N     1 
ATOM   8276  C  CA    . ILE I 5  932  ? 297.652 254.515 324.531 1.00 147.68 ? 932  ILE I CA    1 
ATOM   8277  C  C     . ILE I 5  932  ? 297.866 256.022 324.564 1.00 147.68 ? 932  ILE I C     1 
ATOM   8278  O  O     . ILE I 5  932  ? 298.997 256.445 324.882 1.00 147.68 ? 932  ILE I O     1 
ATOM   8279  C  CB    . ILE I 5  932  ? 298.163 253.866 323.236 1.00 147.68 ? 932  ILE I CB    1 
ATOM   8280  C  CG1   . ILE I 5  932  ? 298.233 252.350 323.406 1.00 147.68 ? 932  ILE I CG1   1 
ATOM   8281  C  CG2   . ILE I 5  932  ? 299.518 254.443 322.859 1.00 147.68 ? 932  ILE I CG2   1 
ATOM   8282  C  CD1   . ILE I 5  932  ? 298.093 251.896 324.842 1.00 147.68 ? 932  ILE I CD1   1 
ATOM   8283  N  N     . PHE I 5  933  ? 296.823 256.789 324.227 1.00 142.70 ? 933  PHE I N     1 
ATOM   8284  C  CA    . PHE I 5  933  ? 296.922 258.258 324.388 1.00 142.70 ? 933  PHE I CA    1 
ATOM   8285  C  C     . PHE I 5  933  ? 297.470 258.480 325.789 1.00 142.70 ? 933  PHE I C     1 
ATOM   8286  O  O     . PHE I 5  933  ? 298.430 259.231 325.914 1.00 142.70 ? 933  PHE I O     1 
ATOM   8287  C  CB    . PHE I 5  933  ? 295.531 258.893 324.385 1.00 142.70 ? 933  PHE I CB    1 
ATOM   8288  C  CG    . PHE I 5  933  ? 294.791 258.862 323.074 1.00 142.70 ? 933  PHE I CG    1 
ATOM   8289  C  CD1   . PHE I 5  933  ? 294.256 257.681 322.588 1.00 142.70 ? 933  PHE I CD1   1 
ATOM   8290  C  CD2   . PHE I 5  933  ? 294.601 260.022 322.340 1.00 142.70 ? 933  PHE I CD2   1 
ATOM   8291  C  CE1   . PHE I 5  933  ? 293.560 257.658 321.390 1.00 142.70 ? 933  PHE I CE1   1 
ATOM   8292  C  CE2   . PHE I 5  933  ? 293.904 259.998 321.143 1.00 142.70 ? 933  PHE I CE2   1 
ATOM   8293  C  CZ    . PHE I 5  933  ? 293.384 258.816 320.670 1.00 142.70 ? 933  PHE I CZ    1 
ATOM   8294  N  N     . LYS I 5  934  ? 296.958 257.742 326.781 1.00 141.17 ? 934  LYS I N     1 
ATOM   8295  C  CA    . LYS I 5  934  ? 297.346 257.915 328.178 1.00 141.17 ? 934  LYS I CA    1 
ATOM   8296  C  C     . LYS I 5  934  ? 298.842 257.725 328.382 1.00 141.17 ? 934  LYS I C     1 
ATOM   8297  O  O     . LYS I 5  934  ? 299.500 258.590 328.967 1.00 141.17 ? 934  LYS I O     1 
ATOM   8298  C  CB    . LYS I 5  934  ? 296.563 256.951 329.069 1.00 141.17 ? 934  LYS I CB    1 
ATOM   8299  C  CG    . LYS I 5  934  ? 297.067 256.860 330.504 1.00 141.17 ? 934  LYS I CG    1 
ATOM   8300  C  CD    . LYS I 5  934  ? 296.768 255.507 331.113 1.00 141.17 ? 934  LYS I CD    1 
ATOM   8301  C  CE    . LYS I 5  934  ? 297.472 254.404 330.352 1.00 141.17 ? 934  LYS I CE    1 
