data_6LXT
# 
_entry.id   6LXT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.324 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6LXT         
WWPDB D_1300015658 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6LXT 
_pdbx_database_status.recvd_initial_deposition_date   2020-02-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zhu, Y.' 1 ? 
'Sun, F.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CN 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Cell Res.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1001-0602 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            30 
_citation.language                  ? 
_citation.page_first                343 
_citation.page_last                 355 
_citation.title                     
;Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion.
;
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41422-020-0305-x 
_citation.pdbx_database_id_PubMed   32231345 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Xia, S.'   1  ?                   
primary 'Liu, M.'   2  ?                   
primary 'Wang, C.'  3  ?                   
primary 'Xu, W.'    4  ?                   
primary 'Lan, Q.'   5  0000-0001-5524-3542 
primary 'Feng, S.'  6  ?                   
primary 'Qi, F.'    7  ?                   
primary 'Bao, L.'   8  ?                   
primary 'Du, L.'    9  ?                   
primary 'Liu, S.'   10 ?                   
primary 'Qin, C.'   11 ?                   
primary 'Sun, F.'   12 0000-0002-0351-5144 
primary 'Shi, Z.'   13 ?                   
primary 'Zhu, Y.'   14 ?                   
primary 'Jiang, S.' 15 ?                   
primary 'Lu, L.'    16 0000-0002-2255-0391 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   91.580 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6LXT 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     51.240 
_cell.length_a_esd                 ? 
_cell.length_b                     57.580 
_cell.length_b_esd                 ? 
_cell.length_c                     115.720 
_cell.length_c_esd                 ? 
_cell.volume                       341290.388 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6LXT 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            'P 2yb' 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Spike protein S2, Spike protein S2' 13979.517 6 ? ? 'HR1 domain,HR2 domain' 
;The fusion protein of SARS-CoV-2 S2 subunit HR1 domain (residues 910-988), linker (SGGRGG), SARS-CoV-2 S2 subunit HR2 domain (residues 1162-1206), and expression tag (GG)
;
2 non-polymer syn 'TETRAETHYLENE GLYCOL'               194.226   2 ? ? ?                       ? 
3 non-polymer syn 'ZINC ION'                           65.409    6 ? ? ?                       ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVES
GGRGGPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYGG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVES
GGRGGPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYGG
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   VAL n 
1 3   THR n 
1 4   GLN n 
1 5   ASN n 
1 6   VAL n 
1 7   LEU n 
1 8   TYR n 
1 9   GLU n 
1 10  ASN n 
1 11  GLN n 
1 12  LYS n 
1 13  LEU n 
1 14  ILE n 
1 15  ALA n 
1 16  ASN n 
1 17  GLN n 
1 18  PHE n 
1 19  ASN n 
1 20  SER n 
1 21  ALA n 
1 22  ILE n 
1 23  GLY n 
1 24  LYS n 
1 25  ILE n 
1 26  GLN n 
1 27  ASP n 
1 28  SER n 
1 29  LEU n 
1 30  SER n 
1 31  SER n 
1 32  THR n 
1 33  ALA n 
1 34  SER n 
1 35  ALA n 
1 36  LEU n 
1 37  GLY n 
1 38  LYS n 
1 39  LEU n 
1 40  GLN n 
1 41  ASP n 
1 42  VAL n 
1 43  VAL n 
1 44  ASN n 
1 45  GLN n 
1 46  ASN n 
1 47  ALA n 
1 48  GLN n 
1 49  ALA n 
1 50  LEU n 
1 51  ASN n 
1 52  THR n 
1 53  LEU n 
1 54  VAL n 
1 55  LYS n 
1 56  GLN n 
1 57  LEU n 
1 58  SER n 
1 59  SER n 
1 60  ASN n 
1 61  PHE n 
1 62  GLY n 
1 63  ALA n 
1 64  ILE n 
1 65  SER n 
1 66  SER n 
1 67  VAL n 
1 68  LEU n 
1 69  ASN n 
1 70  ASP n 
1 71  ILE n 
1 72  LEU n 
1 73  SER n 
1 74  ARG n 
1 75  LEU n 
1 76  ASP n 
1 77  LYS n 
1 78  VAL n 
1 79  GLU n 
1 80  SER n 
1 81  GLY n 
1 82  GLY n 
1 83  ARG n 
1 84  GLY n 
1 85  GLY n 
1 86  PRO n 
1 87  ASP n 
1 88  VAL n 
1 89  ASP n 
1 90  LEU n 
1 91  GLY n 
1 92  ASP n 
1 93  ILE n 
1 94  SER n 
1 95  GLY n 
1 96  ILE n 
1 97  ASN n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 VAL n 
1 102 ASN n 
1 103 ILE n 
1 104 GLN n 
1 105 LYS n 
1 106 GLU n 
1 107 ILE n 
1 108 ASP n 
1 109 ARG n 
1 110 LEU n 
1 111 ASN n 
1 112 GLU n 
1 113 VAL n 
1 114 ALA n 
1 115 LYS n 
1 116 ASN n 
1 117 LEU n 
1 118 ASN n 
1 119 GLU n 
1 120 SER n 
1 121 LEU n 
1 122 ILE n 
1 123 ASP n 
1 124 LEU n 
1 125 GLN n 
1 126 GLU n 
1 127 LEU n 
1 128 GLY n 
1 129 LYS n 
1 130 TYR n 
1 131 GLY n 
1 132 GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1  79  2019-nCoV ? 'S, 2' ? ? ? ? ? ? 'Severe acute respiratory syndrome coronavirus 2' 2697049 ? 
? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 80 132 2019-nCoV ? 'S, 2' ? ? ? ? ? ? 'Severe acute respiratory syndrome coronavirus 2' 2697049 ? 
? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP SPIKE_SARS2 P0DTC2 ? 1 GVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVE 910  
2 UNP SPIKE_SARS2 P0DTC2 ? 1 PDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKY                                   1162 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6LXT A 1  ? 79  ? P0DTC2 910  ? 988  ? 910  988  
2  2 6LXT A 86 ? 130 ? P0DTC2 1162 ? 1206 ? 1162 1206 
3  1 6LXT B 1  ? 79  ? P0DTC2 910  ? 988  ? 910  988  
4  2 6LXT B 86 ? 130 ? P0DTC2 1162 ? 1206 ? 1162 1206 
5  1 6LXT C 1  ? 79  ? P0DTC2 910  ? 988  ? 910  988  
6  2 6LXT C 86 ? 130 ? P0DTC2 1162 ? 1206 ? 1162 1206 
7  1 6LXT D 1  ? 79  ? P0DTC2 910  ? 988  ? 910  1155 
8  2 6LXT D 86 ? 130 ? P0DTC2 1162 ? 1206 ? 1162 1206 
9  1 6LXT E 1  ? 79  ? P0DTC2 910  ? 988  ? 910  988  
10 2 6LXT E 86 ? 130 ? P0DTC2 1162 ? 1206 ? 1162 1206 
11 1 6LXT F 1  ? 79  ? P0DTC2 910  ? 988  ? 910  988  
12 2 6LXT F 86 ? 130 ? P0DTC2 1162 ? 1206 ? 1162 1206 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6LXT SER A 80  ? UNP P0DTC2 ? ? linker           1156 1  
1  6LXT GLY A 81  ? UNP P0DTC2 ? ? linker           1157 2  
1  6LXT GLY A 82  ? UNP P0DTC2 ? ? linker           1158 3  
1  6LXT ARG A 83  ? UNP P0DTC2 ? ? linker           1159 4  
1  6LXT GLY A 84  ? UNP P0DTC2 ? ? linker           1160 5  
1  6LXT GLY A 85  ? UNP P0DTC2 ? ? linker           1161 6  
2  6LXT GLY A 131 ? UNP P0DTC2 ? ? 'expression tag' 1207 7  
2  6LXT GLY A 132 ? UNP P0DTC2 ? ? 'expression tag' 1208 8  
3  6LXT SER B 80  ? UNP P0DTC2 ? ? linker           1156 9  
3  6LXT GLY B 81  ? UNP P0DTC2 ? ? linker           1157 10 
3  6LXT GLY B 82  ? UNP P0DTC2 ? ? linker           1158 11 
3  6LXT ARG B 83  ? UNP P0DTC2 ? ? linker           1159 12 
3  6LXT GLY B 84  ? UNP P0DTC2 ? ? linker           1160 13 
3  6LXT GLY B 85  ? UNP P0DTC2 ? ? linker           1161 14 
4  6LXT GLY B 131 ? UNP P0DTC2 ? ? 'expression tag' 1207 15 
4  6LXT GLY B 132 ? UNP P0DTC2 ? ? 'expression tag' 1208 16 
5  6LXT SER C 80  ? UNP P0DTC2 ? ? linker           1156 17 
5  6LXT GLY C 81  ? UNP P0DTC2 ? ? linker           1157 18 
5  6LXT GLY C 82  ? UNP P0DTC2 ? ? linker           1158 19 
5  6LXT ARG C 83  ? UNP P0DTC2 ? ? linker           1159 20 
5  6LXT GLY C 84  ? UNP P0DTC2 ? ? linker           1160 21 
5  6LXT GLY C 85  ? UNP P0DTC2 ? ? linker           1161 22 
6  6LXT GLY C 131 ? UNP P0DTC2 ? ? 'expression tag' 1207 23 
6  6LXT GLY C 132 ? UNP P0DTC2 ? ? 'expression tag' 1208 24 
7  6LXT SER D 80  ? UNP P0DTC2 ? ? linker           1156 25 
7  6LXT GLY D 81  ? UNP P0DTC2 ? ? linker           1157 26 
7  6LXT GLY D 82  ? UNP P0DTC2 ? ? linker           1158 27 
7  6LXT ARG D 83  ? UNP P0DTC2 ? ? linker           1159 28 
7  6LXT GLY D 84  ? UNP P0DTC2 ? ? linker           1160 29 
7  6LXT GLY D 85  ? UNP P0DTC2 ? ? linker           1161 30 
8  6LXT GLY D 131 ? UNP P0DTC2 ? ? 'expression tag' 1207 31 
8  6LXT GLY D 132 ? UNP P0DTC2 ? ? 'expression tag' 1208 32 
9  6LXT SER E 80  ? UNP P0DTC2 ? ? linker           1156 33 
9  6LXT GLY E 81  ? UNP P0DTC2 ? ? linker           1157 34 
9  6LXT GLY E 82  ? UNP P0DTC2 ? ? linker           1158 35 
9  6LXT ARG E 83  ? UNP P0DTC2 ? ? linker           1159 36 
9  6LXT GLY E 84  ? UNP P0DTC2 ? ? linker           1160 37 
9  6LXT GLY E 85  ? UNP P0DTC2 ? ? linker           1161 38 
10 6LXT GLY E 131 ? UNP P0DTC2 ? ? 'expression tag' 1207 39 
10 6LXT GLY E 132 ? UNP P0DTC2 ? ? 'expression tag' 1208 40 
11 6LXT SER F 80  ? UNP P0DTC2 ? ? linker           1156 41 
11 6LXT GLY F 81  ? UNP P0DTC2 ? ? linker           1157 42 
11 6LXT GLY F 82  ? UNP P0DTC2 ? ? linker           1158 43 
11 6LXT ARG F 83  ? UNP P0DTC2 ? ? linker           1159 44 
11 6LXT GLY F 84  ? UNP P0DTC2 ? ? linker           1160 45 
11 6LXT GLY F 85  ? UNP P0DTC2 ? ? linker           1161 46 
12 6LXT GLY F 131 ? UNP P0DTC2 ? ? 'expression tag' 1207 47 
12 6LXT GLY F 132 ? UNP P0DTC2 ? ? 'expression tag' 1208 48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ? 'C6 H15 N2 O2 1' 147.195 
PG4 non-polymer         . 'TETRAETHYLENE GLYCOL' ? 'C8 H18 O5'      194.226 
PHE 'L-peptide linking' y PHENYLALANINE          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'             ? 'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6LXT 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.14 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         42.50 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '10% PEG 8000, 200 mM zinc acetate, 0.1 M MES, pH 6.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU RAXIS IV++' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2020-02-10 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'Cu FINE FOCUS' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6LXT 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.90 
_reflns.d_resolution_low                 47.32 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       14470 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             94.02 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.0 
_reflns.pdbx_Rmerge_I_obs                0.16 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     1 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.90 
_reflns_shell.d_res_low                   3.00 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1518 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.13 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.82 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               87.99 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6LXT 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.90 
_refine.ls_d_res_low                             47.32 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     14313 
_refine.ls_number_reflns_R_free                  737 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    94.02 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       0.2896 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2593 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1WYY 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        47.32 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               5237 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        5205 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0132  ? 5236 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.9331  ? 7058 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0824  ? 883  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0047  ? 928  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 16.5867 ? 3277 ? f_dihedral_angle_d ? ? 
# 
_refine_ls_shell.R_factor_R_free                  0.43 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.36 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.d_res_high                       2.9 
_refine_ls_shell.d_res_low                        3.0 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                1518 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.percent_reflns_obs               99.02 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
# 
_struct.entry_id                     6LXT 
_struct.title                        'Structure of post fusion core of 2019-nCoV S2 subunit' 
_struct.pdbx_descriptor              'Spike protein S2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6LXT 
_struct_keywords.text            '2019-nCoV, HR1 and HR2 domain, VIRUS, VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLN A 4   ? GLU A 79  ? GLN A 913  GLU A 988  1 ? 76 
HELX_P HELX_P2  AA2 ILE A 103 ? LEU A 117 ? ILE A 1179 LEU A 1193 1 ? 15 
HELX_P HELX_P3  AA3 ASN A 118 ? LEU A 121 ? ASN A 1194 LEU A 1197 5 ? 4  
HELX_P HELX_P4  AA4 VAL B 6   ? GLU B 79  ? VAL B 915  GLU B 988  1 ? 74 
HELX_P HELX_P5  AA5 ILE B 103 ? LEU B 117 ? ILE B 1179 LEU B 1193 1 ? 15 
HELX_P HELX_P6  AA6 ASN B 118 ? LEU B 121 ? ASN B 1194 LEU B 1197 5 ? 4  
HELX_P HELX_P7  AA7 GLN C 4   ? GLU C 79  ? GLN C 913  GLU C 988  1 ? 76 
HELX_P HELX_P8  AA8 ILE C 103 ? LEU C 117 ? ILE C 1179 LEU C 1193 1 ? 15 
HELX_P HELX_P9  AA9 ASN C 118 ? LEU C 121 ? ASN C 1194 LEU C 1197 5 ? 4  
HELX_P HELX_P10 AB1 GLN D 4   ? LEU D 75  ? GLN D 913  LEU D 984  1 ? 72 
HELX_P HELX_P11 AB2 ILE D 103 ? LEU D 117 ? ILE D 1179 LEU D 1193 1 ? 15 
HELX_P HELX_P12 AB3 ASN D 118 ? LEU D 121 ? ASN D 1194 LEU D 1197 5 ? 4  
HELX_P HELX_P13 AB4 LEU E 7   ? LYS E 77  ? LEU E 916  LYS E 986  1 ? 71 
HELX_P HELX_P14 AB5 ILE E 103 ? LEU E 117 ? ILE E 1179 LEU E 1193 1 ? 15 
HELX_P HELX_P15 AB6 ASN E 118 ? LEU E 121 ? ASN E 1194 LEU E 1197 5 ? 4  
HELX_P HELX_P16 AB7 ASN F 5   ? GLU F 79  ? ASN F 914  GLU F 988  1 ? 75 
HELX_P HELX_P17 AB8 ILE F 103 ? LEU F 117 ? ILE F 1179 LEU F 1193 1 ? 15 
HELX_P HELX_P18 AB9 ASN F 118 ? LEU F 121 ? ASN F 1194 LEU F 1197 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A ASP 89  OD2 ? ? ? 1_555 J ZN . ZN ? ? A ASP 1165 A ZN 1304 1_555 ? ? ? ? ? ? ? 1.770 ? 
metalc2 metalc ? ? B ASP 27  OD1 ? ? ? 1_555 K ZN . ZN ? ? B ASP 936  B ZN 1301 1_555 ? ? ? ? ? ? ? 1.940 ? 
metalc3 metalc ? ? E ASP 87  OD1 ? ? ? 1_555 J ZN . ZN ? ? E ASP 1163 A ZN 1304 1_555 ? ? ? ? ? ? ? 2.528 ? 
metalc4 metalc ? ? E ASP 89  OD1 ? ? ? 1_555 J ZN . ZN ? ? E ASP 1165 A ZN 1304 1_555 ? ? ? ? ? ? ? 2.614 ? 
metalc5 metalc ? ? F GLU 9   OE1 ? ? ? 1_555 N ZN . ZN ? ? F GLU 918  F ZN 1302 1_555 ? ? ? ? ? ? ? 2.693 ? 
metalc6 metalc ? ? F ASP 41  OD1 ? ? ? 1_555 M ZN . ZN ? ? F ASP 950  F ZN 1301 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc7 metalc ? ? A GLU 119 OE2 ? ? ? 1_555 L ZN . ZN ? ? A GLU 1195 B ZN 1302 2_545 ? ? ? ? ? ? ? 2.679 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PG4 1301 ? 2 'binding site for residue PG4 A 1301' 
AC2 Software A ZN  1302 ? 3 'binding site for residue ZN A 1302'  
AC3 Software A PG4 1303 ? 3 'binding site for residue PG4 A 1303' 
AC4 Software A ZN  1304 ? 3 'binding site for residue ZN A 1304'  
AC5 Software B ZN  1301 ? 1 'binding site for residue ZN B 1301'  
AC6 Software B ZN  1302 ? 1 'binding site for residue ZN B 1302'  
AC7 Software F ZN  1301 ? 1 'binding site for residue ZN F 1301'  
AC8 Software F ZN  1302 ? 1 'binding site for residue ZN F 1302'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 ARG A 109 ? ARG A 1185 . ? 1_555 ? 
2  AC1 2 PG4 I .   ? PG4 A 1303 . ? 1_555 ? 
3  AC2 3 GLN A 40  ? GLN A 949  . ? 1_555 ? 
4  AC2 3 ASP A 41  ? ASP A 950  . ? 1_555 ? 
5  AC2 3 GLN A 104 ? GLN A 1180 . ? 1_555 ? 
6  AC3 3 ASP A 108 ? ASP A 1184 . ? 1_555 ? 
7  AC3 3 GLU A 112 ? GLU A 1188 . ? 1_555 ? 
8  AC3 3 PG4 G .   ? PG4 A 1301 . ? 1_555 ? 
9  AC4 3 ASP A 89  ? ASP A 1165 . ? 1_555 ? 
10 AC4 3 ASP E 87  ? ASP E 1163 . ? 1_555 ? 
11 AC4 3 ASP E 89  ? ASP E 1165 . ? 1_555 ? 
12 AC5 1 ASP B 27  ? ASP B 936  . ? 1_555 ? 
13 AC6 1 ASP B 76  ? ASP B 985  . ? 1_555 ? 
14 AC7 1 ASP F 41  ? ASP F 950  . ? 1_555 ? 
15 AC8 1 GLU F 9   ? GLU F 918  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6LXT 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.019516 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000538 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017367 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008645 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
N  
O  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . THR A 1 3   ? 7.87200   -5.98700  -68.80400 1.000 147.90721 ? 912  THR A N   1 
ATOM   2    C  CA  . THR A 1 3   ? 8.20200   -4.78900  -67.95800 1.000 144.51470 ? 912  THR A CA  1 
ATOM   3    C  C   . THR A 1 3   ? 7.17300   -4.68000  -66.82100 1.000 131.26311 ? 912  THR A C   1 
ATOM   4    O  O   . THR A 1 3   ? 6.60700   -3.58800  -66.60600 1.000 124.61494 ? 912  THR A O   1 
ATOM   5    C  CB  . THR A 1 3   ? 8.34500   -3.53600  -68.83500 1.000 147.84667 ? 912  THR A CB  1 
ATOM   6    O  OG1 . THR A 1 3   ? 7.10300   -3.29600  -69.49800 1.000 148.03354 ? 912  THR A OG1 1 
ATOM   7    C  CG2 . THR A 1 3   ? 9.44800   -3.67200  -69.86200 1.000 151.30235 ? 912  THR A CG2 1 
ATOM   8    N  N   . GLN A 1 4   ? 6.97500   -5.79500  -66.11600 1.000 134.78195 ? 913  GLN A N   1 
ATOM   9    C  CA  . GLN A 1 4   ? 6.13300   -5.93600  -64.89900 1.000 127.50213 ? 913  GLN A CA  1 
ATOM   10   C  C   . GLN A 1 4   ? 7.03100   -6.42100  -63.75400 1.000 125.04394 ? 913  GLN A C   1 
ATOM   11   O  O   . GLN A 1 4   ? 6.48700   -6.88200  -62.73300 1.000 133.70814 ? 913  GLN A O   1 
ATOM   12   C  CB  . GLN A 1 4   ? 4.98600   -6.92100  -65.15400 1.000 125.67033 ? 913  GLN A CB  1 
ATOM   13   C  CG  . GLN A 1 4   ? 5.36800   -8.08700  -66.06300 1.000 131.40260 ? 913  GLN A CG  1 
ATOM   14   C  CD  . GLN A 1 4   ? 4.61000   -9.36600  -65.79000 1.000 134.63983 ? 913  GLN A CD  1 
ATOM   15   O  OE1 . GLN A 1 4   ? 4.42200   -9.77300  -64.64500 1.000 138.82454 ? 913  GLN A OE1 1 
ATOM   16   N  NE2 . GLN A 1 4   ? 4.19600   -10.04100 -66.85100 1.000 131.26574 ? 913  GLN A NE2 1 
ATOM   17   N  N   . ASN A 1 5   ? 8.35500   -6.33000  -63.92900 1.000 122.84104 ? 914  ASN A N   1 
ATOM   18   C  CA  . ASN A 1 5   ? 9.37100   -6.85300  -62.97400 1.000 121.63300 ? 914  ASN A CA  1 
ATOM   19   C  C   . ASN A 1 5   ? 9.34400   -6.01300  -61.69400 1.000 117.36934 ? 914  ASN A C   1 
ATOM   20   O  O   . ASN A 1 5   ? 9.37100   -6.61900  -60.59600 1.000 108.39194 ? 914  ASN A O   1 
ATOM   21   C  CB  . ASN A 1 5   ? 10.77500  -6.88500  -63.58500 1.000 121.62248 ? 914  ASN A CB  1 
ATOM   22   C  CG  . ASN A 1 5   ? 10.98300  -8.07100  -64.50100 1.000 128.90756 ? 914  ASN A CG  1 
ATOM   23   O  OD1 . ASN A 1 5   ? 10.34100  -9.11100  -64.34600 1.000 132.98700 ? 914  ASN A OD1 1 
ATOM   24   N  ND2 . ASN A 1 5   ? 11.87100  -7.92100  -65.46900 1.000 134.26873 ? 914  ASN A ND2 1 
ATOM   25   N  N   . VAL A 1 6   ? 9.27500   -4.68200  -61.84000 1.000 123.78589 ? 915  VAL A N   1 
ATOM   26   C  CA  . VAL A 1 6   ? 9.25000   -3.69500  -60.71500 1.000 121.68827 ? 915  VAL A CA  1 
ATOM   27   C  C   . VAL A 1 6   ? 8.09500   -4.05700  -59.77500 1.000 114.46109 ? 915  VAL A C   1 
ATOM   28   O  O   . VAL A 1 6   ? 8.31400   -4.08800  -58.54800 1.000 113.04513 ? 915  VAL A O   1 
ATOM   29   C  CB  . VAL A 1 6   ? 9.11000   -2.23800  -61.20400 1.000 116.42185 ? 915  VAL A CB  1 
ATOM   30   C  CG1 . VAL A 1 6   ? 9.09600   -1.25500  -60.03900 1.000 116.15603 ? 915  VAL A CG1 1 
ATOM   31   C  CG2 . VAL A 1 6   ? 10.19500  -1.85600  -62.19700 1.000 115.51648 ? 915  VAL A CG2 1 
ATOM   32   N  N   . LEU A 1 7   ? 6.91100   -4.30700  -60.33600 1.000 105.80742 ? 916  LEU A N   1 
ATOM   33   C  CA  . LEU A 1 7   ? 5.67800   -4.60500  -59.56500 1.000 108.42353 ? 916  LEU A CA  1 
ATOM   34   C  C   . LEU A 1 7   ? 5.84300   -5.92900  -58.80100 1.000 117.38776 ? 916  LEU A C   1 
ATOM   35   O  O   . LEU A 1 7   ? 5.45800   -5.96200  -57.61300 1.000 113.21094 ? 916  LEU A O   1 
ATOM   36   C  CB  . LEU A 1 7   ? 4.47500   -4.61400  -60.51400 1.000 109.19730 ? 916  LEU A CB  1 
ATOM   37   C  CG  . LEU A 1 7   ? 3.78500   -3.25900  -60.68500 1.000 103.48083 ? 916  LEU A CG  1 
ATOM   38   C  CD1 . LEU A 1 7   ? 4.67600   -2.26900  -61.42500 1.000 106.51277 ? 916  LEU A CD1 1 
ATOM   39   C  CD2 . LEU A 1 7   ? 2.45100   -3.41700  -61.39700 1.000 89.96079  ? 916  LEU A CD2 1 
ATOM   40   N  N   . TYR A 1 8   ? 6.41500   -6.96700  -59.42400 1.000 108.51564 ? 917  TYR A N   1 
ATOM   41   C  CA  . TYR A 1 8   ? 6.59300   -8.30300  -58.79200 1.000 109.16572 ? 917  TYR A CA  1 
ATOM   42   C  C   . TYR A 1 8   ? 7.65400   -8.22600  -57.69600 1.000 109.47102 ? 917  TYR A C   1 
ATOM   43   O  O   . TYR A 1 8   ? 7.45800   -8.86500  -56.65000 1.000 116.89559 ? 917  TYR A O   1 
ATOM   44   C  CB  . TYR A 1 8   ? 6.98700   -9.38000  -59.80100 1.000 108.66829 ? 917  TYR A CB  1 
ATOM   45   C  CG  . TYR A 1 8   ? 7.08600   -10.76800 -59.21400 1.000 112.56350 ? 917  TYR A CG  1 
ATOM   46   C  CD1 . TYR A 1 8   ? 6.04700   -11.31700 -58.47700 1.000 116.42712 ? 917  TYR A CD1 1 
ATOM   47   C  CD2 . TYR A 1 8   ? 8.21800   -11.54500 -59.40400 1.000 115.80336 ? 917  TYR A CD2 1 
ATOM   48   C  CE1 . TYR A 1 8   ? 6.13200   -12.59400 -57.94000 1.000 120.23547 ? 917  TYR A CE1 1 
ATOM   49   C  CE2 . TYR A 1 8   ? 8.31500   -12.82700 -58.88400 1.000 116.92455 ? 917  TYR A CE2 1 
ATOM   50   C  CZ  . TYR A 1 8   ? 7.27000   -13.35400 -58.14600 1.000 118.99321 ? 917  TYR A CZ  1 
ATOM   51   O  OH  . TYR A 1 8   ? 7.37000   -14.61000 -57.62200 1.000 117.83518 ? 917  TYR A OH  1 
ATOM   52   N  N   . GLU A 1 9   ? 8.74100   -7.48900  -57.93600 1.000 110.04214 ? 918  GLU A N   1 
ATOM   53   C  CA  . GLU A 1 9   ? 9.81900   -7.27800  -56.93100 1.000 116.03233 ? 918  GLU A CA  1 
ATOM   54   C  C   . GLU A 1 9   ? 9.28600   -6.42800  -55.76600 1.000 113.07935 ? 918  GLU A C   1 
ATOM   55   O  O   . GLU A 1 9   ? 9.69500   -6.70600  -54.62000 1.000 112.04764 ? 918  GLU A O   1 
ATOM   56   C  CB  . GLU A 1 9   ? 11.06400  -6.66900  -57.58300 1.000 116.83243 ? 918  GLU A CB  1 
ATOM   57   C  CG  . GLU A 1 9   ? 11.81500  -7.64300  -58.48200 1.000 116.03233 ? 918  GLU A CG  1 
ATOM   58   C  CD  . GLU A 1 9   ? 12.34100  -8.90600  -57.80900 1.000 114.03473 ? 918  GLU A CD  1 
ATOM   59   O  OE1 . GLU A 1 9   ? 13.14500  -8.78000  -56.85700 1.000 110.39482 ? 918  GLU A OE1 1 
ATOM   60   O  OE2 . GLU A 1 9   ? 11.94200  -10.02100 -58.23400 1.000 111.78709 ? 918  GLU A OE2 1 
ATOM   61   N  N   . ASN A 1 10  ? 8.40700   -5.45100  -56.03500 1.000 115.13223 ? 919  ASN A N   1 
ATOM   62   C  CA  . ASN A 1 10  ? 7.71500   -4.63900  -54.99300 1.000 108.93938 ? 919  ASN A CA  1 
ATOM   63   C  C   . ASN A 1 10  ? 6.82500   -5.56700  -54.15500 1.000 107.21285 ? 919  ASN A C   1 
ATOM   64   O  O   . ASN A 1 10  ? 6.87700   -5.46800  -52.91700 1.000 108.44458 ? 919  ASN A O   1 
ATOM   65   C  CB  . ASN A 1 10  ? 6.91000   -3.47200  -55.58200 1.000 109.90791 ? 919  ASN A CB  1 
ATOM   66   C  CG  . ASN A 1 10  ? 7.74700   -2.25800  -55.93600 1.000 113.04776 ? 919  ASN A CG  1 
ATOM   67   O  OD1 . ASN A 1 10  ? 8.86700   -2.10700  -55.45100 1.000 118.86162 ? 919  ASN A OD1 1 
ATOM   68   N  ND2 . ASN A 1 10  ? 7.20200   -1.37700  -56.76500 1.000 109.16835 ? 919  ASN A ND2 1 
ATOM   69   N  N   . GLN A 1 11  ? 6.05300   -6.45100  -54.79500 1.000 84.71805  ? 920  GLN A N   1 
ATOM   70   C  CA  . GLN A 1 11  ? 5.16600   -7.41100  -54.08200 1.000 84.98651  ? 920  GLN A CA  1 
ATOM   71   C  C   . GLN A 1 11  ? 6.00800   -8.27600  -53.14000 1.000 94.70609  ? 920  GLN A C   1 
ATOM   72   O  O   . GLN A 1 11  ? 5.59200   -8.44700  -51.97900 1.000 97.79594  ? 920  GLN A O   1 
ATOM   73   C  CB  . GLN A 1 11  ? 4.39700   -8.31300  -55.04700 1.000 88.76854  ? 920  GLN A CB  1 
ATOM   74   C  CG  . GLN A 1 11  ? 3.32500   -7.58000  -55.83400 1.000 88.94487  ? 920  GLN A CG  1 
ATOM   75   C  CD  . GLN A 1 11  ? 2.40100   -8.50600  -56.58500 1.000 98.30389  ? 920  GLN A CD  1 
ATOM   76   O  OE1 . GLN A 1 11  ? 2.63100   -9.70900  -56.68800 1.000 94.00864  ? 920  GLN A OE1 1 
ATOM   77   N  NE2 . GLN A 1 11  ? 1.33300   -7.93900  -57.12200 1.000 106.96019 ? 920  GLN A NE2 1 
ATOM   78   N  N   . LYS A 1 12  ? 7.13900   -8.79500  -53.62500 1.000 86.09453  ? 921  LYS A N   1 
ATOM   79   C  CA  . LYS A 1 12  ? 8.06200   -9.64900  -52.83400 1.000 84.04692  ? 921  LYS A CA  1 
ATOM   80   C  C   . LYS A 1 12  ? 8.60000   -8.86200  -51.63600 1.000 80.96234  ? 921  LYS A C   1 
ATOM   81   O  O   . LYS A 1 12  ? 8.67600   -9.44200  -50.54100 1.000 83.82321  ? 921  LYS A O   1 
ATOM   82   C  CB  . LYS A 1 12  ? 9.23800   -10.12300 -53.68700 1.000 92.96378  ? 921  LYS A CB  1 
ATOM   83   C  CG  . LYS A 1 12  ? 8.95800   -11.30000 -54.60800 1.000 93.10064  ? 921  LYS A CG  1 
ATOM   84   C  CD  . LYS A 1 12  ? 10.23900  -11.89300 -55.14700 1.000 91.30305  ? 921  LYS A CD  1 
ATOM   85   C  CE  . LYS A 1 12  ? 10.01700  -13.14100 -55.97000 1.000 106.04429 ? 921  LYS A CE  1 
ATOM   86   N  NZ  . LYS A 1 12  ? 11.11000  -13.34900 -56.95100 1.000 114.39003 ? 921  LYS A NZ  1 
ATOM   87   N  N   . LEU A 1 13  ? 8.97100   -7.59700  -51.83800 1.000 89.43178  ? 922  LEU A N   1 
ATOM   88   C  CA  . LEU A 1 13  ? 9.44700   -6.70000  -50.75100 1.000 85.86556  ? 922  LEU A CA  1 
ATOM   89   C  C   . LEU A 1 13  ? 8.34000   -6.53100  -49.70900 1.000 80.02012  ? 922  LEU A C   1 
ATOM   90   O  O   . LEU A 1 13  ? 8.62000   -6.75400  -48.51900 1.000 87.79211  ? 922  LEU A O   1 
ATOM   91   C  CB  . LEU A 1 13  ? 9.86200   -5.34600  -51.33400 1.000 90.93722  ? 922  LEU A CB  1 
ATOM   92   C  CG  . LEU A 1 13  ? 11.20600  -5.33700  -52.06000 1.000 109.68947 ? 922  LEU A CG  1 
ATOM   93   C  CD1 . LEU A 1 13  ? 11.54300  -3.94100  -52.56200 1.000 118.12732 ? 922  LEU A CD1 1 
ATOM   94   C  CD2 . LEU A 1 13  ? 12.31900  -5.86700  -51.16500 1.000 107.53921 ? 922  LEU A CD2 1 
ATOM   95   N  N   . ILE A 1 14  ? 7.13500   -6.15900  -50.14300 1.000 72.43237  ? 923  ILE A N   1 
ATOM   96   C  CA  . ILE A 1 14  ? 5.97700   -5.91600  -49.23300 1.000 75.79067  ? 923  ILE A CA  1 
ATOM   97   C  C   . ILE A 1 14  ? 5.79000   -7.16900  -48.37000 1.000 76.00648  ? 923  ILE A C   1 
ATOM   98   O  O   . ILE A 1 14  ? 5.73000   -7.02400  -47.13100 1.000 72.17707  ? 923  ILE A O   1 
ATOM   99   C  CB  . ILE A 1 14  ? 4.70600   -5.53400  -50.02300 1.000 73.70884  ? 923  ILE A CB  1 
ATOM   100  C  CG1 . ILE A 1 14  ? 4.82200   -4.13600  -50.63700 1.000 65.48943  ? 923  ILE A CG1 1 
ATOM   101  C  CG2 . ILE A 1 14  ? 3.46700   -5.64600  -49.14700 1.000 67.72391  ? 923  ILE A CG2 1 
ATOM   102  C  CD1 . ILE A 1 14  ? 3.87100   -3.87600  -51.77500 1.000 60.86519  ? 923  ILE A CD1 1 
ATOM   103  N  N   . ALA A 1 15  ? 5.74900   -8.34700  -49.00200 1.000 64.25770  ? 924  ALA A N   1 
ATOM   104  C  CA  . ALA A 1 15  ? 5.45400   -9.64800  -48.35700 1.000 73.37196  ? 924  ALA A CA  1 
ATOM   105  C  C   . ALA A 1 15  ? 6.52400   -9.98000  -47.31600 1.000 81.33607  ? 924  ALA A C   1 
ATOM   106  O  O   . ALA A 1 15  ? 6.14400   -10.42800 -46.21700 1.000 87.64735  ? 924  ALA A O   1 
ATOM   107  C  CB  . ALA A 1 15  ? 5.35600   -10.73700 -49.38800 1.000 68.46874  ? 924  ALA A CB  1 
ATOM   108  N  N   . ASN A 1 16  ? 7.80200   -9.78800  -47.66100 1.000 75.45378  ? 925  ASN A N   1 
ATOM   109  C  CA  . ASN A 1 16  ? 8.94800   -10.05100 -46.75000 1.000 75.39062  ? 925  ASN A CA  1 
ATOM   110  C  C   . ASN A 1 16  ? 8.83900   -9.10500  -45.55400 1.000 69.22409  ? 925  ASN A C   1 
ATOM   111  O  O   . ASN A 1 16  ? 8.76600   -9.62100  -44.42600 1.000 66.83170  ? 925  ASN A O   1 
ATOM   112  C  CB  . ASN A 1 16  ? 10.29500  -9.94800  -47.46900 1.000 69.54255  ? 925  ASN A CB  1 
ATOM   113  C  CG  . ASN A 1 16  ? 10.52200  -11.09200 -48.43500 1.000 82.14932  ? 925  ASN A CG  1 
ATOM   114  O  OD1 . ASN A 1 16  ? 9.86000   -12.13300 -48.36100 1.000 86.74987  ? 925  ASN A OD1 1 
ATOM   115  N  ND2 . ASN A 1 16  ? 11.46100  -10.90200 -49.34900 1.000 80.01749  ? 925  ASN A ND2 1 
ATOM   116  N  N   . GLN A 1 17  ? 8.78500   -7.79200  -45.81000 1.000 65.37100  ? 926  GLN A N   1 
ATOM   117  C  CA  . GLN A 1 17  ? 8.62900   -6.73200  -44.77700 1.000 65.23940  ? 926  GLN A CA  1 
ATOM   118  C  C   . GLN A 1 17  ? 7.46900   -7.08200  -43.83600 1.000 66.38164  ? 926  GLN A C   1 
ATOM   119  O  O   . GLN A 1 17  ? 7.65700   -7.01200  -42.60300 1.000 63.23916  ? 926  GLN A O   1 
ATOM   120  C  CB  . GLN A 1 17  ? 8.36600   -5.37300  -45.43000 1.000 66.83959  ? 926  GLN A CB  1 
ATOM   121  C  CG  . GLN A 1 17  ? 9.55600   -4.79300  -46.18400 1.000 58.38858  ? 926  GLN A CG  1 
ATOM   122  C  CD  . GLN A 1 17  ? 10.85100  -4.91100  -45.41700 1.000 60.90730  ? 926  GLN A CD  1 
ATOM   123  O  OE1 . GLN A 1 17  ? 11.51100  -5.95100  -45.44100 1.000 70.21368  ? 926  GLN A OE1 1 
ATOM   124  N  NE2 . GLN A 1 17  ? 11.22600  -3.83600  -44.74000 1.000 60.67306  ? 926  GLN A NE2 1 
ATOM   125  N  N   . PHE A 1 18  ? 6.31100   -7.43000  -44.40200 1.000 62.54171  ? 927  PHE A N   1 
ATOM   126  C  CA  . PHE A 1 18  ? 5.08700   -7.81000  -43.64900 1.000 64.65775  ? 927  PHE A CA  1 
ATOM   127  C  C   . PHE A 1 18  ? 5.40900   -8.99700  -42.72600 1.000 59.55977  ? 927  PHE A C   1 
ATOM   128  O  O   . PHE A 1 18  ? 5.26500   -8.85200  -41.50300 1.000 67.39229  ? 927  PHE A O   1 
ATOM   129  C  CB  . PHE A 1 18  ? 3.94000   -8.10000  -44.62200 1.000 61.26261  ? 927  PHE A CB  1 
ATOM   130  C  CG  . PHE A 1 18  ? 2.64700   -8.48100  -43.95800 1.000 55.96724  ? 927  PHE A CG  1 
ATOM   131  C  CD1 . PHE A 1 18  ? 2.00700   -7.59600  -43.11100 1.000 50.63765  ? 927  PHE A CD1 1 
ATOM   132  C  CD2 . PHE A 1 18  ? 2.08700   -9.73100  -44.16000 1.000 68.08711  ? 927  PHE A CD2 1 
ATOM   133  C  CE1 . PHE A 1 18  ? 0.82300   -7.95200  -42.48300 1.000 57.88062  ? 927  PHE A CE1 1 
ATOM   134  C  CE2 . PHE A 1 18  ? 0.89500   -10.08100 -43.54600 1.000 63.27338  ? 927  PHE A CE2 1 
ATOM   135  C  CZ  . PHE A 1 18  ? 0.25800   -9.18600  -42.71600 1.000 53.34324  ? 927  PHE A CZ  1 
ATOM   136  N  N   . ASN A 1 19  ? 5.87300   -10.11400 -43.30000 1.000 58.35437  ? 928  ASN A N   1 
ATOM   137  C  CA  . ASN A 1 19  ? 6.19100   -11.38300 -42.58500 1.000 57.29634  ? 928  ASN A CA  1 
ATOM   138  C  C   . ASN A 1 19  ? 7.23200   -11.10900 -41.49300 1.000 57.91484  ? 928  ASN A C   1 
ATOM   139  O  O   . ASN A 1 19  ? 7.12300   -11.70600 -40.42300 1.000 62.51013  ? 928  ASN A O   1 
ATOM   140  C  CB  . ASN A 1 19  ? 6.67900   -12.47900 -43.53900 1.000 64.14980  ? 928  ASN A CB  1 
ATOM   141  C  CG  . ASN A 1 19  ? 5.59400   -13.01400 -44.45500 1.000 67.02119  ? 928  ASN A CG  1 
ATOM   142  O  OD1 . ASN A 1 19  ? 4.45400   -13.15600 -44.03800 1.000 75.16164  ? 928  ASN A OD1 1 
ATOM   143  N  ND2 . ASN A 1 19  ? 5.93000   -13.33500 -45.69700 1.000 68.70561  ? 928  ASN A ND2 1 
ATOM   144  N  N   . SER A 1 20  ? 8.20300   -10.23400 -41.76000 1.000 67.37650  ? 929  SER A N   1 
ATOM   145  C  CA  . SER A 1 20  ? 9.18600   -9.75300  -40.75700 1.000 59.65715  ? 929  SER A CA  1 
ATOM   146  C  C   . SER A 1 20  ? 8.41600   -9.05800  -39.63100 1.000 62.99703  ? 929  SER A C   1 
ATOM   147  O  O   . SER A 1 20  ? 8.50700   -9.54000  -38.50100 1.000 69.98207  ? 929  SER A O   1 
ATOM   148  C  CB  . SER A 1 20  ? 10.24400  -8.86700  -41.37400 1.000 60.51515  ? 929  SER A CB  1 
ATOM   149  O  OG  . SER A 1 20  ? 9.81900   -7.51800  -41.42000 1.000 64.05505  ? 929  SER A OG  1 
ATOM   150  N  N   . ALA A 1 21  ? 7.63200   -8.02200  -39.94400 1.000 58.52017  ? 930  ALA A N   1 
ATOM   151  C  CA  . ALA A 1 21  ? 6.89000   -7.19300  -38.96400 1.000 50.90084  ? 930  ALA A CA  1 
ATOM   152  C  C   . ALA A 1 21  ? 6.03600   -8.08500  -38.05400 1.000 64.10505  ? 930  ALA A C   1 
ATOM   153  O  O   . ALA A 1 21  ? 6.13500   -7.94600  -36.82200 1.000 64.76829  ? 930  ALA A O   1 
ATOM   154  C  CB  . ALA A 1 21  ? 6.03500   -6.18300  -39.68400 1.000 46.93457  ? 930  ALA A CB  1 
ATOM   155  N  N   . ILE A 1 22  ? 5.22100   -8.96300  -38.63700 1.000 53.04320  ? 931  ILE A N   1 
ATOM   156  C  CA  . ILE A 1 22  ? 4.31500   -9.86900  -37.87400 1.000 60.54937  ? 931  ILE A CA  1 
ATOM   157  C  C   . ILE A 1 22  ? 5.14900   -10.69300 -36.89600 1.000 67.60021  ? 931  ILE A C   1 
ATOM   158  O  O   . ILE A 1 22  ? 4.73800   -10.79800 -35.73300 1.000 67.95288  ? 931  ILE A O   1 
ATOM   159  C  CB  . ILE A 1 22  ? 3.49300   -10.77300 -38.81000 1.000 60.98363  ? 931  ILE A CB  1 
ATOM   160  C  CG1 . ILE A 1 22  ? 2.40900   -9.95900  -39.52500 1.000 61.92848  ? 931  ILE A CG1 1 
ATOM   161  C  CG2 . ILE A 1 22  ? 2.91600   -11.96600 -38.04900 1.000 55.27768  ? 931  ILE A CG2 1 
ATOM   162  C  CD1 . ILE A 1 22  ? 1.53700   -10.77700 -40.44200 1.000 75.52221  ? 931  ILE A CD1 1 
ATOM   163  N  N   . GLY A 1 23  ? 6.25700   -11.26800 -37.36800 1.000 65.50785  ? 932  GLY A N   1 
ATOM   164  C  CA  . GLY A 1 23  ? 7.21000   -12.02800 -36.53700 1.000 54.17492  ? 932  GLY A CA  1 
ATOM   165  C  C   . GLY A 1 23  ? 7.56800   -11.25000 -35.28900 1.000 55.21451  ? 932  GLY A C   1 
ATOM   166  O  O   . GLY A 1 23  ? 7.35200   -11.79300 -34.19200 1.000 58.96496  ? 932  GLY A O   1 
ATOM   167  N  N   . LYS A 1 24  ? 8.04600   -10.00600 -35.45800 1.000 60.62569  ? 933  LYS A N   1 
ATOM   168  C  CA  . LYS A 1 24  ? 8.43100   -9.08400  -34.35300 1.000 58.06222  ? 933  LYS A CA  1 
ATOM   169  C  C   . LYS A 1 24  ? 7.22500   -8.85000  -33.43000 1.000 61.77583  ? 933  LYS A C   1 
ATOM   170  O  O   . LYS A 1 24  ? 7.43200   -8.82900  -32.21100 1.000 62.01533  ? 933  LYS A O   1 
ATOM   171  C  CB  . LYS A 1 24  ? 8.88600   -7.70500  -34.84200 1.000 55.48823  ? 933  LYS A CB  1 
ATOM   172  C  CG  . LYS A 1 24  ? 9.89200   -7.62000  -35.98400 1.000 62.14956  ? 933  LYS A CG  1 
ATOM   173  C  CD  . LYS A 1 24  ? 11.01700  -8.63400  -36.01200 1.000 77.44086  ? 933  LYS A CD  1 
ATOM   174  C  CE  . LYS A 1 24  ? 12.28700  -8.09900  -36.65800 1.000 82.40725  ? 933  LYS A CE  1 
ATOM   175  N  NZ  . LYS A 1 24  ? 12.08400  -6.85000  -37.44000 1.000 75.27745  ? 933  LYS A NZ  1 
ATOM   176  N  N   . ILE A 1 25  ? 6.02500   -8.64400  -33.98700 1.000 48.28210  ? 934  ILE A N   1 
ATOM   177  C  CA  . ILE A 1 25  ? 4.77400   -8.37200  -33.20800 1.000 54.50917  ? 934  ILE A CA  1 
ATOM   178  C  C   . ILE A 1 25  ? 4.44100   -9.60800  -32.35300 1.000 60.19932  ? 934  ILE A C   1 
ATOM   179  O  O   . ILE A 1 25  ? 4.10500   -9.42700  -31.15000 1.000 63.67606  ? 934  ILE A O   1 
ATOM   180  C  CB  . ILE A 1 25  ? 3.60900   -7.96300  -34.14200 1.000 44.92381  ? 934  ILE A CB  1 
ATOM   181  C  CG1 . ILE A 1 25  ? 3.85000   -6.58400  -34.75800 1.000 45.16068  ? 934  ILE A CG1 1 
ATOM   182  C  CG2 . ILE A 1 25  ? 2.26100   -8.02200  -33.43300 1.000 43.00516  ? 934  ILE A CG2 1 
ATOM   183  C  CD1 . ILE A 1 25  ? 3.14300   -6.37800  -36.06800 1.000 45.90287  ? 934  ILE A CD1 1 
ATOM   184  N  N   . GLN A 1 26  ? 4.53400   -10.80800 -32.95300 1.000 59.62820  ? 935  GLN A N   1 
ATOM   185  C  CA  . GLN A 1 26  ? 4.29400   -12.12300 -32.29600 1.000 53.56432  ? 935  GLN A CA  1 
ATOM   186  C  C   . GLN A 1 26  ? 5.19500   -12.24800 -31.06600 1.000 61.38104  ? 935  GLN A C   1 
ATOM   187  O  O   . GLN A 1 26  ? 4.71400   -12.76500 -30.03800 1.000 66.20267  ? 935  GLN A O   1 
ATOM   188  C  CB  . GLN A 1 26  ? 4.58900   -13.28700 -33.24700 1.000 57.19370  ? 935  GLN A CB  1 
ATOM   189  C  CG  . GLN A 1 26  ? 3.53500   -13.52000 -34.32200 1.000 54.91448  ? 935  GLN A CG  1 
ATOM   190  C  CD  . GLN A 1 26  ? 3.90200   -14.61800 -35.29600 1.000 65.83684  ? 935  GLN A CD  1 
ATOM   191  O  OE1 . GLN A 1 26  ? 5.02300   -14.68000 -35.79700 1.000 69.52939  ? 935  GLN A OE1 1 
ATOM   192  N  NE2 . GLN A 1 26  ? 2.94400   -15.48400 -35.59800 1.000 69.74257  ? 935  GLN A NE2 1 
ATOM   193  N  N   . ASP A 1 27  ? 6.45800   -11.82000 -31.19200 1.000 59.62031  ? 936  ASP A N   1 
ATOM   194  C  CA  . ASP A 1 27  ? 7.45000   -11.78300 -30.08000 1.000 62.51802  ? 936  ASP A CA  1 
ATOM   195  C  C   . ASP A 1 27  ? 6.92400   -10.78600 -29.04000 1.000 56.01987  ? 936  ASP A C   1 
ATOM   196  O  O   . ASP A 1 27  ? 6.84900   -11.15400 -27.85400 1.000 63.64447  ? 936  ASP A O   1 
ATOM   197  C  CB  . ASP A 1 27  ? 8.88200   -11.49300 -30.57700 1.000 65.12360  ? 936  ASP A CB  1 
ATOM   198  C  CG  . ASP A 1 27  ? 9.63000   -12.68900 -31.17600 1.000 71.41119  ? 936  ASP A CG  1 
ATOM   199  O  OD1 . ASP A 1 27  ? 9.70000   -13.75000 -30.51300 1.000 73.67725  ? 936  ASP A OD1 1 
ATOM   200  O  OD2 . ASP A 1 27  ? 10.15700  -12.55300 -32.30200 1.000 71.95863  ? 936  ASP A OD2 1 
ATOM   201  N  N   . SER A 1 28  ? 6.51300   -9.59400  -29.47800 1.000 54.90922  ? 937  SER A N   1 
ATOM   202  C  CA  . SER A 1 28  ? 6.07000   -8.49200  -28.58700 1.000 49.94809  ? 937  SER A CA  1 
ATOM   203  C  C   . SER A 1 28  ? 4.83700   -8.94300  -27.80900 1.000 53.80119  ? 937  SER A C   1 
ATOM   204  O  O   . SER A 1 28  ? 4.78000   -8.66700  -26.59500 1.000 54.69603  ? 937  SER A O   1 
ATOM   205  C  CB  . SER A 1 28  ? 5.77500   -7.25800  -29.35300 1.000 48.08998  ? 937  SER A CB  1 
ATOM   206  O  OG  . SER A 1 28  ? 4.50600   -7.37100  -29.96200 1.000 48.85323  ? 937  SER A OG  1 
ATOM   207  N  N   . LEU A 1 29  ? 3.89600   -9.61200  -28.48700 1.000 56.75417  ? 938  LEU A N   1 
ATOM   208  C  CA  . LEU A 1 29  ? 2.64600   -10.12900 -27.86800 1.000 45.73969  ? 938  LEU A CA  1 
ATOM   209  C  C   . LEU A 1 29  ? 2.97800   -11.14900 -26.78000 1.000 47.09249  ? 938  LEU A C   1 
ATOM   210  O  O   . LEU A 1 29  ? 2.39100   -11.06500 -25.69300 1.000 71.25854  ? 938  LEU A O   1 
ATOM   211  C  CB  . LEU A 1 29  ? 1.74300   -10.76200 -28.92800 1.000 54.95133  ? 938  LEU A CB  1 
ATOM   212  C  CG  . LEU A 1 29  ? 0.99100   -9.78400  -29.82900 1.000 47.76099  ? 938  LEU A CG  1 
ATOM   213  C  CD1 . LEU A 1 29  ? 0.13500   -10.52700 -30.84200 1.000 41.37601  ? 938  LEU A CD1 1 
ATOM   214  C  CD2 . LEU A 1 29  ? 0.12600   -8.83200  -29.01700 1.000 41.19704  ? 938  LEU A CD2 1 
ATOM   215  N  N   . SER A 1 30  ? 3.88600   -12.07500 -27.06200 1.000 54.44863  ? 939  SER A N   1 
ATOM   216  C  CA  . SER A 1 30  ? 4.33600   -13.09800 -26.08500 1.000 57.89642  ? 939  SER A CA  1 
ATOM   217  C  C   . SER A 1 30  ? 5.00100   -12.42300 -24.87700 1.000 76.64340  ? 939  SER A C   1 
ATOM   218  O  O   . SER A 1 30  ? 4.63100   -12.78600 -23.75000 1.000 75.57222  ? 939  SER A O   1 
ATOM   219  C  CB  . SER A 1 30  ? 5.23800   -14.12300 -26.71400 1.000 66.18688  ? 939  SER A CB  1 
ATOM   220  O  OG  . SER A 1 30  ? 5.32100   -15.27900 -25.88600 1.000 78.19095  ? 939  SER A OG  1 
ATOM   221  N  N   . SER A 1 31  ? 5.91800   -11.47300 -25.08600 1.000 48.79269  ? 940  SER A N   1 
ATOM   222  C  CA  . SER A 1 31  ? 6.58800   -10.72600 -23.98400 1.000 55.78564  ? 940  SER A CA  1 
ATOM   223  C  C   . SER A 1 31  ? 5.54600   -10.00400 -23.11600 1.000 46.95563  ? 940  SER A C   1 
ATOM   224  O  O   . SER A 1 31  ? 5.69100   -10.05000 -21.88500 1.000 49.52962  ? 940  SER A O   1 
ATOM   225  C  CB  . SER A 1 31  ? 7.62200   -9.75300  -24.48900 1.000 46.56348  ? 940  SER A CB  1 
ATOM   226  O  OG  . SER A 1 31  ? 8.69100   -10.42300 -25.12900 1.000 51.77989  ? 940  SER A OG  1 
ATOM   227  N  N   . THR A 1 32  ? 4.55800   -9.34400  -23.73600 1.000 48.25842  ? 941  THR A N   1 
ATOM   228  C  CA  . THR A 1 32  ? 3.44400   -8.64500  -23.04200 1.000 55.10661  ? 941  THR A CA  1 
ATOM   229  C  C   . THR A 1 32  ? 2.75100   -9.65100  -22.12000 1.000 53.96173  ? 941  THR A C   1 
ATOM   230  O  O   . THR A 1 32  ? 2.69200   -9.39700  -20.90300 1.000 52.11151  ? 941  THR A O   1 
ATOM   231  C  CB  . THR A 1 32  ? 2.45400   -8.01400  -24.03600 1.000 52.68000  ? 941  THR A CB  1 
ATOM   232  O  OG1 . THR A 1 32  ? 3.17800   -7.19400  -24.95200 1.000 46.98721  ? 941  THR A OG1 1 
ATOM   233  C  CG2 . THR A 1 32  ? 1.38400   -7.18300  -23.36000 1.000 39.65475  ? 941  THR A CG2 1 
ATOM   234  N  N   . ALA A 1 33  ? 2.27500   -10.76300 -22.68400 1.000 53.36692  ? 942  ALA A N   1 
ATOM   235  C  CA  . ALA A 1 33  ? 1.55000   -11.84100 -21.96500 1.000 54.92764  ? 942  ALA A CA  1 
ATOM   236  C  C   . ALA A 1 33  ? 2.36800   -12.34800 -20.77000 1.000 53.75381  ? 942  ALA A C   1 
ATOM   237  O  O   . ALA A 1 33  ? 1.77000   -12.59700 -19.70800 1.000 52.89845  ? 942  ALA A O   1 
ATOM   238  C  CB  . ALA A 1 33  ? 1.23800   -12.95900 -22.91600 1.000 53.26165  ? 942  ALA A CB  1 
ATOM   239  N  N   . SER A 1 34  ? 3.68200   -12.50500 -20.94900 1.000 57.90168  ? 943  SER A N   1 
ATOM   240  C  CA  . SER A 1 34  ? 4.64400   -12.90600 -19.89200 1.000 63.00229  ? 943  SER A CA  1 
ATOM   241  C  C   . SER A 1 34  ? 4.59400   -11.87000 -18.76300 1.000 57.08842  ? 943  SER A C   1 
ATOM   242  O  O   . SER A 1 34  ? 4.41600   -12.25800 -17.60200 1.000 59.47029  ? 943  SER A O   1 
ATOM   243  C  CB  . SER A 1 34  ? 6.04100   -13.06400 -20.47000 1.000 59.13867  ? 943  SER A CB  1 
ATOM   244  O  OG  . SER A 1 34  ? 6.97800   -13.52000 -19.50000 1.000 65.22887  ? 943  SER A OG  1 
ATOM   245  N  N   . ALA A 1 35  ? 4.73400   -10.59100 -19.10100 1.000 48.26368  ? 944  ALA A N   1 
ATOM   246  C  CA  . ALA A 1 35  ? 4.84500   -9.48300  -18.12200 1.000 53.39588  ? 944  ALA A CA  1 
ATOM   247  C  C   . ALA A 1 35  ? 3.53800   -9.40400  -17.32700 1.000 55.81722  ? 944  ALA A C   1 
ATOM   248  O  O   . ALA A 1 35  ? 3.58700   -9.20500  -16.09100 1.000 60.89941  ? 944  ALA A O   1 
ATOM   249  C  CB  . ALA A 1 35  ? 5.16300   -8.17000  -18.81600 1.000 46.46873  ? 944  ALA A CB  1 
ATOM   250  N  N   . LEU A 1 36  ? 2.40300   -9.55900  -18.01200 1.000 57.45689  ? 945  LEU A N   1 
ATOM   251  C  CA  . LEU A 1 36  ? 1.07700   -9.50000  -17.35400 1.000 57.04368  ? 945  LEU A CA  1 
ATOM   252  C  C   . LEU A 1 36  ? 0.93400   -10.69900 -16.40900 1.000 63.35760  ? 945  LEU A C   1 
ATOM   253  O  O   . LEU A 1 36  ? 0.44500   -10.49800 -15.28100 1.000 55.99619  ? 945  LEU A O   1 
ATOM   254  C  CB  . LEU A 1 36  ? -0.01000  -9.45700  -18.42800 1.000 51.29036  ? 945  LEU A CB  1 
ATOM   255  C  CG  . LEU A 1 36  ? -0.08300  -8.14400  -19.20000 1.000 45.21068  ? 945  LEU A CG  1 
ATOM   256  C  CD1 . LEU A 1 36  ? -0.98600  -8.29300  -20.40600 1.000 37.52292  ? 945  LEU A CD1 1 
ATOM   257  C  CD2 . LEU A 1 36  ? -0.56000  -6.99700  -18.32000 1.000 42.62090  ? 945  LEU A CD2 1 
ATOM   258  N  N   . GLY A 1 37  ? 1.39700   -11.88000 -16.83000 1.000 50.37446  ? 946  GLY A N   1 
ATOM   259  C  CA  . GLY A 1 37  ? 1.42000   -13.10500 -16.00700 1.000 55.49350  ? 946  GLY A CA  1 
ATOM   260  C  C   . GLY A 1 37  ? 2.21600   -12.93500 -14.72300 1.000 58.43069  ? 946  GLY A C   1 
ATOM   261  O  O   . GLY A 1 37  ? 1.70200   -13.30600 -13.65400 1.000 55.86986  ? 946  GLY A O   1 
ATOM   262  N  N   . LYS A 1 38  ? 3.42900   -12.39100 -14.81000 1.000 68.24502  ? 947  LYS A N   1 
ATOM   263  C  CA  . LYS A 1 38  ? 4.29600   -12.14700 -13.62600 1.000 60.51778  ? 947  LYS A CA  1 
ATOM   264  C  C   . LYS A 1 38  ? 3.65800   -11.07500 -12.73000 1.000 60.63095  ? 947  LYS A C   1 
ATOM   265  O  O   . LYS A 1 38  ? 3.72300   -11.27100 -11.50100 1.000 71.34540  ? 947  LYS A O   1 
ATOM   266  C  CB  . LYS A 1 38  ? 5.71400   -11.77600 -14.06100 1.000 59.65715  ? 947  LYS A CB  1 
ATOM   267  C  CG  . LYS A 1 38  ? 6.47600   -12.87000 -14.80000 1.000 61.35472  ? 947  LYS A CG  1 
ATOM   268  C  CD  . LYS A 1 38  ? 7.97700   -12.60600 -14.84300 1.000 66.07371  ? 947  LYS A CD  1 
ATOM   269  C  CE  . LYS A 1 38  ? 8.73100   -13.46400 -15.83600 1.000 60.74676  ? 947  LYS A CE  1 
ATOM   270  N  NZ  . LYS A 1 38  ? 9.97600   -12.79800 -16.29000 1.000 63.82607  ? 947  LYS A NZ  1 
ATOM   271  N  N   . LEU A 1 39  ? 3.05600   -10.01500 -13.30400 1.000 59.47029  ? 948  LEU A N   1 
ATOM   272  C  CA  . LEU A 1 39  ? 2.35100   -8.93500  -12.55300 1.000 56.08041  ? 948  LEU A CA  1 
ATOM   273  C  C   . LEU A 1 39  ? 1.15000   -9.52300  -11.80500 1.000 56.94367  ? 948  LEU A C   1 
ATOM   274  O  O   . LEU A 1 39  ? 0.95600   -9.16900  -10.61400 1.000 50.75609  ? 948  LEU A O   1 
ATOM   275  C  CB  . LEU A 1 39  ? 1.88500   -7.82300  -13.50000 1.000 44.52639  ? 948  LEU A CB  1 
ATOM   276  C  CG  . LEU A 1 39  ? 2.95200   -6.82400  -13.93700 1.000 42.23664  ? 948  LEU A CG  1 
ATOM   277  C  CD1 . LEU A 1 39  ? 2.35600   -5.81300  -14.91300 1.000 37.39133  ? 948  LEU A CD1 1 
ATOM   278  C  CD2 . LEU A 1 39  ? 3.57600   -6.11600  -12.74000 1.000 40.93649  ? 948  LEU A CD2 1 
ATOM   279  N  N   . GLN A 1 40  ? 0.37000   -10.37600 -12.47300 1.000 60.90204  ? 949  GLN A N   1 
ATOM   280  C  CA  . GLN A 1 40  ? -0.81300  -11.04800 -11.86500 1.000 55.05134  ? 949  GLN A CA  1 
ATOM   281  C  C   . GLN A 1 40  ? -0.34400  -11.85400 -10.65000 1.000 56.59363  ? 949  GLN A C   1 
ATOM   282  O  O   . GLN A 1 40  ? -0.90700  -11.65200 -9.57700  1.000 55.62246  ? 949  GLN A O   1 
ATOM   283  C  CB  . GLN A 1 40  ? -1.54600  -11.93300 -12.88100 1.000 55.88038  ? 949  GLN A CB  1 
ATOM   284  C  CG  . GLN A 1 40  ? -2.72200  -12.71700 -12.29400 1.000 63.56025  ? 949  GLN A CG  1 
ATOM   285  C  CD  . GLN A 1 40  ? -3.66400  -13.27100 -13.34200 1.000 64.43931  ? 949  GLN A CD  1 
ATOM   286  O  OE1 . GLN A 1 40  ? -3.25700  -13.64000 -14.43800 1.000 64.23928  ? 949  GLN A OE1 1 
ATOM   287  N  NE2 . GLN A 1 40  ? -4.94500  -13.34400 -13.01700 1.000 62.49697  ? 949  GLN A NE2 1 
ATOM   288  N  N   . ASP A 1 41  ? 0.67500   -12.70200 -10.81200 1.000 64.16559  ? 950  ASP A N   1 
ATOM   289  C  CA  . ASP A 1 41  ? 1.19700   -13.58600 -9.73100  1.000 70.86639  ? 950  ASP A CA  1 
ATOM   290  C  C   . ASP A 1 41  ? 1.56100   -12.73400 -8.51300  1.000 69.36884  ? 950  ASP A C   1 
ATOM   291  O  O   . ASP A 1 41  ? 0.96900   -12.94800 -7.43900  1.000 79.16475  ? 950  ASP A O   1 
ATOM   292  C  CB  . ASP A 1 41  ? 2.43200   -14.38900 -10.15500 1.000 83.07575  ? 950  ASP A CB  1 
ATOM   293  C  CG  . ASP A 1 41  ? 2.17300   -15.51600 -11.14200 1.000 92.03209  ? 950  ASP A CG  1 
ATOM   294  O  OD1 . ASP A 1 41  ? 0.97700   -15.83100 -11.40200 1.000 89.71076  ? 950  ASP A OD1 1 
ATOM   295  O  OD2 . ASP A 1 41  ? 3.18100   -16.07900 -11.63800 1.000 100.76998 ? 950  ASP A OD2 1 
ATOM   296  N  N   . VAL A 1 42  ? 2.47600   -11.78600 -8.69900  1.000 60.96257  ? 951  VAL A N   1 
ATOM   297  C  CA  . VAL A 1 42  ? 3.02400   -10.93000 -7.60900  1.000 62.59172  ? 951  VAL A CA  1 
ATOM   298  C  C   . VAL A 1 42  ? 1.91500   -10.06400 -6.98800  1.000 60.69938  ? 951  VAL A C   1 
ATOM   299  O  O   . VAL A 1 42  ? 1.91700   -9.93600  -5.74600  1.000 59.95719  ? 951  VAL A O   1 
ATOM   300  C  CB  . VAL A 1 42  ? 4.19300   -10.07400 -8.12300  1.000 61.97848  ? 951  VAL A CB  1 
ATOM   301  C  CG1 . VAL A 1 42  ? 4.60900   -9.01800  -7.10800  1.000 51.88780  ? 951  VAL A CG1 1 
ATOM   302  C  CG2 . VAL A 1 42  ? 5.36100   -10.96700 -8.51300  1.000 62.65751  ? 951  VAL A CG2 1 
ATOM   303  N  N   . VAL A 1 43  ? 1.01000   -9.47600  -7.77900  1.000 67.39229  ? 952  VAL A N   1 
ATOM   304  C  CA  . VAL A 1 43  ? -0.09100  -8.63600  -7.20800  1.000 64.73934  ? 952  VAL A CA  1 
ATOM   305  C  C   . VAL A 1 43  ? -0.93100  -9.49200  -6.25700  1.000 67.93709  ? 952  VAL A C   1 
ATOM   306  O  O   . VAL A 1 43  ? -1.30600  -8.97200  -5.18700  1.000 69.76363  ? 952  VAL A O   1 
ATOM   307  C  CB  . VAL A 1 43  ? -0.98800  -7.97000  -8.26700  1.000 59.74401  ? 952  VAL A CB  1 
ATOM   308  C  CG1 . VAL A 1 43  ? -2.27500  -7.45700  -7.64200  1.000 60.50725  ? 952  VAL A CG1 1 
ATOM   309  C  CG2 . VAL A 1 43  ? -0.27100  -6.83500  -8.98300  1.000 53.23533  ? 952  VAL A CG2 1 
ATOM   310  N  N   . ASN A 1 44  ? -1.19600  -10.74700 -6.63700  1.000 66.81854  ? 953  ASN A N   1 
ATOM   311  C  CA  . ASN A 1 44  ? -2.07800  -11.69500 -5.90100  1.000 66.13425  ? 953  ASN A CA  1 
ATOM   312  C  C   . ASN A 1 44  ? -1.36000  -12.19000 -4.63000  1.000 69.56360  ? 953  ASN A C   1 
ATOM   313  O  O   . ASN A 1 44  ? -2.00200  -12.21300 -3.56500  1.000 72.79820  ? 953  ASN A O   1 
ATOM   314  C  CB  . ASN A 1 44  ? -2.57500  -12.81700 -6.82700  1.000 58.60703  ? 953  ASN A CB  1 
ATOM   315  C  CG  . ASN A 1 44  ? -3.63200  -12.37000 -7.82600  1.000 59.13077  ? 953  ASN A CG  1 
ATOM   316  O  OD1 . ASN A 1 44  ? -4.40200  -11.44500 -7.57700  1.000 56.30938  ? 953  ASN A OD1 1 
ATOM   317  N  ND2 . ASN A 1 44  ? -3.68800  -13.02500 -8.97500  1.000 59.77032  ? 953  ASN A ND2 1 
ATOM   318  N  N   . GLN A 1 45  ? -0.07700  -12.55200 -4.71500  1.000 68.57928  ? 954  GLN A N   1 
ATOM   319  C  CA  . GLN A 1 45  ? 0.76800   -12.89700 -3.53400  1.000 72.28498  ? 954  GLN A CA  1 
ATOM   320  C  C   . GLN A 1 45  ? 0.74800   -11.75500 -2.51200  1.000 71.30329  ? 954  GLN A C   1 
ATOM   321  O  O   . GLN A 1 45  ? 0.63300   -12.04200 -1.31100  1.000 81.07025  ? 954  GLN A O   1 
ATOM   322  C  CB  . GLN A 1 45  ? 2.24400   -13.09400 -3.89800  1.000 80.35437  ? 954  GLN A CB  1 
ATOM   323  C  CG  . GLN A 1 45  ? 2.57200   -14.38200 -4.64500  1.000 83.25209  ? 954  GLN A CG  1 
ATOM   324  C  CD  . GLN A 1 45  ? 4.06800   -14.59400 -4.71800  1.000 90.02658  ? 954  GLN A CD  1 
ATOM   325  O  OE1 . GLN A 1 45  ? 4.79800   -14.29600 -3.77200  1.000 99.73827  ? 954  GLN A OE1 1 
ATOM   326  N  NE2 . GLN A 1 45  ? 4.54900   -15.09800 -5.84600  1.000 84.62857  ? 954  GLN A NE2 1 
ATOM   327  N  N   . ASN A 1 46  ? 0.92700   -10.51600 -2.97700  1.000 68.28450  ? 955  ASN A N   1 
ATOM   328  C  CA  . ASN A 1 46  ? 1.02200   -9.30900  -2.11500  1.000 65.67103  ? 955  ASN A CA  1 
ATOM   329  C  C   . ASN A 1 46  ? -0.35400  -9.02200  -1.52000  1.000 57.70429  ? 955  ASN A C   1 
ATOM   330  O  O   . ASN A 1 46  ? -0.40100  -8.51600  -0.37700  1.000 57.73324  ? 955  ASN A O   1 
ATOM   331  C  CB  . ASN A 1 46  ? 1.59100   -8.10300  -2.86600  1.000 66.77643  ? 955  ASN A CB  1 
ATOM   332  C  CG  . ASN A 1 46  ? 3.08400   -8.21500  -3.10700  1.000 73.87728  ? 955  ASN A CG  1 
ATOM   333  O  OD1 . ASN A 1 46  ? 3.71100   -9.22700  -2.77100  1.000 75.29061  ? 955  ASN A OD1 1 
ATOM   334  N  ND2 . ASN A 1 46  ? 3.66500   -7.17300  -3.68300  1.000 71.06115  ? 955  ASN A ND2 1 
ATOM   335  N  N   . ALA A 1 47  ? -1.42300  -9.34600  -2.25200  1.000 63.77870  ? 956  ALA A N   1 
ATOM   336  C  CA  . ALA A 1 47  ? -2.80900  -9.18200  -1.76500  1.000 54.85658  ? 956  ALA A CA  1 
ATOM   337  C  C   . ALA A 1 47  ? -3.02100  -10.16100 -0.61400  1.000 64.84462  ? 956  ALA A C   1 
ATOM   338  O  O   . ALA A 1 47  ? -3.53800  -9.74600  0.44300   1.000 65.87632  ? 956  ALA A O   1 
ATOM   339  C  CB  . ALA A 1 47  ? -3.80900  -9.39200  -2.87000  1.000 51.95097  ? 956  ALA A CB  1 
ATOM   340  N  N   . GLN A 1 48  ? -2.60000  -11.40900 -0.80000  1.000 69.32937  ? 957  GLN A N   1 
ATOM   341  C  CA  . GLN A 1 48  ? -2.77600  -12.46000 0.23400   1.000 79.41478  ? 957  GLN A CA  1 
ATOM   342  C  C   . GLN A 1 48  ? -1.94200  -12.07900 1.47000   1.000 79.67534  ? 957  GLN A C   1 
ATOM   343  O  O   . GLN A 1 48  ? -2.51500  -12.06500 2.58200   1.000 79.01474  ? 957  GLN A O   1 
ATOM   344  C  CB  . GLN A 1 48  ? -2.43200  -13.84200 -0.32600  1.000 82.67570  ? 957  GLN A CB  1 
ATOM   345  C  CG  . GLN A 1 48  ? -2.98300  -14.97800 0.53100   1.000 89.47915  ? 957  GLN A CG  1 
ATOM   346  C  CD  . GLN A 1 48  ? -2.04100  -16.15400 0.63500   1.000 92.03735  ? 957  GLN A CD  1 
ATOM   347  O  OE1 . GLN A 1 48  ? -1.80900  -16.69200 1.71700   1.000 81.08341  ? 957  GLN A OE1 1 
ATOM   348  N  NE2 . GLN A 1 48  ? -1.48300  -16.56400 -0.49400  1.000 94.72452  ? 957  GLN A NE2 1 
ATOM   349  N  N   . ALA A 1 49  ? -0.65800  -11.74300 1.28400   1.000 71.88493  ? 958  ALA A N   1 
ATOM   350  C  CA  . ALA A 1 49  ? 0.27500   -11.35900 2.37100   1.000 67.10541  ? 958  ALA A CA  1 
ATOM   351  C  C   . ALA A 1 49  ? -0.39400  -10.31000 3.26600   1.000 66.39743  ? 958  ALA A C   1 
ATOM   352  O  O   . ALA A 1 49  ? -0.34400  -10.47600 4.49100   1.000 62.92070  ? 958  ALA A O   1 
ATOM   353  C  CB  . ALA A 1 49  ? 1.57500   -10.84900 1.79800   1.000 71.52173  ? 958  ALA A CB  1 
ATOM   354  N  N   . LEU A 1 50  ? -1.01200  -9.28500  2.66600   1.000 82.84151  ? 959  LEU A N   1 
ATOM   355  C  CA  . LEU A 1 50  ? -1.75100  -8.21100  3.38500   1.000 67.61863  ? 959  LEU A CA  1 
ATOM   356  C  C   . LEU A 1 50  ? -2.94000  -8.82200  4.13800   1.000 60.44935  ? 959  LEU A C   1 
ATOM   357  O  O   . LEU A 1 50  ? -3.10600  -8.47700  5.32400   1.000 62.13903  ? 959  LEU A O   1 
ATOM   358  C  CB  . LEU A 1 50  ? -2.20300  -7.12600  2.40000   1.000 55.12766  ? 959  LEU A CB  1 
ATOM   359  C  CG  . LEU A 1 50  ? -2.95800  -5.94700  3.01900   1.000 53.86172  ? 959  LEU A CG  1 
ATOM   360  C  CD1 . LEU A 1 50  ? -2.29200  -5.46700  4.29600   1.000 60.68886  ? 959  LEU A CD1 1 
ATOM   361  C  CD2 . LEU A 1 50  ? -3.07800  -4.79100  2.04200   1.000 50.38762  ? 959  LEU A CD2 1 
ATOM   362  N  N   . ASN A 1 51  ? -3.71000  -9.71500  3.50200   1.000 61.71266  ? 960  ASN A N   1 
ATOM   363  C  CA  . ASN A 1 51  ? -4.93900  -10.33200 4.09000   1.000 59.74664  ? 960  ASN A CA  1 
ATOM   364  C  C   . ASN A 1 51  ? -4.57400  -11.26900 5.25000   1.000 71.79545  ? 960  ASN A C   1 
ATOM   365  O  O   . ASN A 1 51  ? -5.31400  -11.26700 6.25600   1.000 68.13448  ? 960  ASN A O   1 
ATOM   366  C  CB  . ASN A 1 51  ? -5.77500  -11.06700 3.04700   1.000 58.95707  ? 960  ASN A CB  1 
ATOM   367  C  CG  . ASN A 1 51  ? -6.38400  -10.11200 2.05100   1.000 66.67905  ? 960  ASN A CG  1 
ATOM   368  O  OD1 . ASN A 1 51  ? -7.02400  -9.13900  2.43800   1.000 60.29144  ? 960  ASN A OD1 1 
ATOM   369  N  ND2 . ASN A 1 51  ? -6.17400  -10.37100 0.76900   1.000 70.92956  ? 960  ASN A ND2 1 
ATOM   370  N  N   . THR A 1 52  ? -3.47800  -12.02600 5.12700   1.000 59.11761  ? 961  THR A N   1 
ATOM   371  C  CA  . THR A 1 52  ? -2.89600  -12.86600 6.21100   1.000 61.61791  ? 961  THR A CA  1 
ATOM   372  C  C   . THR A 1 52  ? -2.40000  -11.97800 7.36300   1.000 70.77164  ? 961  THR A C   1 
ATOM   373  O  O   . THR A 1 52  ? -2.58300  -12.35100 8.54400   1.000 77.85670  ? 961  THR A O   1 
ATOM   374  C  CB  . THR A 1 52  ? -1.72600  -13.70600 5.68800   1.000 63.07335  ? 961  THR A CB  1 
ATOM   375  O  OG1 . THR A 1 52  ? -2.23500  -14.57000 4.67500   1.000 69.34779  ? 961  THR A OG1 1 
ATOM   376  C  CG2 . THR A 1 52  ? -1.03700  -14.51100 6.76800   1.000 65.58944  ? 961  THR A CG2 1 
ATOM   377  N  N   . LEU A 1 53  ? -1.74200  -10.86800 7.03700   1.000 62.53381  ? 962  LEU A N   1 
ATOM   378  C  CA  . LEU A 1 53  ? -1.30400  -9.89300  8.05700   1.000 66.71589  ? 962  LEU A CA  1 
ATOM   379  C  C   . LEU A 1 53  ? -2.55800  -9.40800  8.79300   1.000 68.04763  ? 962  LEU A C   1 
ATOM   380  O  O   . LEU A 1 53  ? -2.62100  -9.61700  10.01500  1.000 70.82428  ? 962  LEU A O   1 
ATOM   381  C  CB  . LEU A 1 53  ? -0.51700  -8.76000  7.39300   1.000 57.48584  ? 962  LEU A CB  1 
ATOM   382  C  CG  . LEU A 1 53  ? -0.08600  -7.62800  8.32100   1.000 63.82607  ? 962  LEU A CG  1 
ATOM   383  C  CD1 . LEU A 1 53  ? 0.76000   -8.14800  9.47000   1.000 73.46670  ? 962  LEU A CD1 1 
ATOM   384  C  CD2 . LEU A 1 53  ? 0.67200   -6.56300  7.55100   1.000 64.19191  ? 962  LEU A CD2 1 
ATOM   385  N  N   . VAL A 1 54  ? -3.54800  -8.86500  8.07800   1.000 70.60320  ? 963  VAL A N   1 
ATOM   386  C  CA  . VAL A 1 54  ? -4.76300  -8.25700  8.70700   1.000 71.84809  ? 963  VAL A CA  1 
ATOM   387  C  C   . VAL A 1 54  ? -5.41600  -9.26800  9.66600   1.000 75.02478  ? 963  VAL A C   1 
ATOM   388  O  O   . VAL A 1 54  ? -5.87600  -8.84200  10.73800  1.000 77.31716  ? 963  VAL A O   1 
ATOM   389  C  CB  . VAL A 1 54  ? -5.76900  -7.73700  7.66000   1.000 67.58442  ? 963  VAL A CB  1 
ATOM   390  C  CG1 . VAL A 1 54  ? -7.17400  -7.59200  8.22100   1.000 59.51503  ? 963  VAL A CG1 1 
ATOM   391  C  CG2 . VAL A 1 54  ? -5.31600  -6.42100  7.05400   1.000 77.18294  ? 963  VAL A CG2 1 
ATOM   392  N  N   . LYS A 1 55  ? -5.48800  -10.55200 9.30800   1.000 76.09333  ? 964  LYS A N   1 
ATOM   393  C  CA  . LYS A 1 55  ? -6.19700  -11.56300 10.14100  1.000 79.11212  ? 964  LYS A CA  1 
ATOM   394  C  C   . LYS A 1 55  ? -5.37900  -11.80800 11.41200  1.000 81.27290  ? 964  LYS A C   1 
ATOM   395  O  O   . LYS A 1 55  ? -5.96800  -11.82200 12.51000  1.000 86.30508  ? 964  LYS A O   1 
ATOM   396  C  CB  . LYS A 1 55  ? -6.48400  -12.84200 9.34700   1.000 88.43692  ? 964  LYS A CB  1 
ATOM   397  C  CG  . LYS A 1 55  ? -7.67000  -12.71700 8.39400   1.000 95.97203  ? 964  LYS A CG  1 
ATOM   398  C  CD  . LYS A 1 55  ? -7.91400  -13.91400 7.48900   1.000 98.67236  ? 964  LYS A CD  1 
ATOM   399  C  CE  . LYS A 1 55  ? -8.66200  -13.54600 6.22100   1.000 90.01342  ? 964  LYS A CE  1 
ATOM   400  N  NZ  . LYS A 1 55  ? -8.16400  -14.28900 5.03600   1.000 80.44649  ? 964  LYS A NZ  1 
ATOM   401  N  N   . GLN A 1 56  ? -4.06400  -11.94900 11.28000  1.000 72.02706  ? 965  GLN A N   1 
ATOM   402  C  CA  . GLN A 1 56  ? -3.19100  -12.24100 12.44000  1.000 73.25878  ? 965  GLN A CA  1 
ATOM   403  C  C   . GLN A 1 56  ? -3.00900  -10.98300 13.30300  1.000 79.29898  ? 965  GLN A C   1 
ATOM   404  O  O   . GLN A 1 56  ? -2.59500  -11.13800 14.46400  1.000 81.21237  ? 965  GLN A O   1 
ATOM   405  C  CB  . GLN A 1 56  ? -1.84600  -12.79600 11.99000  1.000 74.85634  ? 965  GLN A CB  1 
ATOM   406  C  CG  . GLN A 1 56  ? -1.16900  -13.56300 13.11300  1.000 91.41096  ? 965  GLN A CG  1 
ATOM   407  C  CD  . GLN A 1 56  ? 0.06200   -14.32800 12.69100  1.000 96.52736  ? 965  GLN A CD  1 
ATOM   408  O  OE1 . GLN A 1 56  ? 0.53000   -14.24300 11.55100  1.000 94.98244  ? 965  GLN A OE1 1 
ATOM   409  N  NE2 . GLN A 1 56  ? 0.60700   -15.07900 13.63700  1.000 95.29827  ? 965  GLN A NE2 1 
ATOM   410  N  N   . LEU A 1 57  ? -3.29200  -9.78800  12.76100  1.000 84.45223  ? 966  LEU A N   1 
ATOM   411  C  CA  . LEU A 1 57  ? -3.27700  -8.50100  13.51000  1.000 61.27577  ? 966  LEU A CA  1 
ATOM   412  C  C   . LEU A 1 57  ? -4.54600  -8.39000  14.35600  1.000 61.72582  ? 966  LEU A C   1 
ATOM   413  O  O   . LEU A 1 57  ? -4.42200  -8.03400  15.53000  1.000 69.12934  ? 966  LEU A O   1 
ATOM   414  C  CB  . LEU A 1 57  ? -3.17200  -7.32100  12.54400  1.000 57.17001  ? 966  LEU A CB  1 
ATOM   415  C  CG  . LEU A 1 57  ? -1.78900  -7.07300  11.94300  1.000 60.82045  ? 966  LEU A CG  1 
ATOM   416  C  CD1 . LEU A 1 57  ? -1.84900  -5.92600  10.95400  1.000 58.39648  ? 966  LEU A CD1 1 
ATOM   417  C  CD2 . LEU A 1 57  ? -0.76000  -6.77800  13.01900  1.000 60.04141  ? 966  LEU A CD2 1 
ATOM   418  N  N   . SER A 1 58  ? -5.71400  -8.70400  13.79200  1.000 66.44218  ? 967  SER A N   1 
ATOM   419  C  CA  . SER A 1 58  ? -7.00800  -8.79600  14.52700  1.000 70.54267  ? 967  SER A CA  1 
ATOM   420  C  C   . SER A 1 58  ? -6.88900  -9.82100  15.66400  1.000 77.26716  ? 967  SER A C   1 
ATOM   421  O  O   . SER A 1 58  ? -7.43100  -9.56600  16.75700  1.000 80.82285  ? 967  SER A O   1 
ATOM   422  C  CB  . SER A 1 58  ? -8.16900  -9.14400  13.62400  1.000 67.60547  ? 967  SER A CB  1 
ATOM   423  O  OG  . SER A 1 58  ? -8.39900  -8.14500  12.64300  1.000 70.85323  ? 967  SER A OG  1 
ATOM   424  N  N   . SER A 1 59  ? -6.21800  -10.94500 15.41300  1.000 67.76865  ? 968  SER A N   1 
ATOM   425  C  CA  . SER A 1 59  ? -5.97000  -11.99600 16.43000  1.000 75.23270  ? 968  SER A CA  1 
ATOM   426  C  C   . SER A 1 59  ? -5.13800  -11.40900 17.57700  1.000 71.12169  ? 968  SER A C   1 
ATOM   427  O  O   . SER A 1 59  ? -5.55500  -11.53900 18.74400  1.000 72.75083  ? 968  SER A O   1 
ATOM   428  C  CB  . SER A 1 59  ? -5.30100  -13.19600 15.80700  1.000 82.86520  ? 968  SER A CB  1 
ATOM   429  O  OG  . SER A 1 59  ? -4.87800  -14.12400 16.80000  1.000 84.98124  ? 968  SER A OG  1 
ATOM   430  N  N   . ASN A 1 60  ? -4.01300  -10.76900 17.24800  1.000 65.87106  ? 969  ASN A N   1 
ATOM   431  C  CA  . ASN A 1 60  ? -3.09100  -10.15000 18.23600  1.000 65.60260  ? 969  ASN A CA  1 
ATOM   432  C  C   . ASN A 1 60  ? -3.84000  -9.07600  19.05400  1.000 65.61050  ? 969  ASN A C   1 
ATOM   433  O  O   . ASN A 1 60  ? -3.80500  -9.17300  20.29200  1.000 67.70549  ? 969  ASN A O   1 
ATOM   434  C  CB  . ASN A 1 60  ? -1.81700  -9.63100  17.55800  1.000 62.87070  ? 969  ASN A CB  1 
ATOM   435  C  CG  . ASN A 1 60  ? -0.85000  -10.73600 17.17800  1.000 63.71027  ? 969  ASN A CG  1 
ATOM   436  O  OD1 . ASN A 1 60  ? -1.13400  -11.91600 17.36700  1.000 66.27637  ? 969  ASN A OD1 1 
ATOM   437  N  ND2 . ASN A 1 60  ? 0.30600   -10.37100 16.64700  1.000 61.83110  ? 969  ASN A ND2 1 
ATOM   438  N  N   . PHE A 1 61  ? -4.51100  -8.10300  18.42400  1.000 63.17863  ? 970  PHE A N   1 
ATOM   439  C  CA  . PHE A 1 61  ? -5.19600  -7.00300  19.14600  1.000 63.21811  ? 970  PHE A CA  1 
ATOM   440  C  C   . PHE A 1 61  ? -6.24900  -7.58300  20.07900  1.000 66.65536  ? 970  PHE A C   1 
ATOM   441  O  O   . PHE A 1 61  ? -6.39400  -7.06900  21.18900  1.000 67.86866  ? 970  PHE A O   1 
ATOM   442  C  CB  . PHE A 1 61  ? -5.85700  -6.00300  18.19900  1.000 60.87572  ? 970  PHE A CB  1 
ATOM   443  C  CG  . PHE A 1 61  ? -4.89500  -5.12500  17.44200  1.000 57.66218  ? 970  PHE A CG  1 
ATOM   444  C  CD1 . PHE A 1 61  ? -3.85100  -4.49200  18.09400  1.000 56.97262  ? 970  PHE A CD1 1 
ATOM   445  C  CD2 . PHE A 1 61  ? -5.05000  -4.92400  16.08100  1.000 55.51455  ? 970  PHE A CD2 1 
ATOM   446  C  CE1 . PHE A 1 61  ? -2.96900  -3.68700  17.39200  1.000 55.89091  ? 970  PHE A CE1 1 
ATOM   447  C  CE2 . PHE A 1 61  ? -4.16600  -4.12300  15.38100  1.000 52.84844  ? 970  PHE A CE2 1 
ATOM   448  C  CZ  . PHE A 1 61  ? -3.12900  -3.50500  16.03800  1.000 52.33259  ? 970  PHE A CZ  1 
ATOM   449  N  N   . GLY A 1 62  ? -6.98000  -8.59800  19.62500  1.000 68.74772  ? 971  GLY A N   1 
ATOM   450  C  CA  . GLY A 1 62  ? -7.93900  -9.32700  20.47300  1.000 73.80885  ? 971  GLY A CA  1 
ATOM   451  C  C   . GLY A 1 62  ? -7.26300  -9.77300  21.75600  1.000 74.76423  ? 971  GLY A C   1 
ATOM   452  O  O   . GLY A 1 62  ? -7.74000  -9.39900  22.83700  1.000 76.63550  ? 971  GLY A O   1 
ATOM   453  N  N   . ALA A 1 63  ? -6.15600  -10.50300 21.61900  1.000 74.12994  ? 972  ALA A N   1 
ATOM   454  C  CA  . ALA A 1 63  ? -5.34900  -11.08500 22.71900  1.000 76.26441  ? 972  ALA A CA  1 
ATOM   455  C  C   . ALA A 1 63  ? -4.82600  -9.98400  23.65700  1.000 76.45127  ? 972  ALA A C   1 
ATOM   456  O  O   . ALA A 1 63  ? -4.75100  -10.23500 24.87100  1.000 78.94894  ? 972  ALA A O   1 
ATOM   457  C  CB  . ALA A 1 63  ? -4.21400  -11.90400 22.14000  1.000 75.68013  ? 972  ALA A CB  1 
ATOM   458  N  N   . ILE A 1 64  ? -4.47400  -8.81900  23.11500  1.000 71.99284  ? 973  ILE A N   1 
ATOM   459  C  CA  . ILE A 1 64  ? -3.96200  -7.65900  23.89900  1.000 77.01713  ? 973  ILE A CA  1 
ATOM   460  C  C   . ILE A 1 64  ? -5.11600  -7.09600  24.74300  1.000 74.39313  ? 973  ILE A C   1 
ATOM   461  O  O   . ILE A 1 64  ? -4.98800  -7.09700  25.98400  1.000 76.98818  ? 973  ILE A O   1 
ATOM   462  C  CB  . ILE A 1 64  ? -3.31600  -6.61700  22.96200  1.000 67.11068  ? 973  ILE A CB  1 
ATOM   463  C  CG1 . ILE A 1 64  ? -1.98700  -7.13100  22.40400  1.000 66.58430  ? 973  ILE A CG1 1 
ATOM   464  C  CG2 . ILE A 1 64  ? -3.14400  -5.27500  23.65200  1.000 67.73970  ? 973  ILE A CG2 1 
ATOM   465  C  CD1 . ILE A 1 64  ? -1.48900  -6.34800  21.21400  1.000 68.59243  ? 973  ILE A CD1 1 
ATOM   466  N  N   . SER A 1 65  ? -6.21500  -6.67500  24.10700  1.000 74.25627  ? 974  SER A N   1 
ATOM   467  C  CA  . SER A 1 65  ? -7.40000  -6.07900  24.78400  1.000 76.02490  ? 974  SER A CA  1 
ATOM   468  C  C   . SER A 1 65  ? -7.89900  -6.99800  25.90900  1.000 84.53645  ? 974  SER A C   1 
ATOM   469  O  O   . SER A 1 65  ? -8.34700  -6.46400  26.93800  1.000 86.78672  ? 974  SER A O   1 
ATOM   470  C  CB  . SER A 1 65  ? -8.50000  -5.76500  23.80300  1.000 75.20902  ? 974  SER A CB  1 
ATOM   471  O  OG  . SER A 1 65  ? -8.85900  -6.92100  23.06300  1.000 85.35760  ? 974  SER A OG  1 
ATOM   472  N  N   . SER A 1 66  ? -7.83900  -8.31900  25.72000  1.000 83.27577  ? 975  SER A N   1 
ATOM   473  C  CA  . SER A 1 66  ? -8.18300  -9.34100  26.74500  1.000 85.33918  ? 975  SER A CA  1 
ATOM   474  C  C   . SER A 1 66  ? -7.25900  -9.16700  27.95400  1.000 92.56899  ? 975  SER A C   1 
ATOM   475  O  O   . SER A 1 66  ? -7.76900  -9.02100  29.07900  1.000 88.81854  ? 975  SER A O   1 
ATOM   476  C  CB  . SER A 1 66  ? -8.09500  -10.74400 26.17500  1.000 86.69724  ? 975  SER A CB  1 
ATOM   477  O  OG  . SER A 1 66  ? -8.05800  -11.72300 27.20600  1.000 90.60297  ? 975  SER A OG  1 
ATOM   478  N  N   . VAL A 1 67  ? -5.94700  -9.16900  27.70900  1.000 90.32399  ? 976  VAL A N   1 
ATOM   479  C  CA  . VAL A 1 67  ? -4.89200  -9.09100  28.76200  1.000 84.76016  ? 976  VAL A CA  1 
ATOM   480  C  C   . VAL A 1 67  ? -5.00400  -7.74200  29.47200  1.000 83.66266  ? 976  VAL A C   1 
ATOM   481  O  O   . VAL A 1 67  ? -4.86700  -7.72300  30.70000  1.000 90.92932  ? 976  VAL A O   1 
ATOM   482  C  CB  . VAL A 1 67  ? -3.47900  -9.30000  28.18500  1.000 88.83434  ? 976  VAL A CB  1 
ATOM   483  C  CG1 . VAL A 1 67  ? -2.41200  -9.10400  29.24700  1.000 90.17397  ? 976  VAL A CG1 1 
ATOM   484  C  CG2 . VAL A 1 67  ? -3.32700  -10.66900 27.53900  1.000 95.54567  ? 976  VAL A CG2 1 
ATOM   485  N  N   . LEU A 1 68  ? -5.25500  -6.66900  28.72200  1.000 84.62330  ? 977  LEU A N   1 
ATOM   486  C  CA  . LEU A 1 68  ? -5.38800  -5.29100  29.26600  1.000 86.07874  ? 977  LEU A CA  1 
ATOM   487  C  C   . LEU A 1 68  ? -6.58300  -5.21100  30.22500  1.000 87.43680  ? 977  LEU A C   1 
ATOM   488  O  O   . LEU A 1 68  ? -6.42200  -4.61300  31.30900  1.000 89.78445  ? 977  LEU A O   1 
ATOM   489  C  CB  . LEU A 1 68  ? -5.53700  -4.28900  28.11400  1.000 84.04166  ? 977  LEU A CB  1 
ATOM   490  C  CG  . LEU A 1 68  ? -4.24600  -3.88600  27.39600  1.000 79.39373  ? 977  LEU A CG  1 
ATOM   491  C  CD1 . LEU A 1 68  ? -4.53400  -2.82500  26.34300  1.000 73.95887  ? 977  LEU A CD1 1 
ATOM   492  C  CD2 . LEU A 1 68  ? -3.18600  -3.38300  28.37000  1.000 76.82763  ? 977  LEU A CD2 1 
ATOM   493  N  N   . ASN A 1 69  ? -7.73600  -5.77000  29.84600  1.000 103.10973 ? 978  ASN A N   1 
ATOM   494  C  CA  . ASN A 1 69  ? -8.98000  -5.75800  30.66600  1.000 106.01534 ? 978  ASN A CA  1 
ATOM   495  C  C   . ASN A 1 69  ? -8.75800  -6.53300  31.97000  1.000 109.04992 ? 978  ASN A C   1 
ATOM   496  O  O   . ASN A 1 69  ? -9.21400  -6.04900  33.01900  1.000 109.46576 ? 978  ASN A O   1 
ATOM   497  C  CB  . ASN A 1 69  ? -10.17100 -6.32900  29.89800  1.000 111.93447 ? 978  ASN A CB  1 
ATOM   498  C  CG  . ASN A 1 69  ? -10.58700 -5.43800  28.75200  1.000 109.68157 ? 978  ASN A CG  1 
ATOM   499  O  OD1 . ASN A 1 69  ? -10.15500 -4.28500  28.65900  1.000 97.28008  ? 978  ASN A OD1 1 
ATOM   500  N  ND2 . ASN A 1 69  ? -11.40500 -5.97800  27.86400  1.000 111.73445 ? 978  ASN A ND2 1 
ATOM   501  N  N   . ASP A 1 70  ? -8.08600  -7.68700  31.89700  1.000 111.29492 ? 979  ASP A N   1 
ATOM   502  C  CA  . ASP A 1 70  ? -7.68000  -8.51000  33.06900  1.000 108.37089 ? 979  ASP A CA  1 
ATOM   503  C  C   . ASP A 1 70  ? -6.74500  -7.72700  33.99400  1.000 112.43190 ? 979  ASP A C   1 
ATOM   504  O  O   . ASP A 1 70  ? -6.90000  -7.86500  35.21200  1.000 124.09119 ? 979  ASP A O   1 
ATOM   505  C  CB  . ASP A 1 70  ? -6.96200  -9.79500  32.65500  1.000 112.69772 ? 979  ASP A CB  1 
ATOM   506  C  CG  . ASP A 1 70  ? -7.77700  -11.04100 32.93200  1.000 121.33297 ? 979  ASP A CG  1 
ATOM   507  O  OD1 . ASP A 1 70  ? -8.95700  -11.06400 32.51400  1.000 129.97085 ? 979  ASP A OD1 1 
ATOM   508  O  OD2 . ASP A 1 70  ? -7.23100  -11.96500 33.58600  1.000 121.48035 ? 979  ASP A OD2 1 
ATOM   509  N  N   . ILE A 1 71  ? -5.78800  -6.97900  33.43900  1.000 96.86425  ? 980  ILE A N   1 
ATOM   510  C  CA  . ILE A 1 71  ? -4.79900  -6.16700  34.21500  1.000 95.73253  ? 980  ILE A CA  1 
ATOM   511  C  C   . ILE A 1 71  ? -5.52200  -4.99800  34.90200  1.000 96.33523  ? 980  ILE A C   1 
ATOM   512  O  O   . ILE A 1 71  ? -5.19800  -4.73100  36.08100  1.000 97.93543  ? 980  ILE A O   1 
ATOM   513  C  CB  . ILE A 1 71  ? -3.63400  -5.70500  33.31400  1.000 91.64257  ? 980  ILE A CB  1 
ATOM   514  C  CG1 . ILE A 1 71  ? -2.67300  -6.86500  33.04900  1.000 91.83733  ? 980  ILE A CG1 1 
ATOM   515  C  CG2 . ILE A 1 71  ? -2.90800  -4.49800  33.89800  1.000 90.07133  ? 980  ILE A CG2 1 
ATOM   516  C  CD1 . ILE A 1 71  ? -1.70800  -6.61000  31.92600  1.000 88.19742  ? 980  ILE A CD1 1 
ATOM   517  N  N   . LEU A 1 72  ? -6.45700  -4.33700  34.21100  1.000 107.83135 ? 981  LEU A N   1 
ATOM   518  C  CA  . LEU A 1 72  ? -7.21700  -3.17400  34.74700  1.000 96.85635  ? 981  LEU A CA  1 
ATOM   519  C  C   . LEU A 1 72  ? -8.15900  -3.61500  35.87200  1.000 108.88674 ? 981  LEU A C   1 
ATOM   520  O  O   . LEU A 1 72  ? -8.39600  -2.79900  36.78300  1.000 107.53658 ? 981  LEU A O   1 
ATOM   521  C  CB  . LEU A 1 72  ? -8.00800  -2.51800  33.61500  1.000 98.96187  ? 981  LEU A CB  1 
ATOM   522  C  CG  . LEU A 1 72  ? -7.17400  -1.72400  32.61300  1.000 90.43979  ? 981  LEU A CG  1 
ATOM   523  C  CD1 . LEU A 1 72  ? -8.04500  -1.21600  31.47900  1.000 88.85539  ? 981  LEU A CD1 1 
ATOM   524  C  CD2 . LEU A 1 72  ? -6.45600  -0.56600  33.29400  1.000 89.34755  ? 981  LEU A CD2 1 
ATOM   525  N  N   . SER A 1 73  ? -8.70100  -4.83500  35.79900  1.000 110.12110 ? 982  SER A N   1 
ATOM   526  C  CA  . SER A 1 73  ? -9.56800  -5.42700  36.85200  1.000 113.73206 ? 982  SER A CA  1 
ATOM   527  C  C   . SER A 1 73  ? -8.71000  -5.79500  38.06900  1.000 118.51684 ? 982  SER A C   1 
ATOM   528  O  O   . SER A 1 73  ? -9.10300  -5.40900  39.18900  1.000 132.60011 ? 982  SER A O   1 
ATOM   529  C  CB  . SER A 1 73  ? -10.35000 -6.60900  36.33600  1.000 116.95350 ? 982  SER A CB  1 
ATOM   530  O  OG  . SER A 1 73  ? -9.51400  -7.74400  36.16600  1.000 123.22267 ? 982  SER A OG  1 
ATOM   531  N  N   . ARG A 1 74  ? -7.58400  -6.49400  37.85100  1.000 105.97586 ? 983  ARG A N   1 
ATOM   532  C  CA  . ARG A 1 74  ? -6.57300  -6.82500  38.89600  1.000 115.80599 ? 983  ARG A CA  1 
ATOM   533  C  C   . ARG A 1 74  ? -6.18500  -5.54500  39.65400  1.000 118.58527 ? 983  ARG A C   1 
ATOM   534  O  O   . ARG A 1 74  ? -6.17300  -5.58500  40.89700  1.000 110.91330 ? 983  ARG A O   1 
ATOM   535  C  CB  . ARG A 1 74  ? -5.28800  -7.42700  38.30600  1.000 113.87418 ? 983  ARG A CB  1 
ATOM   536  C  CG  . ARG A 1 74  ? -5.28900  -8.92900  38.03300  1.000 110.43693 ? 983  ARG A CG  1 
ATOM   537  C  CD  . ARG A 1 74  ? -3.85600  -9.46000  37.91100  1.000 115.15591 ? 983  ARG A CD  1 
ATOM   538  N  NE  . ARG A 1 74  ? -3.62600  -10.70200 37.16800  1.000 122.27519 ? 983  ARG A NE  1 
ATOM   539  C  CZ  . ARG A 1 74  ? -2.57500  -11.51800 37.33300  1.000 128.90756 ? 983  ARG A CZ  1 
ATOM   540  N  NH1 . ARG A 1 74  ? -1.65200  -11.26400 38.25100  1.000 135.84260 ? 983  ARG A NH1 1 
ATOM   541  N  NH2 . ARG A 1 74  ? -2.46400  -12.61000 36.59200  1.000 123.96486 ? 983  ARG A NH2 1 
ATOM   542  N  N   . LEU A 1 75  ? -5.86400  -4.47000  38.92000  1.000 127.49160 ? 984  LEU A N   1 
ATOM   543  C  CA  . LEU A 1 75  ? -5.37800  -3.16200  39.44700  1.000 125.09395 ? 984  LEU A CA  1 
ATOM   544  C  C   . LEU A 1 75  ? -6.45400  -2.49300  40.31500  1.000 129.70766 ? 984  LEU A C   1 
ATOM   545  O  O   . LEU A 1 75  ? -6.08000  -1.88900  41.34500  1.000 128.81808 ? 984  LEU A O   1 
ATOM   546  C  CB  . LEU A 1 75  ? -5.00000  -2.27300  38.26000  1.000 107.20496 ? 984  LEU A CB  1 
ATOM   547  C  CG  . LEU A 1 75  ? -4.51700  -0.86900  38.60500  1.000 105.98376 ? 984  LEU A CG  1 
ATOM   548  C  CD1 . LEU A 1 75  ? -3.48300  -0.42300  37.58600  1.000 104.55464 ? 984  LEU A CD1 1 
ATOM   549  C  CD2 . LEU A 1 75  ? -5.68700  0.11100   38.68900  1.000 109.46312 ? 984  LEU A CD2 1 
ATOM   550  N  N   . ASP A 1 76  ? -7.72700  -2.55600  39.90500  1.000 126.48885 ? 985  ASP A N   1 
ATOM   551  C  CA  . ASP A 1 76  ? -8.87300  -2.01900  40.69000  1.000 128.08904 ? 985  ASP A CA  1 
ATOM   552  C  C   . ASP A 1 76  ? -8.93900  -2.75900  42.03400  1.000 128.18642 ? 985  ASP A C   1 
ATOM   553  O  O   . ASP A 1 76  ? -9.03200  -2.08000  43.08500  1.000 121.54352 ? 985  ASP A O   1 
ATOM   554  C  CB  . ASP A 1 76  ? -10.18200 -2.10800  39.90000  1.000 127.31263 ? 985  ASP A CB  1 
ATOM   555  C  CG  . ASP A 1 76  ? -10.29000 -1.07700  38.78900  1.000 123.98592 ? 985  ASP A CG  1 
ATOM   556  O  OD1 . ASP A 1 76  ? -9.46000  -0.14500  38.76100  1.000 120.21968 ? 985  ASP A OD1 1 
ATOM   557  O  OD2 . ASP A 1 76  ? -11.20300 -1.21600  37.95700  1.000 123.09897 ? 985  ASP A OD2 1 
ATOM   558  N  N   . LYS A 1 77  ? -8.84200  -4.09300  41.99500  1.000 131.23942 ? 986  LYS A N   1 
ATOM   559  C  CA  . LYS A 1 77  ? -8.92700  -4.98900  43.18300  1.000 126.53886 ? 986  LYS A CA  1 
ATOM   560  C  C   . LYS A 1 77  ? -7.73200  -4.76800  44.11900  1.000 127.67583 ? 986  LYS A C   1 
ATOM   561  O  O   . LYS A 1 77  ? -7.91800  -4.93500  45.33900  1.000 142.30127 ? 986  LYS A O   1 
ATOM   562  C  CB  . LYS A 1 77  ? -9.06000  -6.45500  42.75100  1.000 127.13103 ? 986  LYS A CB  1 
ATOM   563  C  CG  . LYS A 1 77  ? -10.43200 -7.08000  42.98000  1.000 131.37891 ? 986  LYS A CG  1 
ATOM   564  C  CD  . LYS A 1 77  ? -11.60500 -6.10800  42.89800  1.000 138.31395 ? 986  LYS A CD  1 
ATOM   565  C  CE  . LYS A 1 77  ? -12.12100 -5.89100  41.49200  1.000 140.32998 ? 986  LYS A CE  1 
ATOM   566  N  NZ  . LYS A 1 77  ? -12.87600 -4.62000  41.36900  1.000 145.04107 ? 986  LYS A NZ  1 
ATOM   567  N  N   . VAL A 1 78  ? -6.56400  -4.39200  43.59200  1.000 128.35750 ? 987  VAL A N   1 
ATOM   568  C  CA  . VAL A 1 78  ? -5.37400  -4.03400  44.42200  1.000 130.84464 ? 987  VAL A CA  1 
ATOM   569  C  C   . VAL A 1 78  ? -5.59900  -2.62900  45.00500  1.000 136.27423 ? 987  VAL A C   1 
ATOM   570  O  O   . VAL A 1 78  ? -5.45400  -2.48300  46.22800  1.000 141.34853 ? 987  VAL A O   1 
ATOM   571  C  CB  . VAL A 1 78  ? -4.05900  -4.16100  43.62700  1.000 115.71387 ? 987  VAL A CB  1 
ATOM   572  C  CG1 . VAL A 1 78  ? -2.88800  -3.49200  44.32800  1.000 115.65597 ? 987  VAL A CG1 1 
ATOM   573  C  CG2 . VAL A 1 78  ? -3.73300  -5.61700  43.33400  1.000 116.79295 ? 987  VAL A CG2 1 
ATOM   574  N  N   . GLU A 1 79  ? -5.97000  -1.64700  44.17700  1.000 138.45344 ? 988  GLU A N   1 
ATOM   575  C  CA  . GLU A 1 79  ? -6.33900  -0.28400  44.64200  1.000 142.29864 ? 988  GLU A CA  1 
ATOM   576  C  C   . GLU A 1 79  ? -7.68200  -0.36900  45.37800  1.000 148.47306 ? 988  GLU A C   1 
ATOM   577  O  O   . GLU A 1 79  ? -7.83900  0.36600   46.38100  1.000 158.90326 ? 988  GLU A O   1 
ATOM   578  C  CB  . GLU A 1 79  ? -6.44300  0.69500   43.47400  1.000 140.40104 ? 988  GLU A CB  1 
ATOM   579  C  CG  . GLU A 1 79  ? -5.13100  0.93800   42.74800  1.000 136.32950 ? 988  GLU A CG  1 
ATOM   580  C  CD  . GLU A 1 79  ? -5.09800  2.24500   41.97300  1.000 132.66327 ? 988  GLU A CD  1 
ATOM   581  O  OE1 . GLU A 1 79  ? -6.18800  2.80000   41.70900  1.000 134.96355 ? 988  GLU A OE1 1 
ATOM   582  O  OE2 . GLU A 1 79  ? -3.98500  2.71500   41.65200  1.000 127.32053 ? 988  GLU A OE2 1 
ATOM   583  N  N   . VAL A 1 88  ? -9.75700  -1.80300  27.83200  1.000 106.09430 ? 1164 VAL A N   1 
ATOM   584  C  CA  . VAL A 1 88  ? -10.19000 -0.80700  26.80200  1.000 107.15232 ? 1164 VAL A CA  1 
ATOM   585  C  C   . VAL A 1 88  ? -10.63100 -1.55400  25.53600  1.000 106.37591 ? 1164 VAL A C   1 
ATOM   586  O  O   . VAL A 1 88  ? -10.24800 -2.73500  25.37000  1.000 106.87334 ? 1164 VAL A O   1 
ATOM   587  C  CB  . VAL A 1 88  ? -9.08200  0.21400   26.47200  1.000 101.92011 ? 1164 VAL A CB  1 
ATOM   588  C  CG1 . VAL A 1 88  ? -7.93900  -0.42600  25.69300  1.000 86.37088  ? 1164 VAL A CG1 1 
ATOM   589  C  CG2 . VAL A 1 88  ? -9.62700  1.42500   25.72500  1.000 97.75909  ? 1164 VAL A CG2 1 
ATOM   590  N  N   . ASP A 1 89  ? -11.40100 -0.86400  24.68700  1.000 112.10818 ? 1165 ASP A N   1 
ATOM   591  C  CA  . ASP A 1 89  ? -11.89600 -1.34000  23.36700  1.000 116.14814 ? 1165 ASP A CA  1 
ATOM   592  C  C   . ASP A 1 89  ? -11.21000 -0.50000  22.27200  1.000 104.32303 ? 1165 ASP A C   1 
ATOM   593  O  O   . ASP A 1 89  ? -11.42300 0.73200   22.24000  1.000 108.30509 ? 1165 ASP A O   1 
ATOM   594  C  CB  . ASP A 1 89  ? -13.43100 -1.28300  23.32200  1.000 117.66148 ? 1165 ASP A CB  1 
ATOM   595  C  CG  . ASP A 1 89  ? -14.13800 -1.95300  24.49800  1.000 123.66483 ? 1165 ASP A CG  1 
ATOM   596  O  OD1 . ASP A 1 89  ? -14.41500 -3.17300  24.41400  1.000 119.72751 ? 1165 ASP A OD1 1 
ATOM   597  O  OD2 . ASP A 1 89  ? -14.42400 -1.24400  25.48800  1.000 137.73230 ? 1165 ASP A OD2 1 
ATOM   598  N  N   . LEU A 1 90  ? -10.40200 -1.13500  21.41500  1.000 83.21787  ? 1166 LEU A N   1 
ATOM   599  C  CA  . LEU A 1 90  ? -9.60700  -0.46000  20.35100  1.000 76.50391  ? 1166 LEU A CA  1 
ATOM   600  C  C   . LEU A 1 90  ? -10.10700 -0.88900  18.96900  1.000 83.62582  ? 1166 LEU A C   1 
ATOM   601  O  O   . LEU A 1 90  ? -10.79100 -1.92100  18.87800  1.000 92.73480  ? 1166 LEU A O   1 
ATOM   602  C  CB  . LEU A 1 90  ? -8.12400  -0.80000  20.51200  1.000 84.23378  ? 1166 LEU A CB  1 
ATOM   603  C  CG  . LEU A 1 90  ? -7.80600  -2.22100  20.97500  1.000 89.79761  ? 1166 LEU A CG  1 
ATOM   604  C  CD1 . LEU A 1 90  ? -8.28000  -3.26200  19.96500  1.000 93.95600  ? 1166 LEU A CD1 1 
ATOM   605  C  CD2 . LEU A 1 90  ? -6.31600  -2.36800  21.23000  1.000 79.01737  ? 1166 LEU A CD2 1 
ATOM   606  N  N   . GLY A 1 91  ? -9.71100  -0.14300  17.93400  1.000 90.05553  ? 1167 GLY A N   1 
ATOM   607  C  CA  . GLY A 1 91  ? -10.30900 -0.17100  16.58300  1.000 91.23989  ? 1167 GLY A CA  1 
ATOM   608  C  C   . GLY A 1 91  ? -10.22100 -1.53200  15.91000  1.000 92.16631  ? 1167 GLY A C   1 
ATOM   609  O  O   . GLY A 1 91  ? -9.25100  -2.28000  16.18100  1.000 94.20340  ? 1167 GLY A O   1 
ATOM   610  N  N   . ASP A 1 92  ? -11.21500 -1.84600  15.07100  1.000 103.31502 ? 1168 ASP A N   1 
ATOM   611  C  CA  . ASP A 1 92  ? -11.28400 -3.10300  14.28100  1.000 105.60740 ? 1168 ASP A CA  1 
ATOM   612  C  C   . ASP A 1 92  ? -10.76300 -2.81600  12.87400  1.000 97.62749  ? 1168 ASP A C   1 
ATOM   613  O  O   . ASP A 1 92  ? -11.17900 -1.80800  12.27600  1.000 98.34863  ? 1168 ASP A O   1 
ATOM   614  C  CB  . ASP A 1 92  ? -12.69500 -3.69300  14.23000  1.000 113.67942 ? 1168 ASP A CB  1 
ATOM   615  C  CG  . ASP A 1 92  ? -12.71000 -5.14200  13.76500  1.000 118.69318 ? 1168 ASP A CG  1 
ATOM   616  O  OD1 . ASP A 1 92  ? -11.66600 -5.82200  13.89900  1.000 114.90588 ? 1168 ASP A OD1 1 
ATOM   617  O  OD2 . ASP A 1 92  ? -13.76300 -5.58200  13.27500  1.000 124.33859 ? 1168 ASP A OD2 1 
ATOM   618  N  N   . ILE A 1 93  ? -9.88000  -3.68400  12.38300  1.000 87.53681  ? 1169 ILE A N   1 
ATOM   619  C  CA  . ILE A 1 93  ? -9.19700  -3.54800  11.06200  1.000 78.10673  ? 1169 ILE A CA  1 
ATOM   620  C  C   . ILE A 1 93  ? -9.49100  -4.77500  10.19200  1.000 87.66314  ? 1169 ILE A C   1 
ATOM   621  O  O   . ILE A 1 93  ? -8.97600  -4.80500  9.05300   1.000 88.43166  ? 1169 ILE A O   1 
ATOM   622  C  CB  . ILE A 1 93  ? -7.68000  -3.32500  11.23600  1.000 77.50929  ? 1169 ILE A CB  1 
ATOM   623  C  CG1 . ILE A 1 93  ? -7.02500  -4.30500  12.21800  1.000 74.86424  ? 1169 ILE A CG1 1 
ATOM   624  C  CG2 . ILE A 1 93  ? -7.41600  -1.88400  11.63000  1.000 75.36430  ? 1169 ILE A CG2 1 
ATOM   625  C  CD1 . ILE A 1 93  ? -6.62800  -5.62200  11.61000  1.000 74.89582  ? 1169 ILE A CD1 1 
ATOM   626  N  N   . SER A 1 94  ? -10.29200 -5.73000  10.69100  1.000 84.42591  ? 1170 SER A N   1 
ATOM   627  C  CA  . SER A 1 94  ? -10.66600 -6.98800  9.98700   1.000 83.82847  ? 1170 SER A CA  1 
ATOM   628  C  C   . SER A 1 94  ? -11.45100 -6.65800  8.70200   1.000 83.18103  ? 1170 SER A C   1 
ATOM   629  O  O   . SER A 1 94  ? -11.40000 -7.46600  7.75300   1.000 82.85467  ? 1170 SER A O   1 
ATOM   630  C  CB  . SER A 1 94  ? -11.41200 -7.93800  10.91500  1.000 89.53442  ? 1170 SER A CB  1 
ATOM   631  O  OG  . SER A 1 94  ? -12.60300 -7.34700  11.41300  1.000 92.94272  ? 1170 SER A OG  1 
ATOM   632  N  N   . GLY A 1 95  ? -12.10600 -5.49100  8.65200   1.000 88.45534  ? 1171 GLY A N   1 
ATOM   633  C  CA  . GLY A 1 95  ? -12.82800 -4.98200  7.46800   1.000 92.65848  ? 1171 GLY A CA  1 
ATOM   634  C  C   . GLY A 1 95  ? -11.89700 -4.63700  6.31400   1.000 89.66601  ? 1171 GLY A C   1 
ATOM   635  O  O   . GLY A 1 95  ? -12.36900 -4.67000  5.15200   1.000 84.32590  ? 1171 GLY A O   1 
ATOM   636  N  N   . ILE A 1 96  ? -10.63400 -4.28800  6.60600   1.000 95.25089  ? 1172 ILE A N   1 
ATOM   637  C  CA  . ILE A 1 96  ? -9.59300  -3.98800  5.57600   1.000 86.68408  ? 1172 ILE A CA  1 
ATOM   638  C  C   . ILE A 1 96  ? -9.26000  -5.29800  4.85800   1.000 80.39122  ? 1172 ILE A C   1 
ATOM   639  O  O   . ILE A 1 96  ? -8.88000  -6.27800  5.53500   1.000 83.39947  ? 1172 ILE A O   1 
ATOM   640  C  CB  . ILE A 1 96  ? -8.32800  -3.32000  6.16200   1.000 85.49446  ? 1172 ILE A CB  1 
ATOM   641  C  CG1 . ILE A 1 96  ? -8.54600  -1.83300  6.46300   1.000 87.10518  ? 1172 ILE A CG1 1 
ATOM   642  C  CG2 . ILE A 1 96  ? -7.13700  -3.52000  5.23200   1.000 78.04094  ? 1172 ILE A CG2 1 
ATOM   643  C  CD1 . ILE A 1 96  ? -8.87200  -1.52900  7.90600   1.000 92.18474  ? 1172 ILE A CD1 1 
ATOM   644  N  N   . ASN A 1 97  ? -9.40600  -5.29900  3.53500   1.000 73.36406  ? 1173 ASN A N   1 
ATOM   645  C  CA  . ASN A 1 97  ? -9.20600  -6.49800  2.68600   1.000 75.43010  ? 1173 ASN A CA  1 
ATOM   646  C  C   . ASN A 1 97  ? -8.63600  -6.06900  1.33100   1.000 69.72415  ? 1173 ASN A C   1 
ATOM   647  O  O   . ASN A 1 97  ? -9.15600  -5.08900  0.72800   1.000 71.39277  ? 1173 ASN A O   1 
ATOM   648  C  CB  . ASN A 1 97  ? -10.49800 -7.30200  2.51800   1.000 75.81962  ? 1173 ASN A CB  1 
ATOM   649  C  CG  . ASN A 1 97  ? -10.36500 -8.40100  1.48500   1.000 74.52209  ? 1173 ASN A CG  1 
ATOM   650  O  OD1 . ASN A 1 97  ? -10.60800 -8.18100  0.29900   1.000 80.74126  ? 1173 ASN A OD1 1 
ATOM   651  N  ND2 . ASN A 1 97  ? -9.95500  -9.58100  1.92300   1.000 77.92513  ? 1173 ASN A ND2 1 
ATOM   652  N  N   . ALA A 1 98  ? -7.61200  -6.80000  0.88500   1.000 69.60045  ? 1174 ALA A N   1 
ATOM   653  C  CA  . ALA A 1 98  ? -6.95300  -6.64900  -0.42800  1.000 67.20543  ? 1174 ALA A CA  1 
ATOM   654  C  C   . ALA A 1 98  ? -7.67000  -7.54100  -1.43900  1.000 68.03447  ? 1174 ALA A C   1 
ATOM   655  O  O   . ALA A 1 98  ? -7.70000  -8.76500  -1.23500  1.000 75.22744  ? 1174 ALA A O   1 
ATOM   656  C  CB  . ALA A 1 98  ? -5.49600  -7.01300  -0.32000  1.000 57.73061  ? 1174 ALA A CB  1 
ATOM   657  N  N   . SER A 1 99  ? -8.25400  -6.94300  -2.47100  1.000 67.40019  ? 1175 SER A N   1 
ATOM   658  C  CA  . SER A 1 99  ? -8.85600  -7.68000  -3.60400  1.000 78.31202  ? 1175 SER A CA  1 
ATOM   659  C  C   . SER A 1 99  ? -7.72800  -8.25200  -4.46600  1.000 76.14597  ? 1175 SER A C   1 
ATOM   660  O  O   . SER A 1 99  ? -6.58400  -7.74300  -4.38600  1.000 63.22600  ? 1175 SER A O   1 
ATOM   661  C  CB  . SER A 1 99  ? -9.79200  -6.80900  -4.40200  1.000 85.36813  ? 1175 SER A CB  1 
ATOM   662  O  OG  . SER A 1 99  ? -9.43800  -5.43700  -4.29200  1.000 91.63204  ? 1175 SER A OG  1 
ATOM   663  N  N   . VAL A 1 100 ? -8.06000  -9.28600  -5.23700  1.000 62.53908  ? 1176 VAL A N   1 
ATOM   664  C  CA  . VAL A 1 100 ? -7.14800  -10.00400 -6.16900  1.000 59.24395  ? 1176 VAL A CA  1 
ATOM   665  C  C   . VAL A 1 100 ? -7.57500  -9.65000  -7.59200  1.000 68.90826  ? 1176 VAL A C   1 
ATOM   666  O  O   . VAL A 1 100 ? -8.67900  -9.04400  -7.77400  1.000 65.14728  ? 1176 VAL A O   1 
ATOM   667  C  CB  . VAL A 1 100 ? -7.16300  -11.52700 -5.92900  1.000 68.90563  ? 1176 VAL A CB  1 
ATOM   668  C  CG1 . VAL A 1 100 ? -6.69300  -11.87800 -4.52100  1.000 79.39110  ? 1176 VAL A CG1 1 
ATOM   669  C  CG2 . VAL A 1 100 ? -8.52400  -12.15300 -6.20500  1.000 66.13688  ? 1176 VAL A CG2 1 
ATOM   670  N  N   . VAL A 1 101 ? -6.71500  -9.98100  -8.55800  1.000 74.41682  ? 1177 VAL A N   1 
ATOM   671  C  CA  . VAL A 1 101 ? -6.91400  -9.62200  -9.99300  1.000 68.00552  ? 1177 VAL A CA  1 
ATOM   672  C  C   . VAL A 1 101 ? -6.98100  -10.92100 -10.80500 1.000 69.24778  ? 1177 VAL A C   1 
ATOM   673  O  O   . VAL A 1 101 ? -6.26300  -11.89100 -10.46200 1.000 72.80873  ? 1177 VAL A O   1 
ATOM   674  C  CB  . VAL A 1 101 ? -5.83300  -8.64800  -10.50800 1.000 47.18197  ? 1177 VAL A CB  1 
ATOM   675  C  CG1 . VAL A 1 101 ? -4.44400  -9.26300  -10.47300 1.000 49.04799  ? 1177 VAL A CG1 1 
ATOM   676  C  CG2 . VAL A 1 101 ? -6.16100  -8.10900  -11.89500 1.000 45.32912  ? 1177 VAL A CG2 1 
ATOM   677  N  N   . ASN A 1 102 ? -7.84800  -10.93200 -11.81700 1.000 55.45402  ? 1178 ASN A N   1 
ATOM   678  C  CA  . ASN A 1 102 ? -8.01400  -12.06300 -12.75700 1.000 65.61839  ? 1178 ASN A CA  1 
ATOM   679  C  C   . ASN A 1 102 ? -7.94200  -11.52500 -14.18700 1.000 64.41825  ? 1178 ASN A C   1 
ATOM   680  O  O   . ASN A 1 102 ? -8.95400  -11.00300 -14.68100 1.000 62.66804  ? 1178 ASN A O   1 
ATOM   681  C  CB  . ASN A 1 102 ? -9.31700  -12.81000 -12.48700 1.000 70.62426  ? 1178 ASN A CB  1 
ATOM   682  C  CG  . ASN A 1 102 ? -9.37500  -14.14900 -13.18800 1.000 76.12755  ? 1178 ASN A CG  1 
ATOM   683  O  OD1 . ASN A 1 102 ? -8.66600  -14.39400 -14.16500 1.000 69.52413  ? 1178 ASN A OD1 1 
ATOM   684  N  ND2 . ASN A 1 102 ? -10.22500 -15.02700 -12.68600 1.000 83.86532  ? 1178 ASN A ND2 1 
ATOM   685  N  N   . ILE A 1 103 ? -6.78300  -11.66200 -14.82600 1.000 62.58908  ? 1179 ILE A N   1 
ATOM   686  C  CA  . ILE A 1 103 ? -6.57900  -11.23700 -16.23900 1.000 65.41311  ? 1179 ILE A CA  1 
ATOM   687  C  C   . ILE A 1 103 ? -6.13200  -12.43300 -17.08300 1.000 65.17887  ? 1179 ILE A C   1 
ATOM   688  O  O   . ILE A 1 103 ? -5.78800  -12.21300 -18.26100 1.000 70.14525  ? 1179 ILE A O   1 
ATOM   689  C  CB  . ILE A 1 103 ? -5.57200  -10.07700 -16.30900 1.000 50.09811  ? 1179 ILE A CB  1 
ATOM   690  C  CG1 . ILE A 1 103 ? -4.24900  -10.44500 -15.62900 1.000 49.34276  ? 1179 ILE A CG1 1 
ATOM   691  C  CG2 . ILE A 1 103 ? -6.20800  -8.82600  -15.72300 1.000 48.75585  ? 1179 ILE A CG2 1 
ATOM   692  C  CD1 . ILE A 1 103 ? -3.10700  -9.52700  -15.95300 1.000 45.13436  ? 1179 ILE A CD1 1 