ATOM   8302  N  NZ    . LYS I 5  934  ? 297.685 253.200 331.191 1.00 141.17 ? 934  LYS I NZ    1 
ATOM   8303  N  N     . SER I 5  935  ? 299.404 256.620 327.881 1.00 144.35 ? 935  SER I N     1 
ATOM   8304  C  CA    . SER I 5  935  ? 300.822 256.363 328.127 1.00 144.35 ? 935  SER I CA    1 
ATOM   8305  C  C     . SER I 5  935  ? 301.711 257.359 327.394 1.00 144.35 ? 935  SER I C     1 
ATOM   8306  O  O     . SER I 5  935  ? 302.621 257.951 327.994 1.00 144.35 ? 935  SER I O     1 
ATOM   8307  C  CB    . SER I 5  935  ? 301.187 254.945 327.725 1.00 144.35 ? 935  SER I CB    1 
ATOM   8308  O  OG    . SER I 5  935  ? 302.599 254.807 327.694 1.00 144.35 ? 935  SER I OG    1 
ATOM   8309  N  N     . CYS I 5  936  ? 301.431 257.610 326.115 1.00 143.37 ? 936  CYS I N     1 
ATOM   8310  C  CA    . CYS I 5  936  ? 302.330 258.489 325.388 1.00 143.37 ? 936  CYS I CA    1 
ATOM   8311  C  C     . CYS I 5  936  ? 302.064 259.956 325.695 1.00 143.37 ? 936  CYS I C     1 
ATOM   8312  O  O     . CYS I 5  936  ? 302.922 260.796 325.417 1.00 143.37 ? 936  CYS I O     1 
ATOM   8313  C  CB    . CYS I 5  936  ? 302.238 258.209 323.892 1.00 143.37 ? 936  CYS I CB    1 
ATOM   8314  S  SG    . CYS I 5  936  ? 303.575 258.906 322.915 1.00 143.37 ? 936  CYS I SG    1 
ATOM   8315  N  N     . SER I 5  937  ? 300.932 260.287 326.316 1.00 150.77 ? 937  SER I N     1 
ATOM   8316  C  CA    . SER I 5  937  ? 300.703 261.646 326.775 1.00 150.77 ? 937  SER I CA    1 
ATOM   8317  C  C     . SER I 5  937  ? 301.104 261.868 328.231 1.00 150.77 ? 937  SER I C     1 
ATOM   8318  O  O     . SER I 5  937  ? 301.172 263.021 328.671 1.00 150.77 ? 937  SER I O     1 
ATOM   8319  C  CB    . SER I 5  937  ? 299.236 262.036 326.570 1.00 150.77 ? 937  SER I CB    1 
ATOM   8320  O  OG    . SER I 5  937  ? 298.940 262.117 325.189 1.00 150.77 ? 937  SER I OG    1 
ATOM   8321  N  N     . THR I 5  938  ? 301.366 260.804 328.999 1.00 149.94 ? 938  THR I N     1 
ATOM   8322  C  CA    . THR I 5  938  ? 302.288 260.963 330.118 1.00 149.94 ? 938  THR I CA    1 
ATOM   8323  C  C     . THR I 5  938  ? 303.682 261.232 329.591 1.00 149.94 ? 938  THR I C     1 
ATOM   8324  O  O     . THR I 5  938  ? 304.376 262.138 330.061 1.00 149.94 ? 938  THR I O     1 
ATOM   8325  C  CB    . THR I 5  938  ? 302.309 259.725 331.026 1.00 149.94 ? 938  THR I CB    1 
ATOM   8326  O  OG1   . THR I 5  938  ? 302.761 258.582 330.290 1.00 149.94 ? 938  THR I OG1   1 
ATOM   8327  C  CG2   . THR I 5  938  ? 300.968 259.461 331.695 1.00 149.94 ? 938  THR I CG2   1 
ATOM   8328  N  N     . PHE I 5  939  ? 304.081 260.478 328.574 1.00 156.72 ? 939  PHE I N     1 
ATOM   8329  C  CA    . PHE I 5  939  ? 305.418 260.574 328.024 1.00 156.72 ? 939  PHE I CA    1 
ATOM   8330  C  C     . PHE I 5  939  ? 305.504 261.539 326.846 1.00 156.72 ? 939  PHE I C     1 
ATOM   8331  O  O     . PHE I 5  939  ? 306.326 261.326 325.949 1.00 156.72 ? 939  PHE I O     1 
ATOM   8332  C  CB    . PHE I 5  939  ? 305.902 259.182 327.611 1.00 156.72 ? 939  PHE I CB    1 
ATOM   8333  C  CG    . PHE I 5  939  ? 306.193 258.255 328.777 1.00 156.72 ? 939  PHE I CG    1 
ATOM   8334  C  CD1   . PHE I 5  939  ? 306.439 258.758 330.052 1.00 156.72 ? 939  PHE I CD1   1 
ATOM   8335  C  CD2   . PHE I 5  939  ? 306.242 256.879 328.588 1.00 156.72 ? 939  PHE I CD2   1 
ATOM   8336  C  CE1   . PHE I 5  939  ? 306.718 257.910 331.112 1.00 156.72 ? 939  PHE I CE1   1 
ATOM   8337  C  CE2   . PHE I 5  939  ? 306.517 256.024 329.645 1.00 156.72 ? 939  PHE I CE2   1 
ATOM   8338  C  CZ    . PHE I 5  939  ? 306.756 256.544 330.908 1.00 156.72 ? 939  PHE I CZ    1 
ATOM   8339  N  N     . GLU I 5  940  ? 304.676 262.586 326.822 1.00 151.96 ? 940  GLU I N     1 
ATOM   8340  C  CA    . GLU I 5  940  ? 304.592 263.441 325.640 1.00 151.96 ? 940  GLU I CA    1 
ATOM   8341  C  C     . GLU I 5  940  ? 305.800 264.360 325.495 1.00 151.96 ? 940  GLU I C     1 
ATOM   8342  O  O     . GLU I 5  940  ? 306.373 264.472 324.406 1.00 151.96 ? 940  GLU I O     1 
ATOM   8343  C  CB    . GLU I 5  940  ? 303.308 264.265 325.675 1.00 151.96 ? 940  GLU I CB    1 
ATOM   8344  C  CG    . GLU I 5  940  ? 302.689 264.449 324.297 1.00 151.96 ? 940  GLU I CG    1 
ATOM   8345  C  CD    . GLU I 5  940  ? 301.314 265.071 324.344 1.00 151.96 ? 940  GLU I CD    1 
ATOM   8346  O  OE1   . GLU I 5  940  ? 301.224 266.270 324.674 1.00 151.96 ? 940  GLU I OE1   1 
ATOM   8347  O  OE2   . GLU I 5  940  ? 300.327 264.365 324.048 1.00 151.96 ? 940  GLU I OE2   1 
ATOM   8348  N  N     . GLN I 5  941  ? 306.195 265.028 326.574 1.00 170.09 ? 941  GLN I N     1 
ATOM   8349  C  CA    . GLN I 5  941  ? 307.259 266.024 326.532 1.00 170.09 ? 941  GLN I CA    1 
ATOM   8350  C  C     . GLN I 5  941  ? 308.648 265.399 326.522 1.00 170.09 ? 941  GLN I C     1 
ATOM   8351  O  O     . GLN I 5  941  ? 309.630 266.093 326.236 1.00 170.09 ? 941  GLN I O     1 
ATOM   8352  C  CB    . GLN I 5  941  ? 307.090 266.979 327.723 1.00 170.09 ? 941  GLN I CB    1 
ATOM   8353  C  CG    . GLN I 5  941  ? 307.843 268.279 327.634 1.00 170.09 ? 941  GLN I CG    1 