ATOM   693  N  N   . GLN A 1 104 ? -6.17800  -13.64900 -16.52500 1.000 75.40115  ? 1180 GLN A N   1 
ATOM   694  C  CA  . GLN A 1 104 ? -5.72700  -14.90100 -17.19800 1.000 83.25209  ? 1180 GLN A CA  1 
ATOM   695  C  C   . GLN A 1 104 ? -6.47500  -15.09400 -18.53000 1.000 78.05673  ? 1180 GLN A C   1 
ATOM   696  O  O   . GLN A 1 104 ? -5.91700  -15.75800 -19.44200 1.000 79.98591  ? 1180 GLN A O   1 
ATOM   697  C  CB  . GLN A 1 104 ? -5.92700  -16.11500 -16.28700 1.000 87.61050  ? 1180 GLN A CB  1 
ATOM   698  C  CG  . GLN A 1 104 ? -5.16200  -17.34000 -16.76800 1.000 96.89846  ? 1180 GLN A CG  1 
ATOM   699  C  CD  . GLN A 1 104 ? -3.69000  -17.05200 -16.97300 1.000 92.03735  ? 1180 GLN A CD  1 
ATOM   700  O  OE1 . GLN A 1 104 ? -2.97600  -16.69500 -16.03800 1.000 89.46336  ? 1180 GLN A OE1 1 
ATOM   701  N  NE2 . GLN A 1 104 ? -3.21900  -17.19800 -18.20400 1.000 87.04991  ? 1180 GLN A NE2 1 
ATOM   702  N  N   . LYS A 1 105 ? -7.69400  -14.55400 -18.62600 1.000 76.97765  ? 1181 LYS A N   1 
ATOM   703  C  CA  . LYS A 1 105 ? -8.49900  -14.48800 -19.87200 1.000 61.10206  ? 1181 LYS A CA  1 
ATOM   704  C  C   . LYS A 1 105 ? -7.75400  -13.65400 -20.92400 1.000 71.31645  ? 1181 LYS A C   1 
ATOM   705  O  O   . LYS A 1 105 ? -7.62500  -14.13700 -22.06400 1.000 81.64926  ? 1181 LYS A O   1 
ATOM   706  C  CB  . LYS A 1 105 ? -9.87600  -13.90400 -19.55600 1.000 62.19430  ? 1181 LYS A CB  1 
ATOM   707  C  CG  . LYS A 1 105 ? -10.74800 -13.60900 -20.76600 1.000 62.61540  ? 1181 LYS A CG  1 
ATOM   708  C  CD  . LYS A 1 105 ? -12.03400 -12.87500 -20.43000 1.000 79.99643  ? 1181 LYS A CD  1 
ATOM   709  C  CE  . LYS A 1 105 ? -13.02700 -13.71200 -19.64700 1.000 93.83230  ? 1181 LYS A CE  1 
ATOM   710  N  NZ  . LYS A 1 105 ? -14.42500 -13.44400 -20.06900 1.000 95.63778  ? 1181 LYS A NZ  1 
ATOM   711  N  N   . GLU A 1 106 ? -7.27900  -12.45400 -20.56000 1.000 63.62342  ? 1182 GLU A N   1 
ATOM   712  C  CA  . GLU A 1 106 ? -6.57700  -11.51800 -21.48800 1.000 63.82607  ? 1182 GLU A CA  1 
ATOM   713  C  C   . GLU A 1 106 ? -5.18800  -12.05700 -21.83400 1.000 61.03363  ? 1182 GLU A C   1 
ATOM   714  O  O   . GLU A 1 106 ? -4.77400  -11.89800 -22.98700 1.000 59.84665  ? 1182 GLU A O   1 
ATOM   715  C  CB  . GLU A 1 106 ? -6.42800  -10.11800 -20.89700 1.000 56.91209  ? 1182 GLU A CB  1 
ATOM   716  C  CG  . GLU A 1 106 ? -7.72800  -9.34700  -20.84100 1.000 59.90192  ? 1182 GLU A CG  1 
ATOM   717  C  CD  . GLU A 1 106 ? -8.51900  -9.53500  -19.55800 1.000 67.19490  ? 1182 GLU A CD  1 
ATOM   718  O  OE1 . GLU A 1 106 ? -8.50000  -10.66500 -19.00200 1.000 71.47173  ? 1182 GLU A OE1 1 
ATOM   719  O  OE2 . GLU A 1 106 ? -9.15000  -8.54700  -19.11600 1.000 65.51575  ? 1182 GLU A OE2 1 
ATOM   720  N  N   . ILE A 1 107 ? -4.49100  -12.65300 -20.87200 1.000 53.25375  ? 1183 ILE A N   1 
ATOM   721  C  CA  . ILE A 1 107 ? -3.17100  -13.29300 -21.11800 1.000 53.21691  ? 1183 ILE A CA  1 
ATOM   722  C  C   . ILE A 1 107 ? -3.37100  -14.42400 -22.12600 1.000 65.61313  ? 1183 ILE A C   1 
ATOM   723  O  O   . ILE A 1 107 ? -2.54500  -14.57000 -23.04500 1.000 76.17492  ? 1183 ILE A O   1 
ATOM   724  C  CB  . ILE A 1 107 ? -2.55600  -13.79700 -19.80800 1.000 62.21799  ? 1183 ILE A CB  1 
ATOM   725  C  CG1 . ILE A 1 107 ? -2.33800  -12.63600 -18.83500 1.000 58.73073  ? 1183 ILE A CG1 1 
ATOM   726  C  CG2 . ILE A 1 107 ? -1.27000  -14.56500 -20.07900 1.000 67.48178  ? 1183 ILE A CG2 1 
ATOM   727  C  CD1 . ILE A 1 107 ? -1.82000  -13.05700 -17.48500 1.000 65.42890  ? 1183 ILE A CD1 1 
ATOM   728  N  N   . ASP A 1 108 ? -4.42200  -15.21300 -21.95000 1.000 66.54219  ? 1184 ASP A N   1 
ATOM   729  C  CA  . ASP A 1 108 ? -4.76400  -16.28800 -22.91100 1.000 77.22505  ? 1184 ASP A CA  1 
ATOM   730  C  C   . ASP A 1 108 ? -4.86900  -15.64300 -24.30300 1.000 69.31884  ? 1184 ASP A C   1 
ATOM   731  O  O   . ASP A 1 108 ? -4.05200  -15.99300 -25.18600 1.000 73.29563  ? 1184 ASP A O   1 
ATOM   732  C  CB  . ASP A 1 108 ? -6.01000  -17.03500 -22.42900 1.000 89.53179  ? 1184 ASP A CB  1 
ATOM   733  C  CG  . ASP A 1 108 ? -6.72400  -17.79500 -23.52800 1.000 92.25843  ? 1184 ASP A CG  1 
ATOM   734  O  OD1 . ASP A 1 108 ? -6.06000  -18.65400 -24.15600 1.000 102.60178 ? 1184 ASP A OD1 1 
ATOM   735  O  OD2 . ASP A 1 108 ? -7.93100  -17.49900 -23.76000 1.000 74.45893  ? 1184 ASP A OD2 1 
ATOM   736  N  N   . ARG A 1 109 ? -5.76600  -14.66000 -24.44600 1.000 72.00337  ? 1185 ARG A N   1 
ATOM   737  C  CA  . ARG A 1 109 ? -6.15000  -14.00800 -25.73100 1.000 61.04679  ? 1185 ARG A CA  1 
ATOM   738  C  C   . ARG A 1 109 ? -4.91300  -13.44900 -26.44900 1.000 64.85514  ? 1185 ARG A C   1 
ATOM   739  O  O   . ARG A 1 109 ? -4.88000  -13.50300 -27.68800 1.000 58.89917  ? 1185 ARG A O   1 
ATOM   740  C  CB  . ARG A 1 109 ? -7.17100  -12.89800 -25.46700 1.000 58.82021  ? 1185 ARG A CB  1 
ATOM   741  C  CG  . ARG A 1 109 ? -7.59800  -12.12400 -26.71000 1.000 64.86830  ? 1185 ARG A CG  1 
ATOM   742  C  CD  . ARG A 1 109 ? -8.80500  -12.69100 -27.45000 1.000 72.97980  ? 1185 ARG A CD  1 
ATOM   743  N  NE  . ARG A 1 109 ? -8.49700  -13.01900 -28.84300 1.000 79.82010  ? 1185 ARG A NE  1 
ATOM   744  C  CZ  . ARG A 1 109 ? -9.19500  -12.62900 -29.90700 1.000 82.93889  ? 1185 ARG A CZ  1 
ATOM   745  N  NH1 . ARG A 1 109 ? -10.28700 -11.88900 -29.76600 1.000 94.94033  ? 1185 ARG A NH1 1 
ATOM   746  N  NH2 . ARG A 1 109 ? -8.79500  -12.99600 -31.11500 1.000 69.91891  ? 1185 ARG A NH2 1 
ATOM   747  N  N   . LEU A 1 110 ? -3.94400  -12.90500 -25.71100 1.000 64.10505  ? 1186 LEU A N   1 
ATOM   748  C  CA  . LEU A 1 110 ? -2.65400  -12.43800 -26.28200 1.000 61.51001  ? 1186 LEU A CA  1 
ATOM   749  C  C   . LEU A 1 110 ? -1.90800  -13.62300 -26.90100 1.000 70.48477  ? 1186 LEU A C   1 
ATOM   750  O  O   . LEU A 1 110 ? -1.49100  -13.49600 -28.07100 1.000 61.90742  ? 1186 LEU A O   1 
ATOM   751  C  CB  . LEU A 1 110 ? -1.80800  -11.77500 -25.18800 1.000 57.84904  ? 1186 LEU A CB  1 
ATOM   752  C  CG  . LEU A 1 110 ? -2.25400  -10.38000 -24.74500 1.000 56.21463  ? 1186 LEU A CG  1 
ATOM   753  C  CD1 . LEU A 1 110 ? -1.23200  -9.79600  -23.78900 1.000 46.58716  ? 1186 LEU A CD1 1 
ATOM   754  C  CD2 . LEU A 1 110 ? -2.46900  -9.44100  -25.93400 1.000 42.23927  ? 1186 LEU A CD2 1 
ATOM   755  N  N   . ASN A 1 111 ? -1.74200  -14.71100 -26.13300 1.000 69.11355  ? 1187 ASN A N   1 
ATOM   756  C  CA  . ASN A 1 111 ? -1.00200  -15.93700 -26.53700 1.000 71.64280  ? 1187 ASN A CA  1 
ATOM   757  C  C   . ASN A 1 111 ? -1.73200  -16.59900 -27.70200 1.000 77.01187  ? 1187 ASN A C   1 
ATOM   758  O  O   . ASN A 1 111 ? -1.06300  -17.15200 -28.58500 1.000 88.10793  ? 1187 ASN A O   1 
ATOM   759  C  CB  . ASN A 1 111 ? -0.83500  -16.93100 -25.38900 1.000 79.85431  ? 1187 ASN A CB  1 
ATOM   760  C  CG  . ASN A 1 111 ? 0.26000   -16.53300 -24.42400 1.000 85.97083  ? 1187 ASN A CG  1 
ATOM   761  O  OD1 . ASN A 1 111 ? 1.26700   -15.95400 -24.82900 1.000 88.65010  ? 1187 ASN A OD1 1 
ATOM   762  N  ND2 . ASN A 1 111 ? 0.08300   -16.86000 -23.15300 1.000 82.74150  ? 1187 ASN A ND2 1 
ATOM   763  N  N   . GLU A 1 112 ? -3.05600  -16.54200 -27.70500 1.000 76.59866  ? 1188 GLU A N   1 
ATOM   764  C  CA  . GLU A 1 112 ? -3.85700  -17.06100 -28.84000 1.000 78.90420  ? 1188 GLU A CA  1 
ATOM   765  C  C   . GLU A 1 112 ? -3.49700  -16.27200 -30.10500 1.000 74.68001  ? 1188 GLU A C   1 
ATOM   766  O  O   . GLU A 1 112 ? -3.16600  -16.91300 -31.12000 1.000 79.01210  ? 1188 GLU A O   1 
ATOM   767  C  CB  . GLU A 1 112 ? -5.35600  -16.99000 -28.54900 1.000 81.86771  ? 1188 GLU A CB  1 
ATOM   768  C  CG  . GLU A 1 112 ? -6.13900  -17.96000 -29.40800 1.000 100.63575 ? 1188 GLU A CG  1 
ATOM   769  C  CD  . GLU A 1 112 ? -5.79300  -19.41500 -29.12000 1.000 116.70083 ? 1188 GLU A CD  1 
ATOM   770  O  OE1 . GLU A 1 112 ? -5.64000  -19.77100 -27.92800 1.000 117.09562 ? 1188 GLU A OE1 1 
ATOM   771  O  OE2 . GLU A 1 112 ? -5.62100  -20.18300 -30.09400 1.000 125.20185 ? 1188 GLU A OE2 1 
ATOM   772  N  N   . VAL A 1 113 ? -3.53700  -14.93800 -30.04500 1.000 75.18270  ? 1189 VAL A N   1 
ATOM   773  C  CA  . VAL A 1 113 ? -3.34300  -14.05700 -31.23600 1.000 66.98961  ? 1189 VAL A CA  1 
ATOM   774  C  C   . VAL A 1 113 ? -1.90000  -14.18400 -31.73400 1.000 69.67414  ? 1189 VAL A C   1 
ATOM   775  O  O   . VAL A 1 113 ? -1.70700  -14.17200 -32.95700 1.000 68.61349  ? 1189 VAL A O   1 
ATOM   776  C  CB  . VAL A 1 113 ? -3.71300  -12.59400 -30.94400 1.000 59.05445  ? 1189 VAL A CB  1 
ATOM   777  C  CG1 . VAL A 1 113 ? -3.34900  -11.68800 -32.10500 1.000 50.58764  ? 1189 VAL A CG1 1 
ATOM   778  C  CG2 . VAL A 1 113 ? -5.18900  -12.45800 -30.60800 1.000 60.43619  ? 1189 VAL A CG2 1 
ATOM   779  N  N   . ALA A 1 114 ? -0.92700  -14.31300 -30.82900 1.000 73.26405  ? 1190 ALA A N   1 
ATOM   780  C  CA  . ALA A 1 114 ? 0.50400   -14.53300 -31.16800 1.000 69.86101  ? 1190 ALA A CA  1 
ATOM   781  C  C   . ALA A 1 114 ? 0.65000   -15.78100 -32.06100 1.000 74.86424  ? 1190 ALA A C   1 
ATOM   782  O  O   . ALA A 1 114 ? 1.35700   -15.70200 -33.09300 1.000 76.12755  ? 1190 ALA A O   1 
ATOM   783  C  CB  . ALA A 1 114 ? 1.33100   -14.63800 -29.90400 1.000 74.60631  ? 1190 ALA A CB  1 
ATOM   784  N  N   . LYS A 1 115 ? -0.00700  -16.88900 -31.69600 1.000 72.76925  ? 1191 LYS A N   1 
ATOM   785  C  CA  . LYS A 1 115 ? 0.01000   -18.15800 -32.47300 1.000 72.26393  ? 1191 LYS A CA  1 
ATOM   786  C  C   . LYS A 1 115 ? -0.81000  -17.96300 -33.74900 1.000 69.23725  ? 1191 LYS A C   1 
ATOM   787  O  O   . LYS A 1 115 ? -0.32400  -18.33600 -34.81200 1.000 78.63311  ? 1191 LYS A O   1 
ATOM   788  C  CB  . LYS A 1 115 ? -0.55500  -19.34300 -31.67800 1.000 73.09034  ? 1191 LYS A CB  1 
ATOM   789  C  CG  . LYS A 1 115 ? 0.08600   -19.64000 -30.32400 1.000 85.73923  ? 1191 LYS A CG  1 
ATOM   790  C  CD  . LYS A 1 115 ? 1.60400   -19.60700 -30.29100 1.000 86.92621  ? 1191 LYS A CD  1 
ATOM   791  C  CE  . LYS A 1 115 ? 2.19300   -19.96000 -28.93600 1.000 87.59471  ? 1191 LYS A CE  1 
ATOM   792  N  NZ  . LYS A 1 115 ? 3.67400   -19.96000 -28.98300 1.000 85.65501  ? 1191 LYS A NZ  1 
ATOM   793  N  N   . ASN A 1 116 ? -2.01000  -17.39600 -33.63700 1.000 72.59555  ? 1192 ASN A N   1 
ATOM   794  C  CA  . ASN A 1 116 ? -2.97400  -17.24400 -34.76000 1.000 73.61672  ? 1192 ASN A CA  1 
ATOM   795  C  C   . ASN A 1 116 ? -2.41600  -16.36900 -35.88400 1.000 70.60583  ? 1192 ASN A C   1 
ATOM   796  O  O   . ASN A 1 116 ? -2.93600  -16.50400 -36.99900 1.000 79.52006  ? 1192 ASN A O   1 
ATOM   797  C  CB  . ASN A 1 116 ? -4.28500  -16.59200 -34.32700 1.000 85.66290  ? 1192 ASN A CB  1 
ATOM   798  C  CG  . ASN A 1 116 ? -5.23000  -17.54700 -33.63400 1.000 100.44362 ? 1192 ASN A CG  1 
ATOM   799  O  OD1 . ASN A 1 116 ? -4.85000  -18.66100 -33.27600 1.000 110.50009 ? 1192 ASN A OD1 1 
ATOM   800  N  ND2 . ASN A 1 116 ? -6.46800  -17.11800 -33.44800 1.000 101.23056 ? 1192 ASN A ND2 1 
ATOM   801  N  N   . LEU A 1 117 ? -1.44600  -15.48700 -35.60700 1.000 69.19251  ? 1193 LEU A N   1 
ATOM   802  C  CA  . LEU A 1 117 ? -0.84100  -14.57500 -36.62000 1.000 70.05314  ? 1193 LEU A CA  1 
ATOM   803  C  C   . LEU A 1 117 ? -0.01000  -15.36900 -37.63200 1.000 56.17516  ? 1193 LEU A C   1 
ATOM   804  O  O   . LEU A 1 117 ? 0.26300   -14.81800 -38.70700 1.000 71.30592  ? 1193 LEU A O   1 
ATOM   805  C  CB  . LEU A 1 117 ? 0.01400   -13.50100 -35.93800 1.000 51.37984  ? 1193 LEU A CB  1 
ATOM   806  C  CG  . LEU A 1 117 ? -0.76100  -12.29100 -35.41200 1.000 53.31692  ? 1193 LEU A CG  1 
ATOM   807  C  CD1 . LEU A 1 117 ? 0.17000   -11.32000 -34.69500 1.000 46.00815  ? 1193 LEU A CD1 1 
ATOM   808  C  CD2 . LEU A 1 117 ? -1.51100  -11.58600 -36.53600 1.000 45.05803  ? 1193 LEU A CD2 1 
ATOM   809  N  N   . ASN A 1 118 ? 0.37300   -16.61300 -37.32100 1.000 62.49697  ? 1194 ASN A N   1 
ATOM   810  C  CA  . ASN A 1 118 ? 1.06800   -17.52300 -38.27800 1.000 77.43297  ? 1194 ASN A CA  1 
ATOM   811  C  C   . ASN A 1 118 ? 0.19000   -17.70800 -39.52700 1.000 76.88027  ? 1194 ASN A C   1 
ATOM   812  O  O   . ASN A 1 118 ? 0.75100   -17.80700 -40.63200 1.000 71.51647  ? 1194 ASN A O   1 
ATOM   813  C  CB  . ASN A 1 118 ? 1.45600   -18.85900 -37.63200 1.000 81.05709  ? 1194 ASN A CB  1 
ATOM   814  C  CG  . ASN A 1 118 ? 2.66600   -18.74400 -36.72500 1.000 79.09896  ? 1194 ASN A CG  1 
ATOM   815  O  OD1 . ASN A 1 118 ? 3.51300   -17.86100 -36.91000 1.000 76.58550  ? 1194 ASN A OD1 1 
ATOM   816  N  ND2 . ASN A 1 118 ? 2.75300   -19.63300 -35.74300 1.000 82.65728  ? 1194 ASN A ND2 1 
ATOM   817  N  N   . GLU A 1 119 ? -1.13400  -17.69800 -39.35600 1.000 75.40641  ? 1195 GLU A N   1 
ATOM   818  C  CA  . GLU A 1 119 ? -2.12900  -17.86000 -40.45100 1.000 80.17277  ? 1195 GLU A CA  1 
ATOM   819  C  C   . GLU A 1 119 ? -2.35900  -16.53900 -41.20200 1.000 71.43488  ? 1195 GLU A C   1 
ATOM   820  O  O   . GLU A 1 119 ? -3.14600  -16.54600 -42.15600 1.000 70.80059  ? 1195 GLU A O   1 
ATOM   821  C  CB  . GLU A 1 119 ? -3.42700  -18.40900 -39.86500 1.000 85.07073  ? 1195 GLU A CB  1 
ATOM   822  C  CG  . GLU A 1 119 ? -3.31000  -19.87600 -39.48200 1.000 95.08772  ? 1195 GLU A CG  1 
ATOM   823  C  CD  . GLU A 1 119 ? -4.34000  -20.38300 -38.48500 1.000 103.77823 ? 1195 GLU A CD  1 
ATOM   824  O  OE1 . GLU A 1 119 ? -5.40800  -19.74200 -38.35700 1.000 107.88662 ? 1195 GLU A OE1 1 
ATOM   825  O  OE2 . GLU A 1 119 ? -4.07400  -21.42000 -37.83900 1.000 110.18690 ? 1195 GLU A OE2 1 
ATOM   826  N  N   . SER A 1 120 ? -1.69400  -15.44900 -40.80500 1.000 74.98267  ? 1196 SER A N   1 
ATOM   827  C  CA  . SER A 1 120 ? -1.75200  -14.12300 -41.48300 1.000 66.85275  ? 1196 SER A CA  1 
ATOM   828  C  C   . SER A 1 120 ? -0.53000  -13.94100 -42.38300 1.000 63.18126  ? 1196 SER A C   1 
ATOM   829  O  O   . SER A 1 120 ? -0.53900  -12.99100 -43.18100 1.000 69.86364  ? 1196 SER A O   1 
ATOM   830  C  CB  . SER A 1 120 ? -1.87900  -12.97100 -40.49900 1.000 59.62031  ? 1196 SER A CB  1 
ATOM   831  O  OG  . SER A 1 120 ? -3.24500  -12.69800 -40.21200 1.000 71.06115  ? 1196 SER A OG  1 
ATOM   832  N  N   . LEU A 1 121 ? 0.46600   -14.82400 -42.27900 1.000 58.58071  ? 1197 LEU A N   1 
ATOM   833  C  CA  . LEU A 1 121 ? 1.70600   -14.72800 -43.08400 1.000 62.71805  ? 1197 LEU A CA  1 
ATOM   834  C  C   . LEU A 1 121 ? 1.36100   -14.98100 -44.55500 1.000 70.81375  ? 1197 LEU A C   1 
ATOM   835  O  O   . LEU A 1 121 ? 0.24300   -15.45200 -44.83300 1.000 61.09680  ? 1197 LEU A O   1 
ATOM   836  C  CB  . LEU A 1 121 ? 2.74800   -15.70500 -42.53500 1.000 63.08388  ? 1197 LEU A CB  1 
ATOM   837  C  CG  . LEU A 1 121 ? 3.29200   -15.35500 -41.14500 1.000 61.01784  ? 1197 LEU A CG  1 
ATOM   838  C  CD1 . LEU A 1 121 ? 4.22900   -16.43500 -40.61900 1.000 62.28378  ? 1197 LEU A CD1 1 
ATOM   839  C  CD2 . LEU A 1 121 ? 4.01000   -14.01300 -41.14600 1.000 54.78815  ? 1197 LEU A CD2 1 
ATOM   840  N  N   . ILE A 1 122 ? 2.28300   -14.62000 -45.45100 1.000 79.03316  ? 1198 ILE A N   1 
ATOM   841  C  CA  . ILE A 1 122 ? 2.11600   -14.64500 -46.93200 1.000 73.69568  ? 1198 ILE A CA  1 
ATOM   842  C  C   . ILE A 1 122 ? 3.08900   -15.67600 -47.51700 1.000 80.06486  ? 1198 ILE A C   1 
ATOM   843  O  O   . ILE A 1 122 ? 4.29300   -15.56800 -47.22100 1.000 84.09166  ? 1198 ILE A O   1 
ATOM   844  C  CB  . ILE A 1 122 ? 2.35900   -13.23400 -47.50800 1.000 70.75848  ? 1198 ILE A CB  1 
ATOM   845  C  CG1 . ILE A 1 122 ? 1.53100   -12.17300 -46.77900 1.000 67.15016  ? 1198 ILE A CG1 1 
ATOM   846  C  CG2 . ILE A 1 122 ? 2.11200   -13.21300 -49.00800 1.000 76.45127  ? 1198 ILE A CG2 1 
ATOM   847  C  CD1 . ILE A 1 122 ? 1.69700   -10.77300 -47.32000 1.000 69.42938  ? 1198 ILE A CD1 1 
ATOM   848  N  N   . ASP A 1 123 ? 2.58100   -16.65000 -48.28700 1.000 93.07432  ? 1199 ASP A N   1 
ATOM   849  C  CA  . ASP A 1 123 ? 3.35500   -17.35200 -49.35100 1.000 99.10662  ? 1199 ASP A CA  1 
ATOM   850  C  C   . ASP A 1 123 ? 2.84800   -16.81000 -50.69100 1.000 98.33021  ? 1199 ASP A C   1 
ATOM   851  O  O   . ASP A 1 123 ? 1.72500   -17.16500 -51.11500 1.000 100.73576 ? 1199 ASP A O   1 
ATOM   852  C  CB  . ASP A 1 123 ? 3.28400   -18.88700 -49.31900 1.000 108.09454 ? 1199 ASP A CB  1 
ATOM   853  C  CG  . ASP A 1 123 ? 2.87300   -19.51700 -47.99800 1.000 119.52749 ? 1199 ASP A CG  1 
ATOM   854  O  OD1 . ASP A 1 123 ? 2.92100   -18.81400 -46.96400 1.000 125.08868 ? 1199 ASP A OD1 1 
ATOM   855  O  OD2 . ASP A 1 123 ? 2.51100   -20.71700 -48.01900 1.000 123.10950 ? 1199 ASP A OD2 1 
ATOM   856  N  N   . LEU A 1 124 ? 3.64000   -15.93400 -51.30300 1.000 106.24958 ? 1200 LEU A N   1 
ATOM   857  C  CA  . LEU A 1 124 ? 3.36300   -15.33400 -52.62900 1.000 98.16440  ? 1200 LEU A CA  1 
ATOM   858  C  C   . LEU A 1 124 ? 3.29000   -16.46500 -53.66300 1.000 103.80718 ? 1200 LEU A C   1 
ATOM   859  O  O   . LEU A 1 124 ? 3.85000   -17.55500 -53.39400 1.000 111.40809 ? 1200 LEU A O   1 
ATOM   860  C  CB  . LEU A 1 124 ? 4.47800   -14.32500 -52.92400 1.000 87.41574  ? 1200 LEU A CB  1 
ATOM   861  C  CG  . LEU A 1 124 ? 4.03300   -12.96700 -53.46000 1.000 93.47700  ? 1200 LEU A CG  1 
ATOM   862  C  CD1 . LEU A 1 124 ? 3.01200   -12.30900 -52.54100 1.000 88.35270  ? 1200 LEU A CD1 1 
ATOM   863  C  CD2 . LEU A 1 124 ? 5.23900   -12.05700 -53.65100 1.000 100.56732 ? 1200 LEU A CD2 1 
ATOM   864  N  N   . GLN A 1 125 ? 2.59000   -16.23000 -54.77600 1.000 102.76232 ? 1201 GLN A N   1 
ATOM   865  C  CA  . GLN A 1 125 ? 2.31300   -17.24400 -55.83100 1.000 107.78134 ? 1201 GLN A CA  1 
ATOM   866  C  C   . GLN A 1 125 ? 3.24000   -17.02000 -57.03900 1.000 106.31801 ? 1201 GLN A C   1 
ATOM   867  O  O   . GLN A 1 125 ? 3.03400   -16.03100 -57.77200 1.000 107.25496 ? 1201 GLN A O   1 
ATOM   868  C  CB  . GLN A 1 125 ? 0.82300   -17.21500 -56.19600 1.000 111.40283 ? 1201 GLN A CB  1 
ATOM   869  C  CG  . GLN A 1 125 ? 0.50300   -17.61900 -57.63500 1.000 117.02193 ? 1201 GLN A CG  1 
ATOM   870  C  CD  . GLN A 1 125 ? -0.65100  -18.59400 -57.73500 1.000 124.57546 ? 1201 GLN A CD  1 
ATOM   871  O  OE1 . GLN A 1 125 ? -0.64900  -19.66400 -57.12600 1.000 129.18917 ? 1201 GLN A OE1 1 
ATOM   872  N  NE2 . GLN A 1 125 ? -1.65900  -18.22900 -58.51300 1.000 123.18582 ? 1201 GLN A NE2 1 
ATOM   873  N  N   . GLU A 1 126 ? 4.23200   -17.90900 -57.19900 1.000 111.19754 ? 1202 GLU A N   1 
ATOM   874  C  CA  . GLU A 1 126 ? 4.98600   -18.21400 -58.45300 1.000 118.01678 ? 1202 GLU A CA  1 
ATOM   875  C  C   . GLU A 1 126 ? 6.13800   -19.18000 -58.12600 1.000 129.87610 ? 1202 GLU A C   1 
ATOM   876  O  O   . GLU A 1 126 ? 5.95500   -20.35100 -57.76800 1.000 134.58193 ? 1202 GLU A O   1 
ATOM   877  C  CB  . GLU A 1 126 ? 5.54900   -16.95800 -59.12700 1.000 111.34756 ? 1202 GLU A CB  1 
ATOM   878  C  CG  . GLU A 1 126 ? 4.75300   -16.47800 -60.33900 1.000 105.32579 ? 1202 GLU A CG  1 
ATOM   879  C  CD  . GLU A 1 126 ? 5.53900   -15.66200 -61.36200 1.000 112.38716 ? 1202 GLU A CD  1 
ATOM   880  O  OE1 . GLU A 1 126 ? 5.00900   -14.63600 -61.84700 1.000 111.61338 ? 1202 GLU A OE1 1 
ATOM   881  O  OE2 . GLU A 1 126 ? 6.67700   -16.05800 -61.69100 1.000 115.77441 ? 1202 GLU A OE2 1 
ATOM   882  N  N   . ASN B 1 5   ? -2.19100  -10.37000 -64.38900 1.000 117.37197 ? 914  ASN B N   1 
ATOM   883  C  CA  . ASN B 1 5   ? -2.40000  -11.85800 -64.41300 1.000 116.76137 ? 914  ASN B CA  1 
ATOM   884  C  C   . ASN B 1 5   ? -2.47800  -12.35900 -62.95800 1.000 111.76866 ? 914  ASN B C   1 
ATOM   885  O  O   . ASN B 1 5   ? -3.50600  -12.09200 -62.29000 1.000 105.74163 ? 914  ASN B O   1 
ATOM   886  C  CB  . ASN B 1 5   ? -1.37500  -12.58700 -65.30900 1.000 117.15878 ? 914  ASN B CB  1 
ATOM   887  C  CG  . ASN B 1 5   ? -0.04200  -11.88500 -65.50600 1.000 114.73481 ? 914  ASN B CG  1 
ATOM   888  O  OD1 . ASN B 1 5   ? 0.04500   -10.65900 -65.48000 1.000 114.02157 ? 914  ASN B OD1 1 
ATOM   889  N  ND2 . ASN B 1 5   ? 1.00500   -12.65600 -65.75000 1.000 115.21118 ? 914  ASN B ND2 1 
ATOM   890  N  N   . VAL B 1 6   ? -1.43100  -13.04400 -62.48700 1.000 107.03652 ? 915  VAL B N   1 
ATOM   891  C  CA  . VAL B 1 6   ? -1.30500  -13.59300 -61.10400 1.000 96.30365  ? 915  VAL B CA  1 
ATOM   892  C  C   . VAL B 1 6   ? -1.03100  -12.41700 -60.15800 1.000 102.85181 ? 915  VAL B C   1 
ATOM   893  O  O   . VAL B 1 6   ? -1.50700  -12.46400 -59.01100 1.000 112.17661 ? 915  VAL B O   1 
ATOM   894  C  CB  . VAL B 1 6   ? -0.23500  -14.70900 -61.04500 1.000 98.28284  ? 915  VAL B CB  1 
ATOM   895  C  CG1 . VAL B 1 6   ? 0.90800   -14.43700 -60.07100 1.000 95.54303  ? 915  VAL B CG1 1 
ATOM   896  C  CG2 . VAL B 1 6   ? -0.87200  -16.06100 -60.75900 1.000 107.71291 ? 915  VAL B CG2 1 
ATOM   897  N  N   . LEU B 1 7   ? -0.32900  -11.38900 -60.64700 1.000 103.68612 ? 916  LEU B N   1 
ATOM   898  C  CA  . LEU B 1 7   ? 0.00800   -10.15000 -59.89600 1.000 104.76519 ? 916  LEU B CA  1 
ATOM   899  C  C   . LEU B 1 7   ? -1.22000  -9.63500  -59.13400 1.000 102.84391 ? 916  LEU B C   1 
ATOM   900  O  O   . LEU B 1 7   ? -1.08300  -9.29900  -57.94000 1.000 86.78672  ? 916  LEU B O   1 
ATOM   901  C  CB  . LEU B 1 7   ? 0.52000   -9.10100  -60.88800 1.000 104.41515 ? 916  LEU B CB  1 
ATOM   902  C  CG  . LEU B 1 7   ? 1.98500   -9.25100  -61.28800 1.000 99.87513  ? 916  LEU B CG  1 
ATOM   903  C  CD1 . LEU B 1 7   ? 2.32600   -8.32800  -62.44500 1.000 106.07588 ? 916  LEU B CD1 1 
ATOM   904  C  CD2 . LEU B 1 7   ? 2.89700   -8.97200  -60.10600 1.000 91.06092  ? 916  LEU B CD2 1 
ATOM   905  N  N   . TYR B 1 8   ? -2.37800  -9.57300  -59.79400 1.000 98.95660  ? 917  TYR B N   1 
ATOM   906  C  CA  . TYR B 1 8   ? -3.64200  -9.09700  -59.18100 1.000 100.31466 ? 917  TYR B CA  1 
ATOM   907  C  C   . TYR B 1 8   ? -4.02800  -10.05100 -58.04300 1.000 100.25676 ? 917  TYR B C   1 
ATOM   908  O  O   . TYR B 1 8   ? -4.36700  -9.56500  -56.95000 1.000 105.98639 ? 917  TYR B O   1 
ATOM   909  C  CB  . TYR B 1 8   ? -4.74600  -8.94400  -60.23000 1.000 102.08329 ? 917  TYR B CB  1 
ATOM   910  C  CG  . TYR B 1 8   ? -6.06000  -8.46700  -59.66300 1.000 108.89200 ? 917  TYR B CG  1 
ATOM   911  C  CD1 . TYR B 1 8   ? -6.14800  -7.26000  -58.98300 1.000 109.96845 ? 917  TYR B CD1 1 
ATOM   912  C  CD2 . TYR B 1 8   ? -7.21600  -9.22500  -59.78300 1.000 114.42425 ? 917  TYR B CD2 1 
ATOM   913  C  CE1 . TYR B 1 8   ? -7.34500  -6.81400  -58.44600 1.000 112.80037 ? 917  TYR B CE1 1 
ATOM   914  C  CE2 . TYR B 1 8   ? -8.42300  -8.79300  -59.25100 1.000 116.57450 ? 917  TYR B CE2 1 
ATOM   915  C  CZ  . TYR B 1 8   ? -8.48900  -7.58100  -58.58100 1.000 115.91916 ? 917  TYR B CZ  1 
ATOM   916  O  OH  . TYR B 1 8   ? -9.66300  -7.13300  -58.04600 1.000 117.32986 ? 917  TYR B OH  1 
ATOM   917  N  N   . GLU B 1 9   ? -3.95000  -11.36400 -58.27200 1.000 98.33547  ? 918  GLU B N   1 
ATOM   918  C  CA  . GLU B 1 9   ? -4.30300  -12.38800 -57.25100 1.000 90.66350  ? 918  GLU B CA  1 
ATOM   919  C  C   . GLU B 1 9   ? -3.36900  -12.23900 -56.04100 1.000 87.20519  ? 918  GLU B C   1 
ATOM   920  O  O   . GLU B 1 9   ? -3.86200  -12.32600 -54.90500 1.000 91.38201  ? 918  GLU B O   1 
ATOM   921  C  CB  . GLU B 1 9   ? -4.25900  -13.79300 -57.85400 1.000 93.39804  ? 918  GLU B CB  1 
ATOM   922  C  CG  . GLU B 1 9   ? -5.25600  -14.01300 -58.98100 1.000 106.92861 ? 918  GLU B CG  1 
ATOM   923  C  CD  . GLU B 1 9   ? -6.70100  -14.17800 -58.53700 1.000 116.79032 ? 918  GLU B CD  1 
ATOM   924  O  OE1 . GLU B 1 9   ? -7.22800  -13.25000 -57.88300 1.000 111.30545 ? 918  GLU B OE1 1 
ATOM   925  O  OE2 . GLU B 1 9   ? -7.30100  -15.23700 -58.84800 1.000 124.73074 ? 918  GLU B OE2 1 
ATOM   926  N  N   . ASN B 1 10  ? -2.08000  -11.98500 -56.27400 1.000 81.29396  ? 919  ASN B N   1 
ATOM   927  C  CA  . ASN B 1 10  ? -1.07000  -11.75600 -55.20600 1.000 77.58825  ? 919  ASN B CA  1 
ATOM   928  C  C   . ASN B 1 10  ? -1.45200  -10.52100 -54.39300 1.000 80.84654  ? 919  ASN B C   1 
ATOM   929  O  O   . ASN B 1 10  ? -1.36700  -10.59900 -53.15800 1.000 83.90743  ? 919  ASN B O   1 
ATOM   930  C  CB  . ASN B 1 10  ? 0.34200   -11.62200 -55.77400 1.000 87.31310  ? 919  ASN B CB  1 
ATOM   931  C  CG  . ASN B 1 10  ? 0.95500   -12.97000 -56.08200 1.000 93.62438  ? 919  ASN B CG  1 
ATOM   932  O  OD1 . ASN B 1 10  ? 0.54900   -13.97700 -55.50800 1.000 95.35354  ? 919  ASN B OD1 1 
ATOM   933  N  ND2 . ASN B 1 10  ? 1.93300   -12.99900 -56.97300 1.000 95.24037  ? 919  ASN B ND2 1 
ATOM   934  N  N   . GLN B 1 11  ? -1.85400  -9.43300  -55.05900 1.000 84.24694  ? 920  GLN B N   1 
ATOM   935  C  CA  . GLN B 1 11  ? -2.27200  -8.16500  -54.39400 1.000 85.25233  ? 920  GLN B CA  1 
ATOM   936  C  C   . GLN B 1 11  ? -3.50500  -8.41800  -53.51600 1.000 79.69113  ? 920  GLN B C   1 
ATOM   937  O  O   . GLN B 1 11  ? -3.53300  -7.85900  -52.40900 1.000 78.86209  ? 920  GLN B O   1 
ATOM   938  C  CB  . GLN B 1 11  ? -2.57400  -7.05300  -55.40200 1.000 78.96736  ? 920  GLN B CB  1 
ATOM   939  C  CG  . GLN B 1 11  ? -1.33300  -6.44400  -56.03700 1.000 83.61529  ? 920  GLN B CG  1 
ATOM   940  C  CD  . GLN B 1 11  ? -1.53400  -4.99700  -56.41700 1.000 92.58478  ? 920  GLN B CD  1 
ATOM   941  O  OE1 . GLN B 1 11  ? -2.56600  -4.60400  -56.95800 1.000 87.97107  ? 920  GLN B OE1 1 
ATOM   942  N  NE2 . GLN B 1 11  ? -0.53300  -4.18700  -56.13100 1.000 101.81747 ? 920  GLN B NE2 1 
ATOM   943  N  N   . LYS B 1 12  ? -4.48700  -9.19600  -54.00000 1.000 71.48752  ? 921  LYS B N   1 
ATOM   944  C  CA  . LYS B 1 12  ? -5.71000  -9.57200  -53.23200 1.000 78.91999  ? 921  LYS B CA  1 
ATOM   945  C  C   . LYS B 1 12  ? -5.27500  -10.32600 -51.97300 1.000 82.64149  ? 921  LYS B C   1 
ATOM   946  O  O   . LYS B 1 12  ? -5.83600  -10.03100 -50.89300 1.000 73.21931  ? 921  LYS B O   1 
ATOM   947  C  CB  . LYS B 1 12  ? -6.66900  -10.48400 -54.01000 1.000 73.29037  ? 921  LYS B CB  1 
ATOM   948  C  CG  . LYS B 1 12  ? -7.38600  -9.89200  -55.21900 1.000 75.71434  ? 921  LYS B CG  1 
ATOM   949  C  CD  . LYS B 1 12  ? -8.04700  -8.55100  -55.00200 1.000 91.86628  ? 921  LYS B CD  1 
ATOM   950  C  CE  . LYS B 1 12  ? -9.28500  -8.61000  -54.13400 1.000 107.19180 ? 921  LYS B CE  1 
ATOM   951  N  NZ  . LYS B 1 12  ? -10.00800 -7.31300  -54.13900 1.000 114.67164 ? 921  LYS B NZ  1 
ATOM   952  N  N   . LEU B 1 13  ? -4.32300  -11.26200 -52.12300 1.000 80.19909  ? 922  LEU B N   1 
ATOM   953  C  CA  . LEU B 1 13  ? -3.78200  -12.12000 -51.02900 1.000 77.06187  ? 922  LEU B CA  1 
ATOM   954  C  C   . LEU B 1 13  ? -3.14600  -11.23600 -49.94900 1.000 70.08472  ? 922  LEU B C   1 
ATOM   955  O  O   . LEU B 1 13  ? -3.60700  -11.29300 -48.80400 1.000 70.62952  ? 922  LEU B O   1 
ATOM   956  C  CB  . LEU B 1 13  ? -2.76100  -13.10500 -51.60600 1.000 77.42770  ? 922  LEU B CB  1 
ATOM   957  C  CG  . LEU B 1 13  ? -2.10800  -14.04300 -50.59400 1.000 72.62187  ? 922  LEU B CG  1 
ATOM   958  C  CD1 . LEU B 1 13  ? -3.13700  -14.98900 -49.99000 1.000 73.26142  ? 922  LEU B CD1 1 
ATOM   959  C  CD2 . LEU B 1 13  ? -0.97700  -14.82400 -51.23600 1.000 67.34755  ? 922  LEU B CD2 1 
ATOM   960  N  N   . ILE B 1 14  ? -2.14400  -10.43300 -50.31700 1.000 67.52915  ? 923  ILE B N   1 
ATOM   961  C  CA  . ILE B 1 14  ? -1.44500  -9.45800  -49.41800 1.000 69.42675  ? 923  ILE B CA  1 
ATOM   962  C  C   . ILE B 1 14  ? -2.48300  -8.63600  -48.62000 1.000 73.15351  ? 923  ILE B C   1 
ATOM   963  O  O   . ILE B 1 14  ? -2.41600  -8.59700  -47.37000 1.000 57.26476  ? 923  ILE B O   1 
ATOM   964  C  CB  . ILE B 1 14  ? -0.49800  -8.56000  -50.24600 1.000 68.01868  ? 923  ILE B CB  1 
ATOM   965  C  CG1 . ILE B 1 14  ? 0.69600   -9.35000  -50.79400 1.000 71.88493  ? 923  ILE B CG1 1 
ATOM   966  C  CG2 . ILE B 1 14  ? -0.04900  -7.35500  -49.43800 1.000 54.25914  ? 923  ILE B CG2 1 
ATOM   967  C  CD1 . ILE B 1 14  ? 1.44300   -8.66400  -51.92000 1.000 69.43990  ? 923  ILE B CD1 1 
ATOM   968  N  N   . ALA B 1 15  ? -3.42300  -8.00000  -49.31200 1.000 56.21990  ? 924  ALA B N   1 
ATOM   969  C  CA  . ALA B 1 15  ? -4.44900  -7.12600  -48.71000 1.000 57.04368  ? 924  ALA B CA  1 
ATOM   970  C  C   . ALA B 1 15  ? -5.25300  -7.91400  -47.67900 1.000 60.09668  ? 924  ALA B C   1 
ATOM   971  O  O   . ALA B 1 15  ? -5.44700  -7.38700  -46.56500 1.000 64.24981  ? 924  ALA B O   1 
ATOM   972  C  CB  . ALA B 1 15  ? -5.35200  -6.57500  -49.78100 1.000 59.56240  ? 924  ALA B CB  1 
ATOM   973  N  N   . ASN B 1 16  ? -5.71900  -9.11200  -48.05400 1.000 61.01258  ? 925  ASN B N   1 
ATOM   974  C  CA  . ASN B 1 16  ? -6.59100  -9.95700  -47.19700 1.000 68.22923  ? 925  ASN B CA  1 
ATOM   975  C  C   . ASN B 1 16  ? -5.79900  -10.34700 -45.95300 1.000 63.91819  ? 925  ASN B C   1 
ATOM   976  O  O   . ASN B 1 16  ? -6.31300  -10.09400 -44.84900 1.000 64.44194  ? 925  ASN B O   1 
ATOM   977  C  CB  . ASN B 1 16  ? -7.14300  -11.18200 -47.93200 1.000 71.59543  ? 925  ASN B CB  1 
ATOM   978  C  CG  . ASN B 1 16  ? -8.25700  -10.84700 -48.90300 1.000 80.98866  ? 925  ASN B CG  1 
ATOM   979  O  OD1 . ASN B 1 16  ? -8.87700  -9.78600  -48.81300 1.000 83.88374  ? 925  ASN B OD1 1 
ATOM   980  N  ND2 . ASN B 1 16  ? -8.52300  -11.75000 -49.83700 1.000 83.26788  ? 925  ASN B ND2 1 
ATOM   981  N  N   . GLN B 1 17  ? -4.59000  -10.88600 -46.14800 1.000 59.40712  ? 926  GLN B N   1 
ATOM   982  C  CA  . GLN B 1 17  ? -3.65600  -11.28200 -45.06000 1.000 63.54183  ? 926  GLN B CA  1 
ATOM   983  C  C   . GLN B 1 17  ? -3.43300  -10.07300 -44.14400 1.000 63.41023  ? 926  GLN B C   1 
ATOM   984  O  O   . GLN B 1 17  ? -3.63100  -10.22100 -42.91500 1.000 50.66397  ? 926  GLN B O   1 
ATOM   985  C  CB  . GLN B 1 17  ? -2.32300  -11.79400 -45.62300 1.000 60.44409  ? 926  GLN B CB  1 
ATOM   986  C  CG  . GLN B 1 17  ? -2.41000  -13.07900 -46.44200 1.000 59.21236  ? 926  GLN B CG  1 
ATOM   987  C  CD  . GLN B 1 17  ? -3.15600  -14.16900 -45.71900 1.000 60.93362  ? 926  GLN B CD  1 
ATOM   988  O  OE1 . GLN B 1 17  ? -4.37700  -14.26000 -45.80800 1.000 61.30735  ? 926  GLN B OE1 1 
ATOM   989  N  NE2 . GLN B 1 17  ? -2.42500  -14.99300 -44.98500 1.000 60.93625  ? 926  GLN B NE2 1 
ATOM   990  N  N   . PHE B 1 18  ? -3.05200  -8.92800  -44.72200 1.000 59.97824  ? 927  PHE B N   1 
ATOM   991  C  CA  . PHE B 1 18  ? -2.75700  -7.67400  -43.98500 1.000 51.34563  ? 927  PHE B CA  1 
ATOM   992  C  C   . PHE B 1 18  ? -3.97800  -7.23600  -43.16500 1.000 58.24909  ? 927  PHE B C   1 
ATOM   993  O  O   . PHE B 1 18  ? -3.78200  -6.78300  -42.02400 1.000 61.34157  ? 927  PHE B O   1 
ATOM   994  C  CB  . PHE B 1 18  ? -2.34800  -6.55900  -44.94400 1.000 50.87978  ? 927  PHE B CB  1 
ATOM   995  C  CG  . PHE B 1 18  ? -2.08900  -5.24600  -44.25600 1.000 54.79868  ? 927  PHE B CG  1 
ATOM   996  C  CD1 . PHE B 1 18  ? -1.04100  -5.12400  -43.36200 1.000 48.29000  ? 927  PHE B CD1 1 
ATOM   997  C  CD2 . PHE B 1 18  ? -2.90200  -4.14700  -44.47500 1.000 55.75932  ? 927  PHE B CD2 1 
ATOM   998  C  CE1 . PHE B 1 18  ? -0.80000  -3.92800  -42.70800 1.000 57.03315  ? 927  PHE B CE1 1 
ATOM   999  C  CE2 . PHE B 1 18  ? -2.65300  -2.94400  -43.83200 1.000 61.59686  ? 927  PHE B CE2 1 
ATOM   1000 C  CZ  . PHE B 1 18  ? -1.60000  -2.83700  -42.95200 1.000 63.43392  ? 927  PHE B CZ  1 
ATOM   1001 N  N   . ASN B 1 19  ? -5.18800  -7.33200  -43.73000 1.000 54.75130  ? 928  ASN B N   1 
ATOM   1002 C  CA  . ASN B 1 19  ? -6.43800  -6.88600  -43.05700 1.000 50.58238  ? 928  ASN B CA  1 
ATOM   1003 C  C   . ASN B 1 19  ? -6.75800  -7.86700  -41.93100 1.000 51.56671  ? 928  ASN B C   1 
ATOM   1004 O  O   . ASN B 1 19  ? -7.25400  -7.42300  -40.88700 1.000 53.14058  ? 928  ASN B O   1 
ATOM   1005 C  CB  . ASN B 1 19  ? -7.61000  -6.73900  -44.02500 1.000 53.64854  ? 928  ASN B CB  1 
ATOM   1006 C  CG  . ASN B 1 19  ? -7.43400  -5.57000  -44.96600 1.000 69.23199  ? 928  ASN B CG  1 
ATOM   1007 O  OD1 . ASN B 1 19  ? -6.73400  -4.60500  -44.64500 1.000 63.46814  ? 928  ASN B OD1 1 
ATOM   1008 N  ND2 . ASN B 1 19  ? -8.05500  -5.66000  -46.13200 1.000 62.15482  ? 928  ASN B ND2 1 
ATOM   1009 N  N   . SER B 1 20  ? -6.48200  -9.15100  -42.15200 1.000 53.33534  ? 929  SER B N   1 
ATOM   1010 C  CA  . SER B 1 20  ? -6.59400  -10.23200 -41.13900 1.000 51.64567  ? 929  SER B CA  1 
ATOM   1011 C  C   . SER B 1 20  ? -5.65000  -9.91500  -39.97000 1.000 48.38475  ? 929  SER B C   1 
ATOM   1012 O  O   . SER B 1 20  ? -6.12400  -9.80400  -38.82500 1.000 59.07287  ? 929  SER B O   1 
ATOM   1013 C  CB  . SER B 1 20  ? -6.31500  -11.57500 -41.77600 1.000 64.35772  ? 929  SER B CB  1 
ATOM   1014 O  OG  . SER B 1 20  ? -6.13000  -12.59400 -40.80600 1.000 77.80670  ? 929  SER B OG  1 
ATOM   1015 N  N   . ALA B 1 21  ? -4.36500  -9.71700  -40.25600 1.000 56.49098  ? 930  ALA B N   1 
ATOM   1016 C  CA  . ALA B 1 21  ? -3.32400  -9.38600  -39.25400 1.000 55.63825  ? 930  ALA B CA  1 
ATOM   1017 C  C   . ALA B 1 21  ? -3.78400  -8.23300  -38.36600 1.000 56.08830  ? 930  ALA B C   1 
ATOM   1018 O  O   . ALA B 1 21  ? -3.73200  -8.36500  -37.13600 1.000 56.40676  ? 930  ALA B O   1 
ATOM   1019 C  CB  . ALA B 1 21  ? -2.02800  -9.03000  -39.93100 1.000 47.27672  ? 930  ALA B CB  1 
ATOM   1020 N  N   . ILE B 1 22  ? -4.19700  -7.12900  -38.97800 1.000 49.28222  ? 931  ILE B N   1 
ATOM   1021 C  CA  . ILE B 1 22  ? -4.55400  -5.88600  -38.24200 1.000 50.27971  ? 931  ILE B CA  1 
ATOM   1022 C  C   . ILE B 1 22  ? -5.73500  -6.19100  -37.32200 1.000 56.28306  ? 931  ILE B C   1 
ATOM   1023 O  O   . ILE B 1 22  ? -5.69100  -5.78200  -36.16400 1.000 58.25172  ? 931  ILE B O   1 
ATOM   1024 C  CB  . ILE B 1 22  ? -4.84700  -4.73600  -39.21500 1.000 53.73013  ? 931  ILE B CB  1 
ATOM   1025 C  CG1 . ILE B 1 22  ? -3.55300  -4.27400  -39.88700 1.000 46.44767  ? 931  ILE B CG1 1 
ATOM   1026 C  CG2 . ILE B 1 22  ? -5.57800  -3.59900  -38.50400 1.000 52.17468  ? 931  ILE B CG2 1 
ATOM   1027 C  CD1 . ILE B 1 22  ? -3.74900  -3.13900  -40.86200 1.000 68.43189  ? 931  ILE B CD1 1 
ATOM   1028 N  N   . GLY B 1 23  ? -6.74800  -6.88500  -37.82800 1.000 52.25627  ? 932  GLY B N   1 
ATOM   1029 C  CA  . GLY B 1 23  ? -7.94900  -7.26300  -37.05800 1.000 50.96401  ? 932  GLY B CA  1 
ATOM   1030 C  C   . GLY B 1 23  ? -7.57400  -7.97200  -35.77400 1.000 58.43332  ? 932  GLY B C   1 
ATOM   1031 O  O   . GLY B 1 23  ? -8.15900  -7.65700  -34.72600 1.000 57.22002  ? 932  GLY B O   1 
ATOM   1032 N  N   . LYS B 1 24  ? -6.62100  -8.90300  -35.86300 1.000 61.78899  ? 933  LYS B N   1 
ATOM   1033 C  CA  . LYS B 1 24  ? -6.11800  -9.71900  -34.72900 1.000 46.22133  ? 933  LYS B CA  1 
ATOM   1034 C  C   . LYS B 1 24  ? -5.30300  -8.82700  -33.78600 1.000 49.47698  ? 933  LYS B C   1 
ATOM   1035 O  O   . LYS B 1 24  ? -5.43600  -8.98400  -32.55400 1.000 51.40880  ? 933  LYS B O   1 
ATOM   1036 C  CB  . LYS B 1 24  ? -5.27300  -10.87700 -35.26400 1.000 42.96041  ? 933  LYS B CB  1 
ATOM   1037 C  CG  . LYS B 1 24  ? -6.03500  -11.86900 -36.12900 1.000 46.17133  ? 933  LYS B CG  1 
ATOM   1038 C  CD  . LYS B 1 24  ? -5.24300  -13.08400 -36.53400 1.000 44.40006  ? 933  LYS B CD  1 
ATOM   1039 C  CE  . LYS B 1 24  ? -5.97900  -13.87900 -37.58700 1.000 56.55152  ? 933  LYS B CE  1 
ATOM   1040 N  NZ  . LYS B 1 24  ? -5.20900  -15.06700 -38.02200 1.000 74.01677  ? 933  LYS B NZ  1 
ATOM   1041 N  N   . ILE B 1 25  ? -4.48000  -7.93300  -34.33600 1.000 41.38917  ? 934  ILE B N   1 
ATOM   1042 C  CA  . ILE B 1 25  ? -3.68800  -6.95200  -33.53600 1.000 47.50043  ? 934  ILE B CA  1 
ATOM   1043 C  C   . ILE B 1 25  ? -4.64500  -6.01200  -32.79600 1.000 49.52962  ? 934  ILE B C   1 
ATOM   1044 O  O   . ILE B 1 25  ? -4.37600  -5.69400  -31.63400 1.000 41.43392  ? 934  ILE B O   1 
ATOM   1045 C  CB  . ILE B 1 25  ? -2.69500  -6.17900  -34.41800 1.000 38.31249  ? 934  ILE B CB  1 
ATOM   1046 C  CG1 . ILE B 1 25  ? -1.58300  -7.09700  -34.93400 1.000 44.84485  ? 934  ILE B CG1 1 
ATOM   1047 C  CG2 . ILE B 1 25  ? -2.13400  -5.00000  -33.64600 1.000 38.38881  ? 934  ILE B CG2 1 
ATOM   1048 C  CD1 . ILE B 1 25  ? -0.88100  -6.59900  -36.17600 1.000 37.79664  ? 934  ILE B CD1 1 
ATOM   1049 N  N   . GLN B 1 26  ? -5.72200  -5.57700  -33.44900 1.000 44.57377  ? 935  GLN B N   1 
ATOM   1050 C  CA  . GLN B 1 26  ? -6.74700  -4.71000  -32.81700 1.000 48.35843  ? 935  GLN B CA  1 
ATOM   1051 C  C   . GLN B 1 26  ? -7.25400  -5.41400  -31.55400 1.000 54.22229  ? 935  GLN B C   1 
ATOM   1052 O  O   . GLN B 1 26  ? -7.23400  -4.78700  -30.47700 1.000 60.73360  ? 935  GLN B O   1 
ATOM   1053 C  CB  . GLN B 1 26  ? -7.90500  -4.42700  -33.77600 1.000 50.43499  ? 935  GLN B CB  1 
ATOM   1054 C  CG  . GLN B 1 26  ? -7.56600  -3.49900  -34.93000 1.000 47.77152  ? 935  GLN B CG  1 
ATOM   1055 C  CD  . GLN B 1 26  ? -8.77400  -3.34700  -35.81900 1.000 58.47280  ? 935  GLN B CD  1 
ATOM   1056 O  OE1 . GLN B 1 26  ? -9.21000  -4.29500  -36.46500 1.000 62.44696  ? 935  GLN B OE1 1 
ATOM   1057 N  NE2 . GLN B 1 26  ? -9.34400  -2.15300  -35.83900 1.000 68.27661  ? 935  GLN B NE2 1 
ATOM   1058 N  N   . ASP B 1 27  ? -7.69100  -6.66800  -31.70200 1.000 46.52400  ? 936  ASP B N   1 
ATOM   1059 C  CA  . ASP B 1 27  ? -8.22700  -7.51500  -30.60300 1.000 47.21092  ? 936  ASP B CA  1 
ATOM   1060 C  C   . ASP B 1 27  ? -7.15900  -7.63300  -29.51600 1.000 48.26105  ? 936  ASP B C   1 
ATOM   1061 O  O   . ASP B 1 27  ? -7.51700  -7.47200  -28.34500 1.000 57.33056  ? 936  ASP B O   1 
ATOM   1062 C  CB  . ASP B 1 27  ? -8.68600  -8.89400  -31.10000 1.000 51.12718  ? 936  ASP B CB  1 
ATOM   1063 C  CG  . ASP B 1 27  ? -10.11600 -8.93300  -31.62900 1.000 73.15351  ? 936  ASP B CG  1 
ATOM   1064 O  OD1 . ASP B 1 27  ? -10.68100 -7.84900  -31.90600 1.000 91.21357  ? 936  ASP B OD1 1 
ATOM   1065 O  OD2 . ASP B 1 27  ? -10.66500 -10.04600 -31.76800 1.000 73.50355  ? 936  ASP B OD2 1 
ATOM   1066 N  N   . SER B 1 28  ? -5.89900  -7.88100  -29.89100 1.000 52.03255  ? 937  SER B N   1 
ATOM   1067 C  CA  . SER B 1 28  ? -4.76200  -8.02900  -28.94300 1.000 52.36417  ? 937  SER B CA  1 
ATOM   1068 C  C   . SER B 1 28  ? -4.56400  -6.72800  -28.15900 1.000 52.60368  ? 937  SER B C   1 
ATOM   1069 O  O   . SER B 1 28  ? -4.39500  -6.83400  -26.93100 1.000 40.16271  ? 937  SER B O   1 
ATOM   1070 C  CB  . SER B 1 28  ? -3.50100  -8.43700  -29.63200 1.000 48.96377  ? 937  SER B CB  1 
ATOM   1071 O  OG  . SER B 1 28  ? -2.74200  -7.29600  -30.00800 1.000 51.48775  ? 937  SER B OG  1 
ATOM   1072 N  N   . LEU B 1 29  ? -4.58800  -5.56300  -28.83400 1.000 52.36154  ? 938  LEU B N   1 
ATOM   1073 C  CA  . LEU B 1 29  ? -4.39500  -4.23400  -28.18400 1.000 44.81327  ? 938  LEU B CA  1 
ATOM   1074 C  C   . LEU B 1 29  ? -5.50800  -4.03700  -27.14600 1.000 57.42531  ? 938  LEU B C   1 
ATOM   1075 O  O   . LEU B 1 29  ? -5.19600  -3.68500  -25.98600 1.000 56.48309  ? 938  LEU B O   1 
ATOM   1076 C  CB  . LEU B 1 29  ? -4.36900  -3.10300  -29.21800 1.000 44.34742  ? 938  LEU B CB  1 
ATOM   1077 C  CG  . LEU B 1 29  ? -3.10400  -3.00300  -30.07100 1.000 47.20566  ? 938  LEU B CG  1 
ATOM   1078 C  CD1 . LEU B 1 29  ? -3.18800  -1.84000  -31.04000 1.000 44.92907  ? 938  LEU B CD1 1 
ATOM   1079 C  CD2 . LEU B 1 29  ? -1.85600  -2.84900  -29.23300 1.000 48.13735  ? 938  LEU B CD2 1 
ATOM   1080 N  N   . SER B 1 30  ? -6.75700  -4.29600  -27.52500 1.000 50.80872  ? 939  SER B N   1 
ATOM   1081 C  CA  . SER B 1 30  ? -7.94100  -4.05100  -26.66700 1.000 51.70357  ? 939  SER B CA  1 
ATOM   1082 C  C   . SER B 1 30  ? -7.86500  -4.94500  -25.42600 1.000 57.71481  ? 939  SER B C   1 
ATOM   1083 O  O   . SER B 1 30  ? -8.29400  -4.50700  -24.35400 1.000 58.93338  ? 939  SER B O   1 
ATOM   1084 C  CB  . SER B 1 30  ? -9.22100  -4.25700  -27.43100 1.000 56.33307  ? 939  SER B CB  1 
ATOM   1085 O  OG  . SER B 1 30  ? -9.80900  -5.50700  -27.09500 1.000 78.89367  ? 939  SER B OG  1 
ATOM   1086 N  N   . SER B 1 31  ? -7.34200  -6.16200  -25.57600 1.000 58.81231  ? 940  SER B N   1 
ATOM   1087 C  CA  . SER B 1 31  ? -7.11900  -7.12500  -24.46400 1.000 51.71936  ? 940  SER B CA  1 
ATOM   1088 C  C   . SER B 1 31  ? -5.98200  -6.62700  -23.56400 1.000 43.93948  ? 940  SER B C   1 
ATOM   1089 O  O   . SER B 1 31  ? -6.10700  -6.74400  -22.34700 1.000 45.63442  ? 940  SER B O   1 
ATOM   1090 C  CB  . SER B 1 31  ? -6.86600  -8.51500  -24.98500 1.000 38.96520  ? 940  SER B CB  1 
ATOM   1091 O  OG  . SER B 1 31  ? -8.05800  -9.03600  -25.54500 1.000 49.66648  ? 940  SER B OG  1 
ATOM   1092 N  N   . THR B 1 32  ? -4.91500  -6.07900  -24.14300 1.000 54.00648  ? 941  THR B N   1 
ATOM   1093 C  CA  . THR B 1 32  ? -3.79000  -5.47200  -23.38300 1.000 51.34037  ? 941  THR B CA  1 
ATOM   1094 C  C   . THR B 1 32  ? -4.34300  -4.32500  -22.53000 1.000 46.02920  ? 941  THR B C   1 
ATOM   1095 O  O   . THR B 1 32  ? -4.08800  -4.30400  -21.31400 1.000 52.24574  ? 941  THR B O   1 
ATOM   1096 C  CB  . THR B 1 32  ? -2.65500  -4.99700  -24.30000 1.000 50.04811  ? 941  THR B CB  1 
ATOM   1097 O  OG1 . THR B 1 32  ? -2.22700  -6.06300  -25.14700 1.000 42.63932  ? 941  THR B OG1 1 
ATOM   1098 C  CG2 . THR B 1 32  ? -1.46300  -4.49700  -23.51800 1.000 35.53584  ? 941  THR B CG2 1 
ATOM   1099 N  N   . ALA B 1 33  ? -5.10300  -3.42500  -23.14500 1.000 44.73168  ? 942  ALA B N   1 
ATOM   1100 C  CA  . ALA B 1 33  ? -5.76000  -2.28000  -22.46600 1.000 50.37183  ? 942  ALA B CA  1 
ATOM   1101 C  C   . ALA B 1 33  ? -6.56200  -2.78400  -21.26700 1.000 53.50378  ? 942  ALA B C   1 
ATOM   1102 O  O   . ALA B 1 33  ? -6.39800  -2.22600  -20.16500 1.000 49.04535  ? 942  ALA B O   1 
ATOM   1103 C  CB  . ALA B 1 33  ? -6.64900  -1.52300  -23.42800 1.000 54.53285  ? 942  ALA B CB  1 
ATOM   1104 N  N   . SER B 1 34  ? -7.39000  -3.80700  -21.49100 1.000 56.02514  ? 943  SER B N   1 
ATOM   1105 C  CA  . SER B 1 34  ? -8.28400  -4.43700  -20.48200 1.000 54.76183  ? 943  SER B CA  1 
ATOM   1106 C  C   . SER B 1 34  ? -7.42900  -4.93200  -19.30900 1.000 49.13484  ? 943  SER B C   1 
ATOM   1107 O  O   . SER B 1 34  ? -7.72700  -4.59700  -18.15300 1.000 51.46407  ? 943  SER B O   1 
ATOM   1108 C  CB  . SER B 1 34  ? -9.10300  -5.53900  -21.13600 1.000 50.59291  ? 943  SER B CB  1 
ATOM   1109 O  OG  . SER B 1 34  ? -9.88000  -6.26900  -20.19600 1.000 55.04607  ? 943  SER B OG  1 
ATOM   1110 N  N   . ALA B 1 35  ? -6.35600  -5.65700  -19.61200 1.000 58.87022  ? 944  ALA B N   1 
ATOM   1111 C  CA  . ALA B 1 35  ? -5.47500  -6.29700  -18.61200 1.000 51.48775  ? 944  ALA B CA  1 
ATOM   1112 C  C   . ALA B 1 35  ? -4.77800  -5.21900  -17.78200 1.000 49.68754  ? 944  ALA B C   1 
ATOM   1113 O  O   . ALA B 1 35  ? -4.70100  -5.38600  -16.55800 1.000 50.34288  ? 944  ALA B O   1 
ATOM   1114 C  CB  . ALA B 1 35  ? -4.48600  -7.19600  -19.30700 1.000 55.50666  ? 944  ALA B CB  1 
ATOM   1115 N  N   . LEU B 1 36  ? -4.30500  -4.14900  -18.42900 1.000 52.24311  ? 945  LEU B N   1 
ATOM   1116 C  CA  . LEU B 1 36  ? -3.61400  -3.02000  -17.74600 1.000 55.31979  ? 945  LEU B CA  1 
ATOM   1117 C  C   . LEU B 1 36  ? -4.61800  -2.23400  -16.89000 1.000 61.31525  ? 945  LEU B C   1 
ATOM   1118 O  O   . LEU B 1 36  ? -4.23200  -1.80300  -15.78800 1.000 59.07024  ? 945  LEU B O   1 
ATOM   1119 C  CB  . LEU B 1 36  ? -2.92700  -2.13900  -18.79100 1.000 48.02944  ? 945  LEU B CB  1 
ATOM   1120 C  CG  . LEU B 1 36  ? -1.74000  -2.79200  -19.49500 1.000 42.12347  ? 945  LEU B CG  1 
ATOM   1121 C  CD1 . LEU B 1 36  ? -1.30000  -1.97400  -20.68900 1.000 40.74699  ? 945  LEU B CD1 1 
ATOM   1122 C  CD2 . LEU B 1 36  ? -0.57300  -2.99500  -18.53700 1.000 43.21044  ? 945  LEU B CD2 1 
ATOM   1123 N  N   . GLY B 1 37  ? -5.86300  -2.08100  -17.34500 1.000 54.95133  ? 946  GLY B N   1 
ATOM   1124 C  CA  . GLY B 1 37  ? -6.93600  -1.46500  -16.53800 1.000 63.54709  ? 946  GLY B CA  1 
ATOM   1125 C  C   . GLY B 1 37  ? -7.21800  -2.24200  -15.25600 1.000 62.78648  ? 946  GLY B C   1 
ATOM   1126 O  O   . GLY B 1 37  ? -7.33900  -1.61700  -14.18000 1.000 50.82715  ? 946  GLY B O   1 
ATOM   1127 N  N   . LYS B 1 38  ? -7.33600  -3.56800  -15.35200 1.000 61.46790  ? 947  LYS B N   1 
ATOM   1128 C  CA  . LYS B 1 38  ? -7.71000  -4.42100  -14.19200 1.000 58.02275  ? 947  LYS B CA  1 
ATOM   1129 C  C   . LYS B 1 38  ? -6.55500  -4.43200  -13.19300 1.000 57.20686  ? 947  LYS B C   1 
ATOM   1130 O  O   . LYS B 1 38  ? -6.84300  -4.34700  -11.99700 1.000 68.86615  ? 947  LYS B O   1 
ATOM   1131 C  CB  . LYS B 1 38  ? -8.11100  -5.82600  -14.64100 1.000 41.01018  ? 947  LYS B CB  1 
ATOM   1132 C  CG  . LYS B 1 38  ? -9.41900  -5.88000  -15.42200 1.000 43.78683  ? 947  LYS B CG  1 
ATOM   1133 C  CD  . LYS B 1 38  ? -9.79500  -7.26300  -15.92800 1.000 43.90790  ? 947  LYS B CD  1 
ATOM   1134 C  CE  . LYS B 1 38  ? -11.14000 -7.28700  -16.63100 1.000 48.90060  ? 947  LYS B CE  1 
ATOM   1135 N  NZ  . LYS B 1 38  ? -11.46100 -8.62400  -17.18500 1.000 47.37936  ? 947  LYS B NZ  1 
ATOM   1136 N  N   . LEU B 1 39  ? -5.30800  -4.49100  -13.67300 1.000 56.36728  ? 948  LEU B N   1 
ATOM   1137 C  CA  . LEU B 1 39  ? -4.08700  -4.31100  -12.83600 1.000 54.45653  ? 948  LEU B CA  1 
ATOM   1138 C  C   . LEU B 1 39  ? -4.10700  -2.92800  -12.16500 1.000 64.97095  ? 948  LEU B C   1 
ATOM   1139 O  O   . LEU B 1 39  ? -3.90400  -2.89000  -10.93200 1.000 69.91101  ? 948  LEU B O   1 
ATOM   1140 C  CB  . LEU B 1 39  ? -2.83100  -4.48100  -13.69000 1.000 43.12886  ? 948  LEU B CB  1 
ATOM   1141 C  CG  . LEU B 1 39  ? -2.49600  -5.91600  -14.06700 1.000 41.69974  ? 948  LEU B CG  1 
ATOM   1142 C  CD1 . LEU B 1 39  ? -1.28900  -5.94700  -14.97600 1.000 35.74113  ? 948  LEU B CD1 1 
ATOM   1143 C  CD2 . LEU B 1 39  ? -2.23500  -6.75800  -12.83600 1.000 50.28234  ? 948  LEU B CD2 1 
ATOM   1144 N  N   . GLN B 1 40  ? -4.34700  -1.84100  -12.91700 1.000 63.56025  ? 949  GLN B N   1 
ATOM   1145 C  CA  . GLN B 1 40  ? -4.35600  -0.46000  -12.35300 1.000 61.66529  ? 949  GLN B CA  1 
ATOM   1146 C  C   . GLN B 1 40  ? -5.35500  -0.39400  -11.19200 1.000 61.35472  ? 949  GLN B C   1 
ATOM   1147 O  O   . GLN B 1 40  ? -4.96700  0.08900   -10.11300 1.000 58.90180  ? 949  GLN B O   1 
ATOM   1148 C  CB  . GLN B 1 40  ? -4.70600  0.61300   -13.38700 1.000 66.24742  ? 949  GLN B CB  1 
ATOM   1149 C  CG  . GLN B 1 40  ? -4.76700  2.02200   -12.79000 1.000 58.04907  ? 949  GLN B CG  1 
ATOM   1150 C  CD  . GLN B 1 40  ? -4.87600  3.15300   -13.78700 1.000 68.63718  ? 949  GLN B CD  1 
ATOM   1151 O  OE1 . GLN B 1 40  ? -5.56400  3.06200   -14.79800 1.000 72.44026  ? 949  GLN B OE1 1 
ATOM   1152 N  NE2 . GLN B 1 40  ? -4.22700  4.26400   -13.48600 1.000 72.75609  ? 949  GLN B NE2 1 
ATOM   1153 N  N   . ASP B 1 41  ? -6.58600  -0.86800  -11.40500 1.000 62.99966  ? 950  ASP B N   1 
ATOM   1154 C  CA  . ASP B 1 41  ? -7.67700  -0.81400  -10.39400 1.000 63.82607  ? 950  ASP B CA  1 
ATOM   1155 C  C   . ASP B 1 41  ? -7.22900  -1.58300  -9.14600  1.000 62.50223  ? 950  ASP B C   1 
ATOM   1156 O  O   . ASP B 1 41  ? -7.23200  -0.99700  -8.04500  1.000 73.56672  ? 950  ASP B O   1 
ATOM   1157 C  CB  . ASP B 1 41  ? -9.00100  -1.33000  -10.96300 1.000 67.73970  ? 950  ASP B CB  1 
ATOM   1158 C  CG  . ASP B 1 41  ? -9.63000  -0.42100  -12.01300 1.000 83.56265  ? 950  ASP B CG  1 
ATOM   1159 O  OD1 . ASP B 1 41  ? -9.07500  0.68800   -12.29000 1.000 74.41682  ? 950  ASP B OD1 1 
ATOM   1160 O  OD2 . ASP B 1 41  ? -10.67600 -0.82700  -12.55900 1.000 94.80874  ? 950  ASP B OD2 1 
ATOM   1161 N  N   . VAL B 1 42  ? -6.80400  -2.83400  -9.30500  1.000 59.07287  ? 951  VAL B N   1 
ATOM   1162 C  CA  . VAL B 1 42  ? -6.50000  -3.71900  -8.14700  1.000 56.70417  ? 951  VAL B CA  1 
ATOM   1163 C  C   . VAL B 1 42  ? -5.23000  -3.23500  -7.44100  1.000 52.86686  ? 951  VAL B C   1 
ATOM   1164 O  O   . VAL B 1 42  ? -5.17700  -3.35400  -6.20600  1.000 67.11331  ? 951  VAL B O   1 
ATOM   1165 C  CB  . VAL B 1 42  ? -6.38400  -5.19100  -8.56800  1.000 43.73682  ? 951  VAL B CB  1 
ATOM   1166 C  CG1 . VAL B 1 42  ? -5.91900  -6.06500  -7.41200  1.000 42.48667  ? 951  VAL B CG1 1 
ATOM   1167 C  CG2 . VAL B 1 42  ? -7.69600  -5.69900  -9.13900  1.000 50.99296  ? 951  VAL B CG2 1 
ATOM   1168 N  N   . VAL B 1 43  ? -4.22800  -2.74100  -8.16800  1.000 57.34372  ? 952  VAL B N   1 
ATOM   1169 C  CA  . VAL B 1 43  ? -2.97100  -2.24600  -7.52600  1.000 53.94857  ? 952  VAL B CA  1 
ATOM   1170 C  C   . VAL B 1 43  ? -3.33100  -1.08300  -6.60700  1.000 59.61504  ? 952  VAL B C   1 
ATOM   1171 O  O   . VAL B 1 43  ? -2.77800  -1.02900  -5.50000  1.000 69.22935  ? 952  VAL B O   1 
ATOM   1172 C  CB  . VAL B 1 43  ? -1.89400  -1.82300  -8.53900  1.000 40.88122  ? 952  VAL B CB  1 
ATOM   1173 C  CG1 . VAL B 1 43  ? -0.83000  -0.95100  -7.88900  1.000 39.16522  ? 952  VAL B CG1 1 
ATOM   1174 C  CG2 . VAL B 1 43  ? -1.26300  -3.03600  -9.20500  1.000 42.86830  ? 952  VAL B CG2 1 
ATOM   1175 N  N   . ASN B 1 44  ? -4.22900  -0.20400  -7.06800  1.000 58.50175  ? 953  ASN B N   1 
ATOM   1176 C  CA  . ASN B 1 44  ? -4.63200  1.03900   -6.35800  1.000 62.96018  ? 953  ASN B CA  1 
ATOM   1177 C  C   . ASN B 1 44  ? -5.49200  0.67900   -5.13100  1.000 61.59686  ? 953  ASN B C   1 
ATOM   1178 O  O   . ASN B 1 44  ? -5.20500  1.21200   -4.02900  1.000 62.52855  ? 953  ASN B O   1 
ATOM   1179 C  CB  . ASN B 1 44  ? -5.28200  2.02600   -7.33000  1.000 60.97573  ? 953  ASN B CB  1 
ATOM   1180 C  CG  . ASN B 1 44  ? -4.29000  2.68500   -8.26700  1.000 56.87261  ? 953  ASN B CG  1 
ATOM   1181 O  OD1 . ASN B 1 44  ? -3.13700  2.94600   -7.92500  1.000 54.65919  ? 953  ASN B OD1 1 
ATOM   1182 N  ND2 . ASN B 1 44  ? -4.74300  2.98500   -9.46700  1.000 73.16667  ? 953  ASN B ND2 1 
ATOM   1183 N  N   . GLN B 1 45  ? -6.48500  -0.20300  -5.28500  1.000 65.99739  ? 954  GLN B N   1 
ATOM   1184 C  CA  . GLN B 1 45  ? -7.29400  -0.72600  -4.14800  1.000 65.86579  ? 954  GLN B CA  1 
ATOM   1185 C  C   . GLN B 1 45  ? -6.35900  -1.26800  -3.05400  1.000 71.25591  ? 954  GLN B C   1 
ATOM   1186 O  O   . GLN B 1 45  ? -6.55200  -0.90900  -1.87400  1.000 62.66804  ? 954  GLN B O   1 
ATOM   1187 C  CB  . GLN B 1 45  ? -8.24600  -1.84000  -4.59400  1.000 65.99739  ? 954  GLN B CB  1 
ATOM   1188 C  CG  . GLN B 1 45  ? -9.41700  -1.36000  -5.44100  1.000 71.11116  ? 954  GLN B CG  1 
ATOM   1189 C  CD  . GLN B 1 45  ? -10.62900 -2.24900  -5.28800  1.000 92.33739  ? 954  GLN B CD  1 
ATOM   1190 O  OE1 . GLN B 1 45  ? -10.55000 -3.36700  -4.77400  1.000 96.54315  ? 954  GLN B OE1 1 
ATOM   1191 N  NE2 . GLN B 1 45  ? -11.77500 -1.75300  -5.73400  1.000 99.14083  ? 954  GLN B NE2 1 
ATOM   1192 N  N   . ASN B 1 46  ? -5.38600  -2.10600  -3.43300  1.000 74.11941  ? 955  ASN B N   1 
ATOM   1193 C  CA  . ASN B 1 46  ? -4.41900  -2.74900  -2.50200  1.000 65.55260  ? 955  ASN B CA  1 
ATOM   1194 C  C   . ASN B 1 46  ? -3.54600  -1.66800  -1.84000  1.000 64.19191  ? 955  ASN B C   1 
ATOM   1195 O  O   . ASN B 1 46  ? -3.26500  -1.79400  -0.62600  1.000 62.20746  ? 955  ASN B O   1 
ATOM   1196 C  CB  . ASN B 1 46  ? -3.57900  -3.82400  -3.20200  1.000 61.87584  ? 955  ASN B CB  1 
ATOM   1197 C  CG  . ASN B 1 46  ? -4.33900  -5.09800  -3.52500  1.000 63.50498  ? 955  ASN B CG  1 
ATOM   1198 O  OD1 . ASN B 1 46  ? -5.53300  -5.20700  -3.24900  1.000 63.25495  ? 955  ASN B OD1 1 
ATOM   1199 N  ND2 . ASN B 1 46  ? -3.64900  -6.07600  -4.09400  1.000 60.84414  ? 955  ASN B ND2 1 
ATOM   1200 N  N   . ALA B 1 47  ? -3.14900  -0.63200  -2.58800  1.000 56.37781  ? 956  ALA B N   1 
ATOM   1201 C  CA  . ALA B 1 47  ? -2.44400  0.55400   -2.04800  1.000 58.73862  ? 956  ALA B CA  1 
ATOM   1202 C  C   . ALA B 1 47  ? -3.31600  1.21400   -0.97500  1.000 69.75310  ? 956  ALA B C   1 
ATOM   1203 O  O   . ALA B 1 47  ? -2.82900  1.43300   0.15300   1.000 63.65500  ? 956  ALA B O   1 
ATOM   1204 C  CB  . ALA B 1 47  ? -2.12300  1.52100   -3.15300  1.000 51.10876  ? 956  ALA B CB  1 
ATOM   1205 N  N   . GLN B 1 48  ? -4.58200  1.47700   -1.29900  1.000 69.33726  ? 957  GLN B N   1 
ATOM   1206 C  CA  . GLN B 1 48  ? -5.51300  2.17900   -0.38000  1.000 64.12085  ? 957  GLN B CA  1 
ATOM   1207 C  C   . GLN B 1 48  ? -5.78800  1.31100   0.85600   1.000 62.14956  ? 957  GLN B C   1 
ATOM   1208 O  O   . GLN B 1 48  ? -5.78200  1.86300   1.95100   1.000 63.44445  ? 957  GLN B O   1 
ATOM   1209 C  CB  . GLN B 1 48  ? -6.79700  2.58800   -1.10900  1.000 81.17552  ? 957  GLN B CB  1 
ATOM   1210 C  CG  . GLN B 1 48  ? -7.67000  3.55300   -0.31000  1.000 93.88231  ? 957  GLN B CG  1 
ATOM   1211 C  CD  . GLN B 1 48  ? -6.89000  4.52900   0.54400   1.000 91.47149  ? 957  GLN B CD  1 
ATOM   1212 O  OE1 . GLN B 1 48  ? -6.07000  5.31100   0.06100   1.000 94.79821  ? 957  GLN B OE1 1 
ATOM   1213 N  NE2 . GLN B 1 48  ? -7.14000  4.48600   1.84300   1.000 83.32841  ? 957  GLN B NE2 1 
ATOM   1214 N  N   . ALA B 1 49  ? -6.02900  0.00900   0.68900   1.000 61.49158  ? 958  ALA B N   1 
ATOM   1215 C  CA  . ALA B 1 49  ? -6.21000  -0.96200  1.79700   1.000 61.96796  ? 958  ALA B CA  1 
ATOM   1216 C  C   . ALA B 1 49  ? -5.01700  -0.89800  2.75500   1.000 55.23820  ? 958  ALA B C   1 
ATOM   1217 O  O   . ALA B 1 49  ? -5.22800  -0.94000  3.97000   1.000 51.48775  ? 958  ALA B O   1 
ATOM   1218 C  CB  . ALA B 1 49  ? -6.36300  -2.35600  1.24400   1.000 62.83648  ? 958  ALA B CB  1 
ATOM   1219 N  N   . LEU B 1 50  ? -3.80000  -0.81900  2.22200   1.000 59.52819  ? 959  LEU B N   1 
ATOM   1220 C  CA  . LEU B 1 50  ? -2.57400  -0.72800  3.04800   1.000 59.37028  ? 959  LEU B CA  1 
ATOM   1221 C  C   . LEU B 1 50  ? -2.55600  0.59800   3.80900   1.000 62.91281  ? 959  LEU B C   1 
ATOM   1222 O  O   . LEU B 1 50  ? -2.30600  0.55700   5.01700   1.000 66.41323  ? 959  LEU B O   1 
ATOM   1223 C  CB  . LEU B 1 50  ? -1.34300  -0.85000  2.15300   1.000 63.60236  ? 959  LEU B CB  1 
ATOM   1224 C  CG  . LEU B 1 50  ? -0.01300  -0.95500  2.89100   1.000 58.32541  ? 959  LEU B CG  1 
ATOM   1225 C  CD1 . LEU B 1 50  ? -0.14500  -1.83800  4.12200   1.000 57.31477  ? 959  LEU B CD1 1 
ATOM   1226 C  CD2 . LEU B 1 50  ? 1.06500   -1.49800  1.96000   1.000 53.68012  ? 959  LEU B CD2 1 
ATOM   1227 N  N   . ASN B 1 51  ? -2.82100  1.71900   3.12700   1.000 62.65751  ? 960  ASN B N   1 
ATOM   1228 C  CA  . ASN B 1 51  ? -2.77800  3.09200   3.71300   1.000 62.00743  ? 960  ASN B CA  1 
ATOM   1229 C  C   . ASN B 1 51  ? -3.86900  3.27900   4.77600   1.000 66.75537  ? 960  ASN B C   1 
ATOM   1230 O  O   . ASN B 1 51  ? -3.62600  4.04700   5.72600   1.000 72.27446  ? 960  ASN B O   1 
ATOM   1231 C  CB  . ASN B 1 51  ? -2.90100  4.18500   2.65100   1.000 68.90037  ? 960  ASN B CB  1 
ATOM   1232 C  CG  . ASN B 1 51  ? -1.69800  4.25400   1.73300   1.000 66.12109  ? 960  ASN B CG  1 
ATOM   1233 O  OD1 . ASN B 1 51  ? -0.56300  4.09000   2.16600   1.000 61.57317  ? 960  ASN B OD1 1 
ATOM   1234 N  ND2 . ASN B 1 51  ? -1.93100  4.50500   0.45900   1.000 59.75453  ? 960  ASN B ND2 1 
ATOM   1235 N  N   . THR B 1 52  ? -5.02300  2.62500   4.62300   1.000 60.62832  ? 961  THR B N   1 
ATOM   1236 C  CA  . THR B 1 52  ? -6.12800  2.62500   5.61900   1.000 60.48357  ? 961  THR B CA  1 
ATOM   1237 C  C   . THR B 1 52  ? -5.68700  1.77700   6.81700   1.000 70.66637  ? 961  THR B C   1 
ATOM   1238 O  O   . THR B 1 52  ? -5.88300  2.23200   7.96500   1.000 73.46934  ? 961  THR B O   1 
ATOM   1239 C  CB  . THR B 1 52  ? -7.45400  2.14900   5.00200   1.000 61.53633  ? 961  THR B CB  1 
ATOM   1240 O  OG1 . THR B 1 52  ? -7.89000  3.10100   4.02600   1.000 77.87776  ? 961  THR B OG1 1 
ATOM   1241 C  CG2 . THR B 1 52  ? -8.55500  1.95700   6.02500   1.000 71.97179  ? 961  THR B CG2 1 
ATOM   1242 N  N   . LEU B 1 53  ? -5.11300  0.59800   6.55200   1.000 71.76387  ? 962  LEU B N   1 
ATOM   1243 C  CA  . LEU B 1 53  ? -4.56300  -0.31400  7.59500   1.000 76.65393  ? 962  LEU B CA  1 
ATOM   1244 C  C   . LEU B 1 53  ? -3.53300  0.45300   8.42700   1.000 67.59758  ? 962  LEU B C   1 
ATOM   1245 O  O   . LEU B 1 53  ? -3.62000  0.39600   9.65300   1.000 70.52688  ? 962  LEU B O   1 
ATOM   1246 C  CB  . LEU B 1 53  ? -3.92700  -1.55100  6.95100   1.000 48.90586  ? 962  LEU B CB  1 
ATOM   1247 C  CG  . LEU B 1 53  ? -3.19700  -2.47800  7.92000   1.000 45.58704  ? 962  LEU B CG  1 
ATOM   1248 C  CD1 . LEU B 1 53  ? -4.17000  -3.09800  8.91200   1.000 58.53070  ? 962  LEU B CD1 1 
ATOM   1249 C  CD2 . LEU B 1 53  ? -2.42400  -3.56000  7.18700   1.000 41.80764  ? 962  LEU B CD2 1 
ATOM   1250 N  N   . VAL B 1 54  ? -2.60500  1.15300   7.77600   1.000 65.64998  ? 963  VAL B N   1 
ATOM   1251 C  CA  . VAL B 1 54  ? -1.51500  1.90400   8.46600   1.000 66.11845  ? 963  VAL B CA  1 
ATOM   1252 C  C   . VAL B 1 54  ? -2.16100  2.91700   9.41400   1.000 67.98973  ? 963  VAL B C   1 
ATOM   1253 O  O   . VAL B 1 54  ? -1.84100  2.86700   10.60100  1.000 63.96030  ? 963  VAL B O   1 
ATOM   1254 C  CB  . VAL B 1 54  ? -0.53000  2.55400   7.47200   1.000 71.90599  ? 963  VAL B CB  1 
ATOM   1255 C  CG1 . VAL B 1 54  ? 0.16600   3.77300   8.05500   1.000 64.82356  ? 963  VAL B CG1 1 
ATOM   1256 C  CG2 . VAL B 1 54  ? 0.49800   1.54400   6.96900   1.000 67.50020  ? 963  VAL B CG2 1 
ATOM   1257 N  N   . LYS B 1 55  ? -3.07600  3.75700   8.92400   1.000 73.77200  ? 964  LYS B N   1 
ATOM   1258 C  CA  . LYS B 1 55  ? -3.73000  4.80600   9.75400   1.000 72.72188  ? 964  LYS B CA  1 
ATOM   1259 C  C   . LYS B 1 55  ? -4.41500  4.13800   10.94700  1.000 74.67474  ? 964  LYS B C   1 
ATOM   1260 O  O   . LYS B 1 55  ? -4.19500  4.59600   12.06700  1.000 88.25269  ? 964  LYS B O   1 
ATOM   1261 C  CB  . LYS B 1 55  ? -4.73200  5.63400   8.94600   1.000 74.41155  ? 964  LYS B CB  1 
ATOM   1262 C  CG  . LYS B 1 55  ? -4.11300  6.58800   7.93100   1.000 88.65010  ? 964  LYS B CG  1 
ATOM   1263 C  CD  . LYS B 1 55  ? -5.14200  7.28900   7.05000   1.000 97.89595  ? 964  LYS B CD  1 
ATOM   1264 C  CE  . LYS B 1 55  ? -4.66500  7.55300   5.63300   1.000 93.27434  ? 964  LYS B CE  1 
ATOM   1265 N  NZ  . LYS B 1 55  ? -5.73900  7.30600   4.63800   1.000 84.68910  ? 964  LYS B NZ  1 
ATOM   1266 N  N   . GLN B 1 56  ? -5.18800  3.07700   10.72400  1.000 79.32004  ? 965  GLN B N   1 
ATOM   1267 C  CA  . GLN B 1 56  ? -5.94900  2.40000   11.80900  1.000 80.57545  ? 965  GLN B CA  1 
ATOM   1268 C  C   . GLN B 1 56  ? -4.98200  1.69100   12.76900  1.000 77.61720  ? 965  GLN B C   1 
ATOM   1269 O  O   . GLN B 1 56  ? -5.36300  1.50400   13.93300  1.000 78.08305  ? 965  GLN B O   1 
ATOM   1270 C  CB  . GLN B 1 56  ? -6.99800  1.44400   11.23400  1.000 92.47425  ? 965  GLN B CB  1 
ATOM   1271 C  CG  . GLN B 1 56  ? -8.28300  2.13800   10.78900  1.000 106.14167 ? 965  GLN B CG  1 
ATOM   1272 C  CD  . GLN B 1 56  ? -9.17500  2.53500   11.94600  1.000 110.10531 ? 965  GLN B CD  1 
ATOM   1273 O  OE1 . GLN B 1 56  ? -9.26400  3.70600   12.32400  1.000 101.49638 ? 965  GLN B OE1 1 
ATOM   1274 N  NE2 . GLN B 1 56  ? -9.85400  1.55300   12.52200  1.000 113.72679 ? 965  GLN B NE2 1 
ATOM   1275 N  N   . LEU B 1 57  ? -3.78600  1.30800   12.31300  1.000 76.08544  ? 966  LEU B N   1 
ATOM   1276 C  CA  . LEU B 1 57  ? -2.75700  0.63800   13.16300  1.000 67.43177  ? 966  LEU B CA  1 
ATOM   1277 C  C   . LEU B 1 57  ? -2.10600  1.67200   14.08400  1.000 74.27733  ? 966  LEU B C   1 
ATOM   1278 O  O   . LEU B 1 57  ? -1.91000  1.35200   15.27000  1.000 78.12516  ? 966  LEU B O   1 
ATOM   1279 C  CB  . LEU B 1 57  ? -1.69600  -0.04100  12.29200  1.000 56.23043  ? 966  LEU B CB  1 
ATOM   1280 C  CG  . LEU B 1 57  ? -2.09900  -1.37200  11.66300  1.000 52.59841  ? 966  LEU B CG  1 
ATOM   1281 C  CD1 . LEU B 1 57  ? -1.00000  -1.86900  10.74000  1.000 50.81662  ? 966  LEU B CD1 1 
ATOM   1282 C  CD2 . LEU B 1 57  ? -2.41500  -2.40800  12.72800  1.000 52.88792  ? 966  LEU B CD2 1 
ATOM   1283 N  N   . SER B 1 58  ? -1.76600  2.84800   13.54100  1.000 73.51408  ? 967  SER B N   1 
ATOM   1284 C  CA  . SER B 1 58  ? -1.26700  4.02300   14.30300  1.000 73.30353  ? 967  SER B CA  1 
ATOM   1285 C  C   . SER B 1 58  ? -2.26400  4.34500   15.41800  1.000 71.51910  ? 967  SER B C   1 
ATOM   1286 O  O   . SER B 1 58  ? -1.83100  4.48200   16.56900  1.000 69.82416  ? 967  SER B O   1 
ATOM   1287 C  CB  . SER B 1 58  ? -1.04400  5.23400   13.42300  1.000 80.18856  ? 967  SER B CB  1 
ATOM   1288 O  OG  . SER B 1 58  ? -0.23000  4.93100   12.30200  1.000 82.45989  ? 967  SER B OG  1 
ATOM   1289 N  N   . SER B 1 59  ? -3.55200  4.44300   15.07800  1.000 70.56899  ? 968  SER B N   1 
ATOM   1290 C  CA  . SER B 1 59  ? -4.65700  4.70400   16.03400  1.000 73.52987  ? 968  SER B CA  1 
ATOM   1291 C  C   . SER B 1 59  ? -4.62600  3.65700   17.15000  1.000 68.10817  ? 968  SER B C   1 
ATOM   1292 O  O   . SER B 1 59  ? -4.71200  4.03600   18.32000  1.000 75.65118  ? 968  SER B O   1 
ATOM   1293 C  CB  . SER B 1 59  ? -5.99200  4.73200   15.33800  1.000 80.63335  ? 968  SER B CB  1 
ATOM   1294 O  OG  . SER B 1 59  ? -6.20600  5.99300   14.72000  1.000 85.03388  ? 968  SER B OG  1 
ATOM   1295 N  N   . ASN B 1 60  ? -4.49600  2.38100   16.79900  1.000 73.09561  ? 969  ASN B N   1 
ATOM   1296 C  CA  . ASN B 1 60  ? -4.56400  1.26600   17.77900  1.000 75.35904  ? 969  ASN B CA  1 
ATOM   1297 C  C   . ASN B 1 60  ? -3.35200  1.34900   18.70800  1.000 72.93769  ? 969  ASN B C   1 
ATOM   1298 O  O   . ASN B 1 60  ? -3.54300  1.12000   19.90100  1.000 86.69987  ? 969  ASN B O   1 
ATOM   1299 C  CB  . ASN B 1 60  ? -4.64800  -0.11800  17.12100  1.000 77.63562  ? 969  ASN B CB  1 
ATOM   1300 C  CG  . ASN B 1 60  ? -6.00200  -0.44400  16.51600  1.000 76.74604  ? 969  ASN B CG  1 
ATOM   1301 O  OD1 . ASN B 1 60  ? -6.94400  0.34300   16.60900  1.000 69.95049  ? 969  ASN B OD1 1 
ATOM   1302 N  ND2 . ASN B 1 60  ? -6.10300  -1.60400  15.87900  1.000 69.71099  ? 969  ASN B ND2 1 
ATOM   1303 N  N   . PHE B 1 61  ? -2.15800  1.65500   18.18500  1.000 73.60619  ? 970  PHE B N   1 
ATOM   1304 C  CA  . PHE B 1 61  ? -0.89300  1.69700   18.97200  1.000 72.11128  ? 970  PHE B CA  1 
ATOM   1305 C  C   . PHE B 1 61  ? -0.89700  2.92400   19.88800  1.000 71.77966  ? 970  PHE B C   1 
ATOM   1306 O  O   . PHE B 1 61  ? -0.44400  2.82000   21.04100  1.000 69.31884  ? 970  PHE B O   1 
ATOM   1307 C  CB  . PHE B 1 61  ? 0.34300   1.71100   18.07200  1.000 68.98722  ? 970  PHE B CB  1 
ATOM   1308 C  CG  . PHE B 1 61  ? 0.68300   0.38100   17.45400  1.000 70.25316  ? 970  PHE B CG  1 
ATOM   1309 C  CD1 . PHE B 1 61  ? 0.83900   -0.75100  18.23700  1.000 62.72068  ? 970  PHE B CD1 1 
ATOM   1310 C  CD2 . PHE B 1 61  ? 0.85700   0.26800   16.08500  1.000 67.79760  ? 970  PHE B CD2 1 
ATOM   1311 C  CE1 . PHE B 1 61  ? 1.14300   -1.97400  17.65800  1.000 67.86077  ? 970  PHE B CE1 1 
ATOM   1312 C  CE2 . PHE B 1 61  ? 1.17100   -0.95100  15.51000  1.000 66.72905  ? 970  PHE B CE2 1 
ATOM   1313 C  CZ  . PHE B 1 61  ? 1.31200   -2.07100  16.29700  1.000 67.30281  ? 970  PHE B CZ  1 
ATOM   1314 N  N   . GLY B 1 62  ? -1.38400  4.05200   19.37600  1.000 65.36573  ? 971  GLY B N   1 
ATOM   1315 C  CA  . GLY B 1 62  ? -1.61500  5.27500   20.16300  1.000 68.68192  ? 971  GLY B CA  1 
ATOM   1316 C  C   . GLY B 1 62  ? -2.48500  5.00600   21.37800  1.000 76.56444  ? 971  GLY B C   1 
ATOM   1317 O  O   . GLY B 1 62  ? -2.14000  5.50200   22.46800  1.000 77.77775  ? 971  GLY B O   1 
ATOM   1318 N  N   . ALA B 1 63  ? -3.58200  4.26400   21.19400  1.000 69.16619  ? 972  ALA B N   1 
ATOM   1319 C  CA  . ALA B 1 63  ? -4.54200  3.87500   22.25400  1.000 72.40605  ? 972  ALA B CA  1 
ATOM   1320 C  C   . ALA B 1 63  ? -3.89400  2.88900   23.23600  1.000 70.70585  ? 972  ALA B C   1 
ATOM   1321 O  O   . ALA B 1 63  ? -4.18800  3.00300   24.43600  1.000 73.25878  ? 972  ALA B O   1 
ATOM   1322 C  CB  . ALA B 1 63  ? -5.78300  3.28300   21.63200  1.000 74.13257  ? 972  ALA B CB  1 
ATOM   1323 N  N   . ILE B 1 64  ? -3.06000  1.96300   22.74800  1.000 68.92142  ? 973  ILE B N   1 
ATOM   1324 C  CA  . ILE B 1 64  ? -2.40400  0.89800   23.56700  1.000 67.33702  ? 973  ILE B CA  1 
ATOM   1325 C  C   . ILE B 1 64  ? -1.35500  1.54100   24.47900  1.000 78.47783  ? 973  ILE B C   1 
ATOM   1326 O  O   . ILE B 1 64  ? -1.35300  1.22100   25.68000  1.000 76.92764  ? 973  ILE B O   1 
ATOM   1327 C  CB  . ILE B 1 64  ? -1.77700  -0.20000  22.68600  1.000 63.74975  ? 973  ILE B CB  1 
ATOM   1328 C  CG1 . ILE B 1 64  ? -2.84600  -1.08300  22.03800  1.000 65.94738  ? 973  ILE B CG1 1 
ATOM   1329 C  CG2 . ILE B 1 64  ? -0.78400  -1.03300  23.48200  1.000 62.02323  ? 973  ILE B CG2 1 
ATOM   1330 C  CD1 . ILE B 1 64  ? -2.34800  -1.88900  20.86100  1.000 61.48106  ? 973  ILE B CD1 1 
ATOM   1331 N  N   . SER B 1 65  ? -0.47800  2.38600   23.92900  1.000 81.34133  ? 974  SER B N   1 
ATOM   1332 C  CA  . SER B 1 65  ? 0.65400   3.00500   24.67000  1.000 79.75167  ? 974  SER B CA  1 
ATOM   1333 C  C   . SER B 1 65  ? 0.09200   3.96000   25.73500  1.000 80.19119  ? 974  SER B C   1 
ATOM   1334 O  O   . SER B 1 65  ? 0.69100   4.03900   26.83500  1.000 72.53764  ? 974  SER B O   1 
ATOM   1335 C  CB  . SER B 1 65  ? 1.64000   3.67100   23.73600  1.000 78.51994  ? 974  SER B CB  1 
ATOM   1336 O  OG  . SER B 1 65  ? 1.31900   5.03700   23.54500  1.000 83.00995  ? 974  SER B OG  1 
ATOM   1337 N  N   . SER B 1 66  ? -1.04100  4.61400   25.44600  1.000 83.92322  ? 975  SER B N   1 
ATOM   1338 C  CA  . SER B 1 66  ? -1.78900  5.46600   26.41300  1.000 84.18115  ? 975  SER B CA  1 
ATOM   1339 C  C   . SER B 1 66  ? -2.19600  4.61000   27.60900  1.000 84.53119  ? 975  SER B C   1 
ATOM   1340 O  O   . SER B 1 66  ? -1.88200  4.98400   28.74300  1.000 97.24850  ? 975  SER B O   1 
ATOM   1341 C  CB  . SER B 1 66  ? -3.00800  6.12400   25.80800  1.000 92.08209  ? 975  SER B CB  1 
ATOM   1342 O  OG  . SER B 1 66  ? -2.65500  7.26100   25.03200  1.000 98.15124  ? 975  SER B OG  1 
ATOM   1343 N  N   . VAL B 1 67  ? -2.86000  3.49200   27.34600  1.000 76.15124  ? 976  VAL B N   1 
ATOM   1344 C  CA  . VAL B 1 67  ? -3.37200  2.57400   28.40100  1.000 77.94092  ? 976  VAL B CA  1 
ATOM   1345 C  C   . VAL B 1 67  ? -2.18800  1.98900   29.17400  1.000 82.69413  ? 976  VAL B C   1 
ATOM   1346 O  O   . VAL B 1 67  ? -2.28300  1.86700   30.40300  1.000 87.43943  ? 976  VAL B O   1 
ATOM   1347 C  CB  . VAL B 1 67  ? -4.25300  1.46900   27.79600  1.000 83.14944  ? 976  VAL B CB  1 
ATOM   1348 C  CG1 . VAL B 1 67  ? -4.71500  0.47700   28.85600  1.000 92.39002  ? 976  VAL B CG1 1 
ATOM   1349 C  CG2 . VAL B 1 67  ? -5.44200  2.06500   27.05400  1.000 81.36239  ? 976  VAL B CG2 1 
ATOM   1350 N  N   . LEU B 1 68  ? -1.10800  1.63800   28.48600  1.000 78.50941  ? 977  LEU B N   1 
ATOM   1351 C  CA  . LEU B 1 68  ? 0.06300   0.97900   29.11900  1.000 78.09094  ? 977  LEU B CA  1 
ATOM   1352 C  C   . LEU B 1 68  ? 0.75900   1.96000   30.06300  1.000 75.37483  ? 977  LEU B C   1 
ATOM   1353 O  O   . LEU B 1 68  ? 1.17900   1.53500   31.15200  1.000 72.86926  ? 977  LEU B O   1 
ATOM   1354 C  CB  . LEU B 1 68  ? 1.01900   0.48400   28.02900  1.000 75.38535  ? 977  LEU B CB  1 
ATOM   1355 C  CG  . LEU B 1 68  ? 0.71900   -0.90600  27.48100  1.000 68.20555  ? 977  LEU B CG  1 
ATOM   1356 C  CD1 . LEU B 1 68  ? 1.69600   -1.25700  26.36100  1.000 65.79473  ? 977  LEU B CD1 1 
ATOM   1357 C  CD2 . LEU B 1 68  ? 0.77500   -1.93500  28.60000  1.000 66.21057  ? 977  LEU B CD2 1 
ATOM   1358 N  N   . ASN B 1 69  ? 0.88500   3.21900   29.64600  1.000 77.27505  ? 978  ASN B N   1 
ATOM   1359 C  CA  . ASN B 1 69  ? 1.55200   4.28200   30.44400  1.000 80.18856  ? 978  ASN B CA  1 
ATOM   1360 C  C   . ASN B 1 69  ? 0.70200   4.61300   31.67400  1.000 83.37842  ? 978  ASN B C   1 
ATOM   1361 O  O   . ASN B 1 69  ? 1.29300   4.86500   32.74200  1.000 85.55763  ? 978  ASN B O   1 
ATOM   1362 C  CB  . ASN B 1 69  ? 1.85200   5.50200   29.57800  1.000 83.36263  ? 978  ASN B CB  1 
ATOM   1363 C  CG  . ASN B 1 69  ? 2.93200   5.19600   28.56300  1.000 78.07515  ? 978  ASN B CG  1 
ATOM   1364 O  OD1 . ASN B 1 69  ? 3.99300   4.69100   28.92600  1.000 68.69245  ? 978  ASN B OD1 1 
ATOM   1365 N  ND2 . ASN B 1 69  ? 2.65600   5.46200   27.29600  1.000 78.99368  ? 978  ASN B ND2 1 
ATOM   1366 N  N   . ASP B 1 70  ? -0.62600  4.59500   31.53200  1.000 86.27087  ? 979  ASP B N   1 
ATOM   1367 C  CA  . ASP B 1 70  ? -1.56700  4.74300   32.67100  1.000 89.71076  ? 979  ASP B CA  1 
ATOM   1368 C  C   . ASP B 1 70  ? -1.31000  3.59300   33.64400  1.000 88.36849  ? 979  ASP B C   1 
ATOM   1369 O  O   . ASP B 1 70  ? -1.06100  3.89600   34.82000  1.000 89.00804  ? 979  ASP B O   1 
ATOM   1370 C  CB  . ASP B 1 70  ? -3.03100  4.82300   32.22100  1.000 90.20555  ? 979  ASP B CB  1 
ATOM   1371 C  CG  . ASP B 1 70  ? -3.53300  6.23900   31.97700  1.000 107.22075 ? 979  ASP B CG  1 
ATOM   1372 O  OD1 . ASP B 1 70  ? -3.14200  7.14400   32.74000  1.000 114.39793 ? 979  ASP B OD1 1 
ATOM   1373 O  OD2 . ASP B 1 70  ? -4.32400  6.42600   31.03100  1.000 117.16142 ? 979  ASP B OD2 1 
ATOM   1374 N  N   . ILE B 1 71  ? -1.32200  2.34200   33.16700  1.000 83.49685  ? 980  ILE B N   1 
ATOM   1375 C  CA  . ILE B 1 71  ? -1.16600  1.12400   34.02400  1.000 83.69688  ? 980  ILE B CA  1 
ATOM   1376 C  C   . ILE B 1 71  ? 0.18500   1.18000   34.74700  1.000 87.46312  ? 980  ILE B C   1 
ATOM   1377 O  O   . ILE B 1 71  ? 0.24200   0.76000   35.91300  1.000 93.25329  ? 980  ILE B O   1 
ATOM   1378 C  CB  . ILE B 1 71  ? -1.31300  -0.18300  33.21800  1.000 85.16811  ? 980  ILE B CB  1 
ATOM   1379 C  CG1 . ILE B 1 71  ? -2.74800  -0.38600  32.73200  1.000 89.03962  ? 980  ILE B CG1 1 
ATOM   1380 C  CG2 . ILE B 1 71  ? -0.83100  -1.38200  34.02900  1.000 79.87010  ? 980  ILE B CG2 1 
ATOM   1381 C  CD1 . ILE B 1 71  ? -2.87000  -1.37900  31.60200  1.000 86.49195  ? 980  ILE B CD1 1 
ATOM   1382 N  N   . LEU B 1 72  ? 1.23800   1.66000   34.08400  1.000 85.59974  ? 981  LEU B N   1 
ATOM   1383 C  CA  . LEU B 1 72  ? 2.59700   1.71000   34.68300  1.000 84.01534  ? 981  LEU B CA  1 
ATOM   1384 C  C   . LEU B 1 72  ? 2.65200   2.82100   35.74300  1.000 93.27697  ? 981  LEU B C   1 
ATOM   1385 O  O   . LEU B 1 72  ? 3.33900   2.61900   36.76500  1.000 97.62223  ? 981  LEU B O   1 
ATOM   1386 C  CB  . LEU B 1 72  ? 3.63300   1.90900   33.57300  1.000 82.32829  ? 981  LEU B CB  1 
ATOM   1387 C  CG  . LEU B 1 72  ? 3.92900   0.67900   32.71600  1.000 80.71231  ? 981  LEU B CG  1 
ATOM   1388 C  CD1 . LEU B 1 72  ? 4.91800   1.02600   31.62000  1.000 81.14394  ? 981  LEU B CD1 1 
ATOM   1389 C  CD2 . LEU B 1 72  ? 4.47000   -0.47400  33.54900  1.000 76.07754  ? 981  LEU B CD2 1 
ATOM   1390 N  N   . SER B 1 73  ? 1.94000   3.93300   35.52200  1.000 101.80168 ? 982  SER B N   1 
ATOM   1391 C  CA  . SER B 1 73  ? 1.83400   5.08500   36.46100  1.000 86.76040  ? 982  SER B CA  1 
ATOM   1392 C  C   . SER B 1 73  ? 1.01300   4.70100   37.69800  1.000 90.11870  ? 982  SER B C   1 
ATOM   1393 O  O   . SER B 1 73  ? 1.31200   5.24700   38.77700  1.000 94.67977  ? 982  SER B O   1 
ATOM   1394 C  CB  . SER B 1 73  ? 1.24800   6.29500   35.79200  1.000 88.68432  ? 982  SER B CB  1 
ATOM   1395 O  OG  . SER B 1 73  ? 0.42900   7.00700   36.69800  1.000 120.99082 ? 982  SER B OG  1 
ATOM   1396 N  N   . ARG B 1 74  ? 0.00300   3.83700   37.53400  1.000 88.20794  ? 983  ARG B N   1 
ATOM   1397 C  CA  . ARG B 1 74  ? -0.82700  3.28900   38.64200  1.000 102.65705 ? 983  ARG B CA  1 
ATOM   1398 C  C   . ARG B 1 74  ? -0.01100  2.28100   39.45700  1.000 107.30760 ? 983  ARG B C   1 
ATOM   1399 O  O   . ARG B 1 74  ? -0.18800  2.25800   40.68500  1.000 114.13474 ? 983  ARG B O   1 
ATOM   1400 C  CB  . ARG B 1 74  ? -2.08200  2.58200   38.12600  1.000 103.03077 ? 983  ARG B CB  1 
ATOM   1401 C  CG  . ARG B 1 74  ? -3.25600  3.49600   37.80700  1.000 104.43357 ? 983  ARG B CG  1 
ATOM   1402 C  CD  . ARG B 1 74  ? -4.36400  2.71000   37.12900  1.000 106.04693 ? 983  ARG B CD  1 
ATOM   1403 N  NE  . ARG B 1 74  ? -5.66000  3.36600   37.15700  1.000 109.31574 ? 983  ARG B NE  1 
ATOM   1404 C  CZ  . ARG B 1 74  ? -6.75400  2.91900   36.54400  1.000 107.51552 ? 983  ARG B CZ  1 
ATOM   1405 N  NH1 . ARG B 1 74  ? -6.73000  1.79700   35.84100  1.000 103.09920 ? 983  ARG B NH1 1 
ATOM   1406 N  NH2 . ARG B 1 74  ? -7.87800  3.61100   36.63600  1.000 117.01403 ? 983  ARG B NH2 1 
ATOM   1407 N  N   . LEU B 1 75  ? 0.81500   1.46000   38.79900  1.000 104.83362 ? 984  LEU B N   1 
ATOM   1408 C  CA  . LEU B 1 75  ? 1.72200   0.47900   39.46200  1.000 114.46109 ? 984  LEU B CA  1 
ATOM   1409 C  C   . LEU B 1 75  ? 2.79700   1.21200   40.27300  1.000 119.71962 ? 984  LEU B C   1 
ATOM   1410 O  O   . LEU B 1 75  ? 3.20400   0.67800   41.31900  1.000 122.18570 ? 984  LEU B O   1 
ATOM   1411 C  CB  . LEU B 1 75  ? 2.36600   -0.43100  38.41100  1.000 116.77716 ? 984  LEU B CB  1 
ATOM   1412 C  CG  . LEU B 1 75  ? 1.68600   -1.78300  38.22000  1.000 113.41886 ? 984  LEU B CG  1 
ATOM   1413 C  CD1 . LEU B 1 75  ? 1.78900   -2.61800  39.48900  1.000 115.36383 ? 984  LEU B CD1 1 
ATOM   1414 C  CD2 . LEU B 1 75  ? 0.23300   -1.60600  37.80000  1.000 109.01570 ? 984  LEU B CD2 1 
ATOM   1415 N  N   . ASP B 1 76  ? 3.24900   2.37300   39.78800  1.000 115.83494 ? 985  ASP B N   1 
ATOM   1416 C  CA  . ASP B 1 76  ? 4.17500   3.29700   40.49900  1.000 117.57199 ? 985  ASP B CA  1 
ATOM   1417 C  C   . ASP B 1 76  ? 3.56700   3.69200   41.85600  1.000 123.15687 ? 985  ASP B C   1 
ATOM   1418 O  O   . ASP B 1 76  ? 4.28700   3.60800   42.87600  1.000 127.97587 ? 985  ASP B O   1 
ATOM   1419 C  CB  . ASP B 1 76  ? 4.47300   4.52400   39.63300  1.000 121.48035 ? 985  ASP B CB  1 
ATOM   1420 C  CG  . ASP B 1 76  ? 5.88100   5.06100   39.80200  1.000 126.81520 ? 985  ASP B CG  1 
ATOM   1421 O  OD1 . ASP B 1 76  ? 6.20100   5.52600   40.93100  1.000 133.16070 ? 985  ASP B OD1 1 
ATOM   1422 O  OD2 . ASP B 1 76  ? 6.65200   4.99200   38.80400  1.000 124.91761 ? 985  ASP B OD2 1 
ATOM   1423 N  N   . LYS B 1 77  ? 2.29100   4.09800   41.86600  1.000 122.97264 ? 986  LYS B N   1 
ATOM   1424 C  CA  . LYS B 1 77  ? 1.53400   4.49900   43.08600  1.000 116.50344 ? 986  LYS B CA  1 
ATOM   1425 C  C   . LYS B 1 77  ? 1.28100   3.28200   43.99000  1.000 115.89811 ? 986  LYS B C   1 
ATOM   1426 O  O   . LYS B 1 77  ? 1.21900   3.47100   45.21400  1.000 122.93842 ? 986  LYS B O   1 
ATOM   1427 C  CB  . LYS B 1 77  ? 0.19700   5.15100   42.72000  1.000 99.74091  ? 986  LYS B CB  1 
ATOM   1428 C  CG  . LYS B 1 77  ? 0.27500   6.58900   42.22300  1.000 101.82273 ? 986  LYS B CG  1 
ATOM   1429 C  CD  . LYS B 1 77  ? -1.02700  7.34800   42.43600  1.000 114.71112 ? 986  LYS B CD  1 
ATOM   1430 C  CE  . LYS B 1 77  ? -0.83400  8.80800   42.78200  1.000 120.94871 ? 986  LYS B CE  1 
ATOM   1431 N  NZ  . LYS B 1 77  ? -1.84000  9.27300   43.76700  1.000 117.94309 ? 986  LYS B NZ  1 
ATOM   1432 N  N   . VAL B 1 78  ? 1.12100   2.08900   43.41400  1.000 121.79881 ? 987  VAL B N   1 
ATOM   1433 C  CA  . VAL B 1 78  ? 0.83600   0.82700   44.16200  1.000 124.51493 ? 987  VAL B CA  1 
ATOM   1434 C  C   . VAL B 1 78  ? 2.15500   0.21500   44.66000  1.000 120.63815 ? 987  VAL B C   1 
ATOM   1435 O  O   . VAL B 1 78  ? 2.16200   -0.29700  45.79100  1.000 118.98269 ? 987  VAL B O   1 
ATOM   1436 C  CB  . VAL B 1 78  ? 0.01900   -0.16600  43.31000  1.000 123.49112 ? 987  VAL B CB  1 
ATOM   1437 C  CG1 . VAL B 1 78  ? 0.01600   -1.56900  43.90500  1.000 129.30761 ? 987  VAL B CG1 1 
ATOM   1438 C  CG2 . VAL B 1 78  ? -1.40900  0.32300   43.09800  1.000 118.00362 ? 987  VAL B CG2 1 
ATOM   1439 N  N   . GLU B 1 79  ? 3.21900   0.23200   43.84800  1.000 121.94883 ? 988  GLU B N   1 
ATOM   1440 C  CA  . GLU B 1 79  ? 4.57300   -0.24400  44.25300  1.000 121.61458 ? 988  GLU B CA  1 
ATOM   1441 C  C   . GLU B 1 79  ? 5.43500   0.97600   44.61400  1.000 119.51170 ? 988  GLU B C   1 
ATOM   1442 O  O   . GLU B 1 79  ? 5.14200   1.60200   45.66000  1.000 120.14335 ? 988  GLU B O   1 
ATOM   1443 C  CB  . GLU B 1 79  ? 5.21500   -1.10000  43.15200  1.000 117.87466 ? 988  GLU B CB  1 
ATOM   1444 C  CG  . GLU B 1 79  ? 5.99800   -0.31000  42.11400  1.000 119.06954 ? 988  GLU B CG  1 
ATOM   1445 C  CD  . GLU B 1 79  ? 6.31100   -1.06300  40.83100  1.000 129.27866 ? 988  GLU B CD  1 
ATOM   1446 O  OE1 . GLU B 1 79  ? 6.68400   -2.25200  40.92100  1.000 134.55561 ? 988  GLU B OE1 1 
ATOM   1447 O  OE2 . GLU B 1 79  ? 6.18100   -0.45600  39.74500  1.000 131.95003 ? 988  GLU B OE2 1 
ATOM   1448 N  N   . PRO B 1 86  ? 9.90700   5.92600   33.80500  1.000 119.39589 ? 1162 PRO B N   1 
ATOM   1449 C  CA  . PRO B 1 86  ? 10.10700  5.06100   32.62500  1.000 119.07480 ? 1162 PRO B CA  1 
ATOM   1450 C  C   . PRO B 1 86  ? 8.82100   4.86600   31.80200  1.000 120.22494 ? 1162 PRO B C   1 
ATOM   1451 O  O   . PRO B 1 86  ? 7.78700   4.55600   32.37000  1.000 122.99633 ? 1162 PRO B O   1 
ATOM   1452 C  CB  . PRO B 1 86  ? 10.61900  3.73800   33.21400  1.000 114.69007 ? 1162 PRO B CB  1 
ATOM   1453 C  CG  . PRO B 1 86  ? 10.06500  3.71800   34.62500  1.000 115.10591 ? 1162 PRO B CG  1 
ATOM   1454 C  CD  . PRO B 1 86  ? 10.01400  5.16800   35.05900  1.000 115.67176 ? 1162 PRO B CD  1 
ATOM   1455 N  N   . ASP B 1 87  ? 8.94200   5.02200   30.48100  1.000 99.45929  ? 1163 ASP B N   1 
ATOM   1456 C  CA  . ASP B 1 87  ? 7.82800   5.34700   29.55400  1.000 95.87465  ? 1163 ASP B CA  1 
ATOM   1457 C  C   . ASP B 1 87  ? 7.83700   4.32900   28.40300  1.000 93.63491  ? 1163 ASP B C   1 
ATOM   1458 O  O   . ASP B 1 87  ? 8.93800   3.97700   27.92700  1.000 91.44254  ? 1163 ASP B O   1 
ATOM   1459 C  CB  . ASP B 1 87  ? 7.91400   6.82600   29.14300  1.000 100.83577 ? 1163 ASP B CB  1 
ATOM   1460 C  CG  . ASP B 1 87  ? 9.29300   7.49500   29.22900  1.000 109.55261 ? 1163 ASP B CG  1 
ATOM   1461 O  OD1 . ASP B 1 87  ? 10.32100  6.76700   29.24400  1.000 112.51875 ? 1163 ASP B OD1 1 
ATOM   1462 O  OD2 . ASP B 1 87  ? 9.34200   8.75700   29.25800  1.000 112.18187 ? 1163 ASP B OD2 1 
ATOM   1463 N  N   . VAL B 1 88  ? 6.65400   3.84500   28.00600  1.000 90.95564  ? 1164 VAL B N   1 
ATOM   1464 C  CA  . VAL B 1 88  ? 6.46400   2.84600   26.91000  1.000 78.15674  ? 1164 VAL B CA  1 
ATOM   1465 C  C   . VAL B 1 88  ? 6.30300   3.60700   25.59000  1.000 71.42962  ? 1164 VAL B C   1 
ATOM   1466 O  O   . VAL B 1 88  ? 5.29800   4.32100   25.45200  1.000 65.62366  ? 1164 VAL B O   1 
ATOM   1467 C  CB  . VAL B 1 88  ? 5.26300   1.92500   27.20500  1.000 75.96174  ? 1164 VAL B CB  1 
ATOM   1468 C  CG1 . VAL B 1 88  ? 4.79800   1.14100   25.98700  1.000 72.34288  ? 1164 VAL B CG1 1 
ATOM   1469 C  CG2 . VAL B 1 88  ? 5.57900   0.97900   28.35100  1.000 77.97514  ? 1164 VAL B CG2 1 
ATOM   1470 N  N   . ASP B 1 89  ? 7.26900   3.46000   24.67300  1.000 82.18880  ? 1165 ASP B N   1 
ATOM   1471 C  CA  . ASP B 1 89  ? 7.32100   4.16500   23.36200  1.000 78.67259  ? 1165 ASP B CA  1 
ATOM   1472 C  C   . ASP B 1 89  ? 7.35000   3.11700   22.24600  1.000 71.19538  ? 1165 ASP B C   1 
ATOM   1473 O  O   . ASP B 1 89  ? 8.40800   2.50000   22.04300  1.000 67.77918  ? 1165 ASP B O   1 
ATOM   1474 C  CB  . ASP B 1 89  ? 8.53700   5.09400   23.27300  1.000 75.54327  ? 1165 ASP B CB  1 
ATOM   1475 C  CG  . ASP B 1 89  ? 8.20900   6.52200   22.86500  1.000 94.05075  ? 1165 ASP B CG  1 
ATOM   1476 O  OD1 . ASP B 1 89  ? 7.01200   6.87000   22.83200  1.000 101.55691 ? 1165 ASP B OD1 1 
ATOM   1477 O  OD2 . ASP B 1 89  ? 9.16100   7.28100   22.59500  1.000 99.55667  ? 1165 ASP B OD2 1 
ATOM   1478 N  N   . LEU B 1 90  ? 6.22200   2.92000   21.56300  1.000 77.03818  ? 1166 LEU B N   1 
ATOM   1479 C  CA  . LEU B 1 90  ? 6.09800   1.95300   20.44100  1.000 72.82978  ? 1166 LEU B CA  1 
ATOM   1480 C  C   . LEU B 1 90  ? 6.59600   2.62200   19.15900  1.000 73.04034  ? 1166 LEU B C   1 
ATOM   1481 O  O   . LEU B 1 90  ? 6.51000   3.86100   19.07200  1.000 76.27757  ? 1166 LEU B O   1 
ATOM   1482 C  CB  . LEU B 1 90  ? 4.63700   1.52500   20.29200  1.000 66.44218  ? 1166 LEU B CB  1 
ATOM   1483 C  CG  . LEU B 1 90  ? 3.96500   1.00100   21.55600  1.000 64.35245  ? 1166 LEU B CG  1 
ATOM   1484 C  CD1 . LEU B 1 90  ? 2.49200   0.75700   21.29100  1.000 62.69962  ? 1166 LEU B CD1 1 
ATOM   1485 C  CD2 . LEU B 1 90  ? 4.64400   -0.26600  22.05700  1.000 58.23067  ? 1166 LEU B CD2 1 
ATOM   1486 N  N   . GLY B 1 91  ? 7.08700   1.82300   18.20500  1.000 69.03722  ? 1167 GLY B N   1 
ATOM   1487 C  CA  . GLY B 1 91  ? 7.58200   2.29100   16.89500  1.000 73.80622  ? 1167 GLY B CA  1 
ATOM   1488 C  C   . GLY B 1 91  ? 6.51500   3.05700   16.13900  1.000 78.16463  ? 1167 GLY B C   1 
ATOM   1489 O  O   . GLY B 1 91  ? 5.33700   2.66400   16.22600  1.000 82.77308  ? 1167 GLY B O   1 
ATOM   1490 N  N   . ASP B 1 92  ? 6.89900   4.13000   15.44200  1.000 73.78779  ? 1168 ASP B N   1 
ATOM   1491 C  CA  . ASP B 1 92  ? 5.97000   4.92000   14.59000  1.000 77.14346  ? 1168 ASP B CA  1 
ATOM   1492 C  C   . ASP B 1 92  ? 5.96200   4.29600   13.19000  1.000 75.90121  ? 1168 ASP B C   1 
ATOM   1493 O  O   . ASP B 1 92  ? 7.03700   4.19300   12.56200  1.000 77.40665  ? 1168 ASP B O   1 
ATOM   1494 C  CB  . ASP B 1 92  ? 6.30400   6.41500   14.57000  1.000 80.56492  ? 1168 ASP B CB  1 
ATOM   1495 C  CG  . ASP B 1 92  ? 5.17900   7.28200   14.01400  1.000 95.42986  ? 1168 ASP B CG  1 
ATOM   1496 O  OD1 . ASP B 1 92  ? 4.01600   6.81600   14.00500  1.000 100.10937 ? 1168 ASP B OD1 1 
ATOM   1497 O  OD2 . ASP B 1 92  ? 5.46600   8.41900   13.59600  1.000 100.89104 ? 1168 ASP B OD2 1 
ATOM   1498 N  N   . ILE B 1 93  ? 4.77200   3.90700   12.73700  1.000 73.29037  ? 1169 ILE B N   1 
ATOM   1499 C  CA  . ILE B 1 93  ? 4.51700   3.11500   11.50400  1.000 62.75489  ? 1169 ILE B CA  1 
ATOM   1500 C  C   . ILE B 1 93  ? 3.54800   3.91600   10.63300  1.000 83.53896  ? 1169 ILE B C   1 
ATOM   1501 O  O   . ILE B 1 93  ? 2.77300   3.28200   9.90200   1.000 91.91365  ? 1169 ILE B O   1 
ATOM   1502 C  CB  . ILE B 1 93  ? 3.95300   1.71400   11.84100  1.000 68.95037  ? 1169 ILE B CB  1 
ATOM   1503 C  CG1 . ILE B 1 93  ? 2.54100   1.76500   12.44800  1.000 77.26979  ? 1169 ILE B CG1 1 
ATOM   1504 C  CG2 . ILE B 1 93  ? 4.92500   0.92400   12.71000  1.000 50.67450  ? 1169 ILE B CG2 1 
ATOM   1505 C  CD1 . ILE B 1 93  ? 2.47000   2.14200   13.92100  1.000 91.33200  ? 1169 ILE B CD1 1 
ATOM   1506 N  N   . SER B 1 94  ? 3.57400   5.25100   10.73500  1.000 87.45259  ? 1170 SER B N   1 
ATOM   1507 C  CA  . SER B 1 94  ? 2.64200   6.18400   10.04100  1.000 93.44278  ? 1170 SER B CA  1 
ATOM   1508 C  C   . SER B 1 94  ? 3.35300   6.88000   8.87500   1.000 90.99775  ? 1170 SER B C   1 
ATOM   1509 O  O   . SER B 1 94  ? 2.65800   7.46500   8.02600   1.000 99.80407  ? 1170 SER B O   1 
ATOM   1510 C  CB  . SER B 1 94  ? 2.04800   7.19600   10.99800  1.000 108.68408 ? 1170 SER B CB  1 
ATOM   1511 O  OG  . SER B 1 94  ? 3.03400   8.11200   11.46400  1.000 117.96414 ? 1170 SER B OG  1 
ATOM   1512 N  N   . GLY B 1 95  ? 4.68800   6.84100   8.85300   1.000 87.33152  ? 1171 GLY B N   1 
ATOM   1513 C  CA  . GLY B 1 95  ? 5.49400   7.23200   7.68500   1.000 83.62582  ? 1171 GLY B CA  1 
ATOM   1514 C  C   . GLY B 1 95  ? 5.34800   6.22600   6.55200   1.000 76.28809  ? 1171 GLY B C   1 
ATOM   1515 O  O   . GLY B 1 95  ? 5.58100   6.61900   5.38200   1.000 71.40593  ? 1171 GLY B O   1 
ATOM   1516 N  N   . ILE B 1 96  ? 4.99100   4.97100   6.86800   1.000 74.12204  ? 1172 ILE B N   1 
ATOM   1517 C  CA  . ILE B 1 96  ? 4.79800   3.89800   5.84800   1.000 55.65141  ? 1172 ILE B CA  1 
ATOM   1518 C  C   . ILE B 1 96  ? 3.61300   4.30000   4.96700   1.000 70.63742  ? 1172 ILE B C   1 
ATOM   1519 O  O   . ILE B 1 96  ? 2.52800   4.56900   5.51100   1.000 83.38631  ? 1172 ILE B O   1 
ATOM   1520 C  CB  . ILE B 1 96  ? 4.61000   2.49500   6.46800   1.000 53.47746  ? 1172 ILE B CB  1 
ATOM   1521 C  CG1 . ILE B 1 96  ? 5.91800   1.91700   7.01600   1.000 53.46694  ? 1172 ILE B CG1 1 
ATOM   1522 C  CG2 . ILE B 1 96  ? 3.99600   1.54100   5.45400   1.000 46.07658  ? 1172 ILE B CG2 1 
ATOM   1523 C  CD1 . ILE B 1 96  ? 5.94200   1.73600   8.51000   1.000 51.56145  ? 1172 ILE B CD1 1 
ATOM   1524 N  N   . ASN B 1 97  ? 3.82900   4.35000   3.65500   1.000 63.88661  ? 1173 ASN B N   1 
ATOM   1525 C  CA  . ASN B 1 97  ? 2.80200   4.77500   2.67600   1.000 71.52437  ? 1173 ASN B CA  1 
ATOM   1526 C  C   . ASN B 1 97  ? 2.94300   3.93000   1.40600   1.000 64.48668  ? 1173 ASN B C   1 
ATOM   1527 O  O   . ASN B 1 97  ? 4.08900   3.65300   0.97900   1.000 54.70130  ? 1173 ASN B O   1 
ATOM   1528 C  CB  . ASN B 1 97  ? 2.88000   6.27900   2.41200   1.000 81.15447  ? 1173 ASN B CB  1 
ATOM   1529 C  CG  . ASN B 1 97  ? 2.03600   6.71100   1.23200   1.000 84.47329  ? 1173 ASN B CG  1 
ATOM   1530 O  OD1 . ASN B 1 97  ? 2.48300   6.62300   0.08900   1.000 78.28307  ? 1173 ASN B OD1 1 
ATOM   1531 N  ND2 . ASN B 1 97  ? 0.82400   7.17900   1.49900   1.000 89.73708  ? 1173 ASN B ND2 1 
ATOM   1532 N  N   . ALA B 1 98  ? 1.79900   3.51600   0.85800   1.000 72.92980  ? 1174 ALA B N   1 
ATOM   1533 C  CA  . ALA B 1 98  ? 1.66200   2.79700   -0.42700  1.000 59.23342  ? 1174 ALA B CA  1 
ATOM   1534 C  C   . ALA B 1 98  ? 1.33700   3.82800   -1.50200  1.000 68.58191  ? 1174 ALA B C   1 
ATOM   1535 O  O   . ALA B 1 98  ? 0.34000   4.53700   -1.34500  1.000 79.81746  ? 1174 ALA B O   1 
ATOM   1536 C  CB  . ALA B 1 98  ? 0.57900   1.75300   -0.32800  1.000 55.43296  ? 1174 ALA B CB  1 
ATOM   1537 N  N   . SER B 1 99  ? 2.17600   3.94900   -2.52300  1.000 65.01306  ? 1175 SER B N   1 
ATOM   1538 C  CA  . SER B 1 99  ? 1.94900   4.90100   -3.63000  1.000 65.53417  ? 1175 SER B CA  1 
ATOM   1539 C  C   . SER B 1 99  ? 0.95900   4.26800   -4.60400  1.000 65.92106  ? 1175 SER B C   1 
ATOM   1540 O  O   . SER B 1 99  ? 0.86100   3.03300   -4.62300  1.000 68.17133  ? 1175 SER B O   1 
ATOM   1541 C  CB  . SER B 1 99  ? 3.22900   5.27100   -4.30000  1.000 62.22062  ? 1175 SER B CB  1 
ATOM   1542 O  OG  . SER B 1 99  ? 4.09700   4.15700   -4.32200  1.000 66.56061  ? 1175 SER B OG  1 
ATOM   1543 N  N   . VAL B 1 100 ? 0.25100   5.09700   -5.36800  1.000 51.84832  ? 1176 VAL B N   1 
ATOM   1544 C  CA  . VAL B 1 100 ? -0.70200  4.64000   -6.41500  1.000 61.23892  ? 1176 VAL B CA  1 
ATOM   1545 C  C   . VAL B 1 100 ? -0.00700  4.76900   -7.76700  1.000 67.41335  ? 1176 VAL B C   1 
ATOM   1546 O  O   . VAL B 1 100 ? 1.08300   5.39900   -7.83300  1.000 65.03411  ? 1176 VAL B O   1 
ATOM   1547 C  CB  . VAL B 1 100 ? -2.04700  5.39600   -6.39000  1.000 63.00755  ? 1176 VAL B CB  1 
ATOM   1548 C  CG1 . VAL B 1 100 ? -2.75700  5.20100   -5.06100  1.000 65.61576  ? 1176 VAL B CG1 1 
ATOM   1549 C  CG2 . VAL B 1 100 ? -1.90100  6.87200   -6.71900  1.000 60.12300  ? 1176 VAL B CG2 1 
ATOM   1550 N  N   . VAL B 1 101 ? -0.61600  4.15800   -8.78300  1.000 67.42651  ? 1177 VAL B N   1 
ATOM   1551 C  CA  . VAL B 1 101 ? -0.08500  4.13600   -10.17000 1.000 64.01557  ? 1177 VAL B CA  1 
ATOM   1552 C  C   . VAL B 1 101 ? -1.12700  4.80200   -11.06300 1.000 67.11594  ? 1177 VAL B C   1 
ATOM   1553 O  O   . VAL B 1 101 ? -2.32600  4.59700   -10.81900 1.000 69.27936  ? 1177 VAL B O   1 
ATOM   1554 C  CB  . VAL B 1 101 ? 0.25000   2.71000   -10.63800 1.000 47.56623  ? 1177 VAL B CB  1 
ATOM   1555 C  CG1 . VAL B 1 101 ? -0.99500  1.85200   -10.81800 1.000 52.09046  ? 1177 VAL B CG1 1 
ATOM   1556 C  CG2 . VAL B 1 101 ? 1.05600   2.74900   -11.92000 1.000 44.91328  ? 1177 VAL B CG2 1 
ATOM   1557 N  N   . ASN B 1 102 ? -0.66000  5.57800   -12.03600 1.000 62.51802  ? 1178 ASN B N   1 
ATOM   1558 C  CA  . ASN B 1 102 ? -1.51000  6.28100   -13.02000 1.000 66.58167  ? 1178 ASN B CA  1 
ATOM   1559 C  C   . ASN B 1 102 ? -0.99500  5.92700   -14.41400 1.000 73.97466  ? 1178 ASN B C   1 
ATOM   1560 O  O   . ASN B 1 102 ? 0.02400   6.51500   -14.84500 1.000 75.94858  ? 1178 ASN B O   1 
ATOM   1561 C  CB  . ASN B 1 102 ? -1.53400  7.78800   -12.77000 1.000 81.65979  ? 1178 ASN B CB  1 
ATOM   1562 C  CG  . ASN B 1 102 ? -2.63700  8.48000   -13.53900 1.000 88.88961  ? 1178 ASN B CG  1 
ATOM   1563 O  OD1 . ASN B 1 102 ? -3.02800  8.02100   -14.61200 1.000 83.75478  ? 1178 ASN B OD1 1 
ATOM   1564 N  ND2 . ASN B 1 102 ? -3.15200  9.57200   -12.99500 1.000 96.11152  ? 1178 ASN B ND2 1 
ATOM   1565 N  N   . ILE B 1 103 ? -1.67400  4.98900   -15.07600 1.000 74.43524  ? 1179 ILE B N   1 
ATOM   1566 C  CA  . ILE B 1 103 ? -1.34900  4.55200   -16.46200 1.000 68.31609  ? 1179 ILE B CA  1 
ATOM   1567 C  C   . ILE B 1 103 ? -2.57900  4.75000   -17.34900 1.000 73.94571  ? 1179 ILE B C   1 
ATOM   1568 O  O   . ILE B 1 103 ? -2.59000  4.19000   -18.46200 1.000 71.92441  ? 1179 ILE B O   1 
ATOM   1569 C  CB  . ILE B 1 103 ? -0.85500  3.09400   -16.46100 1.000 61.40473  ? 1179 ILE B CB  1 
ATOM   1570 C  CG1 . ILE B 1 103 ? -1.89500  2.13700   -15.87300 1.000 54.05122  ? 1179 ILE B CG1 1 
ATOM   1571 C  CG2 . ILE B 1 103 ? 0.47200   2.99200   -15.73200 1.000 60.58884  ? 1179 ILE B CG2 1 
ATOM   1572 C  CD1 . ILE B 1 103 ? -1.65500  0.69200   -16.22500 1.000 48.86375  ? 1179 ILE B CD1 1 
ATOM   1573 N  N   . GLN B 1 104 ? -3.55900  5.53500   -16.89100 1.000 70.92429  ? 1180 GLN B N   1 
ATOM   1574 C  CA  . GLN B 1 104 ? -4.83100  5.73800   -17.62800 1.000 74.10625  ? 1180 GLN B CA  1 
ATOM   1575 C  C   . GLN B 1 104 ? -4.52400  6.33400   -19.00800 1.000 77.69353  ? 1180 GLN B C   1 
ATOM   1576 O  O   . GLN B 1 104 ? -5.27400  6.03100   -19.95100 1.000 79.01210  ? 1180 GLN B O   1 
ATOM   1577 C  CB  . GLN B 1 104 ? -5.79500  6.61700   -16.83000 1.000 73.46407  ? 1180 GLN B CB  1 
ATOM   1578 C  CG  . GLN B 1 104 ? -7.20100  6.61300   -17.40400 1.000 77.66458  ? 1180 GLN B CG  1 
ATOM   1579 C  CD  . GLN B 1 104 ? -7.69000  5.20100   -17.58000 1.000 74.87477  ? 1180 GLN B CD  1 
ATOM   1580 O  OE1 . GLN B 1 104 ? -7.96800  4.50200   -16.60700 1.000 78.24359  ? 1180 GLN B OE1 1 
ATOM   1581 N  NE2 . GLN B 1 104 ? -7.76800  4.77000   -18.82800 1.000 72.29025  ? 1180 GLN B NE2 1 
ATOM   1582 N  N   . LYS B 1 105 ? -3.46000  7.13700   -19.11700 1.000 76.22230  ? 1181 LYS B N   1 
ATOM   1583 C  CA  . LYS B 1 105 ? -3.00700  7.77400   -20.38400 1.000 82.48621  ? 1181 LYS B CA  1 
ATOM   1584 C  C   . LYS B 1 105 ? -2.64100  6.70000   -21.41000 1.000 73.47460  ? 1181 LYS B C   1 
ATOM   1585 O  O   . LYS B 1 105 ? -3.02400  6.86600   -22.58700 1.000 76.92501  ? 1181 LYS B O   1 
ATOM   1586 C  CB  . LYS B 1 105 ? -1.78900  8.67100   -20.14100 1.000 89.67654  ? 1181 LYS B CB  1 
ATOM   1587 C  CG  . LYS B 1 105 ? -0.89800  8.92400   -21.35600 1.000 87.62630  ? 1181 LYS B CG  1 
ATOM   1588 C  CD  . LYS B 1 105 ? 0.40000   9.64300   -21.01600 1.000 96.04309  ? 1181 LYS B CD  1 
ATOM   1589 C  CE  . LYS B 1 105 ? 0.24700   11.14300  -20.85700 1.000 109.96055 ? 1181 LYS B CE  1 
ATOM   1590 N  NZ  . LYS B 1 105 ? 0.52300   11.86400  -22.12200 1.000 120.39865 ? 1181 LYS B NZ  1 
ATOM   1591 N  N   . GLU B 1 106 ? -1.88900  5.67900   -20.98000 1.000 63.11020  ? 1182 GLU B N   1 
ATOM   1592 C  CA  . GLU B 1 106 ? -1.37700  4.57800   -21.84400 1.000 62.88649  ? 1182 GLU B CA  1 
ATOM   1593 C  C   . GLU B 1 106 ? -2.52700  3.65100   -22.25300 1.000 65.73420  ? 1182 GLU B C   1 
ATOM   1594 O  O   . GLU B 1 106 ? -2.55700  3.24700   -23.43200 1.000 72.24550  ? 1182 GLU B O   1 
ATOM   1595 C  CB  . GLU B 1 106 ? -0.29000  3.76900   -21.13600 1.000 54.61444  ? 1182 GLU B CB  1 
ATOM   1596 C  CG  . GLU B 1 106 ? 1.03300   4.49800   -21.04700 1.000 61.36525  ? 1182 GLU B CG  1 
ATOM   1597 C  CD  . GLU B 1 106 ? 1.19300   5.34600   -19.80200 1.000 67.17648  ? 1182 GLU B CD  1 
ATOM   1598 O  OE1 . GLU B 1 106 ? 2.34500   5.71900   -19.49500 1.000 71.07168  ? 1182 GLU B OE1 1 
ATOM   1599 O  OE2 . GLU B 1 106 ? 0.16800   5.61900   -19.14200 1.000 75.73013  ? 1182 GLU B OE2 1 
ATOM   1600 N  N   . ILE B 1 107 ? -3.42500  3.32700   -21.31900 1.000 54.71972  ? 1183 ILE B N   1 
ATOM   1601 C  CA  . ILE B 1 107 ? -4.62100  2.47300   -21.57600 1.000 49.72438  ? 1183 ILE B CA  1 
ATOM   1602 C  C   . ILE B 1 107 ? -5.47300  3.15100   -22.65400 1.000 59.58609  ? 1183 ILE B C   1 
ATOM   1603 O  O   . ILE B 1 107 ? -5.91600  2.45600   -23.60600 1.000 51.92728  ? 1183 ILE B O   1 
ATOM   1604 C  CB  . ILE B 1 107 ? -5.42400  2.24700   -20.28300 1.000 59.99140  ? 1183 ILE B CB  1 
ATOM   1605 C  CG1 . ILE B 1 107 ? -4.60700  1.51500   -19.22000 1.000 52.81423  ? 1183 ILE B CG1 1 
ATOM   1606 C  CG2 . ILE B 1 107 ? -6.72900  1.52700   -20.57800 1.000 75.02215  ? 1183 ILE B CG2 1 
ATOM   1607 C  CD1 . ILE B 1 107 ? -5.31500  1.41500   -17.89800 1.000 56.76733  ? 1183 ILE B CD1 1 
ATOM   1608 N  N   . ASP B 1 108 ? -5.70800  4.45500   -22.48900 1.000 57.68060  ? 1184 ASP B N   1 
ATOM   1609 C  CA  . ASP B 1 108 ? -6.51500  5.26700   -23.43400 1.000 61.83110  ? 1184 ASP B CA  1 
ATOM   1610 C  C   . ASP B 1 108 ? -5.83000  5.13500   -24.79300 1.000 69.29778  ? 1184 ASP B C   1 
ATOM   1611 O  O   . ASP B 1 108 ? -6.51700  4.72900   -25.74700 1.000 76.66182  ? 1184 ASP B O   1 
ATOM   1612 C  CB  . ASP B 1 108 ? -6.67700  6.71700   -22.95700 1.000 80.52544  ? 1184 ASP B CB  1 
ATOM   1613 C  CG  . ASP B 1 108 ? -7.59000  6.91800   -21.74700 1.000 82.22565  ? 1184 ASP B CG  1 
ATOM   1614 O  OD1 . ASP B 1 108 ? -8.15500  5.91600   -21.24400 1.000 71.67965  ? 1184 ASP B OD1 1 
ATOM   1615 O  OD2 . ASP B 1 108 ? -7.73500  8.08800   -21.31200 1.000 80.97550  ? 1184 ASP B OD2 1 
ATOM   1616 N  N   . ARG B 1 109 ? -4.51200  5.37600   -24.83700 1.000 70.13472  ? 1185 ARG B N   1 
ATOM   1617 C  CA  . ARG B 1 109 ? -3.70100  5.36700   -26.08400 1.000 66.46586  ? 1185 ARG B CA  1 
ATOM   1618 C  C   . ARG B 1 109 ? -3.82700  4.01400   -26.79000 1.000 63.23390  ? 1185 ARG B C   1 
ATOM   1619 O  O   . ARG B 1 109 ? -3.96000  4.02300   -28.03300 1.000 74.68527  ? 1185 ARG B O   1 
ATOM   1620 C  CB  . ARG B 1 109 ? -2.22500  5.64600   -25.81600 1.000 64.61301  ? 1185 ARG B CB  1 
ATOM   1621 C  CG  . ARG B 1 109 ? -1.44900  5.97200   -27.08600 1.000 68.89773  ? 1185 ARG B CG  1 
ATOM   1622 C  CD  . ARG B 1 109 ? -1.20200  7.46300   -27.28900 1.000 89.23702  ? 1185 ARG B CD  1 
ATOM   1623 N  NE  . ARG B 1 109 ? -0.57600  8.06500   -26.10900 1.000 101.37005 ? 1185 ARG B NE  1 
ATOM   1624 C  CZ  . ARG B 1 109 ? -0.52800  9.36700   -25.82600 1.000 103.29133 ? 1185 ARG B CZ  1 
ATOM   1625 N  NH1 . ARG B 1 109 ? -1.07200  10.25600  -26.64200 1.000 103.43872 ? 1185 ARG B NH1 1 
ATOM   1626 N  NH2 . ARG B 1 109 ? 0.06200   9.77500   -24.71200 1.000 100.88315 ? 1185 ARG B NH2 1 
ATOM   1627 N  N   . LEU B 1 110 ? -3.78600  2.90400   -26.04200 1.000 52.43260  ? 1186 LEU B N   1 
ATOM   1628 C  CA  . LEU B 1 110 ? -3.94700  1.53600   -26.60300 1.000 48.41633  ? 1186 LEU B CA  1 
ATOM   1629 C  C   . LEU B 1 110 ? -5.32000  1.40600   -27.25500 1.000 55.51718  ? 1186 LEU B C   1 
ATOM   1630 O  O   . LEU B 1 110 ? -5.37400  0.91900   -28.39500 1.000 67.35808  ? 1186 LEU B O   1 
ATOM   1631 C  CB  . LEU B 1 110 ? -3.79800  0.48100   -25.50700 1.000 48.16104  ? 1186 LEU B CB  1 
ATOM   1632 C  CG  . LEU B 1 110 ? -2.37300  0.19200   -25.04200 1.000 46.96616  ? 1186 LEU B CG  1 
ATOM   1633 C  CD1 . LEU B 1 110 ? -2.37300  -0.94900  -24.04600 1.000 46.43715  ? 1186 LEU B CD1 1 
ATOM   1634 C  CD2 . LEU B 1 110 ? -1.45900  -0.13500  -26.21300 1.000 47.12670  ? 1186 LEU B CD2 1 
ATOM   1635 N  N   . ASN B 1 111 ? -6.38300  1.79400   -26.54700 1.000 50.21392  ? 1187 ASN B N   1 
ATOM   1636 C  CA  . ASN B 1 111 ? -7.77200  1.72400   -27.07700 1.000 52.50893  ? 1187 ASN B CA  1 
ATOM   1637 C  C   . ASN B 1 111 ? -7.89000  2.66200   -28.28500 1.000 54.35389  ? 1187 ASN B C   1 
ATOM   1638 O  O   . ASN B 1 111 ? -8.56200  2.28900   -29.25000 1.000 55.68562  ? 1187 ASN B O   1 
ATOM   1639 C  CB  . ASN B 1 111 ? -8.80800  1.99500   -25.98600 1.000 51.88254  ? 1187 ASN B CB  1 
ATOM   1640 C  CG  . ASN B 1 111 ? -8.89700  0.86200   -24.98000 1.000 56.73575  ? 1187 ASN B CG  1 
ATOM   1641 O  OD1 . ASN B 1 111 ? -9.07600  1.09700   -23.78400 1.000 62.37590  ? 1187 ASN B OD1 1 
ATOM   1642 N  ND2 . ASN B 1 111 ? -8.78000  -0.37600  -25.44700 1.000 44.32110  ? 1187 ASN B ND2 1 
ATOM   1643 N  N   . GLU B 1 112 ? -7.23400  3.81700   -28.25100 1.000 59.13604  ? 1188 GLU B N   1 
ATOM   1644 C  CA  . GLU B 1 112 ? -7.26000  4.77800   -29.37500 1.000 65.44732  ? 1188 GLU B CA  1 
ATOM   1645 C  C   . GLU B 1 112 ? -6.68100  4.06400   -30.60100 1.000 71.53489  ? 1188 GLU B C   1 
ATOM   1646 O  O   . GLU B 1 112 ? -7.37700  3.99800   -31.63900 1.000 64.12874  ? 1188 GLU B O   1 
ATOM   1647 C  CB  . GLU B 1 112 ? -6.51600  6.06300   -28.98700 1.000 77.94619  ? 1188 GLU B CB  1 
ATOM   1648 C  CG  . GLU B 1 112 ? -5.84200  6.78500   -30.14800 1.000 84.42065  ? 1188 GLU B CG  1 
ATOM   1649 C  CD  . GLU B 1 112 ? -5.55100  8.25500   -29.90500 1.000 93.71650  ? 1188 GLU B CD  1 
ATOM   1650 O  OE1 . GLU B 1 112 ? -6.40000  9.09100   -30.30300 1.000 98.14071  ? 1188 GLU B OE1 1 
ATOM   1651 O  OE2 . GLU B 1 112 ? -4.47400  8.56100   -29.33000 1.000 97.86173  ? 1188 GLU B OE2 1 
ATOM   1652 N  N   . VAL B 1 113 ? -5.46100  3.52900   -30.47900 1.000 69.20830  ? 1189 VAL B N   1 
ATOM   1653 C  CA  . VAL B 1 113 ? -4.72900  2.88600   -31.61200 1.000 62.25746  ? 1189 VAL B CA  1 
ATOM   1654 C  C   . VAL B 1 113 ? -5.54100  1.69000   -32.12200 1.000 58.79652  ? 1189 VAL B C   1 
ATOM   1655 O  O   . VAL B 1 113 ? -5.54000  1.48200   -33.34400 1.000 65.25782  ? 1189 VAL B O   1 
ATOM   1656 C  CB  . VAL B 1 113 ? -3.29900  2.45300   -31.24100 1.000 59.10445  ? 1189 VAL B CB  1 
ATOM   1657 C  CG1 . VAL B 1 113 ? -2.63700  1.74500   -32.41500 1.000 53.65907  ? 1189 VAL B CG1 1 
ATOM   1658 C  CG2 . VAL B 1 113 ? -2.43800  3.62100   -30.77700 1.000 61.10996  ? 1189 VAL B CG2 1 
ATOM   1659 N  N   . ALA B 1 114 ? -6.20000  0.94500   -31.23000 1.000 50.08495  ? 1190 ALA B N   1 
ATOM   1660 C  CA  . ALA B 1 114 ? -7.09400  -0.18500  -31.58000 1.000 61.31261  ? 1190 ALA B CA  1 
ATOM   1661 C  C   . ALA B 1 114 ? -8.20400  0.27500   -32.54200 1.000 64.47615  ? 1190 ALA B C   1 
ATOM   1662 O  O   . ALA B 1 114 ? -8.44000  -0.44100  -33.54700 1.000 56.53836  ? 1190 ALA B O   1 
ATOM   1663 C  CB  . ALA B 1 114 ? -7.67000  -0.81200  -30.33200 1.000 58.76494  ? 1190 ALA B CB  1 
ATOM   1664 N  N   . LYS B 1 115 ? -8.85100  1.41800   -32.25700 1.000 60.27038  ? 1191 LYS B N   1 
ATOM   1665 C  CA  . LYS B 1 115 ? -9.90900  2.05200   -33.10400 1.000 69.22672  ? 1191 LYS B CA  1 
ATOM   1666 C  C   . LYS B 1 115 ? -9.27400  2.70200   -34.34100 1.000 70.87429  ? 1191 LYS B C   1 
ATOM   1667 O  O   . LYS B 1 115 ? -9.86300  2.58800   -35.42400 1.000 73.76148  ? 1191 LYS B O   1 
ATOM   1668 C  CB  . LYS B 1 115 ? -10.68400 3.10800   -32.30800 1.000 75.49853  ? 1191 LYS B CB  1 
ATOM   1669 C  CG  . LYS B 1 115 ? -11.75200 3.87500   -33.08500 1.000 78.57258  ? 1191 LYS B CG  1 
ATOM   1670 C  CD  . LYS B 1 115 ? -11.87100 5.33900   -32.68100 1.000 75.68276  ? 1191 LYS B CD  1 
ATOM   1671 C  CE  . LYS B 1 115 ? -12.82600 6.13600   -33.54800 1.000 80.05434  ? 1191 LYS B CE  1 
ATOM   1672 N  NZ  . LYS B 1 115 ? -12.36500 7.53700   -33.74000 1.000 84.65225  ? 1191 LYS B NZ  1 
ATOM   1673 N  N   . ASN B 1 116 ? -8.12600  3.36600   -34.18400 1.000 70.95588  ? 1192 ASN B N   1 
ATOM   1674 C  CA  . ASN B 1 116 ? -7.42000  4.05800   -35.29400 1.000 72.04548  ? 1192 ASN B CA  1 
ATOM   1675 C  C   . ASN B 1 116 ? -7.00700  3.06500   -36.38800 1.000 70.46634  ? 1192 ASN B C   1 
ATOM   1676 O  O   . ASN B 1 116 ? -6.86100  3.52500   -37.53900 1.000 80.43859  ? 1192 ASN B O   1 
ATOM   1677 C  CB  . ASN B 1 116 ? -6.15400  4.78900   -34.84000 1.000 77.94356  ? 1192 ASN B CB  1 
ATOM   1678 C  CG  . ASN B 1 116 ? -6.39900  6.05500   -34.04800 1.000 81.78349  ? 1192 ASN B CG  1 
ATOM   1679 O  OD1 . ASN B 1 116 ? -7.52000  6.34400   -33.62100 1.000 86.98675  ? 1192 ASN B OD1 1 
ATOM   1680 N  ND2 . ASN B 1 116 ? -5.33300  6.81200   -33.83900 1.000 75.79856  ? 1192 ASN B ND2 1 
ATOM   1681 N  N   . LEU B 1 117 ? -6.76300  1.78400   -36.05900 1.000 68.70034  ? 1193 LEU B N   1 
ATOM   1682 C  CA  . LEU B 1 117 ? -6.16100  0.81300   -37.02200 1.000 65.37626  ? 1193 LEU B CA  1 
ATOM   1683 C  C   . LEU B 1 117 ? -7.17500  0.46300   -38.11100 1.000 73.96413  ? 1193 LEU B C   1 
ATOM   1684 O  O   . LEU B 1 117 ? -6.73800  -0.06200  -39.15000 1.000 81.77823  ? 1193 LEU B O   1 
ATOM   1685 C  CB  . LEU B 1 117 ? -5.65800  -0.45200  -36.31800 1.000 56.52257  ? 1193 LEU B CB  1 
ATOM   1686 C  CG  . LEU B 1 117 ? -4.20900  -0.39500  -35.82000 1.000 59.14130  ? 1193 LEU B CG  1 
ATOM   1687 C  CD1 . LEU B 1 117 ? -3.87800  -1.61200  -34.97500 1.000 44.76326  ? 1193 LEU B CD1 1 
ATOM   1688 C  CD2 . LEU B 1 117 ? -3.21500  -0.26500  -36.96700 1.000 49.56910  ? 1193 LEU B CD2 1 
ATOM   1689 N  N   . ASN B 1 118 ? -8.46100  0.76200   -37.89700 1.000 66.60535  ? 1194 ASN B N   1 
ATOM   1690 C  CA  . ASN B 1 118 ? -9.51800  0.67300   -38.94300 1.000 71.88493  ? 1194 ASN B CA  1 
ATOM   1691 C  C   . ASN B 1 118 ? -9.16000  1.56700   -40.14000 1.000 77.88302  ? 1194 ASN B C   1 
ATOM   1692 O  O   . ASN B 1 118 ? -9.52400  1.19800   -41.27000 1.000 84.53908  ? 1194 ASN B O   1 
ATOM   1693 C  CB  . ASN B 1 118 ? -10.89500 1.03900   -38.39500 1.000 66.05792  ? 1194 ASN B CB  1 
ATOM   1694 C  CG  . ASN B 1 118 ? -11.43100 -0.03800  -37.48700 1.000 70.77164  ? 1194 ASN B CG  1 
ATOM   1695 O  OD1 . ASN B 1 118 ? -11.40900 -1.21400  -37.84400 1.000 65.82895  ? 1194 ASN B OD1 1 
ATOM   1696 N  ND2 . ASN B 1 118 ? -11.88500 0.35800   -36.31000 1.000 82.15985  ? 1194 ASN B ND2 1 
ATOM   1697 N  N   . GLU B 1 119 ? -8.45700  2.68200   -39.91300 1.000 77.65931  ? 1195 GLU B N   1 
ATOM   1698 C  CA  . GLU B 1 119 ? -8.07600  3.65200   -40.97700 1.000 85.23390  ? 1195 GLU B CA  1 
ATOM   1699 C  C   . GLU B 1 119 ? -6.77900  3.20500   -41.65000 1.000 77.49877  ? 1195 GLU B C   1 
ATOM   1700 O  O   . GLU B 1 119 ? -6.30500  3.92400   -42.54500 1.000 79.06211  ? 1195 GLU B O   1 
ATOM   1701 C  CB  . GLU B 1 119 ? -7.93300  5.06100   -40.39700 1.000 88.34217  ? 1195 GLU B CB  1 
ATOM   1702 C  CG  . GLU B 1 119 ? -9.26400  5.68100   -39.99400 1.000 94.07707  ? 1195 GLU B CG  1 
ATOM   1703 C  CD  . GLU B 1 119 ? -9.28000  6.26300   -38.58900 1.000 100.64101 ? 1195 GLU B CD  1 
ATOM   1704 O  OE1 . GLU B 1 119 ? -8.28700  6.93500   -38.20600 1.000 103.10447 ? 1195 GLU B OE1 1 
ATOM   1705 O  OE2 . GLU B 1 119 ? -10.27200 6.01600   -37.86400 1.000 102.97024 ? 1195 GLU B OE2 1 
ATOM   1706 N  N   . SER B 1 120 ? -6.23400  2.06200   -41.23400 1.000 76.44074  ? 1196 SER B N   1 
ATOM   1707 C  CA  . SER B 1 120 ? -5.01800  1.45500   -41.82300 1.000 72.12707  ? 1196 SER B CA  1 
ATOM   1708 C  C   . SER B 1 120 ? -5.39400  0.26500   -42.70300 1.000 70.87692  ? 1196 SER B C   1 
ATOM   1709 O  O   . SER B 1 120 ? -4.47700  -0.33200  -43.28900 1.000 76.32231  ? 1196 SER B O   1 
ATOM   1710 C  CB  . SER B 1 120 ? -4.04100  1.06500   -40.75600 1.000 75.93016  ? 1196 SER B CB  1 
ATOM   1711 O  OG  . SER B 1 120 ? -3.25800  2.18900   -40.39000 1.000 93.05853  ? 1196 SER B OG  1 
ATOM   1712 N  N   . LEU B 1 121 ? -6.68100  -0.06600  -42.81400 1.000 68.54769  ? 1197 LEU B N   1 
ATOM   1713 C  CA  . LEU B 1 121 ? -7.11100  -1.25000  -43.60100 1.000 61.32051  ? 1197 LEU B CA  1 
ATOM   1714 C  C   . LEU B 1 121 ? -7.07300  -0.90600  -45.09100 1.000 79.65955  ? 1197 LEU B C   1 
ATOM   1715 O  O   . LEU B 1 121 ? -7.02800  0.29400   -45.42900 1.000 94.52449  ? 1197 LEU B O   1 
ATOM   1716 C  CB  . LEU B 1 121 ? -8.49800  -1.70000  -43.13900 1.000 66.42639  ? 1197 LEU B CB  1 
ATOM   1717 C  CG  . LEU B 1 121 ? -8.55200  -2.31400  -41.73800 1.000 57.35161  ? 1197 LEU B CG  1 
ATOM   1718 C  CD1 . LEU B 1 121 ? -9.97700  -2.66900  -41.34600 1.000 57.72797  ? 1197 LEU B CD1 1 
ATOM   1719 C  CD2 . LEU B 1 121 ? -7.66400  -3.54500  -41.64700 1.000 68.35030  ? 1197 LEU B CD2 1 
ATOM   1720 N  N   . ILE B 1 122 ? -7.04000  -1.93600  -45.93500 1.000 79.27266  ? 1198 ILE B N   1 
ATOM   1721 C  CA  . ILE B 1 122 ? -6.93400  -1.80800  -47.41300 1.000 76.53023  ? 1198 ILE B CA  1 
ATOM   1722 C  C   . ILE B 1 122 ? -8.28700  -2.15400  -48.02500 1.000 77.61457  ? 1198 ILE B C   1 
ATOM   1723 O  O   . ILE B 1 122 ? -8.67900  -3.31500  -47.87500 1.000 79.58586  ? 1198 ILE B O   1 
ATOM   1724 C  CB  . ILE B 1 122 ? -5.82900  -2.73700  -47.94400 1.000 70.05314  ? 1198 ILE B CB  1 
ATOM   1725 C  CG1 . ILE B 1 122 ? -4.50400  -2.47800  -47.22400 1.000 68.77404  ? 1198 ILE B CG1 1 
ATOM   1726 C  CG2 . ILE B 1 122 ? -5.69400  -2.60800  -49.45300 1.000 68.99511  ? 1198 ILE B CG2 1 
ATOM   1727 C  CD1 . ILE B 1 122 ? -3.37600  -3.37900  -47.66700 1.000 60.83361  ? 1198 ILE B CD1 1 
ATOM   1728 N  N   . ASP B 1 123 ? -8.86600  -1.20800  -48.76600 1.000 78.08041  ? 1199 ASP B N   1 
ATOM   1729 C  CA  . ASP B 1 123 ? -9.92400  -1.44100  -49.74000 1.000 77.25400  ? 1199 ASP B CA  1 
ATOM   1730 C  C   . ASP B 1 123 ? -9.36600  -1.18000  -51.15100 1.000 80.53597  ? 1199 ASP B C   1 
ATOM   1731 O  O   . ASP B 1 123 ? -9.41300  -0.05900  -51.65900 1.000 81.92824  ? 1199 ASP B O   1 
ATOM   1732 C  CB  . ASP B 1 123 ? -11.12300 -0.53300  -49.46500 1.000 79.86747  ? 1199 ASP B CB  1 
ATOM   1733 C  CG  . ASP B 1 123 ? -12.43100 -1.13700  -49.93500 1.000 94.17182  ? 1199 ASP B CG  1 
ATOM   1734 O  OD1 . ASP B 1 123 ? -12.45200 -1.73500  -51.03200 1.000 101.62797 ? 1199 ASP B OD1 1 
ATOM   1735 O  OD2 . ASP B 1 123 ? -13.43900 -1.01400  -49.20800 1.000 94.90875  ? 1199 ASP B OD2 1 
ATOM   1736 N  N   . LEU B 1 124 ? -8.83600  -2.23700  -51.75900 1.000 74.75896  ? 1200 LEU B N   1 
ATOM   1737 C  CA  . LEU B 1 124 ? -8.12700  -2.22700  -53.06700 1.000 76.69604  ? 1200 LEU B CA  1 
ATOM   1738 C  C   . LEU B 1 124 ? -9.04400  -1.70100  -54.18200 1.000 81.14131  ? 1200 LEU B C   1 
ATOM   1739 O  O   . LEU B 1 124 ? -10.28500 -1.73100  -54.00700 1.000 82.12300  ? 1200 LEU B O   1 
ATOM   1740 C  CB  . LEU B 1 124 ? -7.67700  -3.65700  -53.37800 1.000 73.77990  ? 1200 LEU B CB  1 
ATOM   1741 C  CG  . LEU B 1 124 ? -6.38400  -4.10400  -52.70300 1.000 70.31633  ? 1200 LEU B CG  1 
ATOM   1742 C  CD1 . LEU B 1 124 ? -6.10200  -5.57500  -52.99100 1.000 67.75812  ? 1200 LEU B CD1 1 
ATOM   1743 C  CD2 . LEU B 1 124 ? -5.21500  -3.23900  -53.15300 1.000 72.29025  ? 1200 LEU B CD2 1 
ATOM   1744 N  N   . GLN B 1 125 ? -8.44400  -1.26500  -55.29700 1.000 94.84821  ? 1201 GLN B N   1 
ATOM   1745 C  CA  . GLN B 1 125 ? -9.14800  -0.83700  -56.53900 1.000 99.69880  ? 1201 GLN B CA  1 
ATOM   1746 C  C   . GLN B 1 125 ? -9.53800  -2.08500  -57.34800 1.000 103.47556 ? 1201 GLN B C   1 
ATOM   1747 O  O   . GLN B 1 125 ? -8.62100  -2.81200  -57.80200 1.000 94.54028  ? 1201 GLN B O   1 
ATOM   1748 C  CB  . GLN B 1 125 ? -8.26700  0.11300   -57.35900 1.000 100.96737 ? 1201 GLN B CB  1 
ATOM   1749 C  CG  . GLN B 1 125 ? -8.48100  1.59000   -57.04800 1.000 107.59974 ? 1201 GLN B CG  1 
ATOM   1750 C  CD  . GLN B 1 125 ? -9.55100  2.22000   -57.91000 1.000 116.45607 ? 1201 GLN B CD  1 
ATOM   1751 O  OE1 . GLN B 1 125 ? -10.70200 1.78700   -57.91300 1.000 123.64904 ? 1201 GLN B OE1 1 
ATOM   1752 N  NE2 . GLN B 1 125 ? -9.18000  3.26400   -58.63700 1.000 115.06906 ? 1201 GLN B NE2 1 
ATOM   1753 N  N   . GLU B 1 126 ? -10.84900 -2.32700  -57.49500 1.000 122.80946 ? 1202 GLU B N   1 
ATOM   1754 C  CA  . GLU B 1 126 ? -11.44600 -3.42700  -58.30600 1.000 117.76412 ? 1202 GLU B CA  1 
ATOM   1755 C  C   . GLU B 1 126 ? -11.10900 -3.19600  -59.78600 1.000 119.77489 ? 1202 GLU B C   1 
ATOM   1756 O  O   . GLU B 1 126 ? -10.69800 -4.11900  -60.52500 1.000 122.64365 ? 1202 GLU B O   1 
ATOM   1757 C  CB  . GLU B 1 126 ? -12.96500 -3.50800  -58.09800 1.000 118.07732 ? 1202 GLU B CB  1 
ATOM   1758 C  CG  . GLU B 1 126 ? -13.38300 -4.32200  -56.88200 1.000 119.02480 ? 1202 GLU B CG  1 
ATOM   1759 C  CD  . GLU B 1 126 ? -14.09500 -3.56200  -55.77200 1.000 121.93304 ? 1202 GLU B CD  1 
ATOM   1760 O  OE1 . GLU B 1 126 ? -15.20400 -3.04100  -56.02600 1.000 124.56230 ? 1202 GLU B OE1 1 
ATOM   1761 O  OE2 . GLU B 1 126 ? -13.54600 -3.50300  -54.65000 1.000 118.19575 ? 1202 GLU B OE2 1 
ATOM   1762 N  N   . THR C 1 3   ? -4.40600  -0.61500  -66.68100 1.000 109.77632 ? 912  THR C N   1 
ATOM   1763 C  CA  . THR C 1 3   ? -4.43600  -1.76700  -65.73200 1.000 114.31897 ? 912  THR C CA  1 
ATOM   1764 C  C   . THR C 1 3   ? -3.17900  -1.69800  -64.85000 1.000 113.35043 ? 912  THR C C   1 
ATOM   1765 O  O   . THR C 1 3   ? -3.34900  -1.64100  -63.62100 1.000 106.21800 ? 912  THR C O   1 
ATOM   1766 C  CB  . THR C 1 3   ? -4.62600  -3.10400  -66.46900 1.000 116.00338 ? 912  THR C CB  1 
ATOM   1767 O  OG1 . THR C 1 3   ? -3.43300  -3.42800  -67.18300 1.000 120.40391 ? 912  THR C OG1 1 
ATOM   1768 C  CG2 . THR C 1 3   ? -5.79500  -3.09700  -67.43200 1.000 108.27614 ? 912  THR C CG2 1 
ATOM   1769 N  N   . GLN C 1 4   ? -1.97800  -1.63500  -65.44600 1.000 114.68480 ? 913  GLN C N   1 
ATOM   1770 C  CA  . GLN C 1 4   ? -0.67600  -1.59100  -64.71300 1.000 116.69820 ? 913  GLN C CA  1 
ATOM   1771 C  C   . GLN C 1 4   ? -0.54000  -0.27900  -63.92000 1.000 117.34038 ? 913  GLN C C   1 
ATOM   1772 O  O   . GLN C 1 4   ? 0.32100   -0.24400  -63.01900 1.000 117.99836 ? 913  GLN C O   1 
ATOM   1773 C  CB  . GLN C 1 4   ? 0.51800   -1.79400  -65.65500 1.000 120.61973 ? 913  GLN C CB  1 
ATOM   1774 C  CG  . GLN C 1 4   ? 0.98400   -3.24500  -65.75600 1.000 117.04561 ? 913  GLN C CG  1 
ATOM   1775 C  CD  . GLN C 1 4   ? 0.05400   -4.13200  -66.55200 1.000 109.98950 ? 913  GLN C CD  1 
ATOM   1776 O  OE1 . GLN C 1 4   ? -0.69700  -3.67600  -67.40800 1.000 111.66602 ? 913  GLN C OE1 1 
ATOM   1777 N  NE2 . GLN C 1 4   ? 0.10600   -5.42500  -66.27400 1.000 100.44362 ? 913  GLN C NE2 1 
ATOM   1778 N  N   . ASN C 1 5   ? -1.34000  0.75300   -64.23300 1.000 114.90062 ? 914  ASN C N   1 
ATOM   1779 C  CA  . ASN C 1 5   ? -1.50000  1.97700   -63.39300 1.000 120.14598 ? 914  ASN C CA  1 
ATOM   1780 C  C   . ASN C 1 5   ? -2.22900  1.58800   -62.09800 1.000 121.95936 ? 914  ASN C C   1 
ATOM   1781 O  O   . ASN C 1 5   ? -1.72400  1.93700   -61.00700 1.000 124.65442 ? 914  ASN C O   1 
ATOM   1782 C  CB  . ASN C 1 5   ? -2.23400  3.10800   -64.13000 1.000 118.14574 ? 914  ASN C CB  1 
ATOM   1783 C  CG  . ASN C 1 5   ? -2.38900  4.38200   -63.31700 1.000 116.05865 ? 914  ASN C CG  1 
ATOM   1784 O  OD1 . ASN C 1 5   ? -1.90400  5.43900   -63.71400 1.000 120.95661 ? 914  ASN C OD1 1 
ATOM   1785 N  ND2 . ASN C 1 5   ? -3.07800  4.31300   -62.18900 1.000 113.91103 ? 914  ASN C ND2 1 
ATOM   1786 N  N   . VAL C 1 6   ? -3.36200  0.88400   -62.22100 1.000 117.23774 ? 915  VAL C N   1 
ATOM   1787 C  CA  . VAL C 1 6   ? -4.21900  0.43900   -61.07900 1.000 108.31562 ? 915  VAL C CA  1 
ATOM   1788 C  C   . VAL C 1 6   ? -3.37500  -0.43400  -60.14700 1.000 101.30425 ? 915  VAL C C   1 
ATOM   1789 O  O   . VAL C 1 6   ? -3.46500  -0.24700  -58.92200 1.000 102.31753 ? 915  VAL C O   1 
ATOM   1790 C  CB  . VAL C 1 6   ? -5.47000  -0.32700  -61.55400 1.000 108.33141 ? 915  VAL C CB  1 
ATOM   1791 C  CG1 . VAL C 1 6   ? -6.29700  -0.83500  -60.38100 1.000 96.85372  ? 915  VAL C CG1 1 
ATOM   1792 C  CG2 . VAL C 1 6   ? -6.32700  0.50600   -62.49800 1.000 114.64269 ? 915  VAL C CG2 1 
ATOM   1793 N  N   . LEU C 1 7   ? -2.60500  -1.36300  -60.71900 1.000 100.58574 ? 916  LEU C N   1 
ATOM   1794 C  CA  . LEU C 1 7   ? -1.69900  -2.27300  -59.97200 1.000 90.50032  ? 916  LEU C CA  1 
ATOM   1795 C  C   . LEU C 1 7   ? -0.70800  -1.43900  -59.17000 1.000 90.78457  ? 916  LEU C C   1 
ATOM   1796 O  O   . LEU C 1 7   ? -0.62400  -1.65500  -57.95500 1.000 88.10267  ? 916  LEU C O   1 
ATOM   1797 C  CB  . LEU C 1 7   ? -0.96100  -3.18800  -60.94900 1.000 84.34696  ? 916  LEU C CB  1 
ATOM   1798 C  CG  . LEU C 1 7   ? -1.76600  -4.39500  -61.41400 1.000 88.91329  ? 916  LEU C CG  1 
ATOM   1799 C  CD1 . LEU C 1 7   ? -1.08400  -5.09300  -62.57900 1.000 97.12480  ? 916  LEU C CD1 1 
ATOM   1800 C  CD2 . LEU C 1 7   ? -1.98500  -5.36100  -60.26400 1.000 88.30532  ? 916  LEU C CD2 1 
ATOM   1801 N  N   . TYR C 1 8   ? -0.00500  -0.51900  -59.83000 1.000 96.86951  ? 917  TYR C N   1 
ATOM   1802 C  CA  . TYR C 1 8   ? 1.03800   0.32200   -59.19200 1.000 98.90660  ? 917  TYR C CA  1 
ATOM   1803 C  C   . TYR C 1 8   ? 0.39200   1.14900   -58.07700 1.000 102.80970 ? 917  TYR C C   1 
ATOM   1804 O  O   . TYR C 1 8   ? 0.95600   1.17500   -56.97100 1.000 109.55524 ? 917  TYR C O   1 
ATOM   1805 C  CB  . TYR C 1 8   ? 1.77800   1.19900   -60.20400 1.000 109.84212 ? 917  TYR C CB  1 
ATOM   1806 C  CG  . TYR C 1 8   ? 2.90000   2.00300   -59.59400 1.000 115.78757 ? 917  TYR C CG  1 
ATOM   1807 C  CD1 . TYR C 1 8   ? 3.93300   1.37700   -58.90800 1.000 123.12266 ? 917  TYR C CD1 1 
ATOM   1808 C  CD2 . TYR C 1 8   ? 2.93000   3.38700   -59.67900 1.000 110.59747 ? 917  TYR C CD2 1 
ATOM   1809 C  CE1 . TYR C 1 8   ? 4.96700   2.09800   -58.33000 1.000 123.32531 ? 917  TYR C CE1 1 
ATOM   1810 C  CE2 . TYR C 1 8   ? 3.96000   4.12200   -59.11400 1.000 112.17134 ? 917  TYR C CE2 1 
ATOM   1811 C  CZ  . TYR C 1 8   ? 4.98200   3.47700   -58.43300 1.000 118.22207 ? 917  TYR C CZ  1 
ATOM   1812 O  OH  . TYR C 1 8   ? 6.00300   4.18600   -57.86700 1.000 117.48251 ? 917  TYR C OH  1 
ATOM   1813 N  N   . GLU C 1 9   ? -0.76400  1.76800   -58.33500 1.000 101.10423 ? 918  GLU C N   1 
ATOM   1814 C  CA  . GLU C 1 9   ? -1.44300  2.63800   -57.33600 1.000 104.21513 ? 918  GLU C CA  1 
ATOM   1815 C  C   . GLU C 1 9   ? -1.91200  1.76100   -56.16600 1.000 95.35354  ? 918  GLU C C   1 
ATOM   1816 O  O   . GLU C 1 9   ? -1.84400  2.24600   -55.02200 1.000 94.55081  ? 918  GLU C O   1 
ATOM   1817 C  CB  . GLU C 1 9   ? -2.52300  3.50700   -57.99800 1.000 103.58084 ? 918  GLU C CB  1 
ATOM   1818 C  CG  . GLU C 1 9   ? -1.91200  4.61400   -58.86100 1.000 114.51636 ? 918  GLU C CG  1 
ATOM   1819 C  CD  . GLU C 1 9   ? -2.74900  5.83300   -59.22400 1.000 118.92479 ? 918  GLU C CD  1 
ATOM   1820 O  OE1 . GLU C 1 9   ? -3.85800  5.99800   -58.67700 1.000 118.81688 ? 918  GLU C OE1 1 
ATOM   1821 O  OE2 . GLU C 1 9   ? -2.26600  6.63800   -60.05000 1.000 116.29552 ? 918  GLU C OE2 1 
ATOM   1822 N  N   . ASN C 1 10  ? -2.29300  0.50700   -56.42700 1.000 84.28905  ? 919  ASN C N   1 
ATOM   1823 C  CA  . ASN C 1 10  ? -2.67000  -0.47200  -55.37300 1.000 83.67319  ? 919  ASN C CA  1 
ATOM   1824 C  C   . ASN C 1 10  ? -1.44000  -0.77600  -54.51200 1.000 85.03651  ? 919  ASN C C   1 
ATOM   1825 O  O   . ASN C 1 10  ? -1.59700  -0.86900  -53.27800 1.000 86.31298  ? 919  ASN C O   1 
ATOM   1826 C  CB  . ASN C 1 10  ? -3.27600  -1.75300  -55.95200 1.000 85.24180  ? 919  ASN C CB  1 
ATOM   1827 C  CG  . ASN C 1 10  ? -4.74900  -1.61800  -56.27600 1.000 89.92657  ? 919  ASN C CG  1 
ATOM   1828 O  OD1 . ASN C 1 10  ? -5.44300  -0.79500  -55.68400 1.000 98.21441  ? 919  ASN C OD1 1 
ATOM   1829 N  ND2 . ASN C 1 10  ? -5.23900  -2.42900  -57.20100 1.000 83.28893  ? 919  ASN C ND2 1 
ATOM   1830 N  N   . GLN C 1 11  ? -0.26700  -0.92900  -55.13100 1.000 74.89582  ? 920  GLN C N   1 
ATOM   1831 C  CA  . GLN C 1 11  ? 0.99200   -1.26200  -54.41600 1.000 74.63790  ? 920  GLN C CA  1 
ATOM   1832 C  C   . GLN C 1 11  ? 1.34300   -0.08700  -53.50700 1.000 77.04082  ? 920  GLN C C   1 
ATOM   1833 O  O   . GLN C 1 11  ? 1.60900   -0.32600  -52.32100 1.000 84.73911  ? 920  GLN C O   1 
ATOM   1834 C  CB  . GLN C 1 11  ? 2.12300   -1.57100  -55.39400 1.000 76.95396  ? 920  GLN C CB  1 
ATOM   1835 C  CG  . GLN C 1 11  ? 1.87000   -2.81600  -56.23000 1.000 90.71351  ? 920  GLN C CG  1 
ATOM   1836 C  CD  . GLN C 1 11  ? 2.70200   -4.00200  -55.80800 1.000 98.15387  ? 920  GLN C CD  1 
ATOM   1837 O  OE1 . GLN C 1 11  ? 3.92300   -3.91000  -55.69300 1.000 105.72057 ? 920  GLN C OE1 1 
ATOM   1838 N  NE2 . GLN C 1 11  ? 2.03600   -5.12800  -55.59100 1.000 92.61900  ? 920  GLN C NE2 1 
ATOM   1839 N  N   . LYS C 1 12  ? 1.31500   1.13500   -54.04000 1.000 78.03830  ? 921  LYS C N   1 
ATOM   1840 C  CA  . LYS C 1 12  ? 1.52400   2.37100   -53.24400 1.000 80.88075  ? 921  LYS C CA  1 
ATOM   1841 C  C   . LYS C 1 12  ? 0.60800   2.31400   -52.01500 1.000 89.86867  ? 921  LYS C C   1 
ATOM   1842 O  O   . LYS C 1 12  ? 1.13500   2.41600   -50.88600 1.000 95.71148  ? 921  LYS C O   1 
ATOM   1843 C  CB  . LYS C 1 12  ? 1.19800   3.63100   -54.04900 1.000 82.64938  ? 921  LYS C CB  1 
ATOM   1844 C  CG  . LYS C 1 12  ? 2.19500   4.07700   -55.11200 1.000 83.07575  ? 921  LYS C CG  1 
ATOM   1845 C  CD  . LYS C 1 12  ? 1.53200   5.13900   -55.98000 1.000 97.64329  ? 921  LYS C CD  1 
ATOM   1846 C  CE  . LYS C 1 12  ? 2.45000   6.02600   -56.79000 1.000 106.83913 ? 921  LYS C CE  1 
ATOM   1847 N  NZ  . LYS C 1 12  ? 1.68200   6.68600   -57.87500 1.000 111.57917 ? 921  LYS C NZ  1 
ATOM   1848 N  N   . LEU C 1 13  ? -0.70500  2.14400   -52.23800 1.000 86.14191  ? 922  LEU C N   1 
ATOM   1849 C  CA  . LEU C 1 13  ? -1.76400  2.09000   -51.18700 1.000 71.53752  ? 922  LEU C CA  1 
ATOM   1850 C  C   . LEU C 1 13  ? -1.35900  1.08300   -50.10200 1.000 79.57270  ? 922  LEU C C   1 
ATOM   1851 O  O   . LEU C 1 13  ? -1.32600  1.46600   -48.91200 1.000 83.20471  ? 922  LEU C O   1 
ATOM   1852 C  CB  . LEU C 1 13  ? -3.10000  1.70400   -51.83700 1.000 67.60284  ? 922  LEU C CB  1 
ATOM   1853 C  CG  . LEU C 1 13  ? -4.29000  1.56900   -50.89300 1.000 67.18700  ? 922  LEU C CG  1 
ATOM   1854 C  CD1 . LEU C 1 13  ? -4.65900  2.91500   -50.29600 1.000 77.93303  ? 922  LEU C CD1 1 
ATOM   1855 C  CD2 . LEU C 1 13  ? -5.48300  0.96500   -51.61100 1.000 63.23127  ? 922  LEU C CD2 1 
ATOM   1856 N  N   . ILE C 1 14  ? -1.04900  -0.15500  -50.49900 1.000 72.66924  ? 923  ILE C N   1 
ATOM   1857 C  CA  . ILE C 1 14  ? -0.63700  -1.25600  -49.57400 1.000 70.00839  ? 923  ILE C CA  1 
ATOM   1858 C  C   . ILE C 1 14  ? 0.53700   -0.77500  -48.71500 1.000 67.01856  ? 923  ILE C C   1 
ATOM   1859 O  O   . ILE C 1 14  ? 0.49100   -0.96800  -47.49600 1.000 68.67666  ? 923  ILE C O   1 
ATOM   1860 C  CB  . ILE C 1 14  ? -0.26900  -2.53200  -50.35400 1.000 69.79258  ? 923  ILE C CB  1 
ATOM   1861 C  CG1 . ILE C 1 14  ? -1.50100  -3.18700  -50.98000 1.000 67.07120  ? 923  ILE C CG1 1 
ATOM   1862 C  CG2 . ILE C 1 14  ? 0.49100   -3.50800  -49.47000 1.000 60.40461  ? 923  ILE C CG2 1 
ATOM   1863 C  CD1 . ILE C 1 14  ? -1.17600  -4.16800  -52.08800 1.000 64.91041  ? 923  ILE C CD1 1 
ATOM   1864 N  N   . ALA C 1 15  ? 1.55800   -0.19000  -49.34000 1.000 71.96652  ? 924  ALA C N   1 
ATOM   1865 C  CA  . ALA C 1 15  ? 2.80000   0.26100   -48.66900 1.000 68.47400  ? 924  ALA C CA  1 
ATOM   1866 C  C   . ALA C 1 15  ? 2.48800   1.40100   -47.69400 1.000 65.34204  ? 924  ALA C C   1 
ATOM   1867 O  O   . ALA C 1 15  ? 3.08300   1.41300   -46.60700 1.000 78.70154  ? 924  ALA C O   1 
ATOM   1868 C  CB  . ALA C 1 15  ? 3.83800   0.67300   -49.68300 1.000 62.04428  ? 924  ALA C CB  1 
ATOM   1869 N  N   . ASN C 1 16  ? 1.58900   2.31600   -48.05500 1.000 69.42411  ? 925  ASN C N   1 
ATOM   1870 C  CA  . ASN C 1 16  ? 1.27000   3.50800   -47.22100 1.000 78.24622  ? 925  ASN C CA  1 
ATOM   1871 C  C   . ASN C 1 16  ? 0.39200   3.10700   -46.02700 1.000 74.95109  ? 925  ASN C C   1 
ATOM   1872 O  O   . ASN C 1 16  ? 0.58800   3.68400   -44.92500 1.000 73.91413  ? 925  ASN C O   1 
ATOM   1873 C  CB  . ASN C 1 16  ? 0.63400   4.62200   -48.05600 1.000 79.29635  ? 925  ASN C CB  1 
ATOM   1874 C  CG  . ASN C 1 16  ? 1.63100   5.28200   -48.99100 1.000 82.59938  ? 925  ASN C CG  1 
ATOM   1875 O  OD1 . ASN C 1 16  ? 2.81600   5.41700   -48.67000 1.000 80.90444  ? 925  ASN C OD1 1 
ATOM   1876 N  ND2 . ASN C 1 16  ? 1.16700   5.69000   -50.16100 1.000 89.05805  ? 925  ASN C ND2 1 
ATOM   1877 N  N   . GLN C 1 17  ? -0.55500  2.18700   -46.24900 1.000 73.29826  ? 926  GLN C N   1 
ATOM   1878 C  CA  . GLN C 1 17  ? -1.42100  1.59600   -45.19400 1.000 68.28450  ? 926  GLN C CA  1 
ATOM   1879 C  C   . GLN C 1 17  ? -0.54000  0.80500   -44.21500 1.000 69.32937  ? 926  GLN C C   1 
ATOM   1880 O  O   . GLN C 1 17  ? -0.68700  0.99100   -42.98800 1.000 57.83588  ? 926  GLN C O   1 
ATOM   1881 C  CB  . GLN C 1 17  ? -2.48900  0.71100   -45.83700 1.000 69.83732  ? 926  GLN C CB  1 
ATOM   1882 C  CG  . GLN C 1 17  ? -3.52300  1.47000   -46.66000 1.000 64.89462  ? 926  GLN C CG  1 
ATOM   1883 C  CD  . GLN C 1 17  ? -4.17200  2.59200   -45.88700 1.000 58.18592  ? 926  GLN C CD  1 
ATOM   1884 O  OE1 . GLN C 1 17  ? -3.58200  3.65100   -45.69800 1.000 66.45270  ? 926  GLN C OE1 1 
ATOM   1885 N  NE2 . GLN C 1 17  ? -5.39700  2.37200   -45.43400 1.000 63.48393  ? 926  GLN C NE2 1 
ATOM   1886 N  N   . PHE C 1 18  ? 0.36100   -0.02400  -44.74500 1.000 61.12838  ? 927  PHE C N   1 
ATOM   1887 C  CA  . PHE C 1 18  ? 1.28300   -0.88300  -43.96400 1.000 56.55941  ? 927  PHE C CA  1 
ATOM   1888 C  C   . PHE C 1 18  ? 2.17900   -0.01300  -43.08400 1.000 58.06749  ? 927  PHE C C   1 
ATOM   1889 O  O   . PHE C 1 18  ? 2.31200   -0.32300  -41.89500 1.000 68.43978  ? 927  PHE C O   1 
ATOM   1890 C  CB  . PHE C 1 18  ? 2.14300   -1.74300  -44.88700 1.000 62.94439  ? 927  PHE C CB  1 
ATOM   1891 C  CG  . PHE C 1 18  ? 3.11100   -2.63100  -44.15600 1.000 69.06091  ? 927  PHE C CG  1 
ATOM   1892 C  CD1 . PHE C 1 18  ? 2.65100   -3.61600  -43.30000 1.000 70.17157  ? 927  PHE C CD1 1 
ATOM   1893 C  CD2 . PHE C 1 18  ? 4.47600   -2.48500  -44.31900 1.000 64.59722  ? 927  PHE C CD2 1 
ATOM   1894 C  CE1 . PHE C 1 18  ? 3.53500   -4.44300  -42.62300 1.000 66.66589  ? 927  PHE C CE1 1 
ATOM   1895 C  CE2 . PHE C 1 18  ? 5.35900   -3.31700  -43.64800 1.000 61.37315  ? 927  PHE C CE2 1 
ATOM   1896 C  CZ  . PHE C 1 18  ? 4.88900   -4.29300  -42.80100 1.000 66.19741  ? 927  PHE C CZ  1 
ATOM   1897 N  N   . ASN C 1 19  ? 2.77400   1.03200   -43.66300 1.000 57.78851  ? 928  ASN C N   1 
ATOM   1898 C  CA  . ASN C 1 19  ? 3.70000   1.96000   -42.96200 1.000 62.37853  ? 928  ASN C CA  1 
ATOM   1899 C  C   . ASN C 1 19  ? 2.90700   2.74000   -41.91400 1.000 61.05995  ? 928  ASN C C   1 
ATOM   1900 O  O   . ASN C 1 19  ? 3.44100   2.99700   -40.82800 1.000 59.17552  ? 928  ASN C O   1 
ATOM   1901 C  CB  . ASN C 1 19  ? 4.41700   2.90100   -43.93500 1.000 66.33164  ? 928  ASN C CB  1 
ATOM   1902 C  CG  . ASN C 1 19  ? 5.48200   2.23500   -44.78700 1.000 71.86914  ? 928  ASN C CG  1 
ATOM   1903 O  OD1 . ASN C 1 19  ? 6.00700   1.17800   -44.44300 1.000 76.40653  ? 928  ASN C OD1 1 
ATOM   1904 N  ND2 . ASN C 1 19  ? 5.83300   2.86300   -45.89900 1.000 67.29228  ? 928  ASN C ND2 1 
ATOM   1905 N  N   . SER C 1 20  ? 1.67500   3.10800   -42.24900 1.000 58.46754  ? 929  SER C N   1 
ATOM   1906 C  CA  . SER C 1 20  ? 0.68800   3.70100   -41.31300 1.000 68.48979  ? 929  SER C CA  1 
ATOM   1907 C  C   . SER C 1 20  ? 0.53800   2.76000   -40.11200 1.000 70.31633  ? 929  SER C C   1 
ATOM   1908 O  O   . SER C 1 20  ? 0.96100   3.12900   -38.99700 1.000 56.94104  ? 929  SER C O   1 
ATOM   1909 C  CB  . SER C 1 20  ? -0.62700  3.96400   -42.02700 1.000 71.40593  ? 929  SER C CB  1 
ATOM   1910 O  OG  . SER C 1 20  ? -1.72900  3.95100   -41.13000 1.000 77.32506  ? 929  SER C OG  1 
ATOM   1911 N  N   . ALA C 1 21  ? 0.01100   1.56000   -40.35900 1.000 66.30269  ? 930  ALA C N   1 
ATOM   1912 C  CA  . ALA C 1 21  ? -0.33700  0.57400   -39.31900 1.000 57.15685  ? 930  ALA C CA  1 
ATOM   1913 C  C   . ALA C 1 21  ? 0.87000   0.40800   -38.39900 1.000 63.48656  ? 930  ALA C C   1 
ATOM   1914 O  O   . ALA C 1 21  ? 0.72300   0.71000   -37.19900 1.000 61.79688  ? 930  ALA C O   1 
ATOM   1915 C  CB  . ALA C 1 21  ? -0.76300  -0.72500  -39.95300 1.000 54.98028  ? 930  ALA C CB  1 
ATOM   1916 N  N   . ILE C 1 22  ? 2.02200   0.01500   -38.96000 1.000 61.16260  ? 931  ILE C N   1 
ATOM   1917 C  CA  . ILE C 1 22  ? 3.27700   -0.24300  -38.18900 1.000 59.56767  ? 931  ILE C CA  1 
ATOM   1918 C  C   . ILE C 1 22  ? 3.56500   0.94900   -37.27600 1.000 67.39492  ? 931  ILE C C   1 
ATOM   1919 O  O   . ILE C 1 22  ? 3.84600   0.70400   -36.09100 1.000 59.25974  ? 931  ILE C O   1 
ATOM   1920 C  CB  . ILE C 1 22  ? 4.48300   -0.52900  -39.09700 1.000 56.40939  ? 931  ILE C CB  1 
ATOM   1921 C  CG1 . ILE C 1 22  ? 4.28900   -1.79700  -39.93400 1.000 56.76470  ? 931  ILE C CG1 1 
ATOM   1922 C  CG2 . ILE C 1 22  ? 5.75600   -0.59400  -38.26700 1.000 53.14585  ? 931  ILE C CG2 1 
ATOM   1923 C  CD1 . ILE C 1 22  ? 3.97400   -3.04000  -39.13400 1.000 56.41729  ? 931  ILE C CD1 1 
ATOM   1924 N  N   . GLY C 1 23  ? 3.50900   2.17400   -37.81200 1.000 54.43284  ? 932  GLY C N   1 
ATOM   1925 C  CA  . GLY C 1 23  ? 3.65600   3.41400   -37.03100 1.000 63.20758  ? 932  GLY C CA  1 
ATOM   1926 C  C   . GLY C 1 23  ? 2.80400   3.38000   -35.77500 1.000 67.10541  ? 932  GLY C C   1 
ATOM   1927 O  O   . GLY C 1 23  ? 3.36500   3.50900   -34.66600 1.000 62.71805  ? 932  GLY C O   1 
ATOM   1928 N  N   . LYS C 1 24  ? 1.49700   3.16500   -35.93500 1.000 71.29276  ? 933  LYS C N   1 
ATOM   1929 C  CA  . LYS C 1 24  ? 0.51600   3.10600   -34.81800 1.000 66.83433  ? 933  LYS C CA  1 
ATOM   1930 C  C   . LYS C 1 24  ? 0.90500   2.01200   -33.81500 1.000 69.98734  ? 933  LYS C C   1 
ATOM   1931 O  O   . LYS C 1 24  ? 0.80600   2.27200   -32.60400 1.000 59.97824  ? 933  LYS C O   1 
ATOM   1932 C  CB  . LYS C 1 24  ? -0.89200  2.81600   -35.34200 1.000 60.96520  ? 933  LYS C CB  1 
ATOM   1933 C  CG  . LYS C 1 24  ? -1.42900  3.82300   -36.34600 1.000 63.94714  ? 933  LYS C CG  1 
ATOM   1934 C  CD  . LYS C 1 24  ? -2.91000  4.10000   -36.19700 1.000 64.11821  ? 933  LYS C CD  1 
ATOM   1935 C  CE  . LYS C 1 24  ? -3.50900  4.71400   -37.44300 1.000 60.51252  ? 933  LYS C CE  1 
ATOM   1936 N  NZ  . LYS C 1 24  ? -4.21800  3.69600   -38.25300 1.000 66.37638  ? 933  LYS C NZ  1 
ATOM   1937 N  N   . ILE C 1 25  ? 1.30100   0.82900   -34.30300 1.000 63.39181  ? 934  ILE C N   1 
ATOM   1938 C  CA  . ILE C 1 25  ? 1.68400   -0.34800  -33.46000 1.000 59.94403  ? 934  ILE C CA  1 
ATOM   1939 C  C   . ILE C 1 25  ? 2.93600   0.01000   -32.64400 1.000 64.65775  ? 934  ILE C C   1 
ATOM   1940 O  O   . ILE C 1 25  ? 2.93800   -0.24400  -31.42100 1.000 64.71829  ? 934  ILE C O   1 
ATOM   1941 C  CB  . ILE C 1 25  ? 1.86600   -1.60800  -34.32900 1.000 54.55917  ? 934  ILE C CB  1 
ATOM   1942 C  CG1 . ILE C 1 25  ? 0.52300   -2.09200  -34.87700 1.000 46.57401  ? 934  ILE C CG1 1 
ATOM   1943 C  CG2 . ILE C 1 25  ? 2.58100   -2.70900  -33.56700 1.000 50.50079  ? 934  ILE C CG2 1 
ATOM   1944 C  CD1 . ILE C 1 25  ? 0.65100   -2.92200  -36.13000 1.000 57.91484  ? 934  ILE C CD1 1 
ATOM   1945 N  N   . GLN C 1 26  ? 3.93900   0.62500   -33.27500 1.000 63.55236  ? 935  GLN C N   1 
ATOM   1946 C  CA  . GLN C 1 26  ? 5.17200   1.08800   -32.58700 1.000 66.84222  ? 935  GLN C CA  1 
ATOM   1947 C  C   . GLN C 1 26  ? 4.78100   1.95400   -31.39100 1.000 66.29479  ? 935  GLN C C   1 
ATOM   1948 O  O   . GLN C 1 26  ? 5.29200   1.69100   -30.29600 1.000 73.16404  ? 935  GLN C O   1 
ATOM   1949 C  CB  . GLN C 1 26  ? 6.07600   1.87500   -33.53300 1.000 74.19574  ? 935  GLN C CB  1 
ATOM   1950 C  CG  . GLN C 1 26  ? 6.75800   1.01200   -34.58400 1.000 75.10901  ? 935  GLN C CG  1 
ATOM   1951 C  CD  . GLN C 1 26  ? 7.66500   1.82800   -35.46900 1.000 78.34097  ? 935  GLN C CD  1 
ATOM   1952 O  OE1 . GLN C 1 26  ? 8.68700   1.34200   -35.94900 1.000 81.44398  ? 935  GLN C OE1 1 
ATOM   1953 N  NE2 . GLN C 1 26  ? 7.30300   3.08700   -35.67500 1.000 69.91365  ? 935  GLN C NE2 1 
ATOM   1954 N  N   . ASP C 1 27  ? 3.90100   2.93500   -31.60400 1.000 71.63490  ? 936  ASP C N   1 
ATOM   1955 C  CA  . ASP C 1 27  ? 3.38400   3.84200   -30.54500 1.000 71.68491  ? 936  ASP C CA  1 
ATOM   1956 C  C   . ASP C 1 27  ? 2.72000   2.98300   -29.45600 1.000 74.58526  ? 936  ASP C C   1 
ATOM   1957 O  O   . ASP C 1 27  ? 2.98300   3.24100   -28.26200 1.000 75.44589  ? 936  ASP C O   1 
ATOM   1958 C  CB  . ASP C 1 27  ? 2.46500   4.91500   -31.15000 1.000 72.54291  ? 936  ASP C CB  1 
ATOM   1959 C  CG  . ASP C 1 27  ? 1.94700   5.95600   -30.16700 1.000 85.34971  ? 936  ASP C CG  1 
ATOM   1960 O  OD1 . ASP C 1 27  ? 2.73000   6.38400   -29.29300 1.000 91.09513  ? 936  ASP C OD1 1 
ATOM   1961 O  OD2 . ASP C 1 27  ? 0.75600   6.33600   -30.28400 1.000 83.76531  ? 936  ASP C OD2 1 
ATOM   1962 N  N   . SER C 1 28  ? 1.92100   1.97800   -29.84400 1.000 64.11821  ? 937  SER C N   1 
ATOM   1963 C  CA  . SER C 1 28  ? 1.15700   1.10700   -28.91200 1.000 55.04344  ? 937  SER C CA  1 
ATOM   1964 C  C   . SER C 1 28  ? 2.14400   0.28400   -28.08200 1.000 62.40222  ? 937  SER C C   1 
ATOM   1965 O  O   . SER C 1 28  ? 1.95000   0.19800   -26.85400 1.000 67.75549  ? 937  SER C O   1 
ATOM   1966 C  CB  . SER C 1 28  ? 0.16600   0.22000   -29.62200 1.000 56.00935  ? 937  SER C CB  1 
ATOM   1967 O  OG  . SER C 1 28  ? 0.76200   -1.01600  -29.98800 1.000 63.92872  ? 937  SER C OG  1 
ATOM   1968 N  N   . LEU C 1 29  ? 3.18100   -0.27800  -28.71200 1.000 54.83026  ? 938  LEU C N   1 
ATOM   1969 C  CA  . LEU C 1 29  ? 4.20200   -1.08200  -27.98500 1.000 59.66505  ? 938  LEU C CA  1 
ATOM   1970 C  C   . LEU C 1 29  ? 4.90100   -0.19600  -26.94700 1.000 62.66014  ? 938  LEU C C   1 
ATOM   1971 O  O   . LEU C 1 29  ? 5.09600   -0.64500  -25.81000 1.000 67.62916  ? 938  LEU C O   1 
ATOM   1972 C  CB  . LEU C 1 29  ? 5.21100   -1.69200  -28.96200 1.000 57.89642  ? 938  LEU C CB  1 
ATOM   1973 C  CG  . LEU C 1 29  ? 4.66800   -2.78100  -29.88800 1.000 62.67594  ? 938  LEU C CG  1 
ATOM   1974 C  CD1 . LEU C 1 29  ? 5.76200   -3.30300  -30.80000 1.000 62.54434  ? 938  LEU C CD1 1 
ATOM   1975 C  CD2 . LEU C 1 29  ? 4.03100   -3.93300  -29.12000 1.000 60.73360  ? 938  LEU C CD2 1 
ATOM   1976 N  N   . SER C 1 30  ? 5.23700   1.03900   -27.30400 1.000 57.10948  ? 939  SER C N   1 
ATOM   1977 C  CA  . SER C 1 30  ? 5.89000   1.99900   -26.38100 1.000 59.99930  ? 939  SER C CA  1 
ATOM   1978 C  C   . SER C 1 30  ? 4.96700   2.28700   -25.18600 1.000 58.68072  ? 939  SER C C   1 
ATOM   1979 O  O   . SER C 1 30  ? 5.45900   2.22100   -24.04500 1.000 67.12910  ? 939  SER C O   1 
ATOM   1980 C  CB  . SER C 1 30  ? 6.32000   3.24500   -27.11500 1.000 59.39660  ? 939  SER C CB  1 
ATOM   1981 O  OG  . SER C 1 30  ? 7.41100   2.95800   -27.98600 1.000 54.25387  ? 939  SER C OG  1 
ATOM   1982 N  N   . SER C 1 31  ? 3.67500   2.54600   -25.42200 1.000 58.56492  ? 940  SER C N   1 
ATOM   1983 C  CA  . SER C 1 31  ? 2.67000   2.82600   -24.35600 1.000 56.98578  ? 940  SER C CA  1 
ATOM   1984 C  C   . SER C 1 31  ? 2.52600   1.61000   -23.43300 1.000 60.24143  ? 940  SER C C   1 
ATOM   1985 O  O   . SER C 1 31  ? 2.39400   1.81500   -22.20700 1.000 55.76195  ? 940  SER C O   1 
ATOM   1986 C  CB  . SER C 1 31  ? 1.33200   3.21900   -24.91500 1.000 50.19023  ? 940  SER C CB  1 
ATOM   1987 O  OG  . SER C 1 31  ? 1.38900   4.50000   -25.51600 1.000 62.13377  ? 940  SER C OG  1 
ATOM   1988 N  N   . THR C 1 32  ? 2.53300   0.39500   -23.99500 1.000 50.63239  ? 941  THR C N   1 
ATOM   1989 C  CA  . THR C 1 32  ? 2.49100   -0.87500  -23.22000 1.000 48.06892  ? 941  THR C CA  1 
ATOM   1990 C  C   . THR C 1 32  ? 3.71200   -0.94200  -22.29100 1.000 54.49074  ? 941  THR C C   1 
ATOM   1991 O  O   . THR C 1 32  ? 3.53600   -1.10700  -21.06500 1.000 55.24083  ? 941  THR C O   1 
ATOM   1992 C  CB  . THR C 1 32  ? 2.40200   -2.08400  -24.15300 1.000 47.93206  ? 941  THR C CB  1 
ATOM   1993 O  OG1 . THR C 1 32  ? 1.26300   -1.84500  -24.97800 1.000 47.22672  ? 941  THR C OG1 1 
ATOM   1994 C  CG2 . THR C 1 32  ? 2.26700   -3.40300  -23.41900 1.000 43.97369  ? 941  THR C CG2 1 
ATOM   1995 N  N   . ALA C 1 33  ? 4.91200   -0.78800  -22.84500 1.000 56.24622  ? 942  ALA C N   1 
ATOM   1996 C  CA  . ALA C 1 33  ? 6.17900   -0.78000  -22.08200 1.000 52.63526  ? 942  ALA C CA  1 
ATOM   1997 C  C   . ALA C 1 33  ? 6.09100   0.24800   -20.94500 1.000 56.23832  ? 942  ALA C C   1 
ATOM   1998 O  O   . ALA C 1 33  ? 6.41300   -0.12700  -19.81600 1.000 61.25471  ? 942  ALA C O   1 
ATOM   1999 C  CB  . ALA C 1 33  ? 7.34700   -0.50900  -22.99900 1.000 53.05373  ? 942  ALA C CB  1 
ATOM   2000 N  N   . SER C 1 34  ? 5.67800   1.49200   -21.22100 1.000 52.55630  ? 943  SER C N   1 
ATOM   2001 C  CA  . SER C 1 34  ? 5.46200   2.56000   -20.20100 1.000 54.15386  ? 943  SER C CA  1 
ATOM   2002 C  C   . SER C 1 34  ? 4.62300   2.01600   -19.04200 1.000 56.34360  ? 943  SER C C   1 
ATOM   2003 O  O   . SER C 1 34  ? 5.08500   2.11100   -17.89800 1.000 58.44648  ? 943  SER C O   1 
ATOM   2004 C  CB  . SER C 1 34  ? 4.78400   3.77600   -20.77700 1.000 46.81351  ? 943  SER C CB  1 
ATOM   2005 O  OG  . SER C 1 34  ? 5.72400   4.66400   -21.34500 1.000 70.86113  ? 943  SER C OG  1 
ATOM   2006 N  N   . ALA C 1 35  ? 3.43000   1.49300   -19.35600 1.000 52.21679  ? 944  ALA C N   1 
ATOM   2007 C  CA  . ALA C 1 35  ? 2.38700   1.06300   -18.39600 1.000 48.67163  ? 944  ALA C CA  1 
ATOM   2008 C  C   . ALA C 1 35  ? 2.91700   -0.08000  -17.52700 1.000 45.87655  ? 944  ALA C C   1 
ATOM   2009 O  O   . ALA C 1 35  ? 2.69600   -0.03900  -16.30100 1.000 52.11151  ? 944  ALA C O   1 
ATOM   2010 C  CB  . ALA C 1 35  ? 1.13800   0.65300   -19.13500 1.000 48.23999  ? 944  ALA C CB  1 
ATOM   2011 N  N   . LEU C 1 36  ? 3.61100   -1.04800  -18.12800 1.000 49.18748  ? 945  LEU C N   1 
ATOM   2012 C  CA  . LEU C 1 36  ? 4.24000   -2.17700  -17.38100 1.000 51.73778  ? 945  LEU C CA  1 
ATOM   2013 C  C   . LEU C 1 36  ? 5.37600   -1.65100  -16.48800 1.000 55.16451  ? 945  LEU C C   1 
ATOM   2014 O  O   . LEU C 1 36  ? 5.52000   -2.16000  -15.35800 1.000 56.25675  ? 945  LEU C O   1 
ATOM   2015 C  CB  . LEU C 1 36  ? 4.74600   -3.23900  -18.36100 1.000 48.42949  ? 945  LEU C CB  1 
ATOM   2016 C  CG  . LEU C 1 36  ? 3.66900   -3.92500  -19.20200 1.000 49.15853  ? 945  LEU C CG  1 
ATOM   2017 C  CD1 . LEU C 1 36  ? 4.32100   -4.74800  -20.30100 1.000 41.57867  ? 945  LEU C CD1 1 
ATOM   2018 C  CD2 . LEU C 1 36  ? 2.76500   -4.79100  -18.33500 1.000 42.05241  ? 945  LEU C CD2 1 
ATOM   2019 N  N   . GLY C 1 37  ? 6.14700   -0.66300  -16.95800 1.000 57.82009  ? 946  GLY C N   1 
ATOM   2020 C  CA  . GLY C 1 37  ? 7.21000   0.00300   -16.17700 1.000 46.28450  ? 946  GLY C CA  1 
ATOM   2021 C  C   . GLY C 1 37  ? 6.66200   0.65600   -14.92400 1.000 45.70811  ? 946  GLY C C   1 
ATOM   2022 O  O   . GLY C 1 37  ? 7.18000   0.36100   -13.84200 1.000 62.39695  ? 946  GLY C O   1 
ATOM   2023 N  N   . LYS C 1 38  ? 5.62500   1.48800   -15.06000 1.000 61.30735  ? 947  LYS C N   1 
ATOM   2024 C  CA  . LYS C 1 38  ? 4.95800   2.18500   -13.92200 1.000 50.90610  ? 947  LYS C CA  1 
ATOM   2025 C  C   . LYS C 1 38  ? 4.30700   1.15600   -12.98300 1.000 47.43463  ? 947  LYS C C   1 
ATOM   2026 O  O   . LYS C 1 38  ? 4.46700   1.31700   -11.76700 1.000 58.53597  ? 947  LYS C O   1 
ATOM   2027 C  CB  . LYS C 1 38  ? 3.99200   3.24000   -14.46100 1.000 46.45557  ? 947  LYS C CB  1 
ATOM   2028 C  CG  . LYS C 1 38  ? 4.68500   4.33100   -15.26200 1.000 54.08017  ? 947  LYS C CG  1 
ATOM   2029 C  CD  . LYS C 1 38  ? 3.75600   5.35700   -15.86400 1.000 64.35508  ? 947  LYS C CD  1 
ATOM   2030 C  CE  . LYS C 1 38  ? 4.41400   6.13800   -16.98300 1.000 71.04799  ? 947  LYS C CE  1 
ATOM   2031 N  NZ  . LYS C 1 38  ? 3.54400   7.23900   -17.46100 1.000 67.93709  ? 947  LYS C NZ  1 
ATOM   2032 N  N   . LEU C 1 39  ? 3.64000   0.12100   -13.50700 1.000 45.11857  ? 948  LEU C N   1 
ATOM   2033 C  CA  . LEU C 1 39  ? 3.10200   -0.98900  -12.67500 1.000 56.15936  ? 948  LEU C CA  1 
ATOM   2034 C  C   . LEU C 1 39  ? 4.24700   -1.64300  -11.87800 1.000 63.16547  ? 948  LEU C C   1 
ATOM   2035 O  O   . LEU C 1 39  ? 4.14200   -1.71500  -10.62500 1.000 65.31046  ? 948  LEU C O   1 
ATOM   2036 C  CB  . LEU C 1 39  ? 2.33300   -1.97500  -13.56300 1.000 40.74436  ? 948  LEU C CB  1 
ATOM   2037 C  CG  . LEU C 1 39  ? 0.89200   -1.53900  -13.82300 1.000 48.33474  ? 948  LEU C CG  1 
ATOM   2038 C  CD1 . LEU C 1 39  ? 0.21400   -2.38000  -14.88700 1.000 34.84628  ? 948  LEU C CD1 1 
ATOM   2039 C  CD2 . LEU C 1 39  ? 0.08700   -1.57700  -12.53700 1.000 51.30089  ? 948  LEU C CD2 1 
ATOM   2040 N  N   . GLN C 1 40  ? 5.33500   -2.03700  -12.54500 1.000 53.85646  ? 949  GLN C N   1 
ATOM   2041 C  CA  . GLN C 1 40  ? 6.47000   -2.72700  -11.87700 1.000 56.56994  ? 949  GLN C CA  1 
ATOM   2042 C  C   . GLN C 1 40  ? 6.95400   -1.87200  -10.70500 1.000 56.28043  ? 949  GLN C C   1 
ATOM   2043 O  O   . GLN C 1 40  ? 7.11900   -2.44100  -9.60800  1.000 63.60763  ? 949  GLN C O   1 
ATOM   2044 C  CB  . GLN C 1 40  ? 7.62300   -3.01200  -12.84200 1.000 62.09692  ? 949  GLN C CB  1 
ATOM   2045 C  CG  . GLN C 1 40  ? 8.80300   -3.68700  -12.15500 1.000 61.07311  ? 949  GLN C CG  1 
ATOM   2046 C  CD  . GLN C 1 40  ? 9.85400   -4.18600  -13.10900 1.000 60.64148  ? 949  GLN C CD  1 
ATOM   2047 O  OE1 . GLN C 1 40  ? 9.97300   -3.71900  -14.23500 1.000 66.00791  ? 949  GLN C OE1 1 
ATOM   2048 N  NE2 . GLN C 1 40  ? 10.63800  -5.13800  -12.64300 1.000 52.16415  ? 949  GLN C NE2 1 
ATOM   2049 N  N   . ASP C 1 41  ? 7.16500   -0.56800  -10.93000 1.000 59.24658  ? 950  ASP C N   1 
ATOM   2050 C  CA  . ASP C 1 41  ? 7.71000   0.37600   -9.91100  1.000 62.65488  ? 950  ASP C CA  1 
ATOM   2051 C  C   . ASP C 1 41  ? 6.74100   0.45200   -8.72300  1.000 60.62043  ? 950  ASP C C   1 
ATOM   2052 O  O   . ASP C 1 41  ? 7.20400   0.34700   -7.56900  1.000 61.49948  ? 950  ASP C O   1 
ATOM   2053 C  CB  . ASP C 1 41  ? 7.98500   1.77000   -10.48800 1.000 61.88637  ? 950  ASP C CB  1 
ATOM   2054 C  CG  . ASP C 1 41  ? 9.11800   1.82600   -11.50300 1.000 77.75932  ? 950  ASP C CG  1 
ATOM   2055 O  OD1 . ASP C 1 41  ? 9.87800   0.83200   -11.63400 1.000 82.69149  ? 950  ASP C OD1 1 
ATOM   2056 O  OD2 . ASP C 1 41  ? 9.22900   2.86400   -12.16600 1.000 85.82871  ? 950  ASP C OD2 1 
ATOM   2057 N  N   . VAL C 1 42  ? 5.44200   0.60000   -8.98700  1.000 53.39061  ? 951  VAL C N   1 
ATOM   2058 C  CA  . VAL C 1 42  ? 4.44400   0.84700   -7.91200  1.000 51.17456  ? 951  VAL C CA  1 
ATOM   2059 C  C   . VAL C 1 42  ? 4.19000   -0.45700  -7.16200  1.000 58.96496  ? 951  VAL C C   1 
ATOM   2060 O  O   . VAL C 1 42  ? 4.08300   -0.39600  -5.91500  1.000 59.89929  ? 951  VAL C O   1 
ATOM   2061 C  CB  . VAL C 1 42  ? 3.14300   1.46600   -8.44300  1.000 56.91209  ? 951  VAL C CB  1 
ATOM   2062 C  CG1 . VAL C 1 42  ? 2.08000   1.50900   -7.36000  1.000 59.50450  ? 951  VAL C CG1 1 
ATOM   2063 C  CG2 . VAL C 1 42  ? 3.39100   2.86000   -8.99600  1.000 62.76279  ? 951  VAL C CG2 1 
ATOM   2064 N  N   . VAL C 1 43  ? 4.10000   -1.58900  -7.86700  1.000 55.82248  ? 952  VAL C N   1 
ATOM   2065 C  CA  . VAL C 1 43  ? 3.91700   -2.91900  -7.20500  1.000 45.72390  ? 952  VAL C CA  1 
ATOM   2066 C  C   . VAL C 1 43  ? 5.08000   -3.12200  -6.23400  1.000 62.66541  ? 952  VAL C C   1 
ATOM   2067 O  O   . VAL C 1 43  ? 4.80200   -3.49700  -5.08100  1.000 67.76339  ? 952  VAL C O   1 
ATOM   2068 C  CB  . VAL C 1 43  ? 3.80100   -4.08500  -8.20300  1.000 41.66026  ? 952  VAL C CB  1 
ATOM   2069 C  CG1 . VAL C 1 43  ? 3.95700   -5.42700  -7.52200  1.000 37.05971  ? 952  VAL C CG1 1 
ATOM   2070 C  CG2 . VAL C 1 43  ? 2.48300   -4.05400  -8.95300  1.000 38.36249  ? 952  VAL C CG2 1 
ATOM   2071 N  N   . ASN C 1 44  ? 6.31400   -2.82500  -6.67300  1.000 62.48644  ? 953  ASN C N   1 
ATOM   2072 C  CA  . ASN C 1 44  ? 7.56400   -3.07700  -5.90200  1.000 60.18616  ? 953  ASN C CA  1 
ATOM   2073 C  C   . ASN C 1 44  ? 7.64100   -2.11700  -4.70200  1.000 60.84940  ? 953  ASN C C   1 
ATOM   2074 O  O   . ASN C 1 44  ? 8.00800   -2.59900  -3.61200  1.000 66.61325  ? 953  ASN C O   1 
ATOM   2075 C  CB  . ASN C 1 44  ? 8.79900   -3.06900  -6.81000  1.000 56.89366  ? 953  ASN C CB  1 
ATOM   2076 C  CG  . ASN C 1 44  ? 8.96700   -4.35300  -7.61300  1.000 57.85431  ? 953  ASN C CG  1 
ATOM   2077 O  OD1 . ASN C 1 44  ? 8.48600   -5.42000  -7.23700  1.000 50.21392  ? 953  ASN C OD1 1 
ATOM   2078 N  ND2 . ASN C 1 44  ? 9.66100   -4.28100  -8.73200  1.000 53.49326  ? 953  ASN C ND2 1 
ATOM   2079 N  N   . GLN C 1 45  ? 7.27700   -0.83700  -4.86500  1.000 58.50175  ? 954  GLN C N   1 
ATOM   2080 C  CA  . GLN C 1 45  ? 7.21500   0.14500   -3.74500  1.000 59.35975  ? 954  GLN C CA  1 
ATOM   2081 C  C   . GLN C 1 45  ? 6.21700   -0.32300  -2.69600  1.000 67.06330  ? 954  GLN C C   1 
ATOM   2082 O  O   . GLN C 1 45  ? 6.52600   -0.19300  -1.51100  1.000 69.44780  ? 954  GLN C O   1 
ATOM   2083 C  CB  . GLN C 1 45  ? 6.75700   1.52600   -4.19200  1.000 61.22050  ? 954  GLN C CB  1 
ATOM   2084 C  CG  . GLN C 1 45  ? 7.80800   2.26300   -5.00100  1.000 69.32147  ? 954  GLN C CG  1 
ATOM   2085 C  CD  . GLN C 1 45  ? 7.32500   3.60300   -5.49700  1.000 78.47520  ? 954  GLN C CD  1 
ATOM   2086 O  OE1 . GLN C 1 45  ? 6.39600   4.19700   -4.95000  1.000 83.43369  ? 954  GLN C OE1 1 
ATOM   2087 N  NE2 . GLN C 1 45  ? 7.96500   4.09300   -6.54900  1.000 81.04656  ? 954  GLN C NE2 1 
ATOM   2088 N  N   . ASN C 1 46  ? 5.06100   -0.81900  -3.13200  1.000 63.17336  ? 955  ASN C N   1 
ATOM   2089 C  CA  . ASN C 1 46  ? 3.99100   -1.29500  -2.22200  1.000 53.39324  ? 955  ASN C CA  1 
ATOM   2090 C  C   . ASN C 1 46  ? 4.52400   -2.51800  -1.46500  1.000 63.66816  ? 955  ASN C C   1 
ATOM   2091 O  O   . ASN C 1 46  ? 4.34100   -2.57800  -0.22400  1.000 65.85263  ? 955  ASN C O   1 
ATOM   2092 C  CB  . ASN C 1 46  ? 2.67400   -1.49700  -2.98100  1.000 52.24574  ? 955  ASN C CB  1 
ATOM   2093 C  CG  . ASN C 1 46  ? 2.02500   -0.17800  -3.36000  1.000 61.47053  ? 955  ASN C CG  1 
ATOM   2094 O  OD1 . ASN C 1 46  ? 2.66900   0.87900   -3.30400  1.000 66.85802  ? 955  ASN C OD1 1 
ATOM   2095 N  ND2 . ASN C 1 46  ? 0.75100   -0.22300  -3.73300  1.000 45.27911  ? 955  ASN C ND2 1 
ATOM   2096 N  N   . ALA C 1 47  ? 5.21500   -3.42500  -2.16400  1.000 58.84653  ? 956  ALA C N   1 
ATOM   2097 C  CA  . ALA C 1 47  ? 5.73700   -4.68300  -1.58500  1.000 57.92537  ? 956  ALA C CA  1 
ATOM   2098 C  C   . ALA C 1 47  ? 6.71300   -4.34000  -0.45800  1.000 64.02873  ? 956  ALA C C   1 
ATOM   2099 O  O   . ALA C 1 47  ? 6.66300   -4.99600  0.58300   1.000 75.08532  ? 956  ALA C O   1 
ATOM   2100 C  CB  . ALA C 1 47  ? 6.38500   -5.52600  -2.64600  1.000 50.60080  ? 956  ALA C CB  1 
ATOM   2101 N  N   . GLN C 1 48  ? 7.55300   -3.32500  -0.65400  1.000 65.53417  ? 957  GLN C N   1 
ATOM   2102 C  CA  . GLN C 1 48  ? 8.57700   -2.90100  0.34100   1.000 73.49039  ? 957  GLN C CA  1 
ATOM   2103 C  C   . GLN C 1 48  ? 7.89500   -2.18800  1.51700   1.000 64.76040  ? 957  GLN C C   1 
ATOM   2104 O  O   . GLN C 1 48  ? 8.29600   -2.42500  2.67800   1.000 65.67893  ? 957  GLN C O   1 
ATOM   2105 C  CB  . GLN C 1 48  ? 9.63200   -2.02600  -0.33600  1.000 79.53322  ? 957  GLN C CB  1 
ATOM   2106 C  CG  . GLN C 1 48  ? 10.48800  -2.80300  -1.32900  1.000 85.42077  ? 957  GLN C CG  1 
ATOM   2107 C  CD  . GLN C 1 48  ? 11.66500  -2.01200  -1.84700  1.000 89.76603  ? 957  GLN C CD  1 
ATOM   2108 O  OE1 . GLN C 1 48  ? 12.17900  -1.11200  -1.18000  1.000 101.28846 ? 957  GLN C OE1 1 
ATOM   2109 N  NE2 . GLN C 1 48  ? 12.11100  -2.36200  -3.04500  1.000 78.37255  ? 957  GLN C NE2 1 
ATOM   2110 N  N   . ALA C 1 49  ? 6.89900   -1.34200  1.23600   1.000 57.73587  ? 958  ALA C N   1 
ATOM   2111 C  CA  . ALA C 1 49  ? 6.10500   -0.65400  2.27400   1.000 53.88014  ? 958  ALA C CA  1 
ATOM   2112 C  C   . ALA C 1 49  ? 5.48700   -1.70100  3.19400   1.000 57.12527  ? 958  ALA C C   1 
ATOM   2113 O  O   . ALA C 1 49  ? 5.55600   -1.49900  4.40300   1.000 57.75166  ? 958  ALA C O   1 
ATOM   2114 C  CB  . ALA C 1 49  ? 5.05100   0.21700   1.66300   1.000 51.33510  ? 958  ALA C CB  1 
ATOM   2115 N  N   . LEU C 1 50  ? 4.92600   -2.78300  2.63800   1.000 61.32051  ? 959  LEU C N   1 
ATOM   2116 C  CA  . LEU C 1 50  ? 4.30400   -3.88000  3.43100   1.000 58.53860  ? 959  LEU C CA  1 
ATOM   2117 C  C   . LEU C 1 50  ? 5.37500   -4.60100  4.26500   1.000 58.80442  ? 959  LEU C C   1 
ATOM   2118 O  O   . LEU C 1 50  ? 5.14400   -4.81600  5.46300   1.000 62.61803  ? 959  LEU C O   1 
ATOM   2119 C  CB  . LEU C 1 50  ? 3.58400   -4.84900  2.49100   1.000 56.30412  ? 959  LEU C CB  1 
ATOM   2120 C  CG  . LEU C 1 50  ? 2.87200   -6.02700  3.16100   1.000 55.06713  ? 959  LEU C CG  1 
ATOM   2121 C  CD1 . LEU C 1 50  ? 2.07300   -5.57800  4.37500   1.000 51.90359  ? 959  LEU C CD1 1 
ATOM   2122 C  CD2 . LEU C 1 50  ? 1.94600   -6.73400  2.18000   1.000 49.20590  ? 959  LEU C CD2 1 
ATOM   2123 N  N   . ASN C 1 51  ? 6.51900   -4.94100  3.67300   1.000 59.05971  ? 960  ASN C N   1 
ATOM   2124 C  CA  . ASN C 1 51  ? 7.63900   -5.62300  4.37900   1.000 53.54589  ? 960  ASN C CA  1 
ATOM   2125 C  C   . ASN C 1 51  ? 8.18200   -4.72100  5.50700   1.000 56.21990  ? 960  ASN C C   1 
ATOM   2126 O  O   . ASN C 1 51  ? 8.42600   -5.23500  6.59400   1.000 61.87847  ? 960  ASN C O   1 
ATOM   2127 C  CB  . ASN C 1 51  ? 8.71200   -6.08800  3.39100   1.000 56.46203  ? 960  ASN C CB  1 
ATOM   2128 C  CG  . ASN C 1 51  ? 8.20800   -7.13500  2.41400   1.000 61.32051  ? 960  ASN C CG  1 
ATOM   2129 O  OD1 . ASN C 1 51  ? 7.40700   -8.00500  2.77100   1.000 59.17552  ? 960  ASN C OD1 1 
ATOM   2130 N  ND2 . ASN C 1 51  ? 8.66900   -7.06100  1.17200   1.000 63.14441  ? 960  ASN C ND2 1 
ATOM   2131 N  N   . THR C 1 52  ? 8.33000   -3.41500  5.28800   1.000 53.55905  ? 961  THR C N   1 
ATOM   2132 C  CA  . THR C 1 52  ? 8.79400   -2.43900  6.31300   1.000 60.08615  ? 961  THR C CA  1 
ATOM   2133 C  C   . THR C 1 52  ? 7.76100   -2.29200  7.44100   1.000 60.68886  ? 961  THR C C   1 
ATOM   2134 O  O   . THR C 1 52  ? 8.17000   -2.08400  8.61000   1.000 56.33570  ? 961  THR C O   1 
ATOM   2135 C  CB  . THR C 1 52  ? 9.05700   -1.07600  5.66400   1.000 57.46215  ? 961  THR C CB  1 
ATOM   2136 O  OG1 . THR C 1 52  ? 10.11200  -1.27000  4.72000   1.000 71.87178  ? 961  THR C OG1 1 
ATOM   2137 C  CG2 . THR C 1 52  ? 9.41300   0.00800   6.66000   1.000 53.78540  ? 961  THR C CG2 1 
ATOM   2138 N  N   . LEU C 1 53  ? 6.47100   -2.33600  7.09400   1.000 54.47758  ? 962  LEU C N   1 
ATOM   2139 C  CA  . LEU C 1 53  ? 5.34600   -2.35500  8.06400   1.000 48.45844  ? 962  LEU C CA  1 
ATOM   2140 C  C   . LEU C 1 53  ? 5.43100   -3.64700  8.88700   1.000 51.36669  ? 962  LEU C C   1 
ATOM   2141 O  O   . LEU C 1 53  ? 5.45000   -3.56000  10.12600  1.000 60.75465  ? 962  LEU C O   1 
ATOM   2142 C  CB  . LEU C 1 53  ? 4.01700   -2.25000  7.31000   1.000 44.90538  ? 962  LEU C CB  1 
ATOM   2143 C  CG  . LEU C 1 53  ? 2.77300   -2.35800  8.18400   1.000 49.63753  ? 962  LEU C CG  1 
ATOM   2144 C  CD1 . LEU C 1 53  ? 2.69700   -1.21000  9.17400   1.000 49.64806  ? 962  LEU C CD1 1 
ATOM   2145 C  CD2 . LEU C 1 53  ? 1.51000   -2.41900  7.34600   1.000 47.73204  ? 962  LEU C CD2 1 
ATOM   2146 N  N   . VAL C 1 54  ? 5.53400   -4.80400  8.23400   1.000 52.85107  ? 963  VAL C N   1 
ATOM   2147 C  CA  . VAL C 1 54  ? 5.61700   -6.11700  8.94200   1.000 56.14621  ? 963  VAL C CA  1 
ATOM   2148 C  C   . VAL C 1 54  ? 6.76600   -6.08100  9.95700   1.000 54.91711  ? 963  VAL C C   1 
ATOM   2149 O  O   . VAL C 1 54  ? 6.58500   -6.55700  11.07900  1.000 60.93099  ? 963  VAL C O   1 
ATOM   2150 C  CB  . VAL C 1 54  ? 5.77800   -7.30200  7.97200   1.000 59.28606  ? 963  VAL C CB  1 
ATOM   2151 C  CG1 . VAL C 1 54  ? 6.27000   -8.54200  8.69700   1.000 58.82021  ? 963  VAL C CG1 1 
ATOM   2152 C  CG2 . VAL C 1 54  ? 4.48500   -7.60800  7.22800   1.000 57.86220  ? 963  VAL C CG2 1 
ATOM   2153 N  N   . LYS C 1 55  ? 7.92500   -5.56400  9.57700   1.000 66.45007  ? 964  LYS C N   1 
ATOM   2154 C  CA  . LYS C 1 55  ? 9.11300   -5.59200  10.46700  1.000 74.85634  ? 964  LYS C CA  1 
ATOM   2155 C  C   . LYS C 1 55  ? 8.84000   -4.70200  11.67900  1.000 79.08317  ? 964  LYS C C   1 
ATOM   2156 O  O   . LYS C 1 55  ? 9.10200   -5.13800  12.82000  1.000 74.54841  ? 964  LYS C O   1 
ATOM   2157 C  CB  . LYS C 1 55  ? 10.38100  -5.17800  9.71300   1.000 77.50929  ? 964  LYS C CB  1 
ATOM   2158 C  CG  . LYS C 1 55  ? 10.94000  -6.26600  8.80300   1.000 93.47437  ? 964  LYS C CG  1 
ATOM   2159 C  CD  . LYS C 1 55  ? 12.19300  -5.88600  8.03700   1.000 96.77213  ? 964  LYS C CD  1 
ATOM   2160 C  CE  . LYS C 1 55  ? 12.53100  -6.89000  6.95300   1.000 83.40211  ? 964  LYS C CE  1 
ATOM   2161 N  NZ  . LYS C 1 55  ? 13.98900  -6.95900  6.70500   1.000 75.74329  ? 964  LYS C NZ  1 
ATOM   2162 N  N   . GLN C 1 56  ? 8.32000   -3.50100  11.44800  1.000 75.72487  ? 965  GLN C N   1 
ATOM   2163 C  CA  . GLN C 1 56  ? 8.11400   -2.52300  12.54000  1.000 70.23210  ? 965  GLN C CA  1 
ATOM   2164 C  C   . GLN C 1 56  ? 6.96700   -3.01800  13.42700  1.000 64.77356  ? 965  GLN C C   1 
ATOM   2165 O  O   . GLN C 1 56  ? 7.02400   -2.76400  14.63600  1.000 65.19466  ? 965  GLN C O   1 
ATOM   2166 C  CB  . GLN C 1 56  ? 7.89600   -1.12800  11.95900  1.000 70.51898  ? 965  GLN C CB  1 
ATOM   2167 C  CG  . GLN C 1 56  ? 8.42100   -0.02600  12.86700  1.000 83.09944  ? 965  GLN C CG  1 
ATOM   2168 C  CD  . GLN C 1 56  ? 8.89700   1.18500   12.09800  1.000 90.50559  ? 965  GLN C CD  1 
ATOM   2169 O  OE1 . GLN C 1 56  ? 8.66100   1.33400   10.89300  1.000 85.63922  ? 965  GLN C OE1 1 
ATOM   2170 N  NE2 . GLN C 1 56  ? 9.58100   2.07100   12.80700  1.000 93.40594  ? 965  GLN C NE2 1 
ATOM   2171 N  N   . LEU C 1 57  ? 5.98500   -3.72500  12.85600  1.000 61.75740  ? 966  LEU C N   1 
ATOM   2172 C  CA  . LEU C 1 57  ? 4.83600   -4.28200  13.61500  1.000 58.81495  ? 966  LEU C CA  1 
ATOM   2173 C  C   . LEU C 1 57  ? 5.32700   -5.38500  14.55300  1.000 64.34982  ? 966  LEU C C   1 
ATOM   2174 O  O   . LEU C 1 57  ? 4.92800   -5.37400  15.73300  1.000 70.73216  ? 966  LEU C O   1 
ATOM   2175 C  CB  . LEU C 1 57  ? 3.77500   -4.82900  12.65800  1.000 58.67809  ? 966  LEU C CB  1 
ATOM   2176 C  CG  . LEU C 1 57  ? 2.87100   -3.79200  11.99300  1.000 54.23282  ? 966  LEU C CG  1 
ATOM   2177 C  CD1 . LEU C 1 57  ? 1.82100   -4.47300  11.12800  1.000 47.53991  ? 966  LEU C CD1 1 
ATOM   2178 C  CD2 . LEU C 1 57  ? 2.19700   -2.89900  13.01600  1.000 53.18269  ? 966  LEU C CD2 1 
ATOM   2179 N  N   . SER C 1 58  ? 6.14900   -6.30800  14.05300  1.000 57.42794  ? 967  SER C N   1 
ATOM   2180 C  CA  . SER C 1 58  ? 6.71600   -7.41000  14.87000  1.000 60.45988  ? 967  SER C CA  1 
ATOM   2181 C  C   . SER C 1 58  ? 7.53100   -6.80100  16.01300  1.000 63.04177  ? 967  SER C C   1 
ATOM   2182 O  O   . SER C 1 58  ? 7.47800   -7.34300  17.11600  1.000 56.36992  ? 967  SER C O   1 
ATOM   2183 C  CB  . SER C 1 58  ? 7.51800   -8.38200  14.04700  1.000 59.55714  ? 967  SER C CB  1 
ATOM   2184 O  OG  . SER C 1 58  ? 8.51200   -7.71100  13.29600  1.000 84.26800  ? 967  SER C OG  1 
ATOM   2185 N  N   . SER C 1 59  ? 8.20900   -5.68100  15.75900  1.000 60.99416  ? 968  SER C N   1 
ATOM   2186 C  CA  . SER C 1 59  ? 9.02300   -4.94500  16.76100  1.000 63.07862  ? 968  SER C CA  1 
ATOM   2187 C  C   . SER C 1 59  ? 8.10300   -4.38500  17.85000  1.000 65.31573  ? 968  SER C C   1 
ATOM   2188 O  O   . SER C 1 59  ? 8.43000   -4.53200  19.03800  1.000 73.85886  ? 968  SER C O   1 
ATOM   2189 C  CB  . SER C 1 59  ? 9.83200   -3.86300  16.11000  1.000 70.04261  ? 968  SER C CB  1 
ATOM   2190 O  OG  . SER C 1 59  ? 10.23200  -2.90900  17.07300  1.000 72.44026  ? 968  SER C OG  1 
ATOM   2191 N  N   . ASN C 1 60  ? 6.98700   -3.77700  17.44700  1.000 66.90276  ? 969  ASN C N   1 
ATOM   2192 C  CA  . ASN C 1 60  ? 6.00100   -3.15700  18.36800  1.000 64.65512  ? 969  ASN C CA  1 
ATOM   2193 C  C   . ASN C 1 60  ? 5.34500   -4.24500  19.21700  1.000 68.15554  ? 969  ASN C C   1 
ATOM   2194 O  O   . ASN C 1 60  ? 5.12600   -3.99400  20.40500  1.000 71.97968  ? 969  ASN C O   1 
ATOM   2195 C  CB  . ASN C 1 60  ? 4.93800   -2.33800  17.63200  1.000 64.17612  ? 969  ASN C CB  1 
ATOM   2196 C  CG  . ASN C 1 60  ? 5.44100   -0.99100  17.15600  1.000 61.81004  ? 969  ASN C CG  1 
ATOM   2197 O  OD1 . ASN C 1 60  ? 6.62300   -0.67700  17.27200  1.000 70.47687  ? 969  ASN C OD1 1 
ATOM   2198 N  ND2 . ASN C 1 60  ? 4.54600   -0.18200  16.61600  1.000 49.94809  ? 969  ASN C ND2 1 
ATOM   2199 N  N   . PHE C 1 61  ? 5.02600   -5.40300  18.64300  1.000 68.12922  ? 970  PHE C N   1 
ATOM   2200 C  CA  . PHE C 1 61  ? 4.34500   -6.49800  19.38600  1.000 74.23258  ? 970  PHE C CA  1 
ATOM   2201 C  C   . PHE C 1 61  ? 5.31600   -7.13200  20.37700  1.000 72.90348  ? 970  PHE C C   1 
ATOM   2202 O  O   . PHE C 1 61  ? 4.88800   -7.52900  21.46900  1.000 82.02299  ? 970  PHE C O   1 
ATOM   2203 C  CB  . PHE C 1 61  ? 3.77500   -7.55300  18.44500  1.000 73.75095  ? 970  PHE C CB  1 
ATOM   2204 C  CG  . PHE C 1 61  ? 2.49600   -7.13800  17.77000  1.000 68.27924  ? 970  PHE C CG  1 
ATOM   2205 C  CD1 . PHE C 1 61  ? 1.39600   -6.76200  18.52000  1.000 68.33188  ? 970  PHE C CD1 1 
ATOM   2206 C  CD2 . PHE C 1 61  ? 2.38800   -7.14400  16.39200  1.000 60.99942  ? 970  PHE C CD2 1 
ATOM   2207 C  CE1 . PHE C 1 61  ? 0.21100   -6.39000  17.90700  1.000 65.11044  ? 970  PHE C CE1 1 
ATOM   2208 C  CE2 . PHE C 1 61  ? 1.20500   -6.76700  15.78000  1.000 62.56013  ? 970  PHE C CE2 1 
ATOM   2209 C  CZ  . PHE C 1 61  ? 0.11900   -6.38900  16.53800  1.000 64.67881  ? 970  PHE C CZ  1 
ATOM   2210 N  N   . GLY C 1 62  ? 6.58500   -7.23300  19.99400  1.000 75.28797  ? 971  GLY C N   1 
ATOM   2211 C  CA  . GLY C 1 62  ? 7.66900   -7.69200  20.88400  1.000 77.97514  ? 971  GLY C CA  1 
ATOM   2212 C  C   . GLY C 1 62  ? 7.77900   -6.80300  22.11000  1.000 68.78193  ? 971  GLY C C   1 
ATOM   2213 O  O   . GLY C 1 62  ? 7.87200   -7.33600  23.22700  1.000 72.91927  ? 971  GLY C O   1 
ATOM   2214 N  N   . ALA C 1 63  ? 7.76200   -5.48700  21.90000  1.000 69.17672  ? 972  ALA C N   1 
ATOM   2215 C  CA  . ALA C 1 63  ? 7.86100   -4.45400  22.95600  1.000 68.15817  ? 972  ALA C CA  1 
ATOM   2216 C  C   . ALA C 1 63  ? 6.60500   -4.49600  23.84400  1.000 73.48249  ? 972  ALA C C   1 
ATOM   2217 O  O   . ALA C 1 63  ? 6.75200   -4.36000  25.07100  1.000 74.85108  ? 972  ALA C O   1 
ATOM   2218 C  CB  . ALA C 1 63  ? 8.07600   -3.09900  22.32100  1.000 59.05182  ? 972  ALA C CB  1 
ATOM   2219 N  N   . ILE C 1 64  ? 5.41800   -4.70900  23.26400  1.000 74.19047  ? 973  ILE C N   1 
ATOM   2220 C  CA  . ILE C 1 64  ? 4.12800   -4.75300  24.01600  1.000 61.89953  ? 973  ILE C CA  1 
ATOM   2221 C  C   . ILE C 1 64  ? 4.12800   -5.98100  24.93100  1.000 74.34576  ? 973  ILE C C   1 
ATOM   2222 O  O   . ILE C 1 64  ? 3.87100   -5.82000  26.13100  1.000 82.80993  ? 973  ILE C O   1 
ATOM   2223 C  CB  . ILE C 1 64  ? 2.91000   -4.73700  23.07000  1.000 57.27266  ? 973  ILE C CB  1 
ATOM   2224 C  CG1 . ILE C 1 64  ? 2.79100   -3.40800  22.32000  1.000 60.34671  ? 973  ILE C CG1 1 
ATOM   2225 C  CG2 . ILE C 1 64  ? 1.63600   -5.04900  23.83500  1.000 56.17252  ? 973  ILE C CG2 1 
ATOM   2226 C  CD1 . ILE C 1 64  ? 1.86200   -3.44000  21.12700  1.000 59.46239  ? 973  ILE C CD1 1 
ATOM   2227 N  N   . SER C 1 65  ? 4.40200   -7.16800  24.39100  1.000 80.58598  ? 974  SER C N   1 
ATOM   2228 C  CA  . SER C 1 65  ? 4.33600   -8.44400  25.15500  1.000 86.71040  ? 974  SER C CA  1 
ATOM   2229 C  C   . SER C 1 65  ? 5.38000   -8.42200  26.28600  1.000 81.49135  ? 974  SER C C   1 
ATOM   2230 O  O   . SER C 1 65  ? 5.08300   -8.96500  27.36200  1.000 83.07575  ? 974  SER C O   1 
ATOM   2231 C  CB  . SER C 1 65  ? 4.44800   -9.66500  24.24800  1.000 85.48920  ? 974  SER C CB  1 
ATOM   2232 O  OG  . SER C 1 65  ? 5.79700   -10.05400 24.03400  1.000 88.52640  ? 974  SER C OG  1 
ATOM   2233 N  N   . SER C 1 66  ? 6.52900   -7.77000  26.07200  1.000 76.53023  ? 975  SER C N   1 
ATOM   2234 C  CA  . SER C 1 66  ? 7.58700   -7.54300  27.09300  1.000 77.98567  ? 975  SER C CA  1 
ATOM   2235 C  C   . SER C 1 66  ? 7.03800   -6.68900  28.24300  1.000 78.73049  ? 975  SER C C   1 
ATOM   2236 O  O   . SER C 1 66  ? 7.29000   -7.04300  29.41100  1.000 80.69915  ? 975  SER C O   1 
ATOM   2237 C  CB  . SER C 1 66  ? 8.81200   -6.90700  26.48600  1.000 78.96999  ? 975  SER C CB  1 
ATOM   2238 O  OG  . SER C 1 66  ? 9.65200   -6.34500  27.48300  1.000 81.55978  ? 975  SER C OG  1 
ATOM   2239 N  N   . VAL C 1 67  ? 6.34000   -5.59900  27.91800  1.000 70.52161  ? 976  VAL C N   1 
ATOM   2240 C  CA  . VAL C 1 67  ? 5.75800   -4.63700  28.90000  1.000 68.30293  ? 976  VAL C CA  1 
ATOM   2241 C  C   . VAL C 1 67  ? 4.61200   -5.32000  29.64800  1.000 74.67737  ? 976  VAL C C   1 
ATOM   2242 O  O   . VAL C 1 67  ? 4.47000   -5.06800  30.85600  1.000 77.43034  ? 976  VAL C O   1 
ATOM   2243 C  CB  . VAL C 1 67  ? 5.26200   -3.35000  28.21500  1.000 67.02909  ? 976  VAL C CB  1 
ATOM   2244 C  CG1 . VAL C 1 67  ? 4.47500   -2.46000  29.16700  1.000 67.63969  ? 976  VAL C CG1 1 
ATOM   2245 C  CG2 . VAL C 1 67  ? 6.41000   -2.57900  27.58500  1.000 67.50809  ? 976  VAL C CG2 1 
ATOM   2246 N  N   . LEU C 1 68  ? 3.81200   -6.13000  28.95600  1.000 66.58430  ? 977  LEU C N   1 
ATOM   2247 C  CA  . LEU C 1 68  ? 2.65200   -6.82700  29.56700  1.000 77.48297  ? 977  LEU C CA  1 
ATOM   2248 C  C   . LEU C 1 68  ? 3.14900   -7.89300  30.55200  1.000 81.03603  ? 977  LEU C C   1 
ATOM   2249 O  O   . LEU C 1 68  ? 2.61700   -7.93600  31.67300  1.000 81.20974  ? 977  LEU C O   1 
ATOM   2250 C  CB  . LEU C 1 68  ? 1.77300   -7.41800  28.46400  1.000 72.81399  ? 977  LEU C CB  1 
ATOM   2251 C  CG  . LEU C 1 68  ? 0.86600   -6.41100  27.76000  1.000 66.36585  ? 977  LEU C CG  1 
ATOM   2252 C  CD1 . LEU C 1 68  ? 0.07600   -7.07200  26.64500  1.000 61.68898  ? 977  LEU C CD1 1 
ATOM   2253 C  CD2 . LEU C 1 68  ? -0.08200  -5.74600  28.73600  1.000 63.39181  ? 977  LEU C CD2 1 
ATOM   2254 N  N   . ASN C 1 69  ? 4.16100   -8.68000  30.17900  1.000 88.53167  ? 978  ASN C N   1 
ATOM   2255 C  CA  . ASN C 1 69  ? 4.74400   -9.73900  31.05300  1.000 95.09824  ? 978  ASN C CA  1 
ATOM   2256 C  C   . ASN C 1 69  ? 5.35200   -9.11100  32.31800  1.000 100.49889 ? 978  ASN C C   1 
ATOM   2257 O  O   . ASN C 1 69  ? 5.24200   -9.74600  33.38600  1.000 101.05422 ? 978  ASN C O   1 
ATOM   2258 C  CB  . ASN C 1 69  ? 5.75800   -10.61300 30.30600  1.000 93.52174  ? 978  ASN C CB  1 
ATOM   2259 C  CG  . ASN C 1 69  ? 5.10900   -11.64700 29.40500  1.000 93.09011  ? 978  ASN C CG  1 
ATOM   2260 O  OD1 . ASN C 1 69  ? 5.66300   -12.00600 28.36200  1.000 100.89894 ? 978  ASN C OD1 1 
ATOM   2261 N  ND2 . ASN C 1 69  ? 3.93900   -12.13800 29.79600  1.000 83.29683  ? 978  ASN C ND2 1 
ATOM   2262 N  N   . ASP C 1 70  ? 5.93200   -7.92000  32.20600  1.000 105.36790 ? 979  ASP C N   1 
ATOM   2263 C  CA  . ASP C 1 70  ? 6.47100   -7.21600  33.36200  1.000 110.11847 ? 979  ASP C CA  1 
ATOM   2264 C  C   . ASP C 1 70  ? 5.34700   -6.74000  34.27700  1.000 106.53646 ? 979  ASP C C   1 
ATOM   2265 O  O   . ASP C 1 70  ? 5.43800   -6.86000  35.49900  1.000 107.16022 ? 979  ASP C O   1 
ATOM   2266 C  CB  . ASP C 1 70  ? 7.32600   -6.02900  32.91600  1.000 110.86329 ? 979  ASP C CB  1 
ATOM   2267 C  CG  . ASP C 1 70  ? 8.76600   -6.14100  33.37800  1.000 113.05040 ? 979  ASP C CG  1 
ATOM   2268 O  OD1 . ASP C 1 70  ? 8.99100   -6.59600  34.51900  1.000 114.02683 ? 979  ASP C OD1 1 
ATOM   2269 O  OD2 . ASP C 1 70  ? 9.67200   -5.77300  32.60100  1.000 110.76591 ? 979  ASP C OD2 1 
ATOM   2270 N  N   . ILE C 1 71  ? 4.28700   -6.20000  33.68100  1.000 102.35701 ? 980  ILE C N   1 
ATOM   2271 C  CA  . ILE C 1 71  ? 3.11600   -5.71700  34.46900  1.000 91.39517  ? 980  ILE C CA  1 
ATOM   2272 C  C   . ILE C 1 71  ? 2.52400   -6.90600  35.23200  1.000 87.24204  ? 980  ILE C C   1 
ATOM   2273 O  O   . ILE C 1 71  ? 2.26900   -6.73700  36.42900  1.000 91.80311  ? 980  ILE C O   1 
ATOM   2274 C  CB  . ILE C 1 71  ? 2.08700   -5.00200  33.57600  1.000 80.28594  ? 980  ILE C CB  1 
ATOM   2275 C  CG1 . ILE C 1 71  ? 2.61800   -3.64500  33.11400  1.000 85.22864  ? 980  ILE C CG1 1 
ATOM   2276 C  CG2 . ILE C 1 71  ? 0.76100   -4.84500  34.29000  1.000 86.54722  ? 980  ILE C CG2 1 
ATOM   2277 C  CD1 . ILE C 1 71  ? 1.88500   -3.06600  31.92700  1.000 88.84486  ? 980  ILE C CD1 1 
ATOM   2278 N  N   . LEU C 1 72  ? 2.36900   -8.06700  34.58400  1.000 92.53215  ? 981  LEU C N   1 
ATOM   2279 C  CA  . LEU C 1 72  ? 1.77300   -9.30000  35.18400  1.000 90.99249  ? 981  LEU C CA  1 
ATOM   2280 C  C   . LEU C 1 72  ? 2.63800   -9.81500  36.34200  1.000 95.73516  ? 981  LEU C C   1 
ATOM   2281 O  O   . LEU C 1 72  ? 2.06300   -10.25300 37.35300  1.000 100.98053 ? 981  LEU C O   1 
ATOM   2282 C  CB  . LEU C 1 72  ? 1.60400   -10.37900 34.10600  1.000 91.36622  ? 981  LEU C CB  1 
ATOM   2283 C  CG  . LEU C 1 72  ? 0.53500   -10.08800 33.04900  1.000 90.95827  ? 981  LEU C CG  1 
ATOM   2284 C  CD1 . LEU C 1 72  ? 0.52600   -11.15000 31.96000  1.000 76.39074  ? 981  LEU C CD1 1 
ATOM   2285 C  CD2 . LEU C 1 72  ? -0.84600  -9.95600  33.67900  1.000 89.49757  ? 981  LEU C CD2 1 
ATOM   2286 N  N   . SER C 1 73  ? 3.96500   -9.76300  36.21000  1.000 104.03089 ? 982  SER C N   1 
ATOM   2287 C  CA  . SER C 1 73  ? 4.92100   -10.18900 37.26800  1.000 112.51612 ? 982  SER C CA  1 
ATOM   2288 C  C   . SER C 1 73  ? 4.84900   -9.22400  38.46200  1.000 113.03987 ? 982  SER C C   1 
ATOM   2289 O  O   . SER C 1 73  ? 4.84600   -9.72200  39.60400  1.000 125.24133 ? 982  SER C O   1 
ATOM   2290 C  CB  . SER C 1 73  ? 6.33000   -10.32900 36.74000  1.000 117.48514 ? 982  SER C CB  1 
ATOM   2291 O  OG  . SER C 1 73  ? 7.08200   -9.14300  36.95600  1.000 116.75347 ? 982  SER C OG  1 
ATOM   2292 N  N   . ARG C 1 74  ? 4.78300   -7.90900  38.21100  1.000 111.91605 ? 983  ARG C N   1 
ATOM   2293 C  CA  . ARG C 1 74  ? 4.58400   -6.86100  39.25500  1.000 106.76017 ? 983  ARG C CA  1 
ATOM   2294 C  C   . ARG C 1 74  ? 3.28100   -7.13800  40.01900  1.000 111.99764 ? 983  ARG C C   1 
ATOM   2295 O  O   . ARG C 1 74  ? 3.32800   -7.14400  41.26500  1.000 112.95302 ? 983  ARG C O   1 
ATOM   2296 C  CB  . ARG C 1 74  ? 4.55400   -5.45100  38.65400  1.000 104.03353 ? 983  ARG C CB  1 
ATOM   2297 C  CG  . ARG C 1 74  ? 5.92800   -4.86700  38.36000  1.000 103.88351 ? 983  ARG C CG  1 
ATOM   2298 C  CD  . ARG C 1 74  ? 5.87000   -3.51000  37.67700  1.000 110.65274 ? 983  ARG C CD  1 
ATOM   2299 N  NE  . ARG C 1 74  ? 7.18800   -3.06900  37.22600  1.000 123.01738 ? 983  ARG C NE  1 
ATOM   2300 C  CZ  . ARG C 1 74  ? 7.47100   -1.86800  36.72100  1.000 126.02564 ? 983  ARG C CZ  1 
ATOM   2301 N  NH1 . ARG C 1 74  ? 6.52500   -0.94800  36.59700  1.000 124.56494 ? 983  ARG C NH1 1 
ATOM   2302 N  NH2 . ARG C 1 74  ? 8.71000   -1.59000  36.34600  1.000 123.51481 ? 983  ARG C NH2 1 
ATOM   2303 N  N   . LEU C 1 75  ? 2.17200   -7.36600  39.30300  1.000 110.23690 ? 984  LEU C N   1 
ATOM   2304 C  CA  . LEU C 1 75  ? 0.82000   -7.59500  39.89400  1.000 107.18127 ? 984  LEU C CA  1 
ATOM   2305 C  C   . LEU C 1 75  ? 0.81100   -8.86500  40.75200  1.000 107.16285 ? 984  LEU C C   1 
ATOM   2306 O  O   . LEU C 1 75  ? 0.08200   -8.87200  41.75800  1.000 103.67822 ? 984  LEU C O   1 
ATOM   2307 C  CB  . LEU C 1 75  ? -0.23800  -7.68500  38.79100  1.000 97.76699  ? 984  LEU C CB  1 
ATOM   2308 C  CG  . LEU C 1 75  ? -1.03200  -6.40300  38.55500  1.000 87.62630  ? 984  LEU C CG  1 
ATOM   2309 C  CD1 . LEU C 1 75  ? -0.10700  -5.23600  38.28100  1.000 93.14538  ? 984  LEU C CD1 1 
ATOM   2310 C  CD2 . LEU C 1 75  ? -2.00300  -6.57000  37.40500  1.000 92.74796  ? 984  LEU C CD2 1 
ATOM   2311 N  N   . ASP C 1 76  ? 1.56400   -9.89800  40.36400  1.000 112.62929 ? 985  ASP C N   1 
ATOM   2312 C  CA  . ASP C 1 76  ? 1.69600   -11.15500 41.15200  1.000 115.40594 ? 985  ASP C CA  1 
ATOM   2313 C  C   . ASP C 1 76  ? 2.48100   -10.88600 42.44200  1.000 118.59317 ? 985  ASP C C   1 
ATOM   2314 O  O   . ASP C 1 76  ? 2.19300   -11.55700 43.45900  1.000 109.44207 ? 985  ASP C O   1 
ATOM   2315 C  CB  . ASP C 1 76  ? 2.35200   -12.26900 40.33600  1.000 115.74546 ? 985  ASP C CB  1 
ATOM   2316 C  CG  . ASP C 1 76  ? 1.34300   -13.20900 39.70800  1.000 110.33955 ? 985  ASP C CG  1 
ATOM   2317 O  OD1 . ASP C 1 76  ? 0.34200   -12.70700 39.16800  1.000 107.37603 ? 985  ASP C OD1 1 
ATOM   2318 O  OD2 . ASP C 1 76  ? 1.55200   -14.43500 39.78900  1.000 107.33129 ? 985  ASP C OD2 1 
ATOM   2319 N  N   . LYS C 1 77  ? 3.44100   -9.95500  42.39500  1.000 125.25976 ? 986  LYS C N   1 
ATOM   2320 C  CA  . LYS C 1 77  ? 4.29600   -9.57200  43.55200  1.000 130.64724 ? 986  LYS C CA  1 
ATOM   2321 C  C   . LYS C 1 77  ? 3.54500   -8.60300  44.47200  1.000 131.47103 ? 986  LYS C C   1 
ATOM   2322 O  O   . LYS C 1 77  ? 3.90700   -8.53500  45.66600  1.000 138.40607 ? 986  LYS C O   1 
ATOM   2323 C  CB  . LYS C 1 77  ? 5.63000   -8.99300  43.06900  1.000 131.71053 ? 986  LYS C CB  1 
ATOM   2324 C  CG  . LYS C 1 77  ? 6.57800   -10.04900 42.51800  1.000 135.48730 ? 986  LYS C CG  1 
ATOM   2325 C  CD  . LYS C 1 77  ? 7.99200   -9.58800  42.25600  1.000 136.62954 ? 986  LYS C CD  1 
ATOM   2326 C  CE  . LYS C 1 77  ? 8.95200   -10.75900 42.26200  1.000 137.35857 ? 986  LYS C CE  1 
ATOM   2327 N  NZ  . LYS C 1 77  ? 10.32500  -10.34800 41.89800  1.000 137.14802 ? 986  LYS C NZ  1 
ATOM   2328 N  N   . VAL C 1 78  ? 2.54600   -7.88200  43.95400  1.000 129.92874 ? 987  VAL C N   1 
ATOM   2329 C  CA  . VAL C 1 78  ? 1.68700   -6.98000  44.77500  1.000 121.29086 ? 987  VAL C CA  1 
ATOM   2330 C  C   . VAL C 1 78  ? 0.58300   -7.81800  45.43500  1.000 121.47772 ? 987  VAL C C   1 
ATOM   2331 O  O   . VAL C 1 78  ? 0.35800   -7.61800  46.63600  1.000 124.22542 ? 987  VAL C O   1 
ATOM   2332 C  CB  . VAL C 1 78  ? 1.13300   -5.80800  43.94600  1.000 113.21884 ? 987  VAL C CB  1 
ATOM   2333 C  CG1 . VAL C 1 78  ? 0.02400   -5.07300  44.67700  1.000 106.83913 ? 987  VAL C CG1 1 
ATOM   2334 C  CG2 . VAL C 1 78  ? 2.23700   -4.83900  43.55100  1.000 114.29528 ? 987  VAL C CG2 1 
ATOM   2335 N  N   . GLU C 1 79  ? -0.06200  -8.73000  44.69600  1.000 123.89117 ? 988  GLU C N   1 
ATOM   2336 C  CA  . GLU C 1 79  ? -1.09100  -9.67100  45.23000  1.000 115.35857 ? 988  GLU C CA  1 
ATOM   2337 C  C   . GLU C 1 79  ? -0.40400  -10.73800 46.09400  1.000 116.59556 ? 988  GLU C C   1 
ATOM   2338 O  O   . GLU C 1 79  ? -0.50300  -11.93500 45.73300  1.000 124.45703 ? 988  GLU C O   1 
ATOM   2339 C  CB  . GLU C 1 79  ? -1.88200  -10.34200 44.10200  1.000 110.21058 ? 988  GLU C CB  1 
ATOM   2340 C  CG  . GLU C 1 79  ? -2.72500  -9.38400  43.27800  1.000 110.50272 ? 988  GLU C CG  1 
ATOM   2341 C  CD  . GLU C 1 79  ? -3.44400  -10.02400 42.10100  1.000 114.22949 ? 988  GLU C CD  1 
ATOM   2342 O  OE1 . GLU C 1 79  ? -3.00300  -11.10100 41.64700  1.000 117.90887 ? 988  GLU C OE1 1 
ATOM   2343 O  OE2 . GLU C 1 79  ? -4.44100  -9.44200  41.63800  1.000 112.57929 ? 988  GLU C OE2 1 
ATOM   2344 N  N   . ASP C 1 87  ? 5.81700   -17.04900 30.38100  1.000 121.99094 ? 1163 ASP C N   1 
ATOM   2345 C  CA  . ASP C 1 87  ? 5.57300   -15.95500 29.40300  1.000 119.06164 ? 1163 ASP C CA  1 
ATOM   2346 C  C   . ASP C 1 87  ? 4.22400   -16.19900 28.72100  1.000 116.97455 ? 1163 ASP C C   1 
ATOM   2347 O  O   . ASP C 1 87  ? 3.99100   -17.34100 28.25800  1.000 114.31107 ? 1163 ASP C O   1 
ATOM   2348 C  CB  . ASP C 1 87  ? 6.71800   -15.82800 28.39100  1.000 117.46408 ? 1163 ASP C CB  1 
ATOM   2349 C  CG  . ASP C 1 87  ? 7.16500   -17.14900 27.79400  1.000 114.37424 ? 1163 ASP C CG  1 
ATOM   2350 O  OD1 . ASP C 1 87  ? 6.39200   -17.71500 26.99900  1.000 107.93399 ? 1163 ASP C OD1 1 
ATOM   2351 O  OD2 . ASP C 1 87  ? 8.27100   -17.60200 28.14600  1.000 119.62487 ? 1163 ASP C OD2 1 
ATOM   2352 N  N   . VAL C 1 88  ? 3.36700   -15.17200 28.69500  1.000 112.26609 ? 1164 VAL C N   1 
ATOM   2353 C  CA  . VAL C 1 88  ? 2.07200   -15.16900 27.95300  1.000 106.33643 ? 1164 VAL C CA  1 
ATOM   2354 C  C   . VAL C 1 88  ? 2.16200   -14.14100 26.80700  1.000 103.81508 ? 1164 VAL C C   1 
ATOM   2355 O  O   . VAL C 1 88  ? 1.92700   -12.93400 27.04000  1.000 100.36467 ? 1164 VAL C O   1 
ATOM   2356 C  CB  . VAL C 1 88  ? 0.88400   -14.94100 28.90800  1.000 96.67212  ? 1164 VAL C CB  1 
ATOM   2357 C  CG1 . VAL C 1 88  ? -0.44200  -14.96300 28.15700  1.000 88.87645  ? 1164 VAL C CG1 1 
ATOM   2358 C  CG2 . VAL C 1 88  ? 0.87800   -15.96400 30.04100  1.000 92.19263  ? 1164 VAL C CG2 1 
ATOM   2359 N  N   . ASP C 1 89  ? 2.49800   -14.63400 25.60800  1.000 99.57773  ? 1165 ASP C N   1 
ATOM   2360 C  CA  . ASP C 1 89  ? 2.81400   -13.85400 24.38100  1.000 98.57498  ? 1165 ASP C CA  1 
ATOM   2361 C  C   . ASP C 1 89  ? 1.71200   -14.09000 23.34000  1.000 94.07181  ? 1165 ASP C C   1 
ATOM   2362 O  O   . ASP C 1 89  ? 0.60100   -14.48700 23.73900  1.000 98.18546  ? 1165 ASP C O   1 
ATOM   2363 C  CB  . ASP C 1 89  ? 4.21100   -14.21700 23.85400  1.000 110.98436 ? 1165 ASP C CB  1 
ATOM   2364 C  CG  . ASP C 1 89  ? 4.32700   -15.58600 23.18400  1.000 116.50344 ? 1165 ASP C CG  1 
ATOM   2365 O  OD1 . ASP C 1 89  ? 3.37600   -16.38500 23.30100  1.000 116.02181 ? 1165 ASP C OD1 1 
ATOM   2366 O  OD2 . ASP C 1 89  ? 5.36900   -15.84200 22.53200  1.000 119.09323 ? 1165 ASP C OD2 1 
ATOM   2367 N  N   . LEU C 1 90  ? 2.02600   -13.87300 22.05700  1.000 83.93901  ? 1166 LEU C N   1 
ATOM   2368 C  CA  . LEU C 1 90  ? 1.03300   -13.66100 20.96900  1.000 87.79474  ? 1166 LEU C CA  1 
ATOM   2369 C  C   . LEU C 1 90  ? 1.65100   -14.05000 19.61700  1.000 89.75550  ? 1166 LEU C C   1 
ATOM   2370 O  O   . LEU C 1 90  ? 2.81000   -14.51500 19.59700  1.000 88.13162  ? 1166 LEU C O   1 
ATOM   2371 C  CB  . LEU C 1 90  ? 0.56000   -12.19700 21.00500  1.000 81.16763  ? 1166 LEU C CB  1 
ATOM   2372 C  CG  . LEU C 1 90  ? 1.62200   -11.12900 21.28300  1.000 76.90659  ? 1166 LEU C CG  1 
ATOM   2373 C  CD1 . LEU C 1 90  ? 2.60200   -11.01200 20.12900  1.000 70.05840  ? 1166 LEU C CD1 1 
ATOM   2374 C  CD2 . LEU C 1 90  ? 0.97800   -9.78100  21.55500  1.000 68.91353  ? 1166 LEU C CD2 1 
ATOM   2375 N  N   . GLY C 1 91  ? 0.89000   -13.87600 18.53500  1.000 86.35772  ? 1167 GLY C N   1 
ATOM   2376 C  CA  . GLY C 1 91  ? 1.18500   -14.46300 17.21500  1.000 90.78194  ? 1167 GLY C CA  1 
ATOM   2377 C  C   . GLY C 1 91  ? 2.39500   -13.83400 16.54800  1.000 86.19718  ? 1167 GLY C C   1 
ATOM   2378 O  O   . GLY C 1 91  ? 2.59200   -12.60900 16.70300  1.000 88.68958  ? 1167 GLY C O   1 
ATOM   2379 N  N   . ASP C 1 92  ? 3.16300   -14.64800 15.81400  1.000 82.86520  ? 1168 ASP C N   1 
ATOM   2380 C  CA  . ASP C 1 92  ? 4.35700   -14.21800 15.03700  1.000 77.05134  ? 1168 ASP C CA  1 
ATOM   2381 C  C   . ASP C 1 92  ? 3.90500   -13.83000 13.63500  1.000 80.46228  ? 1168 ASP C C   1 
ATOM   2382 O  O   . ASP C 1 92  ? 3.19700   -14.63600 13.01800  1.000 85.86293  ? 1168 ASP C O   1 
ATOM   2383 C  CB  . ASP C 1 92  ? 5.40600   -15.32300 14.93000  1.000 70.28211  ? 1168 ASP C CB  1 
ATOM   2384 C  CG  . ASP C 1 92  ? 6.73500   -14.81900 14.41100  1.000 82.70992  ? 1168 ASP C CG  1 
ATOM   2385 O  OD1 . ASP C 1 92  ? 6.91300   -13.59400 14.36400  1.000 88.28690  ? 1168 ASP C OD1 1 
ATOM   2386 O  OD2 . ASP C 1 92  ? 7.58000   -15.65600 14.06600  1.000 89.44230  ? 1168 ASP C OD2 1 
ATOM   2387 N  N   . ILE C 1 93  ? 4.29300   -12.64300 13.16900  1.000 76.59603  ? 1169 ILE C N   1 
ATOM   2388 C  CA  . ILE C 1 93  ? 3.89500   -12.11700 11.82900  1.000 77.16715  ? 1169 ILE C CA  1 
ATOM   2389 C  C   . ILE C 1 93  ? 5.13800   -11.94600 10.94500  1.000 74.27469  ? 1169 ILE C C   1 
ATOM   2390 O  O   . ILE C 1 93  ? 4.95100   -11.93700 9.72100   1.000 81.09920  ? 1169 ILE C O   1 
ATOM   2391 C  CB  . ILE C 1 93  ? 3.02400   -10.83900 11.93500  1.000 73.00349  ? 1169 ILE C CB  1 
ATOM   2392 C  CG1 . ILE C 1 93  ? 3.59400   -9.77200  12.87400  1.000 70.20052  ? 1169 ILE C CG1 1 
ATOM   2393 C  CG2 . ILE C 1 93  ? 1.59900   -11.19500 12.32900  1.000 72.93243  ? 1169 ILE C CG2 1 
ATOM   2394 C  CD1 . ILE C 1 93  ? 4.48600   -8.77600  12.18900  1.000 70.50845  ? 1169 ILE C CD1 1 
ATOM   2395 N  N   . SER C 1 94  ? 6.35100   -11.90200 11.52200  1.000 74.16152  ? 1170 SER C N   1 
ATOM   2396 C  CA  . SER C 1 94  ? 7.64000   -11.69500 10.80100  1.000 76.33547  ? 1170 SER C CA  1 
ATOM   2397 C  C   . SER C 1 94  ? 7.72700   -12.63200 9.58900   1.000 85.53394  ? 1170 SER C C   1 
ATOM   2398 O  O   . SER C 1 94  ? 8.38300   -12.24800 8.60300   1.000 88.88697  ? 1170 SER C O   1 
ATOM   2399 C  CB  . SER C 1 94  ? 8.83600   -11.87100 11.71400  1.000 79.20687  ? 1170 SER C CB  1 
ATOM   2400 O  OG  . SER C 1 94  ? 9.02600   -13.23300 12.07900  1.000 76.31968  ? 1170 SER C OG  1 
ATOM   2401 N  N   . GLY C 1 95  ? 7.08000   -13.80300 9.66500   1.000 95.67200  ? 1171 GLY C N   1 