ATOM   8354  C  CD    . GLN I 5  941  ? 307.770 268.869 326.253 1.00 170.09 ? 941  GLN I CD    1 
ATOM   8355  O  OE1   . GLN I 5  941  ? 308.732 268.809 325.496 1.00 170.09 ? 941  GLN I OE1   1 
ATOM   8356  N  NE2   . GLN I 5  941  ? 306.622 269.436 325.909 1.00 170.09 ? 941  GLN I NE2   1 
ATOM   8357  N  N     . TRP I 5  942  ? 308.747 264.099 326.767 1.00 169.55 ? 942  TRP I N     1 
ATOM   8358  C  CA    . TRP I 5  942  ? 310.025 263.410 326.872 1.00 169.55 ? 942  TRP I CA    1 
ATOM   8359  C  C     . TRP I 5  942  ? 310.806 263.299 325.557 1.00 169.55 ? 942  TRP I C     1 
ATOM   8360  O  O     . TRP I 5  942  ? 310.438 263.871 324.529 1.00 169.55 ? 942  TRP I O     1 
ATOM   8361  C  CB    . TRP I 5  942  ? 309.798 262.010 327.434 1.00 169.55 ? 942  TRP I CB    1 
ATOM   8362  C  CG    . TRP I 5  942  ? 309.678 261.978 328.919 1.00 169.55 ? 942  TRP I CG    1 
ATOM   8363  C  CD1   . TRP I 5  942  ? 308.856 262.744 329.698 1.00 169.55 ? 942  TRP I CD1   1 
ATOM   8364  C  CD2   . TRP I 5  942  ? 310.404 261.130 329.818 1.00 169.55 ? 942  TRP I CD2   1 
ATOM   8365  N  NE1   . TRP I 5  942  ? 309.027 262.424 331.020 1.00 169.55 ? 942  TRP I NE1   1 
ATOM   8366  C  CE2   . TRP I 5  942  ? 309.974 261.436 331.120 1.00 169.55 ? 942  TRP I CE2   1 
ATOM   8367  C  CE3   . TRP I 5  942  ? 311.379 260.139 329.644 1.00 169.55 ? 942  TRP I CE3   1 
ATOM   8368  C  CZ2   . TRP I 5  942  ? 310.483 260.788 332.242 1.00 169.55 ? 942  TRP I CZ2   1 
ATOM   8369  C  CZ3   . TRP I 5  942  ? 311.881 259.497 330.762 1.00 169.55 ? 942  TRP I CZ3   1 
ATOM   8370  C  CH2   . TRP I 5  942  ? 311.434 259.825 332.042 1.00 169.55 ? 942  TRP I CH2   1 
ATOM   8371  N  N     . HIS I 5  969  ? 318.273 259.556 323.661 1.00 121.12 ? 969  HIS I N     1 
ATOM   8372  C  CA    . HIS I 5  969  ? 318.996 258.653 324.546 1.00 121.12 ? 969  HIS I CA    1 
ATOM   8373  C  C     . HIS I 5  969  ? 318.258 257.321 324.666 1.00 121.12 ? 969  HIS I C     1 
ATOM   8374  O  O     . HIS I 5  969  ? 318.618 256.345 324.010 1.00 121.12 ? 969  HIS I O     1 
ATOM   8375  C  CB    . HIS I 5  969  ? 319.212 259.311 325.915 1.00 121.12 ? 969  HIS I CB    1 
ATOM   8376  C  CG    . HIS I 5  969  ? 318.078 260.179 326.374 1.00 121.12 ? 969  HIS I CG    1 
ATOM   8377  N  ND1   . HIS I 5  969  ? 317.909 261.476 325.943 1.00 121.12 ? 969  HIS I ND1   1 
ATOM   8378  C  CD2   . HIS I 5  969  ? 317.077 259.942 327.254 1.00 121.12 ? 969  HIS I CD2   1 