ATOM   2402 C  CA  . GLY C 1 95  ? 6.96000   -14.76300 8.55200   1.000 96.97742  ? 1171 GLY C CA  1 
ATOM   2403 C  C   . GLY C 1 95  ? 6.32500   -14.12400 7.32800   1.000 97.79330  ? 1171 GLY C C   1 
ATOM   2404 O  O   . GLY C 1 95  ? 6.86200   -14.36000 6.21700   1.000 94.38763  ? 1171 GLY C O   1 
ATOM   2405 N  N   . ILE C 1 96  ? 5.25400   -13.32700 7.51200   1.000 96.81687  ? 1172 ILE C N   1 
ATOM   2406 C  CA  . ILE C 1 96  ? 4.52900   -12.64900 6.39100   1.000 73.13772  ? 1172 ILE C CA  1 
ATOM   2407 C  C   . ILE C 1 96  ? 5.56600   -11.83500 5.60800   1.000 83.60213  ? 1172 ILE C C   1 
ATOM   2408 O  O   . ILE C 1 96  ? 6.38200   -11.13800 6.25500   1.000 87.55523  ? 1172 ILE C O   1 
ATOM   2409 C  CB  . ILE C 1 96  ? 3.33100   -11.79100 6.86200   1.000 70.32949  ? 1172 ILE C CB  1 
ATOM   2410 C  CG1 . ILE C 1 96  ? 2.12200   -12.63700 7.27900   1.000 81.23342  ? 1172 ILE C CG1 1 
ATOM   2411 C  CG2 . ILE C 1 96  ? 2.92800   -10.79900 5.78200   1.000 66.05266  ? 1172 ILE C CG2 1 
ATOM   2412 C  CD1 . ILE C 1 96  ? 2.00900   -12.89500 8.76000   1.000 85.24180  ? 1172 ILE C CD1 1 
ATOM   2413 N  N   . ASN C 1 97  ? 5.56800   -11.98100 4.27600   1.000 80.86233  ? 1173 ASN C N   1 
ATOM   2414 C  CA  . ASN C 1 97  ? 6.52000   -11.31700 3.34400   1.000 75.96700  ? 1173 ASN C CA  1 
ATOM   2415 C  C   . ASN C 1 97  ? 5.81100   -11.07000 2.00600   1.000 68.77404  ? 1173 ASN C C   1 
ATOM   2416 O  O   . ASN C 1 97  ? 5.07400   -11.96500 1.55200   1.000 69.05565  ? 1173 ASN C O   1 
ATOM   2417 C  CB  . ASN C 1 97  ? 7.81000   -12.13500 3.20500   1.000 86.82883  ? 1173 ASN C CB  1 
ATOM   2418 C  CG  . ASN C 1 97  ? 8.76800   -11.61000 2.15500   1.000 87.97634  ? 1173 ASN C CG  1 
ATOM   2419 O  OD1 . ASN C 1 97  ? 8.71200   -12.01900 0.99500   1.000 77.63036  ? 1173 ASN C OD1 1 
ATOM   2420 N  ND2 . ASN C 1 97  ? 9.67900   -10.73500 2.55700   1.000 91.44254  ? 1173 ASN C ND2 1 
ATOM   2421 N  N   . ALA C 1 98  ? 5.99600   -9.87300  1.43700   1.000 70.72164  ? 1174 ALA C N   1 
ATOM   2422 C  CA  . ALA C 1 98  ? 5.49000   -9.45800  0.10900   1.000 66.06845  ? 1174 ALA C CA  1 
ATOM   2423 C  C   . ALA C 1 98  ? 6.61100   -9.62800  -0.91500  1.000 77.36191  ? 1174 ALA C C   1 
ATOM   2424 O  O   . ALA C 1 98  ? 7.63700   -8.94800  -0.76000  1.000 88.08161  ? 1174 ALA C O   1 
ATOM   2425 C  CB  . ALA C 1 98  ? 5.03800   -8.02300  0.16200   1.000 67.54494  ? 1174 ALA C CB  1 
ATOM   2426 N  N   . SER C 1 99  ? 6.42600   -10.49300 -1.91600  1.000 72.16392  ? 1175 SER C N   1 
ATOM   2427 C  CA  . SER C 1 99  ? 7.41600   -10.72500 -2.99900  1.000 73.34827  ? 1175 SER C CA  1 
ATOM   2428 C  C   . SER C 1 99  ? 7.51900   -9.46100  -3.84700  1.000 66.04476  ? 1175 SER C C   1 
ATOM   2429 O  O   . SER C 1 99  ? 6.60200   -8.62300  -3.78700  1.000 68.13975  ? 1175 SER C O   1 
ATOM   2430 C  CB  . SER C 1 99  ? 7.06100   -11.91400 -3.87100  1.000 76.02227  ? 1175 SER C CB  1 
ATOM   2431 O  OG  . SER C 1 99  ? 7.02000   -13.12200 -3.12900  1.000 76.54339  ? 1175 SER C OG  1 
ATOM   2432 N  N   . VAL C 1 100 ? 8.58700   -9.35900  -4.62900  1.000 59.48871  ? 1176 VAL C N   1 
ATOM   2433 C  CA  . VAL C 1 100 ? 8.76300   -8.30100  -5.66200  1.000 62.93386  ? 1176 VAL C CA  1 
ATOM   2434 C  C   . VAL C 1 100 ? 8.71000   -8.94500  -7.04800  1.000 64.55248  ? 1176 VAL C C   1 
ATOM   2435 O  O   . VAL C 1 100 ? 8.89800   -10.18300 -7.15400  1.000 62.53381  ? 1176 VAL C O   1 
ATOM   2436 C  CB  . VAL C 1 100 ? 10.06700  -7.51000  -5.45900  1.000 61.83636  ? 1176 VAL C CB  1 
ATOM   2437 C  CG1 . VAL C 1 100 ? 10.07900  -6.80400  -4.11100  1.000 60.95204  ? 1176 VAL C CG1 1 
ATOM   2438 C  CG2 . VAL C 1 100 ? 11.30000  -8.37600  -5.64800  1.000 62.43117  ? 1176 VAL C CG2 1 
ATOM   2439 N  N   . VAL C 1 101 ? 8.44800   -8.12200  -8.06200  1.000 47.41884  ? 1177 VAL C N   1 
ATOM   2440 C  CA  . VAL C 1 101 ? 8.27500   -8.57700  -9.46600  1.000 53.24849  ? 1177 VAL C CA  1 
ATOM   2441 C  C   . VAL C 1 101 ? 9.45000   -8.02500  -10.27400 1.000 62.79700  ? 1177 VAL C C   1 
ATOM   2442 O  O   . VAL C 1 101 ? 9.94500   -6.91800  -9.93800  1.000 66.68694  ? 1177 VAL C O   1 
ATOM   2443 C  CB  . VAL C 1 101 ? 6.90800   -8.15100  -10.03600 1.000 42.04188  ? 1177 VAL C CB  1 
ATOM   2444 C  CG1 . VAL C 1 101 ? 6.81000   -6.64900  -10.25600 1.000 50.70345  ? 1177 VAL C CG1 1 
ATOM   2445 C  CG2 . VAL C 1 101 ? 6.57200   -8.89400  -11.31500 1.000 49.37434  ? 1177 VAL C CG2 1 
ATOM   2446 N  N   . ASN C 1 102 ? 9.88700   -8.79700  -11.27000 1.000 62.15219  ? 1178 ASN C N   1 
ATOM   2447 C  CA  . ASN C 1 102 ? 10.98900  -8.43000  -12.18900 1.000 64.48668  ? 1178 ASN C CA  1 
ATOM   2448 C  C   . ASN C 1 102 ? 10.54400  -8.73900  -13.61400 1.000 59.62820  ? 1178 ASN C C   1 
ATOM   2449 O  O   . ASN C 1 102 ? 10.54600  -9.93600  -13.98900 1.000 60.40461  ? 1178 ASN C O   1 
ATOM   2450 C  CB  . ASN C 1 102 ? 12.28700  -9.15600  -11.85800 1.000 66.73432  ? 1178 ASN C CB  1 
ATOM   2451 C  CG  . ASN C 1 102 ? 13.47100  -8.51900  -12.54800 1.000 75.99069  ? 1178 ASN C CG  1 
ATOM   2452 O  OD1 . ASN C 1 102 ? 13.33600  -7.46100  -13.16800 1.000 59.59662  ? 1178 ASN C OD1 1 
ATOM   2453 N  ND2 . ASN C 1 102 ? 14.63000  -9.15300  -12.43400 1.000 88.40797  ? 1178 ASN C ND2 1 
ATOM   2454 N  N   . ILE C 1 103 ? 10.15900  -7.69200  -14.35000 1.000 54.34336  ? 1179 ILE C N   1 
ATOM   2455 C  CA  . ILE C 1 103 ? 9.69700   -7.77800  -15.76600 1.000 64.37351  ? 1179 ILE C CA  1 
ATOM   2456 C  C   . ILE C 1 103 ? 10.49100  -6.78200  -16.62300 1.000 71.26644  ? 1179 ILE C C   1 
ATOM   2457 O  O   . ILE C 1 103 ? 10.00500  -6.43000  -17.72600 1.000 62.04165  ? 1179 ILE C O   1 
ATOM   2458 C  CB  . ILE C 1 103 ? 8.17800   -7.53700  -15.84800 1.000 49.10589  ? 1179 ILE C CB  1 
ATOM   2459 C  CG1 . ILE C 1 103 ? 7.80300   -6.15100  -15.32100 1.000 50.90347  ? 1179 ILE C CG1 1 
ATOM   2460 C  CG2 . ILE C 1 103 ? 7.42300   -8.64100  -15.12900 1.000 44.95539  ? 1179 ILE C CG2 1 
ATOM   2461 C  CD1 . ILE C 1 103 ? 6.45300   -5.66800  -15.78600 1.000 55.99356  ? 1179 ILE C CD1 1 
ATOM   2462 N  N   . GLN C 1 104 ? 11.67400  -6.36300  -16.15700 1.000 71.41383  ? 1180 GLN C N   1 
ATOM   2463 C  CA  . GLN C 1 104 ? 12.51900  -5.38200  -16.88400 1.000 62.96544  ? 1180 GLN C CA  1 
ATOM   2464 C  C   . GLN C 1 104 ? 12.96500  -5.97800  -18.22000 1.000 66.19478  ? 1180 GLN C C   1 
ATOM   2465 O  O   . GLN C 1 104 ? 13.08400  -5.20900  -19.18400 1.000 72.51659  ? 1180 GLN C O   1 
ATOM   2466 C  CB  . GLN C 1 104 ? 13.73200  -4.94600  -16.06700 1.000 75.41167  ? 1180 GLN C CB  1 
ATOM   2467 C  CG  . GLN C 1 104 ? 14.40900  -3.71700  -16.65800 1.000 83.25998  ? 1180 GLN C CG  1 
ATOM   2468 C  CD  . GLN C 1 104 ? 13.42100  -2.59700  -16.85600 1.000 74.33260  ? 1180 GLN C CD  1 
ATOM   2469 O  OE1 . GLN C 1 104 ? 12.76500  -2.16500  -15.90800 1.000 60.59937  ? 1180 GLN C OE1 1 
ATOM   2470 N  NE2 . GLN C 1 104 ? 13.29000  -2.14900  -18.09600 1.000 68.18975  ? 1180 GLN C NE2 1 
ATOM   2471 N  N   . LYS C 1 105 ? 13.18300  -7.29300  -18.27000 1.000 68.82931  ? 1181 LYS C N   1 
ATOM   2472 C  CA  . LYS C 1 105 ? 13.52400  -8.05100  -19.50500 1.000 61.01521  ? 1181 LYS C CA  1 
ATOM   2473 C  C   . LYS C 1 105 ? 12.43300  -7.89700  -20.57400 1.000 56.53573  ? 1181 LYS C C   1 
ATOM   2474 O  O   . LYS C 1 105 ? 12.78500  -7.68400  -21.74900 1.000 72.11391  ? 1181 LYS C O   1 
ATOM   2475 C  CB  . LYS C 1 105 ? 13.68200  -9.53900  -19.19000 1.000 68.18449  ? 1181 LYS C CB  1 
ATOM   2476 C  CG  . LYS C 1 105 ? 13.56200  -10.48300 -20.38400 1.000 63.89977  ? 1181 LYS C CG  1 
ATOM   2477 C  CD  . LYS C 1 105 ? 13.77900  -11.93700 -20.02100 1.000 68.41347  ? 1181 LYS C CD  1 
ATOM   2478 C  CE  . LYS C 1 105 ? 12.60700  -12.55200 -19.28100 1.000 74.96162  ? 1181 LYS C CE  1 
ATOM   2479 N  NZ  . LYS C 1 105 ? 12.99500  -13.78200 -18.54800 1.000 77.04608  ? 1181 LYS C NZ  1 
ATOM   2480 N  N   . GLU C 1 106 ? 11.16100  -8.05700  -20.19800 1.000 58.63598  ? 1182 GLU C N   1 
ATOM   2481 C  CA  . GLU C 1 106 ? 10.00400  -7.94100  -21.12900 1.000 62.06534  ? 1182 GLU C CA  1 
ATOM   2482 C  C   . GLU C 1 106 ? 9.81600   -6.48200  -21.57300 1.000 60.80203  ? 1182 GLU C C   1 
ATOM   2483 O  O   . GLU C 1 106 ? 9.58400   -6.27400  -22.77700 1.000 59.40975  ? 1182 GLU C O   1 
ATOM   2484 C  CB  . GLU C 1 106 ? 8.72400   -8.46800  -20.48100 1.000 49.90598  ? 1182 GLU C CB  1 
ATOM   2485 C  CG  . GLU C 1 106 ? 8.69900   -9.97600  -20.34100 1.000 56.48309  ? 1182 GLU C CG  1 
ATOM   2486 C  CD  . GLU C 1 106 ? 9.36200   -10.54900 -19.09500 1.000 58.75178  ? 1182 GLU C CD  1 
ATOM   2487 O  OE1 . GLU C 1 106 ? 9.12300   -11.75300 -18.82100 1.000 56.69364  ? 1182 GLU C OE1 1 
ATOM   2488 O  OE2 . GLU C 1 106 ? 10.10800  -9.80200  -18.39700 1.000 59.91771  ? 1182 GLU C OE2 1 
ATOM   2489 N  N   . ILE C 1 107 ? 9.90500   -5.51600  -20.65200 1.000 52.82475  ? 1183 ILE C N   1 
ATOM   2490 C  CA  . ILE C 1 107 ? 9.82000   -4.06300  -20.97900 1.000 57.10422  ? 1183 ILE C CA  1 
ATOM   2491 C  C   . ILE C 1 107 ? 10.89400  -3.75000  -22.02300 1.000 69.34779  ? 1183 ILE C C   1 
ATOM   2492 O  O   . ILE C 1 107 ? 10.54100  -3.14100  -23.06100 1.000 77.95935  ? 1183 ILE C O   1 
ATOM   2493 C  CB  . ILE C 1 107 ? 9.94200   -3.18400  -19.72000 1.000 51.01928  ? 1183 ILE C CB  1 
ATOM   2494 C  CG1 . ILE C 1 107 ? 8.83700   -3.51000  -18.71600 1.000 47.95312  ? 1183 ILE C CG1 1 
ATOM   2495 C  CG2 . ILE C 1 107 ? 9.92200   -1.70700  -20.07800 1.000 50.72450  ? 1183 ILE C CG2 1 
ATOM   2496 C  CD1 . ILE C 1 107 ? 8.96100   -2.77800  -17.41200 1.000 47.77415  ? 1183 ILE C CD1 1 
ATOM   2497 N  N   . ASP C 1 108 ? 12.13900  -4.18200  -21.78000 1.000 64.07874  ? 1184 ASP C N   1 
ATOM   2498 C  CA  . ASP C 1 108 ? 13.29000  -3.95000  -22.69400 1.000 58.54386  ? 1184 ASP C CA  1 
ATOM   2499 C  C   . ASP C 1 108 ? 12.93500  -4.50300  -24.08100 1.000 61.04679  ? 1184 ASP C C   1 
ATOM   2500 O  O   . ASP C 1 108 ? 13.07800  -3.77200  -25.07700 1.000 75.81699  ? 1184 ASP C O   1 
ATOM   2501 C  CB  . ASP C 1 108 ? 14.58100  -4.57200  -22.14800 1.000 74.03519  ? 1184 ASP C CB  1 
ATOM   2502 C  CG  . ASP C 1 108 ? 15.23200  -3.83900  -20.97600 1.000 79.81483  ? 1184 ASP C CG  1 
ATOM   2503 O  OD1 . ASP C 1 108 ? 14.67600  -2.79500  -20.53100 1.000 68.72666  ? 1184 ASP C OD1 1 
ATOM   2504 O  OD2 . ASP C 1 108 ? 16.30800  -4.32200  -20.51700 1.000 78.64890  ? 1184 ASP C OD2 1 
ATOM   2505 N  N   . ARG C 1 109 ? 12.45400  -5.74200  -24.13300 1.000 63.70237  ? 1185 ARG C N   1 
ATOM   2506 C  CA  . ARG C 1 109 ? 12.09800  -6.44800  -25.39300 1.000 68.46874  ? 1185 ARG C CA  1 
ATOM   2507 C  C   . ARG C 1 109 ? 11.06400  -5.62000  -26.17400 1.000 67.67654  ? 1185 ARG C C   1 
ATOM   2508 O  O   . ARG C 1 109 ? 11.23100  -5.41800  -27.39700 1.000 64.33403  ? 1185 ARG C O   1 
ATOM   2509 C  CB  . ARG C 1 109 ? 11.59700  -7.85900  -25.05800 1.000 65.18940  ? 1185 ARG C CB  1 
ATOM   2510 C  CG  . ARG C 1 109 ? 11.33000  -8.75100  -26.26100 1.000 62.73647  ? 1185 ARG C CG  1 
ATOM   2511 C  CD  . ARG C 1 109 ? 12.44100  -8.75600  -27.29600 1.000 71.55068  ? 1185 ARG C CD  1 
ATOM   2512 N  NE  . ARG C 1 109 ? 12.04700  -9.53000  -28.46600 1.000 86.07348  ? 1185 ARG C NE  1 
ATOM   2513 C  CZ  . ARG C 1 109 ? 12.55000  -9.39700  -29.69700 1.000 94.23235  ? 1185 ARG C CZ  1 
ATOM   2514 N  NH1 . ARG C 1 109 ? 13.50200  -8.51300  -29.95600 1.000 97.25640  ? 1185 ARG C NH1 1 
ATOM   2515 N  NH2 . ARG C 1 109 ? 12.08200  -10.15500 -30.67500 1.000 98.99871  ? 1185 ARG C NH2 1 
ATOM   2516 N  N   . LEU C 1 110 ? 10.03500  -5.12800  -25.49100 1.000 64.98674  ? 1186 LEU C N   1 
ATOM   2517 C  CA  . LEU C 1 110 ? 8.96200   -4.34200  -26.14100 1.000 61.00995  ? 1186 LEU C CA  1 
ATOM   2518 C  C   . LEU C 1 110 ? 9.61200   -3.15400  -26.85300 1.000 69.48465  ? 1186 LEU C C   1 
ATOM   2519 O  O   . LEU C 1 110 ? 9.44700   -3.05200  -28.08900 1.000 70.72953  ? 1186 LEU C O   1 
ATOM   2520 C  CB  . LEU C 1 110 ? 7.91700   -3.90700  -25.10100 1.000 61.83373  ? 1186 LEU C CB  1 
ATOM   2521 C  CG  . LEU C 1 110 ? 6.93800   -4.99100  -24.63300 1.000 54.03806  ? 1186 LEU C CG  1 
ATOM   2522 C  CD1 . LEU C 1 110 ? 5.88000   -4.39100  -23.72900 1.000 42.88672  ? 1186 LEU C CD1 1 
ATOM   2523 C  CD2 . LEU C 1 110 ? 6.27900   -5.70600  -25.80000 1.000 44.70010  ? 1186 LEU C CD2 1 
ATOM   2524 N  N   . ASN C 1 111 ? 10.35300  -2.32200  -26.11600 1.000 69.94260  ? 1187 ASN C N   1 
ATOM   2525 C  CA  . ASN C 1 111 ? 11.02500  -1.11700  -26.67800 1.000 58.08328  ? 1187 ASN C CA  1 
ATOM   2526 C  C   . ASN C 1 111 ? 11.98800  -1.55400  -27.79700 1.000 72.81136  ? 1187 ASN C C   1 
ATOM   2527 O  O   . ASN C 1 111 ? 12.04100  -0.85900  -28.83500 1.000 62.82859  ? 1187 ASN C O   1 
ATOM   2528 C  CB  . ASN C 1 111 ? 11.72200  -0.29400  -25.59500 1.000 58.67282  ? 1187 ASN C CB  1 
ATOM   2529 C  CG  . ASN C 1 111 ? 10.77400  0.44100   -24.67100 1.000 74.98794  ? 1187 ASN C CG  1 
ATOM   2530 O  OD1 . ASN C 1 111 ? 10.96200  0.43200   -23.45400 1.000 66.68694  ? 1187 ASN C OD1 1 
ATOM   2531 N  ND2 . ASN C 1 111 ? 9.77100   1.10200   -25.23200 1.000 58.21751  ? 1187 ASN C ND2 1 
ATOM   2532 N  N   . GLU C 1 112 ? 12.69400  -2.67800  -27.62400 1.000 77.95672  ? 1188 GLU C N   1 
ATOM   2533 C  CA  . GLU C 1 112 ? 13.55900  -3.25500  -28.68500 1.000 82.73097  ? 1188 GLU C CA  1 
ATOM   2534 C  C   . GLU C 1 112 ? 12.69800  -3.44800  -29.94400 1.000 81.44134  ? 1188 GLU C C   1 
ATOM   2535 O  O   . GLU C 1 112 ? 13.03900  -2.83200  -30.97300 1.000 89.09226  ? 1188 GLU C O   1 
ATOM   2536 C  CB  . GLU C 1 112 ? 14.25600  -4.53400  -28.19200 1.000 88.08161  ? 1188 GLU C CB  1 
ATOM   2537 C  CG  . GLU C 1 112 ? 15.29600  -5.11300  -29.15200 1.000 93.14275  ? 1188 GLU C CG  1 
ATOM   2538 C  CD  . GLU C 1 112 ? 16.48700  -4.23000  -29.51900 1.000 109.57630 ? 1188 GLU C CD  1 
ATOM   2539 O  OE1 . GLU C 1 112 ? 16.59600  -3.09500  -28.99100 1.000 110.75538 ? 1188 GLU C OE1 1 
ATOM   2540 O  OE2 . GLU C 1 112 ? 17.31100  -4.67900  -30.34800 1.000 124.94919 ? 1188 GLU C OE2 1 
ATOM   2541 N  N   . VAL C 1 113 ? 11.59200  -4.20000  -29.85000 1.000 66.00528  ? 1189 VAL C N   1 
ATOM   2542 C  CA  . VAL C 1 113 ? 10.71200  -4.54800  -31.01000 1.000 63.94977  ? 1189 VAL C CA  1 
ATOM   2543 C  C   . VAL C 1 113 ? 10.12400  -3.26300  -31.60600 1.000 61.63897  ? 1189 VAL C C   1 
ATOM   2544 O  O   . VAL C 1 113 ? 10.03500  -3.17400  -32.84100 1.000 77.11977  ? 1189 VAL C O   1 
ATOM   2545 C  CB  . VAL C 1 113 ? 9.59900   -5.54000  -30.62500 1.000 66.23952  ? 1189 VAL C CB  1 
ATOM   2546 C  CG1 . VAL C 1 113 ? 8.64800   -5.79000  -31.78400 1.000 57.52269  ? 1189 VAL C CG1 1 
ATOM   2547 C  CG2 . VAL C 1 113 ? 10.15800  -6.86100  -30.12800 1.000 62.39169  ? 1189 VAL C CG2 1 
ATOM   2548 N  N   . ALA C 1 114 ? 9.74200   -2.29300  -30.77300 1.000 80.67020  ? 1190 ALA C N   1 
ATOM   2549 C  CA  . ALA C 1 114 ? 9.19800   -0.99400  -31.23400 1.000 71.09010  ? 1190 ALA C CA  1 
ATOM   2550 C  C   . ALA C 1 114 ? 10.19700  -0.34600  -32.20400 1.000 78.55416  ? 1190 ALA C C   1 
ATOM   2551 O  O   . ALA C 1 114 ? 9.76800   0.04000   -33.31000 1.000 78.10147  ? 1190 ALA C O   1 
ATOM   2552 C  CB  . ALA C 1 114 ? 8.87500   -0.10900  -30.05500 1.000 59.01234  ? 1190 ALA C CB  1 
ATOM   2553 N  N   . LYS C 1 115 ? 11.48400  -0.29000  -31.82900 1.000 89.20017  ? 1191 LYS C N   1 
ATOM   2554 C  CA  . LYS C 1 115 ? 12.59100  0.26200   -32.66500 1.000 91.25305  ? 1191 LYS C CA  1 
ATOM   2555 C  C   . LYS C 1 115 ? 12.81400  -0.63400  -33.89200 1.000 88.16057  ? 1191 LYS C C   1 
ATOM   2556 O  O   . LYS C 1 115 ? 12.92400  -0.09200  -35.00200 1.000 89.36598  ? 1191 LYS C O   1 
ATOM   2557 C  CB  . LYS C 1 115 ? 13.88800  0.39000   -31.85500 1.000 93.94284  ? 1191 LYS C CB  1 
ATOM   2558 C  CG  . LYS C 1 115 ? 15.06300  1.04000   -32.58600 1.000 102.38859 ? 1191 LYS C CG  1 
ATOM   2559 C  CD  . LYS C 1 115 ? 16.42200  0.79100   -31.94100 1.000 112.22398 ? 1191 LYS C CD  1 
ATOM   2560 C  CE  . LYS C 1 115 ? 16.99100  -0.58000  -32.24800 1.000 118.15101 ? 1191 LYS C CE  1 
ATOM   2561 N  NZ  . LYS C 1 115 ? 18.25100  -0.83500  -31.50900 1.000 120.53024 ? 1191 LYS C NZ  1 
ATOM   2562 N  N   . ASN C 1 116 ? 12.87100  -1.95300  -33.70000 1.000 86.26561  ? 1192 ASN C N   1 
ATOM   2563 C  CA  . ASN C 1 116 ? 13.17100  -2.94400  -34.76900 1.000 89.88183  ? 1192 ASN C CA  1 
ATOM   2564 C  C   . ASN C 1 116 ? 12.12300  -2.90300  -35.88500 1.000 93.12169  ? 1192 ASN C C   1 
ATOM   2565 O  O   . ASN C 1 116 ? 12.45200  -3.34900  -36.99900 1.000 103.70191 ? 1192 ASN C O   1 
ATOM   2566 C  CB  . ASN C 1 116 ? 13.23000  -4.37900  -34.24400 1.000 96.05099  ? 1192 ASN C CB  1 
ATOM   2567 C  CG  . ASN C 1 116 ? 14.55100  -4.71000  -33.58600 1.000 107.30234 ? 1192 ASN C CG  1 
ATOM   2568 O  OD1 . ASN C 1 116 ? 15.24300  -3.82400  -33.08300 1.000 100.34098 ? 1192 ASN C OD1 1 
ATOM   2569 N  ND2 . ASN C 1 116 ? 14.91400  -5.98500  -33.60100 1.000 117.70095 ? 1192 ASN C ND2 1 
ATOM   2570 N  N   . LEU C 1 117 ? 10.90200  -2.43900  -35.60700 1.000 78.40151  ? 1193 LEU C N   1 
ATOM   2571 C  CA  . LEU C 1 117 ? 9.81400   -2.40800  -36.62300 1.000 79.33320  ? 1193 LEU C CA  1 
ATOM   2572 C  C   . LEU C 1 117 ? 10.13600  -1.36200  -37.70100 1.000 85.33655  ? 1193 LEU C C   1 
ATOM   2573 O  O   . LEU C 1 117 ? 9.64100   -1.52100  -38.83200 1.000 90.89511  ? 1193 LEU C O   1 
ATOM   2574 C  CB  . LEU C 1 117 ? 8.45900   -2.15400  -35.95200 1.000 68.84510  ? 1193 LEU C CB  1 
ATOM   2575 C  CG  . LEU C 1 117 ? 7.77400   -3.39600  -35.37900 1.000 68.56348  ? 1193 LEU C CG  1 
ATOM   2576 C  CD1 . LEU C 1 117 ? 6.48000   -3.02200  -34.68300 1.000 66.28163  ? 1193 LEU C CD1 1 
ATOM   2577 C  CD2 . LEU C 1 117 ? 7.50700   -4.44800  -36.45000 1.000 63.37339  ? 1193 LEU C CD2 1 
ATOM   2578 N  N   . ASN C 1 118 ? 10.97400  -0.36600  -37.39900 1.000 86.36825  ? 1194 ASN C N   1 
ATOM   2579 C  CA  . ASN C 1 118 ? 11.45300  0.62400   -38.40200 1.000 89.05805  ? 1194 ASN C CA  1 
ATOM   2580 C  C   . ASN C 1 118 ? 12.04700  -0.12000  -39.60700 1.000 90.92932  ? 1194 ASN C C   1 
ATOM   2581 O  O   . ASN C 1 118 ? 11.83800  0.34200   -40.73000 1.000 95.04297  ? 1194 ASN C O   1 
ATOM   2582 C  CB  . ASN C 1 118 ? 12.44000  1.62000   -37.78600 1.000 93.76914  ? 1194 ASN C CB  1 
ATOM   2583 C  CG  . ASN C 1 118 ? 11.77300  2.64400   -36.88800 1.000 85.22864  ? 1194 ASN C CG  1 
ATOM   2584 O  OD1 . ASN C 1 118 ? 10.77800  3.25900   -37.26700 1.000 80.28331  ? 1194 ASN C OD1 1 
ATOM   2585 N  ND2 . ASN C 1 118 ? 12.32700  2.85800   -35.70500 1.000 82.47041  ? 1194 ASN C ND2 1 
ATOM   2586 N  N   . GLU C 1 119 ? 12.72200  -1.25200  -39.38100 1.000 92.41108  ? 1195 GLU C N   1 
ATOM   2587 C  CA  . GLU C 1 119 ? 13.38600  -2.07300  -40.43400 1.000 93.12432  ? 1195 GLU C CA  1 
ATOM   2588 C  C   . GLU C 1 119 ? 12.35400  -2.89400  -41.21900 1.000 94.05601  ? 1195 GLU C C   1 
ATOM   2589 O  O   . GLU C 1 119 ? 12.76000  -3.60100  -42.15800 1.000 93.73229  ? 1195 GLU C O   1 
ATOM   2590 C  CB  . GLU C 1 119 ? 14.41900  -3.02500  -39.82100 1.000 102.92023 ? 1195 GLU C CB  1 
ATOM   2591 C  CG  . GLU C 1 119 ? 15.64400  -2.32900  -39.25700 1.000 114.76902 ? 1195 GLU C CG  1 
ATOM   2592 C  CD  . GLU C 1 119 ? 16.68900  -3.27000  -38.68100 1.000 121.23559 ? 1195 GLU C CD  1 
ATOM   2593 O  OE1 . GLU C 1 119 ? 16.90200  -4.35200  -39.26900 1.000 126.50991 ? 1195 GLU C OE1 1 
ATOM   2594 O  OE2 . GLU C 1 119 ? 17.28000  -2.92400  -37.64000 1.000 120.48287 ? 1195 GLU C OE2 1 
ATOM   2595 N  N   . SER C 1 120 ? 11.07600  -2.83700  -40.84200 1.000 79.93064  ? 1196 SER C N   1 
ATOM   2596 C  CA  . SER C 1 120 ? 9.98500   -3.57200  -41.52500 1.000 72.12707  ? 1196 SER C CA  1 
ATOM   2597 C  C   . SER C 1 120 ? 9.27700   -2.64100  -42.50600 1.000 75.57222  ? 1196 SER C C   1 
ATOM   2598 O  O   . SER C 1 120 ? 8.53200   -3.15600  -43.35400 1.000 83.74162  ? 1196 SER C O   1 
ATOM   2599 C  CB  . SER C 1 120 ? 9.02100   -4.16500  -40.54900 1.000 71.90336  ? 1196 SER C CB  1 
ATOM   2600 O  OG  . SER C 1 120 ? 9.50500   -5.40600  -40.08600 1.000 84.06271  ? 1196 SER C OG  1 
ATOM   2601 N  N   . LEU C 1 121 ? 9.51800   -1.33200  -42.41400 1.000 72.72714  ? 1197 LEU C N   1 
ATOM   2602 C  CA  . LEU C 1 121 ? 8.81800   -0.32800  -43.25800 1.000 71.57174  ? 1197 LEU C CA  1 
ATOM   2603 C  C   . LEU C 1 121 ? 9.21400   -0.50800  -44.73200 1.000 76.42758  ? 1197 LEU C C   1 
ATOM   2604 O  O   . LEU C 1 121 ? 10.18700  -1.24500  -45.01300 1.000 81.27290  ? 1197 LEU C O   1 
ATOM   2605 C  CB  . LEU C 1 121 ? 9.15400   1.07200   -42.73800 1.000 73.71937  ? 1197 LEU C CB  1 
ATOM   2606 C  CG  . LEU C 1 121 ? 8.59600   1.40600   -41.35500 1.000 67.61074  ? 1197 LEU C CG  1 
ATOM   2607 C  CD1 . LEU C 1 121 ? 9.10000   2.76000   -40.87900 1.000 68.93458  ? 1197 LEU C CD1 1 
ATOM   2608 C  CD2 . LEU C 1 121 ? 7.07000   1.37900   -41.35800 1.000 65.09465  ? 1197 LEU C CD2 1 
ATOM   2609 N  N   . ILE C 1 122 ? 8.45200   0.12200   -45.63200 1.000 74.57999  ? 1198 ILE C N   1 
ATOM   2610 C  CA  . ILE C 1 122 ? 8.58400   0.00800   -47.11400 1.000 83.28367  ? 1198 ILE C CA  1 
ATOM   2611 C  C   . ILE C 1 122 ? 8.86400   1.40800   -47.66500 1.000 86.19455  ? 1198 ILE C C   1 
ATOM   2612 O  O   . ILE C 1 122 ? 8.17100   2.34500   -47.22300 1.000 81.62821  ? 1198 ILE C O   1 
ATOM   2613 C  CB  . ILE C 1 122 ? 7.30300   -0.60200  -47.71800 1.000 85.96557  ? 1198 ILE C CB  1 
ATOM   2614 C  CG1 . ILE C 1 122 ? 6.89800   -1.89500  -47.00100 1.000 83.71004  ? 1198 ILE C CG1 1 
ATOM   2615 C  CG2 . ILE C 1 122 ? 7.45900   -0.80100  -49.21900 1.000 92.08736  ? 1198 ILE C CG2 1 
ATOM   2616 C  CD1 . ILE C 1 122 ? 5.62200   -2.52100  -47.51400 1.000 86.06032  ? 1198 ILE C CD1 1 
ATOM   2617 N  N   . ASP C 1 123 ? 9.80700   1.53700   -48.60800 1.000 102.62283 ? 1199 ASP C N   1 
ATOM   2618 C  CA  . ASP C 1 123 ? 10.42800  2.84100   -48.97800 1.000 114.42688 ? 1199 ASP C CA  1 
ATOM   2619 C  C   . ASP C 1 123 ? 9.81800   3.42400   -50.26000 1.000 115.81125 ? 1199 ASP C C   1 
ATOM   2620 O  O   . ASP C 1 123 ? 9.00200   2.74200   -50.93000 1.000 106.07851 ? 1199 ASP C O   1 
ATOM   2621 C  CB  . ASP C 1 123 ? 11.95500  2.73000   -49.10100 1.000 126.29409 ? 1199 ASP C CB  1 
ATOM   2622 C  CG  . ASP C 1 123 ? 12.73300  3.62900   -48.14400 1.000 131.28943 ? 1199 ASP C CG  1 
ATOM   2623 O  OD1 . ASP C 1 123 ? 12.28300  3.80600   -46.99100 1.000 126.23092 ? 1199 ASP C OD1 1 
ATOM   2624 O  OD2 . ASP C 1 123 ? 13.78400  4.15900   -48.56500 1.000 138.30869 ? 1199 ASP C OD2 1 
ATOM   2625 N  N   . LEU C 1 124 ? 10.25400  4.65200   -50.56900 1.000 119.65119 ? 1200 LEU C N   1 
ATOM   2626 C  CA  . LEU C 1 124 ? 9.87200   5.47500   -51.74800 1.000 123.96750 ? 1200 LEU C CA  1 
ATOM   2627 C  C   . LEU C 1 124 ? 10.41300  4.76400   -52.99600 1.000 128.50751 ? 1200 LEU C C   1 
ATOM   2628 O  O   . LEU C 1 124 ? 11.63500  4.85100   -53.24200 1.000 133.55022 ? 1200 LEU C O   1 
ATOM   2629 C  CB  . LEU C 1 124 ? 10.48300  6.88500   -51.64900 1.000 123.62008 ? 1200 LEU C CB  1 
ATOM   2630 C  CG  . LEU C 1 124 ? 10.20100  7.74700   -50.41200 1.000 108.02874 ? 1200 LEU C CG  1 
ATOM   2631 C  CD1 . LEU C 1 124 ? 10.68100  7.11000   -49.11300 1.000 105.39158 ? 1200 LEU C CD1 1 
ATOM   2632 C  CD2 . LEU C 1 124 ? 10.87500  9.10200   -50.57600 1.000 113.90576 ? 1200 LEU C CD2 1 
ATOM   2633 N  N   . GLN C 1 125 ? 9.55300   4.05100   -53.72600 1.000 128.31802 ? 1201 GLN C N   1 
ATOM   2634 C  CA  . GLN C 1 125 ? 9.90700   3.35900   -54.99500 1.000 136.79272 ? 1201 GLN C CA  1 
ATOM   2635 C  C   . GLN C 1 125 ? 9.14200   4.02100   -56.15300 1.000 140.70634 ? 1201 GLN C C   1 
ATOM   2636 O  O   . GLN C 1 125 ? 7.90600   3.82800   -56.22900 1.000 137.87179 ? 1201 GLN C O   1 
ATOM   2637 C  CB  . GLN C 1 125 ? 9.58600   1.86700   -54.87100 1.000 135.08462 ? 1201 GLN C CB  1 
ATOM   2638 C  CG  . GLN C 1 125 ? 9.84500   1.08000   -56.14900 1.000 140.78004 ? 1201 GLN C CG  1 
ATOM   2639 C  CD  . GLN C 1 125 ? 11.29400  0.68500   -56.29600 1.000 147.84931 ? 1201 GLN C CD  1 
ATOM   2640 O  OE1 . GLN C 1 125 ? 11.76000  0.36800   -57.39000 1.000 155.25019 ? 1201 GLN C OE1 1 
ATOM   2641 N  NE2 . GLN C 1 125 ? 12.02300  0.71100   -55.18700 1.000 147.17291 ? 1201 GLN C NE2 1 
ATOM   2642 N  N   . GLU C 1 126 ? 9.84200   4.76400   -57.02400 1.000 144.25677 ? 1202 GLU C N   1 
ATOM   2643 C  CA  . GLU C 1 126 ? 9.24600   5.44900   -58.20800 1.000 145.59377 ? 1202 GLU C CA  1 
ATOM   2644 C  C   . GLU C 1 126 ? 10.26700  5.50400   -59.35000 1.000 150.67333 ? 1202 GLU C C   1 
ATOM   2645 O  O   . GLU C 1 126 ? 11.21500  4.72700   -59.39300 1.000 148.74415 ? 1202 GLU C O   1 
ATOM   2646 C  CB  . GLU C 1 126 ? 8.74800   6.84900   -57.82700 1.000 148.57834 ? 1202 GLU C CB  1 
ATOM   2647 C  CG  . GLU C 1 126 ? 9.84600   7.89500   -57.65400 1.000 153.94214 ? 1202 GLU C CG  1 
ATOM   2648 C  CD  . GLU C 1 126 ? 9.38400   9.32600   -57.38900 1.000 148.44148 ? 1202 GLU C CD  1 
ATOM   2649 O  OE1 . GLU C 1 126 ? 10.18700  10.25700  -57.62400 1.000 151.52343 ? 1202 GLU C OE1 1 
ATOM   2650 O  OE2 . GLU C 1 126 ? 8.23000   9.51700   -56.94600 1.000 139.20090 ? 1202 GLU C OE2 1 
ATOM   2651 N  N   . THR D 1 3   ? -20.76200 7.45400   -67.00100 1.000 122.76209 ? 912  THR D N   1 
ATOM   2652 C  CA  . THR D 1 3   ? -20.29300 7.88600   -65.64900 1.000 128.54699 ? 912  THR D CA  1 
ATOM   2653 C  C   . THR D 1 3   ? -21.45900 8.44200   -64.82100 1.000 134.94776 ? 912  THR D C   1 
ATOM   2654 O  O   . THR D 1 3   ? -21.37600 8.35300   -63.59100 1.000 134.70562 ? 912  THR D O   1 
ATOM   2655 C  CB  . THR D 1 3   ? -19.17400 8.94300   -65.70000 1.000 125.77824 ? 912  THR D CB  1 
ATOM   2656 O  OG1 . THR D 1 3   ? -19.70100 10.20300  -66.12200 1.000 128.04167 ? 912  THR D OG1 1 
ATOM   2657 C  CG2 . THR D 1 3   ? -18.00200 8.55000   -66.57800 1.000 116.82190 ? 912  THR D CG2 1 
ATOM   2658 N  N   . GLN D 1 4   ? -22.49200 9.00100   -65.45900 1.000 134.77932 ? 913  GLN D N   1 
ATOM   2659 C  CA  . GLN D 1 4   ? -23.55400 9.80700   -64.79100 1.000 140.80372 ? 913  GLN D CA  1 
ATOM   2660 C  C   . GLN D 1 4   ? -24.58000 8.90900   -64.06700 1.000 145.34111 ? 913  GLN D C   1 
ATOM   2661 O  O   . GLN D 1 4   ? -25.38700 9.46200   -63.28300 1.000 137.56649 ? 913  GLN D O   1 
ATOM   2662 C  CB  . GLN D 1 4   ? -24.20800 10.73300  -65.82100 1.000 140.83794 ? 913  GLN D CB  1 
ATOM   2663 C  CG  . GLN D 1 4   ? -24.82200 11.99400  -65.22300 1.000 138.85086 ? 913  GLN D CG  1 
ATOM   2664 C  CD  . GLN D 1 4   ? -24.73800 13.19000  -66.14600 1.000 137.25330 ? 913  GLN D CD  1 
ATOM   2665 O  OE1 . GLN D 1 4   ? -23.68700 13.49800  -66.70900 1.000 135.04777 ? 913  GLN D OE1 1 
ATOM   2666 N  NE2 . GLN D 1 4   ? -25.85000 13.89500  -66.29900 1.000 137.90074 ? 913  GLN D NE2 1 
ATOM   2667 N  N   . ASN D 1 5   ? -24.57400 7.59100   -64.30900 1.000 144.21992 ? 914  ASN D N   1 
ATOM   2668 C  CA  . ASN D 1 5   ? -25.33000 6.59700   -63.49300 1.000 142.70132 ? 914  ASN D CA  1 
ATOM   2669 C  C   . ASN D 1 5   ? -24.64900 6.47300   -62.12500 1.000 133.11596 ? 914  ASN D C   1 
ATOM   2670 O  O   . ASN D 1 5   ? -25.34800 6.62900   -61.09900 1.000 130.26299 ? 914  ASN D O   1 
ATOM   2671 C  CB  . ASN D 1 5   ? -25.43900 5.22400   -64.17300 1.000 144.15413 ? 914  ASN D CB  1 
ATOM   2672 C  CG  . ASN D 1 5   ? -26.67500 5.06500   -65.03400 1.000 146.98868 ? 914  ASN D CG  1 
ATOM   2673 O  OD1 . ASN D 1 5   ? -27.71900 5.64800   -64.75000 1.000 147.16238 ? 914  ASN D OD1 1 
ATOM   2674 N  ND2 . ASN D 1 5   ? -26.58100 4.25100   -66.07200 1.000 150.41803 ? 914  ASN D ND2 1 
ATOM   2675 N  N   . VAL D 1 6   ? -23.33300 6.22200   -62.13000 1.000 132.25007 ? 915  VAL D N   1 
ATOM   2676 C  CA  . VAL D 1 6   ? -22.46700 6.07500   -60.92000 1.000 129.92610 ? 915  VAL D CA  1 
ATOM   2677 C  C   . VAL D 1 6   ? -22.65000 7.31100   -60.02000 1.000 128.34434 ? 915  VAL D C   1 
ATOM   2678 O  O   . VAL D 1 6   ? -22.77300 7.11500   -58.79200 1.000 130.17087 ? 915  VAL D O   1 
ATOM   2679 C  CB  . VAL D 1 6   ? -20.99400 5.83900   -61.32300 1.000 131.29206 ? 915  VAL D CB  1 
ATOM   2680 C  CG1 . VAL D 1 6   ? -20.03700 5.90900   -60.14000 1.000 130.46301 ? 915  VAL D CG1 1 
ATOM   2681 C  CG2 . VAL D 1 6   ? -20.81800 4.51800   -62.05900 1.000 131.83423 ? 915  VAL D CG2 1 
ATOM   2682 N  N   . LEU D 1 7   ? -22.69300 8.52000   -60.60200 1.000 125.93089 ? 916  LEU D N   1 
ATOM   2683 C  CA  . LEU D 1 7   ? -22.90900 9.81000   -59.88200 1.000 121.70143 ? 916  LEU D CA  1 
ATOM   2684 C  C   . LEU D 1 7   ? -24.23400 9.77400   -59.12200 1.000 130.10244 ? 916  LEU D C   1 
ATOM   2685 O  O   . LEU D 1 7   ? -24.24000 10.19600  -57.95200 1.000 130.03401 ? 916  LEU D O   1 
ATOM   2686 C  CB  . LEU D 1 7   ? -22.92500 10.98300  -60.86600 1.000 119.88543 ? 916  LEU D CB  1 
ATOM   2687 C  CG  . LEU D 1 7   ? -21.55600 11.49100  -61.31000 1.000 117.77465 ? 916  LEU D CG  1 
ATOM   2688 C  CD1 . LEU D 1 7   ? -21.70100 12.51800  -62.41900 1.000 114.77429 ? 916  LEU D CD1 1 
ATOM   2689 C  CD2 . LEU D 1 7   ? -20.78300 12.08200  -60.14200 1.000 120.00913 ? 916  LEU D CD2 1 
ATOM   2690 N  N   . TYR D 1 8   ? -25.31800 9.33100   -59.76800 1.000 130.94465 ? 917  TYR D N   1 
ATOM   2691 C  CA  . TYR D 1 8   ? -26.65400 9.26800   -59.12500 1.000 126.26777 ? 917  TYR D CA  1 
ATOM   2692 C  C   . TYR D 1 8   ? -26.64600 8.16400   -58.06800 1.000 122.05148 ? 917  TYR D C   1 
ATOM   2693 O  O   . TYR D 1 8   ? -27.11200 8.42600   -56.95000 1.000 121.31455 ? 917  TYR D O   1 
ATOM   2694 C  CB  . TYR D 1 8   ? -27.80000 9.07300   -60.11800 1.000 131.97635 ? 917  TYR D CB  1 
ATOM   2695 C  CG  . TYR D 1 8   ? -29.12300 9.49900   -59.53200 1.000 139.31934 ? 917  TYR D CG  1 
ATOM   2696 C  CD1 . TYR D 1 8   ? -29.32500 10.81400  -59.13600 1.000 140.36683 ? 917  TYR D CD1 1 
ATOM   2697 C  CD2 . TYR D 1 8   ? -30.15600 8.59700   -59.32300 1.000 143.16453 ? 917  TYR D CD2 1 
ATOM   2698 C  CE1 . TYR D 1 8   ? -30.52300 11.22900  -58.57600 1.000 140.22734 ? 917  TYR D CE1 1 
ATOM   2699 C  CE2 . TYR D 1 8   ? -31.36200 8.99600   -58.76500 1.000 143.43825 ? 917  TYR D CE2 1 
ATOM   2700 C  CZ  . TYR D 1 8   ? -31.54800 10.31700  -58.39000 1.000 138.97193 ? 917  TYR D CZ  1 
ATOM   2701 O  OH  . TYR D 1 8   ? -32.72900 10.72400  -57.83800 1.000 132.28428 ? 917  TYR D OH  1 
ATOM   2702 N  N   . GLU D 1 9   ? -26.11300 6.98700   -58.40500 1.000 119.23008 ? 918  GLU D N   1 
ATOM   2703 C  CA  . GLU D 1 9   ? -25.96000 5.84500   -57.46300 1.000 118.27208 ? 918  GLU D CA  1 
ATOM   2704 C  C   . GLU D 1 9   ? -25.17200 6.26500   -56.22000 1.000 119.74594 ? 918  GLU D C   1 
ATOM   2705 O  O   . GLU D 1 9   ? -25.52500 5.80100   -55.11900 1.000 124.06751 ? 918  GLU D O   1 
ATOM   2706 C  CB  . GLU D 1 9   ? -25.21000 4.69500   -58.11900 1.000 121.61458 ? 918  GLU D CB  1 
ATOM   2707 C  CG  . GLU D 1 9   ? -26.04200 3.93900   -59.12200 1.000 131.16309 ? 918  GLU D CG  1 
ATOM   2708 C  CD  . GLU D 1 9   ? -25.45600 2.57000   -59.39500 1.000 134.17925 ? 918  GLU D CD  1 
ATOM   2709 O  OE1 . GLU D 1 9   ? -24.21200 2.43100   -59.29400 1.000 132.71328 ? 918  GLU D OE1 1 
ATOM   2710 O  OE2 . GLU D 1 9   ? -26.24400 1.64500   -59.65700 1.000 135.11094 ? 918  GLU D OE2 1 
ATOM   2711 N  N   . ASN D 1 10  ? -24.12400 7.07200   -56.40100 1.000 114.48215 ? 919  ASN D N   1 
ATOM   2712 C  CA  . ASN D 1 10  ? -23.30900 7.62900   -55.29100 1.000 112.74246 ? 919  ASN D CA  1 
ATOM   2713 C  C   . ASN D 1 10  ? -24.18600 8.55900   -54.43700 1.000 110.82118 ? 919  ASN D C   1 
ATOM   2714 O  O   . ASN D 1 10  ? -24.11100 8.44400   -53.20500 1.000 117.76412 ? 919  ASN D O   1 
ATOM   2715 C  CB  . ASN D 1 10  ? -22.04300 8.32300   -55.80300 1.000 112.57402 ? 919  ASN D CB  1 
ATOM   2716 C  CG  . ASN D 1 10  ? -20.93400 7.36200   -56.18500 1.000 110.34218 ? 919  ASN D CG  1 
ATOM   2717 O  OD1 . ASN D 1 10  ? -20.99500 6.17100   -55.88000 1.000 107.76029 ? 919  ASN D OD1 1 
ATOM   2718 N  ND2 . ASN D 1 10  ? -19.90300 7.87300   -56.84200 1.000 108.43405 ? 919  ASN D ND2 1 
ATOM   2719 N  N   . GLN D 1 11  ? -25.00100 9.42500   -55.05400 1.000 105.33368 ? 920  GLN D N   1 
ATOM   2720 C  CA  . GLN D 1 11  ? -25.87500 10.39700  -54.33400 1.000 99.58036  ? 920  GLN D CA  1 
ATOM   2721 C  C   . GLN D 1 11  ? -26.95900 9.66700   -53.53000 1.000 107.19443 ? 920  GLN D C   1 
ATOM   2722 O  O   . GLN D 1 11  ? -27.43700 10.24400  -52.53700 1.000 99.15136  ? 920  GLN D O   1 
ATOM   2723 C  CB  . GLN D 1 11  ? -26.59200 11.34400  -55.29300 1.000 108.28930 ? 920  GLN D CB  1 
ATOM   2724 C  CG  . GLN D 1 11  ? -25.68700 12.34200  -55.99300 1.000 110.65011 ? 920  GLN D CG  1 
ATOM   2725 C  CD  . GLN D 1 11  ? -26.49500 13.43400  -56.65400 1.000 116.84559 ? 920  GLN D CD  1 
ATOM   2726 O  OE1 . GLN D 1 11  ? -27.55100 13.19900  -57.24000 1.000 118.52211 ? 920  GLN D OE1 1 
ATOM   2727 N  NE2 . GLN D 1 11  ? -26.00500 14.65700  -56.55100 1.000 118.81425 ? 920  GLN D NE2 1 
ATOM   2728 N  N   . LYS D 1 12  ? -27.38300 8.48700   -53.99700 1.000 106.03903 ? 921  LYS D N   1 
ATOM   2729 C  CA  . LYS D 1 12  ? -28.35300 7.59300   -53.30000 1.000 102.26752 ? 921  LYS D CA  1 
ATOM   2730 C  C   . LYS D 1 12  ? -27.66000 6.88100   -52.13000 1.000 96.63001  ? 921  LYS D C   1 
ATOM   2731 O  O   . LYS D 1 12  ? -28.28800 6.72700   -51.06800 1.000 97.21429  ? 921  LYS D O   1 
ATOM   2732 C  CB  . LYS D 1 12  ? -28.93300 6.54000   -54.25500 1.000 105.52844 ? 921  LYS D CB  1 
ATOM   2733 C  CG  . LYS D 1 12  ? -30.14100 6.97600   -55.07600 1.000 111.23176 ? 921  LYS D CG  1 
ATOM   2734 C  CD  . LYS D 1 12  ? -30.82000 5.83000   -55.79700 1.000 117.27196 ? 921  LYS D CD  1 
ATOM   2735 C  CE  . LYS D 1 12  ? -32.27500 6.10800   -56.10600 1.000 123.64640 ? 921  LYS D CE  1 
ATOM   2736 N  NZ  . LYS D 1 12  ? -32.85500 5.06500   -56.98200 1.000 129.79451 ? 921  LYS D NZ  1 
ATOM   2737 N  N   . LEU D 1 13  ? -26.42800 6.42000   -52.33900 1.000 94.93770  ? 922  LEU D N   1 
ATOM   2738 C  CA  . LEU D 1 13  ? -25.60000 5.77300   -51.29000 1.000 91.22673  ? 922  LEU D CA  1 
ATOM   2739 C  C   . LEU D 1 13  ? -25.39300 6.76600   -50.13800 1.000 87.24730  ? 922  LEU D C   1 
ATOM   2740 O  O   . LEU D 1 13  ? -25.79500 6.42600   -49.00600 1.000 88.08425  ? 922  LEU D O   1 
ATOM   2741 C  CB  . LEU D 1 13  ? -24.27300 5.34200   -51.92000 1.000 88.29743  ? 922  LEU D CB  1 
ATOM   2742 C  CG  . LEU D 1 13  ? -23.29000 4.60400   -51.00900 1.000 91.13724  ? 922  LEU D CG  1 
ATOM   2743 C  CD1 . LEU D 1 13  ? -23.92900 3.36700   -50.38500 1.000 87.95265  ? 922  LEU D CD1 1 
ATOM   2744 C  CD2 . LEU D 1 13  ? -22.02700 4.22800   -51.77600 1.000 82.46515  ? 922  LEU D CD2 1 
ATOM   2745 N  N   . ILE D 1 14  ? -24.83200 7.95100   -50.43000 1.000 88.16057  ? 923  ILE D N   1 
ATOM   2746 C  CA  . ILE D 1 14  ? -24.49300 9.01800   -49.43400 1.000 84.30221  ? 923  ILE D CA  1 
ATOM   2747 C  C   . ILE D 1 14  ? -25.74200 9.32800   -48.60200 1.000 87.03675  ? 923  ILE D C   1 
ATOM   2748 O  O   . ILE D 1 14  ? -25.65000 9.24900   -47.36400 1.000 85.07599  ? 923  ILE D O   1 
ATOM   2749 C  CB  . ILE D 1 14  ? -23.91300 10.28600  -50.10700 1.000 81.93877  ? 923  ILE D CB  1 
ATOM   2750 C  CG1 . ILE D 1 14  ? -22.50100 10.05000  -50.65500 1.000 78.30413  ? 923  ILE D CG1 1 
ATOM   2751 C  CG2 . ILE D 1 14  ? -23.93900 11.48200  -49.15800 1.000 79.65429  ? 923  ILE D CG2 1 
ATOM   2752 C  CD1 . ILE D 1 14  ? -22.04600 11.09100  -51.65400 1.000 77.07766  ? 923  ILE D CD1 1 
ATOM   2753 N  N   . ALA D 1 15  ? -26.85900 9.65500   -49.25800 1.000 87.03412  ? 924  ALA D N   1 
ATOM   2754 C  CA  . ALA D 1 15  ? -28.14800 10.01400  -48.61800 1.000 90.40031  ? 924  ALA D CA  1 
ATOM   2755 C  C   . ALA D 1 15  ? -28.62200 8.89500   -47.67700 1.000 91.87681  ? 924  ALA D C   1 
ATOM   2756 O  O   . ALA D 1 15  ? -29.04300 9.21600   -46.54800 1.000 92.97431  ? 924  ALA D O   1 
ATOM   2757 C  CB  . ALA D 1 15  ? -29.17800 10.30000  -49.67700 1.000 95.56935  ? 924  ALA D CB  1 
ATOM   2758 N  N   . ASN D 1 16  ? -28.57300 7.63500   -48.11800 1.000 100.60154 ? 925  ASN D N   1 
ATOM   2759 C  CA  . ASN D 1 16  ? -29.03900 6.48000   -47.30700 1.000 100.50416 ? 925  ASN D CA  1 
ATOM   2760 C  C   . ASN D 1 16  ? -28.13300 6.35400   -46.08000 1.000 97.52222  ? 925  ASN D C   1 
ATOM   2761 O  O   . ASN D 1 16  ? -28.67300 6.33900   -44.95900 1.000 107.42604 ? 925  ASN D O   1 
ATOM   2762 C  CB  . ASN D 1 16  ? -29.13600 5.18900   -48.12800 1.000 106.47856 ? 925  ASN D CB  1 
ATOM   2763 C  CG  . ASN D 1 16  ? -30.51000 4.99200   -48.73800 1.000 114.70323 ? 925  ASN D CG  1 
ATOM   2764 O  OD1 . ASN D 1 16  ? -31.34900 5.89200   -48.70600 1.000 123.18319 ? 925  ASN D OD1 1 
ATOM   2765 N  ND2 . ASN D 1 16  ? -30.76000 3.80800   -49.27500 1.000 114.17685 ? 925  ASN D ND2 1 
ATOM   2766 N  N   . GLN D 1 17  ? -26.81300 6.30600   -46.28500 1.000 93.16907  ? 926  GLN D N   1 
ATOM   2767 C  CA  . GLN D 1 17  ? -25.80600 6.21100   -45.19200 1.000 88.33428  ? 926  GLN D CA  1 
ATOM   2768 C  C   . GLN D 1 17  ? -26.01700 7.36300   -44.20600 1.000 89.94499  ? 926  GLN D C   1 
ATOM   2769 O  O   . GLN D 1 17  ? -25.92600 7.12400   -42.99700 1.000 86.32351  ? 926  GLN D O   1 
ATOM   2770 C  CB  . GLN D 1 17  ? -24.37900 6.25900   -45.74000 1.000 84.51540  ? 926  GLN D CB  1 
ATOM   2771 C  CG  . GLN D 1 17  ? -24.00500 5.06800   -46.60900 1.000 93.24802  ? 926  GLN D CG  1 
ATOM   2772 C  CD  . GLN D 1 17  ? -24.17600 3.75900   -45.88400 1.000 95.30090  ? 926  GLN D CD  1 
ATOM   2773 O  OE1 . GLN D 1 17  ? -23.25600 3.26600   -45.23800 1.000 96.43261  ? 926  GLN D OE1 1 
ATOM   2774 N  NE2 . GLN D 1 17  ? -25.36400 3.18600   -45.98600 1.000 95.21405  ? 926  GLN D NE2 1 
ATOM   2775 N  N   . PHE D 1 18  ? -26.28000 8.56600   -44.71500 1.000 94.42711  ? 927  PHE D N   1 
ATOM   2776 C  CA  . PHE D 1 18  ? -26.49200 9.79300   -43.90800 1.000 81.95719  ? 927  PHE D CA  1 
ATOM   2777 C  C   . PHE D 1 18  ? -27.78100 9.66500   -43.09700 1.000 92.42687  ? 927  PHE D C   1 
ATOM   2778 O  O   . PHE D 1 18  ? -27.75500 9.94300   -41.88900 1.000 93.17959  ? 927  PHE D O   1 
ATOM   2779 C  CB  . PHE D 1 18  ? -26.55800 11.02400  -44.80700 1.000 82.62833  ? 927  PHE D CB  1 
ATOM   2780 C  CG  . PHE D 1 18  ? -26.82300 12.30800  -44.07000 1.000 81.60978  ? 927  PHE D CG  1 
ATOM   2781 C  CD1 . PHE D 1 18  ? -25.89400 12.80800  -43.17300 1.000 79.63060  ? 927  PHE D CD1 1 
ATOM   2782 C  CD2 . PHE D 1 18  ? -27.99600 13.01600  -44.27600 1.000 88.45797  ? 927  PHE D CD2 1 
ATOM   2783 C  CE1 . PHE D 1 18  ? -26.13300 13.99100  -42.49200 1.000 83.42316  ? 927  PHE D CE1 1 
ATOM   2784 C  CE2 . PHE D 1 18  ? -28.22600 14.20600  -43.60500 1.000 88.90803  ? 927  PHE D CE2 1 
ATOM   2785 C  CZ  . PHE D 1 18  ? -27.29400 14.69200  -42.71700 1.000 87.99213  ? 927  PHE D CZ  1 
ATOM   2786 N  N   . ASN D 1 19  ? -28.87500 9.26200   -43.74900 1.000 94.92717  ? 928  ASN D N   1 
ATOM   2787 C  CA  . ASN D 1 19  ? -30.20600 9.06500   -43.11200 1.000 103.65717 ? 928  ASN D CA  1 
ATOM   2788 C  C   . ASN D 1 19  ? -30.09500 7.95900   -42.05300 1.000 103.66243 ? 928  ASN D C   1 
ATOM   2789 O  O   . ASN D 1 19  ? -30.63700 8.14400   -40.94500 1.000 106.77859 ? 928  ASN D O   1 
ATOM   2790 C  CB  . ASN D 1 19  ? -31.30000 8.75500   -44.14100 1.000 110.26585 ? 928  ASN D CB  1 
ATOM   2791 C  CG  . ASN D 1 19  ? -31.67500 9.92800   -45.03000 1.000 108.25772 ? 928  ASN D CG  1 
ATOM   2792 O  OD1 . ASN D 1 19  ? -31.39700 11.08800  -44.72200 1.000 109.86054 ? 928  ASN D OD1 1 
ATOM   2793 N  ND2 . ASN D 1 19  ? -32.32100 9.63100   -46.14600 1.000 101.28583 ? 928  ASN D ND2 1 
ATOM   2794 N  N   . SER D 1 20  ? -29.40500 6.86100   -42.38100 1.000 104.83099 ? 929  SER D N   1 
ATOM   2795 C  CA  . SER D 1 20  ? -29.04800 5.75900   -41.44700 1.000 101.08054 ? 929  SER D CA  1 
ATOM   2796 C  C   . SER D 1 20  ? -28.33500 6.35100   -40.21900 1.000 97.42484  ? 929  SER D C   1 
ATOM   2797 O  O   . SER D 1 20  ? -28.88700 6.22600   -39.11300 1.000 99.65932  ? 929  SER D O   1 
ATOM   2798 C  CB  . SER D 1 20  ? -28.22400 4.70200   -42.16000 1.000 97.98806  ? 929  SER D CB  1 
ATOM   2799 O  OG  . SER D 1 20  ? -27.78000 3.69400   -41.26800 1.000 96.55895  ? 929  SER D OG  1 
ATOM   2800 N  N   . ALA D 1 21  ? -27.19700 7.03000   -40.41900 1.000 93.37699  ? 930  ALA D N   1 
ATOM   2801 C  CA  . ALA D 1 21  ? -26.33600 7.60100   -39.35300 1.000 90.80826  ? 930  ALA D CA  1 
ATOM   2802 C  C   . ALA D 1 21  ? -27.17000 8.49300   -38.43100 1.000 96.77213  ? 930  ALA D C   1 
ATOM   2803 O  O   . ALA D 1 21  ? -27.06200 8.32200   -37.19800 1.000 100.76471 ? 930  ALA D O   1 
ATOM   2804 C  CB  . ALA D 1 21  ? -25.17800 8.36800   -39.94700 1.000 94.98507  ? 930  ALA D CB  1 
ATOM   2805 N  N   . ILE D 1 22  ? -27.96000 9.41000   -38.99800 1.000 97.64065  ? 931  ILE D N   1 
ATOM   2806 C  CA  . ILE D 1 22  ? -28.77000 10.38200  -38.20500 1.000 95.81675  ? 931  ILE D CA  1 
ATOM   2807 C  C   . ILE D 1 22  ? -29.75200 9.60000   -37.32900 1.000 93.52700  ? 931  ILE D C   1 
ATOM   2808 O  O   . ILE D 1 22  ? -29.83800 9.91500   -36.12900 1.000 98.53287  ? 931  ILE D O   1 
ATOM   2809 C  CB  . ILE D 1 22  ? -29.48500 11.40900  -39.09800 1.000 92.24527  ? 931  ILE D CB  1 
ATOM   2810 C  CG1 . ILE D 1 22  ? -28.48900 12.38400  -39.72900 1.000 96.86161  ? 931  ILE D CG1 1 
ATOM   2811 C  CG2 . ILE D 1 22  ? -30.55900 12.14200  -38.30800 1.000 94.11128  ? 931  ILE D CG2 1 
ATOM   2812 C  CD1 . ILE D 1 22  ? -29.13600 13.43600  -40.59100 1.000 108.92359 ? 931  ILE D CD1 1 
ATOM   2813 N  N   . GLY D 1 23  ? -30.45400 8.62300   -37.90800 1.000 88.77117  ? 932  GLY D N   1 
ATOM   2814 C  CA  . GLY D 1 23  ? -31.39000 7.74200   -37.18500 1.000 96.79055  ? 932  GLY D CA  1 
ATOM   2815 C  C   . GLY D 1 23  ? -30.76500 7.15500   -35.92900 1.000 92.66111  ? 932  GLY D C   1 
ATOM   2816 O  O   . GLY D 1 23  ? -31.40000 7.25900   -34.85500 1.000 90.40294  ? 932  GLY D O   1 
ATOM   2817 N  N   . LYS D 1 24  ? -29.56700 6.56900   -36.06100 1.000 90.13449  ? 933  LYS D N   1 
ATOM   2818 C  CA  . LYS D 1 24  ? -28.75400 6.00500   -34.94400 1.000 87.18151  ? 933  LYS D CA  1 
ATOM   2819 C  C   . LYS D 1 24  ? -28.41000 7.10100   -33.92700 1.000 87.96055  ? 933  LYS D C   1 
ATOM   2820 O  O   . LYS D 1 24  ? -28.51100 6.84300   -32.71600 1.000 88.77643  ? 933  LYS D O   1 
ATOM   2821 C  CB  . LYS D 1 24  ? -27.44200 5.38400   -35.44000 1.000 79.24634  ? 933  LYS D CB  1 
ATOM   2822 C  CG  . LYS D 1 24  ? -27.59300 4.27400   -36.47200 1.000 86.27087  ? 933  LYS D CG  1 
ATOM   2823 C  CD  . LYS D 1 24  ? -26.43500 3.29400   -36.51200 1.000 87.70262  ? 933  LYS D CD  1 
ATOM   2824 C  CE  . LYS D 1 24  ? -26.33400 2.56600   -37.84000 1.000 89.42651  ? 933  LYS D CE  1 
ATOM   2825 N  NZ  . LYS D 1 24  ? -25.02400 1.89600   -38.03000 1.000 80.07013  ? 933  LYS D NZ  1 
ATOM   2826 N  N   . ILE D 1 25  ? -27.98100 8.26700   -34.40300 1.000 82.39672  ? 934  ILE D N   1 
ATOM   2827 C  CA  . ILE D 1 25  ? -27.58800 9.41000   -33.53400 1.000 85.69185  ? 934  ILE D CA  1 
ATOM   2828 C  C   . ILE D 1 25  ? -28.81700 9.85100   -32.72600 1.000 86.94727  ? 934  ILE D C   1 
ATOM   2829 O  O   . ILE D 1 25  ? -28.67900 10.03100  -31.49500 1.000 92.51636  ? 934  ILE D O   1 
ATOM   2830 C  CB  . ILE D 1 25  ? -26.96600 10.53700  -34.38000 1.000 84.29432  ? 934  ILE D CB  1 
ATOM   2831 C  CG1 . ILE D 1 25  ? -25.59900 10.11600  -34.92100 1.000 76.72236  ? 934  ILE D CG1 1 
ATOM   2832 C  CG2 . ILE D 1 25  ? -26.88300 11.84500  -33.60000 1.000 83.94428  ? 934  ILE D CG2 1 
ATOM   2833 C  CD1 . ILE D 1 25  ? -25.14200 10.91800  -36.12000 1.000 77.84618  ? 934  ILE D CD1 1 
ATOM   2834 N  N   . GLN D 1 26  ? -29.97400 9.98400   -33.38500 1.000 95.57988  ? 935  GLN D N   1 
ATOM   2835 C  CA  . GLN D 1 26  ? -31.27000 10.38400  -32.76300 1.000 103.61242 ? 935  GLN D CA  1 
ATOM   2836 C  C   . GLN D 1 26  ? -31.60300 9.45700   -31.58500 1.000 104.39936 ? 935  GLN D C   1 
ATOM   2837 O  O   . GLN D 1 26  ? -31.97400 9.97600   -30.51900 1.000 111.05016 ? 935  GLN D O   1 
ATOM   2838 C  CB  . GLN D 1 26  ? -32.40300 10.35200  -33.79600 1.000 105.51002 ? 935  GLN D CB  1 
ATOM   2839 C  CG  . GLN D 1 26  ? -32.34300 11.49500  -34.80200 1.000 98.42496  ? 935  GLN D CG  1 
ATOM   2840 C  CD  . GLN D 1 26  ? -33.34200 11.36800  -35.92800 1.000 101.69904 ? 935  GLN D CD  1 
ATOM   2841 O  OE1 . GLN D 1 26  ? -33.98100 12.33900  -36.32500 1.000 110.79486 ? 935  GLN D OE1 1 
ATOM   2842 N  NE2 . GLN D 1 26  ? -33.47100 10.16900  -36.47100 1.000 101.83589 ? 935  GLN D NE2 1 
ATOM   2843 N  N   . ASP D 1 27  ? -31.49100 8.14100   -31.78100 1.000 100.26202 ? 936  ASP D N   1 
ATOM   2844 C  CA  . ASP D 1 27  ? -31.73200 7.12100   -30.72400 1.000 100.80156 ? 936  ASP D CA  1 
ATOM   2845 C  C   . ASP D 1 27  ? -30.65300 7.24100   -29.63800 1.000 100.64101 ? 936  ASP D C   1 
ATOM   2846 O  O   . ASP D 1 27  ? -30.99500 7.04600   -28.45400 1.000 99.20926  ? 936  ASP D O   1 
ATOM   2847 C  CB  . ASP D 1 27  ? -31.78600 5.70600   -31.30700 1.000 105.11523 ? 936  ASP D CB  1 
ATOM   2848 C  CG  . ASP D 1 27  ? -33.15200 5.29700   -31.84500 1.000 111.96869 ? 936  ASP D CG  1 
ATOM   2849 O  OD1 . ASP D 1 27  ? -33.91900 6.19800   -32.26400 1.000 113.43729 ? 936  ASP D OD1 1 
ATOM   2850 O  OD2 . ASP D 1 27  ? -33.44800 4.07500   -31.83700 1.000 108.83937 ? 936  ASP D OD2 1 
ATOM   2851 N  N   . SER D 1 28  ? -29.40800 7.54600   -30.02700 1.000 96.03783  ? 937  SER D N   1 
ATOM   2852 C  CA  . SER D 1 28  ? -28.24900 7.75200   -29.11700 1.000 86.66829  ? 937  SER D CA  1 
ATOM   2853 C  C   . SER D 1 28  ? -28.50100 8.97300   -28.21800 1.000 83.92848  ? 937  SER D C   1 
ATOM   2854 O  O   . SER D 1 28  ? -28.24600 8.85300   -27.00100 1.000 78.40414  ? 937  SER D O   1 
ATOM   2855 C  CB  . SER D 1 28  ? -26.96000 7.88400   -29.89500 1.000 80.41490  ? 937  SER D CB  1 
ATOM   2856 O  OG  . SER D 1 28  ? -25.97000 7.00100   -29.39400 1.000 83.58634  ? 937  SER D OG  1 
ATOM   2857 N  N   . LEU D 1 29  ? -29.00700 10.08100  -28.78300 1.000 84.58646  ? 938  LEU D N   1 
ATOM   2858 C  CA  . LEU D 1 29  ? -29.25600 11.37000  -28.06500 1.000 77.36980  ? 938  LEU D CA  1 
ATOM   2859 C  C   . LEU D 1 29  ? -30.44200 11.25000  -27.10500 1.000 87.72631  ? 938  LEU D C   1 
ATOM   2860 O  O   . LEU D 1 29  ? -30.47200 12.02200  -26.11500 1.000 93.82178  ? 938  LEU D O   1 
ATOM   2861 C  CB  . LEU D 1 29  ? -29.51700 12.49800  -29.06600 1.000 79.08580  ? 938  LEU D CB  1 
ATOM   2862 C  CG  . LEU D 1 29  ? -28.37300 13.49200  -29.24700 1.000 84.44170  ? 938  LEU D CG  1 
ATOM   2863 C  CD1 . LEU D 1 29  ? -27.06800 12.80000  -29.62200 1.000 79.86221  ? 938  LEU D CD1 1 
ATOM   2864 C  CD2 . LEU D 1 29  ? -28.73900 14.52300  -30.29600 1.000 82.06247  ? 938  LEU D CD2 1 
ATOM   2865 N  N   . SER D 1 30  ? -31.40400 10.37200  -27.41500 1.000 88.70011  ? 939  SER D N   1 
ATOM   2866 C  CA  . SER D 1 30  ? -32.59400 10.09500  -26.56600 1.000 93.54806  ? 939  SER D CA  1 
ATOM   2867 C  C   . SER D 1 30  ? -32.17500 9.23800   -25.36200 1.000 87.55523  ? 939  SER D C   1 
ATOM   2868 O  O   . SER D 1 30  ? -32.61400 9.55000   -24.23800 1.000 93.41383  ? 939  SER D O   1 
ATOM   2869 C  CB  . SER D 1 30  ? -33.71600 9.46000   -27.36200 1.000 97.79594  ? 939  SER D CB  1 
ATOM   2870 O  OG  . SER D 1 30  ? -34.42500 10.43500  -28.12100 1.000 99.43297  ? 939  SER D OG  1 
ATOM   2871 N  N   . SER D 1 31  ? -31.34400 8.21400   -25.58300 1.000 79.22266  ? 940  SER D N   1 
ATOM   2872 C  CA  . SER D 1 31  ? -30.78800 7.33400   -24.52100 1.000 78.89104  ? 940  SER D CA  1 
ATOM   2873 C  C   . SER D 1 31  ? -29.91400 8.15300   -23.55700 1.000 80.68073  ? 940  SER D C   1 
ATOM   2874 O  O   . SER D 1 31  ? -29.94800 7.87400   -22.33700 1.000 68.97143  ? 940  SER D O   1 
ATOM   2875 C  CB  . SER D 1 31  ? -30.00800 6.19600   -25.11200 1.000 79.44900  ? 940  SER D CB  1 
ATOM   2876 O  OG  . SER D 1 31  ? -30.76400 5.54000   -26.11100 1.000 80.74652  ? 940  SER D OG  1 
ATOM   2877 N  N   . THR D 1 32  ? -29.14000 9.11200   -24.08200 1.000 75.33798  ? 941  THR D N   1 
ATOM   2878 C  CA  . THR D 1 32  ? -28.28300 10.03100  -23.28100 1.000 75.50379  ? 941  THR D CA  1 
ATOM   2879 C  C   . THR D 1 32  ? -29.19700 10.85300  -22.36500 1.000 81.36765  ? 941  THR D C   1 
ATOM   2880 O  O   . THR D 1 32  ? -28.98400 10.82100  -21.13400 1.000 70.99799  ? 941  THR D O   1 
ATOM   2881 C  CB  . THR D 1 32  ? -27.38600 10.89800  -24.17700 1.000 76.31441  ? 941  THR D CB  1 
ATOM   2882 O  OG1 . THR D 1 32  ? -26.57400 10.02500  -24.96100 1.000 77.79354  ? 941  THR D OG1 1 
ATOM   2883 C  CG2 . THR D 1 32  ? -26.48100 11.83000  -23.40100 1.000 76.00911  ? 941  THR D CG2 1 
ATOM   2884 N  N   . ALA D 1 33  ? -30.19700 11.52100  -22.95400 1.000 86.24192  ? 942  ALA D N   1 
ATOM   2885 C  CA  . ALA D 1 33  ? -31.20400 12.36100  -22.25800 1.000 91.14777  ? 942  ALA D CA  1 
ATOM   2886 C  C   . ALA D 1 33  ? -31.91300 11.55400  -21.16800 1.000 87.68420  ? 942  ALA D C   1 
ATOM   2887 O  O   . ALA D 1 33  ? -32.16500 12.12900  -20.09500 1.000 91.63204  ? 942  ALA D O   1 
ATOM   2888 C  CB  . ALA D 1 33  ? -32.20600 12.90500  -23.24500 1.000 95.71674  ? 942  ALA D CB  1 
ATOM   2889 N  N   . SER D 1 34  ? -32.25100 10.28900  -21.45200 1.000 81.47029  ? 943  SER D N   1 
ATOM   2890 C  CA  . SER D 1 34  ? -32.85500 9.34000   -20.48000 1.000 82.27565  ? 943  SER D CA  1 
ATOM   2891 C  C   . SER D 1 34  ? -31.90400 9.19400   -19.28800 1.000 76.14597  ? 943  SER D C   1 
ATOM   2892 O  O   . SER D 1 34  ? -32.30300 9.57900   -18.18100 1.000 84.41802  ? 943  SER D O   1 
ATOM   2893 C  CB  . SER D 1 34  ? -33.18100 8.01000   -21.12400 1.000 85.46025  ? 943  SER D CB  1 
ATOM   2894 O  OG  . SER D 1 34  ? -33.67200 7.07700   -20.17000 1.000 91.03986  ? 943  SER D OG  1 
ATOM   2895 N  N   . ALA D 1 35  ? -30.67600 8.72000   -19.52900 1.000 75.03005  ? 944  ALA D N   1 
ATOM   2896 C  CA  . ALA D 1 35  ? -29.64500 8.47100   -18.49400 1.000 67.44230  ? 944  ALA D CA  1 
ATOM   2897 C  C   . ALA D 1 35  ? -29.46300 9.73300   -17.62900 1.000 68.04500  ? 944  ALA D C   1 
ATOM   2898 O  O   . ALA D 1 35  ? -29.54700 9.61900   -16.39000 1.000 71.29802  ? 944  ALA D O   1 
ATOM   2899 C  CB  . ALA D 1 35  ? -28.36000 8.02000   -19.15500 1.000 69.14776  ? 944  ALA D CB  1 
ATOM   2900 N  N   . LEU D 1 36  ? -29.27100 10.90300  -18.24800 1.000 67.13173  ? 945  LEU D N   1 
ATOM   2901 C  CA  . LEU D 1 36  ? -29.04500 12.19000  -17.53100 1.000 74.33260  ? 945  LEU D CA  1 
ATOM   2902 C  C   . LEU D 1 36  ? -30.25200 12.54400  -16.65600 1.000 80.32542  ? 945  LEU D C   1 
ATOM   2903 O  O   . LEU D 1 36  ? -30.05500 13.20300  -15.61000 1.000 82.59675  ? 945  LEU D O   1 
ATOM   2904 C  CB  . LEU D 1 36  ? -28.78200 13.30700  -18.54300 1.000 76.60655  ? 945  LEU D CB  1 
ATOM   2905 C  CG  . LEU D 1 36  ? -27.44100 13.22700  -19.26600 1.000 79.81746  ? 945  LEU D CG  1 
ATOM   2906 C  CD1 . LEU D 1 36  ? -27.41200 14.18900  -20.44100 1.000 83.21524  ? 945  LEU D CD1 1 
ATOM   2907 C  CD2 . LEU D 1 36  ? -26.28600 13.50800  -18.31300 1.000 69.43727  ? 945  LEU D CD2 1 
ATOM   2908 N  N   . GLY D 1 37  ? -31.45700 12.17300  -17.09000 1.000 86.47089  ? 946  GLY D N   1 
ATOM   2909 C  CA  . GLY D 1 37  ? -32.68600 12.37400  -16.30400 1.000 89.65022  ? 946  GLY D CA  1 
ATOM   2910 C  C   . GLY D 1 37  ? -32.65700 11.53000  -15.04500 1.000 86.56038  ? 946  GLY D C   1 
ATOM   2911 O  O   . GLY D 1 37  ? -32.88000 12.08100  -13.94500 1.000 96.47736  ? 946  GLY D O   1 
ATOM   2912 N  N   . LYS D 1 38  ? -32.38500 10.23600  -15.20500 1.000 86.49195  ? 947  LYS D N   1 
ATOM   2913 C  CA  . LYS D 1 38  ? -32.41800 9.24100   -14.10800 1.000 85.04967  ? 947  LYS D CA  1 
ATOM   2914 C  C   . LYS D 1 38  ? -31.31600 9.59000   -13.09900 1.000 85.15758  ? 947  LYS D C   1 
ATOM   2915 O  O   . LYS D 1 38  ? -31.58800 9.46500   -11.88400 1.000 80.42543  ? 947  LYS D O   1 
ATOM   2916 C  CB  . LYS D 1 38  ? -32.28100 7.82300   -14.67200 1.000 81.77296  ? 947  LYS D CB  1 
ATOM   2917 C  CG  . LYS D 1 38  ? -33.45200 7.33400   -15.51600 1.000 86.81830  ? 947  LYS D CG  1 
ATOM   2918 C  CD  . LYS D 1 38  ? -33.20500 5.94300   -16.05900 1.000 88.20268  ? 947  LYS D CD  1 
ATOM   2919 C  CE  . LYS D 1 38  ? -34.38000 5.32200   -16.78100 1.000 83.53370  ? 947  LYS D CE  1 
ATOM   2920 N  NZ  . LYS D 1 38  ? -33.98700 4.03500   -17.40400 1.000 84.01007  ? 947  LYS D NZ  1 
ATOM   2921 N  N   . LEU D 1 39  ? -30.14300 10.03200  -13.58100 1.000 76.60392  ? 948  LEU D N   1 
ATOM   2922 C  CA  . LEU D 1 39  ? -29.02000 10.50200  -12.71900 1.000 78.61469  ? 948  LEU D CA  1 
ATOM   2923 C  C   . LEU D 1 39  ? -29.49600 11.71600  -11.91400 1.000 78.54363  ? 948  LEU D C   1 
ATOM   2924 O  O   . LEU D 1 39  ? -29.42600 11.63300  -10.66700 1.000 84.94703  ? 948  LEU D O   1 
ATOM   2925 C  CB  . LEU D 1 39  ? -27.76300 10.78900  -13.55400 1.000 61.14681  ? 948  LEU D CB  1 
ATOM   2926 C  CG  . LEU D 1 39  ? -26.98400 9.53700   -13.97200 1.000 54.69077  ? 948  LEU D CG  1 
ATOM   2927 C  CD1 . LEU D 1 39  ? -25.86200 9.84500   -14.94800 1.000 53.50905  ? 948  LEU D CD1 1 
ATOM   2928 C  CD2 . LEU D 1 39  ? -26.42300 8.81200   -12.76500 1.000 55.48034  ? 948  LEU D CD2 1 
ATOM   2929 N  N   . GLN D 1 40  ? -30.03400 12.74700  -12.58200 1.000 80.02275  ? 949  GLN D N   1 
ATOM   2930 C  CA  . GLN D 1 40  ? -30.56300 13.98100  -11.93100 1.000 89.43704  ? 949  GLN D CA  1 
ATOM   2931 C  C   . GLN D 1 40  ? -31.54500 13.60700  -10.81400 1.000 86.39983  ? 949  GLN D C   1 
ATOM   2932 O  O   . GLN D 1 40  ? -31.38800 14.14000  -9.69600  1.000 88.01582  ? 949  GLN D O   1 
ATOM   2933 C  CB  . GLN D 1 40  ? -31.26700 14.91000  -12.92700 1.000 100.30940 ? 949  GLN D CB  1 
ATOM   2934 C  CG  . GLN D 1 40  ? -31.85100 16.16600  -12.27500 1.000 98.93818  ? 949  GLN D CG  1 
ATOM   2935 C  CD  . GLN D 1 40  ? -32.51700 17.12900  -13.23200 1.000 91.71363  ? 949  GLN D CD  1 
ATOM   2936 O  OE1 . GLN D 1 40  ? -33.03900 16.74700  -14.28000 1.000 91.12408  ? 949  GLN D OE1 1 
ATOM   2937 N  NE2 . GLN D 1 40  ? -32.53100 18.39900  -12.85600 1.000 87.06044  ? 949  GLN D NE2 1 
ATOM   2938 N  N   . ASP D 1 41  ? -32.53100 12.75100  -11.11900 1.000 89.23965  ? 950  ASP D N   1 
ATOM   2939 C  CA  . ASP D 1 41  ? -33.59200 12.31500  -10.16900 1.000 91.46886  ? 950  ASP D CA  1 
ATOM   2940 C  C   . ASP D 1 41  ? -32.90700 11.71300  -8.93400  1.000 87.02096  ? 950  ASP D C   1 
ATOM   2941 O  O   . ASP D 1 41  ? -33.05700 12.27600  -7.82400  1.000 88.68958  ? 950  ASP D O   1 
ATOM   2942 C  CB  . ASP D 1 41  ? -34.58200 11.34300  -10.83100 1.000 96.40366  ? 950  ASP D CB  1 
ATOM   2943 C  CG  . ASP D 1 41  ? -35.46000 11.93700  -11.93400 1.000 101.43321 ? 950  ASP D CG  1 
ATOM   2944 O  OD1 . ASP D 1 41  ? -35.46400 13.18900  -12.09900 1.000 106.31801 ? 950  ASP D OD1 1 
ATOM   2945 O  OD2 . ASP D 1 41  ? -36.14400 11.14100  -12.62900 1.000 96.95636  ? 950  ASP D OD2 1 
ATOM   2946 N  N   . VAL D 1 42  ? -32.12900 10.64900  -9.13600  1.000 80.66757  ? 951  VAL D N   1 
ATOM   2947 C  CA  . VAL D 1 42  ? -31.51100 9.86200   -8.03200  1.000 77.20926  ? 951  VAL D CA  1 
ATOM   2948 C  C   . VAL D 1 42  ? -30.54700 10.76400  -7.25900  1.000 82.35987  ? 951  VAL D C   1 
ATOM   2949 O  O   . VAL D 1 42  ? -30.59400 10.70500  -6.02500  1.000 91.49518  ? 951  VAL D O   1 
ATOM   2950 C  CB  . VAL D 1 42  ? -30.82000 8.58300   -8.54000  1.000 69.24251  ? 951  VAL D CB  1 
ATOM   2951 C  CG1 . VAL D 1 42  ? -30.08500 7.85400   -7.42500  1.000 61.24155  ? 951  VAL D CG1 1 
ATOM   2952 C  CG2 . VAL D 1 42  ? -31.81700 7.65100   -9.21200  1.000 64.43931  ? 951  VAL D CG2 1 
ATOM   2953 N  N   . VAL D 1 43  ? -29.71400 11.56800  -7.92800  1.000 71.14800  ? 952  VAL D N   1 
ATOM   2954 C  CA  . VAL D 1 43  ? -28.74800 12.46000  -7.21500  1.000 74.88529  ? 952  VAL D CA  1 
ATOM   2955 C  C   . VAL D 1 43  ? -29.53900 13.31500  -6.21900  1.000 81.70453  ? 952  VAL D C   1 
ATOM   2956 O  O   . VAL D 1 43  ? -29.14500 13.34900  -5.03400  1.000 83.34684  ? 952  VAL D O   1 
ATOM   2957 C  CB  . VAL D 1 43  ? -27.90600 13.33800  -8.16500  1.000 74.80107  ? 952  VAL D CB  1 
ATOM   2958 C  CG1 . VAL D 1 43  ? -27.18900 14.45200  -7.41400  1.000 71.80598  ? 952  VAL D CG1 1 
ATOM   2959 C  CG2 . VAL D 1 43  ? -26.89400 12.52100  -8.95600  1.000 67.43440  ? 952  VAL D CG2 1 
ATOM   2960 N  N   . ASN D 1 44  ? -30.62700 13.94200  -6.68500  1.000 87.32626  ? 953  ASN D N   1 
ATOM   2961 C  CA  . ASN D 1 44  ? -31.44300 14.93900  -5.93000  1.000 89.89499  ? 953  ASN D CA  1 
ATOM   2962 C  C   . ASN D 1 44  ? -32.19900 14.25300  -4.77300  1.000 87.47628  ? 953  ASN D C   1 
ATOM   2963 O  O   . ASN D 1 44  ? -32.36500 14.91000  -3.72600  1.000 89.75023  ? 953  ASN D O   1 
ATOM   2964 C  CB  . ASN D 1 44  ? -32.40300 15.70800  -6.85200  1.000 88.41323  ? 953  ASN D CB  1 
ATOM   2965 C  CG  . ASN D 1 44  ? -31.73700 16.71300  -7.77800  1.000 85.27075  ? 953  ASN D CG  1 
ATOM   2966 O  OD1 . ASN D 1 44  ? -30.71900 17.31500  -7.45400  1.000 79.46742  ? 953  ASN D OD1 1 
ATOM   2967 N  ND2 . ASN D 1 44  ? -32.32000 16.92100  -8.94400  1.000 86.27350  ? 953  ASN D ND2 1 
ATOM   2968 N  N   . GLN D 1 45  ? -32.64800 12.99900  -4.94800  1.000 90.36347  ? 954  GLN D N   1 
ATOM   2969 C  CA  . GLN D 1 45  ? -33.30000 12.17600  -3.88400  1.000 87.70262  ? 954  GLN D CA  1 
ATOM   2970 C  C   . GLN D 1 45  ? -32.30500 11.88100  -2.76000  1.000 86.89989  ? 954  GLN D C   1 
ATOM   2971 O  O   . GLN D 1 45  ? -32.70300 11.96300  -1.58800  1.000 90.84510  ? 954  GLN D O   1 
ATOM   2972 C  CB  . GLN D 1 45  ? -33.80100 10.83500  -4.41700  1.000 89.82656  ? 954  GLN D CB  1 
ATOM   2973 C  CG  . GLN D 1 45  ? -35.06800 10.95000  -5.24700  1.000 102.13067 ? 954  GLN D CG  1 
ATOM   2974 C  CD  . GLN D 1 45  ? -35.46600 9.63200   -5.86200  1.000 102.58862 ? 954  GLN D CD  1 
ATOM   2975 O  OE1 . GLN D 1 45  ? -35.07100 8.56200   -5.40200  1.000 103.00709 ? 954  GLN D OE1 1 
ATOM   2976 N  NE2 . GLN D 1 45  ? -36.25500 9.70800   -6.92000  1.000 102.60704 ? 954  GLN D NE2 1 
ATOM   2977 N  N   . ASN D 1 46  ? -31.07400 11.51900  -3.12400  1.000 79.90958  ? 955  ASN D N   1 
ATOM   2978 C  CA  . ASN D 1 46  ? -29.96800 11.19500  -2.18300  1.000 79.02263  ? 955  ASN D CA  1 
ATOM   2979 C  C   . ASN D 1 46  ? -29.50300 12.48300  -1.48500  1.000 74.61421  ? 955  ASN D C   1 
ATOM   2980 O  O   . ASN D 1 46  ? -29.18300 12.41600  -0.28200  1.000 75.04847  ? 955  ASN D O   1 
ATOM   2981 C  CB  . ASN D 1 46  ? -28.82400 10.45900  -2.89200  1.000 79.77535  ? 955  ASN D CB  1 
ATOM   2982 C  CG  . ASN D 1 46  ? -29.17700 9.03300   -3.27100  1.000 72.10075  ? 955  ASN D CG  1 
ATOM   2983 O  OD1 . ASN D 1 46  ? -30.27500 8.55600   -2.97700  1.000 64.42351  ? 955  ASN D OD1 1 
ATOM   2984 N  ND2 . ASN D 1 46  ? -28.24900 8.34400   -3.92300  1.000 67.76339  ? 955  ASN D ND2 1 
ATOM   2985 N  N   . ALA D 1 47  ? -29.47900 13.61600  -2.19400  1.000 66.97119  ? 956  ALA D N   1 
ATOM   2986 C  CA  . ALA D 1 47  ? -29.17400 14.94400  -1.61600  1.000 75.72224  ? 956  ALA D CA  1 
ATOM   2987 C  C   . ALA D 1 47  ? -30.20300 15.30000  -0.53200  1.000 83.84690  ? 956  ALA D C   1 
ATOM   2988 O  O   . ALA D 1 47  ? -29.77700 15.76600  0.54400   1.000 96.99847  ? 956  ALA D O   1 
ATOM   2989 C  CB  . ALA D 1 47  ? -29.13900 15.98800  -2.69800  1.000 76.82500  ? 956  ALA D CB  1 
ATOM   2990 N  N   . GLN D 1 48  ? -31.49800 15.08500  -0.79300  1.000 81.16499  ? 957  GLN D N   1 
ATOM   2991 C  CA  . GLN D 1 48  ? -32.60200 15.40400  0.15600   1.000 82.00720  ? 957  GLN D CA  1 
ATOM   2992 C  C   . GLN D 1 48  ? -32.57800 14.44300  1.35000   1.000 80.12540  ? 957  GLN D C   1 
ATOM   2993 O  O   . GLN D 1 48  ? -32.74800 14.92300  2.49000   1.000 82.11248  ? 957  GLN D O   1 
ATOM   2994 C  CB  . GLN D 1 48  ? -33.96100 15.33100  -0.53900  1.000 94.38763  ? 957  GLN D CB  1 
ATOM   2995 C  CG  . GLN D 1 48  ? -34.21000 16.47100  -1.51700  1.000 101.65166 ? 957  GLN D CG  1 
ATOM   2996 C  CD  . GLN D 1 48  ? -35.62200 16.43700  -2.05100  1.000 100.15148 ? 957  GLN D CD  1 
ATOM   2997 O  OE1 . GLN D 1 48  ? -36.50600 15.80700  -1.47300  1.000 84.78385  ? 957  GLN D OE1 1 
ATOM   2998 N  NE2 . GLN D 1 48  ? -35.84000 17.10900  -3.17100  1.000 103.85982 ? 957  GLN D NE2 1 
ATOM   2999 N  N   . ALA D 1 49  ? -32.40500 13.14100  1.09700   1.000 71.37961  ? 958  ALA D N   1 
ATOM   3000 C  CA  . ALA D 1 49  ? -32.26700 12.09100  2.13500   1.000 75.11690  ? 958  ALA D CA  1 
ATOM   3001 C  C   . ALA D 1 49  ? -31.17300 12.49700  3.13000   1.000 77.81196  ? 958  ALA D C   1 
ATOM   3002 O  O   . ALA D 1 49  ? -31.40600 12.33200  4.33600   1.000 77.44876  ? 958  ALA D O   1 
ATOM   3003 C  CB  . ALA D 1 49  ? -31.97100 10.75000  1.50700   1.000 63.92345  ? 958  ALA D CB  1 
ATOM   3004 N  N   . LEU D 1 50  ? -30.04200 13.02200  2.64100   1.000 62.26010  ? 959  LEU D N   1 
ATOM   3005 C  CA  . LEU D 1 50  ? -28.88400 13.45300  3.47700   1.000 63.19179  ? 959  LEU D CA  1 
ATOM   3006 C  C   . LEU D 1 50  ? -29.26800 14.69900  4.28100   1.000 80.25173  ? 959  LEU D C   1 
ATOM   3007 O  O   . LEU D 1 50  ? -28.92800 14.75900  5.47900   1.000 87.55260  ? 959  LEU D O   1 
ATOM   3008 C  CB  . LEU D 1 50  ? -27.66200 13.71900  2.58900   1.000 71.67175  ? 959  LEU D CB  1 
ATOM   3009 C  CG  . LEU D 1 50  ? -26.37800 14.15300  3.30600   1.000 68.42399  ? 959  LEU D CG  1 
ATOM   3010 C  CD1 . LEU D 1 50  ? -26.10200 13.32800  4.55400   1.000 66.94487  ? 959  LEU D CD1 1 
ATOM   3011 C  CD2 . LEU D 1 50  ? -25.18200 14.07000  2.37300   1.000 57.54901  ? 959  LEU D CD2 1 
ATOM   3012 N  N   . ASN D 1 51  ? -29.96900 15.65200  3.66100   1.000 82.57832  ? 960  ASN D N   1 
ATOM   3013 C  CA  . ASN D 1 51  ? -30.38700 16.93100  4.30800   1.000 85.86819  ? 960  ASN D CA  1 
ATOM   3014 C  C   . ASN D 1 51  ? -31.44600 16.66700  5.39400   1.000 87.48944  ? 960  ASN D C   1 
ATOM   3015 O  O   . ASN D 1 51  ? -31.33700 17.31600  6.45500   1.000 95.78254  ? 960  ASN D O   1 
ATOM   3016 C  CB  . ASN D 1 51  ? -30.86000 17.96500  3.28300   1.000 83.29157  ? 960  ASN D CB  1 
ATOM   3017 C  CG  . ASN D 1 51  ? -29.72900 18.52000  2.43800   1.000 80.78600  ? 960  ASN D CG  1 
ATOM   3018 O  OD1 . ASN D 1 51  ? -28.69500 18.94000  2.96000   1.000 79.61744  ? 960  ASN D OD1 1 
ATOM   3019 N  ND2 . ASN D 1 51  ? -29.90700 18.52100  1.12700   1.000 83.02838  ? 960  ASN D ND2 1 
ATOM   3020 N  N   . THR D 1 52  ? -32.41100 15.76000  5.15700   1.000 79.65429  ? 961  THR D N   1 
ATOM   3021 C  CA  . THR D 1 52  ? -33.41600 15.29100  6.16300   1.000 76.63814  ? 961  THR D CA  1 
ATOM   3022 C  C   . THR D 1 52  ? -32.70200 14.59200  7.33000   1.000 81.33344  ? 961  THR D C   1 
ATOM   3023 O  O   . THR D 1 52  ? -33.04000 14.87800  8.50700   1.000 79.24898  ? 961  THR D O   1 
ATOM   3024 C  CB  . THR D 1 52  ? -34.44200 14.32100  5.55200   1.000 74.78791  ? 961  THR D CB  1 
ATOM   3025 O  OG1 . THR D 1 52  ? -35.16100 14.97800  4.50700   1.000 81.59926  ? 961  THR D OG1 1 
ATOM   3026 C  CG2 . THR D 1 52  ? -35.42300 13.77900  6.57000   1.000 68.35030  ? 961  THR D CG2 1 
ATOM   3027 N  N   . LEU D 1 53  ? -31.78000 13.68100  7.00600   1.000 66.71853  ? 962  LEU D N   1 
ATOM   3028 C  CA  . LEU D 1 53  ? -30.93800 12.97100  7.99600   1.000 71.29013  ? 962  LEU D CA  1 
ATOM   3029 C  C   . LEU D 1 53  ? -30.21100 14.02000  8.84300   1.000 71.41119  ? 962  LEU D C   1 
ATOM   3030 O  O   . LEU D 1 53  ? -30.31100 13.93500  10.07200  1.000 88.05266  ? 962  LEU D O   1 
ATOM   3031 C  CB  . LEU D 1 53  ? -29.96200 12.02600  7.28400   1.000 72.61923  ? 962  LEU D CB  1 
ATOM   3032 C  CG  . LEU D 1 53  ? -28.93800 11.33600  8.18500   1.000 69.75573  ? 962  LEU D CG  1 
ATOM   3033 C  CD1 . LEU D 1 53  ? -29.62100 10.47400  9.23900   1.000 66.59219  ? 962  LEU D CD1 1 
ATOM   3034 C  CD2 . LEU D 1 53  ? -27.96500 10.51600  7.35600   1.000 55.80143  ? 962  LEU D CD2 1 
ATOM   3035 N  N   . VAL D 1 54  ? -29.52100 14.98000  8.22300   1.000 77.78564  ? 963  VAL D N   1 
ATOM   3036 C  CA  . VAL D 1 54  ? -28.70500 15.98300  8.97700   1.000 88.95277  ? 963  VAL D CA  1 
ATOM   3037 C  C   . VAL D 1 54  ? -29.61600 16.71100  9.97800   1.000 93.72176  ? 963  VAL D C   1 
ATOM   3038 O  O   . VAL D 1 54  ? -29.17800 16.89200  11.13700  1.000 99.45929  ? 963  VAL D O   1 
ATOM   3039 C  CB  . VAL D 1 54  ? -27.95400 16.97600  8.06100   1.000 85.38655  ? 963  VAL D CB  1 
ATOM   3040 C  CG1 . VAL D 1 54  ? -27.54100 18.24200  8.81300   1.000 85.82345  ? 963  VAL D CG1 1 
ATOM   3041 C  CG2 . VAL D 1 54  ? -26.74500 16.32800  7.39900   1.000 76.40390  ? 963  VAL D CG2 1 
ATOM   3042 N  N   . LYS D 1 55  ? -30.82200 17.11200  9.55400   1.000 96.31681  ? 964  LYS D N   1 
ATOM   3043 C  CA  . LYS D 1 55  ? -31.77700 17.87700  10.40500  1.000 94.45343  ? 964  LYS D CA  1 
ATOM   3044 C  C   . LYS D 1 55  ? -32.12200 17.02200  11.63100  1.000 91.73995  ? 964  LYS D C   1 
ATOM   3045 O  O   . LYS D 1 55  ? -31.88900 17.49500  12.76200  1.000 92.94799  ? 964  LYS D O   1 
ATOM   3046 C  CB  . LYS D 1 55  ? -33.04400 18.27700  9.63500   1.000 97.16691  ? 964  LYS D CB  1 
ATOM   3047 C  CG  . LYS D 1 55  ? -32.91000 19.44400  8.66200   1.000 105.76268 ? 964  LYS D CG  1 
ATOM   3048 C  CD  . LYS D 1 55  ? -34.20600 19.69900  7.91700   1.000 108.79199 ? 964  LYS D CD  1 
ATOM   3049 C  CE  . LYS D 1 55  ? -34.12300 20.75900  6.83900   1.000 105.95744 ? 964  LYS D CE  1 
ATOM   3050 N  NZ  . LYS D 1 55  ? -35.47800 21.20900  6.44200   1.000 100.42520 ? 964  LYS D NZ  1 
ATOM   3051 N  N   . GLN D 1 56  ? -32.62200 15.80200  11.40700  1.000 84.17588  ? 965  GLN D N   1 
ATOM   3052 C  CA  . GLN D 1 56  ? -33.08200 14.87500  12.48000  1.000 86.70776  ? 965  GLN D CA  1 
ATOM   3053 C  C   . GLN D 1 56  ? -31.91400 14.49700  13.41400  1.000 89.27123  ? 965  GLN D C   1 
ATOM   3054 O  O   . GLN D 1 56  ? -32.17300 14.27000  14.60700  1.000 83.83110  ? 965  GLN D O   1 
ATOM   3055 C  CB  . GLN D 1 56  ? -33.76500 13.65900  11.85500  1.000 82.52305  ? 965  GLN D CB  1 
ATOM   3056 C  CG  . GLN D 1 56  ? -35.14000 13.98600  11.29700  1.000 95.90887  ? 965  GLN D CG  1 
ATOM   3057 C  CD  . GLN D 1 56  ? -35.70300 12.87100  10.45200  1.000 94.77715  ? 965  GLN D CD  1 
ATOM   3058 O  OE1 . GLN D 1 56  ? -35.48200 11.69100  10.71500  1.000 89.78445  ? 965  GLN D OE1 1 
ATOM   3059 N  NE2 . GLN D 1 56  ? -36.45500 13.24400  9.43000   1.000 90.82142  ? 965  GLN D NE2 1 
ATOM   3060 N  N   . LEU D 1 57  ? -30.67700 14.44400  12.90700  1.000 81.93614  ? 966  LEU D N   1 
ATOM   3061 C  CA  . LEU D 1 57  ? -29.45100 14.17400  13.71000  1.000 79.15160  ? 966  LEU D CA  1 
ATOM   3062 C  C   . LEU D 1 57  ? -29.16000 15.35700  14.64500  1.000 78.82524  ? 966  LEU D C   1 
ATOM   3063 O  O   . LEU D 1 57  ? -28.86400 15.11400  15.83500  1.000 78.29623  ? 966  LEU D O   1 
ATOM   3064 C  CB  . LEU D 1 57  ? -28.27100 13.90500  12.76900  1.000 84.67331  ? 966  LEU D CB  1 
ATOM   3065 C  CG  . LEU D 1 57  ? -28.28200 12.54800  12.05800  1.000 82.11774  ? 966  LEU D CG  1 
ATOM   3066 C  CD1 . LEU D 1 57  ? -27.02700 12.37300  11.22200  1.000 64.56300  ? 966  LEU D CD1 1 
ATOM   3067 C  CD2 . LEU D 1 57  ? -28.40500 11.39500  13.04000  1.000 85.70238  ? 966  LEU D CD2 1 
ATOM   3068 N  N   . SER D 1 58  ? -29.23800 16.58700  14.13100  1.000 85.89188  ? 967  SER D N   1 
ATOM   3069 C  CA  . SER D 1 58  ? -29.07900 17.84500  14.91100  1.000 83.67056  ? 967  SER D CA  1 
ATOM   3070 C  C   . SER D 1 58  ? -30.15500 17.94000  16.00200  1.000 85.31812  ? 967  SER D C   1 
ATOM   3071 O  O   . SER D 1 58  ? -29.84700 18.48300  17.08400  1.000 84.84965  ? 967  SER D O   1 
ATOM   3072 C  CB  . SER D 1 58  ? -29.10600 19.06700  14.02300  1.000 79.07527  ? 967  SER D CB  1 
ATOM   3073 O  OG  . SER D 1 58  ? -27.82600 19.32200  13.46600  1.000 72.13760  ? 967  SER D OG  1 
ATOM   3074 N  N   . SER D 1 59  ? -31.37200 17.46000  15.72100  1.000 83.61002  ? 968  SER D N   1 
ATOM   3075 C  CA  . SER D 1 59  ? -32.49300 17.39600  16.69400  1.000 89.85288  ? 968  SER D CA  1 
ATOM   3076 C  C   . SER D 1 59  ? -32.15200 16.36200  17.77300  1.000 84.53382  ? 968  SER D C   1 
ATOM   3077 O  O   . SER D 1 59  ? -32.35000 16.65900  18.96200  1.000 87.57103  ? 968  SER D O   1 
ATOM   3078 C  CB  . SER D 1 59  ? -33.81700 17.08600  16.02500  1.000 97.71698  ? 968  SER D CB  1 
ATOM   3079 O  OG  . SER D 1 59  ? -34.23700 15.74800  16.28700  1.000 99.87513  ? 968  SER D OG  1 
ATOM   3080 N  N   . ASN D 1 60  ? -31.64400 15.19400  17.37100  1.000 81.64663  ? 969  ASN D N   1 
ATOM   3081 C  CA  . ASN D 1 60  ? -31.28800 14.09300  18.30500  1.000 75.35640  ? 969  ASN D CA  1 
ATOM   3082 C  C   . ASN D 1 60  ? -30.12100 14.54200  19.19100  1.000 77.08819  ? 969  ASN D C   1 
ATOM   3083 O  O   . ASN D 1 60  ? -30.21400 14.32400  20.40000  1.000 88.63431  ? 969  ASN D O   1 
ATOM   3084 C  CB  . ASN D 1 60  ? -30.96100 12.78100  17.58300  1.000 69.09249  ? 969  ASN D CB  1 
ATOM   3085 C  CG  . ASN D 1 60  ? -32.16600 12.10600  16.95100  1.000 65.40521  ? 969  ASN D CG  1 
ATOM   3086 O  OD1 . ASN D 1 60  ? -33.27700 12.63500  16.96400  1.000 62.34695  ? 969  ASN D OD1 1 
ATOM   3087 N  ND2 . ASN D 1 60  ? -31.95100 10.93700  16.37400  1.000 69.57413  ? 969  ASN D ND2 1 
ATOM   3088 N  N   . PHE D 1 61  ? -29.07300 15.15600  18.63600  1.000 76.49865  ? 970  PHE D N   1 
ATOM   3089 C  CA  . PHE D 1 61  ? -27.87600 15.57000  19.41800  1.000 77.11188  ? 970  PHE D CA  1 
ATOM   3090 C  C   . PHE D 1 61  ? -28.22400 16.70100  20.38900  1.000 88.57641  ? 970  PHE D C   1 
ATOM   3091 O  O   . PHE D 1 61  ? -27.67600 16.70500  21.51000  1.000 91.21883  ? 970  PHE D O   1 
ATOM   3092 C  CB  . PHE D 1 61  ? -26.72300 15.99800  18.51300  1.000 81.41239  ? 970  PHE D CB  1 
ATOM   3093 C  CG  . PHE D 1 61  ? -25.98300 14.84900  17.88100  1.000 76.15124  ? 970  PHE D CG  1 
ATOM   3094 C  CD1 . PHE D 1 61  ? -25.49800 13.80700  18.64900  1.000 74.31944  ? 970  PHE D CD1 1 
ATOM   3095 C  CD2 . PHE D 1 61  ? -25.78300 14.80900  16.51400  1.000 73.82990  ? 970  PHE D CD2 1 
ATOM   3096 C  CE1 . PHE D 1 61  ? -24.82700 12.74800  18.06000  1.000 69.06618  ? 970  PHE D CE1 1 
ATOM   3097 C  CE2 . PHE D 1 61  ? -25.11600 13.75000  15.92600  1.000 71.15853  ? 970  PHE D CE2 1 
ATOM   3098 C  CZ  . PHE D 1 61  ? -24.63600 12.72100  16.70000  1.000 63.77607  ? 970  PHE D CZ  1 
ATOM   3099 N  N   . GLY D 1 62  ? -29.07700 17.64000  19.96500  1.000 82.18091  ? 971  GLY D N   1 
ATOM   3100 C  CA  . GLY D 1 62  ? -29.65500 18.67100  20.84600  1.000 83.67582  ? 971  GLY D CA  1 
ATOM   3101 C  C   . GLY D 1 62  ? -30.29500 18.03800  22.07200  1.000 84.28379  ? 971  GLY D C   1 
ATOM   3102 O  O   . GLY D 1 62  ? -29.92000 18.41300  23.19700  1.000 93.82967  ? 971  GLY D O   1 
ATOM   3103 N  N   . ALA D 1 63  ? -31.19700 17.07300  21.85400  1.000 75.89068  ? 972  ALA D N   1 
ATOM   3104 C  CA  . ALA D 1 63  ? -31.97400 16.35400  22.89400  1.000 77.21978  ? 972  ALA D CA  1 
ATOM   3105 C  C   . ALA D 1 63  ? -31.05100 15.55700  23.83200  1.000 76.08017  ? 972  ALA D C   1 
ATOM   3106 O  O   . ALA D 1 63  ? -31.38200 15.45700  25.02800  1.000 74.26154  ? 972  ALA D O   1 
ATOM   3107 C  CB  . ALA D 1 63  ? -32.99000 15.45400  22.23800  1.000 74.71949  ? 972  ALA D CB  1 
ATOM   3108 N  N   . ILE D 1 64  ? -29.94900 15.00500  23.31400  1.000 71.07694  ? 973  ILE D N   1 
ATOM   3109 C  CA  . ILE D 1 64  ? -28.97800 14.17700  24.09100  1.000 80.15961  ? 973  ILE D CA  1 
ATOM   3110 C  C   . ILE D 1 64  ? -28.19300 15.09200  25.03400  1.000 82.98627  ? 973  ILE D C   1 
ATOM   3111 O  O   . ILE D 1 64  ? -28.13300 14.77800  26.23900  1.000 84.62857  ? 973  ILE D O   1 
ATOM   3112 C  CB  . ILE D 1 64  ? -28.04500 13.39100  23.15000  1.000 78.28044  ? 973  ILE D CB  1 
ATOM   3113 C  CG1 . ILE D 1 64  ? -28.78900 12.26000  22.43900  1.000 72.78241  ? 973  ILE D CG1 1 
ATOM   3114 C  CG2 . ILE D 1 64  ? -26.82000 12.88000  23.89500  1.000 77.14083  ? 973  ILE D CG2 1 
ATOM   3115 C  CD1 . ILE D 1 64  ? -28.05700 11.69700  21.24000  1.000 69.82679  ? 973  ILE D CD1 1 
ATOM   3116 N  N   . SER D 1 65  ? -27.60300 16.16500  24.49900  1.000 91.77943  ? 974  SER D N   1 
ATOM   3117 C  CA  . SER D 1 65  ? -26.75400 17.13200  25.24900  1.000 97.63539  ? 974  SER D CA  1 
ATOM   3118 C  C   . SER D 1 65  ? -27.57600 17.80900  26.35700  1.000 95.14562  ? 974  SER D C   1 
ATOM   3119 O  O   . SER D 1 65  ? -27.00800 18.05800  27.43400  1.000 100.60943 ? 974  SER D O   1 
ATOM   3120 C  CB  . SER D 1 65  ? -26.11300 18.14700  24.33200  1.000 105.02838 ? 974  SER D CB  1 
ATOM   3121 O  OG  . SER D 1 65  ? -26.98900 18.51900  23.27800  1.000 109.52629 ? 974  SER D OG  1 
ATOM   3122 N  N   . SER D 1 66  ? -28.86100 18.09100  26.11200  1.000 99.77775  ? 975  SER D N   1 
ATOM   3123 C  CA  . SER D 1 66  ? -29.80000 18.63600  27.13000  1.000 99.66721  ? 975  SER D CA  1 
ATOM   3124 C  C   . SER D 1 66  ? -29.89000 17.64500  28.30000  1.000 98.11703  ? 975  SER D C   1 
ATOM   3125 O  O   . SER D 1 66  ? -29.59300 18.04400  29.44400  1.000 100.28044 ? 975  SER D O   1 
ATOM   3126 C  CB  . SER D 1 66  ? -31.16900 18.95300  26.54100  1.000 94.51923  ? 975  SER D CB  1 
ATOM   3127 O  OG  . SER D 1 66  ? -32.02300 17.81300  26.51700  1.000 88.36323  ? 975  SER D OG  1 
ATOM   3128 N  N   . VAL D 1 67  ? -30.23400 16.38800  28.00300  1.000 96.47736  ? 976  VAL D N   1 
ATOM   3129 C  CA  . VAL D 1 67  ? -30.44700 15.30700  29.00800  1.000 94.56397  ? 976  VAL D CA  1 
ATOM   3130 C  C   . VAL D 1 67  ? -29.12800 15.04100  29.74600  1.000 102.27016 ? 976  VAL D C   1 
ATOM   3131 O  O   . VAL D 1 67  ? -29.18400 14.87500  30.97400  1.000 106.11009 ? 976  VAL D O   1 
ATOM   3132 C  CB  . VAL D 1 67  ? -31.00800 14.03100  28.35400  1.000 88.30006  ? 976  VAL D CB  1 
ATOM   3133 C  CG1 . VAL D 1 67  ? -31.11700 12.88800  29.34900  1.000 98.09334  ? 976  VAL D CG1 1 
ATOM   3134 C  CG2 . VAL D 1 67  ? -32.35600 14.27600  27.69700  1.000 86.50511  ? 976  VAL D CG2 1 
ATOM   3135 N  N   . LEU D 1 68  ? -27.99000 15.00900  29.04000  1.000 100.78050 ? 977  LEU D N   1 
ATOM   3136 C  CA  . LEU D 1 68  ? -26.64500 14.79700  29.64800  1.000 98.73289  ? 977  LEU D CA  1 
ATOM   3137 C  C   . LEU D 1 68  ? -26.33700 15.89900  30.67400  1.000 105.68636 ? 977  LEU D C   1 
ATOM   3138 O  O   . LEU D 1 68  ? -25.96800 15.55800  31.81900  1.000 104.97048 ? 977  LEU D O   1 
ATOM   3139 C  CB  . LEU D 1 68  ? -25.58000 14.77800  28.54700  1.000 93.36646  ? 977  LEU D CB  1 
ATOM   3140 C  CG  . LEU D 1 68  ? -25.41500 13.45900  27.79400  1.000 78.66996  ? 977  LEU D CG  1 
ATOM   3141 C  CD1 . LEU D 1 68  ? -24.34100 13.60300  26.72900  1.000 72.71925  ? 977  LEU D CD1 1 
ATOM   3142 C  CD2 . LEU D 1 68  ? -25.07700 12.30900  28.73600  1.000 75.20639  ? 977  LEU D CD2 1 
ATOM   3143 N  N   . ASN D 1 69  ? -26.46900 17.16700  30.27700  1.000 111.37388 ? 978  ASN D N   1 
ATOM   3144 C  CA  . ASN D 1 69  ? -26.23000 18.34500  31.15400  1.000 118.38788 ? 978  ASN D CA  1 
ATOM   3145 C  C   . ASN D 1 69  ? -27.11100 18.21600  32.40900  1.000 115.11117 ? 978  ASN D C   1 
ATOM   3146 O  O   . ASN D 1 69  ? -26.58000 18.43600  33.51500  1.000 124.80444 ? 978  ASN D O   1 
ATOM   3147 C  CB  . ASN D 1 69  ? -26.45000 19.67000  30.40500  1.000 122.40152 ? 978  ASN D CB  1 
ATOM   3148 C  CG  . ASN D 1 69  ? -25.28500 20.09500  29.52400  1.000 116.18498 ? 978  ASN D CG  1 
ATOM   3149 O  OD1 . ASN D 1 69  ? -24.12200 19.82500  29.83000  1.000 115.81652 ? 978  ASN D OD1 1 
ATOM   3150 N  ND2 . ASN D 1 69  ? -25.57900 20.79900  28.44100  1.000 110.59484 ? 978  ASN D ND2 1 
ATOM   3151 N  N   . ASP D 1 70  ? -28.39200 17.85300  32.24700  1.000 113.91103 ? 979  ASP D N   1 
ATOM   3152 C  CA  . ASP D 1 70  ? -29.37300 17.71500  33.35700  1.000 118.43262 ? 979  ASP D CA  1 
ATOM   3153 C  C   . ASP D 1 70  ? -28.93800 16.58600  34.29700  1.000 114.16632 ? 979  ASP D C   1 
ATOM   3154 O  O   . ASP D 1 70  ? -29.20800 16.70600  35.50700  1.000 112.11607 ? 979  ASP D O   1 
ATOM   3155 C  CB  . ASP D 1 70  ? -30.79200 17.43000  32.85400  1.000 122.43047 ? 979  ASP D CB  1 
ATOM   3156 C  CG  . ASP D 1 70  ? -31.47900 18.59100  32.15200  1.000 123.55692 ? 979  ASP D CG  1 
ATOM   3157 O  OD1 . ASP D 1 70  ? -30.90700 19.70300  32.14700  1.000 126.34410 ? 979  ASP D OD1 1 
ATOM   3158 O  OD2 . ASP D 1 70  ? -32.59000 18.36900  31.61200  1.000 120.15914 ? 979  ASP D OD2 1 
ATOM   3159 N  N   . ILE D 1 71  ? -28.33400 15.52100  33.75700  1.000 106.53646 ? 980  ILE D N   1 
ATOM   3160 C  CA  . ILE D 1 71  ? -27.86900 14.33900  34.54400  1.000 107.98663 ? 980  ILE D CA  1 
ATOM   3161 C  C   . ILE D 1 71  ? -26.62500 14.74700  35.34400  1.000 115.67440 ? 980  ILE D C   1 
ATOM   3162 O  O   . ILE D 1 71  ? -26.55000 14.37300  36.52800  1.000 112.84248 ? 980  ILE D O   1 
ATOM   3163 C  CB  . ILE D 1 71  ? -27.63600 13.11000  33.63700  1.000 106.44961 ? 980  ILE D CB  1 
ATOM   3164 C  CG1 . ILE D 1 71  ? -28.96600 12.48100  33.20900  1.000 115.35067 ? 980  ILE D CG1 1 
ATOM   3165 C  CG2 . ILE D 1 71  ? -26.72800 12.08600  34.30500  1.000 98.37232  ? 980  ILE D CG2 1 
ATOM   3166 C  CD1 . ILE D 1 71  ? -28.85600 11.51200  32.04600  1.000 117.86150 ? 980  ILE D CD1 1 
ATOM   3167 N  N   . LEU D 1 72  ? -25.71000 15.51700  34.74400  1.000 125.39135 ? 981  LEU D N   1 
ATOM   3168 C  CA  . LEU D 1 72  ? -24.44400 15.97900  35.39100  1.000 117.16668 ? 981  LEU D CA  1 
ATOM   3169 C  C   . LEU D 1 72  ? -24.72500 16.94500  36.55200  1.000 115.35594 ? 981  LEU D C   1 
ATOM   3170 O  O   . LEU D 1 72  ? -23.95600 16.90700  37.53400  1.000 119.99860 ? 981  LEU D O   1 
ATOM   3171 C  CB  . LEU D 1 72  ? -23.55600 16.65400  34.34400  1.000 108.73146 ? 981  LEU D CB  1 
ATOM   3172 C  CG  . LEU D 1 72  ? -22.91000 15.70900  33.33600  1.000 105.05996 ? 981  LEU D CG  1 
ATOM   3173 C  CD1 . LEU D 1 72  ? -22.14700 16.49600  32.28100  1.000 105.61266 ? 981  LEU D CD1 1 
ATOM   3174 C  CD2 . LEU D 1 72  ? -21.99800 14.70600  34.03200  1.000 104.36251 ? 981  LEU D CD2 1 
ATOM   3175 N  N   . SER D 1 73  ? -25.75100 17.79800  36.42300  1.000 117.58778 ? 982  SER D N   1 
ATOM   3176 C  CA  . SER D 1 73  ? -26.21300 18.75700  37.46400  1.000 123.71220 ? 982  SER D CA  1 
ATOM   3177 C  C   . SER D 1 73  ? -26.89200 18.00300  38.61600  1.000 121.78302 ? 982  SER D C   1 
ATOM   3178 O  O   . SER D 1 73  ? -26.62600 18.36500  39.77900  1.000 118.99321 ? 982  SER D O   1 
ATOM   3179 C  CB  . SER D 1 73  ? -27.12100 19.82500  36.88400  1.000 126.87047 ? 982  SER D CB  1 
ATOM   3180 O  OG  . SER D 1 73  ? -28.37200 19.29000  36.47800  1.000 127.04681 ? 982  SER D OG  1 
ATOM   3181 N  N   . ARG D 1 74  ? -27.74100 17.01300  38.29800  1.000 120.77501 ? 983  ARG D N   1 
ATOM   3182 C  CA  . ARG D 1 74  ? -28.40700 16.11100  39.27700  1.000 114.59532 ? 983  ARG D CA  1 
ATOM   3183 C  C   . ARG D 1 74  ? -27.32300 15.32200  40.00200  1.000 114.66375 ? 983  ARG D C   1 
ATOM   3184 O  O   . ARG D 1 74  ? -27.35300 15.26500  41.24000  1.000 111.10279 ? 983  ARG D O   1 
ATOM   3185 C  CB  . ARG D 1 74  ? -29.34500 15.10800  38.59800  1.000 107.13653 ? 983  ARG D CB  1 
ATOM   3186 C  CG  . ARG D 1 74  ? -30.71500 15.65700  38.23100  1.000 110.56852 ? 983  ARG D CG  1 
ATOM   3187 C  CD  . ARG D 1 74  ? -31.54100 14.60300  37.51500  1.000 118.54842 ? 983  ARG D CD  1 
ATOM   3188 N  NE  . ARG D 1 74  ? -32.59000 15.16700  36.67300  1.000 122.88315 ? 983  ARG D NE  1 
ATOM   3189 C  CZ  . ARG D 1 74  ? -32.58300 15.21300  35.33700  1.000 111.71076 ? 983  ARG D CZ  1 
ATOM   3190 N  NH1 . ARG D 1 74  ? -31.57200 14.72100  34.63800  1.000 98.90396  ? 983  ARG D NH1 1 
ATOM   3191 N  NH2 . ARG D 1 74  ? -33.60500 15.75800  34.69800  1.000 109.55524 ? 983  ARG D NH2 1 
ATOM   3192 N  N   . LEU D 1 75  ? -26.38700 14.77100  39.23100  1.000 115.52701 ? 984  LEU D N   1 
ATOM   3193 C  CA  . LEU D 1 75  ? -25.32300 13.86000  39.71400  1.000 113.71363 ? 984  LEU D CA  1 
ATOM   3194 C  C   . LEU D 1 75  ? -24.18300 14.66500  40.35700  1.000 125.70191 ? 984  LEU D C   1 
ATOM   3195 O  O   . LEU D 1 75  ? -23.12100 14.07500  40.61300  1.000 126.64413 ? 984  LEU D O   1 
ATOM   3196 C  CB  . LEU D 1 75  ? -24.85100 13.02900  38.52000  1.000 103.48609 ? 984  LEU D CB  1 
ATOM   3197 C  CG  . LEU D 1 75  ? -23.82700 11.94800  38.83600  1.000 105.43106 ? 984  LEU D CG  1 
ATOM   3198 C  CD1 . LEU D 1 75  ? -24.15800 10.63700  38.14200  1.000 92.44266  ? 984  LEU D CD1 1 
ATOM   3199 C  CD2 . LEU D 1 75  ? -22.45100 12.43100  38.44200  1.000 111.24755 ? 984  LEU D CD2 1 
ATOM   3200 N  N   . ASP D 1 76  ? -24.40000 15.95700  40.63000  1.000 123.50691 ? 985  ASP D N   1 
ATOM   3201 C  CA  . ASP D 1 76  ? -23.56000 16.77500  41.55000  1.000 126.02300 ? 985  ASP D CA  1 
ATOM   3202 C  C   . ASP D 1 76  ? -24.26700 16.83100  42.92000  1.000 125.45452 ? 985  ASP D C   1 
ATOM   3203 O  O   . ASP D 1 76  ? -24.08200 17.83000  43.66000  1.000 138.29026 ? 985  ASP D O   1 
ATOM   3204 C  CB  . ASP D 1 76  ? -23.23000 18.12500  40.90300  1.000 125.16764 ? 985  ASP D CB  1 
ATOM   3205 C  CG  . ASP D 1 76  ? -22.11800 18.04200  39.86700  1.000 120.27758 ? 985  ASP D CG  1 
ATOM   3206 O  OD1 . ASP D 1 76  ? -21.65900 16.91200  39.58600  1.000 119.33273 ? 985  ASP D OD1 1 
ATOM   3207 O  OD2 . ASP D 1 76  ? -21.71900 19.10700  39.34800  1.000 119.43011 ? 985  ASP D OD2 1 
ATOM   3208 N  N   . LYS D 1 77  ? -25.01600 15.76200  43.24100  1.000 120.73816 ? 986  LYS D N   1 
ATOM   3209 C  CA  . LYS D 1 77  ? -25.77500 15.51700  44.50000  1.000 117.10878 ? 986  LYS D CA  1 
ATOM   3210 C  C   . LYS D 1 77  ? -26.24200 16.85300  45.08800  1.000 121.45404 ? 986  LYS D C   1 
ATOM   3211 O  O   . LYS D 1 77  ? -27.22300 17.38300  44.53200  1.000 121.58037 ? 986  LYS D O   1 
ATOM   3212 C  CB  . LYS D 1 77  ? -24.93600 14.69900  45.48800  1.000 112.70562 ? 986  LYS D CB  1 
ATOM   3213 C  CG  . LYS D 1 77  ? -24.17000 13.52400  44.88300  1.000 111.15280 ? 986  LYS D CG  1 
ATOM   3214 C  CD  . LYS D 1 77  ? -22.66000 13.77200  44.74200  1.000 113.92419 ? 986  LYS D CD  1 
ATOM   3215 C  CE  . LYS D 1 77  ? -22.04400 13.37000  43.41500  1.000 105.80216 ? 986  LYS D CE  1 
ATOM   3216 N  NZ  . LYS D 1 77  ? -21.25100 12.11900  43.50400  1.000 93.34277  ? 986  LYS D NZ  1 
ATOM   3217 N  N   . ASP D 1 87  ? -18.60100 20.20600  30.42800  1.000 109.22889 ? 1163 ASP D N   1 
ATOM   3218 C  CA  . ASP D 1 87  ? -20.03700 20.51000  30.16500  1.000 113.33727 ? 1163 ASP D CA  1 
ATOM   3219 C  C   . ASP D 1 87  ? -20.54700 19.55000  29.07800  1.000 111.45020 ? 1163 ASP D C   1 
ATOM   3220 O  O   . ASP D 1 87  ? -20.53000 18.32700  29.32100  1.000 106.78912 ? 1163 ASP D O   1 
ATOM   3221 C  CB  . ASP D 1 87  ? -20.25900 22.00500  29.85700  1.000 116.71926 ? 1163 ASP D CB  1 
ATOM   3222 C  CG  . ASP D 1 87  ? -19.49100 22.59200  28.66700  1.000 115.71387 ? 1163 ASP D CG  1 
ATOM   3223 O  OD1 . ASP D 1 87  ? -18.37800 22.10400  28.36800  1.000 117.07720 ? 1163 ASP D OD1 1 
ATOM   3224 O  OD2 . ASP D 1 87  ? -20.01000 23.54800  28.03800  1.000 111.87394 ? 1163 ASP D OD2 1 
ATOM   3225 N  N   . VAL D 1 88  ? -21.00000 20.09100  27.94300  1.000 111.08174 ? 1164 VAL D N   1 
ATOM   3226 C  CA  . VAL D 1 88  ? -21.37000 19.34600  26.70800  1.000 106.48382 ? 1164 VAL D CA  1 
ATOM   3227 C  C   . VAL D 1 88  ? -20.43800 19.80600  25.58700  1.000 112.01343 ? 1164 VAL D C   1 
ATOM   3228 O  O   . VAL D 1 88  ? -20.47200 21.00600  25.25500  1.000 112.97934 ? 1164 VAL D O   1 
ATOM   3229 C  CB  . VAL D 1 88  ? -22.85600 19.57600  26.37800  1.000 107.71028 ? 1164 VAL D CB  1 
ATOM   3230 C  CG1 . VAL D 1 88  ? -23.16600 19.51700  24.88700  1.000 108.33667 ? 1164 VAL D CG1 1 
ATOM   3231 C  CG2 . VAL D 1 88  ? -23.71500 18.59000  27.14400  1.000 107.05757 ? 1164 VAL D CG2 1 
ATOM   3232 N  N   . ASP D 1 89  ? -19.62500 18.88200  25.06200  1.000 115.83494 ? 1165 ASP D N   1 
ATOM   3233 C  CA  . ASP D 1 89  ? -18.66300 19.11100  23.95000  1.000 120.25652 ? 1165 ASP D CA  1 
ATOM   3234 C  C   . ASP D 1 89  ? -19.19100 18.35100  22.72200  1.000 109.80790 ? 1165 ASP D C   1 
ATOM   3235 O  O   . ASP D 1 89  ? -18.48300 17.42900  22.25900  1.000 106.44697 ? 1165 ASP D O   1 
ATOM   3236 C  CB  . ASP D 1 89  ? -17.23200 18.69900  24.35200  1.000 129.61817 ? 1165 ASP D CB  1 
ATOM   3237 C  CG  . ASP D 1 89  ? -16.39400 19.74500  25.10000  1.000 132.97647 ? 1165 ASP D CG  1 
ATOM   3238 O  OD1 . ASP D 1 89  ? -16.70800 20.04100  26.28100  1.000 134.89775 ? 1165 ASP D OD1 1 
ATOM   3239 O  OD2 . ASP D 1 89  ? -15.40400 20.24900  24.50800  1.000 128.70227 ? 1165 ASP D OD2 1 
ATOM   3240 N  N   . LEU D 1 90  ? -20.40800 18.68200  22.25800  1.000 93.84283  ? 1166 LEU D N   1 
ATOM   3241 C  CA  . LEU D 1 90  ? -21.01300 18.10500  21.02200  1.000 91.94260  ? 1166 LEU D CA  1 
ATOM   3242 C  C   . LEU D 1 90  ? -20.87500 19.10800  19.87700  1.000 96.03257  ? 1166 LEU D C   1 
ATOM   3243 O  O   . LEU D 1 90  ? -21.40000 20.23200  20.01400  1.000 101.34110 ? 1166 LEU D O   1 
ATOM   3244 C  CB  . LEU D 1 90  ? -22.48600 17.73800  21.24200  1.000 95.09298  ? 1166 LEU D CB  1 
ATOM   3245 C  CG  . LEU D 1 90  ? -22.75500 16.41800  21.97100  1.000 94.92980  ? 1166 LEU D CG  1 
ATOM   3246 C  CD1 . LEU D 1 90  ? -24.18600 15.95100  21.72800  1.000 96.93004  ? 1166 LEU D CD1 1 
ATOM   3247 C  CD2 . LEU D 1 90  ? -21.77300 15.32700  21.55900  1.000 89.33176  ? 1166 LEU D CD2 1 
ATOM   3248 N  N   . GLY D 1 91  ? -20.20500 18.68800  18.79700  1.000 95.94835  ? 1167 GLY D N   1 
ATOM   3249 C  CA  . GLY D 1 91  ? -19.96900 19.48000  17.57500  1.000 101.56218 ? 1167 GLY D CA  1 
ATOM   3250 C  C   . GLY D 1 91  ? -21.25100 19.71100  16.79600  1.000 110.40008 ? 1167 GLY D C   1 
ATOM   3251 O  O   . GLY D 1 91  ? -22.10300 18.80100  16.77400  1.000 112.83195 ? 1167 GLY D O   1 
ATOM   3252 N  N   . ASP D 1 92  ? -21.37700 20.89200  16.18300  1.000 110.45535 ? 1168 ASP D N   1 
ATOM   3253 C  CA  . ASP D 1 92  ? -22.54700 21.31400  15.36700  1.000 112.91880 ? 1168 ASP D CA  1 
ATOM   3254 C  C   . ASP D 1 92  ? -22.36700 20.73900  13.95900  1.000 105.55213 ? 1168 ASP D C   1 
ATOM   3255 O  O   . ASP D 1 92  ? -21.23700 20.81300  13.42900  1.000 94.83505  ? 1168 ASP D O   1 
ATOM   3256 C  CB  . ASP D 1 92  ? -22.68800 22.84200  15.37300  1.000 117.14036 ? 1168 ASP D CB  1 
ATOM   3257 C  CG  . ASP D 1 92  ? -23.93800 23.38900  14.70100  1.000 121.63037 ? 1168 ASP D CG  1 
ATOM   3258 O  OD1 . ASP D 1 92  ? -24.71100 22.57800  14.14400  1.000 125.88878 ? 1168 ASP D OD1 1 
ATOM   3259 O  OD2 . ASP D 1 92  ? -24.12700 24.63100  14.74100  1.000 119.09849 ? 1168 ASP D OD2 1 
ATOM   3260 N  N   . ILE D 1 93  ? -23.43200 20.15900  13.39700  1.000 106.48382 ? 1169 ILE D N   1 
ATOM   3261 C  CA  . ILE D 1 93  ? -23.41200 19.48900  12.06100  1.000 87.94212  ? 1169 ILE D CA  1 
ATOM   3262 C  C   . ILE D 1 93  ? -24.47600 20.10900  11.14800  1.000 86.98675  ? 1169 ILE D C   1 
ATOM   3263 O  O   . ILE D 1 93  ? -24.43900 19.79800  9.94900   1.000 99.95146  ? 1169 ILE D O   1 
ATOM   3264 C  CB  . ILE D 1 93  ? -23.55600 17.95100  12.17700  1.000 92.77955  ? 1169 ILE D CB  1 
ATOM   3265 C  CG1 . ILE D 1 93  ? -24.73300 17.50100  13.05000  1.000 90.29767  ? 1169 ILE D CG1 1 
ATOM   3266 C  CG2 . ILE D 1 93  ? -22.24800 17.32400  12.64400  1.000 93.49016  ? 1169 ILE D CG2 1 
ATOM   3267 C  CD1 . ILE D 1 93  ? -26.01100 17.28200  12.28800  1.000 93.79282  ? 1169 ILE D CD1 1 
ATOM   3268 N  N   . SER D 1 94  ? -25.34900 20.98700  11.66200  1.000 92.26896  ? 1170 SER D N   1 
ATOM   3269 C  CA  . SER D 1 94  ? -26.46800 21.60200  10.89000  1.000 93.31382  ? 1170 SER D CA  1 
ATOM   3270 C  C   . SER D 1 94  ? -25.90800 22.34900  9.67000   1.000 95.07193  ? 1170 SER D C   1 
ATOM   3271 O  O   . SER D 1 94  ? -26.65200 22.49600  8.68000   1.000 99.73038  ? 1170 SER D O   1 
ATOM   3272 C  CB  . SER D 1 94  ? -27.32900 22.50100  11.75300  1.000 99.02503  ? 1170 SER D CB  1 
ATOM   3273 O  OG  . SER D 1 94  ? -26.58100 23.59100  12.26500  1.000 100.24623 ? 1170 SER D OG  1 
ATOM   3274 N  N   . GLY D 1 95  ? -24.63800 22.76800  9.74700   1.000 100.43046 ? 1171 GLY D N   1 
ATOM   3275 C  CA  . GLY D 1 95  ? -23.88000 23.42900  8.66800   1.000 85.67869  ? 1171 GLY D CA  1 
ATOM   3276 C  C   . GLY D 1 95  ? -23.61900 22.50800  7.49100   1.000 91.39517  ? 1171 GLY D C   1 
ATOM   3277 O  O   . GLY D 1 95  ? -23.54300 23.03000  6.37400   1.000 97.00374  ? 1171 GLY D O   1 
ATOM   3278 N  N   . ILE D 1 96  ? -23.47100 21.19700  7.71600   1.000 89.67128  ? 1172 ILE D N   1 
ATOM   3279 C  CA  . ILE D 1 96  ? -23.35000 20.17800  6.62700   1.000 92.75059  ? 1172 ILE D CA  1 
ATOM   3280 C  C   . ILE D 1 96  ? -24.67000 20.14900  5.84300   1.000 99.25927  ? 1172 ILE D C   1 
ATOM   3281 O  O   . ILE D 1 96  ? -25.74900 20.01400  6.47700   1.000 96.69317  ? 1172 ILE D O   1 
ATOM   3282 C  CB  . ILE D 1 96  ? -22.96900 18.78300  7.17400   1.000 91.69784  ? 1172 ILE D CB  1 
ATOM   3283 C  CG1 . ILE D 1 96  ? -21.48600 18.70300  7.56400   1.000 89.96079  ? 1172 ILE D CG1 1 
ATOM   3284 C  CG2 . ILE D 1 96  ? -23.34500 17.69000  6.18100   1.000 90.62139  ? 1172 ILE D CG2 1 
ATOM   3285 C  CD1 . ILE D 1 96  ? -21.21400 18.90500  9.03900   1.000 96.68264  ? 1172 ILE D CD1 1 
ATOM   3286 N  N   . ASN D 1 97  ? -24.58700 20.28300  4.51500   1.000 94.29288  ? 1173 ASN D N   1 
ATOM   3287 C  CA  . ASN D 1 97  ? -25.77000 20.36200  3.61900   1.000 102.74127 ? 1173 ASN D CA  1 
ATOM   3288 C  C   . ASN D 1 97  ? -25.38800 19.87600  2.22300   1.000 95.14299  ? 1173 ASN D C   1 
ATOM   3289 O  O   . ASN D 1 97  ? -24.31500 20.27100  1.73100   1.000 94.23498  ? 1173 ASN D O   1 
ATOM   3290 C  CB  . ASN D 1 97  ? -26.35100 21.77600  3.53400   1.000 108.21034 ? 1173 ASN D CB  1 
ATOM   3291 C  CG  . ASN D 1 97  ? -27.64900 21.82200  2.75700   1.000 107.33655 ? 1173 ASN D CG  1 
ATOM   3292 O  OD1 . ASN D 1 97  ? -27.65000 21.75900  1.52800   1.000 105.36790 ? 1173 ASN D OD1 1 
ATOM   3293 N  ND2 . ASN D 1 97  ? -28.76300 21.91600  3.46500   1.000 103.38871 ? 1173 ASN D ND2 1 
ATOM   3294 N  N   . ALA D 1 98  ? -26.27100 19.07800  1.61900   1.000 92.16105  ? 1174 ALA D N   1 
ATOM   3295 C  CA  . ALA D 1 98  ? -26.12400 18.50200  0.26600   1.000 88.29743  ? 1174 ALA D CA  1 
ATOM   3296 C  C   . ALA D 1 98  ? -26.81400 19.42800  -0.73300  1.000 92.80323  ? 1174 ALA D C   1 
ATOM   3297 O  O   . ALA D 1 98  ? -28.01800 19.68000  -0.54900  1.000 99.45140  ? 1174 ALA D O   1 
ATOM   3298 C  CB  . ALA D 1 98  ? -26.72000 17.11500  0.22800   1.000 86.76830  ? 1174 ALA D CB  1 
ATOM   3299 N  N   . SER D 1 99  ? -26.07400 19.91500  -1.73300  1.000 101.27267 ? 1175 SER D N   1 
ATOM   3300 C  CA  . SER D 1 99  ? -26.62200 20.69800  -2.87100  1.000 103.82297 ? 1175 SER D CA  1 
ATOM   3301 C  C   . SER D 1 99  ? -27.48800 19.77000  -3.72500  1.000 94.41922  ? 1175 SER D C   1 
ATOM   3302 O  O   . SER D 1 99  ? -27.34300 18.54300  -3.58900  1.000 92.97694  ? 1175 SER D O   1 
ATOM   3303 C  CB  . SER D 1 99  ? -25.53700 21.34900  -3.70100  1.000 104.20460 ? 1175 SER D CB  1 
ATOM   3304 O  OG  . SER D 1 99  ? -24.47100 21.80900  -2.88500  1.000 105.84690 ? 1175 SER D OG  1 
ATOM   3305 N  N   . VAL D 1 100 ? -28.36800 20.34600  -4.54500  1.000 98.48286  ? 1176 VAL D N   1 
ATOM   3306 C  CA  . VAL D 1 100 ? -29.09400 19.62600  -5.63100  1.000 96.88004  ? 1176 VAL D CA  1 
ATOM   3307 C  C   . VAL D 1 100 ? -28.57900 20.15300  -6.97100  1.000 97.35115  ? 1176 VAL D C   1 
ATOM   3308 O  O   . VAL D 1 100 ? -27.82200 21.15200  -6.98400  1.000 99.55404  ? 1176 VAL D O   1 
ATOM   3309 C  CB  . VAL D 1 100 ? -30.62200 19.75600  -5.51300  1.000 101.21477 ? 1176 VAL D CB  1 
ATOM   3310 C  CG1 . VAL D 1 100 ? -31.11800 19.15600  -4.20900  1.000 100.42520 ? 1176 VAL D CG1 1 
ATOM   3311 C  CG2 . VAL D 1 100 ? -31.09400 21.19500  -5.67700  1.000 108.29983 ? 1176 VAL D CG2 1 
ATOM   3312 N  N   . VAL D 1 101 ? -28.95700 19.46600  -8.04700  1.000 95.27458  ? 1177 VAL D N   1 
ATOM   3313 C  CA  . VAL D 1 101 ? -28.50900 19.76000  -9.43600  1.000 95.16931  ? 1177 VAL D CA  1 
ATOM   3314 C  C   . VAL D 1 101 ? -29.77100 20.04900  -10.25100 1.000 99.25927  ? 1177 VAL D C   1 
ATOM   3315 O  O   . VAL D 1 101 ? -30.84200 19.48500  -9.90200  1.000 106.64437 ? 1177 VAL D O   1 
ATOM   3316 C  CB  . VAL D 1 101 ? -27.66000 18.60400  -10.01100 1.000 93.97706  ? 1177 VAL D CB  1 
ATOM   3317 C  CG1 . VAL D 1 101 ? -28.46900 17.32700  -10.21600 1.000 93.64017  ? 1177 VAL D CG1 1 
ATOM   3318 C  CG2 . VAL D 1 101 ? -26.94000 19.00100  -11.29300 1.000 90.29240  ? 1177 VAL D CG2 1 
ATOM   3319 N  N   . ASN D 1 102 ? -29.64600 20.94400  -11.23800 1.000 106.03903 ? 1178 ASN D N   1 
ATOM   3320 C  CA  . ASN D 1 102 ? -30.69100 21.27300  -12.24300 1.000 111.10016 ? 1178 ASN D CA  1 
ATOM   3321 C  C   . ASN D 1 102 ? -30.03600 21.21800  -13.62800 1.000 114.85324 ? 1178 ASN D C   1 
ATOM   3322 O  O   . ASN D 1 102 ? -29.16900 22.07000  -13.91400 1.000 115.06380 ? 1178 ASN D O   1 
ATOM   3323 C  CB  . ASN D 1 102 ? -31.36700 22.62200  -11.96900 1.000 113.90576 ? 1178 ASN D CB  1 
ATOM   3324 C  CG  . ASN D 1 102 ? -32.61100 22.84500  -12.80900 1.000 118.87478 ? 1178 ASN D CG  1 
ATOM   3325 O  OD1 . ASN D 1 102 ? -32.97500 22.00900  -13.63500 1.000 119.98017 ? 1178 ASN D OD1 1 
ATOM   3326 N  ND2 . ASN D 1 102 ? -33.27400 23.97400  -12.61500 1.000 127.67057 ? 1178 ASN D ND2 1 
ATOM   3327 N  N   . ILE D 1 103 ? -30.39400 20.20500  -14.41900 1.000 119.22482 ? 1179 ILE D N   1 
ATOM   3328 C  CA  . ILE D 1 103 ? -29.91800 20.01300  -15.82100 1.000 116.83506 ? 1179 ILE D CA  1 
ATOM   3329 C  C   . ILE D 1 103 ? -31.12100 19.71800  -16.72700 1.000 116.41922 ? 1179 ILE D C   1 
ATOM   3330 O  O   . ILE D 1 103 ? -30.88100 19.27500  -17.87300 1.000 111.10279 ? 1179 ILE D O   1 
ATOM   3331 C  CB  . ILE D 1 103 ? -28.86200 18.88800  -15.89000 1.000 105.75479 ? 1179 ILE D CB  1 
ATOM   3332 C  CG1 . ILE D 1 103 ? -29.43200 17.54800  -15.41200 1.000 105.07049 ? 1179 ILE D CG1 1 
ATOM   3333 C  CG2 . ILE D 1 103 ? -27.60600 19.27600  -15.12100 1.000 97.28272  ? 1179 ILE D CG2 1 
ATOM   3334 C  CD1 . ILE D 1 103 ? -28.63400 16.34900  -15.85500 1.000 103.36239 ? 1179 ILE D CD1 1 
ATOM   3335 N  N   . GLN D 1 104 ? -32.35200 19.95700  -16.24300 1.000 122.16202 ? 1180 GLN D N   1 
ATOM   3336 C  CA  . GLN D 1 104 ? -33.61300 19.65600  -16.98100 1.000 121.04872 ? 1180 GLN D CA  1 
ATOM   3337 C  C   . GLN D 1 104 ? -33.63100 20.44500  -18.29900 1.000 130.94991 ? 1180 GLN D C   1 
ATOM   3338 O  O   . GLN D 1 104 ? -34.26300 19.96300  -19.26700 1.000 132.67117 ? 1180 GLN D O   1 
ATOM   3339 C  CB  . GLN D 1 104 ? -34.85100 19.97900  -16.13900 1.000 113.43202 ? 1180 GLN D CB  1 
ATOM   3340 C  CG  . GLN D 1 104 ? -36.14900 19.46700  -16.75200 1.000 115.57438 ? 1180 GLN D CG  1 
ATOM   3341 C  CD  . GLN D 1 104 ? -36.07900 17.99000  -17.04800 1.000 110.06320 ? 1180 GLN D CD  1 
ATOM   3342 O  OE1 . GLN D 1 104 ? -36.13300 17.15600  -16.14600 1.000 111.50284 ? 1180 GLN D OE1 1 
ATOM   3343 N  NE2 . GLN D 1 104 ? -35.94200 17.65800  -18.32200 1.000 109.59472 ? 1180 GLN D NE2 1 
ATOM   3344 N  N   . LYS D 1 105 ? -32.96400 21.60800  -18.32200 1.000 129.48395 ? 1181 LYS D N   1 
ATOM   3345 C  CA  . LYS D 1 105 ? -32.80000 22.48800  -19.51200 1.000 129.70766 ? 1181 LYS D CA  1 
ATOM   3346 C  C   . LYS D 1 105 ? -31.97100 21.77900  -20.59000 1.000 127.41264 ? 1181 LYS D C   1 
ATOM   3347 O  O   . LYS D 1 105 ? -32.33700 21.88300  -21.77800 1.000 121.16190 ? 1181 LYS D O   1 
ATOM   3348 C  CB  . LYS D 1 105 ? -32.11700 23.80200  -19.12100 1.000 131.55525 ? 1181 LYS D CB  1 
ATOM   3349 C  CG  . LYS D 1 105 ? -31.81800 24.74000  -20.28500 1.000 136.37951 ? 1181 LYS D CG  1 
ATOM   3350 C  CD  . LYS D 1 105 ? -31.53500 26.18500  -19.89200 1.000 141.47223 ? 1181 LYS D CD  1 
ATOM   3351 C  CE  . LYS D 1 105 ? -32.69400 26.91200  -19.23100 1.000 141.94070 ? 1181 LYS D CE  1 
ATOM   3352 N  NZ  . LYS D 1 105 ? -33.67300 27.44200  -20.21100 1.000 142.08019 ? 1181 LYS D NZ  1 
ATOM   3353 N  N   . GLU D 1 106 ? -30.88000 21.11900  -20.19100 1.000 129.14970 ? 1182 GLU D N   1 
ATOM   3354 C  CA  . GLU D 1 106 ? -29.97200 20.37200  -21.10200 1.000 121.74354 ? 1182 GLU D CA  1 
ATOM   3355 C  C   . GLU D 1 106 ? -30.64400 19.07700  -21.57400 1.000 114.86904 ? 1182 GLU D C   1 
ATOM   3356 O  O   . GLU D 1 106 ? -30.41100 18.70100  -22.73800 1.000 114.27423 ? 1182 GLU D O   1 
ATOM   3357 C  CB  . GLU D 1 106 ? -28.64000 20.06000  -20.41900 1.000 119.56170 ? 1182 GLU D CB  1 
ATOM   3358 C  CG  . GLU D 1 106 ? -27.69100 21.24500  -20.37400 1.000 118.59580 ? 1182 GLU D CG  1 
ATOM   3359 C  CD  . GLU D 1 106 ? -27.81300 22.12200  -19.14100 1.000 122.95948 ? 1182 GLU D CD  1 
ATOM   3360 O  OE1 . GLU D 1 106 ? -26.76700 22.61700  -18.66400 1.000 112.77405 ? 1182 GLU D OE1 1 
ATOM   3361 O  OE2 . GLU D 1 106 ? -28.95000 22.31100  -18.65900 1.000 134.50560 ? 1182 GLU D OE2 1 
ATOM   3362 N  N   . ILE D 1 107 ? -31.42800 18.42100  -20.71200 1.000 112.14239 ? 1183 ILE D N   1 
ATOM   3363 C  CA  . ILE D 1 107 ? -32.16200 17.16400  -21.04800 1.000 105.68899 ? 1183 ILE D CA  1 
ATOM   3364 C  C   . ILE D 1 107 ? -33.21400 17.47500  -22.11400 1.000 115.44016 ? 1183 ILE D C   1 
ATOM   3365 O  O   . ILE D 1 107 ? -33.38300 16.64800  -23.02700 1.000 121.72775 ? 1183 ILE D O   1 
ATOM   3366 C  CB  . ILE D 1 107 ? -32.81000 16.52900  -19.80300 1.000 115.87705 ? 1183 ILE D CB  1 
ATOM   3367 C  CG1 . ILE D 1 107 ? -31.75700 16.14100  -18.76000 1.000 120.18546 ? 1183 ILE D CG1 1 
ATOM   3368 C  CG2 . ILE D 1 107 ? -33.68500 15.34200  -20.20100 1.000 114.45846 ? 1183 ILE D CG2 1 
ATOM   3369 C  CD1 . ILE D 1 107 ? -32.32900 15.70900  -17.42900 1.000 119.85648 ? 1183 ILE D CD1 1 
ATOM   3370 N  N   . ASP D 1 108 ? -33.92200 18.59900  -21.96200 1.000 116.90612 ? 1184 ASP D N   1 
ATOM   3371 C  CA  . ASP D 1 108 ? -34.96700 19.06500  -22.91300 1.000 121.68038 ? 1184 ASP D CA  1 
ATOM   3372 C  C   . ASP D 1 108 ? -34.30300 19.45100  -24.23900 1.000 131.14204 ? 1184 ASP D C   1 
ATOM   3373 O  O   . ASP D 1 108 ? -34.90900 19.17300  -25.29700 1.000 138.12972 ? 1184 ASP D O   1 
ATOM   3374 C  CB  . ASP D 1 108 ? -35.79000 20.22100  -22.33400 1.000 125.27555 ? 1184 ASP D CB  1 
ATOM   3375 C  CG  . ASP D 1 108 ? -36.96300 19.77200  -21.47800 1.000 132.56589 ? 1184 ASP D CG  1 
ATOM   3376 O  OD1 . ASP D 1 108 ? -37.05100 18.56000  -21.19000 1.000 130.20772 ? 1184 ASP D OD1 1 
ATOM   3377 O  OD2 . ASP D 1 108 ? -37.78800 20.63600  -21.11300 1.000 138.01392 ? 1184 ASP D OD2 1 
ATOM   3378 N  N   . ARG D 1 109 ? -33.11900 20.05300  -24.18700 1.000 129.95769 ? 1185 ARG D N   1 
ATOM   3379 C  CA  . ARG D 1 109 ? -32.39200 20.42700  -25.39300 1.000 121.69617 ? 1185 ARG D CA  1 
ATOM   3380 C  C   . ARG D 1 109 ? -32.01600 19.18700  -26.19400 1.000 119.94070 ? 1185 ARG D C   1 
ATOM   3381 O  O   . ARG D 1 109 ? -32.26600 19.11600  -27.39700 1.000 121.15137 ? 1185 ARG D O   1 
ATOM   3382 C  CB  . ARG D 1 109 ? -31.13700 21.22600  -25.03700 1.000 120.85396 ? 1185 ARG D CB  1 
ATOM   3383 C  CG  . ARG D 1 109 ? -31.41100 22.66600  -24.63600 1.000 132.60274 ? 1185 ARG D CG  1 
ATOM   3384 C  CD  . ARG D 1 109 ? -31.40800 23.58700  -25.84600 1.000 147.88878 ? 1185 ARG D CD  1 
ATOM   3385 N  NE  . ARG D 1 109 ? -32.56300 24.47900  -25.85800 1.000 158.38215 ? 1185 ARG D NE  1 
ATOM   3386 C  CZ  . ARG D 1 109 ? -33.82200 24.07300  -25.72500 1.000 153.82371 ? 1185 ARG D CZ  1 
ATOM   3387 N  NH1 . ARG D 1 109 ? -34.09200 22.78400  -25.57000 1.000 147.44926 ? 1185 ARG D NH1 1 
ATOM   3388 N  NH2 . ARG D 1 109 ? -34.81100 24.95600  -25.74800 1.000 153.06046 ? 1185 ARG D NH2 1 
ATOM   3389 N  N   . LEU D 1 110 ? -31.41600 18.21000  -25.52100 1.000 114.09263 ? 1186 LEU D N   1 
ATOM   3390 C  CA  . LEU D 1 110 ? -31.03000 16.93500  -26.18900 1.000 113.69521 ? 1186 LEU D CA  1 
ATOM   3391 C  C   . LEU D 1 110 ? -32.24500 16.36700  -26.93500 1.000 112.16082 ? 1186 LEU D C   1 
ATOM   3392 O  O   . LEU D 1 110 ? -32.13100 16.14000  -28.15700 1.000 114.21896 ? 1186 LEU D O   1 
ATOM   3393 C  CB  . LEU D 1 110 ? -30.49600 15.92300  -25.16700 1.000 114.15579 ? 1186 LEU D CB  1 
ATOM   3394 C  CG  . LEU D 1 110 ? -29.06800 16.14000  -24.66100 1.000 110.02109 ? 1186 LEU D CG  1 
ATOM   3395 C  CD1 . LEU D 1 110 ? -28.58500 14.91800  -23.89200 1.000 106.16010 ? 1186 LEU D CD1 1 
ATOM   3396 C  CD2 . LEU D 1 110 ? -28.10500 16.45200  -25.79400 1.000 103.44661 ? 1186 LEU D CD2 1 
ATOM   3397 N  N   . ASN D 1 111 ? -33.36100 16.15300  -26.23200 1.000 114.89535 ? 1187 ASN D N   1 
ATOM   3398 C  CA  . ASN D 1 111 ? -34.60800 15.59600  -26.81800 1.000 115.04537 ? 1187 ASN D CA  1 
ATOM   3399 C  C   . ASN D 1 111 ? -35.08500 16.51000  -27.95400 1.000 128.14431 ? 1187 ASN D C   1 
ATOM   3400 O  O   . ASN D 1 111 ? -35.64500 15.96100  -28.93600 1.000 132.36061 ? 1187 ASN D O   1 
ATOM   3401 C  CB  . ASN D 1 111 ? -35.68400 15.37700  -25.75300 1.000 113.82944 ? 1187 ASN D CB  1 
ATOM   3402 C  CG  . ASN D 1 111 ? -35.44000 14.12000  -24.94700 1.000 116.83506 ? 1187 ASN D CG  1 
ATOM   3403 O  OD1 . ASN D 1 111 ? -35.34200 13.02800  -25.50800 1.000 118.37472 ? 1187 ASN D OD1 1 
ATOM   3404 N  ND2 . ASN D 1 111 ? -35.33900 14.26100  -23.63500 1.000 105.96270 ? 1187 ASN D ND2 1 
ATOM   3405 N  N   . GLU D 1 112 ? -34.85900 17.82900  -27.83300 1.000 124.63863 ? 1188 GLU D N   1 
ATOM   3406 C  CA  . GLU D 1 112 ? -35.24900 18.84600  -28.85100 1.000 130.69199 ? 1188 GLU D CA  1 
ATOM   3407 C  C   . GLU D 1 112 ? -34.42900 18.63000  -30.13100 1.000 135.10567 ? 1188 GLU D C   1 
ATOM   3408 O  O   . GLU D 1 112 ? -35.03300 18.57500  -31.22600 1.000 132.79750 ? 1188 GLU D O   1 
ATOM   3409 C  CB  . GLU D 1 112 ? -35.08000 20.27000  -28.31200 1.000 131.24995 ? 1188 GLU D CB  1 
ATOM   3410 C  CG  . GLU D 1 112 ? -35.63400 21.32700  -29.25700 1.000 144.95685 ? 1188 GLU D CG  1 
ATOM   3411 C  CD  . GLU D 1 112 ? -36.18700 22.58500  -28.60900 1.000 148.71520 ? 1188 GLU D CD  1 
ATOM   3412 O  OE1 . GLU D 1 112 ? -36.57600 23.50600  -29.35800 1.000 147.13869 ? 1188 GLU D OE1 1 
ATOM   3413 O  OE2 . GLU D 1 112 ? -36.23600 22.63700  -27.36200 1.000 150.17327 ? 1188 GLU D OE2 1 
ATOM   3414 N  N   . VAL D 1 113 ? -33.10700 18.49700  -30.00000 1.000 119.50907 ? 1189 VAL D N   1 
ATOM   3415 C  CA  . VAL D 1 113 ? -32.17400 18.26200  -31.14300 1.000 117.15615 ? 1189 VAL D CA  1 
ATOM   3416 C  C   . VAL D 1 113 ? -32.48800 16.89000  -31.77000 1.000 114.73481 ? 1189 VAL D C   1 
ATOM   3417 O  O   . VAL D 1 113 ? -32.46700 16.80200  -33.01700 1.000 115.88232 ? 1189 VAL D O   1 
ATOM   3418 C  CB  . VAL D 1 113 ? -30.69600 18.38200  -30.71300 1.000 112.71878 ? 1189 VAL D CB  1 
ATOM   3419 C  CG1 . VAL D 1 113 ? -29.75100 18.03100  -31.84700 1.000 110.12636 ? 1189 VAL D CG1 1 
ATOM   3420 C  CG2 . VAL D 1 113 ? -30.35900 19.76600  -30.17100 1.000 115.43752 ? 1189 VAL D CG2 1 
ATOM   3421 N  N   . ALA D 1 114 ? -32.78300 15.86800  -30.95300 1.000 125.82035 ? 1190 ALA D N   1 
ATOM   3422 C  CA  . ALA D 1 114 ? -33.06400 14.47800  -31.39900 1.000 125.99142 ? 1190 ALA D CA  1 
ATOM   3423 C  C   . ALA D 1 114 ? -34.27500 14.46500  -32.33800 1.000 128.47330 ? 1190 ALA D C   1 
ATOM   3424 O  O   . ALA D 1 114 ? -34.23600 13.71500  -33.33700 1.000 123.10160 ? 1190 ALA D O   1 
ATOM   3425 C  CB  . ALA D 1 114 ? -33.29000 13.56500  -30.21600 1.000 125.33871 ? 1190 ALA D CB  1 
ATOM   3426 N  N   . LYS D 1 115 ? -35.30900 15.25300  -32.01000 1.000 136.90589 ? 1191 LYS D N   1 
ATOM   3427 C  CA  . LYS D 1 115 ? -36.54900 15.40400  -32.82000 1.000 132.91067 ? 1191 LYS D CA  1 
ATOM   3428 C  C   . LYS D 1 115 ? -36.26400 16.31200  -34.02200 1.000 128.70227 ? 1191 LYS D C   1 
ATOM   3429 O  O   . LYS D 1 115 ? -36.73300 15.98100  -35.12500 1.000 132.19217 ? 1191 LYS D O   1 
ATOM   3430 C  CB  . LYS D 1 115 ? -37.70100 15.96100  -31.97600 1.000 137.44543 ? 1191 LYS D CB  1 
ATOM   3431 C  CG  . LYS D 1 115 ? -39.02300 16.09400  -32.72600 1.000 142.63026 ? 1191 LYS D CG  1 
ATOM   3432 C  CD  . LYS D 1 115 ? -40.23000 15.48500  -32.03200 1.000 138.06129 ? 1191 LYS D CD  1 
ATOM   3433 C  CE  . LYS D 1 115 ? -41.21900 14.90500  -33.02600 1.000 140.15628 ? 1191 LYS D CE  1 
ATOM   3434 N  NZ  . LYS D 1 115 ? -42.47600 14.45400  -32.38500 1.000 142.19336 ? 1191 LYS D NZ  1 
ATOM   3435 N  N   . ASN D 1 116 ? -35.52800 17.40800  -33.81100 1.000 126.93101 ? 1192 ASN D N   1 
ATOM   3436 C  CA  . ASN D 1 116 ? -35.18200 18.40700  -34.86100 1.000 133.77657 ? 1192 ASN D CA  1 
ATOM   3437 C  C   . ASN D 1 116 ? -34.41700 17.74700  -36.01400 1.000 133.23966 ? 1192 ASN D C   1 
ATOM   3438 O  O   . ASN D 1 116 ? -34.56100 18.23700  -37.15000 1.000 138.25079 ? 1192 ASN D O   1 
ATOM   3439 C  CB  . ASN D 1 116 ? -34.32500 19.56000  -34.32700 1.000 133.47916 ? 1192 ASN D CB  1 
ATOM   3440 C  CG  . ASN D 1 116 ? -35.10000 20.58000  -33.52400 1.000 136.89799 ? 1192 ASN D CG  1 
ATOM   3441 O  OD1 . ASN D 1 116 ? -36.30000 20.43500  -33.31100 1.000 146.52809 ? 1192 ASN D OD1 1 
ATOM   3442 N  ND2 . ASN D 1 116 ? -34.41800 21.62400  -33.07900 1.000 135.26622 ? 1192 ASN D ND2 1 
ATOM   3443 N  N   . LEU D 1 117 ? -33.61800 16.70700  -35.74100 1.000 127.53108 ? 1193 LEU D N   1 
ATOM   3444 C  CA  . LEU D 1 117 ? -32.73000 16.07500  -36.75600 1.000 126.22829 ? 1193 LEU D CA  1 
ATOM   3445 C  C   . LEU D 1 117 ? -33.56800 15.38600  -37.84500 1.000 132.63959 ? 1193 LEU D C   1 
ATOM   3446 O  O   . LEU D 1 117 ? -33.01100 15.17100  -38.93700 1.000 136.24791 ? 1193 LEU D O   1 
ATOM   3447 C  CB  . LEU D 1 117 ? -31.75200 15.10300  -36.08400 1.000 119.88279 ? 1193 LEU D CB  1 
ATOM   3448 C  CG  . LEU D 1 117 ? -30.44500 15.72200  -35.58500 1.000 114.74797 ? 1193 LEU D CG  1 
ATOM   3449 C  CD1 . LEU D 1 117 ? -29.60200 14.69800  -34.84500 1.000 111.73182 ? 1193 LEU D CD1 1 
ATOM   3450 C  CD2 . LEU D 1 117 ? -29.63500 16.31100  -36.72600 1.000 116.45080 ? 1193 LEU D CD2 1 
ATOM   3451 N  N   . ASN D 1 118 ? -34.85000 15.08400  -37.58400 1.000 138.13235 ? 1194 ASN D N   1 
ATOM   3452 C  CA  . ASN D 1 118 ? -35.80600 14.53600  -38.59100 1.000 134.12134 ? 1194 ASN D CA  1 
ATOM   3453 C  C   . ASN D 1 118 ? -35.90900 15.49100  -39.78800 1.000 135.59784 ? 1194 ASN D C   1 
ATOM   3454 O  O   . ASN D 1 118 ? -36.17400 15.00400  -40.90900 1.000 152.83411 ? 1194 ASN D O   1 
ATOM   3455 C  CB  . ASN D 1 118 ? -37.19200 14.27000  -37.99900 1.000 136.81377 ? 1194 ASN D CB  1 
ATOM   3456 C  CG  . ASN D 1 118 ? -37.23600 12.99000  -37.19400 1.000 134.07660 ? 1194 ASN D CG  1 
ATOM   3457 O  OD1 . ASN D 1 118 ? -36.76100 11.95100  -37.65200 1.000 129.36551 ? 1194 ASN D OD1 1 
ATOM   3458 N  ND2 . ASN D 1 118 ? -37.79700 13.05600  -35.99900 1.000 137.11118 ? 1194 ASN D ND2 1 
ATOM   3459 N  N   . GLU D 1 119 ? -35.69900 16.79200  -39.54700 1.000 130.91570 ? 1195 GLU D N   1 
ATOM   3460 C  CA  . GLU D 1 119 ? -35.74100 17.87700  -40.56600 1.000 135.55046 ? 1195 GLU D CA  1 
ATOM   3461 C  C   . GLU D 1 119 ? -34.36200 18.07200  -41.20900 1.000 132.52115 ? 1195 GLU D C   1 
ATOM   3462 O  O   . GLU D 1 119 ? -34.17700 19.10600  -41.88800 1.000 135.71627 ? 1195 GLU D O   1 
ATOM   3463 C  CB  . GLU D 1 119 ? -36.22100 19.18200  -39.92700 1.000 139.71938 ? 1195 GLU D CB  1 
ATOM   3464 C  CG  . GLU D 1 119 ? -37.71100 19.17800  -39.64400 1.000 144.38836 ? 1195 GLU D CG  1 
ATOM   3465 C  CD  . GLU D 1 119 ? -38.22800 20.33400  -38.80900 1.000 148.25462 ? 1195 GLU D CD  1 
ATOM   3466 O  OE1 . GLU D 1 119 ? -37.64000 21.43100  -38.88500 1.000 149.52319 ? 1195 GLU D OE1 1 
ATOM   3467 O  OE2 . GLU D 1 119 ? -39.22000 20.13200  -38.08600 1.000 150.12326 ? 1195 GLU D OE2 1 
ATOM   3468 N  N   . SER D 1 120 ? -33.42600 17.13600  -40.99200 1.000 129.54711 ? 1196 SER D N   1 
ATOM   3469 C  CA  . SER D 1 120 ? -32.08700 17.11600  -41.63800 1.000 129.42341 ? 1196 SER D CA  1 
ATOM   3470 C  C   . SER D 1 120 ? -31.95100 15.91500  -42.59000 1.000 126.07038 ? 1196 SER D C   1 
ATOM   3471 O  O   . SER D 1 120 ? -30.88600 15.81500  -43.22100 1.000 130.99202 ? 1196 SER D O   1 
ATOM   3472 C  CB  . SER D 1 120 ? -30.98100 17.14700  -40.60500 1.000 130.37879 ? 1196 SER D CB  1 
ATOM   3473 O  OG  . SER D 1 120 ? -30.72100 18.48000  -40.18100 1.000 130.99202 ? 1196 SER D OG  1 
ATOM   3474 N  N   . LEU D 1 121 ? -32.98400 15.07000  -42.73800 1.000 122.74630 ? 1197 LEU D N   1 
ATOM   3475 C  CA  . LEU D 1 121 ? -32.92300 13.81900  -43.55500 1.000 121.13294 ? 1197 LEU D CA  1 
ATOM   3476 C  C   . LEU D 1 121 ? -33.02600 14.15900  -45.05000 1.000 125.05447 ? 1197 LEU D C   1 
ATOM   3477 O  O   . LEU D 1 121 ? -32.72900 15.26200  -45.51100 1.000 127.46002 ? 1197 LEU D O   1 
ATOM   3478 C  CB  . LEU D 1 121 ? -34.03500 12.84800  -43.13100 1.000 121.68301 ? 1197 LEU D CB  1 
ATOM   3479 C  CG  . LEU D 1 121 ? -33.66800 11.83800  -42.04000 1.000 116.19551 ? 1197 LEU D CG  1 
ATOM   3480 C  CD1 . LEU D 1 121 ? -33.53400 12.51900  -40.69300 1.000 114.86377 ? 1197 LEU D CD1 1 
ATOM   3481 C  CD2 . LEU D 1 121 ? -34.69200 10.71200  -41.95200 1.000 116.77716 ? 1197 LEU D CD2 1 
ATOM   3482 N  N   . VAL E 1 6   ? -29.93900 18.87200  -61.94400 1.000 139.51410 ? 915  VAL E N   1 
ATOM   3483 C  CA  . VAL E 1 6   ? -30.52600 17.96300  -60.90300 1.000 134.77405 ? 915  VAL E CA  1 
ATOM   3484 C  C   . VAL E 1 6   ? -29.40100 17.48400  -59.98100 1.000 136.50058 ? 915  VAL E C   1 
ATOM   3485 O  O   . VAL E 1 6   ? -29.56100 17.58900  -58.74800 1.000 146.64653 ? 915  VAL E O   1 
ATOM   3486 C  CB  . VAL E 1 6   ? -31.27900 16.76900  -61.52900 1.000 130.79989 ? 915  VAL E CB  1 
ATOM   3487 C  CG1 . VAL E 1 6   ? -31.80700 15.80300  -60.47500 1.000 127.16788 ? 915  VAL E CG1 1 
ATOM   3488 C  CG2 . VAL E 1 6   ? -32.41200 17.22900  -62.43200 1.000 145.49902 ? 915  VAL E CG2 1 
ATOM   3489 N  N   . LEU E 1 7   ? -28.31200 16.97500  -60.56200 1.000 137.11381 ? 916  LEU E N   1 
ATOM   3490 C  CA  . LEU E 1 7   ? -27.20200 16.32800  -59.81600 1.000 131.62104 ? 916  LEU E CA  1 
ATOM   3491 C  C   . LEU E 1 7   ? -26.61700 17.31800  -58.80300 1.000 137.82442 ? 916  LEU E C   1 
ATOM   3492 O  O   . LEU E 1 7   ? -26.58500 16.96300  -57.61600 1.000 135.66363 ? 916  LEU E O   1 
ATOM   3493 C  CB  . LEU E 1 7   ? -26.15200 15.82000  -60.80900 1.000 127.96008 ? 916  LEU E CB  1 
ATOM   3494 C  CG  . LEU E 1 7   ? -26.54100 14.55100  -61.56700 1.000 119.11691 ? 916  LEU E CG  1 
ATOM   3495 C  CD1 . LEU E 1 7   ? -25.52400 14.23400  -62.64900 1.000 111.29229 ? 916  LEU E CD1 1 
ATOM   3496 C  CD2 . LEU E 1 7   ? -26.69300 13.36500  -60.62200 1.000 116.42449 ? 916  LEU E CD2 1 
ATOM   3497 N  N   . TYR E 1 8   ? -26.22400 18.51900  -59.24300 1.000 133.11070 ? 917  TYR E N   1 
ATOM   3498 C  CA  . TYR E 1 8   ? -25.55100 19.55000  -58.40300 1.000 135.76101 ? 917  TYR E CA  1 
ATOM   3499 C  C   . TYR E 1 8   ? -26.53300 20.21200  -57.42800 1.000 138.14025 ? 917  TYR E C   1 
ATOM   3500 O  O   . TYR E 1 8   ? -26.04800 20.81300  -56.44700 1.000 138.45607 ? 917  TYR E O   1 
ATOM   3501 C  CB  . TYR E 1 8   ? -24.88500 20.64000  -59.24500 1.000 140.70898 ? 917  TYR E CB  1 
ATOM   3502 C  CG  . TYR E 1 8   ? -25.82600 21.43300  -60.11400 1.000 154.19744 ? 917  TYR E CG  1 
ATOM   3503 C  CD1 . TYR E 1 8   ? -26.13600 21.01100  -61.39900 1.000 156.69774 ? 917  TYR E CD1 1 
ATOM   3504 C  CD2 . TYR E 1 8   ? -26.40300 22.60900  -59.66000 1.000 164.85398 ? 917  TYR E CD2 1 
ATOM   3505 C  CE1 . TYR E 1 8   ? -26.99600 21.73100  -62.21100 1.000 164.05388 ? 917  TYR E CE1 1 
ATOM   3506 C  CE2 . TYR E 1 8   ? -27.26700 23.34200  -60.46000 1.000 171.50741 ? 917  TYR E CE2 1 
ATOM   3507 C  CZ  . TYR E 1 8   ? -27.56400 22.90100  -61.74000 1.000 170.97313 ? 917  TYR E CZ  1 
ATOM   3508 O  OH  . TYR E 1 8   ? -28.40900 23.60800  -62.54400 1.000 176.68697 ? 917  TYR E OH  1 
ATOM   3509 N  N   . GLU E 1 9   ? -27.84300 20.16400  -57.70300 1.000 139.03772 ? 918  GLU E N   1 
ATOM   3510 C  CA  . GLU E 1 9   ? -28.88300 20.60600  -56.73300 1.000 140.03258 ? 918  GLU E CA  1 
ATOM   3511 C  C   . GLU E 1 9   ? -28.95800 19.55900  -55.61400 1.000 134.70826 ? 918  GLU E C   1 
ATOM   3512 O  O   . GLU E 1 9   ? -29.04300 19.96600  -54.43900 1.000 134.69773 ? 918  GLU E O   1 
ATOM   3513 C  CB  . GLU E 1 9   ? -30.23800 20.85200  -57.41000 1.000 142.28548 ? 918  GLU E CB  1 
ATOM   3514 C  CG  . GLU E 1 9   ? -30.25000 22.08200  -58.30700 1.000 149.28895 ? 918  GLU E CG  1 
ATOM   3515 C  CD  . GLU E 1 9   ? -31.47400 22.97700  -58.20500 1.000 158.62428 ? 918  GLU E CD  1 
ATOM   3516 O  OE1 . GLU E 1 9   ? -32.53000 22.49500  -57.74700 1.000 160.89034 ? 918  GLU E OE1 1 
ATOM   3517 O  OE2 . GLU E 1 9   ? -31.35800 24.16000  -58.57800 1.000 165.57512 ? 918  GLU E OE2 1 
ATOM   3518 N  N   . ASN E 1 10  ? -28.89100 18.26800  -55.96300 1.000 141.35116 ? 919  ASN E N   1 
ATOM   3519 C  CA  . ASN E 1 10  ? -28.82100 17.14400  -54.99000 1.000 137.23224 ? 919  ASN E CA  1 
ATOM   3520 C  C   . ASN E 1 10  ? -27.54700 17.28700  -54.14000 1.000 133.17123 ? 919  ASN E C   1 
ATOM   3521 O  O   . ASN E 1 10  ? -27.62500 17.02100  -52.92400 1.000 129.68134 ? 919  ASN E O   1 
ATOM   3522 C  CB  . ASN E 1 10  ? -28.89600 15.77400  -55.67900 1.000 130.07086 ? 919  ASN E CB  1 
ATOM   3523 C  CG  . ASN E 1 10  ? -30.30000 15.35000  -56.06700 1.000 128.26275 ? 919  ASN E CG  1 
ATOM   3524 O  OD1 . ASN E 1 10  ? -31.28800 15.94000  -55.63100 1.000 137.21119 ? 919  ASN E OD1 1 
ATOM   3525 N  ND2 . ASN E 1 10  ? -30.39800 14.31100  -56.88300 1.000 120.56709 ? 919  ASN E ND2 1 
ATOM   3526 N  N   . GLN E 1 11  ? -26.42400 17.69400  -54.75000 1.000 127.34422 ? 920  GLN E N   1 
ATOM   3527 C  CA  . GLN E 1 11  ? -25.10800 17.87800  -54.06800 1.000 127.78374 ? 920  GLN E CA  1 
ATOM   3528 C  C   . GLN E 1 11  ? -25.22500 18.99600  -53.03000 1.000 128.45488 ? 920  GLN E C   1 
ATOM   3529 O  O   . GLN E 1 11  ? -24.65500 18.84600  -51.93900 1.000 130.21824 ? 920  GLN E O   1 
ATOM   3530 C  CB  . GLN E 1 11  ? -23.98300 18.27100  -55.03100 1.000 132.46325 ? 920  GLN E CB  1 
ATOM   3531 C  CG  . GLN E 1 11  ? -23.70100 17.25600  -56.13000 1.000 126.63360 ? 920  GLN E CG  1 
ATOM   3532 C  CD  . GLN E 1 11  ? -22.95100 16.04100  -55.64600 1.000 111.37651 ? 920  GLN E CD  1 
ATOM   3533 O  OE1 . GLN E 1 11  ? -23.51600 14.95800  -55.48400 1.000 97.30904  ? 920  GLN E OE1 1 
ATOM   3534 N  NE2 . GLN E 1 11  ? -21.65800 16.21600  -55.42300 1.000 105.82585 ? 920  GLN E NE2 1 
ATOM   3535 N  N   . LYS E 1 12  ? -25.90300 20.08800  -53.38800 1.000 126.92838 ? 921  LYS E N   1 
ATOM   3536 C  CA  . LYS E 1 12  ? -26.15300 21.25400  -52.49900 1.000 134.79248 ? 921  LYS E CA  1 
ATOM   3537 C  C   . LYS E 1 12  ? -27.08700 20.84100  -51.35500 1.000 127.90481 ? 921  LYS E C   1 
ATOM   3538 O  O   . LYS E 1 12  ? -26.82800 21.26300  -50.21300 1.000 127.06523 ? 921  LYS E O   1 
ATOM   3539 C  CB  . LYS E 1 12  ? -26.73700 22.42100  -53.30000 1.000 148.70730 ? 921  LYS E CB  1 
ATOM   3540 C  CG  . LYS E 1 12  ? -25.70100 23.21300  -54.08400 1.000 152.52355 ? 921  LYS E CG  1 
ATOM   3541 C  CD  . LYS E 1 12  ? -26.24500 23.98800  -55.26700 1.000 159.13224 ? 921  LYS E CD  1 
ATOM   3542 C  CE  . LYS E 1 12  ? -25.13400 24.45900  -56.18200 1.000 163.73279 ? 921  LYS E CE  1 
ATOM   3543 N  NZ  . LYS E 1 12  ? -25.54900 25.59100  -57.04500 1.000 170.74152 ? 921  LYS E NZ  1 
ATOM   3544 N  N   . LEU E 1 13  ? -28.13100 20.05900  -51.65200 1.000 128.72070 ? 922  LEU E N   1 
ATOM   3545 C  CA  . LEU E 1 13  ? -29.10700 19.55800  -50.64500 1.000 129.84188 ? 922  LEU E CA  1 
ATOM   3546 C  C   . LEU E 1 13  ? -28.33400 18.77100  -49.58300 1.000 129.68134 ? 922  LEU E C   1 
ATOM   3547 O  O   . LEU E 1 13  ? -28.31500 19.20600  -48.40800 1.000 134.43454 ? 922  LEU E O   1 
ATOM   3548 C  CB  . LEU E 1 13  ? -30.16600 18.69200  -51.34200 1.000 125.47820 ? 922  LEU E CB  1 
ATOM   3549 C  CG  . LEU E 1 13  ? -31.22400 18.04900  -50.44100 1.000 123.24636 ? 922  LEU E CG  1 
ATOM   3550 C  CD1 . LEU E 1 13  ? -32.09700 19.10900  -49.78000 1.000 118.34840 ? 922  LEU E CD1 1 
ATOM   3551 C  CD2 . LEU E 1 13  ? -32.08500 17.06500  -51.22300 1.000 127.32579 ? 922  LEU E CD2 1 
ATOM   3552 N  N   . ILE E 1 14  ? -27.67600 17.69000  -50.00900 1.000 123.44901 ? 923  ILE E N   1 
ATOM   3553 C  CA  . ILE E 1 14  ? -26.94700 16.74000  -49.11800 1.000 117.87992 ? 923  ILE E CA  1 
ATOM   3554 C  C   . ILE E 1 14  ? -26.04000 17.54900  -48.18400 1.000 119.95122 ? 923  ILE E C   1 
ATOM   3555 O  O   . ILE E 1 14  ? -26.11400 17.30700  -46.96200 1.000 118.45104 ? 923  ILE E O   1 
ATOM   3556 C  CB  . ILE E 1 14  ? -26.16600 15.69400  -49.93700 1.000 114.37950 ? 923  ILE E CB  1 
ATOM   3557 C  CG1 . ILE E 1 14  ? -27.10600 14.72200  -50.65700 1.000 111.40809 ? 923  ILE E CG1 1 
ATOM   3558 C  CG2 . ILE E 1 14  ? -25.16900 14.95600  -49.05600 1.000 107.54184 ? 923  ILE E CG2 1 
ATOM   3559 C  CD1 . ILE E 1 14  ? -26.46000 13.96100  -51.79800 1.000 107.96294 ? 923  ILE E CD1 1 
ATOM   3560 N  N   . ALA E 1 15  ? -25.24300 18.47600  -48.73900 1.000 103.99931 ? 924  ALA E N   1 
ATOM   3561 C  CA  . ALA E 1 15  ? -24.22800 19.29100  -48.02200 1.000 103.32028 ? 924  ALA E CA  1 
ATOM   3562 C  C   . ALA E 1 15  ? -24.90500 20.21300  -47.00000 1.000 117.10351 ? 924  ALA E C   1 
ATOM   3563 O  O   . ALA E 1 15  ? -24.33500 20.39600  -45.90200 1.000 118.22207 ? 924  ALA E O   1 
ATOM   3564 C  CB  . ALA E 1 15  ? -23.39600 20.09600  -48.99000 1.000 106.38644 ? 924  ALA E CB  1 
ATOM   3565 N  N   . ASN E 1 16  ? -26.05500 20.79700  -47.35400 1.000 122.24097 ? 925  ASN E N   1 
ATOM   3566 C  CA  . ASN E 1 16  ? -26.81200 21.71300  -46.46000 1.000 118.88531 ? 925  ASN E CA  1 
ATOM   3567 C  C   . ASN E 1 16  ? -27.40800 20.88200  -45.32400 1.000 111.92131 ? 925  ASN E C   1 
ATOM   3568 O  O   . ASN E 1 16  ? -27.19700 21.26700  -44.17100 1.000 111.81077 ? 925  ASN E O   1 
ATOM   3569 C  CB  . ASN E 1 16  ? -27.86700 22.52800  -47.21300 1.000 125.89141 ? 925  ASN E CB  1 
ATOM   3570 C  CG  . ASN E 1 16  ? -27.27400 23.65000  -48.04600 1.000 139.08510 ? 925  ASN E CG  1 
ATOM   3571 O  OD1 . ASN E 1 16  ? -26.21400 24.19000  -47.72600 1.000 141.61698 ? 925  ASN E OD1 1 
ATOM   3572 N  ND2 . ASN E 1 16  ? -27.95900 24.01700  -49.11900 1.000 146.32544 ? 925  ASN E ND2 1 
ATOM   3573 N  N   . GLN E 1 17  ? -28.07100 19.76600  -45.64800 1.000 115.27172 ? 926  GLN E N   1 
ATOM   3574 C  CA  . GLN E 1 17  ? -28.66500 18.82000  -44.66000 1.000 112.21609 ? 926  GLN E CA  1 
ATOM   3575 C  C   . GLN E 1 17  ? -27.58600 18.30400  -43.69800 1.000 106.32327 ? 926  GLN E C   1 
ATOM   3576 O  O   . GLN E 1 17  ? -27.84800 18.26700  -42.47800 1.000 105.58634 ? 926  GLN E O   1 
ATOM   3577 C  CB  . GLN E 1 17  ? -29.33400 17.64000  -45.36800 1.000 107.28128 ? 926  GLN E CB  1 
ATOM   3578 C  CG  . GLN E 1 17  ? -30.54200 18.03600  -46.20100 1.000 109.30258 ? 926  GLN E CG  1 
ATOM   3579 C  CD  . GLN E 1 17  ? -31.43300 19.03200  -45.49900 1.000 117.45882 ? 926  GLN E CD  1 
ATOM   3580 O  OE1 . GLN E 1 17  ? -32.22300 18.67700  -44.63000 1.000 119.44590 ? 926  GLN E OE1 1 
ATOM   3581 N  NE2 . GLN E 1 17  ? -31.31200 20.29600  -45.87400 1.000 130.32352 ? 926  GLN E NE2 1 
ATOM   3582 N  N   . PHE E 1 18  ? -26.43100 17.90000  -44.23000 1.000 93.50595  ? 927  PHE E N   1 
ATOM   3583 C  CA  . PHE E 1 18  ? -25.26500 17.42300  -43.44500 1.000 88.48429  ? 927  PHE E CA  1 
ATOM   3584 C  C   . PHE E 1 18  ? -24.83800 18.53500  -42.47600 1.000 91.73731  ? 927  PHE E C   1 
ATOM   3585 O  O   . PHE E 1 18  ? -24.86600 18.29200  -41.24900 1.000 89.50284  ? 927  PHE E O   1 
ATOM   3586 C  CB  . PHE E 1 18  ? -24.13700 16.98400  -44.38200 1.000 85.57868  ? 927  PHE E CB  1 
ATOM   3587 C  CG  . PHE E 1 18  ? -22.88800 16.52100  -43.67900 1.000 80.86759  ? 927  PHE E CG  1 
ATOM   3588 C  CD1 . PHE E 1 18  ? -22.89600 15.35900  -42.92900 1.000 75.24323  ? 927  PHE E CD1 1 
ATOM   3589 C  CD2 . PHE E 1 18  ? -21.71100 17.24700  -43.76100 1.000 82.32303  ? 927  PHE E CD2 1 
ATOM   3590 C  CE1 . PHE E 1 18  ? -21.75200 14.93100  -42.27700 1.000 71.21380  ? 927  PHE E CE1 1 
ATOM   3591 C  CE2 . PHE E 1 18  ? -20.56400 16.81200  -43.11700 1.000 78.23043  ? 927  PHE E CE2 1 
ATOM   3592 C  CZ  . PHE E 1 18  ? -20.58800 15.65400  -42.37900 1.000 72.70872  ? 927  PHE E CZ  1 
ATOM   3593 N  N   . ASN E 1 19  ? -24.50500 19.71800  -43.01100 1.000 91.96892  ? 928  ASN E N   1 
ATOM   3594 C  CA  . ASN E 1 19  ? -24.00400 20.89100  -42.23900 1.000 103.92562 ? 928  ASN E CA  1 
ATOM   3595 C  C   . ASN E 1 19  ? -25.04300 21.28300  -41.18000 1.000 104.22039 ? 928  ASN E C   1 
ATOM   3596 O  O   . ASN E 1 19  ? -24.63200 21.69500  -40.07500 1.000 102.62809 ? 928  ASN E O   1 
ATOM   3597 C  CB  . ASN E 1 19  ? -23.63800 22.06600  -43.15500 1.000 102.79127 ? 928  ASN E CB  1 
ATOM   3598 C  CG  . ASN E 1 19  ? -22.36600 21.83400  -43.95300 1.000 104.03616 ? 928  ASN E CG  1 
ATOM   3599 O  OD1 . ASN E 1 19  ? -21.48000 21.09500  -43.53100 1.000 104.56254 ? 928  ASN E OD1 1 
ATOM   3600 N  ND2 . ASN E 1 19  ? -22.25000 22.46000  -45.11100 1.000 105.16261 ? 928  ASN E ND2 1 
ATOM   3601 N  N   . SER E 1 20  ? -26.33200 21.15700  -41.50800 1.000 104.91784 ? 929  SER E N   1 
ATOM   3602 C  CA  . SER E 1 20  ? -27.46400 21.33200  -40.56400 1.000 109.83159 ? 929  SER E CA  1 
ATOM   3603 C  C   . SER E 1 20  ? -27.30600 20.31300  -39.42900 1.000 107.13653 ? 929  SER E C   1 
ATOM   3604 O  O   . SER E 1 20  ? -27.16000 20.74800  -38.27100 1.000 112.56350 ? 929  SER E O   1 
ATOM   3605 C  CB  . SER E 1 20  ? -28.80000 21.22400  -41.27700 1.000 113.51624 ? 929  SER E CB  1 
ATOM   3606 O  OG  . SER E 1 20  ? -29.87100 21.02800  -40.36500 1.000 111.10543 ? 929  SER E OG  1 
ATOM   3607 N  N   . ALA E 1 21  ? -27.25700 19.01700  -39.76000 1.000 109.49997 ? 930  ALA E N   1 
ATOM   3608 C  CA  . ALA E 1 21  ? -27.22100 17.89700  -38.78600 1.000 96.94320  ? 930  ALA E CA  1 
ATOM   3609 C  C   . ALA E 1 21  ? -26.03100 18.05700  -37.83400 1.000 93.34014  ? 930  ALA E C   1 
ATOM   3610 O  O   . ALA E 1 21  ? -26.21700 17.87700  -36.62500 1.000 85.74712  ? 930  ALA E O   1 
ATOM   3611 C  CB  . ALA E 1 21  ? -27.17100 16.57000  -39.49900 1.000 85.87082  ? 930  ALA E CB  1 
ATOM   3612 N  N   . ILE E 1 22  ? -24.85300 18.38700  -38.35900 1.000 89.58969  ? 931  ILE E N   1 
ATOM   3613 C  CA  . ILE E 1 22  ? -23.62400 18.57500  -37.53400 1.000 91.32937  ? 931  ILE E CA  1 
ATOM   3614 C  C   . ILE E 1 22  ? -23.85900 19.72100  -36.54500 1.000 95.83254  ? 931  ILE E C   1 
ATOM   3615 O  O   . ILE E 1 22  ? -23.60600 19.52500  -35.34100 1.000 91.41622  ? 931  ILE E O   1 
ATOM   3616 C  CB  . ILE E 1 22  ? -22.39200 18.82000  -38.41900 1.000 86.62881  ? 931  ILE E CB  1 
ATOM   3617 C  CG1 . ILE E 1 22  ? -22.02600 17.55000  -39.18800 1.000 82.78887  ? 931  ILE E CG1 1 
ATOM   3618 C  CG2 . ILE E 1 22  ? -21.22600 19.34900  -37.59000 1.000 85.43656  ? 931  ILE E CG2 1 
ATOM   3619 C  CD1 . ILE E 1 22  ? -20.79200 17.68900  -40.04100 1.000 101.34373 ? 931  ILE E CD1 1 
ATOM   3620 N  N   . GLY E 1 23  ? -24.32200 20.87400  -37.03400 1.000 104.98364 ? 932  GLY E N   1 
ATOM   3621 C  CA  . GLY E 1 23  ? -24.63300 22.05200  -36.19900 1.000 106.25221 ? 932  GLY E CA  1 
ATOM   3622 C  C   . GLY E 1 23  ? -25.44200 21.65900  -34.97600 1.000 95.51408  ? 932  GLY E C   1 
ATOM   3623 O  O   . GLY E 1 23  ? -25.02400 21.99500  -33.86100 1.000 97.08532  ? 932  GLY E O   1 
ATOM   3624 N  N   . LYS E 1 24  ? -26.54600 20.93600  -35.18400 1.000 100.99369 ? 933  LYS E N   1 
ATOM   3625 C  CA  . LYS E 1 24  ? -27.43900 20.42900  -34.10700 1.000 100.13832 ? 933  LYS E CA  1 
ATOM   3626 C  C   . LYS E 1 24  ? -26.61200 19.56800  -33.14300 1.000 91.86891  ? 933  LYS E C   1 
ATOM   3627 O  O   . LYS E 1 24  ? -26.61900 19.84100  -31.92900 1.000 92.12947  ? 933  LYS E O   1 
ATOM   3628 C  CB  . LYS E 1 24  ? -28.59900 19.62300  -34.70300 1.000 96.50104  ? 933  LYS E CB  1 
ATOM   3629 C  CG  . LYS E 1 24  ? -29.55500 20.40300  -35.59400 1.000 107.77871 ? 933  LYS E CG  1 
ATOM   3630 C  CD  . LYS E 1 24  ? -30.65500 19.53400  -36.16000 1.000 108.54196 ? 933  LYS E CD  1 
ATOM   3631 C  CE  . LYS E 1 24  ? -31.71000 20.30400  -36.92500 1.000 114.87956 ? 933  LYS E CE  1 
ATOM   3632 N  NZ  . LYS E 1 24  ? -32.39300 19.43500  -37.91200 1.000 116.33763 ? 933  LYS E NZ  1 
ATOM   3633 N  N   . ILE E 1 25  ? -25.90700 18.57400  -33.68300 1.000 90.48453  ? 934  ILE E N   1 
ATOM   3634 C  CA  . ILE E 1 25  ? -25.12200 17.57800  -32.89900 1.000 87.26836  ? 934  ILE E CA  1 
ATOM   3635 C  C   . ILE E 1 25  ? -24.09500 18.33700  -32.04800 1.000 92.14526  ? 934  ILE E C   1 
ATOM   3636 O  O   . ILE E 1 25  ? -23.97200 18.00500  -30.84800 1.000 88.23163  ? 934  ILE E O   1 
ATOM   3637 C  CB  . ILE E 1 25  ? -24.49600 16.53200  -33.84300 1.000 80.04907  ? 934  ILE E CB  1 
ATOM   3638 C  CG1 . ILE E 1 25  ? -25.57000 15.61500  -34.43300 1.000 78.15937  ? 934  ILE E CG1 1 
ATOM   3639 C  CG2 . ILE E 1 25  ? -23.40500 15.74100  -33.13800 1.000 74.98267  ? 934  ILE E CG2 1 
ATOM   3640 C  CD1 . ILE E 1 25  ? -25.16100 14.89900  -35.69900 1.000 75.59854  ? 934  ILE E CD1 1 
ATOM   3641 N  N   . GLN E 1 26  ? -23.41500 19.33500  -32.63200 1.000 95.26142  ? 935  GLN E N   1 
ATOM   3642 C  CA  . GLN E 1 26  ? -22.45000 20.21600  -31.92000 1.000 97.06953  ? 935  GLN E CA  1 
ATOM   3643 C  C   . GLN E 1 26  ? -23.12900 20.80800  -30.68000 1.000 103.50715 ? 935  GLN E C   1 
ATOM   3644 O  O   . GLN E 1 26  ? -22.51000 20.77500  -29.60400 1.000 105.65740 ? 935  GLN E O   1 
ATOM   3645 C  CB  . GLN E 1 26  ? -21.96300 21.36100  -32.80800 1.000 94.84821  ? 935  GLN E CB  1 
ATOM   3646 C  CG  . GLN E 1 26  ? -20.98900 20.94200  -33.89500 1.000 91.06092  ? 935  GLN E CG  1 
ATOM   3647 C  CD  . GLN E 1 26  ? -20.44800 22.14200  -34.63200 1.000 103.25712 ? 935  GLN E CD  1 
ATOM   3648 O  OE1 . GLN E 1 26  ? -21.19100 22.89800  -35.25700 1.000 111.90815 ? 935  GLN E OE1 1 
ATOM   3649 N  NE2 . GLN E 1 26  ? -19.14000 22.33200  -34.55400 1.000 104.08090 ? 935  GLN E NE2 1 
ATOM   3650 N  N   . ASP E 1 27  ? -24.34600 21.34200  -30.84600 1.000 109.01307 ? 936  ASP E N   1 
ATOM   3651 C  CA  . ASP E 1 27  ? -25.18400 21.92800  -29.76000 1.000 116.43238 ? 936  ASP E CA  1 
ATOM   3652 C  C   . ASP E 1 27  ? -25.53300 20.82500  -28.74900 1.000 107.43393 ? 936  ASP E C   1 
ATOM   3653 O  O   . ASP E 1 27  ? -25.52200 21.11300  -27.53000 1.000 107.72871 ? 936  ASP E O   1 
ATOM   3654 C  CB  . ASP E 1 27  ? -26.42500 22.62900  -30.33800 1.000 122.01200 ? 936  ASP E CB  1 
ATOM   3655 C  CG  . ASP E 1 27  ? -27.51200 22.99100  -29.33200 1.000 121.56721 ? 936  ASP E CG  1 
ATOM   3656 O  OD1 . ASP E 1 27  ? -27.23200 23.80900  -28.42900 1.000 119.13270 ? 936  ASP E OD1 1 
ATOM   3657 O  OD2 . ASP E 1 27  ? -28.64300 22.46000  -29.46600 1.000 122.97790 ? 936  ASP E OD2 1 
ATOM   3658 N  N   . SER E 1 28  ? -25.82000 19.61000  -29.23300 1.000 107.88136 ? 937  SER E N   1 
ATOM   3659 C  CA  . SER E 1 28  ? -26.20100 18.43900  -28.39800 1.000 101.06738 ? 937  SER E CA  1 
ATOM   3660 C  C   . SER E 1 28  ? -24.99500 17.96600  -27.57500 1.000 102.95182 ? 937  SER E C   1 
ATOM   3661 O  O   . SER E 1 28  ? -25.19000 17.65100  -26.38600 1.000 106.51803 ? 937  SER E O   1 
ATOM   3662 C  CB  . SER E 1 28  ? -26.80400 17.31600  -29.22500 1.000 90.75299  ? 937  SER E CB  1 
ATOM   3663 O  OG  . SER E 1 28  ? -25.80800 16.44700  -29.74800 1.000 89.83182  ? 937  SER E OG  1 
ATOM   3664 N  N   . LEU E 1 29  ? -23.79800 17.93900  -28.16800 1.000 93.17959  ? 938  LEU E N   1 
ATOM   3665 C  CA  . LEU E 1 29  ? -22.56800 17.43800  -27.49700 1.000 87.90264  ? 938  LEU E CA  1 
ATOM   3666 C  C   . LEU E 1 29  ? -22.12400 18.38000  -26.37100 1.000 99.93303  ? 938  LEU E C   1 
ATOM   3667 O  O   . LEU E 1 29  ? -21.63000 17.86800  -25.34400 1.000 103.30449 ? 938  LEU E O   1 
ATOM   3668 C  CB  . LEU E 1 29  ? -21.44800 17.28000  -28.52500 1.000 89.94236  ? 938  LEU E CB  1 
ATOM   3669 C  CG  . LEU E 1 29  ? -21.59900 16.12000  -29.50600 1.000 93.94284  ? 938  LEU E CG  1 
ATOM   3670 C  CD1 . LEU E 1 29  ? -20.38900 16.05800  -30.42600 1.000 94.17971  ? 938  LEU E CD1 1 
ATOM   3671 C  CD2 . LEU E 1 29  ? -21.78500 14.79200  -28.78400 1.000 93.26381  ? 938  LEU E CD2 1 
ATOM   3672 N  N   . SER E 1 30  ? -22.24300 19.69600  -26.55600 1.000 100.03041 ? 939  SER E N   1 
ATOM   3673 C  CA  . SER E 1 30  ? -21.78400 20.69800  -25.55800 1.000 108.13928 ? 939  SER E CA  1 
ATOM   3674 C  C   . SER E 1 30  ? -22.85200 20.84800  -24.46300 1.000 106.37854 ? 939  SER E C   1 
ATOM   3675 O  O   . SER E 1 30  ? -22.46800 21.24500  -23.34700 1.000 105.01785 ? 939  SER E O   1 
ATOM   3676 C  CB  . SER E 1 30  ? -21.40300 22.01900  -26.20400 1.000 113.92155 ? 939  SER E CB  1 
ATOM   3677 O  OG  . SER E 1 30  ? -20.20300 22.53600  -25.63300 1.000 113.75574 ? 939  SER E OG  1 
ATOM   3678 N  N   . SER E 1 31  ? -24.12200 20.51900  -24.76100 1.000 110.42113 ? 940  SER E N   1 
ATOM   3679 C  CA  . SER E 1 31  ? -25.25200 20.43500  -23.78900 1.000 104.79151 ? 940  SER E CA  1 
ATOM   3680 C  C   . SER E 1 31  ? -25.05500 19.21700  -22.87500 1.000 101.38321 ? 940  SER E C   1 
ATOM   3681 O  O   . SER E 1 31  ? -25.29900 19.33500  -21.65000 1.000 100.57258 ? 940  SER E O   1 
ATOM   3682 C  CB  . SER E 1 31  ? -26.59000 20.39500  -24.50500 1.000 98.28020  ? 940  SER E CB  1 
ATOM   3683 O  OG  . SER E 1 31  ? -27.56500 19.67400  -23.76200 1.000 100.46468 ? 940  SER E OG  1 
ATOM   3684 N  N   . THR E 1 32  ? -24.62800 18.09300  -23.45800 1.000 96.62737  ? 941  THR E N   1 
ATOM   3685 C  CA  . THR E 1 32  ? -24.26500 16.84600  -22.73900 1.000 88.30269  ? 941  THR E CA  1 
ATOM   3686 C  C   . THR E 1 32  ? -23.09100 17.15000  -21.80400 1.000 93.47963  ? 941  THR E C   1 
ATOM   3687 O  O   . THR E 1 32  ? -23.22600 16.84300  -20.60300 1.000 95.06929  ? 941  THR E O   1 
ATOM   3688 C  CB  . THR E 1 32  ? -23.97000 15.71100  -23.72200 1.000 71.91915  ? 941  THR E CB  1 
ATOM   3689 O  OG1 . THR E 1 32  ? -25.15700 15.54500  -24.49500 1.000 70.15841  ? 941  THR E OG1 1 
ATOM   3690 C  CG2 . THR E 1 32  ? -23.61200 14.40600  -23.04600 1.000 75.79330  ? 941  THR E CG2 1 
ATOM   3691 N  N   . ALA E 1 33  ? -22.01300 17.75400  -22.32500 1.000 84.57330  ? 942  ALA E N   1 
ATOM   3692 C  CA  . ALA E 1 33  ? -20.77400 18.08900  -21.57400 1.000 83.62318  ? 942  ALA E CA  1 
ATOM   3693 C  C   . ALA E 1 33  ? -21.10100 18.96300  -20.36000 1.000 84.75227  ? 942  ALA E C   1 
ATOM   3694 O  O   . ALA E 1 33  ? -20.50100 18.73000  -19.29100 1.000 83.13628  ? 942  ALA E O   1 
ATOM   3695 C  CB  . ALA E 1 33  ? -19.78300 18.78300  -22.47300 1.000 80.83601  ? 942  ALA E CB  1 
ATOM   3696 N  N   . SER E 1 34  ? -21.99600 19.93900  -20.54800 1.000 91.66362  ? 943  SER E N   1 
ATOM   3697 C  CA  . SER E 1 34  ? -22.53600 20.84900  -19.50400 1.000 93.15064  ? 943  SER E CA  1 
ATOM   3698 C  C   . SER E 1 34  ? -23.19400 20.01300  -18.40700 1.000 90.38715  ? 943  SER E C   1 
ATOM   3699 O  O   . SER E 1 34  ? -22.78900 20.15800  -17.24100 1.000 100.98842 ? 943  SER E O   1 
ATOM   3700 C  CB  . SER E 1 34  ? -23.51400 21.84500  -20.09100 1.000 104.95732 ? 943  SER E CB  1 
ATOM   3701 O  OG  . SER E 1 34  ? -24.18500 22.58100  -19.07500 1.000 107.93136 ? 943  SER E OG  1 
ATOM   3702 N  N   . ALA E 1 35  ? -24.15700 19.16600  -18.78300 1.000 89.63443  ? 944  ALA E N   1 
ATOM   3703 C  CA  . ALA E 1 35  ? -24.95000 18.32200  -17.85600 1.000 88.64221  ? 944  ALA E CA  1 
ATOM   3704 C  C   . ALA E 1 35  ? -24.01200 17.42400  -17.03100 1.000 86.17612  ? 944  ALA E C   1 
ATOM   3705 O  O   . ALA E 1 35  ? -24.18100 17.38500  -15.79800 1.000 96.52999  ? 944  ALA E O   1 
ATOM   3706 C  CB  . ALA E 1 35  ? -25.97700 17.52500  -18.62800 1.000 80.04644  ? 944  ALA E CB  1 
ATOM   3707 N  N   . LEU E 1 36  ? -23.04000 16.76200  -17.67200 1.000 75.63538  ? 945  LEU E N   1 
ATOM   3708 C  CA  . LEU E 1 36  ? -22.08700 15.81900  -17.01900 1.000 73.71147  ? 945  LEU E CA  1 
ATOM   3709 C  C   . LEU E 1 36  ? -21.15900 16.57200  -16.05600 1.000 77.23031  ? 945  LEU E C   1 
ATOM   3710 O  O   . LEU E 1 36  ? -20.86100 16.00700  -14.98100 1.000 74.75107  ? 945  LEU E O   1 
ATOM   3711 C  CB  . LEU E 1 36  ? -21.27600 15.09100  -18.09300 1.000 75.31429  ? 945  LEU E CB  1 
ATOM   3712 C  CG  . LEU E 1 36  ? -22.06800 14.14600  -18.99700 1.000 62.36011  ? 945  LEU E CG  1 
ATOM   3713 C  CD1 . LEU E 1 36  ? -21.21300 13.70200  -20.17400 1.000 62.68383  ? 945  LEU E CD1 1 
ATOM   3714 C  CD2 . LEU E 1 36  ? -22.58700 12.94400  -18.21700 1.000 56.57784  ? 945  LEU E CD2 1 
ATOM   3715 N  N   . GLY E 1 37  ? -20.71500 17.77800  -16.43600 1.000 79.64639  ? 946  GLY E N   1 
ATOM   3716 C  CA  . GLY E 1 37  ? -19.93800 18.69900  -15.58100 1.000 74.58263  ? 946  GLY E CA  1 
ATOM   3717 C  C   . GLY E 1 37  ? -20.68000 19.06500  -14.30500 1.000 82.18091  ? 946  GLY E C   1 
ATOM   3718 O  O   . GLY E 1 37  ? -20.07200 18.93400  -13.22300 1.000 88.31848  ? 946  GLY E O   1 
ATOM   3719 N  N   . LYS E 1 38  ? -21.94100 19.50600  -14.41700 1.000 84.02323  ? 947  LYS E N   1 
ATOM   3720 C  CA  . LYS E 1 38  ? -22.78600 19.91400  -13.25900 1.000 84.95492  ? 947  LYS E CA  1 
ATOM   3721 C  C   . LYS E 1 38  ? -22.96300 18.70000  -12.33400 1.000 80.58598  ? 947  LYS E C   1 
ATOM   3722 O  O   . LYS E 1 38  ? -22.69700 18.85300  -11.12400 1.000 86.10506  ? 947  LYS E O   1 
ATOM   3723 C  CB  . LYS E 1 38  ? -24.12000 20.51100  -13.72900 1.000 84.95492  ? 947  LYS E CB  1 
ATOM   3724 C  CG  . LYS E 1 38  ? -24.03600 21.86800  -14.42400 1.000 91.26094  ? 947  LYS E CG  1 
ATOM   3725 C  CD  . LYS E 1 38  ? -25.41100 22.46000  -14.70700 1.000 92.26106  ? 947  LYS E CD  1 
ATOM   3726 C  CE  . LYS E 1 38  ? -25.38500 23.79600  -15.42300 1.000 103.08078 ? 947  LYS E CE  1 
ATOM   3727 N  NZ  . LYS E 1 38  ? -26.58000 24.60500  -15.08600 1.000 111.69234 ? 947  LYS E NZ  1 
ATOM   3728 N  N   . LEU E 1 39  ? -23.35000 17.54200  -12.89100 1.000 79.76483  ? 948  LEU E N   1 
ATOM   3729 C  CA  . LEU E 1 39  ? -23.51300 16.26300  -12.14800 1.000 67.71601  ? 948  LEU E CA  1 
ATOM   3730 C  C   . LEU E 1 39  ? -22.20300 15.93000  -11.42500 1.000 69.08723  ? 948  LEU E C   1 
ATOM   3731 O  O   . LEU E 1 39  ? -22.27000 15.63900  -10.22300 1.000 68.41873  ? 948  LEU E O   1 
ATOM   3732 C  CB  . LEU E 1 39  ? -23.94100 15.14200  -13.10200 1.000 67.20543  ? 948  LEU E CB  1 
ATOM   3733 C  CG  . LEU E 1 39  ? -25.43100 15.10100  -13.45800 1.000 64.50247  ? 948  LEU E CG  1 
ATOM   3734 C  CD1 . LEU E 1 39  ? -25.72600 14.00400  -14.47300 1.000 63.53920  ? 948  LEU E CD1 1 
ATOM   3735 C  CD2 . LEU E 1 39  ? -26.29400 14.88600  -12.23100 1.000 64.18138  ? 948  LEU E CD2 1 
ATOM   3736 N  N   . GLN E 1 40  ? -21.05200 16.02400  -12.09900 1.000 78.83577  ? 949  GLN E N   1 
ATOM   3737 C  CA  . GLN E 1 40  ? -19.72000 15.75500  -11.47200 1.000 89.70812  ? 949  GLN E CA  1 
ATOM   3738 C  C   . GLN E 1 40  ? -19.53400 16.64800  -10.23900 1.000 88.41586  ? 949  GLN E C   1 
ATOM   3739 O  O   . GLN E 1 40  ? -19.12700 16.14000  -9.16300  1.000 83.11786  ? 949  GLN E O   1 
ATOM   3740 C  CB  . GLN E 1 40  ? -18.54300 16.01300  -12.42300 1.000 73.87728  ? 949  GLN E CB  1 
ATOM   3741 C  CG  . GLN E 1 40  ? -17.18300 15.80300  -11.75400 1.000 73.48513  ? 949  GLN E CG  1 
ATOM   3742 C  CD  . GLN E 1 40  ? -15.99700 15.73500  -12.68700 1.000 72.41658  ? 949  GLN E CD  1 
ATOM   3743 O  OE1 . GLN E 1 40  ? -16.01000 16.27300  -13.78700 1.000 82.22302  ? 949  GLN E OE1 1 
ATOM   3744 N  NE2 . GLN E 1 40  ? -14.94000 15.07700  -12.24300 1.000 69.86627  ? 949  GLN E NE2 1 
ATOM   3745 N  N   . ASP E 1 41  ? -19.78500 17.94700  -10.40900 1.000 90.54770  ? 950  ASP E N   1 
ATOM   3746 C  CA  . ASP E 1 41  ? -19.56300 18.97100  -9.35700  1.000 86.85252  ? 950  ASP E CA  1 
ATOM   3747 C  C   . ASP E 1 41  ? -20.45100 18.60400  -8.16100  1.000 91.13461  ? 950  ASP E C   1 
ATOM   3748 O  O   . ASP E 1 41  ? -19.89300 18.41200  -7.05900  1.000 94.41922  ? 950  ASP E O   1 
ATOM   3749 C  CB  . ASP E 1 41  ? -19.77800 20.38600  -9.91100  1.000 88.44481  ? 950  ASP E CB  1 
ATOM   3750 C  CG  . ASP E 1 41  ? -18.71800 20.85700  -10.90700 1.000 92.20316  ? 950  ASP E CG  1 
ATOM   3751 O  OD1 . ASP E 1 41  ? -17.65700 20.19500  -11.03200 1.000 89.35019  ? 950  ASP E OD1 1 
ATOM   3752 O  OD2 . ASP E 1 41  ? -18.95400 21.89700  -11.55300 1.000 97.35904  ? 950  ASP E OD2 1 
ATOM   3753 N  N   . VAL E 1 42  ? -21.75900 18.43500  -8.38500  1.000 92.15052  ? 951  VAL E N   1 
ATOM   3754 C  CA  . VAL E 1 42  ? -22.76800 18.20100  -7.30700  1.000 85.50499  ? 951  VAL E CA  1 
ATOM   3755 C  C   . VAL E 1 42  ? -22.52600 16.83800  -6.63800  1.000 88.73959  ? 951  VAL E C   1 
ATOM   3756 O  O   . VAL E 1 42  ? -22.61600 16.76600  -5.38700  1.000 87.96844  ? 951  VAL E O   1 
ATOM   3757 C  CB  . VAL E 1 42  ? -24.20400 18.32200  -7.84500  1.000 71.84282  ? 951  VAL E CB  1 
ATOM   3758 C  CG1 . VAL E 1 42  ? -25.23200 17.87400  -6.81500  1.000 68.93195  ? 951  VAL E CG1 1 
ATOM   3759 C  CG2 . VAL E 1 42  ? -24.48600 19.74000  -8.30500  1.000 83.71267  ? 951  VAL E CG2 1 
ATOM   3760 N  N   . VAL E 1 43  ? -22.24100 15.79000  -7.41200  1.000 68.83457  ? 952  VAL E N   1 
ATOM   3761 C  CA  . VAL E 1 43  ? -22.02000 14.43100  -6.84400  1.000 64.19980  ? 952  VAL E CA  1 
ATOM   3762 C  C   . VAL E 1 43  ? -20.85500 14.52000  -5.85800  1.000 71.04536  ? 952  VAL E C   1 
ATOM   3763 O  O   . VAL E 1 43  ? -21.00500 14.01800  -4.72400  1.000 74.41945  ? 952  VAL E O   1 
ATOM   3764 C  CB  . VAL E 1 43  ? -21.78600 13.37300  -7.93700  1.000 60.29670  ? 952  VAL E CB  1 
ATOM   3765 C  CG1 . VAL E 1 43  ? -21.10500 12.13100  -7.38600  1.000 71.61911  ? 952  VAL E CG1 1 
ATOM   3766 C  CG2 . VAL E 1 43  ? -23.08700 12.98500  -8.62400  1.000 59.10709  ? 952  VAL E CG2 1 
ATOM   3767 N  N   . ASN E 1 44  ? -19.76900 15.18600  -6.26500  1.000 81.65453  ? 953  ASN E N   1 
ATOM   3768 C  CA  . ASN E 1 44  ? -18.50300 15.30500  -5.49000  1.000 86.99464  ? 953  ASN E CA  1 
ATOM   3769 C  C   . ASN E 1 44  ? -18.71600 16.17600  -4.24000  1.000 88.41586  ? 953  ASN E C   1 
ATOM   3770 O  O   . ASN E 1 44  ? -18.17000 15.80900  -3.18600  1.000 93.15854  ? 953  ASN E O   1 
ATOM   3771 C  CB  . ASN E 1 44  ? -17.36000 15.82000  -6.37100  1.000 90.22134  ? 953  ASN E CB  1 
ATOM   3772 C  CG  . ASN E 1 44  ? -16.84100 14.79200  -7.36000  1.000 89.48441  ? 953  ASN E CG  1 
ATOM   3773 O  OD1 . ASN E 1 44  ? -16.86700 13.58500  -7.10500  1.000 79.94380  ? 953  ASN E OD1 1 
ATOM   3774 N  ND2 . ASN E 1 44  ? -16.34400 15.26300  -8.49400  1.000 94.10865  ? 953  ASN E ND2 1 
ATOM   3775 N  N   . GLN E 1 45  ? -19.46800 17.28000  -4.34200  1.000 87.66577  ? 954  GLN E N   1 
ATOM   3776 C  CA  . GLN E 1 45  ? -19.86000 18.11300  -3.17000  1.000 90.85037  ? 954  GLN E CA  1 
ATOM   3777 C  C   . GLN E 1 45  ? -20.57300 17.20900  -2.16100  1.000 89.53442  ? 954  GLN E C   1 
ATOM   3778 O  O   . GLN E 1 45  ? -20.12900 17.15800  -0.98900  1.000 90.75035  ? 954  GLN E O   1 
ATOM   3779 C  CB  . GLN E 1 45  ? -20.77700 19.27700  -3.56100  1.000 98.38022  ? 954  GLN E CB  1 
ATOM   3780 C  CG  . GLN E 1 45  ? -20.05700 20.42400  -4.26200  1.000 110.20532 ? 954  GLN E CG  1 
ATOM   3781 C  CD  . GLN E 1 45  ? -20.95500 21.60800  -4.54400  1.000 113.22147 ? 954  GLN E CD  1 
ATOM   3782 O  OE1 . GLN E 1 45  ? -22.17700 21.55100  -4.39300  1.000 117.80097 ? 954  GLN E OE1 1 
ATOM   3783 N  NE2 . GLN E 1 45  ? -20.34700 22.70700  -4.95900  1.000 106.52067 ? 954  GLN E NE2 1 
ATOM   3784 N  N   . ASN E 1 46  ? -21.61200 16.50300  -2.61900  1.000 91.21620  ? 955  ASN E N   1 
ATOM   3785 C  CA  . ASN E 1 46  ? -22.45900 15.62700  -1.76800  1.000 84.27853  ? 955  ASN E CA  1 
ATOM   3786 C  C   . ASN E 1 46  ? -21.57800 14.57100  -1.09600  1.000 77.64089  ? 955  ASN E C   1 
ATOM   3787 O  O   . ASN E 1 46  ? -21.76800 14.34400  0.10800   1.000 77.41191  ? 955  ASN E O   1 
ATOM   3788 C  CB  . ASN E 1 46  ? -23.59900 14.98200  -2.55400  1.000 86.63407  ? 955  ASN E CB  1 
ATOM   3789 C  CG  . ASN E 1 46  ? -24.66000 15.98100  -2.94800  1.000 93.42436  ? 955  ASN E CG  1 
ATOM   3790 O  OD1 . ASN E 1 46  ? -24.42100 17.18800  -2.92400  1.000 98.31968  ? 955  ASN E OD1 1 
ATOM   3791 N  ND2 . ASN E 1 46  ? -25.83300 15.47700  -3.30100  1.000 89.91341  ? 955  ASN E ND2 1 
ATOM   3792 N  N   . ALA E 1 47  ? -20.63700 13.97700  -1.83500  1.000 79.15686  ? 956  ALA E N   1 
ATOM   3793 C  CA  . ALA E 1 47  ? -19.68900 12.96300  -1.31400  1.000 84.49961  ? 956  ALA E CA  1 
ATOM   3794 C  C   . ALA E 1 47  ? -18.85600 13.56200  -0.17500  1.000 95.62199  ? 956  ALA E C   1 
ATOM   3795 O  O   . ALA E 1 47  ? -18.61300 12.86200  0.82600   1.000 99.67774  ? 956  ALA E O   1 
ATOM   3796 C  CB  . ALA E 1 47  ? -18.79900 12.45400  -2.41800  1.000 77.61720  ? 956  ALA E CB  1 
ATOM   3797 N  N   . GLN E 1 48  ? -18.42300 14.81300  -0.32200  1.000 94.24551  ? 957  GLN E N   1 
ATOM   3798 C  CA  . GLN E 1 48  ? -17.59000 15.50600  0.69500   1.000 98.01702  ? 957  GLN E CA  1 
ATOM   3799 C  C   . GLN E 1 48  ? -18.46600 15.84500  1.90700   1.000 94.25867  ? 957  GLN E C   1 
ATOM   3800 O  O   . GLN E 1 48  ? -18.01100 15.57000  3.03500   1.000 96.93531  ? 957  GLN E O   1 
ATOM   3801 C  CB  . GLN E 1 48  ? -16.91900 16.74500  0.09600   1.000 100.55679 ? 957  GLN E CB  1 
ATOM   3802 C  CG  . GLN E 1 48  ? -15.90800 16.41500  -0.99800  1.000 96.51157  ? 957  GLN E CG  1 
ATOM   3803 C  CD  . GLN E 1 48  ? -15.82500 17.48000  -2.06500  1.000 102.19910 ? 957  GLN E CD  1 
ATOM   3804 O  OE1 . GLN E 1 48  ? -16.39000 18.56400  -1.94200  1.000 111.86341 ? 957  GLN E OE1 1 
ATOM   3805 N  NE2 . GLN E 1 48  ? -15.12600 17.16900  -3.14400  1.000 94.75610  ? 957  GLN E NE2 1 
ATOM   3806 N  N   . ALA E 1 49  ? -19.67000 16.39600  1.67600   1.000 88.15004  ? 958  ALA E N   1 
ATOM   3807 C  CA  . ALA E 1 49  ? -20.68100 16.70700  2.72000   1.000 86.13401  ? 958  ALA E CA  1 
ATOM   3808 C  C   . ALA E 1 49  ? -20.94500 15.47200  3.59500   1.000 85.72870  ? 958  ALA E C   1 
ATOM   3809 O  O   . ALA E 1 49  ? -20.98600 15.61500  4.82400   1.000 85.37866  ? 958  ALA E O   1 
ATOM   3810 C  CB  . ALA E 1 49  ? -21.96300 17.19900  2.09600   1.000 74.45893  ? 958  ALA E CB  1 
ATOM   3811 N  N   . LEU E 1 50  ? -21.10900 14.29800  2.98200   1.000 83.05996  ? 959  LEU E N   1 
ATOM   3812 C  CA  . LEU E 1 50  ? -21.32200 13.01600  3.69800   1.000 77.16715  ? 959  LEU E CA  1 
ATOM   3813 C  C   . LEU E 1 50  ? -20.06400 12.59200  4.46900   1.000 78.27781  ? 959  LEU E C   1 
ATOM   3814 O  O   . LEU E 1 50  ? -20.23400 12.07100  5.57900   1.000 89.63180  ? 959  LEU E O   1 
ATOM   3815 C  CB  . LEU E 1 50  ? -21.69700 11.94100  2.68000   1.000 66.08424  ? 959  LEU E CB  1 
ATOM   3816 C  CG  . LEU E 1 50  ? -22.04400 10.58500  3.28600   1.000 64.14453  ? 959  LEU E CG  1 
ATOM   3817 C  CD1 . LEU E 1 50  ? -22.97400 10.73700  4.48000   1.000 59.85718  ? 959  LEU E CD1 1 
ATOM   3818 C  CD2 . LEU E 1 50  ? -22.66400 9.68700   2.23600   1.000 61.91269  ? 959  LEU E CD2 1 
ATOM   3819 N  N   . ASN E 1 51  ? -18.86500 12.76100  3.89500   1.000 78.84893  ? 960  ASN E N   1 
ATOM   3820 C  CA  . ASN E 1 51  ? -17.57000 12.37300  4.52800   1.000 86.57354  ? 960  ASN E CA  1 
ATOM   3821 C  C   . ASN E 1 51  ? -17.25600 13.27200  5.74000   1.000 91.24778  ? 960  ASN E C   1 
ATOM   3822 O  O   . ASN E 1 51  ? -16.71000 12.75300  6.74300   1.000 84.27853  ? 960  ASN E O   1 
ATOM   3823 C  CB  . ASN E 1 51  ? -16.40900 12.39800  3.53000   1.000 87.39995  ? 960  ASN E CB  1 
ATOM   3824 C  CG  . ASN E 1 51  ? -16.45900 11.28500  2.50400   1.000 80.91760  ? 960  ASN E CG  1 
ATOM   3825 O  OD1 . ASN E 1 51  ? -16.87700 10.16500  2.79400   1.000 69.07144  ? 960  ASN E OD1 1 
ATOM   3826 N  ND2 . ASN E 1 51  ? -16.00200 11.58200  1.29900   1.000 88.21584  ? 960  ASN E ND2 1 
ATOM   3827 N  N   . THR E 1 52  ? -17.56400 14.56900  5.66400   1.000 83.73109  ? 961  THR E N   1 
ATOM   3828 C  CA  . THR E 1 52  ? -17.40400 15.52200  6.79400   1.000 90.04764  ? 961  THR E CA  1 
ATOM   3829 C  C   . THR E 1 52  ? -18.41700 15.14300  7.88800   1.000 89.72918  ? 961  THR E C   1 
ATOM   3830 O  O   . THR E 1 52  ? -18.01000 15.06000  9.08400   1.000 86.14717  ? 961  THR E O   1 
ATOM   3831 C  CB  . THR E 1 52  ? -17.49900 16.97700  6.30700   1.000 92.82692  ? 961  THR E CB  1 
ATOM   3832 O  OG1 . THR E 1 52  ? -18.76000 17.16900  5.66200   1.000 88.95540  ? 961  THR E OG1 1 
ATOM   3833 C  CG2 . THR E 1 52  ? -16.38400 17.35400  5.35400   1.000 93.78230  ? 961  THR E CG2 1 
ATOM   3834 N  N   . LEU E 1 53  ? -19.67500 14.89400  7.49700   1.000 84.22852  ? 962  LEU E N   1 
ATOM   3835 C  CA  . LEU E 1 53  ? -20.76200 14.46200  8.42100   1.000 83.22314  ? 962  LEU E CA  1 
ATOM   3836 C  C   . LEU E 1 53  ? -20.25100 13.25200  9.20500   1.000 73.37985  ? 962  LEU E C   1 
ATOM   3837 O  O   . LEU E 1 53  ? -20.17400 13.34100  10.44100  1.000 78.70944  ? 962  LEU E O   1 
ATOM   3838 C  CB  . LEU E 1 53  ? -22.05400 14.14100  7.65300   1.000 71.60859  ? 962  LEU E CB  1 
ATOM   3839 C  CG  . LEU E 1 53  ? -23.20400 13.56300  8.48600   1.000 68.98196  ? 962  LEU E CG  1 
ATOM   3840 C  CD1 . LEU E 1 53  ? -23.60200 14.49600  9.62300   1.000 77.53561  ? 962  LEU E CD1 1 
ATOM   3841 C  CD2 . LEU E 1 53  ? -24.42600 13.25700  7.62600   1.000 67.24227  ? 962  LEU E CD2 1 
ATOM   3842 N  N   . VAL E 1 54  ? -19.86000 12.19200  8.49900   1.000 74.25364  ? 963  VAL E N   1 
ATOM   3843 C  CA  . VAL E 1 54  ? -19.40100 10.91800  9.12100   1.000 69.99260  ? 963  VAL E CA  1 
ATOM   3844 C  C   . VAL E 1 54  ? -18.34900 11.22700  10.19500  1.000 84.07587  ? 963  VAL E C   1 
ATOM   3845 O  O   . VAL E 1 54  ? -18.53300 10.77000  11.34100  1.000 72.12444  ? 963  VAL E O   1 
ATOM   3846 C  CB  . VAL E 1 54  ? -18.87100 9.93000   8.06900   1.000 64.77882  ? 963  VAL E CB  1 
ATOM   3847 C  CG1 . VAL E 1 54  ? -17.97800 8.86400   8.68700   1.000 64.11558  ? 963  VAL E CG1 1 
ATOM   3848 C  CG2 . VAL E 1 54  ? -20.01400 9.29200   7.30200   1.000 60.92046  ? 963  VAL E CG2 1 
ATOM   3849 N  N   . LYS E 1 55  ? -17.30000 11.97900  9.84500   1.000 90.45558  ? 964  LYS E N   1 
ATOM   3850 C  CA  . LYS E 1 55  ? -16.17600 12.30800  10.76700  1.000 93.49016  ? 964  LYS E CA  1 
ATOM   3851 C  C   . LYS E 1 55  ? -16.72700 13.07000  11.97900  1.000 92.11631  ? 964  LYS E C   1 
ATOM   3852 O  O   . LYS E 1 55  ? -16.44700 12.65000  13.11600  1.000 91.99787  ? 964  LYS E O   1 
ATOM   3853 C  CB  . LYS E 1 55  ? -15.07700 13.08900  10.03800  1.000 93.69544  ? 964  LYS E CB  1 
ATOM   3854 C  CG  . LYS E 1 55  ? -14.23800 12.24900  9.08400   1.000 92.62690  ? 964  LYS E CG  1 
ATOM   3855 C  CD  . LYS E 1 55  ? -13.13900 13.02600  8.39500   1.000 97.47748  ? 964  LYS E CD  1 
ATOM   3856 C  CE  . LYS E 1 55  ? -12.27600 12.16600  7.49600   1.000 89.27386  ? 964  LYS E CE  1 
ATOM   3857 N  NZ  . LYS E 1 55  ? -10.85900 12.60300  7.52200   1.000 82.45462  ? 964  LYS E NZ  1 
ATOM   3858 N  N   . GLN E 1 56  ? -17.51800 14.12000  11.75200  1.000 85.04441  ? 965  GLN E N   1 
ATOM   3859 C  CA  . GLN E 1 56  ? -18.09000 14.93300  12.85300  1.000 82.85730  ? 965  GLN E CA  1 
ATOM   3860 C  C   . GLN E 1 56  ? -18.99000 14.04400  13.72700  1.000 91.38727  ? 965  GLN E C   1 
ATOM   3861 O  O   . GLN E 1 56  ? -18.97500 14.22600  14.96300  1.000 98.83290  ? 965  GLN E O   1 
ATOM   3862 C  CB  . GLN E 1 56  ? -18.80700 16.16000  12.28900  1.000 80.86759  ? 965  GLN E CB  1 
ATOM   3863 C  CG  . GLN E 1 56  ? -19.19800 17.17000  13.36100  1.000 89.84235  ? 965  GLN E CG  1 
ATOM   3864 C  CD  . GLN E 1 56  ? -18.00500 17.69600  14.12400  1.000 92.76375  ? 965  GLN E CD  1 
ATOM   3865 O  OE1 . GLN E 1 56  ? -17.75500 17.32400  15.27200  1.000 97.33009  ? 965  GLN E OE1 1 
ATOM   3866 N  NE2 . GLN E 1 56  ? -17.23600 18.55200  13.47000  1.000 91.79522  ? 965  GLN E NE2 1 
ATOM   3867 N  N   . LEU E 1 57  ? -19.71900 13.09800  13.12700  1.000 85.09968  ? 966  LEU E N   1 
ATOM   3868 C  CA  . LEU E 1 57  ? -20.62400 12.17100  13.86200  1.000 82.07826  ? 966  LEU E CA  1 
ATOM   3869 C  C   . LEU E 1 57  ? -19.80000 11.24700  14.76300  1.000 81.56767  ? 966  LEU E C   1 
ATOM   3870 O  O   . LEU E 1 57  ? -20.19900 11.05100  15.92900  1.000 77.50140  ? 966  LEU E O   1 
ATOM   3871 C  CB  . LEU E 1 57  ? -21.45000 11.34700  12.87300  1.000 71.75334  ? 966  LEU E CB  1 
ATOM   3872 C  CG  . LEU E 1 57  ? -22.61600 12.06800  12.20500  1.000 79.63850  ? 966  LEU E CG  1 
ATOM   3873 C  CD1 . LEU E 1 57  ? -23.29000 11.13700  11.20600  1.000 77.29085  ? 966  LEU E CD1 1 
ATOM   3874 C  CD2 . LEU E 1 57  ? -23.61500 12.58400  13.23300  1.000 75.06163  ? 966  LEU E CD2 1 
ATOM   3875 N  N   . SER E 1 58  ? -18.71000 10.68200  14.23800  1.000 87.68157  ? 967  SER E N   1 
ATOM   3876 C  CA  . SER E 1 58  ? -17.83100 9.74800   14.98800  1.000 78.43835  ? 967  SER E CA  1 
ATOM   3877 C  C   . SER E 1 58  ? -17.22100 10.48400  16.19000  1.000 88.73696  ? 967  SER E C   1 
ATOM   3878 O  O   . SER E 1 58  ? -17.09900 9.85400   17.27100  1.000 87.42364  ? 967  SER E O   1 
ATOM   3879 C  CB  . SER E 1 58  ? -16.79700 9.11800   14.09400  1.000 75.02742  ? 967  SER E CB  1 
ATOM   3880 O  OG  . SER E 1 58  ? -16.63200 9.86900   12.90100  1.000 89.47652  ? 967  SER E OG  1 
ATOM   3881 N  N   . SER E 1 59  ? -16.91700 11.77800  16.02200  1.000 80.53071  ? 968  SER E N   1 
ATOM   3882 C  CA  . SER E 1 59  ? -16.40600 12.68600  17.08600  1.000 88.78170  ? 968  SER E CA  1 
ATOM   3883 C  C   . SER E 1 59  ? -17.47600 12.88300  18.16900  1.000 85.77871  ? 968  SER E C   1 
ATOM   3884 O  O   . SER E 1 59  ? -17.12100 12.88600  19.36600  1.000 82.55463  ? 968  SER E O   1 
ATOM   3885 C  CB  . SER E 1 59  ? -15.95300 14.01200  16.51300  1.000 93.60070  ? 968  SER E CB  1 
ATOM   3886 O  OG  . SER E 1 59  ? -15.70700 14.95500  17.54800  1.000 92.60584  ? 968  SER E OG  1 
ATOM   3887 N  N   . ASN E 1 60  ? -18.73200 13.06600  17.76100  1.000 81.30975  ? 969  ASN E N   1 
ATOM   3888 C  CA  . ASN E 1 60  ? -19.86500 13.32900  18.68500  1.000 81.88877  ? 969  ASN E CA  1 
ATOM   3889 C  C   . ASN E 1 60  ? -20.17200 12.06200  19.48600  1.000 78.00409  ? 969  ASN E C   1 
ATOM   3890 O  O   . ASN E 1 60  ? -20.37900 12.18500  20.69200  1.000 86.18665  ? 969  ASN E O   1 
ATOM   3891 C  CB  . ASN E 1 60  ? -21.10600 13.82700  17.94500  1.000 86.64460  ? 969  ASN E CB  1 
ATOM   3892 C  CG  . ASN E 1 60  ? -20.97600 15.24900  17.44400  1.000 96.95110  ? 969  ASN E CG  1 
ATOM   3893 O  OD1 . ASN E 1 60  ? -19.89500 15.83700  17.47900  1.000 92.71375  ? 969  ASN E OD1 1 
ATOM   3894 N  ND2 . ASN E 1 60  ? -22.08000 15.81100  16.97600  1.000 105.51002 ? 969  ASN E ND2 1 
ATOM   3895 N  N   . PHE E 1 61  ? -20.21100 10.89400  18.84100  1.000 79.17265  ? 970  PHE E N   1 
ATOM   3896 C  CA  . PHE E 1 61  ? -20.54200 9.59900   19.49200  1.000 82.59938  ? 970  PHE E CA  1 
ATOM   3897 C  C   . PHE E 1 61  ? -19.44600 9.18700   20.47700  1.000 89.06594  ? 970  PHE E C   1 
ATOM   3898 O  O   . PHE E 1 61  ? -19.79400 8.64700   21.55200  1.000 89.65812  ? 970  PHE E O   1 
ATOM   3899 C  CB  . PHE E 1 61  ? -20.69900 8.47300   18.47100  1.000 77.95672  ? 970  PHE E CB  1 
ATOM   3900 C  CG  . PHE E 1 61  ? -22.00600 8.48200   17.72800  1.000 73.49829  ? 970  PHE E CG  1 
ATOM   3901 C  CD1 . PHE E 1 61  ? -23.20700 8.64600   18.39800  1.000 76.30652  ? 970  PHE E CD1 1 
ATOM   3902 C  CD2 . PHE E 1 61  ? -22.03000 8.30300   16.35900  1.000 68.13975  ? 970  PHE E CD2 1 
ATOM   3903 C  CE1 . PHE E 1 61  ? -24.40500 8.64800   17.70500  1.000 74.77739  ? 970  PHE E CE1 1 
ATOM   3904 C  CE2 . PHE E 1 61  ? -23.22800 8.30900   15.66800  1.000 67.81866  ? 970  PHE E CE2 1 
ATOM   3905 C  CZ  . PHE E 1 61  ? -24.41200 8.48200   16.34100  1.000 69.54518  ? 970  PHE E CZ  1 
ATOM   3906 N  N   . GLY E 1 62  ? -18.17500 9.36400   20.09300  1.000 94.07444  ? 971  GLY E N   1 
ATOM   3907 C  CA  . GLY E 1 62  ? -17.03200 9.22700   21.01200  1.000 79.67534  ? 971  GLY E CA  1 
ATOM   3908 C  C   . GLY E 1 62  ? -17.29100 10.00800  22.29000  1.000 83.39421  ? 971  GLY E C   1 
ATOM   3909 O  O   . GLY E 1 62  ? -17.35100 9.37800   23.36900  1.000 87.02359  ? 971  GLY E O   1 
ATOM   3910 N  N   . ALA E 1 63  ? -17.50300 11.32300  22.14700  1.000 89.69496  ? 972  ALA E N   1 
ATOM   3911 C  CA  . ALA E 1 63  ? -17.73900 12.29600  23.24000  1.000 92.90851  ? 972  ALA E CA  1 
ATOM   3912 C  C   . ALA E 1 63  ? -18.90100 11.82500  24.12200  1.000 95.18773  ? 972  ALA E C   1 
ATOM   3913 O  O   . ALA E 1 63  ? -18.76600 11.89700  25.35600  1.000 100.86473 ? 972  ALA E O   1 
ATOM   3914 C  CB  . ALA E 1 63  ? -17.99100 13.67400  22.66500  1.000 89.58969  ? 972  ALA E CB  1 
ATOM   3915 N  N   . ILE E 1 64  ? -19.99300 11.35200  23.51500  1.000 93.21381  ? 973  ILE E N   1 
ATOM   3916 C  CA  . ILE E 1 64  ? -21.21200 10.88300  24.24000  1.000 91.28463  ? 973  ILE E CA  1 
ATOM   3917 C  C   . ILE E 1 64  ? -20.82800 9.66900   25.09700  1.000 89.71865  ? 973  ILE E C   1 
ATOM   3918 O  O   . ILE E 1 64  ? -21.14400 9.68600   26.29900  1.000 89.70023  ? 973  ILE E O   1 
ATOM   3919 C  CB  . ILE E 1 64  ? -22.36600 10.56700  23.26100  1.000 92.89272  ? 973  ILE E CB  1 
ATOM   3920 C  CG1 . ILE E 1 64  ? -22.91400 11.82800  22.58800  1.000 89.05805  ? 973  ILE E CG1 1 
ATOM   3921 C  CG2 . ILE E 1 64  ? -23.47500 9.78700   23.95600  1.000 97.61170  ? 973  ILE E CG2 1 
ATOM   3922 C  CD1 . ILE E 1 64  ? -23.74200 11.55900  21.34600  1.000 80.86233  ? 973  ILE E CD1 1 
ATOM   3923 N  N   . SER E 1 65  ? -20.17700 8.66500   24.49500  1.000 104.23355 ? 974  SER E N   1 
ATOM   3924 C  CA  . SER E 1 65  ? -19.77400 7.37800   25.13400  1.000 99.94619  ? 974  SER E CA  1 
ATOM   3925 C  C   . SER E 1 65  ? -18.87700 7.65000   26.34900  1.000 102.18594 ? 974  SER E C   1 
ATOM   3926 O  O   . SER E 1 65  ? -19.06800 6.99300   27.39800  1.000 96.69844  ? 974  SER E O   1 
ATOM   3927 C  CB  . SER E 1 65  ? -19.08100 6.46900   24.14000  1.000 97.42484  ? 974  SER E CB  1 
ATOM   3928 O  OG  . SER E 1 65  ? -18.92600 5.15700   24.66200  1.000 94.55081  ? 974  SER E OG  1 
ATOM   3929 N  N   . SER E 1 66  ? -17.92800 8.57800   26.20300  1.000 100.26465 ? 975  SER E N   1 
ATOM   3930 C  CA  . SER E 1 66  ? -17.04600 9.06100   27.29700  1.000 102.10435 ? 975  SER E CA  1 
ATOM   3931 C  C   . SER E 1 66  ? -17.91500 9.57300   28.45500  1.000 101.98328 ? 975  SER E C   1 
ATOM   3932 O  O   . SER E 1 66  ? -17.76400 9.05200   29.57600  1.000 98.78553  ? 975  SER E O   1 
ATOM   3933 C  CB  . SER E 1 66  ? -16.09300 10.12700  26.80600  1.000 106.44961 ? 975  SER E CB  1 
ATOM   3934 O  OG  . SER E 1 66  ? -16.69300 11.41700  26.84800  1.000 113.64257 ? 975  SER E OG  1 
ATOM   3935 N  N   . VAL E 1 67  ? -18.81600 10.52400  28.17200  1.000 103.38345 ? 976  VAL E N   1 
ATOM   3936 C  CA  . VAL E 1 67  ? -19.67400 11.21900  29.18100  1.000 101.78062 ? 976  VAL E CA  1 
ATOM   3937 C  C   . VAL E 1 67  ? -20.60800 10.19600  29.83500  1.000 96.43525  ? 976  VAL E C   1 
ATOM   3938 O  O   . VAL E 1 67  ? -20.84500 10.31700  31.04200  1.000 95.61936  ? 976  VAL E O   1 
ATOM   3939 C  CB  . VAL E 1 67  ? -20.47600 12.38800  28.57100  1.000 93.25855  ? 976  VAL E CB  1 
ATOM   3940 C  CG1 . VAL E 1 67  ? -21.40600 13.02200  29.59100  1.000 95.16404  ? 976  VAL E CG1 1 
ATOM   3941 C  CG2 . VAL E 1 67  ? -19.57300 13.45100  27.96700  1.000 102.82812 ? 976  VAL E CG2 1 
ATOM   3942 N  N   . LEU E 1 68  ? -21.13900 9.24700   29.06600  1.000 104.90732 ? 977  LEU E N   1 
ATOM   3943 C  CA  . LEU E 1 68  ? -22.05700 8.19800   29.58500  1.000 108.30246 ? 977  LEU E CA  1 
ATOM   3944 C  C   . LEU E 1 68  ? -21.30800 7.30300   30.58000  1.000 110.04741 ? 977  LEU E C   1 
ATOM   3945 O  O   . LEU E 1 68  ? -21.87300 7.01600   31.65600  1.000 109.80001 ? 977  LEU E O   1 
ATOM   3946 C  CB  . LEU E 1 68  ? -22.62800 7.38400   28.41600  1.000 104.17565 ? 977  LEU E CB  1 
ATOM   3947 C  CG  . LEU E 1 68  ? -23.85100 7.99000   27.72300  1.000 99.60668  ? 977  LEU E CG  1 
ATOM   3948 C  CD1 . LEU E 1 68  ? -24.29900 7.13600   26.55000  1.000 89.27386  ? 977  LEU E CD1 1 
ATOM   3949 C  CD2 . LEU E 1 68  ? -25.00300 8.17200   28.70100  1.000 95.55356  ? 977  LEU E CD2 1 
ATOM   3950 N  N   . ASN E 1 69  ? -20.08500 6.88800   30.23700  1.000 118.94321 ? 978  ASN E N   1 
ATOM   3951 C  CA  . ASN E 1 69  ? -19.24200 5.99000   31.07000  1.000 121.44088 ? 978  ASN E CA  1 
ATOM   3952 C  C   . ASN E 1 69  ? -18.85300 6.70600   32.37300  1.000 122.32519 ? 978  ASN E C   1 
ATOM   3953 O  O   . ASN E 1 69  ? -18.83800 6.02500   33.41900  1.000 122.45152 ? 978  ASN E O   1 
ATOM   3954 C  CB  . ASN E 1 69  ? -18.03300 5.47900   30.28300  1.000 124.76496 ? 978  ASN E CB  1 
ATOM   3955 C  CG  . ASN E 1 69  ? -18.42200 4.49000   29.20200  1.000 121.89093 ? 978  ASN E CG  1 
ATOM   3956 O  OD1 . ASN E 1 69  ? -19.23800 3.59900   29.42700  1.000 121.43561 ? 978  ASN E OD1 1 
ATOM   3957 N  ND2 . ASN E 1 69  ? -17.85100 4.64100   28.01800  1.000 119.51433 ? 978  ASN E ND2 1 
ATOM   3958 N  N   . ASP E 1 70  ? -18.56000 8.01300   32.31600  1.000 122.44100 ? 979  ASP E N   1 
ATOM   3959 C  CA  . ASP E 1 70  ? -18.23600 8.86100   33.50200  1.000 121.75670 ? 979  ASP E CA  1 
ATOM   3960 C  C   . ASP E 1 70  ? -19.45500 8.94700   34.42800  1.000 127.71531 ? 979  ASP E C   1 
ATOM   3961 O  O   . ASP E 1 70  ? -19.26000 8.90600   35.66200  1.000 123.98065 ? 979  ASP E O   1 
ATOM   3962 C  CB  . ASP E 1 70  ? -17.79000 10.27600  33.11300  1.000 126.33094 ? 979  ASP E CB  1 
ATOM   3963 C  CG  . ASP E 1 70  ? -16.28300 10.47000  33.05600  1.000 135.20305 ? 979  ASP E CG  1 
ATOM   3964 O  OD1 . ASP E 1 70  ? -15.58900 9.58000   32.52400  1.000 137.67967 ? 979  ASP E OD1 1 
ATOM   3965 O  OD2 . ASP E 1 70  ? -15.81500 11.51100  33.55300  1.000 140.58265 ? 979  ASP E OD2 1 
ATOM   3966 N  N   . ILE E 1 71  ? -20.65600 9.08300   33.85300  1.000 123.66746 ? 980  ILE E N   1 
ATOM   3967 C  CA  . ILE E 1 71  ? -21.93500 9.23900   34.60700  1.000 119.66172 ? 980  ILE E CA  1 
ATOM   3968 C  C   . ILE E 1 71  ? -22.26600 7.91100   35.29900  1.000 111.97922 ? 980  ILE E C   1 
ATOM   3969 O  O   . ILE E 1 71  ? -22.75400 7.96400   36.44000  1.000 106.54699 ? 980  ILE E O   1 
ATOM   3970 C  CB  . ILE E 1 71  ? -23.07200 9.73500   33.68700  1.000 115.87442 ? 980  ILE E CB  1 
ATOM   3971 C  CG1 . ILE E 1 71  ? -22.89700 11.21500  33.33200  1.000 109.92897 ? 980  ILE E CG1 1 
ATOM   3972 C  CG2 . ILE E 1 71  ? -24.43300 9.46800   34.31600  1.000 121.26191 ? 980  ILE E CG2 1 
ATOM   3973 C  CD1 . ILE E 1 71  ? -23.73900 11.67800  32.16800  1.000 109.80790 ? 980  ILE E CD1 1 
ATOM   3974 N  N   . LEU E 1 72  ? -22.00500 6.77700   34.63900  1.000 123.32794 ? 981  LEU E N   1 
ATOM   3975 C  CA  . LEU E 1 72  ? -22.27600 5.41300   35.17500  1.000 120.85660 ? 981  LEU E CA  1 
ATOM   3976 C  C   . LEU E 1 72  ? -21.31300 5.07600   36.32200  1.000 127.17051 ? 981  LEU E C   1 
ATOM   3977 O  O   . LEU E 1 72  ? -21.74900 4.38300   37.26100  1.000 125.51768 ? 981  LEU E O   1 
ATOM   3978 C  CB  . LEU E 1 72  ? -22.14800 4.39300   34.04100  1.000 108.85516 ? 981  LEU E CB  1 
ATOM   3979 C  CG  . LEU E 1 72  ? -23.29500 4.38800   33.03500  1.000 108.38931 ? 981  LEU E CG  1 
ATOM   3980 C  CD1 . LEU E 1 72  ? -23.01600 3.39600   31.91400  1.000 100.54363 ? 981  LEU E CD1 1 
ATOM   3981 C  CD2 . LEU E 1 72  ? -24.62200 4.07500   33.71900  1.000 99.90672  ? 981  LEU E CD2 1 
ATOM   3982 N  N   . SER E 1 73  ? -20.05400 5.52400   36.23700  1.000 131.52893 ? 982  SER E N   1 
ATOM   3983 C  CA  . SER E 1 73  ? -19.02000 5.36500   37.29500  1.000 134.30031 ? 982  SER E CA  1 
ATOM   3984 C  C   . SER E 1 73  ? -19.36000 6.25500   38.49400  1.000 142.30654 ? 982  SER E C   1 
ATOM   3985 O  O   . SER E 1 73  ? -19.10800 5.81800   39.62900  1.000 152.42880 ? 982  SER E O   1 
ATOM   3986 C  CB  . SER E 1 73  ? -17.63600 5.66500   36.78000  1.000 135.27148 ? 982  SER E CB  1 
ATOM   3987 O  OG  . SER E 1 73  ? -17.19500 4.63700   35.90700  1.000 131.04729 ? 982  SER E OG  1 
ATOM   3988 N  N   . ARG E 1 74  ? -19.89300 7.45700   38.24700  1.000 132.19480 ? 983  ARG E N   1 
ATOM   3989 C  CA  . ARG E 1 74  ? -20.28400 8.43700   39.29800  1.000 126.74678 ? 983  ARG E CA  1 
ATOM   3990 C  C   . ARG E 1 74  ? -21.55200 7.97500   40.01900  1.000 119.74594 ? 983  ARG E C   1 
ATOM   3991 O  O   . ARG E 1 74  ? -21.72500 8.37100   41.18100  1.000 121.81987 ? 983  ARG E O   1 
ATOM   3992 C  CB  . ARG E 1 74  ? -20.55500 9.81600   38.70000  1.000 129.87610 ? 983  ARG E CB  1 
ATOM   3993 C  CG  . ARG E 1 74  ? -19.30500 10.65200  38.46800  1.000 134.41085 ? 983  ARG E CG  1 
ATOM   3994 C  CD  . ARG E 1 74  ? -19.61800 12.00700  37.86300  1.000 138.10340 ? 983  ARG E CD  1 
ATOM   3995 N  NE  . ARG E 1 74  ? -18.44300 12.81000  37.56600  1.000 144.00674 ? 983  ARG E NE  1 
ATOM   3996 C  CZ  . ARG E 1 74  ? -18.38500 14.13900  37.65100  1.000 146.61758 ? 983  ARG E CZ  1 
ATOM   3997 N  NH1 . ARG E 1 74  ? -19.43700 14.84400  38.04300  1.000 143.07242 ? 983  ARG E NH1 1 
ATOM   3998 N  NH2 . ARG E 1 74  ? -17.25900 14.76300  37.35100  1.000 150.28381 ? 983  ARG E NH2 1 
ATOM   3999 N  N   . LEU E 1 75  ? -22.42600 7.23900   39.32200  1.000 127.34422 ? 984  LEU E N   1 
ATOM   4000 C  CA  . LEU E 1 75  ? -23.64200 6.59800   39.89300  1.000 127.97850 ? 984  LEU E CA  1 
ATOM   4001 C  C   . LEU E 1 75  ? -23.22100 5.43800   40.79500  1.000 134.09503 ? 984  LEU E C   1 
ATOM   4002 O  O   . LEU E 1 75  ? -23.77000 5.33600   41.90700  1.000 138.20604 ? 984  LEU E O   1 
ATOM   4003 C  CB  . LEU E 1 75  ? -24.55300 6.07900   38.77300  1.000 120.29074 ? 984  LEU E CB  1 
ATOM   4004 C  CG  . LEU E 1 75  ? -25.64600 7.03100   38.29100  1.000 114.61111 ? 984  LEU E CG  1 
ATOM   4005 C  CD1 . LEU E 1 75  ? -26.36500 6.43400   37.09300  1.000 111.53179 ? 984  LEU E CD1 1 
ATOM   4006 C  CD2 . LEU E 1 75  ? -26.64100 7.34700   39.39900  1.000 120.39338 ? 984  LEU E CD2 1 
ATOM   4007 N  N   . ASP E 1 76  ? -22.29900 4.59400   40.31700  1.000 141.55645 ? 985  ASP E N   1 
ATOM   4008 C  CA  . ASP E 1 76  ? -21.82600 3.37200   41.02500  1.000 143.91462 ? 985  ASP E CA  1 
ATOM   4009 C  C   . ASP E 1 76  ? -21.20600 3.76500   42.37500  1.000 145.14372 ? 985  ASP E C   1 
ATOM   4010 O  O   . ASP E 1 76  ? -21.55600 3.11900   43.38500  1.000 141.70646 ? 985  ASP E O   1 
ATOM   4011 C  CB  . ASP E 1 76  ? -20.86700 2.56300   40.14500  1.000 145.20425 ? 985  ASP E CB  1 
ATOM   4012 C  CG  . ASP E 1 76  ? -21.55400 1.81900   39.01100  1.000 142.99872 ? 985  ASP E CG  1 
ATOM   4013 O  OD1 . ASP E 1 76  ? -22.70600 1.38400   39.20800  1.000 140.00363 ? 985  ASP E OD1 1 
ATOM   4014 O  OD2 . ASP E 1 76  ? -20.93000 1.67800   37.93900  1.000 143.25665 ? 985  ASP E OD2 1 
ATOM   4015 N  N   . LYS E 1 77  ? -20.35000 4.79900   42.39000  1.000 149.59952 ? 986  LYS E N   1 
ATOM   4016 C  CA  . LYS E 1 77  ? -19.63100 5.31200   43.59400  1.000 151.25498 ? 986  LYS E CA  1 
ATOM   4017 C  C   . LYS E 1 77  ? -20.60500 5.98800   44.56700  1.000 150.57858 ? 986  LYS E C   1 
ATOM   4018 O  O   . LYS E 1 77  ? -20.22800 6.15300   45.74600  1.000 152.96308 ? 986  LYS E O   1 
ATOM   4019 C  CB  . LYS E 1 77  ? -18.53600 6.30600   43.19800  1.000 154.61591 ? 986  LYS E CB  1 
ATOM   4020 C  CG  . LYS E 1 77  ? -17.35900 5.68300   42.46400  1.000 157.23464 ? 986  LYS E CG  1 
ATOM   4021 C  CD  . LYS E 1 77  ? -16.28600 6.66900   42.07600  1.000 157.86103 ? 986  LYS E CD  1 
ATOM   4022 C  CE  . LYS E 1 77  ? -15.26200 6.05300   41.14800  1.000 155.70814 ? 986  LYS E CE  1 
ATOM   4023 N  NZ  . LYS E 1 77  ? -13.98800 6.80900   41.16300  1.000 161.41409 ? 986  LYS E NZ  1 
ATOM   4024 N  N   . VAL E 1 78  ? -21.77700 6.41100   44.08000  1.000 150.41540 ? 987  VAL E N   1 
ATOM   4025 C  CA  . VAL E 1 78  ? -22.91700 6.89700   44.91500  1.000 148.25988 ? 987  VAL E CA  1 
ATOM   4026 C  C   . VAL E 1 78  ? -23.76300 5.68100   45.33400  1.000 145.58324 ? 987  VAL E C   1 
ATOM   4027 O  O   . VAL E 1 78  ? -24.08500 5.58400   46.53200  1.000 147.01500 ? 987  VAL E O   1 
ATOM   4028 C  CB  . VAL E 1 78  ? -23.74600 7.97300   44.18000  1.000 145.67010 ? 987  VAL E CB  1 
ATOM   4029 C  CG1 . VAL E 1 78  ? -25.08700 8.23100   44.85300  1.000 142.64868 ? 987  VAL E CG1 1 
ATOM   4030 C  CG2 . VAL E 1 78  ? -22.97300 9.27700   44.02900  1.000 145.54377 ? 987  VAL E CG2 1 
ATOM   4031 N  N   . GLU E 1 79  ? -24.08700 4.78100   44.39400  1.000 143.72776 ? 988  GLU E N   1 
ATOM   4032 C  CA  . GLU E 1 79  ? -24.88800 3.54500   44.63700  1.000 139.11142 ? 988  GLU E CA  1 
ATOM   4033 C  C   . GLU E 1 79  ? -24.11300 2.61500   45.58100  1.000 140.61949 ? 988  GLU E C   1 
ATOM   4034 O  O   . GLU E 1 79  ? -24.57900 1.47200   45.77400  1.000 133.38705 ? 988  GLU E O   1 
ATOM   4035 C  CB  . GLU E 1 79  ? -25.20700 2.82000   43.32300  1.000 139.96152 ? 988  GLU E CB  1 
ATOM   4036 C  CG  . GLU E 1 79  ? -26.38700 3.39700   42.55200  1.000 142.54077 ? 988  GLU E CG  1 
ATOM   4037 C  CD  . GLU E 1 79  ? -26.81800 2.57900   41.33800  1.000 139.57989 ? 988  GLU E CD  1 
ATOM   4038 O  OE1 . GLU E 1 79  ? -25.98300 1.82400   40.80300  1.000 140.99322 ? 988  GLU E OE1 1 
ATOM   4039 O  OE2 . GLU E 1 79  ? -27.99400 2.68200   40.93700  1.000 132.19480 ? 988  GLU E OE2 1 
ATOM   4040 N  N   . ASP E 1 87  ? -20.16400 0.19400   30.85400  1.000 128.32065 ? 1163 ASP E N   1 
ATOM   4041 C  CA  . ASP E 1 87  ? -19.46400 0.14100   29.54100  1.000 127.74163 ? 1163 ASP E CA  1 
ATOM   4042 C  C   . ASP E 1 87  ? -20.51300 0.23300   28.42200  1.000 123.38585 ? 1163 ASP E C   1 
ATOM   4043 O  O   . ASP E 1 87  ? -21.34400 -0.69500  28.28900  1.000 114.00841 ? 1163 ASP E O   1 
ATOM   4044 C  CB  . ASP E 1 87  ? -18.56500 -1.09500  29.46800  1.000 122.91211 ? 1163 ASP E CB  1 
ATOM   4045 C  CG  . ASP E 1 87  ? -18.04700 -1.40000  28.08200  1.000 116.61398 ? 1163 ASP E CG  1 
ATOM   4046 O  OD1 . ASP E 1 87  ? -17.60200 -0.45000  27.39900  1.000 117.97730 ? 1163 ASP E OD1 1 
ATOM   4047 O  OD2 . ASP E 1 87  ? -18.08400 -2.58800  27.71100  1.000 111.93184 ? 1163 ASP E OD2 1 
ATOM   4048 N  N   . VAL E 1 88  ? -20.47400 1.33700   27.66800  1.000 124.22542 ? 1164 VAL E N   1 
ATOM   4049 C  CA  . VAL E 1 88  ? -21.46300 1.70700   26.61600  1.000 118.27208 ? 1164 VAL E CA  1 
ATOM   4050 C  C   . VAL E 1 88  ? -20.67300 2.14000   25.37500  1.000 120.05650 ? 1164 VAL E C   1 
ATOM   4051 O  O   . VAL E 1 88  ? -20.81300 3.30900   24.96800  1.000 134.47139 ? 1164 VAL E O   1 
ATOM   4052 C  CB  . VAL E 1 88  ? -22.40400 2.82000   27.12100  1.000 124.28859 ? 1164 VAL E CB  1 
ATOM   4053 C  CG1 . VAL E 1 88  ? -23.52300 3.12000   26.13500  1.000 126.69151 ? 1164 VAL E CG1 1 
ATOM   4054 C  CG2 . VAL E 1 88  ? -22.97900 2.49900   28.49500  1.000 121.66459 ? 1164 VAL E CG2 1 
ATOM   4055 N  N   . ASP E 1 89  ? -19.82300 1.25500   24.83500  1.000 121.93041 ? 1165 ASP E N   1 
ATOM   4056 C  CA  . ASP E 1 89  ? -19.11000 1.50300   23.55000  1.000 123.01212 ? 1165 ASP E CA  1 
ATOM   4057 C  C   . ASP E 1 89  ? -20.12300 1.34500   22.41300  1.000 112.51612 ? 1165 ASP E C   1 
ATOM   4058 O  O   . ASP E 1 89  ? -20.64800 0.22500   22.23000  1.000 96.34839  ? 1165 ASP E O   1 
ATOM   4059 C  CB  . ASP E 1 89  ? -17.93000 0.56600   23.28900  1.000 123.41480 ? 1165 ASP E CB  1 
ATOM   4060 C  CG  . ASP E 1 89  ? -17.06500 0.25100   24.49300  1.000 130.42880 ? 1165 ASP E CG  1 
ATOM   4061 O  OD1 . ASP E 1 89  ? -16.51400 1.19600   25.09800  1.000 136.12422 ? 1165 ASP E OD1 1 
ATOM   4062 O  OD2 . ASP E 1 89  ? -16.94400 -0.94800  24.80300  1.000 128.43645 ? 1165 ASP E OD2 1 
ATOM   4063 N  N   . LEU E 1 90  ? -20.35300 2.42700   21.66900  1.000 107.15232 ? 1166 LEU E N   1 
ATOM   4064 C  CA  . LEU E 1 90  ? -21.53600 2.60000   20.78700  1.000 106.97862 ? 1166 LEU E CA  1 
ATOM   4065 C  C   . LEU E 1 90  ? -21.38500 1.77400   19.50900  1.000 110.01582 ? 1166 LEU E C   1 
ATOM   4066 O  O   . LEU E 1 90  ? -22.21600 0.87400   19.29600  1.000 108.20771 ? 1166 LEU E O   1 
ATOM   4067 C  CB  . LEU E 1 90  ? -21.70600 4.08600   20.45700  1.000 107.24970 ? 1166 LEU E CB  1 
ATOM   4068 C  CG  . LEU E 1 90  ? -22.76700 4.82100   21.27400  1.000 104.93890 ? 1166 LEU E CG  1 
ATOM   4069 C  CD1 . LEU E 1 90  ? -24.14500 4.22600   21.02500  1.000 97.34062  ? 1166 LEU E CD1 1 
ATOM   4070 C  CD2 . LEU E 1 90  ? -22.44100 4.79400   22.75700  1.000 114.56110 ? 1166 LEU E CD2 1 
ATOM   4071 N  N   . GLY E 1 91  ? -20.39800 2.12900   18.68900  1.000 111.94237 ? 1167 GLY E N   1 
ATOM   4072 C  CA  . GLY E 1 91  ? -20.21000 1.58100   17.36000  1.000 107.27076 ? 1167 GLY E CA  1 
ATOM   4073 C  C   . GLY E 1 91  ? -19.43400 2.57600   16.50900  1.000 104.73887 ? 1167 GLY E C   1 
ATOM   4074 O  O   . GLY E 1 91  ? -19.61600 3.78700   16.63400  1.000 90.26872  ? 1167 GLY E O   1 
ATOM   4075 N  N   . ASP E 1 92  ? -18.71100 2.03400   15.53700  1.000 107.49447 ? 1168 ASP E N   1 
ATOM   4076 C  CA  . ASP E 1 92  ? -17.76900 2.70900   14.66500  1.000 109.16572 ? 1168 ASP E CA  1 
ATOM   4077 C  C   . ASP E 1 92  ? -18.46900 3.07700   13.39700  1.000 104.06774 ? 1168 ASP E C   1 
ATOM   4078 O  O   . ASP E 1 92  ? -19.13600 2.23400   12.83600  1.000 98.23546  ? 1168 ASP E O   1 
ATOM   4079 C  CB  . ASP E 1 92  ? -16.73700 1.66700   14.27600  1.000 111.04226 ? 1168 ASP E CB  1 
ATOM   4080 C  CG  . ASP E 1 92  ? -15.33400 2.16200   14.37200  1.000 124.48861 ? 1168 ASP E CG  1 
ATOM   4081 O  OD1 . ASP E 1 92  ? -15.16500 3.39900   14.43900  1.000 124.69390 ? 1168 ASP E OD1 1 
ATOM   4082 O  OD2 . ASP E 1 92  ? -14.40400 1.31100   14.36900  1.000 132.56853 ? 1168 ASP E OD2 1 
ATOM   4083 N  N   . ILE E 1 93  ? -18.33100 4.30800   12.91800  1.000 106.59436 ? 1169 ILE E N   1 
ATOM   4084 C  CA  . ILE E 1 93  ? -18.93700 4.65700   11.59300  1.000 97.19586  ? 1169 ILE E CA  1 
ATOM   4085 C  C   . ILE E 1 93  ? -17.88100 5.32900   10.70300  1.000 92.81113  ? 1169 ILE E C   1 
ATOM   4086 O  O   . ILE E 1 93  ? -18.15800 5.50200   9.49700   1.000 87.58682  ? 1169 ILE E O   1 
ATOM   4087 C  CB  . ILE E 1 93  ? -20.22600 5.51000   11.74000  1.000 86.42878  ? 1169 ILE E CB  1 
ATOM   4088 C  CG1 . ILE E 1 93  ? -20.08400 6.69400   12.70900  1.000 91.10040  ? 1169 ILE E CG1 1 
ATOM   4089 C  CG2 . ILE E 1 93  ? -21.41000 4.62800   12.11900  1.000 68.82931  ? 1169 ILE E CG2 1 
ATOM   4090 C  CD1 . ILE E 1 93  ? -19.57800 7.96700   12.07000  1.000 86.08401  ? 1169 ILE E CD1 1 
ATOM   4091 N  N   . SER E 1 94  ? -16.70300 5.64300   11.25600  1.000 86.89200  ? 1170 SER E N   1 
ATOM   4092 C  CA  . SER E 1 94  ? -15.58000 6.31800   10.55300  1.000 97.90648  ? 1170 SER E CA  1 
ATOM   4093 C  C   . SER E 1 94  ? -15.14800 5.48400   9.34200   1.000 98.56182  ? 1170 SER E C   1 
ATOM   4094 O  O   . SER E 1 94  ? -14.45800 6.04400   8.46000   1.000 87.38153  ? 1170 SER E O   1 
ATOM   4095 C  CB  . SER E 1 94  ? -14.42600 6.55800   11.49200  1.000 101.87011 ? 1170 SER E CB  1 
ATOM   4096 O  OG  . SER E 1 94  ? -13.95900 5.33700   12.05200  1.000 103.98089 ? 1170 SER E OG  1 
ATOM   4097 N  N   . GLY E 1 95  ? -15.52200 4.19400   9.32800   1.000 102.25173 ? 1171 GLY E N   1 
ATOM   4098 C  CA  . GLY E 1 95  ? -15.34300 3.27300   8.18800   1.000 93.02694  ? 1171 GLY E CA  1 
ATOM   4099 C  C   . GLY E 1 95  ? -16.19300 3.67000   6.99000   1.000 85.92346  ? 1171 GLY E C   1 
ATOM   4100 O  O   . GLY E 1 95  ? -15.71000 3.50400   5.85000   1.000 86.21034  ? 1171 GLY E O   1 
ATOM   4101 N  N   . ILE E 1 96  ? -17.40700 4.18900   7.22300   1.000 84.34169  ? 1172 ILE E N   1 
ATOM   4102 C  CA  . ILE E 1 96  ? -18.33000 4.63000   6.13300   1.000 78.11463  ? 1172 ILE E CA  1 
ATOM   4103 C  C   . ILE E 1 96  ? -17.67200 5.78800   5.37400   1.000 66.07898  ? 1172 ILE E C   1 
ATOM   4104 O  O   . ILE E 1 96  ? -17.33400 6.81800   5.99400   1.000 71.34803  ? 1172 ILE E O   1 
ATOM   4105 C  CB  . ILE E 1 96  ? -19.73100 5.01200   6.65400   1.000 71.79282  ? 1172 ILE E CB  1 
ATOM   4106 C  CG1 . ILE E 1 96  ? -20.56600 3.78700   7.03900   1.000 66.17109  ? 1172 ILE E CG1 1 
ATOM   4107 C  CG2 . ILE E 1 96  ? -20.45900 5.85900   5.62000   1.000 57.34898  ? 1172 ILE E CG2 1 
ATOM   4108 C  CD1 . ILE E 1 96  ? -20.52500 3.44400   8.50500   1.000 72.65871  ? 1172 ILE E CD1 1 
ATOM   4109 N  N   . ASN E 1 97  ? -17.52500 5.63200   4.06500   1.000 65.52628  ? 1173 ASN E N   1 