ATOM   8379  C  CE1   . HIS I 5  969  ? 316.845 261.995 326.527 1.00 121.12 ? 969  HIS I CE1   1 
ATOM   8380  N  NE2   . HIS I 5  969  ? 316.326 261.087 327.332 1.00 121.12 ? 969  HIS I NE2   1 
ATOM   8381  N  N     . LYS I 5  970  ? 317.240 257.283 325.524 1.00 121.49 ? 970  LYS I N     1 
ATOM   8382  C  CA    . LYS I 5  970  ? 316.187 256.280 325.453 1.00 121.49 ? 970  LYS I CA    1 
ATOM   8383  C  C     . LYS I 5  970  ? 314.836 256.958 325.277 1.00 121.49 ? 970  LYS I C     1 
ATOM   8384  O  O     . LYS I 5  970  ? 313.791 256.354 325.509 1.00 121.49 ? 970  LYS I O     1 
ATOM   8385  C  CB    . LYS I 5  970  ? 316.188 255.360 326.678 1.00 121.49 ? 970  LYS I CB    1 
ATOM   8386  C  CG    . LYS I 5  970  ? 315.764 255.996 327.990 1.00 121.49 ? 970  LYS I CG    1 
ATOM   8387  C  CD    . LYS I 5  970  ? 315.051 254.988 328.882 1.00 121.49 ? 970  LYS I CD    1 
ATOM   8388  C  CE    . LYS I 5  970  ? 313.612 254.789 328.439 1.00 121.49 ? 970  LYS I CE    1 
ATOM   8389  N  NZ    . LYS I 5  970  ? 312.864 256.074 328.379 1.00 121.49 ? 970  LYS I NZ    1 
ATOM   8390  N  N     . VAL I 5  971  ? 314.833 258.204 324.801 1.00 120.06 ? 971  VAL I N     1 
ATOM   8391  C  CA    . VAL I 5  971  ? 313.596 258.800 324.307 1.00 120.06 ? 971  VAL I CA    1 
ATOM   8392  C  C     . VAL I 5  971  ? 313.136 258.220 322.986 1.00 120.06 ? 971  VAL I C     1 
ATOM   8393  O  O     . VAL I 5  971  ? 312.191 258.734 322.401 1.00 120.06 ? 971  VAL I O     1 
ATOM   8394  C  CB    . VAL I 5  971  ? 313.710 260.323 324.151 1.00 120.06 ? 971  VAL I CB    1 
ATOM   8395  C  CG1   . VAL I 5  971  ? 313.620 260.964 325.497 1.00 120.06 ? 971  VAL I CG1   1 
ATOM   8396  C  CG2   . VAL I 5  971  ? 315.033 260.659 323.508 1.00 120.06 ? 971  VAL I CG2   1 
ATOM   8397  N  N     . LEU I 5  972  ? 313.826 257.231 322.456 1.00 117.30 ? 972  LEU I N     1 
ATOM   8398  C  CA    . LEU I 5  972  ? 313.200 256.361 321.484 1.00 117.30 ? 972  LEU I CA    1 
ATOM   8399  C  C     . LEU I 5  972  ? 312.562 255.167 322.178 1.00 117.30 ? 972  LEU I C     1 
ATOM   8400  O  O     . LEU I 5  972  ? 311.523 254.673 321.740 1.00 117.30 ? 972  LEU I O     1 
ATOM   8401  C  CB    . LEU I 5  972  ? 314.239 255.921 320.463 1.00 117.30 ? 972  LEU I CB    1 
ATOM   8402  C  CG    . LEU I 5  972  ? 315.139 257.062 319.989 1.00 117.30 ? 972  LEU I CG    1 
ATOM   8403  C  CD1   . LEU I 5  972  ? 316.212 256.520 319.095 1.00 117.30 ? 972  LEU I CD1   1 
ATOM   8404  C  CD2   . LEU I 5  972  ? 314.350 258.122 319.255 1.00 117.30 ? 972  LEU I CD2   1 