ATOM   4110 C  CA  . ASN E 1 97  ? -16.83900 6.64000   3.22800   1.000 72.42710  ? 1173 ASN E CA  1 
ATOM   4111 C  C   . ASN E 1 97  ? -17.53100 6.74400   1.87000   1.000 75.60117  ? 1173 ASN E C   1 
ATOM   4112 O  O   . ASN E 1 97  ? -17.82600 5.68300   1.27000   1.000 67.60021  ? 1173 ASN E O   1 
ATOM   4113 C  CB  . ASN E 1 97  ? -15.36000 6.29200   3.08100   1.000 71.82966  ? 1173 ASN E CB  1 
ATOM   4114 C  CG  . ASN E 1 97  ? -14.67300 7.13600   2.03400   1.000 83.94164  ? 1173 ASN E CG  1 
ATOM   4115 O  OD1 . ASN E 1 97  ? -14.51800 6.69900   0.88800   1.000 86.42089  ? 1173 ASN E OD1 1 
ATOM   4116 N  ND2 . ASN E 1 97  ? -14.26600 8.34400   2.42400   1.000 93.51121  ? 1173 ASN E ND2 1 
ATOM   4117 N  N   . ALA E 1 98  ? -17.75900 7.98400   1.41900   1.000 65.70261  ? 1174 ALA E N   1 
ATOM   4118 C  CA  . ALA E 1 98  ? -18.32900 8.33200   0.10000   1.000 62.75226  ? 1174 ALA E CA  1 
ATOM   4119 C  C   . ALA E 1 98  ? -17.18800 8.57000   -0.89100  1.000 84.76806  ? 1174 ALA E C   1 
ATOM   4120 O  O   . ALA E 1 98  ? -16.40500 9.50800   -0.67400  1.000 90.77141  ? 1174 ALA E O   1 
ATOM   4121 C  CB  . ALA E 1 98  ? -19.19400 9.55600   0.22900   1.000 64.66302  ? 1174 ALA E CB  1 
ATOM   4122 N  N   . SER E 1 99  ? -17.10700 7.75200   -1.94000  1.000 85.75239  ? 1175 SER E N   1 
ATOM   4123 C  CA  . SER E 1 99  ? -16.13900 7.92100   -3.05400  1.000 88.84749  ? 1175 SER E CA  1 
ATOM   4124 C  C   . SER E 1 99  ? -16.52000 9.15900   -3.87300  1.000 84.04166  ? 1175 SER E C   1 
ATOM   4125 O  O   . SER E 1 99  ? -17.66700 9.61900   -3.75800  1.000 86.84199  ? 1175 SER E O   1 
ATOM   4126 C  CB  . SER E 1 99  ? -16.07100 6.68000   -3.91100  1.000 89.67654  ? 1175 SER E CB  1 
ATOM   4127 O  OG  . SER E 1 99  ? -17.28800 5.94400   -3.84700  1.000 86.45510  ? 1175 SER E OG  1 
ATOM   4128 N  N   . VAL E 1 100 ? -15.57400 9.68500   -4.64900  1.000 86.51827  ? 1176 VAL E N   1 
ATOM   4129 C  CA  . VAL E 1 100 ? -15.78700 10.81100  -5.60900  1.000 91.63993  ? 1176 VAL E CA  1 
ATOM   4130 C  C   . VAL E 1 100 ? -15.64800 10.26200  -7.03300  1.000 89.53179  ? 1176 VAL E C   1 
ATOM   4131 O  O   . VAL E 1 100 ? -15.14800 9.12600   -7.19700  1.000 92.37423  ? 1176 VAL E O   1 
ATOM   4132 C  CB  . VAL E 1 100 ? -14.81300 11.98000  -5.36100  1.000 91.55571  ? 1176 VAL E CB  1 
ATOM   4133 C  CG1 . VAL E 1 100 ? -15.03100 12.61500  -3.99700  1.000 92.44003  ? 1176 VAL E CG1 1 
ATOM   4134 C  CG2 . VAL E 1 100 ? -13.35800 11.56500  -5.54600  1.000 90.99775  ? 1176 VAL E CG2 1 
ATOM   4135 N  N   . VAL E 1 101 ? -16.06400 11.05000  -8.02400  1.000 82.68623  ? 1177 VAL E N   1 
ATOM   4136 C  CA  . VAL E 1 101 ? -16.03800 10.65200  -9.46200  1.000 81.91245  ? 1177 VAL E CA  1 
ATOM   4137 C  C   . VAL E 1 101 ? -15.10700 11.60400  -10.21800 1.000 85.70764  ? 1177 VAL E C   1 
ATOM   4138 O  O   . VAL E 1 101 ? -15.09400 12.81100  -9.88800  1.000 81.12288  ? 1177 VAL E O   1 
ATOM   4139 C  CB  . VAL E 1 101 ? -17.45400 10.64200  -10.07100 1.000 76.27757  ? 1177 VAL E CB  1 
ATOM   4140 C  CG1 . VAL E 1 101 ? -18.05900 12.03800  -10.15900 1.000 71.13484  ? 1177 VAL E CG1 1 
ATOM   4141 C  CG2 . VAL E 1 101 ? -17.46900 9.94600   -11.42500 1.000 68.21607  ? 1177 VAL E CG2 1 
ATOM   4142 N  N   . ASN E 1 102 ? -14.37200 11.07100  -11.19800 1.000 77.96461  ? 1178 ASN E N   1 
ATOM   4143 C  CA  . ASN E 1 102 ? -13.50700 11.85900  -12.11500 1.000 87.85264  ? 1178 ASN E CA  1 
ATOM   4144 C  C   . ASN E 1 102 ? -13.89400 11.52300  -13.55700 1.000 93.95600  ? 1178 ASN E C   1 
ATOM   4145 O  O   . ASN E 1 102 ? -13.52800 10.42300  -14.03400 1.000 92.19790  ? 1178 ASN E O   1 
ATOM   4146 C  CB  . ASN E 1 102 ? -12.01500 11.62300  -11.86200 1.000 85.26549  ? 1178 ASN E CB  1 
ATOM   4147 C  CG  . ASN E 1 102 ? -11.13700 12.70200  -12.46700 1.000 85.43656  ? 1178 ASN E CG  1 
ATOM   4148 O  OD1 . ASN E 1 102 ? -11.49400 13.32100  -13.46900 1.000 82.70202  ? 1178 ASN E OD1 1 
ATOM   4149 N  ND2 . ASN E 1 102 ? -9.98800  12.94900  -11.85600 1.000 89.73181  ? 1178 ASN E ND2 1 
ATOM   4150 N  N   . ILE E 1 103 ? -14.61700 12.43700  -14.21100 1.000 74.89319  ? 1179 ILE E N   1 
ATOM   4151 C  CA  . ILE E 1 103 ? -15.03700 12.29600  -15.63500 1.000 72.78504  ? 1179 ILE E CA  1 
ATOM   4152 C  C   . ILE E 1 103 ? -14.62100 13.53800  -16.41800 1.000 75.88541  ? 1179 ILE E C   1 
ATOM   4153 O  O   . ILE E 1 103 ? -15.09300 13.67100  -17.56300 1.000 75.48010  ? 1179 ILE E O   1 
ATOM   4154 C  CB  . ILE E 1 103 ? -16.55300 12.05100  -15.73100 1.000 68.11080  ? 1179 ILE E CB  1 
ATOM   4155 C  CG1 . ILE E 1 103 ? -17.36800 13.20200  -15.13800 1.000 68.15291  ? 1179 ILE E CG1 1 
ATOM   4156 C  CG2 . ILE E 1 103 ? -16.90300 10.72600  -15.07800 1.000 65.25519  ? 1179 ILE E CG2 1 
ATOM   4157 C  CD1 . ILE E 1 103 ? -18.79000 13.24400  -15.62100 1.000 64.19191  ? 1179 ILE E CD1 1 
ATOM   4158 N  N   . GLN E 1 104 ? -13.76300 14.38300  -15.83400 1.000 90.62139  ? 1180 GLN E N   1 
ATOM   4159 C  CA  . GLN E 1 104 ? -13.34400 15.68600  -16.42000 1.000 85.06020  ? 1180 GLN E CA  1 
ATOM   4160 C  C   . GLN E 1 104 ? -12.76400 15.43200  -17.82000 1.000 87.34205  ? 1180 GLN E C   1 
ATOM   4161 O  O   . GLN E 1 104 ? -13.06400 16.23500  -18.73100 1.000 85.41287  ? 1180 GLN E O   1 
ATOM   4162 C  CB  . GLN E 1 104 ? -12.36600 16.42100  -15.49500 1.000 82.96521  ? 1180 GLN E CB  1 
ATOM   4163 C  CG  . GLN E 1 104 ? -12.11400 17.86500  -15.90900 1.000 88.41850  ? 1180 GLN E CG  1 
ATOM   4164 C  CD  . GLN E 1 104 ? -13.39300 18.65600  -16.02100 1.000 89.73444  ? 1180 GLN E CD  1 
ATOM   4165 O  OE1 . GLN E 1 104 ? -14.10600 18.83100  -15.03800 1.000 94.15866  ? 1180 GLN E OE1 1 
ATOM   4166 N  NE2 . GLN E 1 104 ? -13.68900 19.14500  -17.21900 1.000 89.55021  ? 1180 GLN E NE2 1 
ATOM   4167 N  N   . LYS E 1 105 ? -12.01300 14.33500  -17.99000 1.000 87.19467  ? 1181 LYS E N   1 
ATOM   4168 C  CA  . LYS E 1 105 ? -11.35200 13.95000  -19.27000 1.000 85.00756  ? 1181 LYS E CA  1 
ATOM   4169 C  C   . LYS E 1 105 ? -12.40300 13.71300  -20.35800 1.000 89.30544  ? 1181 LYS E C   1 
ATOM   4170 O  O   . LYS E 1 105 ? -12.14400 14.12300  -21.50200 1.000 102.60704 ? 1181 LYS E O   1 
ATOM   4171 C  CB  . LYS E 1 105 ? -10.47600 12.70900  -19.07900 1.000 93.44541  ? 1181 LYS E CB  1 
ATOM   4172 C  CG  . LYS E 1 105 ? -9.25800  12.92000  -18.18300 1.000 103.07288 ? 1181 LYS E CG  1 
ATOM   4173 C  CD  . LYS E 1 105 ? -8.18300  13.82300  -18.77300 1.000 101.45164 ? 1181 LYS E CD  1 
ATOM   4174 C  CE  . LYS E 1 105 ? -7.36800  13.15200  -19.86200 1.000 97.45905  ? 1181 LYS E CE  1 
ATOM   4175 N  NZ  . LYS E 1 105 ? -6.04400  13.79600  -20.03600 1.000 93.04273  ? 1181 LYS E NZ  1 
ATOM   4176 N  N   . GLU E 1 106 ? -13.53600 13.08600  -20.01500 1.000 88.18689  ? 1182 GLU E N   1 
ATOM   4177 C  CA  . GLU E 1 106 ? -14.65800 12.82700  -20.95700 1.000 81.82297  ? 1182 GLU E CA  1 
ATOM   4178 C  C   . GLU E 1 106 ? -15.36200 14.14600  -21.28100 1.000 85.92083  ? 1182 GLU E C   1 
ATOM   4179 O  O   . GLU E 1 106 ? -15.67600 14.36400  -22.45400 1.000 92.69269  ? 1182 GLU E O   1 
ATOM   4180 C  CB  . GLU E 1 106 ? -15.66400 11.82500  -20.39000 1.000 76.09333  ? 1182 GLU E CB  1 
ATOM   4181 C  CG  . GLU E 1 106 ? -15.16900 10.39100  -20.39600 1.000 79.82799  ? 1182 GLU E CG  1 
ATOM   4182 C  CD  . GLU E 1 106 ? -14.50900 9.93600   -19.11000 1.000 82.65202  ? 1182 GLU E CD  1 
ATOM   4183 O  OE1 . GLU E 1 106 ? -14.42300 8.70600   -18.89200 1.000 71.79282  ? 1182 GLU E OE1 1 
ATOM   4184 O  OE2 . GLU E 1 106 ? -14.08000 10.80700  -18.33300 1.000 88.80538  ? 1182 GLU E OE2 1 
ATOM   4185 N  N   . ILE E 1 107 ? -15.60500 14.98800  -20.27900 1.000 80.25173  ? 1183 ILE E N   1 
ATOM   4186 C  CA  . ILE E 1 107 ? -16.24000 16.32500  -20.47700 1.000 82.12300  ? 1183 ILE E CA  1 
ATOM   4187 C  C   . ILE E 1 107 ? -15.37300 17.10700  -21.46700 1.000 92.27949  ? 1183 ILE E C   1 
ATOM   4188 O  O   . ILE E 1 107 ? -15.91200 17.58300  -22.47400 1.000 92.22422  ? 1183 ILE E O   1 
ATOM   4189 C  CB  . ILE E 1 107 ? -16.42200 17.07100  -19.14000 1.000 96.64317  ? 1183 ILE E CB  1 
ATOM   4190 C  CG1 . ILE E 1 107 ? -17.30200 16.26900  -18.17300 1.000 94.44553  ? 1183 ILE E CG1 1 
ATOM   4191 C  CG2 . ILE E 1 107 ? -16.97100 18.47500  -19.37700 1.000 99.01714  ? 1183 ILE E CG2 1 
ATOM   4192 C  CD1 . ILE E 1 107 ? -17.34400 16.81200  -16.76800 1.000 89.20280  ? 1183 ILE E CD1 1 
ATOM   4193 N  N   . ASP E 1 108 ? -14.07100 17.18900  -21.19900 1.000 95.45618  ? 1184 ASP E N   1 
ATOM   4194 C  CA  . ASP E 1 108 ? -13.09200 17.88500  -22.07300 1.000 95.25089  ? 1184 ASP E CA  1 
ATOM   4195 C  C   . ASP E 1 108 ? -13.24400 17.32200  -23.49300 1.000 92.75586  ? 1184 ASP E C   1 
ATOM   4196 O  O   . ASP E 1 108 ? -13.45500 18.12200  -24.41600 1.000 101.10423 ? 1184 ASP E O   1 
ATOM   4197 C  CB  . ASP E 1 108 ? -11.66400 17.77900  -21.51700 1.000 98.36179  ? 1184 ASP E CB  1 
ATOM   4198 C  CG  . ASP E 1 108 ? -11.39300 18.59700  -20.25600 1.000 100.87262 ? 1184 ASP E CG  1 
ATOM   4199 O  OD1 . ASP E 1 108 ? -12.11800 19.59100  -20.01100 1.000 102.02013 ? 1184 ASP E OD1 1 
ATOM   4200 O  OD2 . ASP E 1 108 ? -10.44400 18.24300  -19.52800 1.000 100.62522 ? 1184 ASP E OD2 1 
ATOM   4201 N  N   . ARG E 1 109 ? -13.19400 15.99600  -23.65600 1.000 101.47532 ? 1185 ARG E N   1 
ATOM   4202 C  CA  . ARG E 1 109 ? -13.23500 15.33200  -24.99200 1.000 102.55177 ? 1185 ARG E CA  1 
ATOM   4203 C  C   . ARG E 1 109 ? -14.51600 15.73100  -25.73700 1.000 98.36706  ? 1185 ARG E C   1 
ATOM   4204 O  O   . ARG E 1 109 ? -14.42300 15.91600  -26.95000 1.000 98.96450  ? 1185 ARG E O   1 
ATOM   4205 C  CB  . ARG E 1 109 ? -13.13600 13.80800  -24.87100 1.000 97.84331  ? 1185 ARG E CB  1 
ATOM   4206 C  CG  . ARG E 1 109 ? -13.21200 13.06400  -26.20000 1.000 97.01690  ? 1185 ARG E CG  1 
ATOM   4207 C  CD  . ARG E 1 109 ? -11.95000 12.32100  -26.61000 1.000 111.82130 ? 1185 ARG E CD  1 
ATOM   4208 N  NE  . ARG E 1 109 ? -11.64100 11.18900  -25.73300 1.000 117.94309 ? 1185 ARG E NE  1 
ATOM   4209 C  CZ  . ARG E 1 109 ? -10.83000 10.16700  -26.02900 1.000 114.59795 ? 1185 ARG E CZ  1 
ATOM   4210 N  NH1 . ARG E 1 109 ? -10.22900 10.09600  -27.20600 1.000 110.96594 ? 1185 ARG E NH1 1 
ATOM   4211 N  NH2 . ARG E 1 109 ? -10.62800 9.20400   -25.14200 1.000 110.26059 ? 1185 ARG E NH2 1 
ATOM   4212 N  N   . LEU E 1 110 ? -15.65500 15.85000  -25.04400 1.000 98.89344  ? 1186 LEU E N   1 
ATOM   4213 C  CA  . LEU E 1 110 ? -16.96200 16.23100  -25.65200 1.000 82.04405  ? 1186 LEU E CA  1 
ATOM   4214 C  C   . LEU E 1 110 ? -16.87300 17.66500  -26.17800 1.000 83.50212  ? 1186 LEU E C   1 
ATOM   4215 O  O   . LEU E 1 110 ? -17.22700 17.88100  -27.35300 1.000 92.71638  ? 1186 LEU E O   1 
ATOM   4216 C  CB  . LEU E 1 110 ? -18.09800 16.11400  -24.62800 1.000 83.36789  ? 1186 LEU E CB  1 
ATOM   4217 C  CG  . LEU E 1 110 ? -18.62500 14.70800  -24.33400 1.000 87.96055  ? 1186 LEU E CG  1 
ATOM   4218 C  CD1 . LEU E 1 110 ? -19.91000 14.78500  -23.52300 1.000 80.86759  ? 1186 LEU E CD1 1 
ATOM   4219 C  CD2 . LEU E 1 110 ? -18.86500 13.91200  -25.60900 1.000 89.08963  ? 1186 LEU E CD2 1 
ATOM   4220 N  N   . ASN E 1 111 ? -16.43400 18.60500  -25.33500 1.000 94.57713  ? 1187 ASN E N   1 
ATOM   4221 C  CA  . ASN E 1 111 ? -16.24800 20.03800  -25.70300 1.000 92.53741  ? 1187 ASN E CA  1 
ATOM   4222 C  C   . ASN E 1 111 ? -15.30500 20.11700  -26.91200 1.000 88.51061  ? 1187 ASN E C   1 
ATOM   4223 O  O   . ASN E 1 111 ? -15.59200 20.89800  -27.83700 1.000 89.13964  ? 1187 ASN E O   1 
ATOM   4224 C  CB  . ASN E 1 111 ? -15.67500 20.88200  -24.55800 1.000 96.29312  ? 1187 ASN E CB  1 
ATOM   4225 C  CG  . ASN E 1 111 ? -16.50900 20.86800  -23.29300 1.000 97.47748  ? 1187 ASN E CG  1 
ATOM   4226 O  OD1 . ASN E 1 111 ? -15.97600 20.70800  -22.19100 1.000 89.20543  ? 1187 ASN E OD1 1 
ATOM   4227 N  ND2 . ASN E 1 111 ? -17.81300 21.05100  -23.44200 1.000 96.70107  ? 1187 ASN E ND2 1 
ATOM   4228 N  N   . GLU E 1 112 ? -14.22300 19.33000  -26.87800 1.000 89.33703  ? 1188 GLU E N   1 
ATOM   4229 C  CA  . GLU E 1 112 ? -13.15800 19.26400  -27.91300 1.000 94.46922  ? 1188 GLU E CA  1 
ATOM   4230 C  C   . GLU E 1 112 ? -13.79900 18.90300  -29.25500 1.000 99.13820  ? 1188 GLU E C   1 
ATOM   4231 O  O   . GLU E 1 112 ? -13.54000 19.62200  -30.23600 1.000 98.91712  ? 1188 GLU E O   1 
ATOM   4232 C  CB  . GLU E 1 112 ? -12.08800 18.25400  -27.48000 1.000 95.64041  ? 1188 GLU E CB  1 
ATOM   4233 C  CG  . GLU E 1 112 ? -11.04500 17.93800  -28.53400 1.000 100.61470 ? 1188 GLU E CG  1 
ATOM   4234 C  CD  . GLU E 1 112 ? -9.93600  18.97000  -28.60700 1.000 112.18450 ? 1188 GLU E CD  1 
ATOM   4235 O  OE1 . GLU E 1 112 ? -10.25000 20.17800  -28.62800 1.000 118.71423 ? 1188 GLU E OE1 1 
ATOM   4236 O  OE2 . GLU E 1 112 ? -8.76200  18.55600  -28.61900 1.000 118.78266 ? 1188 GLU E OE2 1 
ATOM   4237 N  N   . VAL E 1 113 ? -14.61300 17.84200  -29.27900 1.000 98.46970  ? 1189 VAL E N   1 
ATOM   4238 C  CA  . VAL E 1 113 ? -15.28700 17.30800  -30.50400 1.000 88.94224  ? 1189 VAL E CA  1 
ATOM   4239 C  C   . VAL E 1 113 ? -16.37500 18.29300  -30.94700 1.000 81.29396  ? 1189 VAL E C   1 
ATOM   4240 O  O   . VAL E 1 113 ? -16.59500 18.40700  -32.15800 1.000 81.84666  ? 1189 VAL E O   1 
ATOM   4241 C  CB  . VAL E 1 113 ? -15.87200 15.89800  -30.28000 1.000 83.93638  ? 1189 VAL E CB  1 
ATOM   4242 C  CG1 . VAL E 1 113 ? -16.66900 15.41700  -31.48000 1.000 77.92776  ? 1189 VAL E CG1 1 
ATOM   4243 C  CG2 . VAL E 1 113 ? -14.78800 14.89000  -29.92800 1.000 78.09884  ? 1189 VAL E CG2 1 
ATOM   4244 N  N   . ALA E 1 114 ? -17.04500 18.96100  -30.00600 1.000 97.07480  ? 1190 ALA E N   1 
ATOM   4245 C  CA  . ALA E 1 114 ? -18.14900 19.90900  -30.29400 1.000 98.99345  ? 1190 ALA E CA  1 
ATOM   4246 C  C   . ALA E 1 114 ? -17.64000 21.07400  -31.15700 1.000 103.24133 ? 1190 ALA E C   1 
ATOM   4247 O  O   . ALA E 1 114 ? -18.38600 21.50100  -32.06700 1.000 106.51014 ? 1190 ALA E O   1 
ATOM   4248 C  CB  . ALA E 1 114 ? -18.77200 20.40600  -29.01000 1.000 94.40606  ? 1190 ALA E CB  1 
ATOM   4249 N  N   . LYS E 1 115 ? -16.42900 21.57700  -30.88300 1.000 92.61110  ? 1191 LYS E N   1 
ATOM   4250 C  CA  . LYS E 1 115 ? -15.81500 22.68600  -31.66400 1.000 95.04561  ? 1191 LYS E CA  1 
ATOM   4251 C  C   . LYS E 1 115 ? -15.08500 22.10000  -32.88500 1.000 93.26645  ? 1191 LYS E C   1 
ATOM   4252 O  O   . LYS E 1 115 ? -15.19900 22.70100  -33.96100 1.000 96.07205  ? 1191 LYS E O   1 
ATOM   4253 C  CB  . LYS E 1 115 ? -14.97200 23.60600  -30.76400 1.000 104.45200 ? 1191 LYS E CB  1 
ATOM   4254 C  CG  . LYS E 1 115 ? -13.54600 23.18900  -30.41400 1.000 106.20221 ? 1191 LYS E CG  1 
ATOM   4255 C  CD  . LYS E 1 115 ? -12.81600 24.29900  -29.65500 1.000 106.53909 ? 1191 LYS E CD  1 
ATOM   4256 C  CE  . LYS E 1 115 ? -11.34900 24.04600  -29.37000 1.000 106.00218 ? 1191 LYS E CE  1 
ATOM   4257 N  NZ  . LYS E 1 115 ? -10.69700 23.24100  -30.42300 1.000 106.15483 ? 1191 LYS E NZ  1 
ATOM   4258 N  N   . ASN E 1 116 ? -14.42200 20.94500  -32.76000 1.000 100.00673 ? 1192 ASN E N   1 
ATOM   4259 C  CA  . ASN E 1 116 ? -13.67300 20.29800  -33.87500 1.000 98.88291  ? 1192 ASN E CA  1 
ATOM   4260 C  C   . ASN E 1 116 ? -14.59800 19.91400  -35.03800 1.000 100.62522 ? 1192 ASN E C   1 
ATOM   4261 O  O   . ASN E 1 116 ? -14.06400 19.69800  -36.13600 1.000 109.57630 ? 1192 ASN E O   1 
ATOM   4262 C  CB  . ASN E 1 116 ? -12.93700 19.02800  -33.44500 1.000 96.28786  ? 1192 ASN E CB  1 
ATOM   4263 C  CG  . ASN E 1 116 ? -11.62300 19.29900  -32.74900 1.000 110.22901 ? 1192 ASN E CG  1 
ATOM   4264 O  OD1 . ASN E 1 116 ? -11.44000 20.35100  -32.13600 1.000 117.46935 ? 1192 ASN E OD1 1 
ATOM   4265 N  ND2 . ASN E 1 116 ? -10.70800 18.34700  -32.83700 1.000 111.70287 ? 1192 ASN E ND2 1 
ATOM   4266 N  N   . LEU E 1 117 ? -15.91200 19.78200  -34.82100 1.000 97.09848  ? 1193 LEU E N   1 
ATOM   4267 C  CA  . LEU E 1 117 ? -16.86800 19.33400  -35.87400 1.000 101.28846 ? 1193 LEU E CA  1 
ATOM   4268 C  C   . LEU E 1 117 ? -17.09400 20.45700  -36.88800 1.000 102.55440 ? 1193 LEU E C   1 
ATOM   4269 O  O   . LEU E 1 117 ? -17.72500 20.18100  -37.93100 1.000 97.82752  ? 1193 LEU E O   1 
ATOM   4270 C  CB  . LEU E 1 117 ? -18.19900 18.91000  -35.24600 1.000 85.86029  ? 1193 LEU E CB  1 
ATOM   4271 C  CG  . LEU E 1 117 ? -18.30800 17.43800  -34.85200 1.000 89.87657  ? 1193 LEU E CG  1 
ATOM   4272 C  CD1 . LEU E 1 117 ? -19.63400 17.16800  -34.16500 1.000 94.02970  ? 1193 LEU E CD1 1 
ATOM   4273 C  CD2 . LEU E 1 117 ? -18.15300 16.52400  -36.05700 1.000 84.52592  ? 1193 LEU E CD2 1 
ATOM   4274 N  N   . ASN E 1 118 ? -16.64300 21.67600  -36.57300 1.000 109.68684 ? 1194 ASN E N   1 
ATOM   4275 C  CA  . ASN E 1 118 ? -16.61500 22.82300  -37.52000 1.000 114.49004 ? 1194 ASN E CA  1 
ATOM   4276 C  C   . ASN E 1 118 ? -15.76400 22.41100  -38.73300 1.000 116.58503 ? 1194 ASN E C   1 
ATOM   4277 O  O   . ASN E 1 118 ? -16.17500 22.69600  -39.87600 1.000 111.46863 ? 1194 ASN E O   1 
ATOM   4278 C  CB  . ASN E 1 118 ? -16.13500 24.11600  -36.84000 1.000 120.94871 ? 1194 ASN E CB  1 
ATOM   4279 C  CG  . ASN E 1 118 ? -17.21300 24.83200  -36.04500 1.000 118.30892 ? 1194 ASN E CG  1 
ATOM   4280 O  OD1 . ASN E 1 118 ? -18.34300 24.98400  -36.51000 1.000 116.37711 ? 1194 ASN E OD1 1 
ATOM   4281 N  ND2 . ASN E 1 118 ? -16.87000 25.30400  -34.85500 1.000 115.40331 ? 1194 ASN E ND2 1 
ATOM   4282 N  N   . GLU E 1 119 ? -14.66200 21.69200  -38.49400 1.000 117.10878 ? 1195 GLU E N   1 
ATOM   4283 C  CA  . GLU E 1 119 ? -13.68100 21.27700  -39.53700 1.000 121.84882 ? 1195 GLU E CA  1 
ATOM   4284 C  C   . GLU E 1 119 ? -14.17500 20.03400  -40.29700 1.000 115.74019 ? 1195 GLU E C   1 
ATOM   4285 O  O   . GLU E 1 119 ? -13.36700 19.48900  -41.08100 1.000 116.56661 ? 1195 GLU E O   1 
ATOM   4286 C  CB  . GLU E 1 119 ? -12.30500 21.02100  -38.90500 1.000 127.23631 ? 1195 GLU E CB  1 
ATOM   4287 C  CG  . GLU E 1 119 ? -11.50300 22.29000  -38.63000 1.000 133.98712 ? 1195 GLU E CG  1 
ATOM   4288 C  CD  . GLU E 1 119 ? -11.48600 22.81600  -37.19900 1.000 133.25808 ? 1195 GLU E CD  1 
ATOM   4289 O  OE1 . GLU E 1 119 ? -12.11500 22.19400  -36.31700 1.000 129.02073 ? 1195 GLU E OE1 1 
ATOM   4290 O  OE2 . GLU E 1 119 ? -10.83500 23.85800  -36.96600 1.000 135.31622 ? 1195 GLU E OE2 1 
ATOM   4291 N  N   . SER E 1 120 ? -15.42600 19.59900  -40.07300 1.000 111.42652 ? 1196 SER E N   1 
ATOM   4292 C  CA  . SER E 1 120 ? -16.10000 18.49000  -40.80500 1.000 101.27793 ? 1196 SER E CA  1 
ATOM   4293 C  C   . SER E 1 120 ? -17.18700 19.04400  -41.72900 1.000 98.36969  ? 1196 SER E C   1 
ATOM   4294 O  O   . SER E 1 120 ? -17.85800 18.23800  -42.39100 1.000 94.73767  ? 1196 SER E O   1 
ATOM   4295 C  CB  . SER E 1 120 ? -16.67100 17.45800  -39.86100 1.000 94.02443  ? 1196 SER E CB  1 
ATOM   4296 O  OG  . SER E 1 120 ? -15.72700 16.42700  -39.62700 1.000 96.72476  ? 1196 SER E OG  1 
ATOM   4297 N  N   . LEU E 1 121 ? -17.34600 20.36700  -41.78500 1.000 94.73504  ? 1197 LEU E N   1 
ATOM   4298 C  CA  . LEU E 1 121 ? -18.35400 21.02700  -42.65500 1.000 96.30892  ? 1197 LEU E CA  1 
ATOM   4299 C  C   . LEU E 1 121 ? -17.91600 20.90300  -44.12300 1.000 104.43094 ? 1197 LEU E C   1 
ATOM   4300 O  O   . LEU E 1 121 ? -16.77400 20.46400  -44.37000 1.000 102.83338 ? 1197 LEU E O   1 
ATOM   4301 C  CB  . LEU E 1 121 ? -18.51500 22.48400  -42.20700 1.000 107.37077 ? 1197 LEU E CB  1 
ATOM   4302 C  CG  . LEU E 1 121 ? -19.09900 22.67300  -40.80500 1.000 104.54148 ? 1197 LEU E CG  1 
ATOM   4303 C  CD1 . LEU E 1 121 ? -19.05900 24.13700  -40.39300 1.000 112.80037 ? 1197 LEU E CD1 1 
ATOM   4304 C  CD2 . LEU E 1 121 ? -20.52500 22.14600  -40.72100 1.000 99.98567  ? 1197 LEU E CD2 1 
ATOM   4305 N  N   . ILE E 1 122 ? -18.80200 21.24100  -45.06400 1.000 109.65788 ? 1198 ILE E N   1 
ATOM   4306 C  CA  . ILE E 1 122 ? -18.58100 21.03800  -46.52600 1.000 98.19598  ? 1198 ILE E CA  1 
ATOM   4307 C  C   . ILE E 1 122 ? -18.53400 22.40200  -47.22600 1.000 123.91486 ? 1198 ILE E C   1 
ATOM   4308 O  O   . ILE E 1 122 ? -19.36700 23.26200  -46.88400 1.000 117.47724 ? 1198 ILE E O   1 
ATOM   4309 C  CB  . ILE E 1 122 ? -19.67300 20.12300  -47.11400 1.000 94.45080  ? 1198 ILE E CB  1 
ATOM   4310 C  CG1 . ILE E 1 122 ? -19.71300 18.77600  -46.39000 1.000 90.07396  ? 1198 ILE E CG1 1 
ATOM   4311 C  CG2 . ILE E 1 122 ? -19.48000 19.94700  -48.61200 1.000 98.00386  ? 1198 ILE E CG2 1 
ATOM   4312 C  CD1 . ILE E 1 122 ? -20.68300 17.78000  -46.97700 1.000 85.86293  ? 1198 ILE E CD1 1 
ATOM   4313 N  N   . ASP E 1 123 ? -17.60000 22.56600  -48.17400 1.000 129.72871 ? 1199 ASP E N   1 
ATOM   4314 C  CA  . ASP E 1 123 ? -17.49000 23.73600  -49.09100 1.000 135.22148 ? 1199 ASP E CA  1 
ATOM   4315 C  C   . ASP E 1 123 ? -17.34600 23.23800  -50.53900 1.000 135.76628 ? 1199 ASP E C   1 
ATOM   4316 O  O   . ASP E 1 123 ? -16.32400 22.58400  -50.83500 1.000 136.79009 ? 1199 ASP E O   1 
ATOM   4317 C  CB  . ASP E 1 123 ? -16.30600 24.63000  -48.70700 1.000 139.45093 ? 1199 ASP E CB  1 
ATOM   4318 C  CG  . ASP E 1 123 ? -16.41300 26.05800  -49.21800 1.000 147.81509 ? 1199 ASP E CG  1 
ATOM   4319 O  OD1 . ASP E 1 123 ? -17.53100 26.61400  -49.18000 1.000 146.84919 ? 1199 ASP E OD1 1 
ATOM   4320 O  OD2 . ASP E 1 123 ? -15.37600 26.60300  -49.64800 1.000 155.70814 ? 1199 ASP E OD2 1 
ATOM   4321 N  N   . LEU E 1 124 ? -18.31000 23.55700  -51.41300 1.000 142.80396 ? 1200 LEU E N   1 
ATOM   4322 C  CA  . LEU E 1 124 ? -18.35800 23.05400  -52.81600 1.000 131.50261 ? 1200 LEU E CA  1 
ATOM   4323 C  C   . LEU E 1 124 ? -17.65500 24.03800  -53.76500 1.000 130.20245 ? 1200 LEU E C   1 
ATOM   4324 O  O   . LEU E 1 124 ? -17.51500 25.23900  -53.42300 1.000 124.80181 ? 1200 LEU E O   1 
ATOM   4325 C  CB  . LEU E 1 124 ? -19.81300 22.82300  -53.25300 1.000 122.06464 ? 1200 LEU E CB  1 
ATOM   4326 C  CG  . LEU E 1 124 ? -20.57100 21.66000  -52.60400 1.000 108.05506 ? 1200 LEU E CG  1 
ATOM   4327 C  CD1 . LEU E 1 124 ? -19.72900 20.39600  -52.53000 1.000 105.33105 ? 1200 LEU E CD1 1 
ATOM   4328 C  CD2 . LEU E 1 124 ? -21.06800 22.03800  -51.22100 1.000 115.85073 ? 1200 LEU E CD2 1 
ATOM   4329 N  N   . GLN E 1 125 ? -17.19200 23.49700  -54.89700 1.000 134.48191 ? 1201 GLN E N   1 
ATOM   4330 C  CA  . GLN E 1 125 ? -16.82800 24.21400  -56.15000 1.000 135.03461 ? 1201 GLN E CA  1 
ATOM   4331 C  C   . GLN E 1 125 ? -18.00300 24.06500  -57.12600 1.000 138.40870 ? 1201 GLN E C   1 
ATOM   4332 O  O   . GLN E 1 125 ? -18.77000 23.08400  -56.97800 1.000 128.87598 ? 1201 GLN E O   1 
ATOM   4333 C  CB  . GLN E 1 125 ? -15.53500 23.61800  -56.72000 1.000 126.90732 ? 1201 GLN E CB  1 
ATOM   4334 C  CG  . GLN E 1 125 ? -15.06800 24.22500  -58.03700 1.000 130.99729 ? 1201 GLN E CG  1 
ATOM   4335 C  CD  . GLN E 1 125 ? -13.99400 23.37700  -58.67600 1.000 130.03401 ? 1201 GLN E CD  1 
ATOM   4336 O  OE1 . GLN E 1 125 ? -13.08600 22.87600  -58.01200 1.000 126.30462 ? 1201 GLN E OE1 1 
ATOM   4337 N  NE2 . GLN E 1 125 ? -14.09300 23.20400  -59.98500 1.000 122.01726 ? 1201 GLN E NE2 1 
ATOM   4338 N  N   . GLU E 1 126 ? -18.14100 25.00000  -58.07400 1.000 148.52570 ? 1202 GLU E N   1 
ATOM   4339 C  CA  . GLU E 1 126 ? -19.24000 25.01400  -59.08000 1.000 145.44112 ? 1202 GLU E CA  1 
ATOM   4340 C  C   . GLU E 1 126 ? -18.84300 25.89100  -60.27400 1.000 140.21944 ? 1202 GLU E C   1 
ATOM   4341 O  O   . GLU E 1 126 ? -19.62100 26.03200  -61.21300 1.000 140.55633 ? 1202 GLU E O   1 
ATOM   4342 C  CB  . GLU E 1 126 ? -20.53800 25.50300  -58.43200 1.000 152.89465 ? 1202 GLU E CB  1 
ATOM   4343 C  CG  . GLU E 1 126 ? -20.32300 26.55000  -57.34900 1.000 155.65287 ? 1202 GLU E CG  1 
ATOM   4344 C  CD  . GLU E 1 126 ? -21.57700 26.92100  -56.57900 1.000 152.36827 ? 1202 GLU E CD  1 
ATOM   4345 O  OE1 . GLU E 1 126 ? -21.59100 28.00500  -55.97000 1.000 157.11357 ? 1202 GLU E OE1 1 
ATOM   4346 O  OE2 . GLU E 1 126 ? -22.53100 26.11900  -56.58500 1.000 146.68601 ? 1202 GLU E OE2 1 
ATOM   4347 N  N   . GLN F 1 4   ? -17.55500 19.37000  -64.89200 1.000 119.87753 ? 913  GLN F N   1 
ATOM   4348 C  CA  . GLN F 1 4   ? -18.13000 17.97800  -64.93000 1.000 121.63564 ? 913  GLN F CA  1 
ATOM   4349 C  C   . GLN F 1 4   ? -17.46400 17.11100  -63.85200 1.000 126.35462 ? 913  GLN F C   1 
ATOM   4350 O  O   . GLN F 1 4   ? -18.18900 16.40100  -63.12500 1.000 118.78003 ? 913  GLN F O   1 
ATOM   4351 C  CB  . GLN F 1 4   ? -17.92700 17.34300  -66.30800 1.000 120.79080 ? 913  GLN F CB  1 
ATOM   4352 C  CG  . GLN F 1 4   ? -19.18200 16.69700  -66.87000 1.000 120.04334 ? 913  GLN F CG  1 
ATOM   4353 C  CD  . GLN F 1 4   ? -18.92500 15.96800  -68.16900 1.000 118.32998 ? 913  GLN F CD  1 
ATOM   4354 O  OE1 . GLN F 1 4   ? -18.29900 16.48200  -69.10200 1.000 120.96714 ? 913  GLN F OE1 1 
ATOM   4355 N  NE2 . GLN F 1 4   ? -19.41900 14.74100  -68.22900 1.000 110.07109 ? 913  GLN F NE2 1 
ATOM   4356 N  N   . ASN F 1 5   ? -16.12900 17.15600  -63.78900 1.000 129.91821 ? 914  ASN F N   1 
ATOM   4357 C  CA  . ASN F 1 5   ? -15.29100 16.56700  -62.70900 1.000 129.24444 ? 914  ASN F CA  1 
ATOM   4358 C  C   . ASN F 1 5   ? -15.64700 17.20900  -61.36200 1.000 127.16525 ? 914  ASN F C   1 
ATOM   4359 O  O   . ASN F 1 5   ? -15.28500 16.63200  -60.31500 1.000 131.09993 ? 914  ASN F O   1 
ATOM   4360 C  CB  . ASN F 1 5   ? -13.79900 16.76600  -62.98800 1.000 133.15807 ? 914  ASN F CB  1 
ATOM   4361 C  CG  . ASN F 1 5   ? -13.25000 15.80900  -64.02300 1.000 141.04849 ? 914  ASN F CG  1 
ATOM   4362 O  OD1 . ASN F 1 5   ? -13.58800 14.62700  -64.02400 1.000 141.04586 ? 914  ASN F OD1 1 
ATOM   4363 N  ND2 . ASN F 1 5   ? -12.38300 16.30900  -64.88900 1.000 146.81760 ? 914  ASN F ND2 1 
ATOM   4364 N  N   . VAL F 1 6   ? -16.29800 18.37500  -61.39700 1.000 119.61434 ? 915  VAL F N   1 
ATOM   4365 C  CA  . VAL F 1 6   ? -16.80700 19.11700  -60.20600 1.000 119.64856 ? 915  VAL F CA  1 
ATOM   4366 C  C   . VAL F 1 6   ? -17.69800 18.17700  -59.38500 1.000 123.45164 ? 915  VAL F C   1 
ATOM   4367 O  O   . VAL F 1 6   ? -17.55800 18.17600  -58.14600 1.000 123.76747 ? 915  VAL F O   1 
ATOM   4368 C  CB  . VAL F 1 6   ? -17.55600 20.39800  -60.62900 1.000 126.19145 ? 915  VAL F CB  1 
ATOM   4369 C  CG1 . VAL F 1 6   ? -18.19900 21.11000  -59.44700 1.000 123.95960 ? 915  VAL F CG1 1 
ATOM   4370 C  CG2 . VAL F 1 6   ? -16.65000 21.35600  -61.39100 1.000 131.94477 ? 915  VAL F CG2 1 
ATOM   4371 N  N   . LEU F 1 7   ? -18.56500 17.40000  -60.04900 1.000 130.82095 ? 916  LEU F N   1 
ATOM   4372 C  CA  . LEU F 1 7   ? -19.51500 16.45500  -59.39400 1.000 119.27746 ? 916  LEU F CA  1 
ATOM   4373 C  C   . LEU F 1 7   ? -18.73200 15.40200  -58.60300 1.000 112.10291 ? 916  LEU F C   1 
ATOM   4374 O  O   . LEU F 1 7   ? -19.02900 15.24300  -57.41000 1.000 99.03819  ? 916  LEU F O   1 
ATOM   4375 C  CB  . LEU F 1 7   ? -20.43000 15.80300  -60.43900 1.000 114.44530 ? 916  LEU F CB  1 
ATOM   4376 C  CG  . LEU F 1 7   ? -21.65200 16.62300  -60.87000 1.000 107.69976 ? 916  LEU F CG  1 
ATOM   4377 C  CD1 . LEU F 1 7   ? -22.44900 15.88600  -61.93200 1.000 104.43357 ? 916  LEU F CD1 1 
ATOM   4378 C  CD2 . LEU F 1 7   ? -22.56200 16.95500  -59.69500 1.000 102.39122 ? 916  LEU F CD2 1 
ATOM   4379 N  N   . TYR F 1 8   ? -17.77000 14.72400  -59.23900 1.000 114.77692 ? 917  TYR F N   1 
ATOM   4380 C  CA  . TYR F 1 8   ? -16.90800 13.69700  -58.59300 1.000 114.80587 ? 917  TYR F CA  1 
ATOM   4381 C  C   . TYR F 1 8   ? -16.17600 14.33400  -57.41000 1.000 113.46624 ? 917  TYR F C   1 
ATOM   4382 O  O   . TYR F 1 8   ? -16.21800 13.74600  -56.31300 1.000 113.44518 ? 917  TYR F O   1 
ATOM   4383 C  CB  . TYR F 1 8   ? -15.86000 13.11100  -59.54400 1.000 121.96989 ? 917  TYR F CB  1 
ATOM   4384 C  CG  . TYR F 1 8   ? -16.34500 12.08800  -60.54200 1.000 130.14192 ? 917  TYR F CG  1 
ATOM   4385 C  CD1 . TYR F 1 8   ? -16.50600 10.75600  -60.18800 1.000 126.98101 ? 917  TYR F CD1 1 
ATOM   4386 C  CD2 . TYR F 1 8   ? -16.57900 12.44000  -61.86400 1.000 139.11668 ? 917  TYR F CD2 1 
ATOM   4387 C  CE1 . TYR F 1 8   ? -16.92300 9.81000   -61.11200 1.000 128.08641 ? 917  TYR F CE1 1 
ATOM   4388 C  CE2 . TYR F 1 8   ? -16.99500 11.50600  -62.80200 1.000 138.00602 ? 917  TYR F CE2 1 
ATOM   4389 C  CZ  . TYR F 1 8   ? -17.16700 10.18500  -62.42300 1.000 129.56027 ? 917  TYR F CZ  1 
ATOM   4390 O  OH  . TYR F 1 8   ? -17.56900 9.24800   -63.33000 1.000 118.79845 ? 917  TYR F OH  1 
ATOM   4391 N  N   . GLU F 1 9   ? -15.53000 15.48700  -57.63900 1.000 112.06344 ? 918  GLU F N   1 
ATOM   4392 C  CA  . GLU F 1 9   ? -14.69400 16.20800  -56.63400 1.000 112.10028 ? 918  GLU F CA  1 
ATOM   4393 C  C   . GLU F 1 9   ? -15.56400 16.61200  -55.43300 1.000 105.32052 ? 918  GLU F C   1 
ATOM   4394 O  O   . GLU F 1 9   ? -15.05000 16.59100  -54.29900 1.000 100.53311 ? 918  GLU F O   1 
ATOM   4395 C  CB  . GLU F 1 9   ? -14.00900 17.43500  -57.25100 1.000 109.39733 ? 918  GLU F CB  1 
ATOM   4396 C  CG  . GLU F 1 9   ? -12.93200 17.10800  -58.27500 1.000 107.53395 ? 918  GLU F CG  1 
ATOM   4397 C  CD  . GLU F 1 9   ? -11.58900 16.67900  -57.70700 1.000 111.83183 ? 918  GLU F CD  1 
ATOM   4398 O  OE1 . GLU F 1 9   ? -11.57800 15.98900  -56.66900 1.000 114.69007 ? 918  GLU F OE1 1 
ATOM   4399 O  OE2 . GLU F 1 9   ? -10.55300 17.03400  -58.30700 1.000 109.10782 ? 918  GLU F OE2 1 
ATOM   4400 N  N   . ASN F 1 10  ? -16.82600 16.97100  -55.67500 1.000 99.90145  ? 919  ASN F N   1 
ATOM   4401 C  CA  . ASN F 1 10  ? -17.81200 17.28500  -54.61100 1.000 96.45104  ? 919  ASN F CA  1 
ATOM   4402 C  C   . ASN F 1 10  ? -18.12500 16.00400  -53.83000 1.000 91.88207  ? 919  ASN F C   1 
ATOM   4403 O  O   . ASN F 1 10  ? -18.12100 16.06100  -52.59100 1.000 90.31609  ? 919  ASN F O   1 
ATOM   4404 C  CB  . ASN F 1 10  ? -19.07500 17.93700  -55.18800 1.000 105.97060 ? 919  ASN F CB  1 
ATOM   4405 C  CG  . ASN F 1 10  ? -18.87000 19.38800  -55.57300 1.000 106.52593 ? 919  ASN F CG  1 
ATOM   4406 O  OD1 . ASN F 1 10  ? -17.87800 20.00500  -55.18600 1.000 104.99943 ? 919  ASN F OD1 1 
ATOM   4407 N  ND2 . ASN F 1 10  ? -19.81400 19.94700  -56.31400 1.000 104.56780 ? 919  ASN F ND2 1 
ATOM   4408 N  N   . GLN F 1 11  ? -18.38700 14.89800  -54.53300 1.000 86.59196  ? 920  GLN F N   1 
ATOM   4409 C  CA  . GLN F 1 11  ? -18.86500 13.63100  -53.92100 1.000 90.70824  ? 920  GLN F CA  1 
ATOM   4410 C  C   . GLN F 1 11  ? -17.78500 13.08500  -52.98300 1.000 99.60931  ? 920  GLN F C   1 
ATOM   4411 O  O   . GLN F 1 11  ? -18.12000 12.80500  -51.81900 1.000 103.15184 ? 920  GLN F O   1 
ATOM   4412 C  CB  . GLN F 1 11  ? -19.25900 12.61600  -54.99200 1.000 83.90743  ? 920  GLN F CB  1 
ATOM   4413 C  CG  . GLN F 1 11  ? -20.54400 12.98500  -55.71600 1.000 88.04214  ? 920  GLN F CG  1 
ATOM   4414 C  CD  . GLN F 1 11  ? -21.32500 11.77800  -56.17700 1.000 94.52976  ? 920  GLN F CD  1 
ATOM   4415 O  OE1 . GLN F 1 11  ? -20.76400 10.73300  -56.49400 1.000 87.19203  ? 920  GLN F OE1 1 
ATOM   4416 N  NE2 . GLN F 1 11  ? -22.64200 11.91800  -56.22000 1.000 98.11966  ? 920  GLN F NE2 1 
ATOM   4417 N  N   . LYS F 1 12  ? -16.54200 12.95900  -53.46100 1.000 92.81376  ? 921  LYS F N   1 
ATOM   4418 C  CA  . LYS F 1 12  ? -15.37800 12.55200  -52.62800 1.000 90.05553  ? 921  LYS F CA  1 
ATOM   4419 C  C   . LYS F 1 12  ? -15.35800 13.41500  -51.36500 1.000 92.35318  ? 921  LYS F C   1 
ATOM   4420 O  O   . LYS F 1 12  ? -15.24400 12.82700  -50.27500 1.000 96.34313  ? 921  LYS F O   1 
ATOM   4421 C  CB  . LYS F 1 12  ? -14.05200 12.71100  -53.37600 1.000 88.25532  ? 921  LYS F CB  1 
ATOM   4422 C  CG  . LYS F 1 12  ? -13.84400 11.76600  -54.55000 1.000 88.42902  ? 921  LYS F CG  1 
ATOM   4423 C  CD  . LYS F 1 12  ? -12.84500 12.29200  -55.56000 1.000 92.79007  ? 921  LYS F CD  1 
ATOM   4424 C  CE  . LYS F 1 12  ? -12.76600 11.45200  -56.81900 1.000 93.49016  ? 921  LYS F CE  1 
ATOM   4425 N  NZ  . LYS F 1 12  ? -11.48500 11.65900  -57.53600 1.000 91.84785  ? 921  LYS F NZ  1 
ATOM   4426 N  N   . LEU F 1 13  ? -15.46700 14.74400  -51.51100 1.000 88.90803  ? 922  LEU F N   1 
ATOM   4427 C  CA  . LEU F 1 13  ? -15.41300 15.70400  -50.37700 1.000 79.78062  ? 922  LEU F CA  1 
ATOM   4428 C  C   . LEU F 1 13  ? -16.50200 15.31400  -49.37600 1.000 88.63694  ? 922  LEU F C   1 
ATOM   4429 O  O   . LEU F 1 13  ? -16.14500 14.98100  -48.23100 1.000 92.48214  ? 922  LEU F O   1 
ATOM   4430 C  CB  . LEU F 1 13  ? -15.59500 17.14000  -50.87800 1.000 79.54638  ? 922  LEU F CB  1 
ATOM   4431 C  CG  . LEU F 1 13  ? -15.56000 18.22300  -49.79800 1.000 83.87585  ? 922  LEU F CG  1 
ATOM   4432 C  CD1 . LEU F 1 13  ? -14.18700 18.30700  -49.14500 1.000 85.84977  ? 922  LEU F CD1 1 
ATOM   4433 C  CD2 . LEU F 1 13  ? -15.96000 19.57500  -50.36900 1.000 84.13640  ? 922  LEU F CD2 1 
ATOM   4434 N  N   . ILE F 1 14  ? -17.76200 15.30000  -49.82000 1.000 89.71865  ? 923  ILE F N   1 
ATOM   4435 C  CA  . ILE F 1 14  ? -18.95800 14.95600  -48.99100 1.000 76.32231  ? 923  ILE F CA  1 
ATOM   4436 C  C   . ILE F 1 14  ? -18.65900 13.69200  -48.16800 1.000 75.50905  ? 923  ILE F C   1 
ATOM   4437 O  O   . ILE F 1 14  ? -18.78000 13.74700  -46.92900 1.000 78.32518  ? 923  ILE F O   1 
ATOM   4438 C  CB  . ILE F 1 14  ? -20.20700 14.78900  -49.88300 1.000 86.78409  ? 923  ILE F CB  1 
ATOM   4439 C  CG1 . ILE F 1 14  ? -20.65400 16.12100  -50.49000 1.000 87.67893  ? 923  ILE F CG1 1 
ATOM   4440 C  CG2 . ILE F 1 14  ? -21.34100 14.12900  -49.11300 1.000 85.29970  ? 923  ILE F CG2 1 
ATOM   4441 C  CD1 . ILE F 1 14  ? -21.59100 15.97300  -51.66500 1.000 84.88386  ? 923  ILE F CD1 1 
ATOM   4442 N  N   . ALA F 1 15  ? -18.27000 12.60200  -48.83500 1.000 72.81663  ? 924  ALA F N   1 
ATOM   4443 C  CA  . ALA F 1 15  ? -17.97000 11.28100  -48.22900 1.000 76.79605  ? 924  ALA F CA  1 
ATOM   4444 C  C   . ALA F 1 15  ? -16.89000 11.40800  -47.14300 1.000 83.25735  ? 924  ALA F C   1 
ATOM   4445 O  O   . ALA F 1 15  ? -17.08900 10.83100  -46.05200 1.000 89.16859  ? 924  ALA F O   1 
ATOM   4446 C  CB  . ALA F 1 15  ? -17.55000 10.30900  -49.30500 1.000 71.32171  ? 924  ALA F CB  1 
ATOM   4447 N  N   . ASN F 1 16  ? -15.79100 12.12400  -47.42300 1.000 81.79665  ? 925  ASN F N   1 
ATOM   4448 C  CA  . ASN F 1 16  ? -14.63300 12.29300  -46.49700 1.000 77.42507  ? 925  ASN F CA  1 
ATOM   4449 C  C   . ASN F 1 16  ? -15.07100 13.11100  -45.27600 1.000 70.86113  ? 925  ASN F C   1 
ATOM   4450 O  O   . ASN F 1 16  ? -14.78700 12.67400  -44.14400 1.000 70.94272  ? 925  ASN F O   1 
ATOM   4451 C  CB  . ASN F 1 16  ? -13.41700 12.92300  -47.19100 1.000 73.06929  ? 925  ASN F CB  1 
ATOM   4452 C  CG  . ASN F 1 16  ? -12.73700 11.99600  -48.18200 1.000 87.49996  ? 925  ASN F CG  1 
ATOM   4453 O  OD1 . ASN F 1 16  ? -12.60100 10.79800  -47.93800 1.000 89.22649  ? 925  ASN F OD1 1 
ATOM   4454 N  ND2 . ASN F 1 16  ? -12.30800 12.53600  -49.31100 1.000 93.93231  ? 925  ASN F ND2 1 
ATOM   4455 N  N   . GLN F 1 17  ? -15.76000 14.23400  -45.50200 1.000 78.84893  ? 926  GLN F N   1 
ATOM   4456 C  CA  . GLN F 1 17  ? -16.34900 15.09000  -44.43300 1.000 80.14119  ? 926  GLN F CA  1 
ATOM   4457 C  C   . GLN F 1 17  ? -17.32000 14.26500  -43.58100 1.000 72.57186  ? 926  GLN F C   1 
ATOM   4458 O  O   . GLN F 1 17  ? -17.27300 14.41600  -42.34100 1.000 69.98207  ? 926  GLN F O   1 
ATOM   4459 C  CB  . GLN F 1 17  ? -17.10200 16.29800  -45.00500 1.000 81.76243  ? 926  GLN F CB  1 
ATOM   4460 C  CG  . GLN F 1 17  ? -16.24300 17.30200  -45.77700 1.000 87.95528  ? 926  GLN F CG  1 
ATOM   4461 C  CD  . GLN F 1 17  ? -14.90600 17.60800  -45.14200 1.000 88.53693  ? 926  GLN F CD  1 
ATOM   4462 O  OE1 . GLN F 1 17  ? -14.80100 17.83800  -43.94000 1.000 87.33152  ? 926  GLN F OE1 1 
ATOM   4463 N  NE2 . GLN F 1 17  ? -13.86300 17.62700  -45.95500 1.000 89.34229  ? 926  GLN F NE2 1 
ATOM   4464 N  N   . PHE F 1 18  ? -18.17600 13.45700  -44.22100 1.000 64.55774  ? 927  PHE F N   1 
ATOM   4465 C  CA  . PHE F 1 18  ? -19.17000 12.57700  -43.55000 1.000 70.21631  ? 927  PHE F CA  1 
ATOM   4466 C  C   . PHE F 1 18  ? -18.43700 11.55100  -42.68800 1.000 69.98734  ? 927  PHE F C   1 
ATOM   4467 O  O   . PHE F 1 18  ? -18.78900 11.42000  -41.50700 1.000 71.91389  ? 927  PHE F O   1 
ATOM   4468 C  CB  . PHE F 1 18  ? -20.07500 11.87500  -44.56200 1.000 64.32087  ? 927  PHE F CB  1 
ATOM   4469 C  CG  . PHE F 1 18  ? -21.08100 10.94000  -43.94500 1.000 62.41538  ? 927  PHE F CG  1 
ATOM   4470 C  CD1 . PHE F 1 18  ? -22.04800 11.42000  -43.07900 1.000 63.50235  ? 927  PHE F CD1 1 
ATOM   4471 C  CD2 . PHE F 1 18  ? -21.07400 9.58600   -44.23400 1.000 64.59459  ? 927  PHE F CD2 1 
ATOM   4472 C  CE1 . PHE F 1 18  ? -22.98600 10.57200  -42.50800 1.000 61.86268  ? 927  PHE F CE1 1 
ATOM   4473 C  CE2 . PHE F 1 18  ? -22.01800 8.74100   -43.66900 1.000 67.50809  ? 927  PHE F CE2 1 
ATOM   4474 C  CZ  . PHE F 1 18  ? -22.97800 9.23500   -42.81300 1.000 59.88350  ? 927  PHE F CZ  1 
ATOM   4475 N  N   . ASN F 1 19  ? -17.44700 10.86400  -43.27000 1.000 70.95588  ? 928  ASN F N   1 
ATOM   4476 C  CA  . ASN F 1 19  ? -16.65700 9.79500   -42.59800 1.000 65.66050  ? 928  ASN F CA  1 
ATOM   4477 C  C   . ASN F 1 19  ? -15.90100 10.42300  -41.42300 1.000 76.32757  ? 928  ASN F C   1 
ATOM   4478 O  O   . ASN F 1 19  ? -15.82700 9.78300   -40.35700 1.000 81.27817  ? 928  ASN F O   1 
ATOM   4479 C  CB  . ASN F 1 19  ? -15.72500 9.06200   -43.57400 1.000 67.56073  ? 928  ASN F CB  1 
ATOM   4480 C  CG  . ASN F 1 19  ? -16.41400 7.97100   -44.37500 1.000 69.32937  ? 928  ASN F CG  1 
ATOM   4481 O  OD1 . ASN F 1 19  ? -17.55000 7.59100   -44.09800 1.000 74.04309  ? 928  ASN F OD1 1 
ATOM   4482 N  ND2 . ASN F 1 19  ? -15.71900 7.42600   -45.35800 1.000 66.77116  ? 928  ASN F ND2 1 
ATOM   4483 N  N   . SER F 1 20  ? -15.37800 11.63700  -41.61900 1.000 73.94834  ? 929  SER F N   1 
ATOM   4484 C  CA  . SER F 1 20  ? -14.74100 12.47100  -40.56900 1.000 71.86651  ? 929  SER F CA  1 
ATOM   4485 C  C   . SER F 1 20  ? -15.72600 12.65400  -39.40700 1.000 72.99823  ? 929  SER F C   1 
ATOM   4486 O  O   . SER F 1 20  ? -15.42600 12.18300  -38.29600 1.000 74.34839  ? 929  SER F O   1 
ATOM   4487 C  CB  . SER F 1 20  ? -14.27900 13.78900  -41.15700 1.000 79.62797  ? 929  SER F CB  1 
ATOM   4488 O  OG  . SER F 1 20  ? -14.02400 14.76400  -40.15000 1.000 78.68312  ? 929  SER F OG  1 
ATOM   4489 N  N   . ALA F 1 21  ? -16.88500 13.25500  -39.67700 1.000 70.89797  ? 930  ALA F N   1 
ATOM   4490 C  CA  . ALA F 1 21  ? -17.92000 13.60500  -38.67500 1.000 60.42830  ? 930  ALA F CA  1 
ATOM   4491 C  C   . ALA F 1 21  ? -18.33800 12.37400  -37.86100 1.000 70.96904  ? 930  ALA F C   1 
ATOM   4492 O  O   . ALA F 1 21  ? -18.37900 12.46900  -36.61400 1.000 68.98722  ? 930  ALA F O   1 
ATOM   4493 C  CB  . ALA F 1 21  ? -19.10800 14.22400  -39.36500 1.000 59.95456  ? 930  ALA F CB  1 
ATOM   4494 N  N   . ILE F 1 22  ? -18.67300 11.26900  -38.53100 1.000 66.20531  ? 931  ILE F N   1 
ATOM   4495 C  CA  . ILE F 1 22  ? -19.08900 10.00800  -37.85300 1.000 67.62127  ? 931  ILE F CA  1 
ATOM   4496 C  C   . ILE F 1 22  ? -17.96600 9.55600   -36.92200 1.000 71.41646  ? 931  ILE F C   1 
ATOM   4497 O  O   . ILE F 1 22  ? -18.27900 9.19200   -35.77200 1.000 78.03567  ? 931  ILE F O   1 
ATOM   4498 C  CB  . ILE F 1 22  ? -19.43600 8.90900   -38.86200 1.000 65.38416  ? 931  ILE F CB  1 
ATOM   4499 C  CG1 . ILE F 1 22  ? -20.73900 9.23600   -39.59300 1.000 66.28690  ? 931  ILE F CG1 1 
ATOM   4500 C  CG2 . ILE F 1 22  ? -19.48200 7.55500   -38.16700 1.000 67.41335  ? 931  ILE F CG2 1 
ATOM   4501 C  CD1 . ILE F 1 22  ? -21.14300 8.18900   -40.60100 1.000 71.36382  ? 931  ILE F CD1 1 
ATOM   4502 N  N   . GLY F 1 23  ? -16.72200 9.55700   -37.41700 1.000 66.98698  ? 932  GLY F N   1 
ATOM   4503 C  CA  . GLY F 1 23  ? -15.53500 9.17300   -36.63300 1.000 77.10398  ? 932  GLY F CA  1 
ATOM   4504 C  C   . GLY F 1 23  ? -15.54000 9.89800   -35.30700 1.000 77.10925  ? 932  GLY F C   1 
ATOM   4505 O  O   . GLY F 1 23  ? -15.53400 9.21500   -34.26300 1.000 80.90970  ? 932  GLY F O   1 
ATOM   4506 N  N   . LYS F 1 24  ? -15.62500 11.23100  -35.36800 1.000 74.40892  ? 933  LYS F N   1 
ATOM   4507 C  CA  . LYS F 1 24  ? -15.65000 12.14100  -34.19700 1.000 71.00588  ? 933  LYS F CA  1 
ATOM   4508 C  C   . LYS F 1 24  ? -16.84500 11.79900  -33.30800 1.000 70.63215  ? 933  LYS F C   1 
ATOM   4509 O  O   . LYS F 1 24  ? -16.68000 11.75700  -32.07700 1.000 77.51982  ? 933  LYS F O   1 
ATOM   4510 C  CB  . LYS F 1 24  ? -15.73900 13.59500  -34.65800 1.000 71.74281  ? 933  LYS F CB  1 
ATOM   4511 C  CG  . LYS F 1 24  ? -14.56500 14.08300  -35.49000 1.000 72.77978  ? 933  LYS F CG  1 
ATOM   4512 C  CD  . LYS F 1 24  ? -14.72200 15.51400  -35.93000 1.000 86.02347  ? 933  LYS F CD  1 
ATOM   4513 C  CE  . LYS F 1 24  ? -13.55100 16.01700  -36.74700 1.000 93.84546  ? 933  LYS F CE  1 
ATOM   4514 N  NZ  . LYS F 1 24  ? -13.82400 17.35700  -37.31900 1.000 93.05853  ? 933  LYS F NZ  1 
ATOM   4515 N  N   . ILE F 1 25  ? -18.00900 11.55400  -33.90300 1.000 77.60667  ? 934  ILE F N   1 
ATOM   4516 C  CA  . ILE F 1 25  ? -19.25800 11.27900  -33.13500 1.000 72.89821  ? 934  ILE F CA  1 
ATOM   4517 C  C   . ILE F 1 25  ? -19.11100 9.95700   -32.38700 1.000 59.42291  ? 934  ILE F C   1 
ATOM   4518 O  O   . ILE F 1 25  ? -19.53600 9.91100   -31.23400 1.000 58.18329  ? 934  ILE F O   1 
ATOM   4519 C  CB  . ILE F 1 25  ? -20.48400 11.32300  -34.05700 1.000 68.96090  ? 934  ILE F CB  1 
ATOM   4520 C  CG1 . ILE F 1 25  ? -20.78900 12.78000  -34.42700 1.000 59.36238  ? 934  ILE F CG1 1 
ATOM   4521 C  CG2 . ILE F 1 25  ? -21.66800 10.61100  -33.41800 1.000 65.34994  ? 934  ILE F CG2 1 
ATOM   4522 C  CD1 . ILE F 1 25  ? -21.57500 12.95100  -35.70600 1.000 54.23282  ? 934  ILE F CD1 1 
ATOM   4523 N  N   . GLN F 1 26  ? -18.50100 8.94800   -33.01000 1.000 67.30281  ? 935  GLN F N   1 
ATOM   4524 C  CA  . GLN F 1 26  ? -18.17300 7.64700   -32.36100 1.000 75.78277  ? 935  GLN F CA  1 
ATOM   4525 C  C   . GLN F 1 26  ? -17.34100 7.90500   -31.09300 1.000 78.19885  ? 935  GLN F C   1 
ATOM   4526 O  O   . GLN F 1 26  ? -17.69800 7.39600   -30.00800 1.000 72.71661  ? 935  GLN F O   1 
ATOM   4527 C  CB  . GLN F 1 26  ? -17.41300 6.73600   -33.32800 1.000 73.72726  ? 935  GLN F CB  1 
ATOM   4528 C  CG  . GLN F 1 26  ? -18.26500 6.17000   -34.45600 1.000 84.88649  ? 935  GLN F CG  1 
ATOM   4529 C  CD  . GLN F 1 26  ? -17.45400 5.27900   -35.36700 1.000 97.17481  ? 935  GLN F CD  1 
ATOM   4530 O  OE1 . GLN F 1 26  ? -17.94000 4.26700   -35.86900 1.000 102.77022 ? 935  GLN F OE1 1 
ATOM   4531 N  NE2 . GLN F 1 26  ? -16.19900 5.65100   -35.58300 1.000 100.30940 ? 935  GLN F NE2 1 
ATOM   4532 N  N   . ASP F 1 27  ? -16.26700 8.68400   -31.21600 1.000 85.64711  ? 936  ASP F N   1 
ATOM   4533 C  CA  . ASP F 1 27  ? -15.39300 9.04500   -30.06900 1.000 87.78158  ? 936  ASP F CA  1 
ATOM   4534 C  C   . ASP F 1 27  ? -16.27500 9.72500   -29.00700 1.000 78.23833  ? 936  ASP F C   1 
ATOM   4535 O  O   . ASP F 1 27  ? -16.13600 9.37600   -27.82000 1.000 77.62510  ? 936  ASP F O   1 
ATOM   4536 C  CB  . ASP F 1 27  ? -14.17200 9.87600   -30.51400 1.000 93.84283  ? 936  ASP F CB  1 
ATOM   4537 C  CG  . ASP F 1 27  ? -12.91400 9.08500   -30.89300 1.000 97.50380  ? 936  ASP F CG  1 
ATOM   4538 O  OD1 . ASP F 1 27  ? -12.55700 8.12800   -30.15800 1.000 104.84415 ? 936  ASP F OD1 1 
ATOM   4539 O  OD2 . ASP F 1 27  ? -12.27000 9.44200   -31.91600 1.000 84.07324  ? 936  ASP F OD2 1 
ATOM   4540 N  N   . SER F 1 28  ? -17.18700 10.62000  -29.41500 1.000 76.22756  ? 937  SER F N   1 
ATOM   4541 C  CA  . SER F 1 28  ? -18.05500 11.41400  -28.50200 1.000 69.27146  ? 937  SER F CA  1 
ATOM   4542 C  C   . SER F 1 28  ? -19.05600 10.50400  -27.77900 1.000 62.21799  ? 937  SER F C   1 
ATOM   4543 O  O   . SER F 1 28  ? -19.27300 10.68700  -26.56800 1.000 52.76422  ? 937  SER F O   1 
ATOM   4544 C  CB  . SER F 1 28  ? -18.76900 12.50200  -29.24300 1.000 67.14752  ? 937  SER F CB  1 
ATOM   4545 O  OG  . SER F 1 28  ? -19.93200 11.98600  -29.86800 1.000 79.59639  ? 937  SER F OG  1 
ATOM   4546 N  N   . LEU F 1 29  ? -19.66000 9.55900   -28.49400 1.000 58.33331  ? 938  LEU F N   1 
ATOM   4547 C  CA  . LEU F 1 29  ? -20.59300 8.58500   -27.88100 1.000 62.70752  ? 938  LEU F CA  1 
ATOM   4548 C  C   . LEU F 1 29  ? -19.83800 7.73800   -26.85500 1.000 71.21117  ? 938  LEU F C   1 
ATOM   4549 O  O   . LEU F 1 29  ? -20.38200 7.52900   -25.76000 1.000 76.06965  ? 938  LEU F O   1 
ATOM   4550 C  CB  . LEU F 1 29  ? -21.21100 7.70700   -28.96700 1.000 63.60499  ? 938  LEU F CB  1 
ATOM   4551 C  CG  . LEU F 1 29  ? -22.15000 8.42600   -29.92600 1.000 55.93829  ? 938  LEU F CG  1 
ATOM   4552 C  CD1 . LEU F 1 29  ? -22.66900 7.45100   -30.96200 1.000 68.60033  ? 938  LEU F CD1 1 
ATOM   4553 C  CD2 . LEU F 1 29  ? -23.30000 9.08200   -29.18000 1.000 55.25399  ? 938  LEU F CD2 1 
ATOM   4554 N  N   . SER F 1 30  ? -18.63400 7.27200   -27.19300 1.000 72.84294  ? 939  SER F N   1 
ATOM   4555 C  CA  . SER F 1 30  ? -17.80200 6.41100   -26.30800 1.000 75.38009  ? 939  SER F CA  1 
ATOM   4556 C  C   . SER F 1 30  ? -17.50500 7.16200   -25.00000 1.000 71.16380  ? 939  SER F C   1 
ATOM   4557 O  O   . SER F 1 30  ? -17.65500 6.55000   -23.92000 1.000 74.55894  ? 939  SER F O   1 
ATOM   4558 C  CB  . SER F 1 30  ? -16.53800 5.95500   -27.01700 1.000 75.29324  ? 939  SER F CB  1 
ATOM   4559 O  OG  . SER F 1 30  ? -15.92900 4.85900   -26.34400 1.000 75.16691  ? 939  SER F OG  1 
ATOM   4560 N  N   . SER F 1 31  ? -17.12900 8.43900   -25.10000 1.000 63.48919  ? 940  SER F N   1 
ATOM   4561 C  CA  . SER F 1 31  ? -16.78000 9.31500   -23.95600 1.000 63.80765  ? 940  SER F CA  1 
ATOM   4562 C  C   . SER F 1 31  ? -18.01700 9.51400   -23.08400 1.000 68.24766  ? 940  SER F C   1 
ATOM   4563 O  O   . SER F 1 31  ? -17.89000 9.43400   -21.84900 1.000 57.99380  ? 940  SER F O   1 
ATOM   4564 C  CB  . SER F 1 31  ? -16.22200 10.62200  -24.43600 1.000 65.95001  ? 940  SER F CB  1 
ATOM   4565 O  OG  . SER F 1 31  ? -15.13300 10.39500  -25.32200 1.000 75.31693  ? 940  SER F OG  1 
ATOM   4566 N  N   . THR F 1 32  ? -19.17500 9.74300   -23.70700 1.000 65.10254  ? 941  THR F N   1 
ATOM   4567 C  CA  . THR F 1 32  ? -20.46900 9.92700   -23.00000 1.000 60.17827  ? 941  THR F CA  1 
ATOM   4568 C  C   . THR F 1 32  ? -20.74800 8.68100   -22.14300 1.000 61.44158  ? 941  THR F C   1 
ATOM   4569 O  O   . THR F 1 32  ? -21.01700 8.84900   -20.92800 1.000 56.49625  ? 941  THR F O   1 
ATOM   4570 C  CB  . THR F 1 32  ? -21.61500 10.22600  -23.97500 1.000 53.58011  ? 941  THR F CB  1 
ATOM   4571 O  OG1 . THR F 1 32  ? -21.28600 11.36700  -24.77100 1.000 51.89306  ? 941  THR F OG1 1 
ATOM   4572 C  CG2 . THR F 1 32  ? -22.92600 10.46400  -23.26000 1.000 49.54541  ? 941  THR F CG2 1 
ATOM   4573 N  N   . ALA F 1 33  ? -20.67900 7.48900   -22.75200 1.000 53.61959  ? 942  ALA F N   1 
ATOM   4574 C  CA  . ALA F 1 33  ? -20.86900 6.16500   -22.10100 1.000 57.85431  ? 942  ALA F CA  1 
ATOM   4575 C  C   . ALA F 1 33  ? -19.87900 5.96000   -20.93500 1.000 66.28690  ? 942  ALA F C   1 
ATOM   4576 O  O   . ALA F 1 33  ? -20.29100 5.39600   -19.89200 1.000 74.67737  ? 942  ALA F O   1 
ATOM   4577 C  CB  . ALA F 1 33  ? -20.73800 5.06900   -23.13200 1.000 61.41526  ? 942  ALA F CB  1 
ATOM   4578 N  N   . SER F 1 34  ? -18.61500 6.37300   -21.09000 1.000 58.79916  ? 943  SER F N   1 
ATOM   4579 C  CA  . SER F 1 34  ? -17.60900 6.42700   -19.99000 1.000 64.87620  ? 943  SER F CA  1 
ATOM   4580 C  C   . SER F 1 34  ? -18.18500 7.23600   -18.81900 1.000 64.84988  ? 943  SER F C   1 
ATOM   4581 O  O   . SER F 1 34  ? -18.36700 6.67300   -17.71600 1.000 55.98303  ? 943  SER F O   1 
ATOM   4582 C  CB  . SER F 1 34  ? -16.29600 7.04700   -20.43900 1.000 68.93984  ? 943  SER F CB  1 
ATOM   4583 O  OG  . SER F 1 34  ? -15.37600 6.08800   -20.92900 1.000 83.51528  ? 943  SER F OG  1 
ATOM   4584 N  N   . ALA F 1 35  ? -18.46300 8.51700   -19.07100 1.000 52.46155  ? 944  ALA F N   1 
ATOM   4585 C  CA  . ALA F 1 35  ? -18.90400 9.49500   -18.05700 1.000 47.35041  ? 944  ALA F CA  1 
ATOM   4586 C  C   . ALA F 1 35  ? -20.14100 8.98100   -17.32500 1.000 62.97071  ? 944  ALA F C   1 
ATOM   4587 O  O   . ALA F 1 35  ? -20.19000 9.11100   -16.10000 1.000 46.18975  ? 944  ALA F O   1 
ATOM   4588 C  CB  . ALA F 1 35  ? -19.17900 10.82100  -18.70900 1.000 45.37123  ? 944  ALA F CB  1 
ATOM   4589 N  N   . LEU F 1 36  ? -21.11800 8.42700   -18.05000 1.000 61.51264  ? 945  LEU F N   1 
ATOM   4590 C  CA  . LEU F 1 36  ? -22.37000 7.89000   -17.44300 1.000 54.94343  ? 945  LEU F CA  1 
ATOM   4591 C  C   . LEU F 1 36  ? -22.05000 6.63200   -16.62600 1.000 61.44684  ? 945  LEU F C   1 
ATOM   4592 O  O   . LEU F 1 36  ? -22.72300 6.38800   -15.58700 1.000 61.15470  ? 945  LEU F O   1 
ATOM   4593 C  CB  . LEU F 1 36  ? -23.39600 7.61000   -18.54400 1.000 53.50905  ? 945  LEU F CB  1 
ATOM   4594 C  CG  . LEU F 1 36  ? -23.98400 8.85500   -19.20600 1.000 49.68227  ? 945  LEU F CG  1 
ATOM   4595 C  CD1 . LEU F 1 36  ? -24.73400 8.50600   -20.48400 1.000 45.03435  ? 945  LEU F CD1 1 
ATOM   4596 C  CD2 . LEU F 1 36  ? -24.89600 9.58500   -18.23300 1.000 44.51323  ? 945  LEU F CD2 1 
ATOM   4597 N  N   . GLY F 1 37  ? -21.05800 5.85200   -17.05500 1.000 56.62784  ? 946  GLY F N   1 
ATOM   4598 C  CA  . GLY F 1 37  ? -20.58800 4.71100   -16.25300 1.000 58.91496  ? 946  GLY F CA  1 
ATOM   4599 C  C   . GLY F 1 37  ? -20.06300 5.17100   -14.90500 1.000 52.99583  ? 946  GLY F C   1 
ATOM   4600 O  O   . GLY F 1 37  ? -20.56500 4.67800   -13.85700 1.000 58.18066  ? 946  GLY F O   1 
ATOM   4601 N  N   . LYS F 1 38  ? -19.10700 6.10400   -14.93100 1.000 51.40880  ? 947  LYS F N   1 
ATOM   4602 C  CA  . LYS F 1 38  ? -18.39600 6.56700   -13.71500 1.000 51.34563  ? 947  LYS F CA  1 
ATOM   4603 C  C   . LYS F 1 38  ? -19.42000 7.18000   -12.75800 1.000 49.11115  ? 947  LYS F C   1 
ATOM   4604 O  O   . LYS F 1 38  ? -19.40900 6.80600   -11.57300 1.000 49.77176  ? 947  LYS F O   1 
ATOM   4605 C  CB  . LYS F 1 38  ? -17.25300 7.51100   -14.09700 1.000 51.13245  ? 947  LYS F CB  1 
ATOM   4606 C  CG  . LYS F 1 38  ? -16.07700 6.82900   -14.79600 1.000 63.78396  ? 947  LYS F CG  1 
ATOM   4607 C  CD  . LYS F 1 38  ? -14.96300 7.78600   -15.17000 1.000 67.48704  ? 947  LYS F CD  1 
ATOM   4608 C  CE  . LYS F 1 38  ? -13.76600 7.14200   -15.83700 1.000 64.28139  ? 947  LYS F CE  1 
ATOM   4609 N  NZ  . LYS F 1 38  ? -13.01800 8.13800   -16.64000 1.000 59.07550  ? 947  LYS F NZ  1 
ATOM   4610 N  N   . LEU F 1 39  ? -20.31200 8.02900   -13.27200 1.000 51.94307  ? 948  LEU F N   1 
ATOM   4611 C  CA  . LEU F 1 39  ? -21.40400 8.64500   -12.47700 1.000 49.30328  ? 948  LEU F CA  1 
ATOM   4612 C  C   . LEU F 1 39  ? -22.26700 7.53400   -11.86600 1.000 56.85419  ? 948  LEU F C   1 
ATOM   4613 O  O   . LEU F 1 39  ? -22.50900 7.60600   -10.64200 1.000 57.88589  ? 948  LEU F O   1 
ATOM   4614 C  CB  . LEU F 1 39  ? -22.20500 9.63000   -13.34100 1.000 44.61851  ? 948  LEU F CB  1 
ATOM   4615 C  CG  . LEU F 1 39  ? -21.49300 10.96200  -13.60600 1.000 43.20518  ? 948  LEU F CG  1 
ATOM   4616 C  CD1 . LEU F 1 39  ? -22.23500 11.81500  -14.61600 1.000 38.44935  ? 948  LEU F CD1 1 
ATOM   4617 C  CD2 . LEU F 1 39  ? -21.29500 11.73800  -12.31800 1.000 40.43116  ? 948  LEU F CD2 1 
ATOM   4618 N  N   . GLN F 1 40  ? -22.66300 6.51700   -12.64100 1.000 56.96209  ? 949  GLN F N   1 
ATOM   4619 C  CA  . GLN F 1 40  ? -23.52900 5.42100   -12.12600 1.000 65.91053  ? 949  GLN F CA  1 
ATOM   4620 C  C   . GLN F 1 40  ? -22.80500 4.71300   -10.97200 1.000 74.98267  ? 949  GLN F C   1 
ATOM   4621 O  O   . GLN F 1 40  ? -23.40300 4.56800   -9.88100  1.000 83.74952  ? 949  GLN F O   1 
ATOM   4622 C  CB  . GLN F 1 40  ? -23.90400 4.42700   -13.22600 1.000 63.42339  ? 949  GLN F CB  1 
ATOM   4623 C  CG  . GLN F 1 40  ? -24.76800 3.27200   -12.71300 1.000 71.45330  ? 949  GLN F CG  1 
ATOM   4624 C  CD  . GLN F 1 40  ? -25.29100 2.33900   -13.78200 1.000 72.70082  ? 949  GLN F CD  1 
ATOM   4625 O  OE1 . GLN F 1 40  ? -24.62500 2.05300   -14.77700 1.000 68.52137  ? 949  GLN F OE1 1 
ATOM   4626 N  NE2 . GLN F 1 40  ? -26.49700 1.83500   -13.56800 1.000 70.19263  ? 949  GLN F NE2 1 
ATOM   4627 N  N   . ASP F 1 41  ? -21.55700 4.30000   -11.18900 1.000 68.55559  ? 950  ASP F N   1 
ATOM   4628 C  CA  . ASP F 1 41  ? -20.76200 3.58100   -10.16000 1.000 73.44565  ? 950  ASP F CA  1 
ATOM   4629 C  C   . ASP F 1 41  ? -20.75700 4.41700   -8.87600  1.000 75.56696  ? 950  ASP F C   1 
ATOM   4630 O  O   . ASP F 1 41  ? -21.24700 3.89600   -7.85300  1.000 78.04620  ? 950  ASP F O   1 
ATOM   4631 C  CB  . ASP F 1 41  ? -19.35100 3.24500   -10.66100 1.000 78.86735  ? 950  ASP F CB  1 
ATOM   4632 C  CG  . ASP F 1 41  ? -19.30600 2.17100   -11.74400 1.000 90.82931  ? 950  ASP F CG  1 
ATOM   4633 O  OD1 . ASP F 1 41  ? -20.28100 1.39500   -11.85600 1.000 94.72715  ? 950  ASP F OD1 1 
ATOM   4634 O  OD2 . ASP F 1 41  ? -18.29600 2.11900   -12.47400 1.000 96.63527  ? 950  ASP F OD2 1 
ATOM   4635 N  N   . VAL F 1 42  ? -20.28400 5.67200   -8.95500  1.000 73.84570  ? 951  VAL F N   1 
ATOM   4636 C  CA  . VAL F 1 42  ? -20.03100 6.56500   -7.78000  1.000 66.57377  ? 951  VAL F CA  1 
ATOM   4637 C  C   . VAL F 1 42  ? -21.35200 6.92200   -7.09200  1.000 63.02071  ? 951  VAL F C   1 
ATOM   4638 O  O   . VAL F 1 42  ? -21.39000 6.86800   -5.84200  1.000 74.51946  ? 951  VAL F O   1 
ATOM   4639 C  CB  . VAL F 1 42  ? -19.23700 7.82700   -8.16500  1.000 56.38044  ? 951  VAL F CB  1 
ATOM   4640 C  CG1 . VAL F 1 42  ? -19.18300 8.83200   -7.01800  1.000 53.23533  ? 951  VAL F CG1 1 
ATOM   4641 C  CG2 . VAL F 1 42  ? -17.83400 7.45800   -8.63600  1.000 60.19143  ? 951  VAL F CG2 1 
ATOM   4642 N  N   . VAL F 1 43  ? -22.39500 7.27200   -7.84700  1.000 62.02586  ? 952  VAL F N   1 
ATOM   4643 C  CA  . VAL F 1 43  ? -23.72200 7.59100   -7.24100  1.000 64.96832  ? 952  VAL F CA  1 
ATOM   4644 C  C   . VAL F 1 43  ? -24.19300 6.42000   -6.36400  1.000 66.50534  ? 952  VAL F C   1 
ATOM   4645 O  O   . VAL F 1 43  ? -24.67200 6.68100   -5.25000  1.000 68.40557  ? 952  VAL F O   1 
ATOM   4646 C  CB  . VAL F 1 43  ? -24.78600 7.94000   -8.29100  1.000 60.04667  ? 952  VAL F CB  1 
ATOM   4647 C  CG1 . VAL F 1 43  ? -26.16400 7.91600   -7.65800  1.000 61.56528  ? 952  VAL F CG1 1 
ATOM   4648 C  CG2 . VAL F 1 43  ? -24.53500 9.29000   -8.94100  1.000 48.01102  ? 952  VAL F CG2 1 
ATOM   4649 N  N   . ASN F 1 44  ? -24.06600 5.18500   -6.85100  1.000 64.78408  ? 953  ASN F N   1 
ATOM   4650 C  CA  . ASN F 1 44  ? -24.53000 3.94700   -6.16500  1.000 57.65691  ? 953  ASN F CA  1 
ATOM   4651 C  C   . ASN F 1 44  ? -23.67500 3.64700   -4.92000  1.000 72.19550  ? 953  ASN F C   1 
ATOM   4652 O  O   . ASN F 1 44  ? -24.25900 3.22800   -3.88100  1.000 77.71984  ? 953  ASN F O   1 
ATOM   4653 C  CB  . ASN F 1 44  ? -24.54700 2.77500   -7.14600  1.000 59.17815  ? 953  ASN F CB  1 
ATOM   4654 C  CG  . ASN F 1 44  ? -25.62800 2.92000   -8.19300  1.000 65.55260  ? 953  ASN F CG  1 
ATOM   4655 O  OD1 . ASN F 1 44  ? -26.64200 3.58300   -7.97100  1.000 65.83158  ? 953  ASN F OD1 1 
ATOM   4656 N  ND2 . ASN F 1 44  ? -25.41600 2.29700   -9.33900  1.000 69.70046  ? 953  ASN F ND2 1 
ATOM   4657 N  N   . GLN F 1 45  ? -22.34800 3.81200   -5.01600  1.000 68.04500  ? 954  GLN F N   1 
ATOM   4658 C  CA  . GLN F 1 45  ? -21.39800 3.65500   -3.87800  1.000 70.75848  ? 954  GLN F CA  1 
ATOM   4659 C  C   . GLN F 1 45  ? -21.79500 4.62200   -2.76500  1.000 68.75824  ? 954  GLN F C   1 
ATOM   4660 O  O   . GLN F 1 45  ? -21.86000 4.17800   -1.60800  1.000 74.42734  ? 954  GLN F O   1 
ATOM   4661 C  CB  . GLN F 1 45  ? -19.95400 3.94700   -4.29200  1.000 81.95456  ? 954  GLN F CB  1 
ATOM   4662 C  CG  . GLN F 1 45  ? -19.29000 2.82400   -5.08800  1.000 92.46898  ? 954  GLN F CG  1 
ATOM   4663 C  CD  . GLN F 1 45  ? -18.92000 1.61700   -4.25100  1.000 101.38058 ? 954  GLN F CD  1 
ATOM   4664 O  OE1 . GLN F 1 45  ? -18.64400 1.71400   -3.05300  1.000 106.91019 ? 954  GLN F OE1 1 
ATOM   4665 N  NE2 . GLN F 1 45  ? -18.89700 0.45500   -4.88700  1.000 98.75131  ? 954  GLN F NE2 1 
ATOM   4666 N  N   . ASN F 1 46  ? -22.05800 5.88200   -3.13200  1.000 63.16547  ? 955  ASN F N   1 
ATOM   4667 C  CA  . ASN F 1 46  ? -22.45600 6.97800   -2.20900  1.000 70.03998  ? 955  ASN F CA  1 
ATOM   4668 C  C   . ASN F 1 46  ? -23.84400 6.70600   -1.62600  1.000 70.97167  ? 955  ASN F C   1 
ATOM   4669 O  O   . ASN F 1 46  ? -24.06200 7.04100   -0.44400  1.000 66.30532  ? 955  ASN F O   1 
ATOM   4670 C  CB  . ASN F 1 46  ? -22.40500 8.34000   -2.89900  1.000 57.52532  ? 955  ASN F CB  1 
ATOM   4671 C  CG  . ASN F 1 46  ? -20.98800 8.78900   -3.18700  1.000 63.89450  ? 955  ASN F CG  1 
ATOM   4672 O  OD1 . ASN F 1 46  ? -20.02900 8.04900   -2.96400  1.000 66.54482  ? 955  ASN F OD1 1 
ATOM   4673 N  ND2 . ASN F 1 46  ? -20.84700 10.00500  -3.68400  1.000 57.50426  ? 955  ASN F ND2 1 
ATOM   4674 N  N   . ALA F 1 47  ? -24.74900 6.12500   -2.41000  1.000 62.82595  ? 956  ALA F N   1 
ATOM   4675 C  CA  . ALA F 1 47  ? -26.08900 5.71800   -1.93700  1.000 63.58131  ? 956  ALA F CA  1 
ATOM   4676 C  C   . ALA F 1 47  ? -25.93800 4.60700   -0.89000  1.000 72.75872  ? 956  ALA F C   1 
ATOM   4677 O  O   . ALA F 1 47  ? -26.62200 4.67400   0.15500   1.000 77.12767  ? 956  ALA F O   1 
ATOM   4678 C  CB  . ALA F 1 47  ? -26.94400 5.28200   -3.09400  1.000 65.95001  ? 956  ALA F CB  1 
ATOM   4679 N  N   . GLN F 1 48  ? -25.06400 3.63000   -1.13600  1.000 80.19383  ? 957  GLN F N   1 
ATOM   4680 C  CA  . GLN F 1 48  ? -24.89100 2.48600   -0.20300  1.000 87.03938  ? 957  GLN F CA  1 
ATOM   4681 C  C   . GLN F 1 48  ? -24.21800 2.98500   1.08500   1.000 81.72822  ? 957  GLN F C   1 
ATOM   4682 O  O   . GLN F 1 48  ? -24.66500 2.58800   2.18200   1.000 86.33404  ? 957  GLN F O   1 
ATOM   4683 C  CB  . GLN F 1 48  ? -24.12100 1.33600   -0.85800  1.000 99.13031  ? 957  GLN F CB  1 
ATOM   4684 C  CG  . GLN F 1 48  ? -24.26000 0.01400   -0.10400  1.000 106.49961 ? 957  GLN F CG  1 
ATOM   4685 C  CD  . GLN F 1 48  ? -25.70000 -0.41400  0.07300   1.000 101.04106 ? 957  GLN F CD  1 
ATOM   4686 O  OE1 . GLN F 1 48  ? -26.22000 -0.49900  1.18700   1.000 90.13975  ? 957  GLN F OE1 1 
ATOM   4687 N  NE2 . GLN F 1 48  ? -26.36700 -0.66900  -1.04000  1.000 104.50200 ? 957  GLN F NE2 1 
ATOM   4688 N  N   . ALA F 1 49  ? -23.19700 3.83300   0.96400   1.000 78.23043  ? 958  ALA F N   1 
ATOM   4689 C  CA  . ALA F 1 49  ? -22.51800 4.46000   2.11900   1.000 68.51348  ? 958  ALA F CA  1 
ATOM   4690 C  C   . ALA F 1 49  ? -23.58000 5.10800   3.01300   1.000 60.66780  ? 958  ALA F C   1 
ATOM   4691 O  O   . ALA F 1 49  ? -23.59900 4.83400   4.20600   1.000 73.99571  ? 958  ALA F O   1 
ATOM   4692 C  CB  . ALA F 1 49  ? -21.48100 5.44700   1.64500   1.000 61.86268  ? 958  ALA F CB  1 
ATOM   4693 N  N   . LEU F 1 50  ? -24.48100 5.90100   2.44200   1.000 70.37949  ? 959  LEU F N   1 
ATOM   4694 C  CA  . LEU F 1 50  ? -25.52000 6.62400   3.21600   1.000 66.36059  ? 959  LEU F CA  1 
ATOM   4695 C  C   . LEU F 1 50  ? -26.47500 5.63000   3.88000   1.000 67.18700  ? 959  LEU F C   1 
ATOM   4696 O  O   . LEU F 1 50  ? -26.84900 5.85400   5.03900   1.000 60.13616  ? 959  LEU F O   1 
ATOM   4697 C  CB  . LEU F 1 50  ? -26.28300 7.53800   2.26200   1.000 61.47579  ? 959  LEU F CB  1 
ATOM   4698 C  CG  . LEU F 1 50  ? -27.37400 8.39000   2.90100   1.000 59.24131  ? 959  LEU F CG  1 
ATOM   4699 C  CD1 . LEU F 1 50  ? -26.90500 8.97200   4.22600   1.000 58.95444  ? 959  LEU F CD1 1 
ATOM   4700 C  CD2 . LEU F 1 50  ? -27.78600 9.49700   1.94300   1.000 59.84665  ? 959  LEU F CD2 1 
ATOM   4701 N  N   . ASN F 1 51  ? -26.87000 4.57800   3.16400   1.000 70.19263  ? 960  ASN F N   1 
ATOM   4702 C  CA  . ASN F 1 51  ? -27.77100 3.52700   3.70800   1.000 74.57210  ? 960  ASN F CA  1 
ATOM   4703 C  C   . ASN F 1 51  ? -27.07400 2.79500   4.86200   1.000 87.10781  ? 960  ASN F C   1 
ATOM   4704 O  O   . ASN F 1 51  ? -27.74500 2.59200   5.89100   1.000 97.88542  ? 960  ASN F O   1 
ATOM   4705 C  CB  . ASN F 1 51  ? -28.26700 2.57500   2.61900   1.000 68.85036  ? 960  ASN F CB  1 
ATOM   4706 C  CG  . ASN F 1 51  ? -29.21500 3.25300   1.65200   1.000 68.26608  ? 960  ASN F CG  1 
ATOM   4707 O  OD1 . ASN F 1 51  ? -30.12400 3.97300   2.06200   1.000 66.20267  ? 960  ASN F OD1 1 
ATOM   4708 N  ND2 . ASN F 1 51  ? -29.02000 3.02200   0.36400   1.000 74.52999  ? 960  ASN F ND2 1 
ATOM   4709 N  N   . THR F 1 52  ? -25.78800 2.44200   4.72900   1.000 69.51623  ? 961  THR F N   1 
ATOM   4710 C  CA  . THR F 1 52  ? -25.01700 1.76600   5.81300   1.000 77.49350  ? 961  THR F CA  1 
ATOM   4711 C  C   . THR F 1 52  ? -24.95400 2.71500   7.01600   1.000 77.44086  ? 961  THR F C   1 
ATOM   4712 O  O   . THR F 1 52  ? -25.29400 2.26700   8.12500   1.000 82.68623  ? 961  THR F O   1 
ATOM   4713 C  CB  . THR F 1 52  ? -23.63300 1.26000   5.36600   1.000 78.83577  ? 961  THR F CB  1 
ATOM   4714 O  OG1 . THR F 1 52  ? -22.80500 2.36700   5.01700   1.000 89.16859  ? 961  THR F OG1 1 
ATOM   4715 C  CG2 . THR F 1 52  ? -23.69500 0.28800   4.20600   1.000 72.41131  ? 961  THR F CG2 1 
ATOM   4716 N  N   . LEU F 1 53  ? -24.57500 3.97800   6.78600   1.000 68.45821  ? 962  LEU F N   1 
ATOM   4717 C  CA  . LEU F 1 53  ? -24.53300 5.05500   7.81500   1.000 64.63407  ? 962  LEU F CA  1 
ATOM   4718 C  C   . LEU F 1 53  ? -25.87300 5.09900   8.55500   1.000 63.12336  ? 962  LEU F C   1 
ATOM   4719 O  O   . LEU F 1 53  ? -25.86600 5.03700   9.79900   1.000 67.11594  ? 962  LEU F O   1 
ATOM   4720 C  CB  . LEU F 1 53  ? -24.22300 6.39900   7.14000   1.000 54.57496  ? 962  LEU F CB  1 
ATOM   4721 C  CG  . LEU F 1 53  ? -24.31800 7.64900   8.02000   1.000 55.63035  ? 962  LEU F CG  1 
ATOM   4722 C  CD1 . LEU F 1 53  ? -23.36900 7.57700   9.20300   1.000 57.44636  ? 962  LEU F CD1 1 
ATOM   4723 C  CD2 . LEU F 1 53  ? -24.02100 8.88800   7.20300   1.000 58.96496  ? 962  LEU F CD2 1 
ATOM   4724 N  N   . VAL F 1 54  ? -26.98500 5.18100   7.82400   1.000 69.43464  ? 963  VAL F N   1 
ATOM   4725 C  CA  . VAL F 1 54  ? -28.33300 5.30500   8.44600   1.000 68.47663  ? 963  VAL F CA  1 
ATOM   4726 C  C   . VAL F 1 54  ? -28.54500 4.14700   9.42600   1.000 68.61349  ? 963  VAL F C   1 
ATOM   4727 O  O   . VAL F 1 54  ? -28.89100 4.43400   10.58400  1.000 69.56887  ? 963  VAL F O   1 
ATOM   4728 C  CB  . VAL F 1 54  ? -29.45500 5.38500   7.39700   1.000 66.50271  ? 963  VAL F CB  1 
ATOM   4729 C  CG1 . VAL F 1 54  ? -30.81100 5.06100   8.01000   1.000 72.92980  ? 963  VAL F CG1 1 
ATOM   4730 C  CG2 . VAL F 1 54  ? -29.48900 6.75500   6.74000   1.000 55.40138  ? 963  VAL F CG2 1 
ATOM   4731 N  N   . LYS F 1 55  ? -28.32800 2.90100   8.98100   1.000 70.89534  ? 964  LYS F N   1 
ATOM   4732 C  CA  . LYS F 1 55  ? -28.53700 1.66700   9.79200   1.000 74.82476  ? 964  LYS F CA  1 
ATOM   4733 C  C   . LYS F 1 55  ? -27.67900 1.73700   11.05500  1.000 76.80131  ? 964  LYS F C   1 
ATOM   4734 O  O   . LYS F 1 55  ? -28.26800 1.61100   12.13800  1.000 89.79234  ? 964  LYS F O   1 
ATOM   4735 C  CB  . LYS F 1 55  ? -28.23700 0.40100   8.98100   1.000 85.87872  ? 964  LYS F CB  1 
ATOM   4736 C  CG  . LYS F 1 55  ? -29.32000 0.05500   7.96900   1.000 92.56373  ? 964  LYS F CG  1 
ATOM   4737 C  CD  . LYS F 1 55  ? -29.03000 -1.13900  7.08900   1.000 101.90169 ? 964  LYS F CD  1 
ATOM   4738 C  CE  . LYS F 1 55  ? -29.88600 -1.15000  5.83700   1.000 104.50990 ? 964  LYS F CE  1 
ATOM   4739 N  NZ  . LYS F 1 55  ? -29.28200 -1.97500  4.76400   1.000 106.15483 ? 964  LYS F NZ  1 
ATOM   4740 N  N   . GLN F 1 56  ? -26.36500 1.96500   10.91800  1.000 69.58729  ? 965  GLN F N   1 
ATOM   4741 C  CA  . GLN F 1 56  ? -25.40500 2.03400   12.05400  1.000 70.00839  ? 965  GLN F CA  1 
ATOM   4742 C  C   . GLN F 1 56  ? -25.75000 3.21700   12.96400  1.000 75.26166  ? 965  GLN F C   1 
ATOM   4743 O  O   . GLN F 1 56  ? -25.51900 3.08400   14.17700  1.000 74.90898  ? 965  GLN F O   1 
ATOM   4744 C  CB  . GLN F 1 56  ? -23.95900 2.10800   11.56800  1.000 70.02682  ? 965  GLN F CB  1 
ATOM   4745 C  CG  . GLN F 1 56  ? -23.47700 0.79800   10.96100  1.000 87.71315  ? 965  GLN F CG  1 
ATOM   4746 C  CD  . GLN F 1 56  ? -22.01400 0.79900   10.58100  1.000 91.92155  ? 965  GLN F CD  1 
ATOM   4747 O  OE1 . GLN F 1 56  ? -21.14800 1.21400   11.35200  1.000 92.12684  ? 965  GLN F OE1 1 
ATOM   4748 N  NE2 . GLN F 1 56  ? -21.71700 0.29600   9.39200   1.000 86.44458  ? 965  GLN F NE2 1 
ATOM   4749 N  N   . LEU F 1 57  ? -26.29600 4.31100   12.42200  1.000 74.68527  ? 966  LEU F N   1 
ATOM   4750 C  CA  . LEU F 1 57  ? -26.74200 5.47900   13.23400  1.000 72.21919  ? 966  LEU F CA  1 
ATOM   4751 C  C   . LEU F 1 57  ? -27.94400 5.08600   14.09100  1.000 67.41598  ? 966  LEU F C   1 
ATOM   4752 O  O   . LEU F 1 57  ? -27.96800 5.45100   15.27600  1.000 61.63107  ? 966  LEU F O   1 
ATOM   4753 C  CB  . LEU F 1 57  ? -27.11500 6.66100   12.33600  1.000 68.14238  ? 966  LEU F CB  1 
ATOM   4754 C  CG  . LEU F 1 57  ? -25.95300 7.45800   11.75400  1.000 65.08412  ? 966  LEU F CG  1 
ATOM   4755 C  CD1 . LEU F 1 57  ? -26.47500 8.53700   10.82400  1.000 66.91855  ? 966  LEU F CD1 1 
ATOM   4756 C  CD2 . LEU F 1 57  ? -25.10100 8.06600   12.85100  1.000 63.63131  ? 966  LEU F CD2 1 
ATOM   4757 N  N   . SER F 1 58  ? -28.91700 4.40100   13.49900  1.000 61.30998  ? 967  SER F N   1 
ATOM   4758 C  CA  . SER F 1 58  ? -30.14600 3.96300   14.20600  1.000 66.43954  ? 967  SER F CA  1 
ATOM   4759 C  C   . SER F 1 58  ? -29.76500 2.97500   15.32100  1.000 80.42017  ? 967  SER F C   1 
ATOM   4760 O  O   . SER F 1 58  ? -30.35100 3.09400   16.42300  1.000 84.64699  ? 967  SER F O   1 
ATOM   4761 C  CB  . SER F 1 58  ? -31.17600 3.41000   13.25200  1.000 59.55714  ? 967  SER F CB  1 
ATOM   4762 O  OG  . SER F 1 58  ? -32.38000 4.16200   13.33700  1.000 65.56576  ? 967  SER F OG  1 
ATOM   4763 N  N   . SER F 1 59  ? -28.79100 2.08500   15.07900  1.000 63.73922  ? 968  SER F N   1 
ATOM   4764 C  CA  . SER F 1 59  ? -28.23300 1.14900   16.09900  1.000 70.54267  ? 968  SER F CA  1 
ATOM   4765 C  C   . SER F 1 59  ? -27.62700 1.92300   17.27800  1.000 78.96210  ? 968  SER F C   1 
ATOM   4766 O  O   . SER F 1 59  ? -27.86200 1.51500   18.43900  1.000 87.18414  ? 968  SER F O   1 
ATOM   4767 C  CB  . SER F 1 59  ? -27.20600 0.22100   15.51000  1.000 72.53764  ? 968  SER F CB  1 
ATOM   4768 O  OG  . SER F 1 59  ? -27.81400 -0.98200  15.08200  1.000 74.08520  ? 968  SER F OG  1 
ATOM   4769 N  N   . ASN F 1 60  ? -26.84700 2.97100   16.98700  1.000 75.69329  ? 969  ASN F N   1 
ATOM   4770 C  CA  . ASN F 1 60  ? -26.19200 3.83800   18.00200  1.000 72.52185  ? 969  ASN F CA  1 
ATOM   4771 C  C   . ASN F 1 60  ? -27.25300 4.57600   18.82300  1.000 78.88314  ? 969  ASN F C   1 
ATOM   4772 O  O   . ASN F 1 60  ? -27.14000 4.55900   20.05900  1.000 84.18904  ? 969  ASN F O   1 
ATOM   4773 C  CB  . ASN F 1 60  ? -25.22400 4.83700   17.37300  1.000 70.27685  ? 969  ASN F CB  1 
ATOM   4774 C  CG  . ASN F 1 60  ? -24.01000 4.15900   16.79000  1.000 80.55966  ? 969  ASN F CG  1 
ATOM   4775 O  OD1 . ASN F 1 60  ? -23.90100 2.93400   16.83700  1.000 88.82907  ? 969  ASN F OD1 1 
ATOM   4776 N  ND2 . ASN F 1 60  ? -23.10100 4.94500   16.23800  1.000 81.69401  ? 969  ASN F ND2 1 
ATOM   4777 N  N   . PHE F 1 61  ? -28.24200 5.20400   18.18000  1.000 71.89283  ? 970  PHE F N   1 
ATOM   4778 C  CA  . PHE F 1 61  ? -29.26900 6.00500   18.89600  1.000 76.09333  ? 970  PHE F CA  1 
ATOM   4779 C  C   . PHE F 1 61  ? -30.07600 5.07100   19.78900  1.000 76.24862  ? 970  PHE F C   1 
ATOM   4780 O  O   . PHE F 1 61  ? -30.25100 5.40500   20.97600  1.000 76.72762  ? 970  PHE F O   1 
ATOM   4781 C  CB  . PHE F 1 61  ? -30.17100 6.80800   17.95600  1.000 78.63838  ? 970  PHE F CB  1 
ATOM   4782 C  CG  . PHE F 1 61  ? -29.48400 8.00600   17.35500  1.000 74.40629  ? 970  PHE F CG  1 
ATOM   4783 C  CD1 . PHE F 1 61  ? -28.81800 8.91100   18.16600  1.000 76.68025  ? 970  PHE F CD1 1 
ATOM   4784 C  CD2 . PHE F 1 61  ? -29.46600 8.20500   15.98400  1.000 64.69723  ? 970  PHE F CD2 1 
ATOM   4785 C  CE1 . PHE F 1 61  ? -28.14400 9.99100   17.61900  1.000 72.50869  ? 970  PHE F CE1 1 
ATOM   4786 C  CE2 . PHE F 1 61  ? -28.79600 9.28700   15.43900  1.000 67.93709  ? 970  PHE F CE2 1 
ATOM   4787 C  CZ  . PHE F 1 61  ? -28.13500 10.17700  16.25600  1.000 70.64794  ? 970  PHE F CZ  1 
ATOM   4788 N  N   . GLY F 1 62  ? -30.51500 3.93500   19.24200  1.000 74.26680  ? 971  GLY F N   1 
ATOM   4789 C  CA  . GLY F 1 62  ? -31.19500 2.87800   20.01400  1.000 80.97813  ? 971  GLY F CA  1 
ATOM   4790 C  C   . GLY F 1 62  ? -30.45300 2.60400   21.30700  1.000 80.02275  ? 971  GLY F C   1 
ATOM   4791 O  O   . GLY F 1 62  ? -31.04900 2.79700   22.38600  1.000 82.18617  ? 971  GLY F O   1 
ATOM   4792 N  N   . ALA F 1 63  ? -29.17600 2.22300   21.19800  1.000 83.58897  ? 972  ALA F N   1 
ATOM   4793 C  CA  . ALA F 1 63  ? -28.26800 1.96700   22.34000  1.000 87.52892  ? 972  ALA F CA  1 
ATOM   4794 C  C   . ALA F 1 63  ? -28.24900 3.18300   23.28700  1.000 77.95935  ? 972  ALA F C   1 
ATOM   4795 O  O   . ALA F 1 63  ? -28.45200 2.98100   24.49900  1.000 79.19897  ? 972  ALA F O   1 
ATOM   4796 C  CB  . ALA F 1 63  ? -26.89300 1.61000   21.82400  1.000 89.30808  ? 972  ALA F CB  1 
ATOM   4797 N  N   . ILE F 1 64  ? -28.06400 4.40300   22.76700  1.000 68.85299  ? 973  ILE F N   1 
ATOM   4798 C  CA  . ILE F 1 64  ? -27.92300 5.63600   23.60400  1.000 75.28008  ? 973  ILE F CA  1 
ATOM   4799 C  C   . ILE F 1 64  ? -29.19800 5.82000   24.42800  1.000 78.37255  ? 973  ILE F C   1 
ATOM   4800 O  O   . ILE F 1 64  ? -29.10000 5.90700   25.66500  1.000 80.60177  ? 973  ILE F O   1 
ATOM   4801 C  CB  . ILE F 1 64  ? -27.59500 6.88500   22.75800  1.000 71.06642  ? 973  ILE F CB  1 
ATOM   4802 C  CG1 . ILE F 1 64  ? -26.17100 6.82200   22.20500  1.000 67.79760  ? 973  ILE F CG1 1 
ATOM   4803 C  CG2 . ILE F 1 64  ? -27.80500 8.16500   23.55300  1.000 59.02023  ? 973  ILE F CG2 1 
ATOM   4804 C  CD1 . ILE F 1 64  ? -25.90500 7.77100   21.06500  1.000 64.16822  ? 973  ILE F CD1 1 
ATOM   4805 N  N   . SER F 1 65  ? -30.35200 5.87000   23.77000  1.000 78.70944  ? 974  SER F N   1 
ATOM   4806 C  CA  . SER F 1 65  ? -31.65200 6.10300   24.44000  1.000 74.06151  ? 974  SER F CA  1 
ATOM   4807 C  C   . SER F 1 65  ? -31.85700 5.04000   25.52800  1.000 77.77775  ? 974  SER F C   1 
ATOM   4808 O  O   . SER F 1 65  ? -32.24900 5.42700   26.64100  1.000 85.04178  ? 974  SER F O   1 
ATOM   4809 C  CB  . SER F 1 65  ? -32.79000 6.16300   23.45600  1.000 63.98399  ? 974  SER F CB  1 
ATOM   4810 O  OG  . SER F 1 65  ? -33.35900 4.88300   23.26700  1.000 75.61696  ? 974  SER F OG  1 
ATOM   4811 N  N   . SER F 1 66  ? -31.55700 3.76500   25.25000  1.000 75.27218  ? 975  SER F N   1 
ATOM   4812 C  CA  . SER F 1 66  ? -31.61100 2.67600   26.26600  1.000 87.98423  ? 975  SER F CA  1 
ATOM   4813 C  C   . SER F 1 66  ? -30.85000 3.14300   27.50900  1.000 81.04393  ? 975  SER F C   1 
ATOM   4814 O  O   . SER F 1 66  ? -31.48200 3.33400   28.56300  1.000 86.31298  ? 975  SER F O   1 
ATOM   4815 C  CB  . SER F 1 66  ? -31.05300 1.35600   25.75900  1.000 93.04273  ? 975  SER F CB  1 
ATOM   4816 O  OG  . SER F 1 66  ? -31.50700 1.06400   24.44700  1.000 99.67511  ? 975  SER F OG  1 
ATOM   4817 N  N   . VAL F 1 67  ? -29.54800 3.38000   27.34400  1.000 80.69915  ? 976  VAL F N   1 
ATOM   4818 C  CA  . VAL F 1 67  ? -28.60500 3.73600   28.44200  1.000 84.08903  ? 976  VAL F CA  1 
ATOM   4819 C  C   . VAL F 1 67  ? -29.18400 4.93900   29.19100  1.000 77.80407  ? 976  VAL F C   1 
ATOM   4820 O  O   . VAL F 1 67  ? -29.28000 4.86100   30.42100  1.000 84.09693  ? 976  VAL F O   1 
ATOM   4821 C  CB  . VAL F 1 67  ? -27.18500 3.98700   27.89600  1.000 85.78923  ? 976  VAL F CB  1 
ATOM   4822 C  CG1 . VAL F 1 67  ? -26.22100 4.46400   28.97700  1.000 88.20268  ? 976  VAL F CG1 1 
ATOM   4823 C  CG2 . VAL F 1 67  ? -26.65200 2.73700   27.21000  1.000 83.86269  ? 976  VAL F CG2 1 
ATOM   4824 N  N   . LEU F 1 68  ? -29.61500 5.97100   28.46800  1.000 74.57210  ? 977  LEU F N   1 
ATOM   4825 C  CA  . LEU F 1 68  ? -30.11700 7.23000   29.07600  1.000 82.36251  ? 977  LEU F CA  1 
ATOM   4826 C  C   . LEU F 1 68  ? -31.32800 6.93300   29.96500  1.000 84.79438  ? 977  LEU F C   1 
ATOM   4827 O  O   . LEU F 1 68  ? -31.37900 7.46000   31.08400  1.000 86.74724  ? 977  LEU F O   1 
ATOM   4828 C  CB  . LEU F 1 68  ? -30.47500 8.23600   27.97900  1.000 81.84402  ? 977  LEU F CB  1 
ATOM   4829 C  CG  . LEU F 1 68  ? -29.29700 8.97000   27.33800  1.000 69.87943  ? 977  LEU F CG  1 
ATOM   4830 C  CD1 . LEU F 1 68  ? -29.79300 9.91400   26.25300  1.000 68.64507  ? 977  LEU F CD1 1 
ATOM   4831 C  CD2 . LEU F 1 68  ? -28.48000 9.72900   28.37600  1.000 60.82045  ? 977  LEU F CD2 1 
ATOM   4832 N  N   . ASN F 1 69  ? -32.26200 6.11500   29.49100  1.000 80.72020  ? 978  ASN F N   1 
ATOM   4833 C  CA  . ASN F 1 69  ? -33.50700 5.79300   30.23600  1.000 93.17170  ? 978  ASN F CA  1 
ATOM   4834 C  C   . ASN F 1 69  ? -33.14000 5.03200   31.51400  1.000 99.81986  ? 978  ASN F C   1 
ATOM   4835 O  O   . ASN F 1 69  ? -33.76700 5.31900   32.55900  1.000 102.90181 ? 978  ASN F O   1 
ATOM   4836 C  CB  . ASN F 1 69  ? -34.50300 5.02300   29.36500  1.000 100.92263 ? 978  ASN F CB  1 
ATOM   4837 C  CG  . ASN F 1 69  ? -35.00300 5.83600   28.18400  1.000 93.39541  ? 978  ASN F CG  1 
ATOM   4838 O  OD1 . ASN F 1 69  ? -35.28400 7.02700   28.31100  1.000 87.86843  ? 978  ASN F OD1 1 
ATOM   4839 N  ND2 . ASN F 1 69  ? -35.10200 5.21000   27.02000  1.000 80.37806  ? 978  ASN F ND2 1 
ATOM   4840 N  N   . ASP F 1 70  ? -32.16300 4.11600   31.42100  1.000 100.04621 ? 979  ASP F N   1 
ATOM   4841 C  CA  . ASP F 1 70  ? -31.59300 3.35600   32.56800  1.000 107.18654 ? 979  ASP F CA  1 
ATOM   4842 C  C   . ASP F 1 70  ? -31.06600 4.37400   33.58700  1.000 111.36335 ? 979  ASP F C   1 
ATOM   4843 O  O   . ASP F 1 70  ? -31.54100 4.34000   34.74500  1.000 115.96917 ? 979  ASP F O   1 
ATOM   4844 C  CB  . ASP F 1 70  ? -30.52600 2.35800   32.09600  1.000 105.38895 ? 979  ASP F CB  1 
ATOM   4845 C  CG  . ASP F 1 70  ? -29.94400 1.46600   33.18200  1.000 112.45296 ? 979  ASP F CG  1 
ATOM   4846 O  OD1 . ASP F 1 70  ? -30.69700 1.10300   34.12000  1.000 121.52773 ? 979  ASP F OD1 1 
ATOM   4847 O  OD2 . ASP F 1 70  ? -28.74500 1.12300   33.06600  1.000 109.12098 ? 979  ASP F OD2 1 
ATOM   4848 N  N   . ILE F 1 71  ? -30.18000 5.28200   33.14800  1.000 116.66925 ? 980  ILE F N   1 
ATOM   4849 C  CA  . ILE F 1 71  ? -29.49500 6.29400   34.01200  1.000 108.35510 ? 980  ILE F CA  1 
ATOM   4850 C  C   . ILE F 1 71  ? -30.55500 7.14600   34.72300  1.000 100.92263 ? 980  ILE F C   1 
ATOM   4851 O  O   . ILE F 1 71  ? -30.37800 7.39700   35.93100  1.000 101.31478 ? 980  ILE F O   1 
ATOM   4852 C  CB  . ILE F 1 71  ? -28.47900 7.13400   33.20700  1.000 101.29372 ? 980  ILE F CB  1 
ATOM   4853 C  CG1 . ILE F 1 71  ? -27.25400 6.29100   32.83100  1.000 103.70717 ? 980  ILE F CG1 1 
ATOM   4854 C  CG2 . ILE F 1 71  ? -28.08600 8.39500   33.96700  1.000 89.14227  ? 980  ILE F CG2 1 
ATOM   4855 C  CD1 . ILE F 1 71  ? -26.35000 6.90100   31.77600  1.000 99.85408  ? 980  ILE F CD1 1 
ATOM   4856 N  N   . LEU F 1 72  ? -31.62400 7.54000   34.02000  1.000 97.12480  ? 981  LEU F N   1 
ATOM   4857 C  CA  . LEU F 1 72  ? -32.71800 8.38200   34.57900  1.000 98.86712  ? 981  LEU F CA  1 
ATOM   4858 C  C   . LEU F 1 72  ? -33.45500 7.61700   35.68700  1.000 107.75239 ? 981  LEU F C   1 
ATOM   4859 O  O   . LEU F 1 72  ? -33.77200 8.24100   36.72300  1.000 117.86676 ? 981  LEU F O   1 
ATOM   4860 C  CB  . LEU F 1 72  ? -33.68300 8.79400   33.46200  1.000 85.85240  ? 981  LEU F CB  1 
ATOM   4861 C  CG  . LEU F 1 72  ? -33.16000 9.84100   32.47800  1.000 88.94487  ? 981  LEU F CG  1 
ATOM   4862 C  CD1 . LEU F 1 72  ? -34.18000 10.08400  31.37500  1.000 77.89618  ? 981  LEU F CD1 1 
ATOM   4863 C  CD2 . LEU F 1 72  ? -32.79100 11.15200  33.17300  1.000 79.63586  ? 981  LEU F CD2 1 
ATOM   4864 N  N   . SER F 1 73  ? -33.72500 6.32400   35.47800  1.000 104.61254 ? 982  SER F N   1 
ATOM   4865 C  CA  . SER F 1 73  ? -34.34900 5.42500   36.48500  1.000 111.10806 ? 982  SER F CA  1 
ATOM   4866 C  C   . SER F 1 73  ? -33.42700 5.29700   37.70100  1.000 116.27973 ? 982  SER F C   1 
ATOM   4867 O  O   . SER F 1 73  ? -33.94100 5.36900   38.83200  1.000 122.03568 ? 982  SER F O   1 
ATOM   4868 C  CB  . SER F 1 73  ? -34.67000 4.07400   35.90700  1.000 107.70502 ? 982  SER F CB  1 
ATOM   4869 O  OG  . SER F 1 73  ? -35.66700 4.18200   34.90900  1.000 99.94619  ? 982  SER F OG  1 
ATOM   4870 N  N   . ARG F 1 74  ? -32.12000 5.11900   37.47700  1.000 117.12194 ? 983  ARG F N   1 
ATOM   4871 C  CA  . ARG F 1 74  ? -31.10800 4.99500   38.56000  1.000 117.86676 ? 983  ARG F CA  1 
ATOM   4872 C  C   . ARG F 1 74  ? -31.06100 6.29800   39.36600  1.000 116.45607 ? 983  ARG F C   1 
ATOM   4873 O  O   . ARG F 1 74  ? -30.99100 6.20600   40.60100  1.000 118.88267 ? 983  ARG F O   1 
ATOM   4874 C  CB  . ARG F 1 74  ? -29.72300 4.63400   38.00900  1.000 116.60082 ? 983  ARG F CB  1 
ATOM   4875 C  CG  . ARG F 1 74  ? -29.53700 3.14700   37.74200  1.000 118.31945 ? 983  ARG F CG  1 
ATOM   4876 C  CD  . ARG F 1 74  ? -28.21300 2.78400   37.08700  1.000 121.09083 ? 983  ARG F CD  1 
ATOM   4877 N  NE  . ARG F 1 74  ? -28.26400 1.44900   36.49300  1.000 133.52654 ? 983  ARG F NE  1 
ATOM   4878 C  CZ  . ARG F 1 74  ? -27.24100 0.81200   35.91900  1.000 136.62164 ? 983  ARG F CZ  1 
ATOM   4879 N  NH1 . ARG F 1 74  ? -26.04700 1.37700   35.85200  1.000 134.74247 ? 983  ARG F NH1 1 
ATOM   4880 N  NH2 . ARG F 1 74  ? -27.42000 -0.39600  35.40800  1.000 138.91666 ? 983  ARG F NH2 1 
ATOM   4881 N  N   . LEU F 1 75  ? -31.10900 7.45900   38.70300  1.000 121.53036 ? 984  LEU F N   1 
ATOM   4882 C  CA  . LEU F 1 75  ? -31.05700 8.79600   39.36300  1.000 112.75826 ? 984  LEU F CA  1 
ATOM   4883 C  C   . LEU F 1 75  ? -32.28500 9.01000   40.25200  1.000 115.71914 ? 984  LEU F C   1 
ATOM   4884 O  O   . LEU F 1 75  ? -32.11200 9.57000   41.35200  1.000 112.76089 ? 984  LEU F O   1 
ATOM   4885 C  CB  . LEU F 1 75  ? -30.98700 9.89800   38.30600  1.000 103.44661 ? 984  LEU F CB  1 
ATOM   4886 C  CG  . LEU F 1 75  ? -29.58400 10.34800  37.91900  1.000 104.99417 ? 984  LEU F CG  1 
ATOM   4887 C  CD1 . LEU F 1 75  ? -29.65800 11.33400  36.76900  1.000 103.80982 ? 984  LEU F CD1 1 
ATOM   4888 C  CD2 . LEU F 1 75  ? -28.85000 10.96700  39.10000  1.000 103.50452 ? 984  LEU F CD2 1 
ATOM   4889 N  N   . ASP F 1 76  ? -33.47000 8.61000   39.77600  1.000 117.80886 ? 985  ASP F N   1 
ATOM   4890 C  CA  . ASP F 1 76  ? -34.75200 8.68200   40.53300  1.000 121.14347 ? 985  ASP F CA  1 
ATOM   4891 C  C   . ASP F 1 76  ? -34.65700 7.84200   41.81400  1.000 125.26239 ? 985  ASP F C   1 
ATOM   4892 O  O   . ASP F 1 76  ? -35.11600 8.32300   42.87400  1.000 131.43155 ? 985  ASP F O   1 
ATOM   4893 C  CB  . ASP F 1 76  ? -35.93500 8.20300   39.68700  1.000 129.55764 ? 985  ASP F CB  1 
ATOM   4894 C  CG  . ASP F 1 76  ? -36.39100 9.18400   38.61700  1.000 134.91618 ? 985  ASP F CG  1 
ATOM   4895 O  OD1 . ASP F 1 76  ? -35.88100 10.32400  38.60200  1.000 133.85552 ? 985  ASP F OD1 1 
ATOM   4896 O  OD2 . ASP F 1 76  ? -37.25900 8.79900   37.80400  1.000 139.01667 ? 985  ASP F OD2 1 
ATOM   4897 N  N   . LYS F 1 77  ? -34.09000 6.63500   41.71700  1.000 119.89859 ? 986  LYS F N   1 
ATOM   4898 C  CA  . LYS F 1 77  ? -33.95600 5.68700   42.85300  1.000 119.79068 ? 986  LYS F CA  1 
ATOM   4899 C  C   . LYS F 1 77  ? -32.91200 6.23000   43.84000  1.000 127.08629 ? 986  LYS F C   1 
ATOM   4900 O  O   . LYS F 1 77  ? -33.15200 6.08500   45.05200  1.000 133.90026 ? 986  LYS F O   1 
ATOM   4901 C  CB  . LYS F 1 77  ? -33.70800 4.27200   42.31500  1.000 116.19814 ? 986  LYS F CB  1 
ATOM   4902 C  CG  . LYS F 1 77  ? -34.95500 3.68100   41.67000  1.000 113.81891 ? 986  LYS F CG  1 
ATOM   4903 C  CD  . LYS F 1 77  ? -34.86400 2.27700   41.11600  1.000 113.11883 ? 986  LYS F CD  1 
ATOM   4904 C  CE  . LYS F 1 77  ? -36.05000 1.99800   40.21300  1.000 113.30306 ? 986  LYS F CE  1 
ATOM   4905 N  NZ  . LYS F 1 77  ? -36.12400 0.58300   39.78500  1.000 115.90600 ? 986  LYS F NZ  1 
ATOM   4906 N  N   . VAL F 1 78  ? -31.85000 6.89700   43.36100  1.000 129.58396 ? 987  VAL F N   1 
ATOM   4907 C  CA  . VAL F 1 78  ? -30.79600 7.51500   44.22800  1.000 129.58396 ? 987  VAL F CA  1 
ATOM   4908 C  C   . VAL F 1 78  ? -31.40700 8.73300   44.93100  1.000 124.02276 ? 987  VAL F C   1 
ATOM   4909 O  O   . VAL F 1 78  ? -31.17300 8.88000   46.14400  1.000 130.31299 ? 987  VAL F O   1 
ATOM   4910 C  CB  . VAL F 1 78  ? -29.51000 7.87100   43.44900  1.000 124.47019 ? 987  VAL F CB  1 
ATOM   4911 C  CG1 . VAL F 1 78  ? -28.60900 8.82900   44.22000  1.000 120.96187 ? 987  VAL F CG1 1 
ATOM   4912 C  CG2 . VAL F 1 78  ? -28.73000 6.62200   43.05800  1.000 122.72261 ? 987  VAL F CG2 1 
ATOM   4913 N  N   . GLU F 1 79  ? -32.16000 9.56200   44.19900  1.000 116.48239 ? 988  GLU F N   1 
ATOM   4914 C  CA  . GLU F 1 79  ? -33.02800 10.62700  44.77300  1.000 118.16417 ? 988  GLU F CA  1 
ATOM   4915 C  C   . GLU F 1 79  ? -34.22700 9.96200   45.46600  1.000 126.30988 ? 988  GLU F C   1 
ATOM   4916 O  O   . GLU F 1 79  ? -34.22600 9.90300   46.71300  1.000 125.21501 ? 988  GLU F O   1 
ATOM   4917 C  CB  . GLU F 1 79  ? -33.54700 11.56800  43.68600  1.000 112.35031 ? 988  GLU F CB  1 
ATOM   4918 C  CG  . GLU F 1 79  ? -32.46600 12.35000  42.96300  1.000 105.61266 ? 988  GLU F CG  1 
ATOM   4919 C  CD  . GLU F 1 79  ? -33.01600 13.28300  41.89800  1.000 122.38573 ? 988  GLU F CD  1 
ATOM   4920 O  OE1 . GLU F 1 79  ? -34.04300 13.94000  42.16400  1.000 129.89979 ? 988  GLU F OE1 1 
ATOM   4921 O  OE2 . GLU F 1 79  ? -32.42600 13.34100  40.80100  1.000 123.85696 ? 988  GLU F OE2 1 
ATOM   4922 N  N   . LEU F 1 90  ? -35.75500 10.87800  21.20400  1.000 63.79449  ? 1166 LEU F N   1 
ATOM   4923 C  CA  . LEU F 1 90  ? -34.90300 10.77000  19.98700  1.000 61.61791  ? 1166 LEU F CA  1 
ATOM   4924 C  C   . LEU F 1 90  ? -35.77300 10.45500  18.76400  1.000 64.76566  ? 1166 LEU F C   1 
ATOM   4925 O  O   . LEU F 1 90  ? -36.51300 9.45200   18.79500  1.000 74.45366  ? 1166 LEU F O   1 
ATOM   4926 C  CB  . LEU F 1 90  ? -33.85000 9.67400   20.18200  1.000 60.79150  ? 1166 LEU F CB  1 
ATOM   4927 C  CG  . LEU F 1 90  ? -32.75600 9.95100   21.21500  1.000 62.73384  ? 1166 LEU F CG  1 
ATOM   4928 C  CD1 . LEU F 1 90  ? -31.62900 8.93400   21.06800  1.000 56.37255  ? 1166 LEU F CD1 1 
ATOM   4929 C  CD2 . LEU F 1 90  ? -32.21200 11.37500  21.10700  1.000 53.19585  ? 1166 LEU F CD2 1 
ATOM   4930 N  N   . GLY F 1 91  ? -35.65000 11.26800  17.71300  1.000 77.49877  ? 1167 GLY F N   1 
ATOM   4931 C  CA  . GLY F 1 91  ? -36.31300 11.05500  16.41400  1.000 81.20184  ? 1167 GLY F CA  1 
ATOM   4932 C  C   . GLY F 1 91  ? -35.78800 9.83000   15.67900  1.000 80.98603  ? 1167 GLY F C   1 
ATOM   4933 O  O   . GLY F 1 91  ? -34.58200 9.50000   15.80200  1.000 76.18282  ? 1167 GLY F O   1 
ATOM   4934 N  N   . ASP F 1 92  ? -36.67400 9.18300   14.92300  1.000 90.25029  ? 1168 ASP F N   1 
ATOM   4935 C  CA  . ASP F 1 92  ? -36.35200 8.00100   14.09200  1.000 91.39254  ? 1168 ASP F CA  1 
ATOM   4936 C  C   . ASP F 1 92  ? -35.82200 8.52200   12.76000  1.000 91.12408  ? 1168 ASP F C   1 
ATOM   4937 O  O   . ASP F 1 92  ? -36.36500 9.53200   12.26900  1.000 81.51240  ? 1168 ASP F O   1 
ATOM   4938 C  CB  . ASP F 1 92  ? -37.56900 7.09300   13.92100  1.000 90.10554  ? 1168 ASP F CB  1 
ATOM   4939 C  CG  . ASP F 1 92  ? -37.25800 5.77200   13.24200  1.000 94.22446  ? 1168 ASP F CG  1 
ATOM   4940 O  OD1 . ASP F 1 92  ? -36.05300 5.43200   13.11500  1.000 97.36957  ? 1168 ASP F OD1 1 
ATOM   4941 O  OD2 . ASP F 1 92  ? -38.22600 5.09300   12.85100  1.000 94.35342  ? 1168 ASP F OD2 1 
ATOM   4942 N  N   . ILE F 1 93  ? -34.76800 7.87600   12.25000  1.000 93.22697  ? 1169 ILE F N   1 
ATOM   4943 C  CA  . ILE F 1 93  ? -34.09000 8.21800   10.96500  1.000 81.62821  ? 1169 ILE F CA  1 
ATOM   4944 C  C   . ILE F 1 93  ? -34.03300 6.97900   10.06500  1.000 79.08317  ? 1169 ILE F C   1 
ATOM   4945 O  O   . ILE F 1 93  ? -33.70500 7.16700   8.87700   1.000 74.60368  ? 1169 ILE F O   1 
ATOM   4946 C  CB  . ILE F 1 93  ? -32.69200 8.84700   11.18900  1.000 76.78026  ? 1169 ILE F CB  1 
ATOM   4947 C  CG1 . ILE F 1 93  ? -31.78700 8.04600   12.13100  1.000 73.80622  ? 1169 ILE F CG1 1 
ATOM   4948 C  CG2 . ILE F 1 93  ? -32.83200 10.28600  11.66100  1.000 80.34384  ? 1169 ILE F CG2 1 
ATOM   4949 C  CD1 . ILE F 1 93  ? -30.96800 6.99000   11.44500  1.000 83.82847  ? 1169 ILE F CD1 1 
ATOM   4950 N  N   . SER F 1 94  ? -34.37200 5.78500   10.57900  1.000 75.22744  ? 1170 SER F N   1 
ATOM   4951 C  CA  . SER F 1 94  ? -34.30500 4.50200   9.82200   1.000 78.44098  ? 1170 SER F CA  1 
ATOM   4952 C  C   . SER F 1 94  ? -35.13300 4.61000   8.53700   1.000 80.79127  ? 1170 SER F C   1 
ATOM   4953 O  O   . SER F 1 94  ? -34.80600 3.89900   7.57700   1.000 83.65214  ? 1170 SER F O   1 
ATOM   4954 C  CB  . SER F 1 94  ? -34.73900 3.32200   10.65500  1.000 82.53358  ? 1170 SER F CB  1 
ATOM   4955 O  OG  . SER F 1 94  ? -36.10400 3.43100   11.02300  1.000 86.04190  ? 1170 SER F OG  1 
ATOM   4956 N  N   . GLY F 1 95  ? -36.14300 5.48600   8.52600   1.000 87.44996  ? 1171 GLY F N   1 
ATOM   4957 C  CA  . GLY F 1 95  ? -36.99700 5.78900   7.35900   1.000 92.39792  ? 1171 GLY F CA  1 
ATOM   4958 C  C   . GLY F 1 95  ? -36.24500 6.48300   6.23100   1.000 88.32375  ? 1171 GLY F C   1 
ATOM   4959 O  O   . GLY F 1 95  ? -36.69200 6.36300   5.06200   1.000 87.64209  ? 1171 GLY F O   1 
ATOM   4960 N  N   . ILE F 1 96  ? -35.16900 7.21200   6.54700   1.000 85.74186  ? 1172 ILE F N   1 
ATOM   4961 C  CA  . ILE F 1 96  ? -34.29200 7.84300   5.51900   1.000 76.11176  ? 1172 ILE F CA  1 
ATOM   4962 C  C   . ILE F 1 96  ? -33.59000 6.70900   4.76100   1.000 82.22828  ? 1172 ILE F C   1 
ATOM   4963 O  O   . ILE F 1 96  ? -33.00300 5.83200   5.42500   1.000 88.43429  ? 1172 ILE F O   1 
ATOM   4964 C  CB  . ILE F 1 96  ? -33.30500 8.86400   6.13200   1.000 71.18485  ? 1172 ILE F CB  1 
ATOM   4965 C  CG1 . ILE F 1 96  ? -33.99300 10.18000  6.50700   1.000 70.02155  ? 1172 ILE F CG1 1 
ATOM   4966 C  CG2 . ILE F 1 96  ? -32.14200 9.12100   5.18800   1.000 77.31980  ? 1172 ILE F CG2 1 
ATOM   4967 C  CD1 . ILE F 1 96  ? -34.42000 10.26900  7.94400   1.000 80.18856  ? 1172 ILE F CD1 1 
ATOM   4968 N  N   . ASN F 1 97  ? -33.70300 6.69600   3.42800   1.000 81.09920  ? 1173 ASN F N   1 
ATOM   4969 C  CA  . ASN F 1 97  ? -33.01400 5.71100   2.55300   1.000 84.42591  ? 1173 ASN F CA  1 
ATOM   4970 C  C   . ASN F 1 97  ? -32.60300 6.39200   1.25000   1.000 82.38356  ? 1173 ASN F C   1 
ATOM   4971 O  O   . ASN F 1 97  ? -33.32600 7.28800   0.77900   1.000 87.88422  ? 1173 ASN F O   1 
ATOM   4972 C  CB  . ASN F 1 97  ? -33.85200 4.45400   2.31100   1.000 95.71674  ? 1173 ASN F CB  1 
ATOM   4973 C  CG  . ASN F 1 97  ? -33.58200 3.38500   3.35000   1.000 106.27590 ? 1173 ASN F CG  1 
ATOM   4974 O  OD1 . ASN F 1 97  ? -32.42500 3.10400   3.67400   1.000 100.84630 ? 1173 ASN F OD1 1 
ATOM   4975 N  ND2 . ASN F 1 97  ? -34.64100 2.78900   3.88000   1.000 117.25090 ? 1173 ASN F ND2 1 
ATOM   4976 N  N   . ALA F 1 98  ? -31.44400 5.99200   0.73500   1.000 74.71949  ? 1174 ALA F N   1 
ATOM   4977 C  CA  . ALA F 1 98  ? -30.86400 6.47800   -0.53200  1.000 71.73755  ? 1174 ALA F CA  1 
ATOM   4978 C  C   . ALA F 1 98  ? -31.19400 5.45600   -1.61600  1.000 72.81663  ? 1174 ALA F C   1 
ATOM   4979 O  O   . ALA F 1 98  ? -30.85100 4.28300   -1.43900  1.000 71.96389  ? 1174 ALA F O   1 
ATOM   4980 C  CB  . ALA F 1 98  ? -29.37600 6.68300   -0.38500  1.000 70.84270  ? 1174 ALA F CB  1 
ATOM   4981 N  N   . SER F 1 99  ? -31.88100 5.89900   -2.66500  1.000 78.63574  ? 1175 SER F N   1 
ATOM   4982 C  CA  . SER F 1 99  ? -32.21900 5.08500   -3.85500  1.000 87.50523  ? 1175 SER F CA  1 
ATOM   4983 C  C   . SER F 1 99  ? -30.95000 4.91500   -4.68500  1.000 87.76315  ? 1175 SER F C   1 
ATOM   4984 O  O   . SER F 1 99  ? -30.04500 5.75500   -4.53100  1.000 85.64974  ? 1175 SER F O   1 
ATOM   4985 C  CB  . SER F 1 99  ? -33.33700 5.71800   -4.65200  1.000 88.06582  ? 1175 SER F CB  1 
ATOM   4986 O  OG  . SER F 1 99  ? -33.42200 7.11700   -4.39500  1.000 86.62354  ? 1175 SER F OG  1 
ATOM   4987 N  N   . VAL F 1 100 ? -30.89500 3.86900   -5.51300  1.000 83.04680  ? 1176 VAL F N   1 
ATOM   4988 C  CA  . VAL F 1 100 ? -29.78800 3.63200   -6.48600  1.000 80.97023  ? 1176 VAL F CA  1 
ATOM   4989 C  C   . VAL F 1 100 ? -30.29900 3.99000   -7.88200  1.000 86.81041  ? 1176 VAL F C   1 
ATOM   4990 O  O   . VAL F 1 100 ? -31.48800 4.32700   -8.01100  1.000 91.15567  ? 1176 VAL F O   1 
ATOM   4991 C  CB  . VAL F 1 100 ? -29.24000 2.19500   -6.40600  1.000 77.82249  ? 1176 VAL F CB  1 
ATOM   4992 C  CG1 . VAL F 1 100 ? -28.63500 1.91800   -5.03700  1.000 78.49362  ? 1176 VAL F CG1 1 
ATOM   4993 C  CG2 . VAL F 1 100 ? -30.28200 1.14800   -6.75800  1.000 79.85694  ? 1176 VAL F CG2 1 
ATOM   4994 N  N   . VAL F 1 101 ? -29.40700 3.98900   -8.87100  1.000 90.77141  ? 1177 VAL F N   1 
ATOM   4995 C  CA  . VAL F 1 101 ? -29.74200 4.32000   -10.28500 1.000 87.09465  ? 1177 VAL F CA  1 
ATOM   4996 C  C   . VAL F 1 101 ? -29.29200 3.13500   -11.14100 1.000 84.42065  ? 1177 VAL F C   1 
ATOM   4997 O  O   . VAL F 1 101 ? -28.26000 2.52800   -10.79900 1.000 80.69915  ? 1177 VAL F O   1 
ATOM   4998 C  CB  . VAL F 1 101 ? -29.10400 5.65100   -10.73300 1.000 83.07049  ? 1177 VAL F CB  1 
ATOM   4999 C  CG1 . VAL F 1 101 ? -27.58300 5.57900   -10.78600 1.000 87.07623  ? 1177 VAL F CG1 1 
ATOM   5000 C  CG2 . VAL F 1 101 ? -29.66200 6.13200   -12.06500 1.000 78.79103  ? 1177 VAL F CG2 1 
ATOM   5001 N  N   . ASN F 1 102 ? -30.07000 2.80600   -12.17700 1.000 91.03986  ? 1178 ASN F N   1 
ATOM   5002 C  CA  . ASN F 1 102 ? -29.75800 1.73100   -13.15600 1.000 100.22781 ? 1178 ASN F CA  1 
ATOM   5003 C  C   . ASN F 1 102 ? -29.90900 2.31400   -14.56200 1.000 94.70346  ? 1178 ASN F C   1 
ATOM   5004 O  O   . ASN F 1 102 ? -31.06300 2.55500   -14.99400 1.000 94.95612  ? 1178 ASN F O   1 
ATOM   5005 C  CB  . ASN F 1 102 ? -30.62500 0.48500   -12.95700 1.000 110.10794 ? 1178 ASN F CB  1 
ATOM   5006 C  CG  . ASN F 1 102 ? -30.01000 -0.76400  -13.55900 1.000 117.54041 ? 1178 ASN F CG  1 
ATOM   5007 O  OD1 . ASN F 1 102 ? -29.06500 -0.69000  -14.34600 1.000 117.56936 ? 1178 ASN F OD1 1 
ATOM   5008 N  ND2 . ASN F 1 102 ? -30.53300 -1.92400  -13.18700 1.000 121.61985 ? 1178 ASN F ND2 1 
ATOM   5009 N  N   . ILE F 1 103 ? -28.77100 2.57200   -15.21100 1.000 87.58155  ? 1179 ILE F N   1 
ATOM   5010 C  CA  . ILE F 1 103 ? -28.67700 3.12600   -16.59100 1.000 85.10231  ? 1179 ILE F CA  1 
ATOM   5011 C  C   . ILE F 1 103 ? -27.69300 2.28000   -17.40700 1.000 88.23690  ? 1179 ILE F C   1 
ATOM   5012 O  O   . ILE F 1 103 ? -27.25500 2.76000   -18.46500 1.000 90.65297  ? 1179 ILE F O   1 
ATOM   5013 C  CB  . ILE F 1 103 ? -28.26000 4.61000   -16.54600 1.000 80.69125  ? 1179 ILE F CB  1 
ATOM   5014 C  CG1 . ILE F 1 103 ? -26.89800 4.80800   -15.87300 1.000 70.58215  ? 1179 ILE F CG1 1 
ATOM   5015 C  CG2 . ILE F 1 103 ? -29.34000 5.44100   -15.87400 1.000 85.34971  ? 1179 ILE F CG2 1 
ATOM   5016 C  CD1 . ILE F 1 103 ? -26.26000 6.14300   -16.16400 1.000 65.78157  ? 1179 ILE F CD1 1 
ATOM   5017 N  N   . GLN F 1 104 ? -27.36800 1.06600   -16.94300 1.000 96.54315  ? 1180 GLN F N   1 
ATOM   5018 C  CA  . GLN F 1 104 ? -26.41200 0.14500   -17.61900 1.000 98.31968  ? 1180 GLN F CA  1 
ATOM   5019 C  C   . GLN F 1 104 ? -26.93100 -0.20500  -19.02100 1.000 97.40905  ? 1180 GLN F C   1 
ATOM   5020 O  O   . GLN F 1 104 ? -26.08900 -0.43900  -19.90500 1.000 99.22505  ? 1180 GLN F O   1 
ATOM   5021 C  CB  . GLN F 1 104 ? -26.17700 -1.11700  -16.78300 1.000 100.83841 ? 1180 GLN F CB  1 
ATOM   5022 C  CG  . GLN F 1 104 ? -25.09100 -2.03400  -17.33500 1.000 99.64353  ? 1180 GLN F CG  1 
ATOM   5023 C  CD  . GLN F 1 104 ? -23.77600 -1.33800  -17.59900 1.000 93.59017  ? 1180 GLN F CD  1 
ATOM   5024 O  OE1 . GLN F 1 104 ? -23.53300 -0.83000  -18.69200 1.000 92.37687  ? 1180 GLN F OE1 1 
ATOM   5025 N  NE2 . GLN F 1 104 ? -22.90100 -1.33400  -16.60400 1.000 93.87968  ? 1180 GLN F NE2 1 
ATOM   5026 N  N   . LYS F 1 105 ? -28.25400 -0.23000  -19.22800 1.000 95.91940  ? 1181 LYS F N   1 
ATOM   5027 C  CA  . LYS F 1 105 ? -28.84200 -0.45300  -20.57700 1.000 103.28870 ? 1181 LYS F CA  1 
ATOM   5028 C  C   . LYS F 1 105 ? -28.42100 0.72100   -21.47700 1.000 101.70956 ? 1181 LYS F C   1 
ATOM   5029 O  O   . LYS F 1 105 ? -27.76400 0.45600   -22.50700 1.000 103.58084 ? 1181 LYS F O   1 
ATOM   5030 C  CB  . LYS F 1 105 ? -30.35900 -0.70000  -20.51800 1.000 100.38309 ? 1181 LYS F CB  1 
ATOM   5031 C  CG  . LYS F 1 105 ? -30.82300 -2.08900  -20.97000 1.000 107.19443 ? 1181 LYS F CG  1 
ATOM   5032 C  CD  . LYS F 1 105 ? -30.17200 -3.27900  -20.25000 1.000 112.91091 ? 1181 LYS F CD  1 
ATOM   5033 C  CE  . LYS F 1 105 ? -29.22500 -4.09600  -21.11000 1.000 111.21070 ? 1181 LYS F CE  1 
ATOM   5034 N  NZ  . LYS F 1 105 ? -29.45100 -5.55000  -20.93700 1.000 114.32160 ? 1181 LYS F NZ  1 
ATOM   5035 N  N   . GLU F 1 106 ? -28.71600 1.96800   -21.08800 1.000 96.88530  ? 1182 GLU F N   1 
ATOM   5036 C  CA  . GLU F 1 106 ? -28.43500 3.17300   -21.92200 1.000 89.70549  ? 1182 GLU F CA  1 
ATOM   5037 C  C   . GLU F 1 106 ? -26.93500 3.27600   -22.23600 1.000 81.46766  ? 1182 GLU F C   1 
ATOM   5038 O  O   . GLU F 1 106 ? -26.62200 3.66600   -23.36600 1.000 77.12767  ? 1182 GLU F O   1 
ATOM   5039 C  CB  . GLU F 1 106 ? -28.90900 4.46200   -21.24700 1.000 85.84187  ? 1182 GLU F CB  1 
ATOM   5040 C  CG  . GLU F 1 106 ? -30.42000 4.61500   -21.19500 1.000 92.05314  ? 1182 GLU F CG  1 
ATOM   5041 C  CD  . GLU F 1 106 ? -31.06800 4.19300   -19.88600 1.000 92.03998  ? 1182 GLU F CD  1 
ATOM   5042 O  OE1 . GLU F 1 106 ? -31.98700 4.90700   -19.43900 1.000 91.96629  ? 1182 GLU F OE1 1 
ATOM   5043 O  OE2 . GLU F 1 106 ? -30.65300 3.15500   -19.31700 1.000 87.68946  ? 1182 GLU F OE2 1 
ATOM   5044 N  N   . ILE F 1 107 ? -26.05600 2.95700   -21.28000 1.000 77.70405  ? 1183 ILE F N   1 
ATOM   5045 C  CA  . ILE F 1 107 ? -24.57300 2.93500   -21.46900 1.000 74.94320  ? 1183 ILE F CA  1 
ATOM   5046 C  C   . ILE F 1 107 ? -24.25200 1.91200   -22.56000 1.000 82.08879  ? 1183 ILE F C   1 
ATOM   5047 O  O   . ILE F 1 107 ? -23.49200 2.25400   -23.48000 1.000 83.08628  ? 1183 ILE F O   1 
ATOM   5048 C  CB  . ILE F 1 107 ? -23.82200 2.62100   -20.15200 1.000 73.79832  ? 1183 ILE F CB  1 
ATOM   5049 C  CG1 . ILE F 1 107 ? -24.10600 3.67400   -19.07600 1.000 70.42950  ? 1183 ILE F CG1 1 
ATOM   5050 C  CG2 . ILE F 1 107 ? -22.32400 2.46500   -20.38700 1.000 75.37483  ? 1183 ILE F CG2 1 
ATOM   5051 C  CD1 . ILE F 1 107 ? -23.55500 3.33700   -17.71800 1.000 69.73994  ? 1183 ILE F CD1 1 
ATOM   5052 N  N   . ASP F 1 108 ? -24.81900 0.70600   -22.45000 1.000 92.05841  ? 1184 ASP F N   1 
ATOM   5053 C  CA  . ASP F 1 108 ? -24.62200 -0.40700  -23.41900 1.000 98.78290  ? 1184 ASP F CA  1 
ATOM   5054 C  C   . ASP F 1 108 ? -25.11700 0.06900   -24.78700 1.000 96.18785  ? 1184 ASP F C   1 
ATOM   5055 O  O   . ASP F 1 108 ? -24.36200 -0.10500  -25.76600 1.000 96.66685  ? 1184 ASP F O   1 
ATOM   5056 C  CB  . ASP F 1 108 ? -25.29500 -1.69400  -22.92900 1.000 107.85767 ? 1184 ASP F CB  1 
ATOM   5057 C  CG  . ASP F 1 108 ? -24.64500 -2.27300  -21.68300 1.000 111.65812 ? 1184 ASP F CG  1 
ATOM   5058 O  OD1 . ASP F 1 108 ? -23.40100 -2.23700  -21.59900 1.000 113.05829 ? 1184 ASP F OD1 1 
ATOM   5059 O  OD2 . ASP F 1 108 ? -25.38700 -2.74400  -20.80200 1.000 116.22709 ? 1184 ASP F OD2 1 
ATOM   5060 N  N   . ARG F 1 109 ? -26.29700 0.70200   -24.82100 1.000 89.28702  ? 1185 ARG F N   1 
ATOM   5061 C  CA  . ARG F 1 109 ? -26.96400 1.23500   -26.04300 1.000 94.10865  ? 1185 ARG F CA  1 
ATOM   5062 C  C   . ARG F 1 109 ? -26.02800 2.22600   -26.75000 1.000 90.60034  ? 1185 ARG F C   1 
ATOM   5063 O  O   . ARG F 1 109 ? -25.93000 2.14500   -27.98400 1.000 87.89212  ? 1185 ARG F O   1 
ATOM   5064 C  CB  . ARG F 1 109 ? -28.31700 1.86700   -25.68100 1.000 93.46647  ? 1185 ARG F CB  1 
ATOM   5065 C  CG  . ARG F 1 109 ? -29.01500 2.61500   -26.81300 1.000 85.37603  ? 1185 ARG F CG  1 
ATOM   5066 C  CD  . ARG F 1 109 ? -30.08600 1.80700   -27.53800 1.000 98.39074  ? 1185 ARG F CD  1 
ATOM   5067 N  NE  . ARG F 1 109 ? -30.52800 2.41700   -28.79800 1.000 104.79414 ? 1185 ARG F NE  1 
ATOM   5068 C  CZ  . ARG F 1 109 ? -30.12200 2.07400   -30.02800 1.000 102.81759 ? 1185 ARG F CZ  1 
ATOM   5069 N  NH1 . ARG F 1 109 ? -29.24600 1.09800   -30.22600 1.000 101.38058 ? 1185 ARG F NH1 1 
ATOM   5070 N  NH2 . ARG F 1 109 ? -30.60800 2.71900   -31.07400 1.000 95.75622  ? 1185 ARG F NH2 1 
ATOM   5071 N  N   . LEU F 1 110 ? -25.36600 3.11600   -26.00100 1.000 90.02658  ? 1186 LEU F N   1 
ATOM   5072 C  CA  . LEU F 1 110 ? -24.39600 4.11100   -26.54400 1.000 79.04632  ? 1186 LEU F CA  1 
ATOM   5073 C  C   . LEU F 1 110 ? -23.21400 3.37700   -27.18300 1.000 90.94511  ? 1186 LEU F C   1 
ATOM   5074 O  O   . LEU F 1 110 ? -22.90900 3.65300   -28.35500 1.000 95.09824  ? 1186 LEU F O   1 
ATOM   5075 C  CB  . LEU F 1 110 ? -23.91700 5.04800   -25.42800 1.000 69.81363  ? 1186 LEU F CB  1 
ATOM   5076 C  CG  . LEU F 1 110 ? -24.90200 6.13900   -25.00500 1.000 80.20172  ? 1186 LEU F CG  1 
ATOM   5077 C  CD1 . LEU F 1 110 ? -24.26700 7.06900   -23.98400 1.000 89.38440  ? 1186 LEU F CD1 1 
ATOM   5078 C  CD2 . LEU F 1 110 ? -25.40300 6.94200   -26.19800 1.000 63.59710  ? 1186 LEU F CD2 1 
ATOM   5079 N  N   . ASN F 1 111 ? -22.57200 2.47700   -26.44100 1.000 90.36873  ? 1187 ASN F N   1 
ATOM   5080 C  CA  . ASN F 1 111 ? -21.43600 1.67100   -26.95400 1.000 95.95887  ? 1187 ASN F CA  1 
ATOM   5081 C  C   . ASN F 1 111 ? -21.89400 0.86800   -28.18400 1.000 100.36730 ? 1187 ASN F C   1 
ATOM   5082 O  O   . ASN F 1 111 ? -21.10200 0.77400   -29.13900 1.000 92.00314  ? 1187 ASN F O   1 
ATOM   5083 C  CB  . ASN F 1 111 ? -20.83300 0.80900   -25.84500 1.000 93.81914  ? 1187 ASN F CB  1 
ATOM   5084 C  CG  . ASN F 1 111 ? -20.02500 1.62600   -24.86100 1.000 89.51336  ? 1187 ASN F CG  1 
ATOM   5085 O  OD1 . ASN F 1 111 ? -19.40200 2.61800   -25.23300 1.000 83.58107  ? 1187 ASN F OD1 1 
ATOM   5086 N  ND2 . ASN F 1 111 ? -20.01300 1.20700   -23.60800 1.000 93.37435  ? 1187 ASN F ND2 1 
ATOM   5087 N  N   . GLU F 1 112 ? -23.12000 0.32900   -28.18000 1.000 106.24169 ? 1188 GLU F N   1 
ATOM   5088 C  CA  . GLU F 1 112 ? -23.70000 -0.43200  -29.32700 1.000 113.55046 ? 1188 GLU F CA  1 
ATOM   5089 C  C   . GLU F 1 112 ? -23.74300 0.48000   -30.56500 1.000 110.06056 ? 1188 GLU F C   1 
ATOM   5090 O  O   . GLU F 1 112 ? -23.22100 0.06000   -31.62300 1.000 111.49495 ? 1188 GLU F O   1 
ATOM   5091 C  CB  . GLU F 1 112 ? -25.08100 -1.00400  -28.96900 1.000 121.72512 ? 1188 GLU F CB  1 
ATOM   5092 C  CG  . GLU F 1 112 ? -25.76500 -1.80500  -30.07900 1.000 130.94202 ? 1188 GLU F CG  1 
ATOM   5093 C  CD  . GLU F 1 112 ? -25.19500 -3.18200  -30.40900 1.000 137.86390 ? 1188 GLU F CD  1 
ATOM   5094 O  OE1 . GLU F 1 112 ? -23.97600 -3.39100  -30.23100 1.000 139.37724 ? 1188 GLU F OE1 1 
ATOM   5095 O  OE2 . GLU F 1 112 ? -25.98300 -4.05500  -30.84700 1.000 140.37209 ? 1188 GLU F OE2 1 
ATOM   5096 N  N   . VAL F 1 113 ? -24.30600 1.68800   -30.43400 1.000 107.92083 ? 1189 VAL F N   1 
ATOM   5097 C  CA  . VAL F 1 113 ? -24.45200 2.67100   -31.55200 1.000 96.41156  ? 1189 VAL F CA  1 
ATOM   5098 C  C   . VAL F 1 113 ? -23.06200 3.13600   -32.01300 1.000 96.38524  ? 1189 VAL F C   1 
ATOM   5099 O  O   . VAL F 1 113 ? -22.91000 3.38400   -33.22600 1.000 96.61158  ? 1189 VAL F O   1 
ATOM   5100 C  CB  . VAL F 1 113 ? -25.33500 3.87800   -31.17400 1.000 86.47089  ? 1189 VAL F CB  1 
ATOM   5101 C  CG1 . VAL F 1 113 ? -25.39500 4.89900   -32.30300 1.000 79.83852  ? 1189 VAL F CG1 1 
ATOM   5102 C  CG2 . VAL F 1 113 ? -26.74400 3.46200   -30.77400 1.000 80.65967  ? 1189 VAL F CG2 1 
ATOM   5103 N  N   . ALA F 1 114 ? -22.09900 3.27500   -31.09200 1.000 94.84558  ? 1190 ALA F N   1 
ATOM   5104 C  CA  . ALA F 1 114 ? -20.72100 3.74300   -31.38400 1.000 92.10315  ? 1190 ALA F CA  1 
ATOM   5105 C  C   . ALA F 1 114 ? -20.04200 2.73900   -32.31700 1.000 93.39014  ? 1190 ALA F C   1 
ATOM   5106 O  O   . ALA F 1 114 ? -19.32300 3.18300   -33.23700 1.000 95.80359  ? 1190 ALA F O   1 
ATOM   5107 C  CB  . ALA F 1 114 ? -19.92600 3.93400   -30.11200 1.000 94.56923  ? 1190 ALA F CB  1 
ATOM   5108 N  N   . LYS F 1 115 ? -20.27000 1.44400   -32.07000 1.000 93.64017  ? 1191 LYS F N   1 
ATOM   5109 C  CA  . LYS F 1 115 ? -19.75700 0.31400   -32.89100 1.000 102.45176 ? 1191 LYS F CA  1 
ATOM   5110 C  C   . LYS F 1 115 ? -20.54600 0.25700   -34.20100 1.000 103.51241 ? 1191 LYS F C   1 
ATOM   5111 O  O   . LYS F 1 115 ? -19.90800 0.17400   -35.27300 1.000 103.17816 ? 1191 LYS F O   1 
ATOM   5112 C  CB  . LYS F 1 115 ? -19.88100 -1.00600  -32.12100 1.000 107.88136 ? 1191 LYS F CB  1 
ATOM   5113 C  CG  . LYS F 1 115 ? -19.33700 -2.24000  -32.83300 1.000 113.93208 ? 1191 LYS F CG  1 
ATOM   5114 C  CD  . LYS F 1 115 ? -19.56900 -3.53400  -32.07100 1.000 118.68265 ? 1191 LYS F CD  1 
ATOM   5115 C  CE  . LYS F 1 115 ? -20.93700 -4.14300  -32.31200 1.000 122.58049 ? 1191 LYS F CE  1 
ATOM   5116 N  NZ  . LYS F 1 115 ? -21.02900 -5.51400  -31.75400 1.000 123.00422 ? 1191 LYS F NZ  1 
ATOM   5117 N  N   . ASN F 1 116 ? -21.87800 0.31900   -34.09900 1.000 98.73289  ? 1192 ASN F N   1 
ATOM   5118 C  CA  . ASN F 1 116 ? -22.83100 0.19200   -35.23300 1.000 98.68025  ? 1192 ASN F CA  1 
ATOM   5119 C  C   . ASN F 1 116 ? -22.58100 1.25800   -36.30400 1.000 96.39314  ? 1192 ASN F C   1 
ATOM   5120 O  O   . ASN F 1 116 ? -22.97500 1.00000   -37.46000 1.000 101.63324 ? 1192 ASN F O   1 
ATOM   5121 C  CB  . ASN F 1 116 ? -24.28800 0.32800   -34.78500 1.000 100.63049 ? 1192 ASN F CB  1 
ATOM   5122 C  CG  . ASN F 1 116 ? -24.82300 -0.88600  -34.06000 1.000 119.44327 ? 1192 ASN F CG  1 
ATOM   5123 O  OD1 . ASN F 1 116 ? -24.07000 -1.78100  -33.67700 1.000 127.96271 ? 1192 ASN F OD1 1 
ATOM   5124 N  ND2 . ASN F 1 116 ? -26.13100 -0.90800  -33.85900 1.000 124.26227 ? 1192 ASN F ND2 1 
ATOM   5125 N  N   . LEU F 1 117 ? -22.01000 2.41600   -35.94600 1.000 89.19754  ? 1193 LEU F N   1 
ATOM   5126 C  CA  . LEU F 1 117 ? -21.84200 3.56600   -36.88000 1.000 89.90815  ? 1193 LEU F CA  1 
ATOM   5127 C  C   . LEU F 1 117 ? -20.74500 3.25900   -37.90900 1.000 97.39062  ? 1193 LEU F C   1 
ATOM   5128 O  O   . LEU F 1 117 ? -20.73600 3.92800   -38.96400 1.000 102.04118 ? 1193 LEU F O   1 
ATOM   5129 C  CB  . LEU F 1 117 ? -21.54300 4.85500   -36.10400 1.000 83.97586  ? 1193 LEU F CB  1 
ATOM   5130 C  CG  . LEU F 1 117 ? -22.76400 5.66000   -35.64700 1.000 82.35724  ? 1193 LEU F CG  1 
ATOM   5131 C  CD1 . LEU F 1 117 ? -22.33700 6.85000   -34.80200 1.000 80.34384  ? 1193 LEU F CD1 1 
ATOM   5132 C  CD2 . LEU F 1 117 ? -23.60200 6.13400   -36.82900 1.000 74.41682  ? 1193 LEU F CD2 1 
ATOM   5133 N  N   . ASN F 1 118 ? -19.88000 2.27500   -37.63900 1.000 99.31454  ? 1194 ASN F N   1 
ATOM   5134 C  CA  . ASN F 1 118 ? -18.87700 1.75800   -38.61200 1.000 104.87836 ? 1194 ASN F CA  1 
ATOM   5135 C  C   . ASN F 1 118 ? -19.58200 1.26000   -39.88400 1.000 103.79139 ? 1194 ASN F C   1 
ATOM   5136 O  O   . ASN F 1 118 ? -18.96400 1.35300   -40.96400 1.000 104.42305 ? 1194 ASN F O   1 
ATOM   5137 C  CB  . ASN F 1 118 ? -18.01000 0.65500   -38.00200 1.000 111.92921 ? 1194 ASN F CB  1 
ATOM   5138 C  CG  . ASN F 1 118 ? -16.97600 1.19700   -37.04000 1.000 109.38417 ? 1194 ASN F CG  1 
ATOM   5139 O  OD1 . ASN F 1 118 ? -16.30500 2.18700   -37.33400 1.000 96.88530  ? 1194 ASN F OD1 1 
ATOM   5140 N  ND2 . ASN F 1 118 ? -16.83900 0.54900   -35.89500 1.000 113.66100 ? 1194 ASN F ND2 1 
ATOM   5141 N  N   . GLU F 1 119 ? -20.82200 0.76700   -39.75500 1.000 98.58024  ? 1195 GLU F N   1 
ATOM   5142 C  CA  . GLU F 1 119 ? -21.67600 0.25700   -40.86700 1.000 104.84678 ? 1195 GLU F CA  1 
ATOM   5143 C  C   . GLU F 1 119 ? -22.32500 1.43800   -41.61200 1.000 106.30222 ? 1195 GLU F C   1 
ATOM   5144 O  O   . GLU F 1 119 ? -22.89900 1.20700   -42.69100 1.000 114.21633 ? 1195 GLU F O   1 
ATOM   5145 C  CB  . GLU F 1 119 ? -22.69000 -0.75400  -40.30500 1.000 106.76543 ? 1195 GLU F CB  1 
ATOM   5146 C  CG  . GLU F 1 119 ? -23.76700 -1.23000  -41.28000 1.000 119.02480 ? 1195 GLU F CG  1 
ATOM   5147 C  CD  . GLU F 1 119 ? -23.40200 -2.36000  -42.23700 1.000 123.79905 ? 1195 GLU F CD  1 
ATOM   5148 O  OE1 . GLU F 1 119 ? -22.52600 -3.19000  -41.89300 1.000 131.06835 ? 1195 GLU F OE1 1 
ATOM   5149 O  OE2 . GLU F 1 119 ? -24.01200 -2.41700  -43.33000 1.000 111.84762 ? 1195 GLU F OE2 1 
ATOM   5150 N  N   . SER F 1 120 ? -22.20700 2.66600   -41.09800 1.000 97.81436  ? 1196 SER F N   1 
ATOM   5151 C  CA  . SER F 1 120 ? -22.77800 3.88600   -41.72700 1.000 98.12755  ? 1196 SER F CA  1 
ATOM   5152 C  C   . SER F 1 120 ? -21.72600 4.61700   -42.57400 1.000 94.62977  ? 1196 SER F C   1 
ATOM   5153 O  O   . SER F 1 120 ? -22.12100 5.54600   -43.29400 1.000 86.63144  ? 1196 SER F O   1 
ATOM   5154 C  CB  . SER F 1 120 ? -23.37500 4.80300   -40.69200 1.000 99.40929  ? 1196 SER F CB  1 
ATOM   5155 O  OG  . SER F 1 120 ? -24.66900 4.36900   -40.31100 1.000 106.52593 ? 1196 SER F OG  1 
ATOM   5156 N  N   . LEU F 1 121 ? -20.45100 4.21400   -42.51700 1.000 92.75586  ? 1197 LEU F N   1 
ATOM   5157 C  CA  . LEU F 1 121 ? -19.35400 4.87400   -43.27900 1.000 82.89415  ? 1197 LEU F CA  1 
ATOM   5158 C  C   . LEU F 1 121 ? -19.52600 4.57100   -44.77500 1.000 81.99667  ? 1197 LEU F C   1 
ATOM   5159 O  O   . LEU F 1 121 ? -20.42200 3.77100   -45.10300 1.000 85.88661  ? 1197 LEU F O   1 
ATOM   5160 C  CB  . LEU F 1 121 ? -18.00100 4.40300   -42.73000 1.000 81.12025  ? 1197 LEU F CB  1 
ATOM   5161 C  CG  . LEU F 1 121 ? -17.67400 4.87700   -41.31100 1.000 80.68862  ? 1197 LEU F CG  1 
ATOM   5162 C  CD1 . LEU F 1 121 ? -16.40800 4.22400   -40.77400 1.000 79.93590  ? 1197 LEU F CD1 1 
ATOM   5163 C  CD2 . LEU F 1 121 ? -17.53200 6.38900   -41.25700 1.000 71.59543  ? 1197 LEU F CD2 1 
ATOM   5164 N  N   . ILE F 1 122 ? -18.71900 5.20500   -45.63800 1.000 81.95719  ? 1198 ILE F N   1 
ATOM   5165 C  CA  . ILE F 1 122 ? -18.82300 5.14100   -47.13000 1.000 88.11583  ? 1198 ILE F CA  1 
ATOM   5166 C  C   . ILE F 1 122 ? -17.53100 4.52700   -47.69500 1.000 91.76627  ? 1198 ILE F C   1 
ATOM   5167 O  O   . ILE F 1 122 ? -16.46000 5.10500   -47.42300 1.000 88.35270  ? 1198 ILE F O   1 
ATOM   5168 C  CB  . ILE F 1 122 ? -19.10300 6.55600   -47.69100 1.000 80.72020  ? 1198 ILE F CB  1 
ATOM   5169 C  CG1 . ILE F 1 122 ? -20.40400 7.13000   -47.11700 1.000 81.54399  ? 1198 ILE F CG1 1 
ATOM   5170 C  CG2 . ILE F 1 122 ? -19.10100 6.56700   -49.21600 1.000 74.59052  ? 1198 ILE F CG2 1 
ATOM   5171 C  CD1 . ILE F 1 122 ? -20.78100 8.49500   -47.64300 1.000 78.28044  ? 1198 ILE F CD1 1 
ATOM   5172 N  N   . ASP F 1 123 ? -17.63900 3.45900   -48.48200 1.000 95.85886  ? 1199 ASP F N   1 
ATOM   5173 C  CA  . ASP F 1 123 ? -16.49300 2.89300   -49.18400 1.000 93.19275  ? 1199 ASP F CA  1 
ATOM   5174 C  C   . ASP F 1 123 ? -15.97100 3.88400   -50.22300 1.000 91.73468  ? 1199 ASP F C   1 
ATOM   5175 O  O   . ASP F 1 123 ? -16.42000 3.90100   -51.36900 1.000 93.48752  ? 1199 ASP F O   1 
ATOM   5176 C  CB  . ASP F 1 123 ? -16.87400 1.57300   -49.85700 1.000 91.31884  ? 1199 ASP F CB  1 
ATOM   5177 C  CG  . ASP F 1 123 ? -15.66500 0.72100   -50.19200 1.000 100.68049 ? 1199 ASP F CG  1 
ATOM   5178 O  OD1 . ASP F 1 123 ? -14.53600 1.25500   -50.17300 1.000 100.99895 ? 1199 ASP F OD1 1 
ATOM   5179 O  OD2 . ASP F 1 123 ? -15.84500 -0.48200  -50.47500 1.000 102.67020 ? 1199 ASP F OD2 1 
ATOM   5180 N  N   . LEU F 1 124 ? -15.02000 4.70700   -49.79900 1.000 97.40905  ? 1200 LEU F N   1 
ATOM   5181 C  CA  . LEU F 1 124 ? -14.42600 5.78000   -50.64100 1.000 95.97993  ? 1200 LEU F CA  1 
ATOM   5182 C  C   . LEU F 1 124 ? -13.81600 5.19500   -51.92200 1.000 99.84092  ? 1200 LEU F C   1 
ATOM   5183 O  O   . LEU F 1 124 ? -13.12000 5.95000   -52.62600 1.000 97.76962  ? 1200 LEU F O   1 
ATOM   5184 C  CB  . LEU F 1 124 ? -13.35800 6.52900   -49.83300 1.000 84.22852  ? 1200 LEU F CB  1 
ATOM   5185 C  CG  . LEU F 1 124 ? -13.80100 7.84200   -49.18800 1.000 92.97694  ? 1200 LEU F CG  1 
ATOM   5186 C  CD1 . LEU F 1 124 ? -14.56900 8.72000   -50.16700 1.000 95.65621  ? 1200 LEU F CD1 1 
ATOM   5187 C  CD2 . LEU F 1 124 ? -14.63000 7.58000   -47.94600 1.000 94.64556  ? 1200 LEU F CD2 1 
ATOM   5188 N  N   . GLN F 1 125 ? -14.04700 3.91300   -52.22100 1.000 100.61470 ? 1201 GLN F N   1 
ATOM   5189 C  CA  . GLN F 1 125 ? -13.61500 3.30800   -53.50600 1.000 108.22087 ? 1201 GLN F CA  1 
ATOM   5190 C  C   . GLN F 1 125 ? -14.64500 3.68000   -54.57800 1.000 114.51110 ? 1201 GLN F C   1 
ATOM   5191 O  O   . GLN F 1 125 ? -15.67200 2.96400   -54.72100 1.000 109.13677 ? 1201 GLN F O   1 
ATOM   5192 C  CB  . GLN F 1 125 ? -13.30800 1.82300   -53.33400 1.000 112.64245 ? 1201 GLN F CB  1 
ATOM   5193 C  CG  . GLN F 1 125 ? -11.80800 1.53700   -53.37400 1.000 118.19312 ? 1201 GLN F CG  1 
ATOM   5194 C  CD  . GLN F 1 125 ? -10.94300 2.53600   -52.63000 1.000 111.27650 ? 1201 GLN F CD  1 
ATOM   5195 O  OE1 . GLN F 1 125 ? -11.37400 3.19100   -51.68500 1.000 108.38142 ? 1201 GLN F OE1 1 
ATOM   5196 N  NE2 . GLN F 1 125 ? -9.69000  2.65300   -53.04600 1.000 101.41742 ? 1201 GLN F NE2 1 
ATOM   5197 N  N   . GLU F 1 126 ? -14.34700 4.80400   -55.25300 1.000 128.96020 ? 1202 GLU F N   1 
ATOM   5198 C  CA  . GLU F 1 126 ? -15.11200 5.46800   -56.34500 1.000 118.70634 ? 1202 GLU F CA  1 
ATOM   5199 C  C   . GLU F 1 126 ? -16.59000 5.59400   -55.94400 1.000 115.44805 ? 1202 GLU F C   1 
ATOM   5200 O  O   . GLU F 1 126 ? -16.96200 6.36500   -55.04100 1.000 104.55727 ? 1202 GLU F O   1 
ATOM   5201 C  CB  . GLU F 1 126 ? -14.90700 4.70600   -57.65600 1.000 108.43405 ? 1202 GLU F CB  1 
ATOM   5202 C  CG  . GLU F 1 126 ? -13.58500 4.99900   -58.35000 1.000 105.28631 ? 1202 GLU F CG  1 
ATOM   5203 C  CD  . GLU F 1 126 ? -13.54300 4.45500   -59.76900 1.000 111.35809 ? 1202 GLU F CD  1 
ATOM   5204 O  OE1 . GLU F 1 126 ? -13.44000 5.26000   -60.71900 1.000 114.17685 ? 1202 GLU F OE1 1 
ATOM   5205 O  OE2 . GLU F 1 126 ? -13.63900 3.22500   -59.92600 1.000 115.96654 ? 1202 GLU F OE2 1 
HETATM 5206 O  O1  . PG4 G 2 .   ? -10.39600 -14.39800 -34.51500 1.000 84.23000  ? 1301 PG4 A O1  1 
HETATM 5207 C  C1  . PG4 G 2 .   ? -11.71700 -14.28900 -33.94500 1.000 58.99000  ? 1301 PG4 A C1  1 
HETATM 5208 C  C2  . PG4 G 2 .   ? -11.80500 -14.68900 -32.46500 1.000 60.86000  ? 1301 PG4 A C2  1 
HETATM 5209 O  O2  . PG4 G 2 .   ? -12.92400 -13.98400 -31.90300 1.000 84.86000  ? 1301 PG4 A O2  1 
HETATM 5210 C  C3  . PG4 G 2 .   ? -12.92900 -13.71400 -30.49500 1.000 71.54000  ? 1301 PG4 A C3  1 
HETATM 5211 C  C4  . PG4 G 2 .   ? -13.16500 -14.92000 -29.57000 1.000 78.18000  ? 1301 PG4 A C4  1 
HETATM 5212 O  O3  . PG4 G 2 .   ? -13.20000 -16.24600 -30.16100 1.000 70.58000  ? 1301 PG4 A O3  1 
HETATM 5213 C  C5  . PG4 G 2 .   ? -12.76500 -17.24500 -29.21100 1.000 67.82000  ? 1301 PG4 A C5  1 
HETATM 5214 C  C6  . PG4 G 2 .   ? -13.61200 -18.51000 -29.18600 1.000 55.96000  ? 1301 PG4 A C6  1 
HETATM 5215 O  O4  . PG4 G 2 .   ? -13.95800 -18.80200 -27.82400 1.000 79.91000  ? 1301 PG4 A O4  1 
HETATM 5216 C  C7  . PG4 G 2 .   ? -14.93100 -17.94400 -27.17500 1.000 55.84000  ? 1301 PG4 A C7  1 
HETATM 5217 C  C8  . PG4 G 2 .   ? -15.86000 -18.74500 -26.23600 1.000 71.40000  ? 1301 PG4 A C8  1 
HETATM 5218 O  O5  . PG4 G 2 .   ? -15.21900 -19.09500 -24.98600 1.000 54.53000  ? 1301 PG4 A O5  1 
HETATM 5219 ZN ZN  . ZN  H 3 .   ? -0.99900  -16.11000 -13.28200 1.000 150.26000 ? 1302 ZN  A ZN  1 
HETATM 5220 O  O1  . PG4 I 2 .   ? -8.00200  -17.43800 -27.87200 1.000 83.92000  ? 1303 PG4 A O1  1 
HETATM 5221 C  C1  . PG4 I 2 .   ? -9.24400  -16.72900 -27.84500 1.000 83.98000  ? 1303 PG4 A C1  1 
HETATM 5222 C  C2  . PG4 I 2 .   ? -9.75700  -16.63800 -26.42000 1.000 72.48000  ? 1303 PG4 A C2  1 
HETATM 5223 O  O2  . PG4 I 2 .   ? -11.01800 -17.28000 -26.40600 1.000 55.84000  ? 1303 PG4 A O2  1 
HETATM 5224 C  C3  . PG4 I 2 .   ? -11.18800 -18.01100 -25.22200 1.000 74.20000  ? 1303 PG4 A C3  1 
HETATM 5225 C  C4  . PG4 I 2 .   ? -10.72000 -19.30200 -25.81200 1.000 53.33000  ? 1303 PG4 A C4  1 
HETATM 5226 O  O3  . PG4 I 2 .   ? -9.34500  -19.19600 -26.15100 1.000 49.33000  ? 1303 PG4 A O3  1 
HETATM 5227 C  C5  . PG4 I 2 .   ? -8.54500  -19.53000 -25.01900 1.000 46.47000  ? 1303 PG4 A C5  1 
HETATM 5228 C  C6  . PG4 I 2 .   ? -7.24500  -20.08300 -25.52400 1.000 45.78000  ? 1303 PG4 A C6  1 
HETATM 5229 O  O4  . PG4 I 2 .   ? -7.65500  -20.84200 -26.63400 1.000 68.58000  ? 1303 PG4 A O4  1 
HETATM 5230 C  C7  . PG4 I 2 .   ? -8.62300  -21.80900 -26.13600 1.000 77.18000  ? 1303 PG4 A C7  1 
HETATM 5231 C  C8  . PG4 I 2 .   ? -10.03600 -21.81000 -26.72400 1.000 42.27000  ? 1303 PG4 A C8  1 
HETATM 5232 O  O5  . PG4 I 2 .   ? -10.78300 -21.83200 -25.56200 1.000 41.58000  ? 1303 PG4 A O5  1 
HETATM 5233 ZN ZN  . ZN  J 3 .   ? -15.15800 -0.27800  26.77700  1.000 117.20000 ? 1304 ZN  A ZN  1 
HETATM 5234 ZN ZN  . ZN  K 3 .   ? -11.95800 -7.48300  -33.32000 1.000 103.88000 ? 1301 ZN  B ZN  1 
HETATM 5235 ZN ZN  . ZN  L 3 .   ? 5.92600   6.86800   35.96900  1.000 145.08000 ? 1302 ZN  B ZN  1 
HETATM 5236 ZN ZN  . ZN  M 3 .   ? -20.81400 -0.15100  -13.47900 1.000 148.58000 ? 1301 ZN  F ZN  1 
HETATM 5237 ZN ZN  . ZN  N 3 .   ? -9.10300  15.12700  -56.04900 1.000 145.91000 ? 1302 ZN  F ZN  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . THR A 3   ? 1.91630 2.30480 1.39870 0.15650  0.09130  0.22820  912  THR A N   
2    C CA  . THR A 3   ? 1.83320 2.28280 1.37490 0.08580  0.08500  0.24860  912  THR A CA  
3    C C   . THR A 3   ? 1.68740 2.03270 1.26730 0.06520  0.06240  0.23020  912  THR A C   
4    O O   . THR A 3   ? 1.60910 1.90950 1.21620 0.00140  0.04050  0.23550  912  THR A O   
5    C CB  . THR A 3   ? 1.86910 2.34470 1.40370 0.02090  0.07790  0.27320  912  THR A CB  
6    O OG1 . THR A 3   ? 1.92830 2.26110 1.43520 0.00490  0.05340  0.25880  912  THR A OG1 
7    C CG2 . THR A 3   ? 1.88440 2.48020 1.38420 0.04040  0.10360  0.29250  912  THR A CG2 
8    N N   . GLN A 4   ? 1.74380 2.05490 1.32240 0.11910  0.06720  0.20920  913  GLN A N   
9    C CA  . GLN A 4   ? 1.66740 1.89630 1.28080 0.11030  0.05130  0.19060  913  GLN A CA  
10   C C   . GLN A 4   ? 1.59580 1.91650 1.23880 0.13620  0.06780  0.19430  913  GLN A C   
11   O O   . GLN A 4   ? 1.71920 1.98060 1.38050 0.14690  0.06020  0.17750  913  GLN A O   
12   C CB  . GLN A 4   ? 1.70300 1.79310 1.27880 0.15120  0.04020  0.16120  913  GLN A CB  
13   C CG  . GLN A 4   ? 1.79430 1.88970 1.30870 0.22250  0.05560  0.15450  913  GLN A CG  
14   C CD  . GLN A 4   ? 1.88130 1.86950 1.36490 0.27550  0.04910  0.12690  913  GLN A CD  
15   O OE1 . GLN A 4   ? 1.93330 1.90070 1.44070 0.28200  0.04650  0.11720  913  GLN A OE1 
16   N NE2 . GLN A 4   ? 1.88070 1.79960 1.30720 0.31440  0.04600  0.11480  913  GLN A NE2 
17   N N   . ASN A 5   ? 1.51970 1.98180 1.16590 0.14600  0.08930  0.21500  914  ASN A N   
18   C CA  . ASN A 5   ? 1.46240 2.02760 1.13150 0.17870  0.10670  0.21850  914  ASN A CA  
19   C C   . ASN A 5   ? 1.38100 1.96490 1.11360 0.12490  0.09630  0.22620  914  ASN A C   
20   O O   . ASN A 5   ? 1.26380 1.84080 1.01380 0.15100  0.09780  0.21460  914  ASN A O   
21   C CB  . ASN A 5   ? 1.41460 2.13420 1.07230 0.19980  0.13160  0.23790  914  ASN A CB  
22   C CG  . ASN A 5   ? 1.52910 2.24450 1.12430 0.27620  0.14460  0.22440  914  ASN A CG  
23   O OD1 . ASN A 5   ? 1.62460 2.24000 1.18830 0.32630  0.13790  0.20020  914  ASN A OD1 
24   N ND2 . ASN A 5   ? 1.56820 2.39090 1.14250 0.28490  0.16210  0.23990  914  ASN A ND2 
25   N N   . VAL A 6   ? 1.44710 2.04780 1.20840 0.05340  0.08430  0.24460  915  VAL A N   
26   C CA  . VAL A 6   ? 1.39500 2.01330 1.21530 -0.00480 0.07030  0.25390  915  VAL A CA  
27   C C   . VAL A 6   ? 1.33930 1.83600 1.17370 0.00080  0.05320  0.22800  915  VAL A C   
28   O O   . VAL A 6   ? 1.29930 1.82400 1.17190 -0.00140 0.05340  0.22640  915  VAL A O   
29   C CB  . VAL A 6   ? 1.32320 1.94310 1.15720 -0.08130 0.05270  0.27390  915  VAL A CB  
30   C CG1 . VAL A 6   ? 1.29620 1.93050 1.18670 -0.13690 0.03570  0.28210  915  VAL A CG1 
31   C CG2 . VAL A 6   ? 1.27890 2.01570 1.09450 -0.09310 0.06950  0.30100  915  VAL A CG2 
32   N N   . LEU A 7   ? 1.28180 1.65160 1.08680 0.00640  0.03880  0.20850  916  LEU A N   
33   C CA  . LEU A 7   ? 1.35110 1.60100 1.16750 0.00620  0.02120  0.18270  916  LEU A CA  
34   C C   . LEU A 7   ? 1.46970 1.71510 1.27540 0.06650  0.03500  0.16790  916  LEU A C   
35   O O   . LEU A 7   ? 1.41550 1.63260 1.25340 0.05650  0.02760  0.15820  916  LEU A O   
36   C CB  . LEU A 7   ? 1.41290 1.54040 1.19570 0.00160  0.00420  0.16600  916  LEU A CB  
37   C CG  . LEU A 7   ? 1.34780 1.43040 1.15360 -0.06580 -0.02230 0.16910  916  LEU A CG  
38   C CD1 . LEU A 7   ? 1.35760 1.52790 1.16150 -0.10300 -0.01950 0.19860  916  LEU A CD1 
39   C CD2 . LEU A 7   ? 1.23030 1.18080 1.00700 -0.06380 -0.04110 0.14570  916  LEU A CD2 
40   N N   . TYR A 8   ? 1.36340 1.63630 1.12340 0.12700  0.05310  0.16620  917  TYR A N   
41   C CA  . TYR A 8   ? 1.38360 1.64290 1.12130 0.18960  0.06320  0.15140  917  TYR A CA  
42   C C   . TYR A 8   ? 1.33810 1.70780 1.11350 0.19250  0.07520  0.16340  917  TYR A C   
43   O O   . TYR A 8   ? 1.44150 1.77720 1.22280 0.21330  0.07360  0.15080  917  TYR A O   
44   C CB  . TYR A 8   ? 1.39720 1.65970 1.07200 0.25610  0.07620  0.14590  917  TYR A CB  
45   C CG  . TYR A 8   ? 1.46810 1.69860 1.11020 0.32130  0.08100  0.12900  917  TYR A CG  
46   C CD1 . TYR A 8   ? 1.55750 1.67100 1.19520 0.32320  0.06690  0.10930  917  TYR A CD1 
47   C CD2 . TYR A 8   ? 1.49040 1.80710 1.10250 0.38160  0.09840  0.13210  917  TYR A CD2 
48   C CE1 . TYR A 8   ? 1.63040 1.70660 1.23140 0.38010  0.06890  0.09520  917  TYR A CE1 
49   C CE2 . TYR A 8   ? 1.52950 1.80880 1.10430 0.44360  0.09910  0.11590  917  TYR A CE2 
50   C CZ  . TYR A 8   ? 1.59960 1.75460 1.16700 0.44150  0.08380  0.09830  917  TYR A CZ  
51   O OH  . TYR A 8   ? 1.61330 1.72540 1.13850 0.49930  0.08220  0.08380  917  TYR A OH  
52   N N   . GLU A 9   ? 1.29520 1.79260 1.09330 0.17200  0.08660  0.18700  918  GLU A N   
53   C CA  . GLU A 9   ? 1.31830 1.93300 1.15740 0.16890  0.09730  0.20030  918  GLU A CA  
54   C C   . GLU A 9   ? 1.27300 1.85660 1.16690 0.11260  0.08040  0.20100  918  GLU A C   
55   O O   . GLU A 9   ? 1.23990 1.85920 1.15820 0.12560  0.08430  0.19920  918  GLU A O   
56   C CB  . GLU A 9   ? 1.27690 2.03700 1.12520 0.15610  0.11280  0.22580  918  GLU A CB  
57   C CG  . GLU A 9   ? 1.26420 2.08210 1.06240 0.22330  0.13280  0.22320  918  GLU A CG  
58   C CD  . GLU A 9   ? 1.23820 2.07750 1.01710 0.29610  0.14320  0.20800  918  GLU A CD  
59   O OE1 . GLU A 9   ? 1.14990 2.07900 0.96560 0.29510  0.14970  0.21530  918  GLU A OE1 
60   O OE2 . GLU A 9   ? 1.25370 2.01580 0.97790 0.35420  0.14280  0.18840  918  GLU A OE2 
61   N N   . ASN A 10  ? 1.31540 1.83360 1.22550 0.05550  0.06100  0.20210  919  ASN A N   
62   C CA  . ASN A 10  ? 1.23650 1.70880 1.19390 0.00420  0.04080  0.19810  919  ASN A CA  
63   C C   . ASN A 10  ? 1.25020 1.62360 1.19980 0.03410  0.03590  0.17210  919  ASN A C   
64   O O   . ASN A 10  ? 1.24970 1.63630 1.23440 0.02400  0.03290  0.17000  919  ASN A O   
65   C CB  . ASN A 10  ? 1.26490 1.67940 1.23170 -0.05580 0.01810  0.20100  919  ASN A CB  
66   C CG  . ASN A 10  ? 1.26540 1.77570 1.25420 -0.10590 0.01580  0.22960  919  ASN A CG  
67   O OD1 . ASN A 10  ? 1.29310 1.91710 1.30600 -0.10720 0.02860  0.24740  919  ASN A OD1 
68   N ND2 . ASN A 10  ? 1.23510 1.69830 1.21450 -0.14920 -0.00220 0.23420  919  ASN A ND2 
69   N N   . GLN A 11  ? 1.01240 1.29090 0.91560 0.06870  0.03500  0.15370  920  GLN A N   
70   C CA  . GLN A 11  ? 1.05400 1.23280 0.94230 0.09540  0.03000  0.12950  920  GLN A CA  
71   C C   . GLN A 11  ? 1.16000 1.39310 1.04530 0.13920  0.04490  0.13030  920  GLN A C   
72   O O   . GLN A 11  ? 1.20440 1.40150 1.10990 0.13230  0.03910  0.12050  920  GLN A O   
73   C CB  . GLN A 11  ? 1.15380 1.23350 0.98550 0.13060  0.02780  0.11250  920  GLN A CB  
74   C CG  . GLN A 11  ? 1.18140 1.18360 1.01450 0.08990  0.00940  0.10540  920  GLN A CG  
75   C CD  . GLN A 11  ? 1.35400 1.24530 1.13580 0.12190  0.00420  0.08520  920  GLN A CD  
76   O OE1 . GLN A 11  ? 1.32040 1.19320 1.05830 0.17680  0.01430  0.07840  920  GLN A OE1 
77   N NE2 . GLN A 11  ? 1.48840 1.30200 1.27360 0.08790  -0.01410 0.07450  920  GLN A NE2 
78   N N   . LYS A 12  ? 1.03150 1.34880 0.89090 0.18340  0.06260  0.14060  921  LYS A N   
79   C CA  . LYS A 12  ? 0.98860 1.36530 0.83950 0.23230  0.07590  0.14050  921  LYS A CA  
80   C C   . LYS A 12  ? 0.90360 1.35800 0.81460 0.19640  0.07550  0.15250  921  LYS A C   
81   O O   . LYS A 12  ? 0.94280 1.38540 0.85670 0.21740  0.07630  0.14450  921  LYS A O   
82   C CB  . LYS A 12  ? 1.08050 1.55260 0.89910 0.28120  0.09370  0.14970  921  LYS A CB  
83   C CG  . LYS A 12  ? 1.12880 1.53150 0.87710 0.34080  0.09580  0.13450  921  LYS A CG  
84   C CD  . LYS A 12  ? 1.08080 1.58950 0.79880 0.39900  0.11330  0.14020  921  LYS A CD  
85   C CE  . LYS A 12  ? 1.31590 1.75400 0.95930 0.46560  0.11290  0.12320  921  LYS A CE  
86   N NZ  . LYS A 12  ? 1.39440 1.94050 1.01140 0.50810  0.12890  0.13070  921  LYS A NZ  
87   N N   . LEU A 13  ? 0.97220 1.49990 0.92590 0.14400  0.07310  0.17160  922  LEU A N   
88   C CA  . LEU A 13  ? 0.88370 1.48250 0.89630 0.10280  0.06910  0.18430  922  LEU A CA  
89   C C   . LEU A 13  ? 0.83400 1.33670 0.86970 0.07500  0.05200  0.16900  922  LEU A C   
90   O O   . LEU A 13  ? 0.91870 1.44220 0.97480 0.08340  0.05360  0.16670  922  LEU A O   
91   C CB  . LEU A 13  ? 0.91280 1.58500 0.95740 0.04620  0.06450  0.20710  922  LEU A CB  
92   C CG  . LEU A 13  ? 1.10900 1.91320 1.14550 0.06410  0.08360  0.22690  922  LEU A CG  
93   C CD1 . LEU A 13  ? 1.18450 2.05270 1.25110 -0.00120 0.07640  0.25120  922  LEU A CD1 
94   C CD2 . LEU A 13  ? 1.04410 1.94690 1.09500 0.10110  0.09810  0.23020  922  LEU A CD2 
95   N N   . ILE A 14  ? 0.77190 1.17630 0.80390 0.04440  0.03610  0.15800  923  ILE A N   
96   C CA  . ILE A 14  ? 0.83610 1.15180 0.89180 0.01460  0.01870  0.14130  923  ILE A CA  
97   C C   . ILE A 14  ? 0.86210 1.13170 0.89410 0.05930  0.02610  0.12550  923  ILE A C   
98   O O   . ILE A 14  ? 0.80160 1.07630 0.86450 0.04590  0.02210  0.12250  923  ILE A O   
99   C CB  . ILE A 14  ? 0.84650 1.06240 0.89170 -0.01340 0.00170  0.12810  923  ILE A CB  
100  C CG1 . ILE A 14  ? 0.72130 0.97400 0.79300 -0.06640 -0.01150 0.14340  923  ILE A CG1 
101  C CG2 . ILE A 14  ? 0.79750 0.91940 0.85630 -0.02890 -0.01250 0.10540  923  ILE A CG2 
102  C CD1 . ILE A 14  ? 0.69820 0.86870 0.74570 -0.08170 -0.02490 0.13380  923  ILE A CD1 
103  N N   . ALA A 15  ? 0.74610 0.97320 0.72220 0.11090  0.03540  0.11650  924  ALA A N   
104  C CA  . ALA A 15  ? 0.89600 1.05720 0.83460 0.15470  0.03890  0.10050  924  ALA A CA  
105  C C   . ALA A 15  ? 0.96720 1.20680 0.91640 0.18050  0.04940  0.10830  924  ALA A C   
106  O O   . ALA A 15  ? 1.06210 1.25620 1.01190 0.18380  0.04580  0.09820  924  ALA A O   
107  C CB  . ALA A 15  ? 0.87320 0.98210 0.74620 0.20510  0.04410  0.09220  924  ALA A CB  
108  N N   . ASN A 16  ? 0.85250 1.20640 0.80800 0.19840  0.06170  0.12510  925  ASN A N   
109  C CA  . ASN A 16  ? 0.81760 1.26140 0.78550 0.22520  0.07150  0.13270  925  ASN A CA  
110  C C   . ASN A 16  ? 0.71120 1.17920 0.73980 0.17490  0.06300  0.13810  925  ASN A C   
111  O O   . ASN A 16  ? 0.69010 1.13200 0.71720 0.18910  0.06190  0.12990  925  ASN A O   
112  C CB  . ASN A 16  ? 0.70190 1.27220 0.66820 0.25020  0.08610  0.14880  925  ASN A CB  
113  C CG  . ASN A 16  ? 0.89020 1.44060 0.79050 0.31410  0.09460  0.14010  925  ASN A CG  
114  O OD1 . ASN A 16  ? 0.99960 1.44550 0.85100 0.34850  0.08960  0.12260  925  ASN A OD1 
115  N ND2 . ASN A 16  ? 0.83090 1.48200 0.72740 0.32950  0.10670  0.15250  925  ASN A ND2 
116  N N   . GLN A 17  ? 0.63350 1.14180 0.70850 0.11870  0.05540  0.15070  926  GLN A N   
117  C CA  . GLN A 17  ? 0.60580 1.13420 0.73880 0.06630  0.04310  0.15590  926  GLN A CA  
118  C C   . GLN A 17  ? 0.65590 1.07870 0.78760 0.05890  0.03270  0.13570  926  GLN A C   
119  O O   . GLN A 17  ? 0.60130 1.04320 0.75830 0.05380  0.03090  0.13520  926  GLN A O   
120  C CB  . GLN A 17  ? 0.61000 1.15380 0.77580 0.00740  0.03000  0.16710  926  GLN A CB  
121  C CG  . GLN A 17  ? 0.46040 1.12140 0.63670 -0.00030 0.03860  0.19110  926  GLN A CG  
122  C CD  . GLN A 17  ? 0.44750 1.22180 0.64490 0.01910  0.05050  0.20370  926  GLN A CD  
123  O OE1 . GLN A 17  ? 0.56440 1.37190 0.73150 0.07580  0.06670  0.20020  926  GLN A OE1 
124  N NE2 . GLN A 17  ? 0.40790 1.24140 0.65600 -0.02680 0.04030  0.21740  926  GLN A NE2 
125  N N   . PHE A 18  ? 0.65150 0.96990 0.75490 0.05700  0.02610  0.11980  927  PHE A N   
126  C CA  . PHE A 18  ? 0.71420 0.92970 0.81280 0.04750  0.01680  0.09910  927  PHE A CA  
127  C C   . PHE A 18  ? 0.66470 0.86560 0.73270 0.09180  0.02660  0.09320  927  PHE A C   
128  O O   . PHE A 18  ? 0.75590 0.95560 0.84910 0.07680  0.02270  0.08970  927  PHE A O   
129  C CB  . PHE A 18  ? 0.71460 0.83130 0.78180 0.04440  0.00990  0.08420  927  PHE A CB  
130  C CG  . PHE A 18  ? 0.68250 0.69920 0.74480 0.03150  0.00070  0.06270  927  PHE A CG  
131  C CD1 . PHE A 18  ? 0.60100 0.61140 0.71160 -0.01430 -0.01240 0.05610  927  PHE A CD1 
132  C CD2 . PHE A 18  ? 0.88250 0.81410 0.89040 0.06500  0.00440  0.04900  927  PHE A CD2 
133  C CE1 . PHE A 18  ? 0.72110 0.64950 0.82860 -0.02680 -0.01950 0.03560  927  PHE A CE1 
134  C CE2 . PHE A 18  ? 0.85180 0.69690 0.85540 0.04870  -0.00350 0.03030  927  PHE A CE2 
135  C CZ  . PHE A 18  ? 0.70820 0.55550 0.76310 0.00250  -0.01440 0.02320  927  PHE A CZ  
136  N N   . ASN A 19  ? 0.67090 0.86250 0.68380 0.14610  0.03740  0.09220  928  ASN A N   
137  C CA  . ASN A 19  ? 0.68140 0.84580 0.64980 0.19580  0.04380  0.08540  928  ASN A CA  
138  C C   . ASN A 19  ? 0.64780 0.90380 0.64890 0.20010  0.04870  0.09620  928  ASN A C   
139  O O   . ASN A 19  ? 0.72220 0.94320 0.70970 0.21320  0.04770  0.08900  928  ASN A O   
140  C CB  . ASN A 19  ? 0.79360 0.94650 0.69730 0.25600  0.05170  0.08350  928  ASN A CB  
141  C CG  . ASN A 19  ? 0.88070 0.92460 0.74120 0.25940  0.04530  0.07020  928  ASN A CG  
142  O OD1 . ASN A 19  ? 1.01510 0.96790 0.87280 0.23440  0.03610  0.05740  928  ASN A OD1 
143  N ND2 . ASN A 19  ? 0.91040 0.96400 0.73610 0.29060  0.04990  0.07230  928  ASN A ND2 
144  N N   . SER A 20  ? 0.71670 1.08550 0.75780 0.18770  0.05330  0.11320  929  SER A N   
145  C CA  . SER A 20  ? 0.57290 1.03840 0.65540 0.18250  0.05590  0.12490  929  SER A CA  
146  C C   . SER A 20  ? 0.61300 1.04260 0.73800 0.13420  0.04370  0.12010  929  SER A C   
147  O O   . SER A 20  ? 0.70780 1.12370 0.82750 0.14910  0.04410  0.11480  929  SER A O   
148  C CB  . SER A 20  ? 0.53090 1.11970 0.64870 0.16920  0.06130  0.14470  929  SER A CB  
149  O OG  . SER A 20  ? 0.55440 1.15550 0.72390 0.10520  0.04960  0.15270  929  SER A OG  
150  N N   . ALA A 21  ? 0.55180 0.95970 0.71200 0.08130  0.03210  0.11990  930  ALA A N   
151  C CA  . ALA A 21  ? 0.44900 0.83140 0.65360 0.03340  0.01790  0.11420  930  ALA A CA  
152  C C   . ALA A 21  ? 0.65550 0.94690 0.83330 0.04620  0.01740  0.09580  930  ALA A C   
153  O O   . ALA A 21  ? 0.65170 0.95730 0.85190 0.03780  0.01470  0.09480  930  ALA A O   
154  C CB  . ALA A 21  ? 0.40080 0.75270 0.62980 -0.01440 0.00370  0.11160  930  ALA A CB  
155  N N   . ILE A 22  ? 0.56150 0.76220 0.69170 0.06400  0.01910  0.08240  931  ILE A N   
156  C CA  . ILE A 22  ? 0.69880 0.80500 0.79680 0.07160  0.01790  0.06540  931  ILE A CA  
157  C C   . ILE A 22  ? 0.78900 0.91700 0.86250 0.11040  0.02610  0.06920  931  ILE A C   
158  O O   . ILE A 22  ? 0.80090 0.89970 0.88130 0.09750  0.02290  0.06240  931  ILE A O   
159  C CB  . ILE A 22  ? 0.75400 0.76560 0.79750 0.08950  0.01830  0.05320  931  ILE A CB  
160  C CG1 . ILE A 22  ? 0.76980 0.74360 0.83960 0.04590  0.00700  0.04440  931  ILE A CG1 
161  C CG2 . ILE A 22  ? 0.72680 0.65140 0.72210 0.10850  0.01930  0.04060  931  ILE A CG2 
162  C CD1 . ILE A 22  ? 0.98970 0.86980 1.01000 0.05960  0.00570  0.03160  931  ILE A CD1 
163  N N   . GLY A 23  ? 0.75610 0.93300 0.79990 0.15760  0.03550  0.07850  932  GLY A N   
164  C CA  . GLY A 23  ? 0.61060 0.81840 0.62940 0.20090  0.04170  0.08180  932  GLY A CA  
165  C C   . GLY A 23  ? 0.58630 0.85340 0.65820 0.17430  0.03870  0.08780  932  GLY A C   
166  O O   . GLY A 23  ? 0.65400 0.87830 0.70810 0.18150  0.03720  0.08100  932  GLY A O   
167  N N   . LYS A 24  ? 0.60480 0.96150 0.73720 0.14180  0.03630  0.10040  933  LYS A N   
168  C CA  . LYS A 24  ? 0.53230 0.95280 0.72100 0.11200  0.03050  0.10770  933  LYS A CA  
169  C C   . LYS A 24  ? 0.59950 0.94510 0.80260 0.07550  0.02070  0.09420  933  LYS A C   
170  O O   . LYS A 24  ? 0.59370 0.95260 0.81000 0.07420  0.01890  0.09370  933  LYS A O   
171  C CB  . LYS A 24  ? 0.45100 0.95940 0.69790 0.07310  0.02480  0.12270  933  LYS A CB  
172  C CG  . LYS A 24  ? 0.50950 1.09930 0.75260 0.09200  0.03350  0.13720  933  LYS A CG  
173  C CD  . LYS A 24  ? 0.69880 1.33850 0.90510 0.15310  0.04720  0.14030  933  LYS A CD  
174  C CE  . LYS A 24  ? 0.71060 1.47830 0.94220 0.15760  0.05410  0.15850  933  LYS A CE  
175  N NZ  . LYS A 24  ? 0.59620 1.39590 0.86810 0.10350  0.04710  0.17060  933  LYS A NZ  
176  N N   . ILE A 25  ? 0.45250 0.72740 0.65460 0.04670  0.01430  0.08320  934  ILE A N   
177  C CA  . ILE A 25  ? 0.54790 0.75700 0.76620 0.00990  0.00480  0.06770  934  ILE A CA  
178  C C   . ILE A 25  ? 0.65950 0.79940 0.82840 0.03560  0.01110  0.05760  934  ILE A C   
179  O O   . ILE A 25  ? 0.70050 0.83170 0.88720 0.01720  0.00730  0.05190  934  ILE A O   
180  C CB  . ILE A 25  ? 0.44350 0.59600 0.66740 -0.02100 -0.00360 0.05640  934  ILE A CB  
181  C CG1 . ILE A 25  ? 0.40900 0.62330 0.68360 -0.05490 -0.01460 0.06590  934  ILE A CG1 
182  C CG2 . ILE A 25  ? 0.44300 0.52090 0.67010 -0.04850 -0.01060 0.03660  934  ILE A CG2 
183  C CD1 . ILE A 25  ? 0.43570 0.60760 0.70080 -0.06820 -0.01990 0.06010  934  ILE A CD1 
184  N N   . GLN A 26  ? 0.68970 0.78020 0.79570 0.07640  0.01910  0.05560  935  GLN A N   
185  C CA  . GLN A 26  ? 0.65900 0.67320 0.70300 0.10510  0.02300  0.04780  935  GLN A CA  
186  C C   . GLN A 26  ? 0.74110 0.80220 0.78890 0.12340  0.02530  0.05470  935  GLN A C   
187  O O   . GLN A 26  ? 0.82790 0.83450 0.85300 0.11920  0.02430  0.04740  935  GLN A O   
188  C CB  . GLN A 26  ? 0.74210 0.71350 0.71750 0.15370  0.02790  0.04780  935  GLN A CB  
189  C CG  . GLN A 26  ? 0.74600 0.64160 0.69890 0.14130  0.02490  0.03790  935  GLN A CG  
190  C CD  . GLN A 26  ? 0.91980 0.77710 0.80460 0.19200  0.02790  0.03820  935  GLN A CD  
191  O OE1 . GLN A 26  ? 0.94640 0.87030 0.82510 0.22900  0.03310  0.04790  935  GLN A OE1 
192  N NE2 . GLN A 26  ? 1.02190 0.77330 0.85470 0.19390  0.02380  0.02680  935  GLN A NE2 
193  N N   . ASP A 27  ? 0.67770 0.83670 0.75090 0.14290  0.02830  0.06820  936  ASP A N   
194  C CA  . ASP A 27  ? 0.68970 0.91010 0.77560 0.16020  0.02930  0.07550  936  ASP A CA  
195  C C   . ASP A 27  ? 0.58420 0.81810 0.72620 0.11120  0.02180  0.07330  936  ASP A C   
196  O O   . ASP A 27  ? 0.69350 0.90240 0.82230 0.11470  0.02100  0.06910  936  ASP A O   
197  C CB  . ASP A 27  ? 0.67980 1.01020 0.78440 0.18870  0.03400  0.08980  936  ASP A CB  
198  C CG  . ASP A 27  ? 0.78260 1.10750 0.82320 0.25190  0.04080  0.08940  936  ASP A CG  
199  O OD1 . ASP A 27  ? 0.84830 1.11730 0.83380 0.28700  0.04020  0.08250  936  ASP A OD1 
200  O OD2 . ASP A 27  ? 0.77140 1.14800 0.81470 0.26680  0.04560  0.09570  936  ASP A OD2 
201  N N   . SER A 28  ? 0.54120 0.80630 0.73880 0.06760  0.01480  0.07460  937  SER A N   
202  C CA  . SER A 28  ? 0.45230 0.73860 0.70690 0.02210  0.00400  0.07180  937  SER A CA  
203  C C   . SER A 28  ? 0.53720 0.73560 0.77140 0.00530  0.00250  0.05480  937  SER A C   
204  O O   . SER A 28  ? 0.53850 0.74740 0.79230 -0.00770 -0.00130 0.05210  937  SER A O   
205  C CB  . SER A 28  ? 0.40130 0.72020 0.70570 -0.01730 -0.00630 0.07430  937  SER A CB  
206  O OG  . SER A 28  ? 0.44140 0.68260 0.73220 -0.03680 -0.00930 0.05970  937  SER A OG  
207  N N   . LEU A 29  ? 0.61430 0.73200 0.81010 0.00500  0.00540  0.04400  938  LEU A N   
208  C CA  . LEU A 29  ? 0.51100 0.54380 0.68310 -0.01380 0.00500  0.02760  938  LEU A CA  
209  C C   . LEU A 29  ? 0.55400 0.55640 0.67890 0.01290  0.01140  0.02880  938  LEU A C   
210  O O   . LEU A 29  ? 0.86420 0.84630 0.99700 -0.00970 0.00950  0.02080  938  LEU A O   
211  C CB  . LEU A 29  ? 0.66610 0.62170 0.80010 -0.01420 0.00680  0.01800  938  LEU A CB  
212  C CG  . LEU A 29  ? 0.55890 0.52000 0.73580 -0.04940 -0.00210 0.01060  938  LEU A CG  
213  C CD1 . LEU A 29  ? 0.51880 0.40020 0.65310 -0.04580 -0.00030 0.00080  938  LEU A CD1 
214  C CD2 . LEU A 29  ? 0.45590 0.42550 0.68390 -0.09410 -0.01240 -0.00230 938  LEU A CD2 
215  N N   . SER A 30  ? 0.66480 0.66410 0.73990 0.06040  0.01760  0.03750  939  SER A N   
216  C CA  . SER A 30  ? 0.73700 0.70410 0.75870 0.09230  0.02090  0.03910  939  SER A CA  
217  C C   . SER A 30  ? 0.93720 0.97370 1.00120 0.08620  0.01850  0.04480  939  SER A C   
218  O O   . SER A 30  ? 0.94340 0.94040 0.98760 0.07860  0.01830  0.03970  939  SER A O   
219  C CB  . SER A 30  ? 0.86520 0.82220 0.82740 0.14850  0.02450  0.04530  939  SER A CB  
220  O OG  . SER A 30  ? 1.06190 0.95290 0.95610 0.17560  0.02420  0.04300  939  SER A OG  
221  N N   . SER A 31  ? 0.53360 0.66810 0.65220 0.08690  0.01610  0.05530  940  SER A N   
222  C CA  . SER A 31  ? 0.58330 0.78910 0.74720 0.07910  0.01150  0.06140  940  SER A CA  
223  C C   . SER A 31  ? 0.46580 0.65190 0.66640 0.03140  0.00490  0.05110  940  SER A C   
224  O O   . SER A 31  ? 0.49750 0.68670 0.69770 0.03160  0.00350  0.05010  940  SER A O   
225  C CB  . SER A 31  ? 0.41320 0.72490 0.63110 0.07940  0.00830  0.07470  940  SER A CB  
226  O OG  . SER A 31  ? 0.47890 0.82350 0.66500 0.12690  0.01520  0.08320  940  SER A OG  
227  N N   . THR A 32  ? 0.47780 0.64730 0.70850 -0.00610 0.00000  0.04260  941  THR A N   
228  C CA  . THR A 32  ? 0.55910 0.71030 0.82440 -0.05020 -0.00760 0.02880  941  THR A CA  
229  C C   . THR A 32  ? 0.58620 0.66270 0.80140 -0.04830 -0.00070 0.01910  941  THR A C   
230  O O   . THR A 32  ? 0.55380 0.64300 0.78320 -0.05950 -0.00330 0.01600  941  THR A O   
231  C CB  . THR A 32  ? 0.52560 0.65860 0.81740 -0.08260 -0.01420 0.01860  941  THR A CB  
232  O OG1 . THR A 32  ? 0.42060 0.61680 0.74790 -0.08290 -0.02030 0.03030  941  THR A OG1 
233  C CG2 . THR A 32  ? 0.34910 0.47620 0.68140 -0.12450 -0.02470 0.00230  941  THR A CG2 
234  N N   . ALA A 33  ? 0.62390 0.62440 0.77940 -0.03470 0.00690  0.01520  942  ALA A N   
235  C CA  . ALA A 33  ? 0.69110 0.60830 0.78760 -0.03620 0.01280  0.00740  942  ALA A CA  
236  C C   . ALA A 33  ? 0.68400 0.60720 0.75120 -0.01070 0.01510  0.01530  942  ALA A C   
237  O O   . ALA A 33  ? 0.69010 0.57860 0.74120 -0.02900 0.01650  0.00860  942  ALA A O   
238  C CB  . ALA A 33  ? 0.71670 0.55760 0.74940 -0.01770 0.01750  0.00650  942  ALA A CB  
239  N N   . SER A 34  ? 0.72440 0.69200 0.78360 0.03020  0.01520  0.02820  943  SER A N   
240  C CA  . SER A 34  ? 0.79120 0.77590 0.82670 0.06050  0.01510  0.03570  943  SER A CA  
241  C C   . SER A 34  ? 0.67860 0.71770 0.77280 0.03150  0.01000  0.03380  943  SER A C   
242  O O   . SER A 34  ? 0.72790 0.73590 0.79580 0.02920  0.01090  0.03090  943  SER A O   
243  C CB  . SER A 34  ? 0.72530 0.76610 0.75560 0.10740  0.01510  0.04760  943  SER A CB  
244  O OG  . SER A 34  ? 0.80660 0.86160 0.81020 0.14100  0.01370  0.05290  943  SER A OG  
245  N N   . ALA A 35  ? 0.51720 0.63160 0.68500 0.00970  0.00340  0.03540  944  ALA A N   
246  C CA  . ALA A 35  ? 0.54240 0.71690 0.76950 -0.01410 -0.00550 0.03450  944  ALA A CA  
247  C C   . ALA A 35  ? 0.58890 0.71560 0.81630 -0.05050 -0.00580 0.01890  944  ALA A C   
248  O O   . ALA A 35  ? 0.64660 0.78560 0.88170 -0.05640 -0.00840 0.01680  944  ALA A O   
249  C CB  . ALA A 35  ? 0.40560 0.65710 0.70290 -0.03270 -0.01570 0.03930  944  ALA A CB  
250  N N   . LEU A 36  ? 0.62910 0.70580 0.84820 -0.07380 -0.00310 0.00760  945  LEU A N   
251  C CA  . LEU A 36  ? 0.63640 0.67390 0.85710 -0.11040 -0.00240 -0.00930 945  LEU A CA  
252  C C   . LEU A 36  ? 0.76030 0.73440 0.91260 -0.09960 0.00730  -0.00880 945  LEU A C   
253  O O   . LEU A 36  ? 0.66440 0.63910 0.82410 -0.12030 0.00710  -0.01670 945  LEU A O   
254  C CB  . LEU A 36  ? 0.57380 0.57570 0.79930 -0.13400 -0.00220 -0.02120 945  LEU A CB  
255  C CG  . LEU A 36  ? 0.45550 0.51340 0.74890 -0.15270 -0.01510 -0.02490 945  LEU A CG  
256  C CD1 . LEU A 36  ? 0.38460 0.39930 0.64180 -0.15690 -0.01400 -0.03080 945  LEU A CD1 
257  C CD2 . LEU A 36  ? 0.42250 0.50870 0.68820 -0.15750 -0.02360 -0.02700 945  LEU A CD2 
258  N N   . GLY A 37  ? 0.63550 0.55750 0.72100 -0.06690 0.01390  0.00030  946  GLY A N   
259  C CA  . GLY A 37  ? 0.74910 0.60180 0.75760 -0.05170 0.01990  0.00330  946  GLY A CA  
260  C C   . GLY A 37  ? 0.77330 0.66140 0.78540 -0.03730 0.01730  0.00920  946  GLY A C   
261  O O   . GLY A 37  ? 0.76320 0.61380 0.74580 -0.05300 0.02040  0.00480  946  GLY A O   
262  N N   . LYS A 38  ? 0.86220 0.82190 0.90890 -0.00960 0.01160  0.01910  947  LYS A N   
263  C CA  . LYS A 38  ? 0.74720 0.74890 0.80330 0.00670  0.00730  0.02490  947  LYS A CA  
264  C C   . LYS A 38  ? 0.71630 0.75690 0.83050 -0.03280 0.00260  0.01560  947  LYS A C   
265  O O   . LYS A 38  ? 0.86220 0.89190 0.95670 -0.03190 0.00280  0.01490  947  LYS A O   
266  C CB  . LYS A 38  ? 0.70190 0.77860 0.78620 0.04270  0.00190  0.03700  947  LYS A CB  
267  C CG  . LYS A 38  ? 0.75370 0.80020 0.77730 0.08990  0.00530  0.04450  947  LYS A CG  
268  C CD  . LYS A 38  ? 0.77890 0.90690 0.82470 0.12900  0.00040  0.05520  947  LYS A CD  
269  C CE  . LYS A 38  ? 0.72940 0.84880 0.72990 0.17570  0.00290  0.06020  947  LYS A CE  
270  N NZ  . LYS A 38  ? 0.71600 0.94230 0.76680 0.19790  -0.00030 0.06940  947  LYS A NZ  
271  N N   . LEU A 39  ? 0.66710 0.74710 0.84540 -0.06420 -0.00270 0.00770  948  LEU A N   
272  C CA  . LEU A 39  ? 0.59360 0.70960 0.82760 -0.10060 -0.01040 -0.00480 948  LEU A CA  
273  C C   . LEU A 39  ? 0.63720 0.69250 0.83390 -0.12590 -0.00180 -0.01780 948  LEU A C   
274  O O   . LEU A 39  ? 0.54900 0.62150 0.75800 -0.13830 -0.00420 -0.02380 948  LEU A O   
275  C CB  . LEU A 39  ? 0.41280 0.56860 0.71040 -0.12600 -0.02010 -0.01210 948  LEU A CB  
276  C CG  . LEU A 39  ? 0.34010 0.57320 0.69150 -0.11560 -0.03300 -0.00060 948  LEU A CG  
277  C CD1 . LEU A 39  ? 0.27960 0.51490 0.62620 -0.13180 -0.03730 -0.00950 948  LEU A CD1 
278  C CD2 . LEU A 39  ? 0.29530 0.58140 0.67870 -0.11370 -0.04370 0.00230  948  LEU A CD2 
279  N N   . GLN A 40  ? 0.72410 0.71310 0.87680 -0.13460 0.00760  -0.02210 949  GLN A N   
280  C CA  . GLN A 40  ? 0.68400 0.61250 0.79520 -0.16280 0.01700  -0.03320 949  GLN A CA  
281  C C   . GLN A 40  ? 0.73400 0.62930 0.78700 -0.14670 0.02180  -0.02470 949  GLN A C   
282  O O   . GLN A 40  ? 0.71840 0.61920 0.77580 -0.16990 0.02380  -0.03320 949  GLN A O   
283  C CB  . GLN A 40  ? 0.73250 0.59140 0.79930 -0.17070 0.02440  -0.03570 949  GLN A CB  
284  C CG  . GLN A 40  ? 0.86710 0.66240 0.88550 -0.20230 0.03410  -0.04490 949  GLN A CG  
285  C CD  . GLN A 40  ? 0.90420 0.64510 0.89910 -0.22060 0.03840  -0.05160 949  GLN A CD  
286  O OE1 . GLN A 40  ? 0.91560 0.63240 0.89280 -0.19800 0.03670  -0.04420 949  GLN A OE1 
287  N NE2 . GLN A 40  ? 0.87030 0.62950 0.87480 -0.22710 0.03390  -0.05620 949  GLN A NE2 
288  N N   . ASP A 41  ? 0.85770 0.72230 0.85800 -0.10650 0.02250  -0.00960 950  ASP A N   
289  C CA  . ASP A 41  ? 0.97930 0.80060 0.91270 -0.08570 0.02460  -0.00120 950  ASP A CA  
290  C C   . ASP A 41  ? 0.92530 0.80850 0.90190 -0.08900 0.01940  -0.00300 950  ASP A C   
291  O O   . ASP A 41  ? 1.06600 0.92400 1.01790 -0.11020 0.02380  -0.00820 950  ASP A O   
292  C CB  . ASP A 41  ? 1.15800 0.95670 1.04180 -0.03370 0.02130  0.01290  950  ASP A CB  
293  C CG  . ASP A 41  ? 1.32070 1.03870 1.13740 -0.02220 0.02460  0.01570  950  ASP A CG  
294  O OD1 . ASP A 41  ? 1.31450 0.98130 1.11280 -0.05770 0.03040  0.00790  950  ASP A OD1 
295  O OD2 . ASP A 41  ? 1.44610 1.15430 1.22840 0.02350  0.02030  0.02470  950  ASP A OD2 
296  N N   . VAL A 42  ? 0.77190 0.73400 0.81040 -0.07090 0.00970  0.00140  951  VAL A N   
297  C CA  . VAL A 42  ? 0.75730 0.78210 0.83880 -0.06820 0.00120  0.00150  951  VAL A CA  
298  C C   . VAL A 42  ? 0.70980 0.75960 0.83690 -0.11120 -0.00020 -0.01470 951  VAL A C   
299  O O   . VAL A 42  ? 0.69950 0.75700 0.82160 -0.11500 -0.00150 -0.01740 951  VAL A O   
300  C CB  . VAL A 42  ? 0.70350 0.80820 0.84320 -0.04460 -0.01020 0.01030  951  VAL A CB  
301  C CG1 . VAL A 42  ? 0.53550 0.70720 0.72880 -0.04910 -0.02210 0.00890  951  VAL A CG1 
302  C CG2 . VAL A 42  ? 0.73320 0.82240 0.82510 0.00260  -0.00880 0.02430  951  VAL A CG2 
303  N N   . VAL A 43  ? 0.77590 0.83960 0.94510 -0.14030 -0.00120 -0.02650 952  VAL A N   
304  C CA  . VAL A 43  ? 0.71850 0.81000 0.93130 -0.17830 -0.00440 -0.04570 952  VAL A CA  
305  C C   . VAL A 43  ? 0.79610 0.83340 0.95180 -0.19720 0.00900  -0.05200 952  VAL A C   
306  O O   . VAL A 43  ? 0.80290 0.86930 0.97850 -0.21280 0.00660  -0.06220 952  VAL A O   
307  C CB  . VAL A 43  ? 0.63700 0.74200 0.89100 -0.20010 -0.00980 -0.05650 952  VAL A CB  
308  C CG1 . VAL A 43  ? 0.65490 0.75090 0.89320 -0.19960 -0.01880 -0.05490 952  VAL A CG1 
309  C CG2 . VAL A 43  ? 0.52720 0.68180 0.81370 -0.17900 -0.02800 -0.04180 952  VAL A CG2 
310  N N   . ASN A 44  ? 0.83080 0.79200 0.91600 -0.19600 0.02130  -0.04570 953  ASN A N   
311  C CA  . ASN A 44  ? 0.86460 0.76290 0.88530 -0.22020 0.03440  -0.04950 953  ASN A CA  
312  C C   . ASN A 44  ? 0.93080 0.80950 0.90280 -0.20090 0.03530  -0.03880 953  ASN A C   
313  O O   . ASN A 44  ? 0.97720 0.85320 0.93560 -0.22540 0.04100  -0.04630 953  ASN A O   
314  C CB  . ASN A 44  ? 0.81530 0.63510 0.77640 -0.22670 0.04330  -0.04550 953  ASN A CB  
315  C CG  . ASN A 44  ? 0.80280 0.63680 0.80710 -0.25650 0.04430  -0.06070 953  ASN A CG  
316  O OD1 . ASN A 44  ? 0.72680 0.62410 0.78860 -0.25780 0.03580  -0.06990 953  ASN A OD1 
317  N ND2 . ASN A 44  ? 0.83710 0.62230 0.81160 -0.24950 0.04630  -0.05540 953  ASN A ND2 
318  N N   . GLN A 45  ? 0.92980 0.79910 0.87680 -0.15790 0.02940  -0.02290 954  GLN A N   
319  C CA  . GLN A 45  ? 0.99350 0.85190 0.90110 -0.13300 0.02650  -0.01340 954  GLN A CA  
320  C C   . GLN A 45  ? 0.93630 0.86770 0.90520 -0.14410 0.02010  -0.02240 954  GLN A C   
321  O O   . GLN A 45  ? 1.07840 0.99050 1.01140 -0.14980 0.02340  -0.02270 954  GLN A O   
322  C CB  . GLN A 45  ? 1.09540 0.96360 0.99410 -0.08180 0.01740  0.00110  954  GLN A CB  
323  C CG  . GLN A 45  ? 1.18430 0.97390 1.00500 -0.05600 0.02020  0.01130  954  GLN A CG  
324  C CD  . GLN A 45  ? 1.26870 1.07540 1.07650 -0.00200 0.01070  0.02290  954  GLN A CD  
325  O OE1 . GLN A 45  ? 1.37790 1.21710 1.19460 0.01600  0.00420  0.02580  954  GLN A OE1 
326  N NE2 . GLN A 45  ? 1.21280 1.00200 1.00070 0.02590  0.00920  0.02850  954  GLN A NE2 
327  N N   . ASN A 46  ? 0.84370 0.85300 0.89780 -0.14500 0.00940  -0.02850 955  ASN A N   
328  C CA  . ASN A 46  ? 0.76560 0.84710 0.88250 -0.15120 -0.00210 -0.03720 955  ASN A CA  
329  C C   . ASN A 46  ? 0.65990 0.74530 0.78730 -0.19240 0.00420  -0.05630 955  ASN A C   
330  O O   . ASN A 46  ? 0.64500 0.76150 0.78710 -0.19680 -0.00030 -0.06300 955  ASN A O   
331  C CB  . ASN A 46  ? 0.72830 0.88310 0.92580 -0.14280 -0.01830 -0.03730 955  ASN A CB  
332  C CG  . ASN A 46  ? 0.81290 0.98610 1.00800 -0.10180 -0.02580 -0.01920 955  ASN A CG  
333  O OD1 . ASN A 46  ? 0.86650 0.99550 0.99870 -0.07510 -0.01970 -0.00800 955  ASN A OD1 
334  N ND2 . ASN A 46  ? 0.73290 0.97240 0.99470 -0.09690 -0.04030 -0.01670 955  ASN A ND2 
335  N N   . ALA A 47  ? 0.74890 0.80620 0.86820 -0.22040 0.01400  -0.06540 956  ALA A N   
336  C CA  . ALA A 47  ? 0.63150 0.69510 0.75770 -0.26110 0.02190  -0.08520 956  ALA A CA  
337  C C   . ALA A 47  ? 0.79990 0.81270 0.85120 -0.26960 0.03540  -0.08000 956  ALA A C   
338  O O   . ALA A 47  ? 0.79850 0.84280 0.86170 -0.28720 0.03680  -0.09210 956  ALA A O   
339  C CB  . ALA A 47  ? 0.60300 0.64300 0.72790 -0.26630 0.02530  -0.08710 956  ALA A CB  
340  N N   . GLN A 48  ? 0.90840 0.84400 0.88180 -0.25590 0.04330  -0.06260 957  GLN A N   
341  C CA  . GLN A 48  ? 1.08560 0.95760 0.97420 -0.26510 0.05440  -0.05510 957  GLN A CA  
342  C C   . GLN A 48  ? 1.07840 0.97920 0.96970 -0.24190 0.04670  -0.05080 957  GLN A C   
343  O O   . GLN A 48  ? 1.07390 0.97970 0.94860 -0.26430 0.05320  -0.05790 957  GLN A O   
344  C CB  . GLN A 48  ? 1.18760 0.96430 0.98940 -0.25100 0.05900  -0.03770 957  GLN A CB  
345  C CG  . GLN A 48  ? 1.33090 1.02960 1.03930 -0.27510 0.07040  -0.03190 957  GLN A CG  
346  C CD  . GLN A 48  ? 1.42310 1.03440 1.03950 -0.24100 0.06580  -0.01200 957  GLN A CD  
347  O OE1 . GLN A 48  ? 1.31840 0.88940 0.87300 -0.23850 0.06660  -0.00460 957  GLN A OE1 
348  N NE2 . GLN A 48  ? 1.47160 1.05210 1.07540 -0.21260 0.05980  -0.00420 957  GLN A NE2 
349  N N   . ALA A 49  ? 0.96430 0.88880 0.87820 -0.19980 0.03320  -0.04040 958  ALA A N   
350  C CA  . ALA A 49  ? 0.89210 0.84570 0.81190 -0.17310 0.02320  -0.03560 958  ALA A CA  
351  C C   . ALA A 49  ? 0.84350 0.86180 0.81750 -0.19740 0.02060  -0.05300 958  ALA A C   
352  O O   . ALA A 49  ? 0.81330 0.82270 0.75470 -0.19750 0.02250  -0.05260 958  ALA A O   
353  C CB  . ALA A 49  ? 0.92020 0.91480 0.88250 -0.13250 0.00800  -0.02630 958  ALA A CB  
354  N N   . LEU A 50  ? 1.00630 1.08480 1.05650 -0.21600 0.01500  -0.06880 959  LEU A N   
355  C CA  . LEU A 50  ? 0.77340 0.91680 0.87900 -0.23760 0.00940  -0.08970 959  LEU A CA  
356  C C   . LEU A 50  ? 0.70720 0.82360 0.76600 -0.27360 0.02770  -0.09970 959  LEU A C   
357  O O   . LEU A 50  ? 0.71920 0.86290 0.77890 -0.27830 0.02680  -0.10770 959  LEU A O   
358  C CB  . LEU A 50  ? 0.56960 0.76920 0.75580 -0.24870 -0.00220 -0.10480 959  LEU A CB  
359  C CG  . LEU A 50  ? 0.52980 0.76530 0.75140 -0.23590 -0.01390 -0.11250 959  LEU A CG  
360  C CD1 . LEU A 50  ? 0.59930 0.87260 0.83400 -0.22880 -0.02380 -0.11700 959  LEU A CD1 
361  C CD2 . LEU A 50  ? 0.47240 0.71140 0.73070 -0.20610 -0.03300 -0.09970 959  LEU A CD2 
362  N N   . ASN A 51  ? 0.75450 0.81930 0.77100 -0.29860 0.04350  -0.09860 960  ASN A N   
363  C CA  . ASN A 51  ? 0.75210 0.79390 0.72410 -0.34040 0.06210  -0.10770 960  ASN A CA  
364  C C   . ASN A 51  ? 0.95190 0.93690 0.83910 -0.33710 0.07060  -0.09260 960  ASN A C   
365  O O   . ASN A 51  ? 0.90560 0.90640 0.77680 -0.36420 0.08030  -0.10250 960  ASN A O   
366  C CB  . ASN A 51  ? 0.76530 0.76260 0.71220 -0.36760 0.07420  -0.10830 960  ASN A CB  
367  C CG  . ASN A 51  ? 0.82110 0.87130 0.84110 -0.33730 0.06140  -0.11500 960  ASN A CG  
368  O OD1 . ASN A 51  ? 0.70730 0.81200 0.77150 -0.32270 0.05360  -0.12510 960  ASN A OD1 
369  N ND2 . ASN A 51  ? 0.88250 0.90600 0.90650 -0.32700 0.05830  -0.10740 960  ASN A ND2 
370  N N   . THR A 52  ? 0.82980 0.75300 0.66340 -0.30420 0.06630  -0.07070 961  THR A N   
371  C CA  . THR A 52  ? 0.90870 0.77280 0.65970 -0.29120 0.06880  -0.05540 961  THR A CA  
372  C C   . THR A 52  ? 0.99240 0.91640 0.78020 -0.27360 0.05890  -0.06130 961  THR A C   
373  O O   . THR A 52  ? 1.10630 1.00890 0.84300 -0.28460 0.06570  -0.05970 961  THR A O   
374  C CB  . THR A 52  ? 0.96760 0.76350 0.66540 -0.25080 0.06120  -0.03440 961  THR A CB  
375  O OG1 . THR A 52  ? 1.08110 0.81570 0.73810 -0.26740 0.06920  -0.02940 961  THR A OG1 
376  C CG2 . THR A 52  ? 1.04810 0.78220 0.66180 -0.23140 0.05940  -0.02010 961  THR A CG2 
377  N N   . LEU A 53  ? 0.83830 0.83060 0.70710 -0.24680 0.04210  -0.06670 962  LEU A N   
378  C CA  . LEU A 53  ? 0.85630 0.91020 0.76840 -0.23070 0.02920  -0.07400 962  LEU A CA  
379  C C   . LEU A 53  ? 0.85220 0.94940 0.78390 -0.26840 0.03780  -0.09520 962  LEU A C   
380  O O   . LEU A 53  ? 0.90340 0.99220 0.79540 -0.27230 0.04260  -0.09520 962  LEU A O   
381  C CB  . LEU A 53  ? 0.68940 0.80790 0.68690 -0.20320 0.00820  -0.07620 962  LEU A CB  
382  C CG  . LEU A 53  ? 0.73030 0.91480 0.78000 -0.18780 -0.00940 -0.08480 962  LEU A CG  
383  C CD1 . LEU A 53  ? 0.88210 1.03370 0.87560 -0.16290 -0.01110 -0.07200 962  LEU A CD1 
384  C CD2 . LEU A 53  ? 0.68960 0.93110 0.81830 -0.16630 -0.03130 -0.08460 962  LEU A CD2 
385  N N   . VAL A 54  ? 0.85300 0.99210 0.83750 -0.29520 0.04040  -0.11320 963  VAL A N   
386  C CA  . VAL A 54  ? 0.83940 1.03620 0.85430 -0.32750 0.04610  -0.13830 963  VAL A CA  
387  C C   . VAL A 54  ? 0.92130 1.07460 0.85470 -0.35710 0.06800  -0.13460 963  VAL A C   
388  O O   . VAL A 54  ? 0.93360 1.13050 0.87360 -0.36800 0.07030  -0.14840 963  VAL A O   
389  C CB  . VAL A 54  ? 0.75680 0.98650 0.82460 -0.34170 0.04610  -0.15380 963  VAL A CB  
390  C CG1 . VAL A 54  ? 0.64990 0.90160 0.70980 -0.35260 0.05790  -0.16650 963  VAL A CG1 
391  C CG2 . VAL A 54  ? 0.84130 1.10960 0.98170 -0.29590 0.02080  -0.15240 963  VAL A CG2 
392  N N   . LYS A 55  ? 0.98810 1.05840 0.84470 -0.37110 0.08270  -0.11700 964  LYS A N   
393  C CA  . LYS A 55  ? 1.07030 1.09270 0.84290 -0.40710 0.10310  -0.11190 964  LYS A CA  
394  C C   . LYS A 55  ? 1.12380 1.11930 0.84490 -0.38470 0.09940  -0.09930 964  LYS A C   
395  O O   . LYS A 55  ? 1.18950 1.20350 0.88620 -0.40810 0.10970  -0.10670 964  LYS A O   
396  C CB  . LYS A 55  ? 1.24140 1.17540 0.94340 -0.42850 0.11540  -0.09620 964  LYS A CB  
397  C CG  . LYS A 55  ? 1.31460 1.27710 1.05480 -0.46550 0.12460  -0.11210 964  LYS A CG  
398  C CD  . LYS A 55  ? 1.39950 1.27420 1.07540 -0.48410 0.13320  -0.09680 964  LYS A CD  
399  C CE  . LYS A 55  ? 1.25760 1.16910 0.99340 -0.47730 0.12940  -0.10870 964  LYS A CE  
400  N NZ  . LYS A 55  ? 1.17160 1.00910 0.87590 -0.46780 0.12600  -0.09300 964  LYS A NZ  
401  N N   . GLN A 56  ? 1.02310 0.98250 0.73110 -0.33990 0.08470  -0.08240 965  GLN A N   
402  C CA  . GLN A 56  ? 1.06710 0.99400 0.72240 -0.31400 0.07880  -0.06990 965  GLN A CA  
403  C C   . GLN A 56  ? 1.09210 1.10570 0.81520 -0.29810 0.06670  -0.08570 965  GLN A C   
404  O O   . GLN A 56  ? 1.13550 1.13330 0.81690 -0.28640 0.06490  -0.08030 965  GLN A O   
405  C CB  . GLN A 56  ? 1.11880 0.98510 0.74030 -0.26900 0.06570  -0.04920 965  GLN A CB  
406  C CG  . GLN A 56  ? 1.37960 1.18020 0.91340 -0.25140 0.06370  -0.03420 965  GLN A CG  
407  C CD  . GLN A 56  ? 1.48460 1.21470 0.96830 -0.20790 0.05150  -0.01510 965  GLN A CD  
408  O OE1 . GLN A 56  ? 1.45120 1.18780 0.96990 -0.18680 0.04430  -0.01220 965  GLN A OE1 
409  N NE2 . GLN A 56  ? 1.51950 1.18300 0.91840 -0.19250 0.04840  -0.00290 965  GLN A NE2 
410  N N   . LEU A 57  ? 1.09740 1.19420 0.91720 -0.29660 0.05650  -0.10460 966  LEU A N   
411  C CA  . LEU A 57  ? 0.75310 0.93430 0.64080 -0.28450 0.04190  -0.12320 966  LEU A CA  
412  C C   . LEU A 57  ? 0.74930 0.96750 0.62850 -0.32250 0.05730  -0.14250 966  LEU A C   
413  O O   . LEU A 57  ? 0.83670 1.08030 0.70960 -0.31380 0.05320  -0.14810 966  LEU A O   
414  C CB  . LEU A 57  ? 0.64670 0.89340 0.63210 -0.27150 0.02300  -0.13620 966  LEU A CB  
415  C CG  . LEU A 57  ? 0.68730 0.92550 0.69810 -0.23020 0.00320  -0.12010 966  LEU A CG  
416  C CD1 . LEU A 57  ? 0.60560 0.90570 0.70750 -0.22650 -0.01430 -0.13280 966  LEU A CD1 
417  C CD2 . LEU A 57  ? 0.67750 0.92270 0.68110 -0.19680 -0.01170 -0.11300 966  LEU A CD2 
418  N N   . SER A 58  ? 0.80790 1.03110 0.68550 -0.36290 0.07440  -0.15260 967  SER A N   
419  C CA  . SER A 58  ? 0.85380 1.11190 0.71460 -0.40520 0.09350  -0.17000 967  SER A CA  
420  C C   . SER A 58  ? 0.99230 1.18900 0.75450 -0.41750 0.10870  -0.15270 967  SER A C   
421  O O   . SER A 58  ? 1.02580 1.26510 0.78000 -0.43230 0.11600  -0.16550 967  SER A O   
422  C CB  . SER A 58  ? 0.81280 1.07580 0.68010 -0.44680 0.10950  -0.17970 967  SER A CB  
423  O OG  . SER A 58  ? 0.80500 1.12610 0.76100 -0.43540 0.09480  -0.19790 967  SER A OG  
424  N N   . SER A 59  ? 0.92990 1.02880 0.61620 -0.41090 0.11220  -0.12540 968  SER A N   
425  C CA  . SER A 59  ? 1.08470 1.10750 0.66630 -0.41900 0.12250  -0.10610 968  SER A CA  
426  C C   . SER A 59  ? 1.02260 1.06890 0.61080 -0.38240 0.10820  -0.10680 968  SER A C   
427  O O   . SER A 59  ? 1.05420 1.10840 0.60160 -0.40080 0.11850  -0.11030 968  SER A O   
428  C CB  . SER A 59  ? 1.24340 1.15620 0.74890 -0.40950 0.12190  -0.07930 968  SER A CB  
429  O OG  . SER A 59  ? 1.33060 1.16400 0.73430 -0.40850 0.12520  -0.06060 968  SER A OG  
430  N N   . ASN A 60  ? 0.93460 0.99500 0.57320 -0.33380 0.08510  -0.10390 969  ASN A N   
431  C CA  . ASN A 60  ? 0.91930 1.00220 0.57110 -0.29450 0.06730  -0.10400 969  ASN A CA  
432  C C   . ASN A 60  ? 0.86980 1.04640 0.57670 -0.30580 0.06630  -0.13030 969  ASN A C   
433  O O   . ASN A 60  ? 0.91170 1.08460 0.57620 -0.30490 0.06940  -0.13010 969  ASN A O   
434  C CB  . ASN A 60  ? 0.86530 0.95460 0.56890 -0.24590 0.04280  -0.09660 969  ASN A CB  
435  C CG  . ASN A 60  ? 0.93040 0.92640 0.56390 -0.22320 0.04100  -0.07100 969  ASN A CG  
436  O OD1 . ASN A 60  ? 1.01970 0.93650 0.56200 -0.24370 0.05610  -0.05810 969  ASN A OD1 
437  N ND2 . ASN A 60  ? 0.89070 0.89530 0.56330 -0.18070 0.02120  -0.06390 969  ASN A ND2 
438  N N   . PHE A 61  ? 0.78390 1.03960 0.57700 -0.31480 0.06120  -0.15310 970  PHE A N   
439  C CA  . PHE A 61  ? 0.73510 1.08300 0.58390 -0.31900 0.05560  -0.18150 970  PHE A CA  
440  C C   . PHE A 61  ? 0.79680 1.14890 0.58690 -0.35970 0.08140  -0.18820 970  PHE A C   
441  O O   . PHE A 61  ? 0.79620 1.19310 0.58940 -0.35350 0.07830  -0.20120 970  PHE A O   
442  C CB  . PHE A 61  ? 0.65030 1.07180 0.59090 -0.32520 0.04580  -0.20580 970  PHE A CB  
443  C CG  . PHE A 61  ? 0.58110 1.01900 0.59080 -0.28680 0.01650  -0.20390 970  PHE A CG  
444  C CD1 . PHE A 61  ? 0.56280 1.01150 0.59040 -0.24780 -0.00710 -0.19970 970  PHE A CD1 
445  C CD2 . PHE A 61  ? 0.53670 0.98020 0.59240 -0.29210 0.01210  -0.20610 970  PHE A CD2 
446  C CE1 . PHE A 61  ? 0.52250 0.98880 0.61230 -0.21730 -0.03410 -0.19650 970  PHE A CE1 
447  C CE2 . PHE A 61  ? 0.47760 0.93700 0.59340 -0.26070 -0.01440 -0.20280 970  PHE A CE2 
448  C CZ  . PHE A 61  ? 0.46120 0.93320 0.59400 -0.22490 -0.03740 -0.19760 970  PHE A CZ  
449  N N   . GLY A 62  ? 0.85470 1.16400 0.59340 -0.40130 0.10550  -0.17980 971  GLY A N   
450  C CA  . GLY A 62  ? 0.94370 1.24690 0.61380 -0.44670 0.13210  -0.18080 971  GLY A CA  
451  C C   . GLY A 62  ? 0.99640 1.25200 0.59230 -0.43240 0.13220  -0.16480 971  GLY A C   
452  O O   . GLY A 62  ? 1.00370 1.31190 0.59620 -0.44130 0.13800  -0.17930 971  GLY A O   
453  N N   . ALA A 63  ? 1.03790 1.19990 0.57880 -0.40720 0.12390  -0.13750 972  ALA A N   
454  C CA  . ALA A 63  ? 1.11420 1.21000 0.57350 -0.38880 0.12090  -0.11870 972  ALA A CA  
455  C C   . ALA A 63  ? 1.07890 1.23870 0.58720 -0.35040 0.10210  -0.13290 972  ALA A C   
456  O O   . ALA A 63  ? 1.13560 1.27830 0.58580 -0.35150 0.10670  -0.12900 972  ALA A O   
457  C CB  . ALA A 63  ? 1.15650 1.15210 0.56690 -0.36030 0.11000  -0.09190 972  ALA A CB  
458  N N   . ILE A 64  ? 0.96720 1.19360 0.57460 -0.31880 0.08030  -0.14820 973  ILE A N   
459  C CA  . ILE A 64  ? 0.99190 1.28060 0.65380 -0.28100 0.05730  -0.16290 973  ILE A CA  
460  C C   . ILE A 64  ? 0.92630 1.29540 0.60490 -0.30620 0.06820  -0.18950 973  ILE A C   
461  O O   . ILE A 64  ? 0.97230 1.34200 0.61090 -0.29880 0.06880  -0.19010 973  ILE A O   
462  C CB  . ILE A 64  ? 0.82000 1.15140 0.57850 -0.24630 0.02970  -0.17020 973  ILE A CB  
463  C CG1 . ILE A 64  ? 0.84410 1.10440 0.58140 -0.21380 0.01730  -0.14400 973  ILE A CG1 
464  C CG2 . ILE A 64  ? 0.78000 1.18910 0.60470 -0.21820 0.00540  -0.19150 973  ILE A CG2 
465  C CD1 . ILE A 64  ? 0.82960 1.12430 0.65230 -0.19240 -0.00320 -0.14700 973  ILE A CD1 
466  N N   . SER A 65  ? 0.88510 1.31940 0.61690 -0.33440 0.07680  -0.21130 974  SER A N   
467  C CA  . SER A 65  ? 0.86900 1.39390 0.62570 -0.35710 0.08650  -0.24140 974  SER A CA  
468  C C   . SER A 65  ? 1.01680 1.51520 0.68000 -0.39060 0.11380  -0.23290 974  SER A C   
469  O O   . SER A 65  ? 1.02220 1.58430 0.69100 -0.39000 0.11510  -0.25230 974  SER A O   
470  C CB  . SER A 65  ? 0.82010 1.40370 0.63380 -0.38610 0.09450  -0.26280 974  SER A CB  
471  O OG  . SER A 65  ? 0.98620 1.50770 0.74930 -0.42440 0.11780  -0.24410 974  SER A OG  
472  N N   . SER A 66  ? 1.05970 1.46690 0.63750 -0.41910 0.13340  -0.20530 975  SER A N   
473  C CA  . SER A 66  ? 1.13650 1.49650 0.60950 -0.45380 0.15750  -0.19060 975  SER A CA  
474  C C   . SER A 66  ? 1.24740 1.58400 0.68580 -0.41590 0.14320  -0.18330 975  SER A C   
475  O O   . SER A 66  ? 1.19450 1.57270 0.60750 -0.42900 0.15360  -0.19430 975  SER A O   
476  C CB  . SER A 66  ? 1.21850 1.46920 0.60640 -0.48380 0.17260  -0.16040 975  SER A CB  
477  O OG  . SER A 66  ? 1.32800 1.50940 0.60510 -0.50600 0.18700  -0.14060 975  SER A OG  
478  N N   . VAL A 67  ? 1.23880 1.51510 0.67800 -0.36990 0.11990  -0.16630 976  VAL A N   
479  C CA  . VAL A 67  ? 1.19220 1.43290 0.59540 -0.32910 0.10310  -0.15640 976  VAL A CA  
480  C C   . VAL A 67  ? 1.12040 1.46150 0.59690 -0.30280 0.08680  -0.18460 976  VAL A C   
481  O O   . VAL A 67  ? 1.22690 1.56730 0.66070 -0.29410 0.08680  -0.18540 976  VAL A O   
482  C CB  . VAL A 67  ? 1.26810 1.43690 0.67030 -0.28420 0.08010  -0.13550 976  VAL A CB  
483  C CG1 . VAL A 67  ? 1.30210 1.44590 0.67820 -0.24020 0.06040  -0.12890 976  VAL A CG1 
484  C CG2 . VAL A 67  ? 1.41530 1.47850 0.73650 -0.30490 0.09300  -0.10880 976  VAL A CG2 
485  N N   . LEU A 68  ? 1.07220 1.49230 0.65080 -0.29050 0.07210  -0.20710 977  LEU A N   
486  C CA  . LEU A 68  ? 1.03380 1.54920 0.68760 -0.26290 0.05100  -0.23660 977  LEU A CA  
487  C C   . LEU A 68  ? 1.03660 1.61700 0.66860 -0.29380 0.07210  -0.25810 977  LEU A C   
488  O O   . LEU A 68  ? 1.05400 1.67020 0.68720 -0.26960 0.06040  -0.27040 977  LEU A O   
489  C CB  . LEU A 68  ? 0.95340 1.52890 0.71090 -0.25090 0.03170  -0.25530 977  LEU A CB  
490  C CG  . LEU A 68  ? 0.89100 1.43360 0.69200 -0.20900 0.00160  -0.24140 977  LEU A CG  
491  C CD1 . LEU A 68  ? 0.76780 1.37480 0.66750 -0.20240 -0.01760 -0.26190 977  LEU A CD1 
492  C CD2 . LEU A 68  ? 0.86190 1.39700 0.66020 -0.16420 -0.02410 -0.23760 977  LEU A CD2 
493  N N   . ASN A 69  ? 1.23460 1.83420 0.84890 -0.34490 0.10140  -0.26310 978  ASN A N   
494  C CA  . ASN A 69  ? 1.25360 1.92610 0.84840 -0.38110 0.12540  -0.28420 978  ASN A CA  
495  C C   . ASN A 69  ? 1.34270 1.96410 0.83660 -0.39110 0.14040  -0.26620 978  ASN A C   
496  O O   . ASN A 69  ? 1.32630 2.01430 0.81860 -0.38890 0.14340  -0.28590 978  ASN A O   
497  C CB  . ASN A 69  ? 1.32220 2.01690 0.91390 -0.43730 0.15400  -0.28900 978  ASN A CB  
498  C CG  . ASN A 69  ? 1.23740 1.99910 0.93090 -0.42830 0.13940  -0.31380 978  ASN A CG  
499  O OD1 . ASN A 69  ? 1.04100 1.84690 0.80830 -0.38360 0.10850  -0.33200 978  ASN A OD1 
500  N ND2 . ASN A 69  ? 1.26240 2.02630 0.95670 -0.47130 0.15980  -0.31380 978  ASN A ND2 
501  N N   . ASP A 70  ? 1.43730 1.94370 0.84770 -0.40030 0.14790  -0.23090 979  ASP A N   
502  C CA  . ASP A 70  ? 1.45990 1.89390 0.76380 -0.40550 0.15730  -0.20910 979  ASP A CA  
503  C C   . ASP A 70  ? 1.50240 1.94640 0.82310 -0.34900 0.12980  -0.21500 979  ASP A C   
504  O O   . ASP A 70  ? 1.66740 2.11580 0.93170 -0.35440 0.13850  -0.21600 979  ASP A O   
505  C CB  . ASP A 70  ? 1.58790 1.88790 0.80620 -0.41420 0.16100  -0.17180 979  ASP A CB  
506  C CG  . ASP A 70  ? 1.74820 1.99780 0.86410 -0.47800 0.19390  -0.15490 979  ASP A CG  
507  O OD1 . ASP A 70  ? 1.82760 2.13690 0.97380 -0.52200 0.21380  -0.16730 979  ASP A OD1 
508  O OD2 . ASP A 70  ? 1.81800 1.96750 0.83020 -0.48110 0.19610  -0.12900 979  ASP A OD2 
509  N N   . ILE A 71  ? 1.28190 1.72580 0.67270 -0.29870 0.09780  -0.21720 980  ILE A N   
510  C CA  . ILE A 71  ? 1.25670 1.70910 0.67160 -0.24250 0.06680  -0.22230 980  ILE A CA  
511  C C   . ILE A 71  ? 1.20690 1.77340 0.68000 -0.23350 0.06000  -0.25800 980  ILE A C   
512  O O   . ILE A 71  ? 1.23480 1.80630 0.68000 -0.21000 0.05110  -0.26190 980  ILE A O   
513  C CB  . ILE A 71  ? 1.19300 1.61940 0.66960 -0.19810 0.03520  -0.21410 980  ILE A CB  
514  C CG1 . ILE A 71  ? 1.25960 1.56810 0.66170 -0.19260 0.03700  -0.17940 980  ILE A CG1 
515  C CG2 . ILE A 71  ? 1.13840 1.61010 0.67380 -0.14570 0.00010  -0.22910 980  ILE A CG2 
516  C CD1 . ILE A 71  ? 1.20140 1.48900 0.66070 -0.16050 0.01390  -0.17020 980  ILE A CD1 
517  N N   . LEU A 72  ? 1.29900 1.95150 0.84660 -0.24920 0.06260  -0.28400 981  LEU A N   
518  C CA  . LEU A 72  ? 1.10180 1.86860 0.70970 -0.23770 0.05310  -0.32260 981  LEU A CA  
519  C C   . LEU A 72  ? 1.26380 2.06680 0.80660 -0.27180 0.08350  -0.33110 981  LEU A C   
520  O O   . LEU A 72  ? 1.21660 2.08990 0.77940 -0.24910 0.07240  -0.35630 981  LEU A O   
521  C CB  . LEU A 72  ? 1.07540 1.91470 0.77000 -0.24900 0.04940  -0.34700 981  LEU A CB  
522  C CG  . LEU A 72  ? 0.94440 1.77380 0.71810 -0.21080 0.01350  -0.34690 981  LEU A CG  
523  C CD1 . LEU A 72  ? 0.87900 1.77100 0.72610 -0.22780 0.01290  -0.36960 981  LEU A CD1 
524  C CD2 . LEU A 72  ? 0.90680 1.76550 0.72250 -0.15700 -0.02560 -0.36130 981  LEU A CD2 
525  N N   . SER A 73  ? 1.31910 2.07830 0.78670 -0.32530 0.11940  -0.31150 982  SER A N   
526  C CA  . SER A 73  ? 1.38010 2.15470 0.78650 -0.36260 0.14920  -0.30850 982  SER A CA  
527  C C   . SER A 73  ? 1.49070 2.19830 0.81410 -0.34140 0.14440  -0.29010 982  SER A C   
528  O O   . SER A 73  ? 1.65290 2.40940 0.97590 -0.33270 0.14590  -0.30240 982  SER A O   
529  C CB  . SER A 73  ? 1.44860 2.18240 0.81270 -0.42370 0.18160  -0.28740 982  SER A CB  
530  O OG  . SER A 73  ? 1.60070 2.20760 0.87360 -0.43390 0.18690  -0.25100 982  SER A OG  
531  N N   . ARG A 74  ? 1.38870 1.98560 0.65230 -0.32920 0.13620  -0.26070 983  ARG A N   
532  C CA  . ARG A 74  ? 1.56340 2.08240 0.75430 -0.29950 0.12450  -0.24120 983  ARG A CA  
533  C C   . ARG A 74  ? 1.55610 2.14300 0.80660 -0.24490 0.09470  -0.26650 983  ARG A C   
534  O O   . ARG A 74  ? 1.47670 2.06510 0.67240 -0.23890 0.09830  -0.26810 983  ARG A O   
535  C CB  . ARG A 74  ? 1.58690 1.98870 0.75110 -0.27380 0.10690  -0.21020 983  ARG A CB  
536  C CG  . ARG A 74  ? 1.61450 1.90610 0.67550 -0.31580 0.12980  -0.17720 983  ARG A CG  
537  C CD  . ARG A 74  ? 1.72690 1.90320 0.74530 -0.27600 0.10720  -0.15000 983  ARG A CD  
538  N NE  . ARG A 74  ? 1.87580 1.94490 0.82520 -0.30010 0.11700  -0.12120 983  ARG A NE  
539  C CZ  . ARG A 74  ? 2.02430 1.97750 0.89610 -0.27710 0.10440  -0.09540 983  ARG A CZ  
540  N NH1 . ARG A 74  ? 2.12740 2.05550 0.97850 -0.23160 0.08320  -0.09340 983  ARG A NH1 
541  N NH2 . ARG A 74  ? 2.01280 1.87320 0.82410 -0.29890 0.11190  -0.07250 983  ARG A NH2 
542  N N   . LEU A 75  ? 1.61800 2.25370 0.97240 -0.20760 0.06500  -0.28430 984  LEU A N   
543  C CA  . LEU A 75  ? 1.54700 2.23900 0.96700 -0.15190 0.02850  -0.30760 984  LEU A CA  
544  C C   . LEU A 75  ? 1.56500 2.36430 0.99900 -0.15860 0.03680  -0.34190 984  LEU A C   
545  O O   . LEU A 75  ? 1.54890 2.36680 0.97880 -0.12140 0.01730  -0.35300 984  LEU A O   
546  C CB  . LEU A 75  ? 1.27690 1.99590 0.80050 -0.12480 -0.00120 -0.31750 984  LEU A CB  
547  C CG  . LEU A 75  ? 1.21860 1.99240 0.81590 -0.07090 -0.04340 -0.34120 984  LEU A CG  
548  C CD1 . LEU A 75  ? 1.19040 1.93130 0.85090 -0.04060 -0.07540 -0.33010 984  LEU A CD1 
549  C CD2 . LEU A 75  ? 1.20370 2.09410 0.86130 -0.07460 -0.04590 -0.38230 984  LEU A CD2 
550  N N   . ASP A 76  ? 1.49370 2.35830 0.95400 -0.19980 0.06230  -0.35630 985  ASP A N   
551  C CA  . ASP A 76  ? 1.47220 2.42870 0.96590 -0.20630 0.07260  -0.37960 985  ASP A CA  
552  C C   . ASP A 76  ? 1.51650 2.43570 0.91830 -0.22130 0.09380  -0.36260 985  ASP A C   
553  O O   . ASP A 76  ? 1.41330 2.37820 0.82660 -0.19240 0.08240  -0.37890 985  ASP A O   
554  C CB  . ASP A 76  ? 1.42450 2.44650 0.96630 -0.24980 0.09570  -0.39170 985  ASP A CB  
555  C CG  . ASP A 76  ? 1.32870 2.40800 0.97420 -0.22690 0.07030  -0.41650 985  ASP A CG  
556  O OD1 . ASP A 76  ? 1.26640 2.34570 0.95570 -0.17570 0.03270  -0.42660 985  ASP A OD1 
557  O OD2 . ASP A 76  ? 1.29180 2.41140 0.97400 -0.26070 0.08670  -0.42420 985  ASP A OD2 
558  N N   . LYS A 77  ? 1.61430 2.44580 0.92640 -0.26240 0.12080  -0.33000 986  LYS A N   
559  C CA  . LYS A 77  ? 1.60550 2.38330 0.81910 -0.28430 0.14270  -0.30830 986  LYS A CA  
560  C C   . LYS A 77  ? 1.65310 2.37760 0.82040 -0.23540 0.11820  -0.30230 986  LYS A C   
561  O O   . LYS A 77  ? 1.85630 2.57760 0.97290 -0.23610 0.12720  -0.29940 986  LYS A O   
562  C CB  . LYS A 77  ? 1.67070 2.35540 0.80430 -0.33790 0.17090  -0.27360 986  LYS A CB  
563  C CG  . LYS A 77  ? 1.71650 2.43820 0.83710 -0.39670 0.20460  -0.27070 986  LYS A CG  
564  C CD  . LYS A 77  ? 1.72480 2.58670 0.94380 -0.40030 0.20680  -0.30700 986  LYS A CD  
565  C CE  . LYS A 77  ? 1.71100 2.61570 1.00520 -0.41770 0.20710  -0.31910 986  LYS A CE  
566  N NZ  . LYS A 77  ? 1.69170 2.72740 1.09180 -0.39650 0.19430  -0.35940 986  LYS A NZ  
567  N N   . VAL A 78  ? 1.66770 2.35570 0.85360 -0.19410 0.08720  -0.30130 987  VAL A N   
568  C CA  . VAL A 78  ? 1.72190 2.37020 0.87940 -0.14100 0.05700  -0.29920 987  VAL A CA  
569  C C   . VAL A 78  ? 1.73110 2.47560 0.97110 -0.09850 0.03160  -0.33280 987  VAL A C   
570  O O   . VAL A 78  ? 1.80890 2.54950 1.01220 -0.07870 0.02730  -0.33450 987  VAL A O   
571  C CB  . VAL A 78  ? 1.55330 2.11810 0.72520 -0.10880 0.02990  -0.27840 987  VAL A CB  
572  C CG1 . VAL A 78  ? 1.55580 2.09740 0.74120 -0.04640 -0.00880 -0.27960 987  VAL A CG1 
573  C CG2 . VAL A 78  ? 1.63700 2.08510 0.71550 -0.14180 0.05120  -0.24100 987  VAL A CG2 
574  N N   . GLU A 79  ? 1.69780 2.52050 1.04230 -0.08560 0.01490  -0.35780 988  GLU A N   
575  C CA  . GLU A 79  ? 1.68850 2.60190 1.11630 -0.04810 -0.00990 -0.39010 988  GLU A CA  
576  C C   . GLU A 79  ? 1.74630 2.72840 1.16660 -0.07930 0.02090  -0.40250 988  GLU A C   
577  O O   . GLU A 79  ? 1.85750 2.88570 1.29440 -0.04940 0.00790  -0.41990 988  GLU A O   
578  C CB  . GLU A 79  ? 1.61040 2.57780 1.14640 -0.03090 -0.03500 -0.41030 988  GLU A CB  
579  C CG  . GLU A 79  ? 1.57000 2.48120 1.12870 0.00270  -0.07010 -0.39960 988  GLU A CG  
580  C CD  . GLU A 79  ? 1.46870 2.43020 1.14170 0.03390  -0.10560 -0.41960 988  GLU A CD  
581  O OE1 . GLU A 79  ? 1.45360 2.48960 1.18480 0.02250  -0.09740 -0.44120 988  GLU A OE1 
582  O OE2 . GLU A 79  ? 1.40350 2.32630 1.10780 0.06970  -0.14110 -0.41120 988  GLU A OE2 
583  N N   . VAL A 88  ? 1.05950 1.97110 1.00050 -0.30920 0.04330  -0.37710 1164 VAL A N   
584  C CA  . VAL A 88  ? 1.02670 1.98470 1.05990 -0.29310 0.02630  -0.39590 1164 VAL A CA  
585  C C   . VAL A 88  ? 1.02770 1.95570 1.05840 -0.33020 0.04610  -0.38550 1164 VAL A C   
586  O O   . VAL A 88  ? 1.07960 1.93650 1.04460 -0.35780 0.06360  -0.35920 1164 VAL A O   
587  C CB  . VAL A 88  ? 0.95400 1.87760 1.04090 -0.23520 -0.01030 -0.38460 1164 VAL A CB  
588  C CG1 . VAL A 88  ? 0.78470 1.64190 0.85510 -0.23910 -0.02180 -0.36060 1164 VAL A CG1 
589  C CG2 . VAL A 88  ? 0.87950 1.80470 1.03020 -0.20090 -0.01800 -0.38980 1164 VAL A CG2 
590  N N   . ASP A 89  ? 1.07720 2.02000 1.16240 -0.31310 0.04960  -0.39180 1165 ASP A N   
591  C CA  . ASP A 89  ? 1.13900 2.04710 1.22700 -0.33380 0.06460  -0.38220 1165 ASP A CA  
592  C C   . ASP A 89  ? 0.99130 1.84530 1.12720 -0.28640 0.03760  -0.36750 1165 ASP A C   
593  O O   . ASP A 89  ? 1.02640 1.88800 1.20070 -0.24490 0.02080  -0.37620 1165 ASP A O   
594  C CB  . ASP A 89  ? 1.14170 2.10030 1.22860 -0.35250 0.08940  -0.40310 1165 ASP A CB  
595  C CG  . ASP A 89  ? 1.21160 2.23380 1.25330 -0.39900 0.11600  -0.41800 1165 ASP A CG  
596  O OD1 . ASP A 89  ? 1.18610 2.19020 1.17280 -0.45640 0.14060  -0.40830 1165 ASP A OD1 
597  O OD2 . ASP A 89  ? 1.36340 2.44840 1.42140 -0.37880 0.11200  -0.43800 1165 ASP A OD2 
598  N N   . LEU A 90  ? 0.74580 1.54260 0.87350 -0.29500 0.03340  -0.34490 1166 LEU A N   
599  C CA  . LEU A 90  ? 0.66520 1.40950 0.83210 -0.25620 0.00870  -0.32680 1166 LEU A CA  
600  C C   . LEU A 90  ? 0.76730 1.47510 0.93500 -0.27010 0.02070  -0.31690 1166 LEU A C   
601  O O   . LEU A 90  ? 0.89320 1.60550 1.02480 -0.31270 0.04700  -0.31970 1166 LEU A O   
602  C CB  . LEU A 90  ? 0.77550 1.49040 0.93460 -0.24880 -0.00910 -0.30970 1166 LEU A CB  
603  C CG  . LEU A 90  ? 0.86880 1.57680 0.96630 -0.29600 0.00640  -0.30690 1166 LEU A CG  
604  C CD1 . LEU A 90  ? 0.94280 1.61380 1.01330 -0.33670 0.03020  -0.29690 1166 LEU A CD1 
605  C CD2 . LEU A 90  ? 0.75490 1.41360 0.83380 -0.26650 -0.01220 -0.28390 1166 LEU A CD2 
606  N N   . GLY A 91  ? 0.85130 1.51760 1.05280 -0.23740 0.00090  -0.30290 1167 GLY A N   
607  C CA  . GLY A 91  ? 0.87420 1.50840 1.08410 -0.23840 0.00590  -0.29560 1167 GLY A CA  
608  C C   . GLY A 91  ? 0.90520 1.51160 1.08510 -0.27360 0.02440  -0.28400 1167 GLY A C   
609  O O   . GLY A 91  ? 0.94260 1.53440 1.10230 -0.28830 0.02460  -0.27350 1167 GLY A O   
610  N N   . ASP A 92  ? 0.96120 2.06920 0.89510 -0.40970 0.20580  -0.29740 1168 ASP A N   
611  C CA  . ASP A 92  ? 1.02500 2.06530 0.92230 -0.44900 0.21650  -0.26790 1168 ASP A CA  
612  C C   . ASP A 92  ? 0.92750 1.91650 0.86540 -0.38970 0.20140  -0.25280 1168 ASP A C   
613  O O   . ASP A 92  ? 0.89020 1.94910 0.89750 -0.33420 0.18610  -0.29300 1168 ASP A O   
614  C CB  . ASP A 92  ? 1.10540 2.21390 1.00000 -0.49640 0.22040  -0.30750 1168 ASP A CB  
615  C CG  . ASP A 92  ? 1.22080 2.23900 1.05000 -0.55390 0.23310  -0.27360 1168 ASP A CG  
616  O OD1 . ASP A 92  ? 1.23380 2.12830 1.00380 -0.56680 0.23930  -0.21670 1168 ASP A OD1 
617  O OD2 . ASP A 92  ? 1.27510 2.34220 1.10700 -0.58370 0.23460  -0.30380 1168 ASP A OD2 
618  N N   . ILE A 93  ? 0.85930 1.71510 0.75160 -0.39550 0.19860  -0.19500 1169 ILE A N   
619  C CA  . ILE A 93  ? 0.75640 1.53290 0.67840 -0.33780 0.17670  -0.16920 1169 ILE A CA  
620  C C   . ILE A 93  ? 0.90860 1.62950 0.79270 -0.37620 0.19220  -0.15400 1169 ILE A C   
621  O O   . ILE A 93  ? 0.93390 1.58900 0.83710 -0.33470 0.17730  -0.13300 1169 ILE A O   
622  C CB  . ILE A 93  ? 0.79140 1.45870 0.69490 -0.29640 0.15530  -0.11180 1169 ILE A CB  
623  C CG1 . ILE A 93  ? 0.81290 1.39970 0.63190 -0.34250 0.16930  -0.06230 1169 ILE A CG1 
624  C CG2 . ILE A 93  ? 0.73080 1.44870 0.68400 -0.24570 0.13300  -0.13320 1169 ILE A CG2 
625  C CD1 . ILE A 93  ? 0.87240 1.34360 0.62970 -0.36280 0.17870  -0.01720 1169 ILE A CD1 
626  N N   . SER A 94  ? 0.87790 1.62350 0.70640 -0.45500 0.22070  -0.16520 1170 SER A N   
627  C CA  . SER A 94  ? 0.90900 1.59450 0.68160 -0.50720 0.23880  -0.15310 1170 SER A CA  
628  C C   . SER A 94  ? 0.85430 1.61370 0.69250 -0.48570 0.23440  -0.19280 1170 SER A C   
629  O O   . SER A 94  ? 0.88610 1.56890 0.69310 -0.50020 0.23920  -0.17460 1170 SER A O   
630  C CB  . SER A 94  ? 1.00450 1.69200 0.70540 -0.58970 0.25530  -0.16090 1170 SER A CB  
631  O OG  . SER A 94  ? 0.98320 1.81600 0.73220 -0.60240 0.25050  -0.22040 1170 SER A OG  
632  N N   . GLY A 95  ? 0.84700 1.74410 0.76980 -0.44740 0.22410  -0.24380 1171 GLY A N   
633  C CA  . GLY A 95  ? 0.84860 1.82910 0.84290 -0.41410 0.21520  -0.28260 1171 GLY A CA  
634  C C   . GLY A 95  ? 0.83130 1.71740 0.85820 -0.34410 0.18860  -0.25190 1171 GLY A C   
635  O O   . GLY A 95  ? 0.74310 1.65700 0.80390 -0.33330 0.18510  -0.26870 1171 GLY A O   
636  N N   . ILE A 96  ? 0.93730 1.72620 0.95560 -0.29990 0.16980  -0.20940 1172 ILE A N   
637  C CA  . ILE A 96  ? 0.85170 1.54830 0.89360 -0.23670 0.14360  -0.17410 1172 ILE A CA  