ATOM   8405  N  N     . ARG I 5  973  ? 313.146 254.737 323.301 1.00 116.43 ? 973  ARG I N     1 
ATOM   8406  C  CA    . ARG I 5  973  ? 312.941 253.392 323.853 1.00 116.43 ? 973  ARG I CA    1 
ATOM   8407  C  C     . ARG I 5  973  ? 311.500 252.960 324.140 1.00 116.43 ? 973  ARG I C     1 
ATOM   8408  O  O     . ARG I 5  973  ? 311.107 251.916 323.599 1.00 116.43 ? 973  ARG I O     1 
ATOM   8409  C  CB    . ARG I 5  973  ? 313.800 253.212 325.114 1.00 116.43 ? 973  ARG I CB    1 
ATOM   8410  C  CG    . ARG I 5  973  ? 313.471 252.008 325.978 1.00 116.43 ? 973  ARG I CG    1 
ATOM   8411  C  CD    . ARG I 5  973  ? 314.107 250.756 325.427 1.00 116.43 ? 973  ARG I CD    1 
ATOM   8412  N  NE    . ARG I 5  973  ? 313.249 249.595 325.620 1.00 116.43 ? 973  ARG I NE    1 
ATOM   8413  C  CZ    . ARG I 5  973  ? 313.526 248.377 325.168 1.00 116.43 ? 973  ARG I CZ    1 
ATOM   8414  N  NH1   . ARG I 5  973  ? 314.644 248.149 324.496 1.00 116.43 ? 973  ARG I NH1   1 
ATOM   8415  N  NH2   . ARG I 5  973  ? 312.681 247.387 325.395 1.00 116.43 ? 973  ARG I NH2   1 
ATOM   8416  N  N     . PRO I 5  974  ? 310.669 253.680 324.934 1.00 116.67 ? 974  PRO I N     1 
ATOM   8417  C  CA    . PRO I 5  974  ? 309.518 253.013 325.583 1.00 116.67 ? 974  PRO I CA    1 
ATOM   8418  C  C     . PRO I 5  974  ? 308.486 252.433 324.633 1.00 116.67 ? 974  PRO I C     1 
ATOM   8419  O  O     . PRO I 5  974  ? 307.779 251.489 325.007 1.00 116.67 ? 974  PRO I O     1 
ATOM   8420  C  CB    . PRO I 5  974  ? 308.904 254.126 326.445 1.00 116.67 ? 974  PRO I CB    1 
ATOM   8421  C  CG    . PRO I 5  974  ? 309.899 255.185 326.512 1.00 116.67 ? 974  PRO I CG    1 
ATOM   8422  C  CD    . PRO I 5  974  ? 310.642 255.120 325.239 1.00 116.67 ? 974  PRO I CD    1 
ATOM   8423  N  N     . PHE I 5  975  ? 308.429 252.917 323.395 1.00 113.27 ? 975  PHE I N     1 
ATOM   8424  C  CA    . PHE I 5  975  ? 307.716 252.216 322.339 1.00 113.27 ? 975  PHE I CA    1 
ATOM   8425  C  C     . PHE I 5  975  ? 308.606 251.837 321.181 1.00 113.27 ? 975  PHE I C     1 
ATOM   8426  O  O     . PHE I 5  975  ? 308.107 251.716 320.067 1.00 113.27 ? 975  PHE I O     1 
ATOM   8427  C  CB    . PHE I 5  975  ? 306.558 253.040 321.797 1.00 113.27 ? 975  PHE I CB    1 
ATOM   8428  C  CG    . PHE I 5  975  ? 305.378 253.032 322.667 1.00 113.27 ? 975  PHE I CG    1 
ATOM   8429  C  CD1   . PHE I 5  975  ? 304.768 251.841 322.989 1.00 113.27 ? 975  PHE I CD1   1 
ATOM   8430  C  CD2   . PHE I 5  975  ? 304.889 254.210 323.192 1.00 113.27 ? 975  PHE I CD2   1 
ATOM   8431  C  CE1   . PHE I 5  975  ? 303.682 251.824 323.807 1.00 113.27 ? 975  PHE I CE1   1 
ATOM   8432  C  CE2   . PHE I 5  975  ? 303.804 254.207 324.012 1.00 113.27 ? 975  PHE I CE2   1 
ATOM   8433  C  CZ    . PHE I 5  975  ? 303.196 253.011 324.322 1.00 113.27 ? 975  PHE I CZ    1 
ATOM   8434  N  N     . LEU I 5  976  ? 309.940 251.773 321.350 1.00 116.98 ? 976  LEU I N     1 
ATOM   8435  C  CA    . LEU I 5  976  ? 310.870 251.304 320.277 1.00 116.98 ? 976  LEU I CA    1 
ATOM   8436  C  C     . LEU I 5  976  ? 311.989 250.483 320.932 1.00 116.98 ? 976  LEU I C     1 
ATOM   8437  O  O     . LEU I 5  976  ? 312.960 251.105 321.403 1.00 116.98 ? 976  LEU I O     1 
ATOM   8438  C  CB    . LEU I 5  976  ? 311.533 252.460 319.511 1.00 116.98 ? 976  LEU I CB    1 
ATOM   8439  C  CG    . LEU I 5  976  ? 310.696 253.557 318.847 1.00 116.98 ? 976  LEU I CG    1 
ATOM   8440  C  CD1   . LEU I 5  976  ? 311.630 254.539 318.164 1.00 116.98 ? 976  LEU I CD1   1 
ATOM   8441  C  CD2   . LEU I 5  976  ? 309.715 253.018 317.821 1.00 116.98 ? 976  LEU I CD2   1 
ATOM   8442  N  N     . LEU I 5  977  ? 311.908 249.147 320.915 1.00 123.60 ? 977  LEU I N     1 
ATOM   8443  C  CA    . LEU I 5  977  ? 312.902 248.304 321.583 1.00 123.60 ? 977  LEU I CA    1 
ATOM   8444  C  C     . LEU I 5  977  ? 314.252 248.321 320.853 1.00 123.60 ? 977  LEU I C     1 
ATOM   8445  O  O     . LEU I 5  977  ? 314.333 247.960 319.673 1.00 123.60 ? 977  LEU I O     1 
ATOM   8446  C  CB    . LEU I 5  977  ? 312.367 246.872 321.675 1.00 123.60 ? 977  LEU I CB    1 
ATOM   8447  C  CG    . LEU I 5  977  ? 313.075 245.764 322.456 1.00 123.60 ? 977  LEU I CG    1 
ATOM   8448  C  CD1   . LEU I 5  977  ? 312.031 244.910 323.147 1.00 123.60 ? 977  LEU I CD1   1 
ATOM   8449  C  CD2   . LEU I 5  977  ? 313.953 244.887 321.574 1.00 123.60 ? 977  LEU I CD2   1 
ATOM   8450  N  N     . ARG I 5  978  ? 315.320 248.721 321.560 1.00 102.55 ? 978  ARG I N     1 
ATOM   8451  C  CA    . ARG I 5  978  ? 316.692 248.646 321.054 1.00 102.55 ? 978  ARG I CA    1 
ATOM   8452  C  C     . ARG I 5  978  ? 317.559 247.933 322.076 1.00 102.55 ? 978  ARG I C     1 
ATOM   8453  O  O     . ARG I 5  978  ? 317.533 248.261 323.264 1.00 102.55 ? 978  ARG I O     1 
ATOM   8454  C  CB    . ARG I 5  978  ? 317.313 250.035 320.765 1.00 102.55 ? 978  ARG I CB    1 
ATOM   8455  C  CG    . ARG I 5  978  ? 318.836 250.011 320.407 1.00 102.55 ? 978  ARG I CG    1 
ATOM   8456  C  CD    . ARG I 5  978  ? 319.493 251.416 320.418 1.00 102.55 ? 978  ARG I CD    1 
ATOM   8457  N  NE