638  C C   . ILE A 96  ? 0.82860 1.41500 0.81090 -0.26780 0.15660  -0.13670 1172 ILE A C   
639  O O   . ILE A 96  ? 0.92080 1.42480 0.82320 -0.31140 0.17360  -0.10300 1172 ILE A O   
640  C CB  . ILE A 96  ? 0.85810 1.49180 0.89850 -0.19060 0.12170  -0.13770 1172 ILE A CB  
641  C CG1 . ILE A 96  ? 0.82860 1.54880 0.93220 -0.14260 0.10090  -0.17520 1172 ILE A CG1 
642  C CG2 . ILE A 96  ? 0.80340 1.32460 0.83720 -0.14940 0.10340  -0.08760 1172 ILE A CG2 
643  C CD1 . ILE A 96  ? 0.87820 1.65920 0.96520 -0.16890 0.11250  -0.19620 1172 ILE A CD1 
644  N N   . ASN A 97  ? 0.73000 1.31170 0.74580 -0.24470 0.14820  -0.14300 1173 ASN A N   
645  C CA  . ASN A 97  ? 0.80810 1.28890 0.76900 -0.27160 0.16080  -0.11530 1173 ASN A CA  
646  C C   . ASN A 97  ? 0.73050 1.17810 0.74060 -0.21010 0.13680  -0.10330 1173 ASN A C   
647  O O   . ASN A 97  ? 0.69400 1.23630 0.78230 -0.17520 0.12000  -0.13890 1173 ASN A O   
648  C CB  . ASN A 97  ? 0.80440 1.34080 0.73560 -0.34650 0.18870  -0.14980 1173 ASN A CB  
649  C CG  . ASN A 97  ? 0.84030 1.27360 0.71760 -0.37080 0.19940  -0.12790 1173 ASN A CG  
650  O OD1 . ASN A 97  ? 0.89500 1.35460 0.81820 -0.34790 0.19040  -0.14280 1173 ASN A OD1 
651  N ND2 . ASN A 97  ? 0.95910 1.26780 0.73390 -0.41490 0.21770  -0.09190 1173 ASN A ND2 
652  N N   . ALA A 98  ? 0.78840 1.10640 0.74970 -0.19660 0.13540  -0.05470 1174 ALA A N   
653  C CA  . ALA A 98  ? 0.76420 1.03400 0.75530 -0.14610 0.11630  -0.03610 1174 ALA A CA  
654  C C   . ALA A 98  ? 0.78860 1.04110 0.75530 -0.18510 0.13430  -0.05110 1174 ALA A C   
655  O O   . ALA A 98  ? 0.93790 1.10330 0.81710 -0.23430 0.15870  -0.03370 1174 ALA A O   
656  C CB  . ALA A 98  ? 0.69830 0.84960 0.64560 -0.11120 0.10750  0.02190  1174 ALA A CB  
657  N N   . SER A 99  ? 0.73170 1.06200 0.76720 -0.16630 0.12230  -0.08270 1175 SER A N   
658  C CA  . SER A 99  ? 0.87870 1.19790 0.89890 -0.19820 0.13560  -0.09610 1175 SER A CA  
659  C C   . SER A 99  ? 0.90660 1.09470 0.89190 -0.16600 0.12930  -0.05200 1175 SER A C   
660  O O   . SER A 99  ? 0.75080 0.89740 0.75410 -0.10780 0.10760  -0.01910 1175 SER A O   
661  C CB  . SER A 99  ? 0.89530 1.34630 1.00200 -0.18330 0.12270  -0.14150 1175 SER A CB  
662  O OG  . SER A 99  ? 0.93040 1.43850 1.11270 -0.11700 0.09160  -0.14700 1175 SER A OG  
663  N N   . VAL A 100 ? 0.77140 0.90090 0.70390 -0.20570 0.14860  -0.05290 1176 VAL A N   
664  C CA  . VAL A 100 ? 0.78660 0.78950 0.67490 -0.18100 0.14800  -0.01750 1176 VAL A CA  
665  C C   . VAL A 100 ? 0.87000 0.92940 0.81880 -0.16830 0.13730  -0.04150 1176 VAL A C   
666  O O   . VAL A 100 ? 0.75890 0.94770 0.76870 -0.18820 0.13490  -0.08480 1176 VAL A O   
667  C CB  . VAL A 100 ? 0.99490 0.86480 0.75840 -0.23720 0.17920  0.00090  1176 VAL A CB  
668  C CG1 . VAL A 100 ? 1.16890 0.97850 0.86910 -0.24720 0.18760  0.02840  1176 VAL A CG1 
669  C CG2 . VAL A 100 ? 0.95810 0.86680 0.68800 -0.32020 0.20420  -0.03810 1176 VAL A CG2 
670  N N   . VAL A 101 ? 0.97350 0.94640 0.90760 -0.13250 0.13010  -0.01410 1177 VAL A N   
671  C CA  . VAL A 101 ? 0.85870 0.87520 0.85000 -0.11330 0.11660  -0.03020 1177 VAL A CA  
672  C C   . VAL A 101 ? 0.93690 0.84830 0.84590 -0.15090 0.14080  -0.02440 1177 VAL A C   
673  O O   . VAL A 101 ? 1.05790 0.83370 0.87480 -0.15250 0.15590  0.00840  1177 VAL A O   
674  C CB  . VAL A 101 ? 0.56950 0.59580 0.62740 -0.03490 0.08200  -0.00680 1177 VAL A CB  
675  C CG1 . VAL A 101 ? 0.65450 0.55520 0.65390 0.00170  0.08220  0.04250  1177 VAL A CG1 
676  C CG2 . VAL A 101 ? 0.50260 0.59250 0.62720 -0.01820 0.06490  -0.02680 1177 VAL A CG2 
677  N N   . ASN A 102 ? 0.73290 0.70470 0.66940 -0.18020 0.14420  -0.05610 1178 ASN A N   
678  C CA  . ASN A 102 ? 0.91590 0.79830 0.77900 -0.21950 0.16570  -0.05670 1178 ASN A CA  
679  C C   . ASN A 102 ? 0.86000 0.79360 0.79400 -0.18580 0.14610  -0.06580 1178 ASN A C   
680  O O   . ASN A 102 ? 0.77600 0.83310 0.77200 -0.20900 0.14100  -0.10180 1178 ASN A O   
681  C CB  . ASN A 102 ? 0.99050 0.89690 0.79600 -0.31320 0.19550  -0.08900 1178 ASN A CB  
682  C CG  . ASN A 102 ? 1.14030 0.91550 0.83670 -0.36260 0.22160  -0.08410 1178 ASN A CG  
683  O OD1 . ASN A 102 ? 1.08570 0.78450 0.77140 -0.32580 0.21620  -0.06730 1178 ASN A OD1 
684  N ND2 . ASN A 102 ? 1.27710 1.02370 0.88570 -0.44900 0.25020  -0.09960 1178 ASN A ND2 
685  N N   . ILE A 103 ? 0.86940 0.71610 0.79260 -0.13220 0.13540  -0.03380 1179 ILE A N   
686  C CA  . ILE A 103 ? 0.87420 0.75600 0.85520 -0.10070 0.11700  -0.03790 1179 ILE A CA  
687  C C   . ILE A 103 ? 0.94460 0.69370 0.83820 -0.11140 0.13700  -0.02380 1179 ILE A C   
688  O O   . ILE A 103 ? 0.99170 0.75220 0.92130 -0.08290 0.12370  -0.02240 1179 ILE A O   
689  C CB  . ILE A 103 ? 0.63950 0.56330 0.70070 -0.02210 0.08040  -0.01510 1179 ILE A CB  
690  C CG1 . ILE A 103 ? 0.68290 0.50060 0.69130 0.02040  0.08060  0.02920  1179 ILE A CG1 
691  C CG2 . ILE A 103 ? 0.54940 0.60670 0.69640 -0.01450 0.05940  -0.03790 1179 ILE A CG2 
692  C CD1 . ILE A 103 ? 0.60060 0.44470 0.66960 0.09100  0.04730  0.05600  1179 ILE A CD1 
693  N N   . GLN A 104 ? 1.15380 0.77930 0.93180 -0.15300 0.16770  -0.01550 1180 GLN A N   
694  C CA  . GLN A 104 ? 1.34060 0.81100 1.01160 -0.16150 0.18950  -0.00160 1180 GLN A CA  
695  C C   . GLN A 104 ? 1.26000 0.76480 0.94100 -0.20210 0.19600  -0.03190 1180 GLN A C   
696  O O   . GLN A 104 ? 1.33500 0.74070 0.96340 -0.18610 0.20350  -0.02150 1180 GLN A O   
697  C CB  . GLN A 104 ? 1.48510 0.82120 1.02250 -0.21330 0.22100  0.00630  1180 GLN A CB  
698  C CG  . GLN A 104 ? 1.70550 0.85450 1.12170 -0.19840 0.23940  0.02950  1180 GLN A CG  
699  C CD  . GLN A 104 ? 1.64690 0.76000 1.09010 -0.09920 0.21950  0.06690  1180 GLN A CD  
700  O OE1 . GLN A 104 ? 1.60760 0.72460 1.06700 -0.05380 0.20740  0.09440  1180 GLN A OE1 
701  N NE2 . GLN A 104 ? 1.59110 0.67730 1.03910 -0.06660 0.21580  0.06790  1180 GLN A NE2 
702  N N   . LYS A 105 ? 1.17950 0.82280 0.92250 -0.25150 0.19370  -0.06830 1181 LYS A N   
703  C CA  . LYS A 105 ? 0.94220 0.66040 0.71900 -0.28790 0.19420  -0.09900 1181 LYS A CA  
704  C C   . LYS A 105 ? 1.02590 0.79190 0.89190 -0.21650 0.16370  -0.08820 1181 LYS A C   
705  O O   . LYS A 105 ? 1.18100 0.90110 1.02020 -0.22350 0.16990  -0.09100 1181 LYS A O   
706  C CB  . LYS A 105 ? 0.88130 0.76250 0.71930 -0.34040 0.19330  -0.13690 1181 LYS A CB  
707  C CG  . LYS A 105 ? 0.83030 0.82490 0.72390 -0.37000 0.18810  -0.16830 1181 LYS A CG  
708  C CD  . LYS A 105 ? 0.96450 1.14250 0.93250 -0.40390 0.18230  -0.20450 1181 LYS A CD  
709  C CE  . LYS A 105 ? 1.16630 1.34570 1.05320 -0.49620 0.21500  -0.22520 1181 LYS A CE  
710  N NZ  . LYS A 105 ? 1.11860 1.46590 1.04930 -0.54770 0.21650  -0.26540 1181 LYS A NZ  
711  N N   . GLU A 106 ? 0.86830 0.71930 0.82980 -0.15420 0.13180  -0.07650 1182 GLU A N   
712  C CA  . GLU A 106 ? 0.82380 0.72970 0.87160 -0.09000 0.09840  -0.06510 1182 GLU A CA  
713  C C   . GLU A 106 ? 0.84680 0.62850 0.84370 -0.04010 0.09910  -0.02880 1182 GLU A C   
714  O O   . GLU A 106 ? 0.81950 0.61030 0.84410 -0.01550 0.08670  -0.02550 1182 GLU A O   
715  C CB  . GLU A 106 ? 0.66810 0.68100 0.81330 -0.04260 0.06450  -0.06130 1182 GLU A CB  
716  C CG  . GLU A 106 ? 0.63440 0.79190 0.84970 -0.07140 0.05560  -0.09890 1182 GLU A CG  
717  C CD  . GLU A 106 ? 0.72640 0.91070 0.91600 -0.11260 0.07450  -0.11570 1182 GLU A CD  
718  O OE1 . GLU A 106 ? 0.84610 0.92930 0.94020 -0.15410 0.10570  -0.10870 1182 GLU A OE1 
719  O OE2 . GLU A 106 ? 0.64160 0.94530 0.90240 -0.10210 0.05740  -0.13600 1182 GLU A OE2 
720  N N   . ILE A 107 ? 0.80680 0.48390 0.73270 -0.02340 0.11240  -0.00260 1183 ILE A N   
721  C CA  . ILE A 107 ? 0.86650 0.42340 0.73210 0.02850  0.11630  0.03220  1183 ILE A CA  
722  C C   . ILE A 107 ? 1.08300 0.54330 0.86670 -0.00380 0.14220  0.02040  1183 ILE A C   
723  O O   . ILE A 107 ? 1.22980 0.65460 1.00990 0.03900  0.13630  0.03390  1183 ILE A O   
724  C CB  . ILE A 107 ? 1.03460 0.49890 0.83050 0.04660  0.12780  0.06040  1183 ILE A CB  
725  C CG1 . ILE A 107 ? 0.93090 0.49330 0.80730 0.07630  0.10180  0.07100  1183 ILE A CG1 
726  C CG2 . ILE A 107 ? 1.16570 0.50770 0.89060 0.10240  0.13420  0.09420  1183 ILE A CG2 
727  C CD1 . ILE A 107 ? 1.06130 0.54910 0.87560 0.08860  0.11200  0.09770  1183 ILE A CD1 
728  N N   . ASP A 108 ? 1.13190 0.55050 0.84590 -0.07960 0.17050  -0.00430 1184 ASP A N   
729  C CA  . ASP A 108 ? 1.32750 0.65230 0.95440 -0.12410 0.19660  -0.02020 1184 ASP A CA  
730  C C   . ASP A 108 ? 1.16510 0.59050 0.87820 -0.11330 0.17770  -0.03560 1184 ASP A C   
731  O O   . ASP A 108 ? 1.24550 0.60580 0.93360 -0.07470 0.17770  -0.02330 1184 ASP A O   
732  C CB  . ASP A 108 ? 1.51920 0.81400 1.06860 -0.21960 0.22600  -0.04680 1184 ASP A CB  
733  C CG  . ASP A 108 ? 1.58600 0.84330 1.07610 -0.28470 0.24720  -0.07400 1184 ASP A CG  
734  O OD1 . ASP A 108 ? 1.79280 0.90970 1.19590 -0.26650 0.26120  -0.06290 1184 ASP A OD1 
735  O OD2 . ASP A 108 ? 1.30760 0.68220 0.83930 -0.35080 0.24910  -0.10670 1184 ASP A OD2 
736  N N   . ARG A 109 ? 1.11230 0.69650 0.92700 -0.13760 0.15940  -0.05960 1185 ARG A N   
737  C CA  . ARG A 109 ? 0.90900 0.60430 0.80620 -0.14100 0.14100  -0.07870 1185 ARG A CA  
738  C C   . ARG A 109 ? 0.93870 0.63830 0.88720 -0.06330 0.11420  -0.05280 1185 ARG A C   
739  O O   . ARG A 109 ? 0.85400 0.56830 0.81560 -0.06600 0.11080  -0.06120 1185 ARG A O   
740  C CB  . ARG A 109 ? 0.78990 0.65500 0.79000 -0.15980 0.12060  -0.10220 1185 ARG A CB  
741  C CG  . ARG A 109 ? 0.79650 0.78320 0.88500 -0.15820 0.09740  -0.11960 1185 ARG A CG  
742  C CD  . ARG A 109 ? 0.89490 0.92080 0.95720 -0.23720 0.11820  -0.15400 1185 ARG A CD  
743  N NE  . ARG A 109 ? 0.99530 0.99160 1.04590 -0.23800 0.11860  -0.15470 1185 ARG A NE  
744  C CZ  . ARG A 109 ? 0.98070 1.08390 1.08670 -0.26320 0.10760  -0.17610 1185 ARG A CZ  
745  N NH1 . ARG A 109 ? 1.05860 1.31170 1.23700 -0.28670 0.09480  -0.19970 1185 ARG A NH1 
746  N NH2 . ARG A 109 ? 0.83590 0.89820 0.92250 -0.26270 0.10970  -0.17430 1185 ARG A NH2 
747  N N   . LEU A 110 ? 0.92080 0.61730 0.89760 -0.00060 0.09540  -0.02290 1186 LEU A N   
748  C CA  . LEU A 110 ? 0.87450 0.57410 0.88850 0.07090  0.07110  0.00530  1186 LEU A CA  
749  C C   . LEU A 110 ? 1.06420 0.63090 0.98300 0.08610  0.09500  0.01670  1186 LEU A C   
750  O O   . LEU A 110 ? 0.93970 0.52880 0.88370 0.10610  0.08480  0.01690  1186 LEU A O   
751  C CB  . LEU A 110 ? 0.81340 0.52750 0.85710 0.12430  0.05140  0.03540  1186 LEU A CB  
752  C CG  . LEU A 110 ? 0.71490 0.56080 0.86020 0.12860  0.01950  0.02810  1186 LEU A CG  
753  C CD1 . LEU A 110 ? 0.58780 0.43550 0.74680 0.17960  -0.00040 0.05940  1186 LEU A CD1 
754  C CD2 . LEU A 110 ? 0.47440 0.42510 0.70540 0.13430  -0.01020 0.01610  1186 LEU A CD2 
755  N N   . ASN A 111 ? 1.12780 0.55990 0.93830 0.07900  0.12470  0.02570  1187 ASN A N   
756  C CA  . ASN A 111 ? 1.24210 0.53410 0.94590 0.10000  0.14740  0.03700  1187 ASN A CA  
757  C C   . ASN A 111 ? 1.34180 0.58720 0.99710 0.04650  0.16980  0.00690  1187 ASN A C   
758  O O   . ASN A 111 ? 1.50810 0.71060 1.12900 0.07390  0.17290  0.01110  1187 ASN A O   
759  C CB  . ASN A 111 ? 1.40380 0.61270 1.01760 0.09120  0.16350  0.04790  1187 ASN A CB  
760  C CG  . ASN A 111 ? 1.44130 0.72160 1.10360 0.14320  0.13620  0.07530  1187 ASN A CG  
761  O OD1 . ASN A 111 ? 1.41810 0.79560 1.15460 0.18240  0.10640  0.08600  1187 ASN A OD1 
762  N ND2 . ASN A 111 ? 1.42980 0.66640 1.04760 0.13040  0.14650  0.08250  1187 ASN A ND2 
763  N N   . GLU A 112 ? 1.31500 0.61350 0.98190 -0.03150 0.17800  -0.02400 1188 GLU A N   
764  C CA  . GLU A 112 ? 1.35760 0.64820 0.99220 -0.09360 0.19480  -0.05520 1188 GLU A CA  
765  C C   . GLU A 112 ? 1.23720 0.63310 0.96720 -0.06050 0.16820  -0.05680 1188 GLU A C   
766  O O   . GLU A 112 ? 1.33170 0.66010 1.01030 -0.05820 0.18100  -0.06190 1188 GLU A O   
767  C CB  . GLU A 112 ? 1.36730 0.73120 1.01210 -0.18230 0.20440  -0.08690 1188 GLU A CB  
768  C CG  . GLU A 112 ? 1.65450 0.95620 1.21300 -0.25950 0.23350  -0.11540 1188 GLU A CG  
769  C CD  . GLU A 112 ? 1.98520 1.07190 1.37700 -0.27540 0.26940  -0.10850 1188 GLU A CD  
770  O OE1 . GLU A 112 ? 2.02830 1.05250 1.36830 -0.26700 0.27620  -0.09160 1188 GLU A OE1 
771  O OE2 . GLU A 112 ? 2.13560 1.15710 1.46440 -0.27920 0.28150  -0.11380 1188 GLU A OE2 
772  N N   . VAL A 113 ? 1.15060 0.69870 1.00730 -0.03560 0.13240  -0.05240 1189 VAL A N   
773  C CA  . VAL A 113 ? 0.97770 0.63840 0.92920 -0.01370 0.10280  -0.05470 1189 VAL A CA  
774  C C   . VAL A 113 ? 1.03380 0.64180 0.97170 0.05720  0.09510  -0.02730 1189 VAL A C   
775  O O   . VAL A 113 ? 1.00700 0.63920 0.96080 0.05960  0.08980  -0.03390 1189 VAL A O   
776  C CB  . VAL A 113 ? 0.78380 0.60080 0.85920 -0.00140 0.06480  -0.05480 1189 VAL A CB  
777  C CG1 . VAL A 113 ? 0.61600 0.52950 0.77660 0.02670  0.03140  -0.05070 1189 VAL A CG1 
778  C CG2 . VAL A 113 ? 0.77070 0.66070 0.86490 -0.06770 0.07230  -0.08600 1189 VAL A CG2 
779  N N   . ALA A 114 ? 1.10960 0.65590 1.01820 0.11220  0.09490  0.00210  1190 ALA A N   
780  C CA  . ALA A 114 ? 1.08510 0.59460 0.97470 0.18090  0.08800  0.02910  1190 ALA A CA  
781  C C   . ALA A 114 ? 1.21590 0.61890 1.00970 0.17000  0.11710  0.01650  1190 ALA A C   
782  O O   . ALA A 114 ? 1.20900 0.65530 1.02820 0.19600  0.10420  0.01970  1190 ALA A O   
783  C CB  . ALA A 114 ? 1.13980 0.66930 1.02560 0.19940  0.07320  0.05080  1190 ALA A CB  
784  N N   . LYS A 115 ? 1.26780 0.54350 0.95360 0.12590  0.15320  0.00140  1191 LYS A N   
785  C CA  . LYS A 115 ? 1.33080 0.50150 0.91340 0.10610  0.18060  -0.01250 1191 LYS A CA  
786  C C   . LYS A 115 ? 1.28180 0.46920 0.87970 0.05540  0.18950  -0.04540 1191 LYS A C   
787  O O   . LYS A 115 ? 1.41900 0.57740 0.99130 0.07410  0.19500  -0.05030 1191 LYS A O   
788  C CB  . LYS A 115 ? 1.42010 0.47140 0.88560 0.06130  0.21070  -0.01900 1191 LYS A CB  
789  C CG  . LYS A 115 ? 1.59300 0.62850 1.03620 0.09730  0.20500  0.00760  1191 LYS A CG  
790  C CD  . LYS A 115 ? 1.57850 0.66820 1.05610 0.17210  0.18290  0.03370  1191 LYS A CD  
791  C CE  . LYS A 115 ? 1.60050 0.67570 1.05200 0.19580  0.18020  0.05340  1191 LYS A CE  
792  N NZ  . LYS A 115 ? 1.54510 0.68120 1.02820 0.25320  0.16190  0.07160  1191 LYS A NZ  
793  N N   . ASN A 116 ? 1.27040 0.55900 0.92890 -0.01110 0.18160  -0.06570 1192 ASN A N   
794  C CA  . ASN A 116 ? 1.24580 0.61350 0.93780 -0.07630 0.18130  -0.09670 1192 ASN A CA  
795  C C   . ASN A 116 ? 1.13620 0.61940 0.92710 -0.03730 0.15020  -0.09080 1192 ASN A C   
796  O O   . ASN A 116 ? 1.23770 0.75260 1.03110 -0.08060 0.15470  -0.11340 1192 ASN A O   
797  C CB  . ASN A 116 ? 1.33630 0.82390 1.09460 -0.13920 0.17200  -0.11560 1192 ASN A CB  
798  C CG  . ASN A 116 ? 1.58750 0.98550 1.24340 -0.21360 0.20670  -0.13440 1192 ASN A CG  
799  O OD1 . ASN A 116 ? 1.81300 1.04240 1.34310 -0.21370 0.23590  -0.12870 1192 ASN A OD1 
800  N ND2 . ASN A 116 ? 1.54360 1.05480 1.24790 -0.27740 0.20310  -0.15670 1192 ASN A ND2 
801  N N   . LEU A 117 ? 1.07120 0.61970 0.93810 0.03420  0.11910  -0.06190 1193 LEU A N   
802  C CA  . LEU A 117 ? 1.01390 0.67520 0.97260 0.06960  0.08570  -0.05250 1193 LEU A CA  
803  C C   . LEU A 117 ? 0.88460 0.47010 0.77970 0.09660  0.10220  -0.05260 1193 LEU A C   
804  O O   . LEU A 117 ? 1.02680 0.70010 0.98240 0.10470  0.08130  -0.05340 1193 LEU A O   
805  C CB  . LEU A 117 ? 0.72580 0.46270 0.76370 0.13220  0.05030  -0.02020 1193 LEU A CB  
806  C CG  . LEU A 117 ? 0.67770 0.53580 0.81230 0.11180  0.02020  -0.02280 1193 LEU A CG  
807  C CD1 . LEU A 117 ? 0.54860 0.45810 0.74140 0.17150  -0.01230 0.00970  1193 LEU A CD1 
808  C CD2 . LEU A 117 ? 0.51030 0.48320 0.71850 0.07490  -0.00130 -0.04200 1193 LEU A CD2 
809  N N   . ASN A 118 ? 1.05840 0.48460 0.83160 0.11110  0.13780  -0.05250 1194 ASN A N   
810  C CA  . ASN A 118 ? 1.30510 0.63900 0.99800 0.13680  0.15920  -0.05840 1194 ASN A CA  
811  C C   . ASN A 118 ? 1.28950 0.65120 0.98040 0.06690  0.16810  -0.09160 1194 ASN A C   
812  O O   . ASN A 118 ? 1.21670 0.59240 0.90820 0.08800  0.16660  -0.09570 1194 ASN A O   
813  C CB  . ASN A 118 ? 1.44670 0.62260 1.01050 0.15380  0.18950  -0.05190 1194 ASN A CB  
814  C CG  . ASN A 118 ? 1.39370 0.62280 0.98890 0.21780  0.16600  -0.01460 1194 ASN A CG  
815  O OD1 . ASN A 118 ? 1.29060 0.64150 0.97780 0.25720  0.13420  0.00320  1194 ASN A OD1 
816  N ND2 . ASN A 118 ? 1.49210 0.63870 1.00980 0.21690  0.18110  -0.00560 1194 ASN A ND2 
817  N N   . GLU A 119 ? 1.26220 0.64690 0.95600 -0.01370 0.17540  -0.11410 1195 GLU A N   
818  C CA  . GLU A 119 ? 1.30970 0.73430 1.00220 -0.09110 0.18410  -0.14630 1195 GLU A CA  
819  C C   . GLU A 119 ? 1.08780 0.70400 0.92240 -0.09500 0.14310  -0.14490 1195 GLU A C   
820  O O   . GLU A 119 ? 1.05720 0.72830 0.90460 -0.15440 0.14530  -0.16870 1195 GLU A O   
821  C CB  . GLU A 119 ? 1.40670 0.78640 1.03920 -0.17580 0.20880  -0.16910 1195 GLU A CB  
822  C CG  . GLU A 119 ? 1.65920 0.82820 1.12550 -0.19040 0.25240  -0.17640 1195 GLU A CG  
823  C CD  . GLU A 119 ? 1.81150 0.92150 1.21010 -0.26090 0.27420  -0.18820 1195 GLU A CD  
824  O OE1 . GLU A 119 ? 1.79410 1.03730 1.26780 -0.31890 0.26190  -0.20150 1195 GLU A OE1 
825  O OE2 . GLU A 119 ? 1.96980 0.95440 1.26240 -0.24650 0.29410  -0.17210 1195 GLU A OE2 
826  N N   . SER A 120 ? 1.06920 0.77950 1.00030 -0.03590 0.10640  -0.11740 1196 SER A N   
827  C CA  . SER A 120 ? 0.86840 0.74560 0.92610 -0.03030 0.06270  -0.11090 1196 SER A CA  
828  C C   . SER A 120 ? 0.80950 0.70640 0.88470 0.02280  0.04790  -0.09480 1196 SER A C   
829  O O   . SER A 120 ? 0.82420 0.84400 0.98630 0.01990  0.01430  -0.09100 1196 SER A O   
830  C CB  . SER A 120 ? 0.71760 0.68450 0.86320 -0.00790 0.02960  -0.09280 1196 SER A CB  
831  O OG  . SER A 120 ? 0.83230 0.86050 1.00720 -0.06660 0.02910  -0.11400 1196 SER A OG  
832  N N   . LEU A 121 ? 0.81690 0.59970 0.80920 0.06970  0.07160  -0.08610 1197 LEU A N   
833  C CA  . LEU A 121 ? 0.85760 0.66490 0.86050 0.12570  0.06040  -0.07140 1197 LEU A CA  
834  C C   . LEU A 121 ? 0.95330 0.78740 0.94990 0.08320  0.06700  -0.09620 1197 LEU A C   
835  O O   . LEU A 121 ? 0.85150 0.65630 0.81360 0.01410  0.08720  -0.12420 1197 LEU A O   
836  C CB  . LEU A 121 ? 0.93820 0.61380 0.84490 0.18940  0.08770  -0.05900 1197 LEU A CB  
837  C CG  . LEU A 121 ? 0.90960 0.57750 0.83130 0.23930  0.07630  -0.02900 1197 LEU A CG  
838  C CD1 . LEU A 121 ? 0.99980 0.54460 0.82210 0.29240  0.10220  -0.01750 1197 LEU A CD1 
839  C CD2 . LEU A 121 ? 0.74450 0.55960 0.77760 0.27600  0.03010  -0.00060 1197 LEU A CD2 
840  N N   . ILE A 122 ? 1.02340 0.92380 1.05570 0.11950  0.04870  -0.08560 1198 ILE A N   
841  C CA  . ILE A 122 ? 0.93410 0.88780 0.97820 0.08470  0.04700  -0.10460 1198 ILE A CA  
842  C C   . ILE A 122 ? 1.07510 0.93700 1.03000 0.12740  0.07650  -0.11130 1198 ILE A C   
843  O O   . ILE A 122 ? 1.12270 0.99170 1.08070 0.20040  0.06810  -0.08740 1198 ILE A O   
844  C CB  . ILE A 122 ? 0.80090 0.92210 0.96550 0.08870  -0.00390 -0.08570 1198 ILE A CB  
845  C CG1 . ILE A 122 ? 0.70210 0.90160 0.94770 0.06450  -0.03490 -0.07650 1198 ILE A CG1 
846  C CG2 . ILE A 122 ? 0.84740 1.03010 1.02730 0.04760  -0.00780 -0.10420 1198 ILE A CG2 
847  C CD1 . ILE A 122 ? 0.64770 0.99220 0.99810 0.06630  -0.08660 -0.05790 1198 ILE A CD1 
848  N N   . ASP A 123 ? 1.29460 1.07360 1.16820 0.08410  0.11040  -0.14330 1199 ASP A N   
849  C CA  . ASP A 123 ? 1.40440 1.14320 1.21800 0.11100  0.12970  -0.15630 1199 ASP A CA  
850  C C   . ASP A 123 ? 1.33350 1.19180 1.21080 0.05280  0.11150  -0.17150 1199 ASP A C   
851  O O   . ASP A 123 ? 1.38100 1.21590 1.23060 -0.02370 0.12760  -0.19850 1199 ASP A O   
852  C CB  . ASP A 123 ? 1.63470 1.17760 1.29480 0.11020  0.18170  -0.18200 1199 ASP A CB  
853  C CG  . ASP A 123 ? 1.85110 1.25620 1.43420 0.10820  0.20480  -0.17960 1199 ASP A CG  
854  O OD1 . ASP A 123 ? 1.88240 1.34030 1.53010 0.12930  0.18200  -0.15400 1199 ASP A OD1 
855  O OD2 . ASP A 123 ? 1.99490 1.23550 1.44720 0.08290  0.24540  -0.20380 1199 ASP A OD2 
856  N N   . LEU A 124 ? 1.36230 1.35190 1.32280 0.08450  0.07710  -0.15260 1200 LEU A N   
857  C CA  . LEU A 124 ? 1.19750 1.31040 1.22190 0.03830  0.05450  -0.16140 1200 LEU A CA  
858  C C   . LEU A 124 ? 1.32830 1.35770 1.25820 0.01370  0.09380  -0.19590 1200 LEU A C   
859  O O   . LEU A 124 ? 1.50640 1.39650 1.33010 0.05710  0.13100  -0.20590 1200 LEU A O   
860  C CB  . LEU A 124 ? 0.98970 1.23410 1.09760 0.08760  0.01360  -0.13100 1200 LEU A CB  
861  C CG  . LEU A 124 ? 0.97630 1.37760 1.19780 0.04560  -0.03590 -0.11740 1200 LEU A CG  
862  C CD1 . LEU A 124 ? 0.88950 1.30710 1.16040 0.01580  -0.05410 -0.11000 1200 LEU A CD1 
863  C CD2 . LEU A 124 ? 1.00850 1.52030 1.29230 0.09270  -0.07420 -0.08560 1200 LEU A CD2 
864  N N   . GLN A 125 ? 1.27960 1.38420 1.24070 -0.05350 0.08590  -0.21390 1201 GLN A N   
865  C CA  . GLN A 125 ? 1.39650 1.42910 1.26960 -0.09480 0.12240  -0.25020 1201 GLN A CA  
866  C C   . GLN A 125 ? 1.34010 1.45980 1.23970 -0.06950 0.10990  -0.24980 1201 GLN A C   
867  O O   . GLN A 125 ? 1.26980 1.53960 1.26580 -0.10320 0.07250  -0.24020 1201 GLN A O   
868  C CB  . GLN A 125 ? 1.43070 1.48920 1.31290 -0.19410 0.12540  -0.27200 1201 GLN A CB  
869  C CG  . GLN A 125 ? 1.50510 1.58440 1.35680 -0.25170 0.13930  -0.30120 1201 GLN A CG  
870  C CD  . GLN A 125 ? 1.66740 1.64270 1.42320 -0.33290 0.17860  -0.33580 1201 GLN A CD  
871  O OE1 . GLN A 125 ? 1.82170 1.62740 1.45950 -0.32560 0.21840  -0.35030 1201 GLN A OE1 
872  N NE2 . GLN A 125 ? 1.60090 1.67800 1.40160 -0.41410 0.16690  -0.34860 1201 GLN A NE2 
873  N N   . GLU A 126 ? 1.46150 1.48880 1.27470 -0.00890 0.13970  -0.25930 1202 GLU A N   
874  C CA  . GLU A 126 ? 1.54460 1.60550 1.33400 0.00810  0.14810  -0.27490 1202 GLU A CA  
875  C C   . GLU A 126 ? 1.76730 1.70950 1.45790 0.10050  0.18070  -0.27930 1202 GLU A C   
876  O O   . GLU A 126 ? 1.92850 1.69040 1.49460 0.11020  0.22370  -0.30150 1202 GLU A O   
877  C CB  . GLU A 126 ? 1.35300 1.61240 1.26530 0.01340  0.09910  -0.25010 1202 GLU A CB  
878  C CG  . GLU A 126 ? 1.22470 1.58850 1.18870 -0.07140 0.08160  -0.26340 1202 GLU A CG  
879  C CD  . GLU A 126 ? 1.23550 1.75990 1.27480 -0.06300 0.04680  -0.24920 1202 GLU A CD  
880  O OE1 . GLU A 126 ? 1.15290 1.80500 1.28290 -0.11590 0.00680  -0.23570 1202 GLU A OE1 
881  O OE2 . GLU A 126 ? 1.29060 1.81420 1.29410 -0.00360 0.05940  -0.25190 1202 GLU A OE2 
882  N N   . ASN B 5   ? 1.79170 1.56720 1.10070 0.11700  -0.03620 0.17670  914  ASN B N   
883  C CA  . ASN B 5   ? 1.76670 1.57040 1.09930 0.11940  -0.03880 0.14940  914  ASN B CA  
884  C C   . ASN B 5   ? 1.68870 1.49020 1.06780 0.10950  -0.03700 0.13860  914  ASN B C   
885  O O   . ASN B 5   ? 1.60630 1.40570 1.00570 0.11170  -0.04930 0.13540  914  ASN B O   
886  C CB  . ASN B 5   ? 1.77230 1.59550 1.08370 0.11950  -0.02670 0.14350  914  ASN B CB  
887  C CG  . ASN B 5   ? 1.74650 1.57360 1.03930 0.10820  -0.00700 0.16370  914  ASN B CG  
888  O OD1 . ASN B 5   ? 1.75120 1.55600 1.02510 0.09950  -0.00500 0.18750  914  ASN B OD1 
889  N ND2 . ASN B 5   ? 1.74320 1.59910 1.03520 0.10810  0.00650  0.15370  914  ASN B ND2 
890  N N   . VAL B 6   ? 1.62260 1.42840 1.01590 0.10100  -0.02290 0.13270  915  VAL B N   
891  C CA  . VAL B 6   ? 1.47590 1.27540 0.90780 0.09110  -0.01980 0.12320  915  VAL B CA  
892  C C   . VAL B 6   ? 1.55830 1.34300 1.00660 0.08200  -0.01230 0.14310  915  VAL B C   
893  O O   . VAL B 6   ? 1.66830 1.44590 1.14800 0.07640  -0.01630 0.13860  915  VAL B O   
894  C CB  . VAL B 6   ? 1.49880 1.30510 0.93040 0.09200  -0.00970 0.10920  915  VAL B CB  
895  C CG1 . VAL B 6   ? 1.45660 1.26450 0.90910 0.08360  0.00680  0.11770  915  VAL B CG1 
896  C CG2 . VAL B 6   ? 1.62050 1.41550 1.05660 0.09220  -0.02300 0.08420  915  VAL B CG2 
897  N N   . LEU B 7   ? 1.57960 1.35770 1.00230 0.07850  -0.00280 0.16450  916  LEU B N   
898  C CA  . LEU B 7   ? 1.60120 1.35440 1.02500 0.06700  0.00300  0.18580  916  LEU B CA  
899  C C   . LEU B 7   ? 1.57830 1.31150 1.01780 0.07520  -0.01270 0.18470  916  LEU B C   
900  O O   . LEU B 7   ? 1.37080 1.09120 0.83550 0.06700  -0.00910 0.18810  916  LEU B O   
901  C CB  . LEU B 7   ? 1.61780 1.35700 0.99250 0.06130  0.00770  0.20880  916  LEU B CB  
902  C CG  . LEU B 7   ? 1.55500 1.32190 0.91790 0.04500  0.02810  0.21520  916  LEU B CG  
903  C CD1 . LEU B 7   ? 1.65560 1.41210 0.96270 0.03590  0.03080  0.23700  916  LEU B CD1 
904  C CD2 . LEU B 7   ? 1.43450 1.20240 0.82300 0.02540  0.04180  0.22190  916  LEU B CD2 
905  N N   . TYR B 8   ? 1.53270 1.26930 0.95790 0.09250  -0.02990 0.17880  917  TYR B N   
906  C CA  . TYR B 8   ? 1.54650 1.27980 0.98520 0.10610  -0.04680 0.17420  917  TYR B CA  
907  C C   . TYR B 8   ? 1.52100 1.27890 1.00940 0.09720  -0.04690 0.15470  917  TYR B C   
908  O O   . TYR B 8   ? 1.58820 1.34000 1.09880 0.09730  -0.04940 0.15600  917  TYR B O   
909  C CB  . TYR B 8   ? 1.57370 1.31900 0.98600 0.12800  -0.06530 0.16920  917  TYR B CB  
910  C CG  . TYR B 8   ? 1.65170 1.40850 1.07720 0.14710  -0.08370 0.16130  917  TYR B CG  
911  C CD1 . TYR B 8   ? 1.68060 1.40240 1.09530 0.15810  -0.08820 0.17450  917  TYR B CD1 
912  C CD2 . TYR B 8   ? 1.69840 1.50450 1.14470 0.15400  -0.09730 0.13930  917  TYR B CD2 
913  C CE1 . TYR B 8   ? 1.70700 1.44640 1.13250 0.18180  -0.10580 0.16460  917  TYR B CE1 
914  C CE2 . TYR B 8   ? 1.71170 1.54510 1.17250 0.17250  -0.11370 0.12990  917  TYR B CE2 
915  C CZ  . TYR B 8   ? 1.71700 1.51920 1.16820 0.18970  -0.11800 0.14180  917  TYR B CZ  
916  O OH  . TYR B 8   ? 1.71990 1.55450 1.18360 0.21410  -0.13490 0.13010  917  TYR B OH  
917  N N   . GLU B 9   ? 1.48570 1.26530 0.98530 0.08910  -0.04510 0.13750  918  GLU B N   
918  C CA  . GLU B 9   ? 1.37190 1.16550 0.90740 0.07570  -0.04680 0.11940  918  GLU B CA  
919  C C   . GLU B 9   ? 1.32630 1.10180 0.88530 0.06360  -0.03240 0.12680  918  GLU B C   
920  O O   . GLU B 9   ? 1.36770 1.14820 0.95620 0.05610  -0.03540 0.12080  918  GLU B O   
921  C CB  . GLU B 9   ? 1.40690 1.20900 0.93280 0.06950  -0.04940 0.10120  918  GLU B CB  
922  C CG  . GLU B 9   ? 1.57830 1.40170 1.08280 0.07830  -0.06480 0.09170  918  GLU B CG  
923  C CD  . GLU B 9   ? 1.68600 1.54140 1.21010 0.07310  -0.08110 0.07830  918  GLU B CD  
924  O OE1 . GLU B 9   ? 1.60660 1.47380 1.14870 0.08070  -0.08440 0.08510  918  GLU B OE1 
925  O OE2 . GLU B 9   ? 1.78340 1.65400 1.30180 0.06080  -0.09110 0.06000  918  GLU B OE2 
926  N N   . ASN B 10  ? 1.26040 1.02210 0.80630 0.06070  -0.01730 0.13910  919  ASN B N   
927  C CA  . ASN B 10  ? 1.21070 0.96090 0.77640 0.04890  -0.00310 0.14710  919  ASN B CA  
928  C C   . ASN B 10  ? 1.25490 0.98750 0.82940 0.04850  -0.00580 0.16050  919  ASN B C   
929  O O   . ASN B 10  ? 1.28480 1.01440 0.88890 0.03990  -0.00240 0.15770  919  ASN B O   
930  C CB  . ASN B 10  ? 1.33920 1.09260 0.88570 0.04490  0.01290  0.15740  919  ASN B CB  
931  C CG  . ASN B 10  ? 1.41390 1.18410 0.95930 0.04880  0.01720  0.14000  919  ASN B CG  
932  O OD1 . ASN B 10  ? 1.43230 1.19760 0.99310 0.04870  0.01020  0.12280  919  ASN B OD1 
933  N ND2 . ASN B 10  ? 1.43600 1.22430 0.95840 0.05220  0.02760  0.14380  919  ASN B ND2 
934  N N   . GLN B 11  ? 1.31330 1.03010 0.85760 0.05940  -0.01320 0.17380  920  GLN B N   
935  C CA  . GLN B 11  ? 1.33730 1.02570 0.87620 0.06560  -0.01990 0.18580  920  GLN B CA  
936  C C   . GLN B 11  ? 1.24860 0.95880 0.82050 0.07520  -0.03250 0.16950  920  GLN B C   
937  O O   . GLN B 11  ? 1.23720 0.93410 0.82510 0.07380  -0.03200 0.17270  920  GLN B O   
938  C CB  . GLN B 11  ? 1.28470 0.94330 0.77240 0.08050  -0.03010 0.20110  920  GLN B CB  
939  C CG  . GLN B 11  ? 1.36610 0.99630 0.81460 0.06380  -0.01730 0.22270  920  GLN B CG  
940  C CD  . GLN B 11  ? 1.51730 1.09080 0.90970 0.07170  -0.02830 0.24310  920  GLN B CD  
941  O OE1 . GLN B 11  ? 1.47110 1.03300 0.83840 0.09780  -0.04670 0.24100  920  GLN B OE1 
942  N NE2 . GLN B 11  ? 1.65540 1.19070 1.02250 0.04870  -0.01830 0.26290  920  GLN B NE2 
943  N N   . LYS B 12  ? 1.13030 0.87630 0.70960 0.08270  -0.04370 0.15250  921  LYS B N   
944  C CA  . LYS B 12  ? 1.20140 0.98480 0.81240 0.08560  -0.05520 0.13470  921  LYS B CA  
945  C C   . LYS B 12  ? 1.23520 1.02220 0.88260 0.06280  -0.04470 0.12790  921  LYS B C   
946  O O   . LYS B 12  ? 1.10330 0.90350 0.77520 0.06330  -0.04830 0.12350  921  LYS B O   
947  C CB  . LYS B 12  ? 1.11620 0.94170 0.72680 0.08670  -0.06700 0.11700  921  LYS B CB  
948  C CG  . LYS B 12  ? 1.15430 0.98960 0.73290 0.11170  -0.08130 0.11870  921  LYS B CG  
949  C CD  . LYS B 12  ? 1.36520 1.19440 0.93090 0.14080  -0.09370 0.12530  921  LYS B CD  
950  C CE  . LYS B 12  ? 1.53010 1.41430 1.12840 0.14860  -0.10560 0.10740  921  LYS B CE  
951  N NZ  . LYS B 12  ? 1.63340 1.51400 1.20960 0.18780  -0.12190 0.11030  921  LYS B NZ  
952  N N   . LEU B 13  ? 1.20780 0.98430 0.85510 0.04680  -0.03330 0.12620  922  LEU B N   
953  C CA  . LEU B 13  ? 1.16110 0.93300 0.83390 0.02740  -0.02450 0.11930  922  LEU B CA  
954  C C   . LEU B 13  ? 1.07400 0.82660 0.76230 0.02510  -0.01500 0.13220  922  LEU B C   
955  O O   . LEU B 13  ? 1.06900 0.83090 0.78370 0.01820  -0.01700 0.12630  922  LEU B O   
956  C CB  . LEU B 13  ? 1.17510 0.93430 0.83250 0.02180  -0.01620 0.11570  922  LEU B CB  
957  C CG  . LEU B 13  ? 1.11330 0.85970 0.78630 0.00780  -0.00950 0.10800  922  LEU B CG  
958  C CD1 . LEU B 13  ? 1.11560 0.86940 0.79860 -0.00760 -0.02110 0.09160  922  LEU B CD1 
959  C CD2 . LEU B 13  ? 1.05750 0.79230 0.70910 0.01270  -0.00230 0.10430  922  LEU B CD2 
960  N N   . ILE B 14  ? 1.05590 0.78450 0.72540 0.02800  -0.00550 0.14910  923  ILE B N   
961  C CA  . ILE B 14  ? 1.08600 0.79070 0.76120 0.02240  0.00300  0.16340  923  ILE B CA  
962  C C   . ILE B 14  ? 1.13070 0.83280 0.81600 0.03310  -0.00830 0.16240  923  ILE B C   
963  O O   . ILE B 14  ? 0.92100 0.62240 0.63240 0.02540  -0.00490 0.16000  923  ILE B O   
964  C CB  . ILE B 14  ? 1.08800 0.76880 0.72760 0.02070  0.01060  0.18290  923  ILE B CB  
965  C CG1 . ILE B 14  ? 1.13290 0.82970 0.76870 0.01050  0.02440  0.18210  923  ILE B CG1 
966  C CG2 . ILE B 14  ? 0.92680 0.57450 0.56030 0.01360  0.01410  0.19840  923  ILE B CG2 
967  C CD1 . ILE B 14  ? 1.11730 0.80700 0.71410 0.00670  0.03090  0.19850  923  ILE B CD1 
968  N N   . ALA B 15  ? 0.92320 0.62640 0.58650 0.05350  -0.02240 0.16280  924  ALA B N   
969  C CA  . ALA B 15  ? 0.93270 0.63720 0.59750 0.07340  -0.03600 0.15970  924  ALA B CA  
970  C C   . ALA B 15  ? 0.94120 0.69270 0.64950 0.06690  -0.03860 0.14090  924  ALA B C   
971  O O   . ALA B 15  ? 0.98920 0.73880 0.71320 0.07050  -0.03960 0.13980  924  ALA B O   
972  C CB  . ALA B 15  ? 0.97430 0.68220 0.60660 0.10050  -0.05240 0.15920  924  ALA B CB  
973  N N   . ASN B 16  ? 0.93550 0.72540 0.65730 0.05580  -0.04060 0.12660  925  ASN B N   
974  C CA  . ASN B 16  ? 1.00010 0.83720 0.75510 0.04200  -0.04470 0.10870  925  ASN B CA  
975  C C   . ASN B 16  ? 0.94390 0.76280 0.72190 0.02040  -0.03190 0.11080  925  ASN B C   
976  O O   . ASN B 16  ? 0.93610 0.77550 0.73690 0.01940  -0.03390 0.10540  925  ASN B O   
977  C CB  . ASN B 16  ? 1.03300 0.90150 0.78580 0.02780  -0.05030 0.09470  925  ASN B CB  
978  C CG  . ASN B 16  ? 1.14380 1.05060 0.88280 0.04830  -0.06580 0.08750  925  ASN B CG  
979  O OD1 . ASN B 16  ? 1.17670 1.09780 0.91270 0.07550  -0.07490 0.08860  925  ASN B OD1 
980  N ND2 . ASN B 16  ? 1.17180 1.09370 0.89830 0.03820  -0.07050 0.07890  925  ASN B ND2 
981  N N   . GLN B 17  ? 0.90030 0.68620 0.67070 0.00750  -0.02000 0.11770  926  GLN B N   
982  C CA  . GLN B 17  ? 0.95350 0.71960 0.74120 -0.00950 -0.00810 0.12020  926  GLN B CA  
983  C C   . GLN B 17  ? 0.95340 0.70510 0.75080 -0.00220 -0.00470 0.13040  926  GLN B C   
984  O O   . GLN B 17  ? 0.78050 0.54210 0.60240 -0.01170 -0.00320 0.12500  926  GLN B O   
985  C CB  . GLN B 17  ? 0.92810 0.66810 0.70040 -0.01420 0.00280  0.12610  926  GLN B CB  
986  C CG  . GLN B 17  ? 0.91660 0.66020 0.67300 -0.01920 -0.00140 0.11420  926  GLN B CG  
987  C CD  . GLN B 17  ? 0.93210 0.68460 0.69850 -0.03760 -0.00880 0.09900  926  GLN B CD  
988  O OE1 . GLN B 17  ? 0.92570 0.70770 0.69600 -0.04260 -0.01970 0.09040  926  GLN B OE1 
989  N NE2 . GLN B 17  ? 0.93980 0.66850 0.70700 -0.04900 -0.00370 0.09560  926  GLN B NE2 
990  N N   . PHE B 18  ? 0.92690 0.65180 0.70020 0.01230  -0.00450 0.14460  927  PHE B N   
991  C CA  . PHE B 18  ? 0.82900 0.52440 0.59750 0.01870  -0.00340 0.15580  927  PHE B CA  
992  C C   . PHE B 18  ? 0.90370 0.62240 0.68710 0.03390  -0.01530 0.14500  927  PHE B C   
993  O O   . PHE B 18  ? 0.94220 0.64970 0.73880 0.03140  -0.01230 0.14640  927  PHE B O   
994  C CB  . PHE B 18  ? 0.85090 0.50610 0.57620 0.02960  -0.00580 0.17250  927  PHE B CB  
995  C CG  . PHE B 18  ? 0.92120 0.53240 0.62850 0.03440  -0.00800 0.18410  927  PHE B CG  
996  C CD1 . PHE B 18  ? 0.84080 0.43420 0.55980 0.01350  0.00450  0.19140  927  PHE B CD1 
997  C CD2 . PHE B 18  ? 0.95300 0.53800 0.62760 0.06140  -0.02430 0.18630  927  PHE B CD2 
998  C CE1 . PHE B 18  ? 0.97380 0.52150 0.67170 0.01480  0.00130  0.20140  927  PHE B CE1 
999  C CE2 . PHE B 18  ? 1.05350 0.58530 0.70160 0.06670  -0.02890 0.19610  927  PHE B CE2 
1000 C CZ  . PHE B 18  ? 1.07960 0.59140 0.73920 0.04100  -0.01580 0.20400  927  PHE B CZ  
1001 N N   . ASN B 19  ? 0.84810 0.60340 0.62880 0.05060  -0.02860 0.13370  928  ASN B N   
1002 C CA  . ASN B 19  ? 0.77780 0.57240 0.57170 0.07040  -0.04130 0.12050  928  ASN B CA  
1003 C C   . ASN B 19  ? 0.76180 0.60120 0.59630 0.04630  -0.03580 0.10720  928  ASN B C   
1004 O O   . ASN B 19  ? 0.76930 0.62970 0.62010 0.05430  -0.03890 0.10050  928  ASN B O   
1005 C CB  . ASN B 19  ? 0.80880 0.64150 0.58810 0.09550  -0.05740 0.11070  928  ASN B CB  
1006 C CG  . ASN B 19  ? 1.03930 0.82060 0.77060 0.12450  -0.06640 0.12400  928  ASN B CG  
1007 O OD1 . ASN B 19  ? 0.99470 0.71500 0.70180 0.13020  -0.06450 0.13810  928  ASN B OD1 
1008 N ND2 . ASN B 19  ? 0.94930 0.75070 0.66160 0.14010  -0.07700 0.12000  928  ASN B ND2 
1009 N N   . SER B 20  ? 0.77780 0.62680 0.62190 0.01850  -0.02910 0.10350  929  SER B N   
1010 C CA  . SER B 20  ? 0.73970 0.61250 0.61010 -0.01150 -0.02400 0.09390  929  SER B CA  
1011 C C   . SER B 20  ? 0.70590 0.54420 0.58830 -0.01850 -0.01300 0.10260  929  SER B C   
1012 O O   . SER B 20  ? 0.82570 0.68960 0.72920 -0.02290 -0.01350 0.09590  929  SER B O   
1013 C CB  . SER B 20  ? 0.90640 0.77170 0.76720 -0.03500 -0.02180 0.09030  929  SER B CB  
1014 O OG  . SER B 20  ? 1.07380 0.93610 0.94640 -0.06440 -0.01700 0.08500  929  SER B OG  
1015 N N   . ALA B 21  ? 0.82970 0.61800 0.69870 -0.01940 -0.00340 0.11640  930  ALA B N   
1016 C CA  . ALA B 21  ? 0.82630 0.58320 0.70450 -0.02710 0.00720  0.12530  930  ALA B CA  
1017 C C   . ALA B 21  ? 0.82910 0.58800 0.71400 -0.01210 0.00280  0.12560  930  ALA B C   
1018 O O   . ALA B 21  ? 0.82350 0.59000 0.72970 -0.02250 0.00680  0.12190  930  ALA B O   
1019 C CB  . ALA B 21  ? 0.74040 0.45750 0.59840 -0.02650 0.01590  0.14010  930  ALA B CB  
1020 N N   . ILE B 22  ? 0.75460 0.50150 0.61640 0.01370  -0.00650 0.12960  931  ILE B N   
1021 C CA  . ILE B 22  ? 0.77420 0.50740 0.62880 0.03550  -0.01380 0.12980  931  ILE B CA  
1022 C C   . ILE B 22  ? 0.81970 0.61510 0.70370 0.04020  -0.01990 0.11140  931  ILE B C   
1023 O O   . ILE B 22  ? 0.84120 0.63480 0.73730 0.04150  -0.01820 0.10900  931  ILE B O   
1024 C CB  . ILE B 22  ? 0.84320 0.54320 0.65510 0.06580  -0.02660 0.13650  931  ILE B CB  
1025 C CG1 . ILE B 22  ? 0.78320 0.41910 0.56250 0.05350  -0.01880 0.15710  931  ILE B CG1 
1026 C CG2 . ILE B 22  ? 0.83010 0.52310 0.62920 0.09750  -0.04000 0.13000  931  ILE B CG2 
1027 C CD1 . ILE B 22  ? 1.09510 0.68400 0.82100 0.07800  -0.03190 0.16690  931  ILE B CD1 
1028 N N   . GLY B 23  ? 0.74630 0.59910 0.64010 0.04030  -0.02650 0.09850  932  GLY B N   
1029 C CA  . GLY B 23  ? 0.69550 0.62430 0.61660 0.03860  -0.03200 0.07990  932  GLY B CA  
1030 C C   . GLY B 23  ? 0.77900 0.71460 0.72660 0.00690  -0.02080 0.07840  932  GLY B C   
1031 O O   . GLY B 23  ? 0.74530 0.71890 0.70990 0.01260  -0.02290 0.06860  932  GLY B O   
1032 N N   . LYS B 24  ? 0.83340 0.73340 0.78090 -0.02260 -0.01020 0.08690  933  LYS B N   
1033 C CA  . LYS B 24  ? 0.63270 0.52640 0.59710 -0.05310 -0.00050 0.08700  933  LYS B CA  
1034 C C   . LYS B 24  ? 0.68490 0.54140 0.65360 -0.04390 0.00570  0.09550  933  LYS B C   
1035 O O   . LYS B 24  ? 0.69730 0.57170 0.68430 -0.05570 0.00900  0.09050  933  LYS B O   
1036 C CB  . LYS B 24  ? 0.60730 0.46500 0.56000 -0.07650 0.00550  0.09260  933  LYS B CB  
1037 C CG  . LYS B 24  ? 0.64210 0.52740 0.58480 -0.09080 -0.00160 0.08350  933  LYS B CG  
1038 C CD  . LYS B 24  ? 0.64000 0.48310 0.56390 -0.11110 0.00180  0.08620  933  LYS B CD  
1039 C CE  . LYS B 24  ? 0.79360 0.65520 0.69990 -0.12130 -0.00720 0.07760  933  LYS B CE  
1040 N NZ  . LYS B 24  ? 1.04030 0.85230 0.91970 -0.13610 -0.00640 0.07830  933  LYS B NZ  
1041 N N   . ILE B 25  ? 0.60580 0.41180 0.55500 -0.02710 0.00710  0.10820  934  ILE B N   
1042 C CA  . ILE B 25  ? 0.69800 0.46310 0.64370 -0.02070 0.01140  0.11710  934  ILE B CA  
1043 C C   . ILE B 25  ? 0.71530 0.50320 0.66340 0.00380  0.00160  0.10720  934  ILE B C   
1044 O O   . ILE B 25  ? 0.61170 0.39220 0.57040 0.00050  0.00520  0.10640  934  ILE B O   
1045 C CB  . ILE B 25  ? 0.61060 0.31890 0.52620 -0.01390 0.01340  0.13320  934  ILE B CB  
1046 C CG1 . ILE B 25  ? 0.69760 0.39230 0.61400 -0.03620 0.02480  0.14100  934  ILE B CG1 
1047 C CG2 . ILE B 25  ? 0.62990 0.29560 0.53310 -0.00780 0.01360  0.14080  934  ILE B CG2 
1048 C CD1 . ILE B 25  ? 0.62930 0.29130 0.51550 -0.03210 0.02630  0.15400  934  ILE B CD1 
1049 N N   . GLN B 26  ? 0.64640 0.46380 0.58340 0.03070  -0.01120 0.09840  935  GLN B N   
1050 C CA  . GLN B 26  ? 0.68360 0.53370 0.62010 0.06270  -0.02310 0.08470  935  GLN B CA  
1051 C C   . GLN B 26  ? 0.72460 0.63770 0.69790 0.04350  -0.01760 0.07170  935  GLN B C   
1052 O O   . GLN B 26  ? 0.80700 0.71620 0.78440 0.05410  -0.01810 0.06780  935  GLN B O   
1053 C CB  . GLN B 26  ? 0.70080 0.59190 0.62360 0.09410  -0.03820 0.07390  935  GLN B CB  
1054 C CG  . GLN B 26  ? 0.70450 0.52920 0.58140 0.12010  -0.04730 0.08590  935  GLN B CG  
1055 C CD  . GLN B 26  ? 0.82720 0.70140 0.69310 0.15230  -0.06310 0.07310  935  GLN B CD  
1056 O OE1 . GLN B 26  ? 0.85470 0.78020 0.73780 0.13600  -0.06120 0.06780  935  GLN B OE1 
1057 N NE2 . GLN B 26  ? 0.96760 0.82580 0.80080 0.19990  -0.08040 0.06680  935  GLN B NE2 
1058 N N   . ASP B 27  ? 0.60300 0.56790 0.59680 0.01430  -0.01350 0.06560  936  ASP B N   
1059 C CA  . ASP B 27  ? 0.58210 0.60770 0.60400 -0.01390 -0.00850 0.05460  936  ASP B CA  
1060 C C   . ASP B 27  ? 0.60880 0.58710 0.63780 -0.03340 0.00290  0.06430  936  ASP B C   
1061 O O   . ASP B 27  ? 0.70740 0.71900 0.75190 -0.03490 0.00410  0.05610  936  ASP B O   
1062 C CB  . ASP B 27  ? 0.61670 0.68130 0.64460 -0.04970 -0.00720 0.05030  936  ASP B CB  
1063 C CG  . ASP B 27  ? 0.86480 1.01690 0.89780 -0.03980 -0.01820 0.03350  936  ASP B CG  
1064 O OD1 . ASP B 27  ? 1.08770 1.26260 1.11540 0.00400  -0.02840 0.02620  936  ASP B OD1 
1065 O OD2 . ASP B 27  ? 0.85290 1.04900 0.89090 -0.07580 -0.01790 0.02730  936  ASP B OD2 
1066 N N   . SER B 28  ? 0.68310 0.59300 0.70090 -0.04600 0.01050  0.07980  937  SER B N   
1067 C CA  . SER B 28  ? 0.69970 0.56670 0.72320 -0.06330 0.02090  0.08900  937  SER B CA  
1068 C C   . SER B 28  ? 0.71040 0.55700 0.73130 -0.04020 0.01900  0.08970  937  SER B C   
1069 O O   . SER B 28  ? 0.54550 0.39940 0.58110 -0.05170 0.02390  0.08710  937  SER B O   
1070 C CB  . SER B 28  ? 0.67930 0.49120 0.68990 -0.07430 0.02780  0.10270  937  SER B CB  
1071 O OG  . SER B 28  ? 0.73220 0.49790 0.72620 -0.05600 0.02800  0.11350  937  SER B OG  
1072 N N   . LEU B 29  ? 0.72540 0.54160 0.72250 -0.00960 0.01090  0.09300  938  LEU B N   
1073 C CA  . LEU B 29  ? 0.64750 0.42700 0.62820 0.01410  0.00550  0.09380  938  LEU B CA  
1074 C C   . LEU B 29  ? 0.78140 0.62170 0.77880 0.03020  -0.00040 0.07530  938  LEU B C   
1075 O O   . LEU B 29  ? 0.77110 0.60060 0.77440 0.02850  0.00260  0.07360  938  LEU B O   
1076 C CB  . LEU B 29  ? 0.67230 0.40090 0.61180 0.04350  -0.00580 0.10030  938  LEU B CB  
1077 C CG  . LEU B 29  ? 0.73740 0.40170 0.65450 0.02600  0.00090  0.12010  938  LEU B CG  
1078 C CD1 . LEU B 29  ? 0.74310 0.35310 0.61090 0.05230  -0.01200 0.12720  938  LEU B CD1 
1079 C CD2 . LEU B 29  ? 0.76130 0.38630 0.68140 0.00240  0.01120  0.13040  938  LEU B CD2 
1080 N N   . SER B 30  ? 0.67160 0.58150 0.67740 0.04380  -0.00800 0.06080  939  SER B N   
1081 C CA  . SER B 30  ? 0.65230 0.63910 0.67310 0.06350  -0.01470 0.04030  939  SER B CA  
1082 C C   . SER B 30  ? 0.70500 0.73100 0.75690 0.02630  -0.00260 0.03720  939  SER B C   
1083 O O   . SER B 30  ? 0.70600 0.76670 0.76650 0.03930  -0.00440 0.02540  939  SER B O   
1084 C CB  . SER B 30  ? 0.68360 0.74830 0.70850 0.08040  -0.02450 0.02550  939  SER B CB  
1085 O OG  . SER B 30  ? 0.93250 1.07680 0.98830 0.04180  -0.01700 0.01790  939  SER B OG  
1086 N N   . SER B 31  ? 0.71810 0.73550 0.78100 -0.01650 0.00800  0.04700  940  SER B N   
1087 C CA  . SER B 31  ? 0.61600 0.65130 0.69780 -0.05580 0.01840  0.04760  940  SER B CA  
1088 C C   . SER B 31  ? 0.53890 0.51230 0.61830 -0.05560 0.02460  0.05720  940  SER B C   
1089 O O   . SER B 31  ? 0.54740 0.54650 0.64000 -0.06630 0.02850  0.05160  940  SER B O   
1090 C CB  . SER B 31  ? 0.45750 0.48480 0.53820 -0.09520 0.02380  0.05480  940  SER B CB  
1091 O OG  . SER B 31  ? 0.56850 0.66590 0.65270 -0.10320 0.01800  0.04340  940  SER B OG  
1092 N N   . THR B 32  ? 0.69710 0.59610 0.75880 -0.04610 0.02540  0.07090  941  THR B N   
1093 C CA  . THR B 32  ? 0.68420 0.52600 0.74050 -0.04670 0.03010  0.07990  941  THR B CA  
1094 C C   . THR B 32  ? 0.61490 0.46760 0.66640 -0.01720 0.02240  0.06850  941  THR B C   
1095 O O   . THR B 32  ? 0.68880 0.54510 0.75120 -0.02620 0.02700  0.06590  941  THR B O   
1096 C CB  . THR B 32  ? 0.69870 0.47010 0.73280 -0.04440 0.03130  0.09580  941  THR B CB  
1097 O OG1 . THR B 32  ? 0.60480 0.37360 0.64170 -0.06520 0.03720  0.10320  941  THR B OG1 
1098 C CG2 . THR B 32  ? 0.53260 0.25540 0.56220 -0.05330 0.03680  0.10470  941  THR B CG2 
1099 N N   . ALA B 33  ? 0.60330 0.46080 0.63550 0.01970  0.00970  0.06060  942  ALA B N   
1100 C CA  . ALA B 33  ? 0.67640 0.54270 0.69480 0.05880  -0.00180 0.04610  942  ALA B CA  
1101 C C   . ALA B 33  ? 0.67750 0.62870 0.72670 0.05170  0.00220  0.02980  942  ALA B C   
1102 O O   . ALA B 33  ? 0.62480 0.56650 0.67220 0.06080  0.00170  0.02430  942  ALA B O   
1103 C CB  . ALA B 33  ? 0.73550 0.60880 0.72770 0.10210  -0.01790 0.03710  942  ALA B CB  
1104 N N   . SER B 34  ? 0.67490 0.70580 0.74800 0.03280  0.00570  0.02270  943  SER B N   
1105 C CA  . SER B 34  ? 0.61810 0.74420 0.71840 0.01670  0.01010  0.00760  943  SER B CA  
1106 C C   . SER B 34  ? 0.55230 0.65110 0.66350 -0.01770 0.02210  0.01650  943  SER B C   
1107 O O   . SER B 34  ? 0.56780 0.70080 0.68680 -0.01040 0.02260  0.00570  943  SER B O   
1108 C CB  . SER B 34  ? 0.53670 0.73410 0.65150 -0.01000 0.01190  0.00360  943  SER B CB  
1109 O OG  . SER B 34  ? 0.55620 0.84290 0.69240 -0.03830 0.01740  -0.00780 943  SER B OG  
1110 N N   . ALA B 35  ? 0.69660 0.73450 0.80570 -0.04970 0.03040  0.03480  944  ALA B N   
1111 C CA  . ALA B 35  ? 0.61000 0.61980 0.72650 -0.08260 0.04060  0.04400  944  ALA B CA  
1112 C C   . ALA B 35  ? 0.60460 0.56910 0.71420 -0.06230 0.03970  0.04490  944  ALA B C   
1113 O O   . ALA B 35  ? 0.60380 0.58560 0.72340 -0.07500 0.04450  0.04140  944  ALA B O   
1114 C CB  . ALA B 35  ? 0.68130 0.63640 0.79130 -0.10930 0.04640  0.06060  944  ALA B CB  
1115 N N   . LEU B 36  ? 0.66370 0.56940 0.75190 -0.03430 0.03290  0.04960  945  LEU B N   
1116 C CA  . LEU B 36  ? 0.72690 0.57680 0.79820 -0.01730 0.02950  0.05100  945  LEU B CA  
1117 C C   . LEU B 36  ? 0.78910 0.68280 0.85780 0.01560  0.02090  0.03090  945  LEU B C   
1118 O O   . LEU B 36  ? 0.76700 0.64370 0.83370 0.01660  0.02190  0.02800  945  LEU B O   
1119 C CB  . LEU B 36  ? 0.67100 0.44360 0.71030 -0.00230 0.02300  0.06240  945  LEU B CB  
1120 C CG  . LEU B 36  ? 0.60900 0.34140 0.65010 -0.03330 0.03250  0.08130  945  LEU B CG  
1121 C CD1 . LEU B 36  ? 0.62270 0.29500 0.63050 -0.02090 0.02600  0.09170  945  LEU B CD1 
1122 C CD2 . LEU B 36  ? 0.62840 0.33500 0.67840 -0.05850 0.04160  0.08920  945  LEU B CD2 
1123 N N   . GLY B 37  ? 0.68820 0.64270 0.75700 0.04270  0.01240  0.01570  946  GLY B N   
1124 C CA  . GLY B 37  ? 0.77560 0.79410 0.84480 0.07760  0.00410  -0.00750 946  GLY B CA  
1125 C C   . GLY B 37  ? 0.73190 0.82200 0.83170 0.04900  0.01520  -0.01450 946  GLY B C   
1126 O O   . GLY B 37  ? 0.57820 0.67880 0.67420 0.06780  0.01240  -0.02640 946  GLY B O   
1127 N N   . LYS B 38  ? 0.69260 0.82670 0.81620 0.00410  0.02620  -0.00770 947  LYS B N   
1128 C CA  . LYS B 38  ? 0.61860 0.82200 0.76400 -0.02990 0.03600  -0.01310 947  LYS B CA  
1129 C C   . LYS B 38  ? 0.63020 0.77000 0.77340 -0.04810 0.04310  -0.00170 947  LYS B C   
1130 O O   . LYS B 38  ? 0.76140 0.94300 0.91220 -0.04970 0.04580  -0.01170 947  LYS B O   
1131 C CB  . LYS B 38  ? 0.38400 0.63260 0.54160 -0.07600 0.04300  -0.00730 947  LYS B CB  
1132 C CG  . LYS B 38  ? 0.38780 0.72440 0.55150 -0.06320 0.03650  -0.02220 947  LYS B CG  
1133 C CD  . LYS B 38  ? 0.37570 0.74810 0.54450 -0.11370 0.04180  -0.01590 947  LYS B CD  
1134 C CE  . LYS B 38  ? 0.40260 0.87610 0.57930 -0.10340 0.03510  -0.03270 947  LYS B CE  
1135 N NZ  . LYS B 38  ? 0.37600 0.87340 0.55080 -0.15700 0.03880  -0.02590 947  LYS B NZ  
1136 N N   . LEU B 39  ? 0.65300 0.70260 0.78610 -0.05940 0.04560  0.01710  948  LEU B N   
1137 C CA  . LEU B 39  ? 0.65130 0.63770 0.78010 -0.07070 0.05030  0.02720  948  LEU B CA  
1138 C C   . LEU B 39  ? 0.79570 0.76290 0.91000 -0.03350 0.04210  0.01580  948  LEU B C   
1139 O O   . LEU B 39  ? 0.85340 0.82980 0.97310 -0.04080 0.04570  0.01180  948  LEU B O   
1140 C CB  . LEU B 39  ? 0.53730 0.44490 0.65650 -0.08330 0.05280  0.04640  948  LEU B CB  
1141 C CG  . LEU B 39  ? 0.51620 0.42500 0.64320 -0.12000 0.06040  0.05790  948  LEU B CG  
1142 C CD1 . LEU B 39  ? 0.46630 0.30830 0.58340 -0.12380 0.06190  0.07330  948  LEU B CD1 
1143 C CD2 . LEU B 39  ? 0.61820 0.53980 0.75250 -0.14920 0.06730  0.05970  948  LEU B CD2 
1144 N N   . GLN B 40  ? 0.79600 0.73210 0.88690 0.00540  0.02990  0.01050  949  GLN B N   
1145 C CA  . GLN B 40  ? 0.79370 0.69260 0.85670 0.04440  0.01810  -0.00100 949  GLN B CA  
1146 C C   . GLN B 40  ? 0.75760 0.74010 0.83350 0.06110  0.01720  -0.02300 949  GLN B C   
1147 O O   . GLN B 40  ? 0.73610 0.69730 0.80460 0.06530  0.01670  -0.02750 949  GLN B O   
1148 C CB  . GLN B 40  ? 0.87850 0.73380 0.90480 0.08740  0.00190  -0.00550 949  GLN B CB  
1149 C CG  . GLN B 40  ? 0.80520 0.61000 0.79040 0.13000  -0.01380 -0.01880 949  GLN B CG  
1150 C CD  . GLN B 40  ? 0.98200 0.71150 0.91440 0.16970  -0.03260 -0.01940 949  GLN B CD  
1151 O OE1 . GLN B 40  ? 1.02260 0.77780 0.95200 0.18850  -0.03830 -0.02220 949  GLN B OE1 
1152 N NE2 . GLN B 40  ? 1.08290 0.71470 0.96680 0.18310  -0.04430 -0.01750 949  GLN B NE2 
1153 N N   . ASP B 41  ? 0.73990 0.81970 0.83410 0.06840  0.01730  -0.03660 950  ASP B N   
1154 C CA  . ASP B 41  ? 0.71190 0.89380 0.81940 0.08500  0.01670  -0.06020 950  ASP B CA  
1155 C C   . ASP B 41  ? 0.68190 0.88320 0.80970 0.04170  0.03070  -0.05410 950  ASP B C   
1156 O O   . ASP B 41  ? 0.82180 1.02990 0.94350 0.05890  0.02860  -0.06580 950  ASP B O   
1157 C CB  . ASP B 41  ? 0.71840 1.01130 0.84410 0.08990  0.01590  -0.07370 950  ASP B CB  
1158 C CG  . ASP B 41  ? 0.92820 1.21630 1.03050 0.14510  -0.00110 -0.08580 950  ASP B CG  
1159 O OD1 . ASP B 41  ? 0.85790 1.04710 0.92250 0.18170  -0.01400 -0.08360 950  ASP B OD1 
1160 O OD2 . ASP B 41  ? 1.03440 1.41590 1.15200 0.14990  -0.00260 -0.09710 950  ASP B OD2 
1161 N N   . VAL B 42  ? 0.63300 0.83350 0.77800 -0.01070 0.04310  -0.03620 951  VAL B N   
1162 C CA  . VAL B 42  ? 0.59130 0.81350 0.74970 -0.05370 0.05500  -0.03020 951  VAL B CA  
1163 C C   . VAL B 42  ? 0.57510 0.71110 0.72250 -0.05360 0.05560  -0.02070 951  VAL B C   
1164 O O   . VAL B 42  ? 0.74600 0.90600 0.89800 -0.06500 0.06040  -0.02510 951  VAL B O   
1165 C CB  . VAL B 42  ? 0.42170 0.65110 0.58900 -0.10620 0.06420  -0.01400 951  VAL B CB  
1166 C CG1 . VAL B 42  ? 0.40600 0.63340 0.57490 -0.14830 0.07360  -0.00520 951  VAL B CG1 
1167 C CG2 . VAL B 42  ? 0.47890 0.80280 0.65580 -0.11370 0.06360  -0.02470 951  VAL B CG2 
1168 N N   . VAL B 43  ? 0.66750 0.71150 0.79980 -0.04530 0.05140  -0.00780 952  VAL B N   
1169 C CA  . VAL B 43  ? 0.65380 0.62130 0.77470 -0.04930 0.05160  0.00090  952  VAL B CA  
1170 C C   . VAL B 43  ? 0.72890 0.70150 0.83470 -0.01340 0.04300  -0.01780 952  VAL B C   
1171 O O   . VAL B 43  ? 0.85470 0.81470 0.96100 -0.02460 0.04640  -0.01760 952  VAL B O   
1172 C CB  . VAL B 43  ? 0.52350 0.40200 0.62780 -0.04890 0.04810  0.01660  952  VAL B CB  
1173 C CG1 . VAL B 43  ? 0.53070 0.34080 0.61660 -0.04610 0.04470  0.01990  952  VAL B CG1 
1174 C CG2 . VAL B 43  ? 0.54760 0.41580 0.66540 -0.08490 0.05740  0.03470  952  VAL B CG2 
1175 N N   . ASN B 44  ? 0.71470 0.70390 0.80420 0.03090  0.03100  -0.03420 953  ASN B N   
1176 C CA  . ASN B 44  ? 0.78200 0.76470 0.84550 0.07710  0.01810  -0.05510 953  ASN B CA  
1177 C C   . ASN B 44  ? 0.72340 0.80900 0.80800 0.07780  0.02400  -0.07330 953  ASN B C   
1178 O O   . ASN B 44  ? 0.74420 0.81390 0.81770 0.08740  0.02180  -0.08160 953  ASN B O   
1179 C CB  . ASN B 44  ? 0.77480 0.73540 0.80660 0.12800  0.00100  -0.06670 953  ASN B CB  
1180 C CG  . ASN B 44  ? 0.77440 0.61530 0.77120 0.12790  -0.00710 -0.04950 953  ASN B CG  
1181 O OD1 . ASN B 44  ? 0.77610 0.54110 0.75960 0.10550  -0.00530 -0.03650 953  ASN B OD1 
1182 N ND2 . ASN B 44  ? 0.99140 0.81820 0.97040 0.15190  -0.01650 -0.04970 953  ASN B ND2 
1183 N N   . GLN B 45  ? 0.73570 0.92440 0.84750 0.06410  0.03150  -0.07900 954  GLN B N   
1184 C CA  . GLN B 45  ? 0.69060 0.98880 0.82320 0.05160  0.03980  -0.09330 954  GLN B CA  
1185 C C   . GLN B 45  ? 0.76740 1.03380 0.90620 0.01040  0.05060  -0.07960 954  GLN B C   
1186 O O   . GLN B 45  ? 0.64830 0.94820 0.78460 0.02170  0.05080  -0.09360 954  GLN B O   
1187 C CB  . GLN B 45  ? 0.65000 1.04970 0.80790 0.02120  0.04840  -0.09350 954  GLN B CB  
1188 C CG  . GLN B 45  ? 0.69230 1.16040 0.84920 0.06380  0.03820  -0.11300 954  GLN B CG  
1189 C CD  . GLN B 45  ? 0.90530 1.51560 1.08750 0.03780  0.04650  -0.12410 954  GLN B CD  
1190 O OE1 . GLN B 45  ? 0.94370 1.58500 1.13950 -0.02080 0.05990  -0.11200 954  GLN B OE1 
1191 N NE2 . GLN B 45  ? 0.96140 1.66020 1.14530 0.08060  0.03720  -0.14770 954  GLN B NE2 
1192 N N   . ASN B 46  ? 0.82190 1.02800 0.96630 -0.03250 0.05830  -0.05450 955  ASN B N   
1193 C CA  . ASN B 46  ? 0.72360 0.89570 0.87140 -0.07130 0.06730  -0.03990 955  ASN B CA  
1194 C C   . ASN B 46  ? 0.73570 0.83740 0.86590 -0.04800 0.06050  -0.04310 955  ASN B C   
1195 O O   . ASN B 46  ? 0.70650 0.81890 0.83820 -0.06090 0.06490  -0.04500 955  ASN B O   
1196 C CB  . ASN B 46  ? 0.69250 0.81400 0.84450 -0.11170 0.07370  -0.01530 955  ASN B CB  
1197 C CG  . ASN B 46  ? 0.68950 0.87230 0.85110 -0.14710 0.08060  -0.01070 955  ASN B CG  
1198 O OD1 . ASN B 46  ? 0.65340 0.92780 0.82220 -0.14670 0.08200  -0.02540 955  ASN B OD1 
1199 N ND2 . ASN B 46  ? 0.67310 0.80750 0.83120 -0.17880 0.08410  0.00860  955  ASN B ND2 
1200 N N   . ALA B 47  ? 0.66750 0.69780 0.77680 -0.01720 0.04940  -0.04350 956  ALA B N   
1201 C CA  . ALA B 47  ? 0.73070 0.68850 0.81260 0.00570  0.03960  -0.04880 956  ALA B CA  
1202 C C   . ALA B 47  ? 0.85510 0.86700 0.92820 0.04010  0.03380  -0.07470 956  ALA B C   
1203 O O   . ALA B 47  ? 0.78440 0.78210 0.85210 0.03450  0.03480  -0.07790 956  ALA B O   
1204 C CB  . ALA B 47  ? 0.67110 0.54790 0.72290 0.03080  0.02690  -0.04570 956  ALA B CB  
1205 N N   . GLN B 48  ? 0.82720 0.90770 0.89960 0.07540  0.02800  -0.09390 957  GLN B N   
1206 C CA  . GLN B 48  ? 0.74390 0.88710 0.80530 0.11830  0.02060  -0.12300 957  GLN B CA  
1207 C C   . GLN B 48  ? 0.67980 0.91260 0.76900 0.08580  0.03540  -0.12590 957  GLN B C   
1208 O O   . GLN B 48  ? 0.69800 0.93760 0.77500 0.10400  0.03200  -0.14060 957  GLN B O   
1209 C CB  . GLN B 48  ? 0.94040 1.14800 0.99590 0.16560  0.01060  -0.14370 957  GLN B CB  
1210 C CG  . GLN B 48  ? 1.09190 1.34980 1.12540 0.22500  -0.00200 -0.17720 957  GLN B CG  
1211 C CD  . GLN B 48  ? 1.10490 1.26970 1.10090 0.24420  -0.01240 -0.18250 957  GLN B CD  
1212 O OE1 . GLN B 48  ? 1.20170 1.24100 1.15920 0.25430  -0.02490 -0.17320 957  GLN B OE1 
1213 N NE2 . GLN B 48  ? 0.97840 1.20530 0.98240 0.24590  -0.00740 -0.19740 957  GLN B NE2 
1214 N N   . ALA B 49  ? 0.64100 0.93500 0.76040 0.03880  0.04990  -0.11260 958  ALA B N   
1215 C CA  . ALA B 49  ? 0.61690 0.98290 0.75470 -0.00310 0.06400  -0.11000 958  ALA B CA  
1216 C C   . ALA B 49  ? 0.55900 0.85200 0.68780 -0.02120 0.06610  -0.09900 958  ALA B C   
1217 O O   . ALA B 49  ? 0.49520 0.83640 0.62470 -0.02560 0.07040  -0.10890 958  ALA B O   
1218 C CB  . ALA B 49  ? 0.61100 1.00910 0.76740 -0.05590 0.07550  -0.09130 958  ALA B CB  
1219 N N   . LEU B 50  ? 0.65110 0.83870 0.77200 -0.03250 0.06350  -0.07970 959  LEU B N   
1220 C CA  . LEU B 50  ? 0.67430 0.79440 0.78710 -0.04940 0.06450  -0.06940 959  LEU B CA  
1221 C C   . LEU B 50  ? 0.73510 0.83130 0.82400 -0.00830 0.05310  -0.08970 959  LEU B C   
1222 O O   . LEU B 50  ? 0.77540 0.88490 0.86310 -0.01740 0.05630  -0.09380 959  LEU B O   
1223 C CB  . LEU B 50  ? 0.76010 0.78680 0.86970 -0.06700 0.06330  -0.04710 959  LEU B CB  
1224 C CG  . LEU B 50  ? 0.71350 0.68330 0.81930 -0.09020 0.06520  -0.03480 959  LEU B CG  
1225 C CD1 . LEU B 50  ? 0.67980 0.70250 0.79540 -0.11660 0.07440  -0.03400 959  LEU B CD1 
1226 C CD2 . LEU B 50  ? 0.67260 0.58390 0.78310 -0.11480 0.06770  -0.01230 959  LEU B CD2 
1227 N N   . ASN B 51  ? 0.75310 0.80980 0.81780 0.03600  0.03890  -0.10200 960  ASN B N   
1228 C CA  . ASN B 51  ? 0.77270 0.78310 0.80020 0.08010  0.02330  -0.12210 960  ASN B CA  
1229 C C   . ASN B 51  ? 0.80030 0.90710 0.82900 0.10940  0.02310  -0.14950 960  ASN B C   
1230 O O   . ASN B 51  ? 0.88780 0.96630 0.89200 0.13010  0.01520  -0.16340 960  ASN B O   
1231 C CB  . ASN B 51  ? 0.89630 0.83480 0.88680 0.12170  0.00570  -0.12850 960  ASN B CB  
1232 C CG  . ASN B 51  ? 0.89920 0.73420 0.87890 0.09380  0.00420  -0.10350 960  ASN B CG  
1233 O OD1 . ASN B 51  ? 0.85650 0.64450 0.83850 0.05930  0.00890  -0.08890 960  ASN B OD1 
1234 N ND2 . ASN B 51  ? 0.83290 0.63750 0.80000 0.10880  -0.00270 -0.09900 960  ASN B ND2 
1235 N N   . THR B 52  ? 0.67640 0.89650 0.73070 0.11020  0.03100  -0.15810 961  THR B N   
1236 C CA  . THR B 52  ? 0.63230 0.97170 0.69410 0.13060  0.03410  -0.18380 961  THR B CA  
1237 C C   . THR B 52  ? 0.74540 1.11510 0.82450 0.08170  0.04910  -0.17300 961  THR B C   
1238 O O   . THR B 52  ? 0.77360 1.17600 0.84190 0.10090  0.04720  -0.19150 961  THR B O   
1239 C CB  . THR B 52  ? 0.59870 1.05700 0.68240 0.13900  0.03840  -0.19500 961  THR B CB  
1240 O OG1 . THR B 52  ? 0.82350 1.25180 0.88370 0.19570  0.02110  -0.20930 961  THR B OG1 
1241 C CG2 . THR B 52  ? 0.67900 1.28000 0.77560 0.14740  0.04520  -0.21910 961  THR B CG2 
1242 N N   . LEU B 53  ? 0.75710 1.11240 0.85720 0.02370  0.06200  -0.14490 962  LEU B N   
1243 C CA  . LEU B 53  ? 0.81270 1.17800 0.92180 -0.02540 0.07430  -0.13030 962  LEU B CA  
1244 C C   . LEU B 53  ? 0.73130 1.01650 0.82060 -0.01330 0.06720  -0.13200 962  LEU B C   
1245 O O   . LEU B 53  ? 0.75580 1.08140 0.84250 -0.01870 0.07120  -0.14050 962  LEU B O   
1246 C CB  . LEU B 53  ? 0.46910 0.79780 0.59130 -0.07850 0.08330  -0.09980 962  LEU B CB  
1247 C CG  . LEU B 53  ? 0.43200 0.74660 0.55350 -0.12460 0.09220  -0.08270 962  LEU B CG  
1248 C CD1 . LEU B 53  ? 0.55930 0.98110 0.68350 -0.14660 0.10190  -0.09130 962  LEU B CD1 
1249 C CD2 . LEU B 53  ? 0.40220 0.65940 0.52690 -0.16490 0.09640  -0.05470 962  LEU B CD2 
1250 N N   . VAL B 54  ? 0.74760 0.92580 0.82100 -0.00030 0.05670  -0.12440 963  VAL B N   
1251 C CA  . VAL B 54  ? 0.78890 0.88340 0.83990 0.00440  0.04880  -0.12430 963  VAL B CA  
1252 C C   . VAL B 54  ? 0.81070 0.93420 0.83840 0.04950  0.03930  -0.15450 963  VAL B C   
1253 O O   . VAL B 54  ? 0.75690 0.89150 0.78180 0.03890  0.04240  -0.15820 963  VAL B O   
1254 C CB  . VAL B 54  ? 0.90550 0.88810 0.93850 0.00790  0.03850  -0.11220 963  VAL B CB  
1255 C CG1 . VAL B 54  ? 0.85470 0.75760 0.85070 0.02810  0.02430  -0.12260 963  VAL B CG1 
1256 C CG2 . VAL B 54  ? 0.85350 0.80370 0.90750 -0.04010 0.04820  -0.08300 963  VAL B CG2 
1257 N N   . LYS B 55  ? 0.88450 1.02430 0.89420 0.10060  0.02780  -0.17650 964  LYS B N   
1258 C CA  . LYS B 55  ? 0.87340 1.03660 0.85310 0.15470  0.01530  -0.20930 964  LYS B CA  
1259 C C   . LYS B 55  ? 0.84960 1.13520 0.85250 0.14210  0.02900  -0.22030 964  LYS B C   
1260 O O   . LYS B 55  ? 1.02930 1.30920 1.01470 0.15360  0.02540  -0.23330 964  LYS B O   
1261 C CB  . LYS B 55  ? 0.89810 1.07410 0.85510 0.21530  0.00030  -0.23190 964  LYS B CB  
1262 C CG  . LYS B 55  ? 1.13730 1.17830 1.05270 0.23700  -0.01820 -0.22610 964  LYS B CG  
1263 C CD  . LYS B 55  ? 1.25880 1.31190 1.14890 0.29750  -0.03380 -0.24660 964  LYS B CD  
1264 C CE  . LYS B 55  ? 1.23950 1.19340 1.11110 0.29350  -0.04240 -0.22790 964  LYS B CE  
1265 N NZ  . LYS B 55  ? 1.10170 1.12770 0.98840 0.31930  -0.04290 -0.23490 964  LYS B NZ  
1266 N N   . GLN B 56  ? 0.86200 1.25240 0.89940 0.11480  0.04410  -0.21420 965  GLN B N   
1267 C CA  . GLN B 56  ? 0.82970 1.34680 0.88500 0.09630  0.05790  -0.22390 965  GLN B CA  
1268 C C   . GLN B 56  ? 0.80140 1.28640 0.86130 0.04440  0.06810  -0.20310 965  GLN B C   
1269 O O   . GLN B 56  ? 0.78240 1.34190 0.84250 0.03800  0.07490  -0.21420 965  GLN B O   
1270 C CB  . GLN B 56  ? 0.93300 1.56340 1.01720 0.07240  0.07010  -0.22090 965  GLN B CB  
1271 C CG  . GLN B 56  ? 1.07770 1.79600 1.15920 0.13070  0.06150  -0.25230 965  GLN B CG  
1272 C CD  . GLN B 56  ? 1.09090 1.92550 1.16710 0.16280  0.06210  -0.28460 965  GLN B CD  
1273 O OE1 . GLN B 56  ? 1.00000 1.80970 1.04670 0.22560  0.04640  -0.31130 965  GLN B OE1 
1274 N NE2 . GLN B 56  ? 1.08630 2.04860 1.18620 0.11880  0.07960  -0.28300 965  GLN B NE2 
1275 N N   . LEU B 57  ? 0.81510 1.19890 0.87690 0.01050  0.06870  -0.17520 966  LEU B N   
1276 C CA  . LEU B 57  ? 0.71760 1.06370 0.78080 -0.03400 0.07580  -0.15530 966  LEU B CA  
1277 C C   . LEU B 57  ? 0.83100 1.12180 0.86940 -0.00750 0.06500  -0.16930 966  LEU B C   
1278 O O   . LEU B 57  ? 0.87120 1.18960 0.90760 -0.02580 0.07070  -0.16960 966  LEU B O   
1279 C CB  . LEU B 57  ? 0.60050 0.86360 0.67240 -0.07010 0.07780  -0.12480 966  LEU B CB  
1280 C CG  . LEU B 57  ? 0.53420 0.83980 0.62450 -0.11080 0.08950  -0.10590 966  LEU B CG  
1281 C CD1 . LEU B 57  ? 0.53990 0.75680 0.63410 -0.13410 0.08840  -0.08010 966  LEU B CD1 
1282 C CD2 . LEU B 57  ? 0.51580 0.88760 0.60610 -0.15090 0.10120  -0.09970 966  LEU B CD2 
1283 N N   . SER B 58  ? 0.85610 1.06570 0.87140 0.03090  0.04910  -0.17920 967  SER B N   
1284 C CA  . SER B 58  ? 0.88590 1.03290 0.86640 0.06140  0.03470  -0.19660 967  SER B CA  
1285 C C   . SER B 58  ? 0.83580 1.07400 0.80760 0.09350  0.03480  -0.22600 967  SER B C   
1286 O O   . SER B 58  ? 0.81960 1.05290 0.78050 0.08740  0.03460  -0.23120 967  SER B O   
1287 C CB  . SER B 58  ? 1.01680 1.06710 0.96290 0.09920  0.01570  -0.20480 967  SER B CB  
1288 O OG  . SER B 58  ? 1.06570 1.04630 1.02110 0.06970  0.01680  -0.17870 967  SER B OG  
1289 N N   . SER B 59  ? 0.79280 1.11870 0.76980 0.12670  0.03520  -0.24530 968  SER B N   
1290 C CA  . SER B 59  ? 0.79440 1.23300 0.76640 0.16100  0.03640  -0.27640 968  SER B CA  
1291 C C   . SER B 59  ? 0.69250 1.20890 0.68640 0.11100  0.05480  -0.26570 968  SER B C   
1292 O O   . SER B 59  ? 0.78310 1.32970 0.76160 0.12690  0.05320  -0.28380 968  SER B O   
1293 C CB  . SER B 59  ? 0.84810 1.38480 0.83080 0.19450  0.03640  -0.29440 968  SER B CB  
1294 O OG  . SER B 59  ? 0.93710 1.41080 0.88300 0.26080  0.01440  -0.31630 968  SER B OG  
1295 N N   . ASN B 60  ? 0.73790 1.27890 0.76050 0.05280  0.07040  -0.23710 969  ASN B N   
1296 C CA  . ASN B 60  ? 0.73890 1.35060 0.77380 0.00070  0.08710  -0.22440 969  ASN B CA  
1297 C C   . ASN B 60  ? 0.73990 1.27150 0.75990 -0.01590 0.08410  -0.21410 969  ASN B C   
1298 O O   . ASN B 60  ? 0.89670 1.48660 0.91090 -0.02740 0.09070  -0.22090 969  ASN B O   
1299 C CB  . ASN B 60  ? 0.75320 1.38710 0.80950 -0.05760 0.10060  -0.19520 969  ASN B CB  
1300 C CG  . ASN B 60  ? 0.69860 1.44650 0.77090 -0.05550 0.10740  -0.20570 969  ASN B CG  
1301 O OD1 . ASN B 60  ? 0.58720 1.41270 0.65790 -0.00690 0.10260  -0.23650 969  ASN B OD1 
1302 N ND2 . ASN B 60  ? 0.60150 1.36080 0.68640 -0.10660 0.11710  -0.18130 969  ASN B ND2 
1303 N N   . PHE B 61  ? 0.79110 1.20100 0.80460 -0.01890 0.07490  -0.19880 970  PHE B N   
1304 C CA  . PHE B 61  ? 0.80120 1.13600 0.80270 -0.03810 0.07140  -0.18780 970  PHE B CA  
1305 C C   . PHE B 61  ? 0.81080 1.13240 0.78410 0.00520  0.05910  -0.21650 970  PHE B C   
1306 O O   . PHE B 61  ? 0.78150 1.10630 0.74600 -0.00860 0.06080  -0.21710 970  PHE B O   
1307 C CB  . PHE B 61  ? 0.79800 1.02170 0.80150 -0.05390 0.06490  -0.16550 970  PHE B CB  
1308 C CG  . PHE B 61  ? 0.80770 1.02920 0.83240 -0.10040 0.07580  -0.13530 970  PHE B CG  
1309 C CD1 . PHE B 61  ? 0.70040 0.95490 0.72780 -0.14070 0.08600  -0.11980 970  PHE B CD1 
1310 C CD2 . PHE B 61  ? 0.78690 0.96660 0.82250 -0.10260 0.07410  -0.12250 970  PHE B CD2 
1311 C CE1 . PHE B 61  ? 0.76730 1.00750 0.80360 -0.17970 0.09280  -0.09320 970  PHE B CE1 
1312 C CE2 . PHE B 61  ? 0.77080 0.94390 0.82070 -0.14150 0.08230  -0.09670 970  PHE B CE2 
1313 C CZ  . PHE B 61  ? 0.76960 0.96980 0.81780 -0.17880 0.09090  -0.08250 970  PHE B CZ  
1314 N N   . GLY B 62  ? 0.74290 1.04360 0.69710 0.05760  0.04550  -0.23990 971  GLY B N   
1315 C CA  . GLY B 62  ? 0.80060 1.09030 0.71870 0.10860  0.03090  -0.27250 971  GLY B CA  
1316 C C   . GLY B 62  ? 0.85910 1.26930 0.78070 0.11580  0.04050  -0.29150 971  GLY B C   
1317 O O   . GLY B 62  ? 0.88740 1.28180 0.78600 0.12720  0.03460  -0.30520 971  GLY B O   
1318 N N   . ALA B 63  ? 0.71700 1.24660 0.66440 0.10730  0.05460  -0.29310 972  ALA B N   
1319 C CA  . ALA B 63  ? 0.71000 1.37750 0.66360 0.10580  0.06680  -0.30970 972  ALA B CA  
1320 C C   . ALA B 63  ? 0.68390 1.35830 0.64430 0.04580  0.08010  -0.28620 972  ALA B C   
1321 O O   . ALA B 63  ? 0.69900 1.43680 0.64770 0.05220  0.08350  -0.30260 972  ALA B O   
1322 C CB  . ALA B 63  ? 0.68330 1.47140 0.66200 0.10170  0.07820  -0.31330 972  ALA B CB  
1323 N N   . ILE B 64  ? 0.67720 1.28940 0.65210 -0.00690 0.08630  -0.25060 973  ILE B N   
1324 C CA  . ILE B 64  ? 0.65830 1.26630 0.63390 -0.06390 0.09690  -0.22510 973  ILE B CA  
1325 C C   . ILE B 64  ? 0.83140 1.36440 0.78600 -0.05270 0.08650  -0.23000 973  ILE B C   
1326 O O   . ILE B 64  ? 0.80070 1.37710 0.74510 -0.06930 0.09240  -0.23170 973  ILE B O   
1327 C CB  . ILE B 64  ? 0.62660 1.17890 0.61670 -0.11260 0.10230  -0.18880 973  ILE B CB  
1328 C CG1 . ILE B 64  ? 0.62110 1.25800 0.62660 -0.13820 0.11460  -0.18150 973  ILE B CG1 
1329 C CG2 . ILE B 64  ? 0.62260 1.13160 0.60240 -0.15640 0.10560  -0.16480 973  ILE B CG2 
1330 C CD1 . ILE B 64  ? 0.58240 1.15440 0.59920 -0.16960 0.11580  -0.15250 973  ILE B CD1 
1331 N N   . SER B 65  ? 0.90670 1.33140 0.85250 -0.03020 0.07150  -0.23090 974  SER B N   
1332 C CA  . SER B 65  ? 0.92060 1.26430 0.84530 -0.02620 0.06000  -0.23350 974  SER B CA  
1333 C C   . SER B 65  ? 0.92160 1.30540 0.81990 0.01670  0.05310  -0.26830 974  SER B C   
1334 O O   . SER B 65  ? 0.83420 1.20410 0.71780 0.00750  0.05090  -0.27050 974  SER B O   
1335 C CB  . SER B 65  ? 0.94600 1.17300 0.86440 -0.01910 0.04620  -0.22600 974  SER B CB  
1336 O OG  . SER B 65  ? 1.02510 1.21420 0.91470 0.03270  0.03000  -0.25410 974  SER B OG  
1337 N N   . SER B 66  ? 0.95300 1.39110 0.84460 0.06390  0.04940  -0.29570 975  SER B N   
1338 C CA  . SER B 66  ? 0.94570 1.44190 0.81090 0.11320  0.04290  -0.33330 975  SER B CA  
1339 C C   . SER B 66  ? 0.91020 1.51620 0.78540 0.08270  0.06000  -0.33140 975  SER B C   
1340 O O   . SER B 66  ? 1.07970 1.68200 0.93330 0.09120  0.05570  -0.34440 975  SER B O   
1341 C CB  . SER B 66  ? 1.02900 1.58180 0.88790 0.17000  0.03690  -0.36210 975  SER B CB  
1342 O OG  . SER B 66  ? 1.15430 1.59250 0.98250 0.21250  0.01510  -0.37320 975  SER B OG  
1343 N N   . VAL B 67  ? 0.76480 1.46100 0.66760 0.04510  0.07800  -0.31490 976  VAL B N   
1344 C CA  . VAL B 67  ? 0.74920 1.55610 0.65610 0.00740  0.09540  -0.31030 976  VAL B CA  
1345 C C   . VAL B 67  ? 0.83510 1.57400 0.73290 -0.03740 0.09690  -0.28490 976  VAL B C   
1346 O O   . VAL B 67  ? 0.88290 1.67340 0.76600 -0.04560 0.10180  -0.29230 976  VAL B O   
1347 C CB  . VAL B 67  ? 0.77630 1.67550 0.70750 -0.03250 0.11240  -0.29410 976  VAL B CB  
1348 C CG1 . VAL B 67  ? 0.86110 1.86200 0.78730 -0.08180 0.12960  -0.28520 976  VAL B CG1 
1349 C CG2 . VAL B 67  ? 0.72380 1.70240 0.66520 0.01500  0.11020  -0.32160 976  VAL B CG2 
1350 N N   . LEU B 68  ? 0.81520 1.44730 0.72050 -0.06330 0.09230  -0.25690 977  LEU B N   
1351 C CA  . LEU B 68  ? 0.83300 1.40350 0.73060 -0.10440 0.09250  -0.23160 977  LEU B CA  
1352 C C   . LEU B 68  ? 0.82180 1.34540 0.69670 -0.07650 0.07940  -0.25060 977  LEU B C   
1353 O O   . LEU B 68  ? 0.79100 1.32470 0.65300 -0.09970 0.08250  -0.24380 977  LEU B O   
1354 C CB  . LEU B 68  ? 0.82540 1.30160 0.73730 -0.12900 0.08900  -0.20220 977  LEU B CB  
1355 C CG  . LEU B 68  ? 0.72160 1.22500 0.64490 -0.17600 0.10180  -0.17360 977  LEU B CG  
1356 C CD1 . LEU B 68  ? 0.71860 1.12700 0.65430 -0.18990 0.09620  -0.14930 977  LEU B CD1 
1357 C CD2 . LEU B 68  ? 0.69100 1.22960 0.59510 -0.21860 0.11050  -0.15800 977  LEU B CD2 
1358 N N   . ASN B 69  ? 0.86790 1.33550 0.73270 -0.02990 0.06410  -0.27300 978  ASN B N   
1359 C CA  . ASN B 69  ? 0.93440 1.34260 0.76980 -0.00240 0.04830  -0.29330 978  ASN B CA  
1360 C C   . ASN B 69  ? 0.95080 1.44990 0.76730 0.02380  0.05120  -0.32230 978  ASN B C   
1361 O O   . ASN B 69  ? 0.99200 1.47080 0.78800 0.02200  0.04580  -0.32870 978  ASN B O   
1362 C CB  . ASN B 69  ? 1.01150 1.32540 0.83050 0.03590  0.02960  -0.30780 978  ASN B CB  
1363 C CG  . ASN B 69  ? 0.96950 1.19280 0.80420 0.00370  0.02660  -0.27840 978  ASN B CG  
1364 O OD1 . ASN B 69  ? 0.86070 1.04860 0.70070 -0.03260 0.02740  -0.25830 978  ASN B OD1 
1365 N ND2 . ASN B 69  ? 0.98890 1.18180 0.83070 0.01780  0.02310  -0.27640 978  ASN B ND2 
1366 N N   . ASP B 70  ? 0.95060 1.55330 0.77400 0.04690  0.05960  -0.33990 979  ASP B N   
1367 C CA  . ASP B 70  ? 0.96030 1.67820 0.77010 0.06830  0.06610  -0.36710 979  ASP B CA  
1368 C C   . ASP B 70  ? 0.92600 1.69170 0.73990 0.01070  0.08160  -0.34350 979  ASP B C   
1369 O O   . ASP B 70  ? 0.93860 1.71320 0.73010 0.01810  0.07840  -0.35660 979  ASP B O   
1370 C CB  . ASP B 70  ? 0.92360 1.75900 0.74480 0.09920  0.07340  -0.38860 979  ASP B CB  
1371 C CG  . ASP B 70  ? 1.15310 1.97220 0.94860 0.17860  0.05440  -0.42970 979  ASP B CG  
1372 O OD1 . ASP B 70  ? 1.27260 2.04110 1.03290 0.21310  0.03950  -0.45220 979  ASP B OD1 
1373 O OD2 . ASP B 70  ? 1.26370 2.11760 1.07030 0.20670  0.05310  -0.43920 979  ASP B OD2 
1374 N N   . ILE B 71  ? 0.85110 1.63520 0.68620 -0.04380 0.09570  -0.30990 980  ILE B N   
1375 C CA  . ILE B 71  ? 0.84270 1.66590 0.67150 -0.10230 0.10940  -0.28440 980  ILE B CA  
1376 C C   . ILE B 71  ? 0.92750 1.65640 0.73930 -0.11380 0.09920  -0.27300 980  ILE B C   
1377 O O   . ILE B 71  ? 0.99430 1.76180 0.78710 -0.13530 0.10470  -0.27000 980  ILE B O   
1378 C CB  . ILE B 71  ? 0.85420 1.68350 0.69830 -0.15650 0.12150  -0.24950 980  ILE B CB  
1379 C CG1 . ILE B 71  ? 0.85880 1.80720 0.71710 -0.15570 0.13400  -0.26070 980  ILE B CG1 
1380 C CG2 . ILE B 71  ? 0.79620 1.61830 0.62020 -0.21480 0.12890  -0.21950 980  ILE B CG2 
1381 C CD1 . ILE B 71  ? 0.82660 1.75890 0.70080 -0.19710 0.14090  -0.23140 980  ILE B CD1 
1382 N N   . LEU B 72  ? 0.94020 1.55500 0.75720 -0.10240 0.08500  -0.26650 981  LEU B N   
1383 C CA  . LEU B 72  ? 0.95270 1.48310 0.75640 -0.11530 0.07440  -0.25570 981  LEU B CA  
1384 C C   . LEU B 72  ? 1.07740 1.61100 0.85570 -0.07770 0.06380  -0.28830 981  LEU B C   
1385 O O   . LEU B 72  ? 1.14230 1.66260 0.90430 -0.09440 0.06130  -0.28320 981  LEU B O   
1386 C CB  . LEU B 72  ? 0.96230 1.38550 0.78030 -0.11720 0.06330  -0.24070 981  LEU B CB  
1387 C CG  . LEU B 72  ? 0.94200 1.34560 0.77910 -0.15810 0.07120  -0.20520 981  LEU B CG  
1388 C CD1 . LEU B 72  ? 0.97420 1.28330 0.82560 -0.15430 0.06020  -0.19530 981  LEU B CD1 
1389 C CD2 . LEU B 72  ? 0.88690 1.29360 0.71010 -0.19940 0.07610  -0.18060 981  LEU B CD2 
1390 N N   . SER B 73  ? 1.18280 1.73200 0.95320 -0.02660 0.05660  -0.32140 982  SER B N   
1391 C CA  . SER B 73  ? 1.00270 1.55290 0.74090 0.01830  0.04430  -0.35790 982  SER B CA  
1392 C C   . SER B 73  ? 1.00880 1.67850 0.73680 0.01580  0.05730  -0.37030 982  SER B C   
1393 O O   . SER B 73  ? 1.07760 1.74130 0.77850 0.03220  0.04940  -0.38890 982  SER B O   
1394 C CB  . SER B 73  ? 1.03910 1.56670 0.76380 0.07690  0.03100  -0.38920 982  SER B CB  
1395 O OG  . SER B 73  ? 1.43470 2.03020 1.13220 0.12330  0.02750  -0.42710 982  SER B OG  
1396 N N   . ARG B 74  ? 0.94330 1.71890 0.68930 -0.00520 0.07610  -0.36150 983  ARG B N   
1397 C CA  . ARG B 74  ? 1.08710 1.98980 0.82360 -0.02100 0.09180  -0.36810 983  ARG B CA  
1398 C C   . ARG B 74  ? 1.15720 2.03670 0.88330 -0.07760 0.09770  -0.33650 983  ARG B C   
1399 O O   . ARG B 74  ? 1.23160 2.16940 0.93560 -0.08030 0.10180  -0.34730 983  ARG B O   
1400 C CB  . ARG B 74  ? 1.04670 2.05690 0.81110 -0.03850 0.10740  -0.35890 983  ARG B CB  
1401 C CG  . ARG B 74  ? 1.03730 2.10980 0.82090 0.02030  0.09930  -0.38750 983  ARG B CG  
1402 C CD  . ARG B 74  ? 1.01530 2.17900 0.83500 -0.00540 0.10980  -0.37180 983  ARG B CD  
1403 N NE  . ARG B 74  ? 1.01780 2.27710 0.85860 0.04150  0.10180  -0.39660 983  ARG B NE  
1404 C CZ  . ARG B 74  ? 0.95490 2.30290 0.82730 0.03040  0.10490  -0.39140 983  ARG B CZ  
1405 N NH1 . ARG B 74  ? 0.89530 2.24140 0.78060 -0.02790 0.11620  -0.36120 983  ARG B NH1 
1406 N NH2 . ARG B 74  ? 1.04020 2.47730 0.92850 0.07860  0.09380  -0.41730 983  ARG B NH2 
1407 N N   . LEU B 75  ? 1.14800 1.94890 0.88630 -0.11870 0.09750  -0.30000 984  LEU B N   
1408 C CA  . LEU B 75  ? 1.28850 2.04890 1.01160 -0.16710 0.09890  -0.26870 984  LEU B CA  
1409 C C   . LEU B 75  ? 1.38360 2.07590 1.08930 -0.14720 0.08290  -0.28030 984  LEU B C   
1410 O O   . LEU B 75  ? 1.41960 2.11970 1.10320 -0.17230 0.08450  -0.26940 984  LEU B O   
1411 C CB  . LEU B 75  ? 1.33740 2.02360 1.07600 -0.20240 0.09870  -0.23230 984  LEU B CB  
1412 C CG  . LEU B 75  ? 1.27900 2.01790 1.01250 -0.25300 0.11460  -0.20510 984  LEU B CG  
1413 C CD1 . LEU B 75  ? 1.30680 2.07310 1.00340 -0.29160 0.12010  -0.19000 984  LEU B CD1 
1414 C CD2 . LEU B 75  ? 1.18270 2.02890 0.93050 -0.24300 0.12730  -0.22300 984  LEU B CD2 
1415 N N   . ASP B 76  ? 1.35540 1.97950 1.06630 -0.10670 0.06730  -0.30060 985  ASP B N   
1416 C CA  . ASP B 76  ? 1.40580 1.96540 1.09600 -0.08460 0.04990  -0.31810 985  ASP B CA  
1417 C C   . ASP B 76  ? 1.46020 2.09640 1.12280 -0.06420 0.05230  -0.34560 985  ASP B C   
1418 O O   . ASP B 76  ? 1.53370 2.15220 1.17660 -0.07690 0.04710  -0.34300 985  ASP B O   
1419 C CB  . ASP B 76  ? 1.48170 1.96090 1.17310 -0.04620 0.03310  -0.33750 985  ASP B CB  
1420 C CG  . ASP B 76  ? 1.58720 1.96460 1.26660 -0.05110 0.01510  -0.33540 985  ASP B CG  
1421 O OD1 . ASP B 76  ? 1.67680 2.05330 1.32940 -0.04170 0.00710  -0.35240 985  ASP B OD1 
1422 O OD2 . ASP B 76  ? 1.58140 1.88670 1.27820 -0.06650 0.00940  -0.31700 985  ASP B OD2 
1423 N N   . LYS B 77  ? 1.42910 2.15330 1.09000 -0.03210 0.05950  -0.37200 986  LYS B N   
1424 C CA  . LYS B 77  ? 1.32450 2.14190 0.96020 -0.00660 0.06320  -0.40260 986  LYS B CA  
1425 C C   . LYS B 77  ? 1.29120 2.18540 0.92700 -0.05680 0.08030  -0.37640 986  LYS B C   
1426 O O   . LYS B 77  ? 1.37440 2.29980 0.99690 -0.04970 0.07850  -0.38450 986  LYS B O   
1427 C CB  . LYS B 77  ? 1.08340 1.97060 0.73570 0.04120  0.06420  -0.42610 986  LYS B CB  
1428 C CG  . LYS B 77  ? 1.14020 1.95310 0.77550 0.10430  0.04280  -0.45910 986  LYS B CG  
1429 C CD  . LYS B 77  ? 1.27580 2.16220 0.92050 0.15920  0.03860  -0.48310 986  LYS B CD  
1430 C CE  . LYS B 77  ? 1.39210 2.20300 1.00040 0.21980  0.01430  -0.51550 986  LYS B CE  
1431 N NZ  . LYS B 77  ? 1.32320 2.22440 0.93370 0.25780  0.01230  -0.53490 986  LYS B NZ  
1432 N N   . VAL B 78  ? 1.35470 2.26870 1.00440 -0.10590 0.09440  -0.34360 987  VAL B N   
1433 C CA  . VAL B 78  ? 1.37220 2.33930 1.01950 -0.15970 0.10760  -0.31170 987  VAL B CA  
1434 C C   . VAL B 78  ? 1.35980 2.24960 0.97430 -0.19510 0.10250  -0.28960 987  VAL B C   
1435 O O   . VAL B 78  ? 1.33550 2.25180 0.93350 -0.21760 0.10520  -0.27760 987  VAL B O   
1436 C CB  . VAL B 78  ? 1.33650 2.34770 1.00790 -0.19690 0.12070  -0.28620 987  VAL B CB  
1437 C CG1 . VAL B 78  ? 1.41140 2.43370 1.06800 -0.26030 0.12850  -0.24860 987  VAL B CG1 
1438 C CG2 . VAL B 78  ? 1.22220 2.33430 0.92710 -0.16630 0.12410  -0.30720 987  VAL B CG2 
1439 N N   . GLU B 79  ? 1.40820 2.18860 1.03670 -0.19600 0.09010  -0.27420 988  GLU B N   
1440 C CA  . GLU B 79  ? 1.43730 2.13190 1.05160 -0.21860 0.07890  -0.25070 988  GLU B CA  
1441 C C   . GLU B 79  ? 1.43060 2.06720 1.04310 -0.18020 0.06050  -0.27630 988  GLU B C   
1442 O O   . GLU B 79  ? 1.43090 2.11190 1.02210 -0.15870 0.05900  -0.30250 988  GLU B O   
1443 C CB  . GLU B 79  ? 1.40910 2.03000 1.03960 -0.24620 0.07680  -0.21640 988  GLU B CB  
1444 C CG  . GLU B 79  ? 1.44180 1.98080 1.10150 -0.21930 0.06310  -0.22300 988  GLU B CG  
1445 C CD  . GLU B 79  ? 1.58090 2.06940 1.26170 -0.24010 0.06430  -0.19470 988  GLU B CD  
1446 O OE1 . GLU B 79  ? 1.65950 2.12810 1.32490 -0.27520 0.06620  -0.16440 988  GLU B OE1 
1447 O OE2 . GLU B 79  ? 1.61350 2.07870 1.32130 -0.21940 0.06200  -0.20360 988  GLU B OE2 
1448 N N   . PRO B 86  ? 1.59810 1.58610 1.35230 -0.11290 -0.02310 -0.26160 1162 PRO B N   
1449 C CA  . PRO B 86  ? 1.58310 1.56940 1.37180 -0.13430 -0.01390 -0.23370 1162 PRO B CA  
1450 C C   . PRO B 86  ? 1.58220 1.60230 1.38350 -0.11560 -0.00300 -0.23450 1162 PRO B C   
1451 O O   . PRO B 86  ? 1.59530 1.68360 1.39440 -0.10270 0.00670  -0.24310 1162 PRO B O   
1452 C CB  . PRO B 86  ? 1.50820 1.53620 1.31330 -0.16340 -0.00500 -0.21020 1162 PRO B CB  
1453 C CG  . PRO B 86  ? 1.50340 1.58280 1.28730 -0.15340 -0.00220 -0.22500 1162 PRO B CG  
1454 C CD  . PRO B 86  ? 1.53250 1.57660 1.28590 -0.12580 -0.01660 -0.25690 1162 PRO B CD  
1455 N N   . ASP B 87  ? 1.32900 1.30670 1.14330 -0.11710 -0.00470 -0.22520 1163 ASP B N   
1456 C CA  . ASP B 87  ? 1.28010 1.26590 1.09680 -0.09040 -0.00160 -0.23390 1163 ASP B CA  
1457 C C   . ASP B 87  ? 1.23660 1.23290 1.08820 -0.11290 0.01000  -0.20610 1163 ASP B C   
1458 O O   . ASP B 87  ? 1.21770 1.17430 1.08240 -0.13970 0.00770  -0.18640 1163 ASP B O   
1459 C CB  . ASP B 87  ? 1.38090 1.28750 1.16290 -0.06280 -0.02000 -0.25590 1163 ASP B CB  
1460 C CG  . ASP B 87  ? 1.52550 1.34980 1.28720 -0.08410 -0.03560 -0.25410 1163 ASP B CG  
1461 O OD1 . ASP B 87  ? 1.55390 1.38190 1.33940 -0.12090 -0.03140 -0.23210 1163 ASP B OD1 
1462 O OD2 . ASP B 87  ? 1.59650 1.35160 1.31430 -0.06390 -0.05320 -0.27560 1163 ASP B OD2 
1463 N N   . VAL B 88  ? 1.17880 1.23330 1.04380 -0.10280 0.02170  -0.20580 1164 VAL B N   
1464 C CA  . VAL B 88  ? 1.00240 1.07090 0.89630 -0.12290 0.03280  -0.18150 1164 VAL B CA  
1465 C C   . VAL B 88  ? 0.93310 0.95270 0.82820 -0.10340 0.02590  -0.18620 1164 VAL B C   
1466 O O   . VAL B 88  ? 0.85770 0.89560 0.74010 -0.06830 0.02310  -0.20790 1164 VAL B O   
1467 C CB  . VAL B 88  ? 0.94120 1.10070 0.84430 -0.12870 0.04840  -0.17880 1164 VAL B CB  
1468 C CG1 . VAL B 88  ? 0.88340 1.05610 0.80920 -0.14230 0.05760  -0.16070 1164 VAL B CG1 
1469 C CG2 . VAL B 88  ? 0.95770 1.15030 0.85470 -0.15760 0.05490  -0.16620 1164 VAL B CG2 
1470 N N   . ASP B 89  ? 1.08440 1.04690 0.99150 -0.12360 0.02270  -0.16730 1165 ASP B N   
1471 C CA  . ASP B 89  ? 1.06000 0.96490 0.96430 -0.11210 0.01540  -0.16770 1165 ASP B CA  
1472 C C   . ASP B 89  ? 0.95070 0.86800 0.88640 -0.13310 0.02610  -0.14260 1165 ASP B C   
1473 O O   . ASP B 89  ? 0.90960 0.80680 0.85890 -0.16100 0.02730  -0.12290 1165 ASP B O   
1474 C CB  . ASP B 89  ? 1.05480 0.87740 0.93810 -0.12080 0.00030  -0.16970 1165 ASP B CB  
1475 C CG  . ASP B 89  ? 1.32390 1.08140 1.16820 -0.09080 -0.01540 -0.19070 1165 ASP B CG  
1476 O OD1 . ASP B 89  ? 1.41470 1.19670 1.24730 -0.05410 -0.01590 -0.20850 1165 ASP B OD1 
1477 O OD2 . ASP B 89  ? 1.42630 1.10880 1.24760 -0.10480 -0.02810 -0.18980 1165 ASP B OD2 
1478 N N   . LEU B 90  ? 1.04550 1.04390 0.83770 0.09610  -0.11890 -0.35180 1166 LEU B N   
1479 C CA  . LEU B 90  ? 0.89810 1.03560 0.83350 0.07210  -0.07520 -0.32600 1166 LEU B CA  
1480 C C   . LEU B 90  ? 0.94370 0.98440 0.84710 0.01700  -0.10210 -0.31050 1166 LEU B C   
1481 O O   . LEU B 90  ? 1.08820 0.95740 0.85260 0.03080  -0.14790 -0.32750 1166 LEU B O   
1482 C CB  . LEU B 90  ? 0.77430 0.99970 0.75050 0.16350  -0.03670 -0.34160 1166 LEU B CB  
1483 C CG  . LEU B 90  ? 0.71430 1.02510 0.70570 0.22950  -0.01120 -0.35900 1166 LEU B CG  
1484 C CD1 . LEU B 90  ? 0.67150 1.02010 0.69070 0.27870  0.00860  -0.32750 1166 LEU B CD1 
1485 C CD2 . LEU B 90  ? 0.54480 1.00520 0.66250 0.18000  0.02310  -0.33570 1166 LEU B CD2 
1486 N N   . GLY B 91  ? 0.81840 0.96270 0.84200 -0.04130 -0.07440 -0.27920 1167 GLY B N   
1487 C CA  . GLY B 91  ? 0.90450 0.98240 0.91740 -0.09740 -0.09210 -0.25950 1167 GLY B CA  
1488 C C   . GLY B 91  ? 1.01450 1.00300 0.95240 -0.03480 -0.10320 -0.27870 1167 GLY B C   
1489 O O   . GLY B 91  ? 1.03840 1.09930 1.00730 0.04400  -0.07360 -0.29560 1167 GLY B O   
1490 N N   . ASP B 92  ? 1.04270 0.87870 0.88220 -0.06790 -0.14540 -0.27540 1168 ASP B N   
1491 C CA  . ASP B 92  ? 1.14330 0.88240 0.90540 -0.01360 -0.15940 -0.29050 1168 ASP B CA  
1492 C C   . ASP B 92  ? 1.06240 0.89160 0.92990 -0.04480 -0.12910 -0.26460 1168 ASP B C   
1493 O O   . ASP B 92  ? 1.06860 0.89960 0.97290 -0.13180 -0.13460 -0.23470 1168 ASP B O   
1494 C CB  . ASP B 92  ? 1.31760 0.83520 0.90830 -0.02730 -0.22140 -0.30150 1168 ASP B CB  
1495 C CG  . ASP B 92  ? 1.57590 0.98400 1.06600 0.05200  -0.23740 -0.32500 1168 ASP B CG  
1496 O OD1 . ASP B 92  ? 1.58890 1.08940 1.12540 0.13410  -0.20390 -0.34040 1168 ASP B OD1 
1497 O OD2 . ASP B 92  ? 1.74570 0.97760 1.11010 0.03130  -0.28400 -0.32680 1168 ASP B OD2 
1498 N N   . ILE B 93  ? 0.99010 0.89290 0.90170 0.02570  -0.09880 -0.27580 1169 ILE B N   
1499 C CA  . ILE B 93  ? 0.78210 0.79640 0.80590 0.01240  -0.06250 -0.25570 1169 ILE B CA  
1500 C C   . ILE B 93  ? 1.10080 1.02510 1.04820 0.06950  -0.07850 -0.27020 1169 ILE B C   
1501 O O   . ILE B 93  ? 1.14660 1.17230 1.17340 0.10080  -0.04610 -0.26730 1169 ILE B O   
1502 C CB  . ILE B 93  ? 0.74880 0.95910 0.91190 0.04210  -0.00790 -0.25380 1169 ILE B CB  
1503 C CG1 . ILE B 93  ? 0.85340 1.09140 0.99110 0.14560  0.00330  -0.28440 1169 ILE B CG1 
1504 C CG2 . ILE B 93  ? 0.46550 0.76030 0.69960 -0.01180 0.00720  -0.23890 1169 ILE B CG2 
1505 C CD1 . ILE B 93  ? 1.07050 1.26460 1.13510 0.18420  -0.01240 -0.30740 1169 ILE B CD1 
1506 N N   . SER B 94  ? 1.26280 1.00190 1.05810 0.08390  -0.12770 -0.28570 1170 SER B N   
1507 C CA  . SER B 94  ? 1.40890 1.03630 1.10520 0.14730  -0.14980 -0.30290 1170 SER B CA  
1508 C C   . SER B 94  ? 1.43440 0.94470 1.07840 0.08140  -0.17910 -0.28180 1170 SER B C   
1509 O O   . SER B 94  ? 1.58820 1.02840 1.17550 0.12230  -0.19090 -0.28860 1170 SER B O   
1510 C CB  . SER B 94  ? 1.69420 1.18950 1.24580 0.22260  -0.18360 -0.33740 1170 SER B CB  
1511 O OG  . SER B 94  ? 1.90440 1.23760 1.34010 0.17000  -0.23150 -0.33730 1170 SER B OG  
1512 N N   . GLY B 95  ? 1.38920 0.88010 1.04890 -0.01620 -0.19120 -0.25620 1171 GLY B N   
1513 C CA  . GLY B 95  ? 1.36990 0.79290 1.01460 -0.09320 -0.20860 -0.22770 1171 GLY B CA  
1514 C C   . GLY B 95  ? 1.18310 0.75250 0.96300 -0.10930 -0.16410 -0.20540 1171 GLY B C   
1515 O O   . GLY B 95  ? 1.14850 0.65890 0.90570 -0.14350 -0.17510 -0.18770 1171 GLY B O   
1516 N N   . ILE B 96  ? 1.05180 0.80100 0.96350 -0.08760 -0.11620 -0.20540 1172 ILE B N   
1517 C CA  . ILE B 96  ? 0.72570 0.62040 0.76840 -0.09960 -0.07190 -0.18610 1172 ILE B CA  
1518 C C   . ILE B 96  ? 0.94070 0.79860 0.94460 -0.03230 -0.07440 -0.20030 1172 ILE B C   
1519 O O   . ILE B 96  ? 1.12080 0.96640 1.08110 0.05250  -0.07750 -0.22920 1172 ILE B O   
1520 C CB  . ILE B 96  ? 0.59000 0.67230 0.76960 -0.08760 -0.02340 -0.18490 1172 ILE B CB  
1521 C CG1 . ILE B 96  ? 0.55010 0.69030 0.79110 -0.16580 -0.01490 -0.16210 1172 ILE B CG1 
1522 C CG2 . ILE B 96  ? 0.41850 0.62700 0.70520 -0.07320 0.01700  -0.17520 1172 ILE B CG2 
1523 C CD1 . ILE B 96  ? 0.51860 0.68560 0.75490 -0.14380 -0.01490 -0.17850 1172 ILE B CD1 
1524 N N   . ASN B 97  ? 0.85560 0.69860 0.87320 -0.06800 -0.07320 -0.17980 1173 ASN B N   
1525 C CA  . ASN B 97  ? 0.97960 0.78080 0.95720 -0.01190 -0.07860 -0.18960 1173 ASN B CA  
1526 C C   . ASN B 97  ? 0.82160 0.72530 0.90330 -0.04970 -0.04660 -0.16420 1173 ASN B C   
1527 O O   . ASN B 97  ? 0.67940 0.59780 0.80120 -0.13240 -0.04120 -0.13520 1173 ASN B O   
1528 C CB  . ASN B 97  ? 1.22420 0.81850 1.04080 -0.00690 -0.13120 -0.19670 1173 ASN B CB  
1529 C CG  . ASN B 97  ? 1.29490 0.84230 1.07240 0.03640  -0.13780 -0.19990 1173 ASN B CG  
1530 O OD1 . ASN B 97  ? 1.20870 0.75460 1.01110 -0.01430 -0.13380 -0.17540 1173 ASN B OD1 
1531 N ND2 . ASN B 97  ? 1.39420 0.90590 1.10950 0.13140  -0.14780 -0.22930 1173 ASN B ND2 
1532 N N   . ALA B 98  ? 0.88990 0.86700 1.01410 0.01110  -0.02590 -0.17490 1174 ALA B N   
1533 C CA  . ALA B 98  ? 0.66050 0.72250 0.86760 -0.00810 0.00110  -0.15640 1174 ALA B CA  
1534 C C   . ALA B 98  ? 0.85530 0.78690 0.96360 0.00750  -0.02970 -0.15640 1174 ALA B C   
1535 O O   . ALA B 98  ? 1.04550 0.91140 1.07580 0.08260  -0.05000 -0.18080 1174 ALA B O   
1536 C CB  . ALA B 98  ? 0.52750 0.74420 0.83450 0.04730  0.03820  -0.16840 1174 ALA B CB  
1537 N N   . SER B 99  ? 0.82440 0.71580 0.93000 -0.05970 -0.03400 -0.12920 1175 SER B N   
1538 C CA  . SER B 99  ? 0.90400 0.66990 0.91610 -0.05210 -0.06240 -0.12520 1175 SER B CA  
1539 C C   . SER B 99  ? 0.85600 0.71590 0.93280 -0.00940 -0.03760 -0.12770 1175 SER B C   
1540 O O   . SER B 99  ? 0.79140 0.80710 0.99170 -0.01730 0.00240  -0.12210 1175 SER B O   
1541 C CB  . SER B 99  ? 0.89610 0.58790 0.88010 -0.14160 -0.07580 -0.09360 1175 SER B CB  
1542 O OG  . SER B 99  ? 0.86730 0.69060 0.97110 -0.20490 -0.03980 -0.07010 1175 SER B OG  
1543 N N   . VAL B 100 ? 0.73810 0.50220 0.72970 0.03450  -0.06220 -0.13570 1176 VAL B N   
1544 C CA  . VAL B 100 ? 0.81690 0.65440 0.85550 0.07440  -0.04530 -0.13710 1176 VAL B CA  
1545 C C   . VAL B 100 ? 0.91440 0.70480 0.94220 0.01320  -0.04810 -0.10870 1176 VAL B C   
1546 O O   . VAL B 100 ? 0.93930 0.62510 0.90660 -0.05010 -0.06840 -0.09040 1176 VAL B O   
1547 C CB  . VAL B 100 ? 0.88490 0.66530 0.84380 0.17190  -0.06820 -0.16480 1176 VAL B CB  
1548 C CG1 . VAL B 100 ? 0.89160 0.73400 0.86750 0.23500  -0.06120 -0.19140 1176 VAL B CG1 
1549 C CG2 . VAL B 100 ? 0.96780 0.54630 0.77030 0.18040  -0.11570 -0.16670 1176 VAL B CG2 
1550 N N   . VAL B 101 ? 0.86800 0.73910 0.95480 0.03000  -0.02800 -0.10440 1177 VAL B N   
1551 C CA  . VAL B 101 ? 0.83330 0.67910 0.91990 -0.02090 -0.02530 -0.07790 1177 VAL B CA  
1552 C C   . VAL B 101 ? 0.91840 0.69760 0.93410 0.04000  -0.04700 -0.08860 1177 VAL B C   
1553 O O   . VAL B 101 ? 0.91830 0.75940 0.95460 0.11440  -0.04310 -0.11190 1177 VAL B O   
1554 C CB  . VAL B 101 ? 0.52730 0.53080 0.74920 -0.06240 0.01970  -0.06080 1177 VAL B CB  
1555 C CG1 . VAL B 101 ? 0.51700 0.64640 0.81580 -0.00280 0.04220  -0.07780 1177 VAL B CG1 
1556 C CG2 . VAL B 101 ? 0.50860 0.47610 0.72180 -0.12380 0.02250  -0.03070 1177 VAL B CG2 
1557 N N   . ASN B 102 ? 0.92700 0.58660 0.86180 0.00810  -0.06940 -0.07070 1178 ASN B N   
1558 C CA  . ASN B 102 ? 1.03060 0.61130 0.88790 0.05840  -0.09250 -0.07640 1178 ASN B CA  
1559 C C   . ASN B 102 ? 1.10960 0.70590 0.99520 0.00430  -0.07880 -0.04800 1178 ASN B C   
1560 O O   . ASN B 102 ? 1.18830 0.68310 1.01430 -0.05870 -0.09310 -0.02390 1178 ASN B O   
1561 C CB  . ASN B 102 ? 1.33800 0.72560 1.03910 0.08310  -0.14050 -0.08500 1178 ASN B CB  
1562 C CG  . ASN B 102 ? 1.47910 0.79700 1.10130 0.15640  -0.16430 -0.09760 1178 ASN B CG  
1563 O OD1 . ASN B 102 ? 1.37910 0.75820 1.04500 0.16140  -0.15040 -0.08920 1178 ASN B OD1 
1564 N ND2 . ASN B 102 ? 1.65280 0.84260 1.15640 0.21610  -0.20050 -0.11820 1178 ASN B ND2 
1565 N N   . ILE B 103 ? 1.04510 0.76580 1.01730 0.02690  -0.05230 -0.05030 1179 ILE B N   
1566 C CA  . ILE B 103 ? 0.94920 0.69570 0.95080 -0.01370 -0.03710 -0.02640 1179 ILE B CA  
1567 C C   . ILE B 103 ? 1.03160 0.77350 1.00450 0.05250  -0.04940 -0.03890 1179 ILE B C   
1568 O O   . ILE B 103 ? 0.97640 0.76770 0.98870 0.03350  -0.03350 -0.02510 1179 ILE B O   
1569 C CB  . ILE B 103 ? 0.76340 0.66870 0.90100 -0.05920 0.00840  -0.01460 1179 ILE B CB  
1570 C CG1 . ILE B 103 ? 0.59210 0.63920 0.82240 -0.00600 0.03000  -0.03840 1179 ILE B CG1 
1571 C CG2 . ILE B 103 ? 0.74800 0.64880 0.90530 -0.12860 0.01800  0.00250  1179 ILE B CG2 
1572 C CD1 . ILE B 103 ? 0.43760 0.62980 0.78920 -0.04110 0.07170  -0.02740 1179 ILE B CD1 
1573 N N   . GLN B 104 ? 1.03660 0.71910 0.93910 0.12850  -0.07740 -0.06360 1180 GLN B N   
1574 C CA  . GLN B 104 ? 1.08320 0.77210 0.96040 0.20090  -0.09070 -0.07720 1180 GLN B CA  
1575 C C   . GLN B 104 ? 1.18870 0.77270 0.99060 0.17600  -0.10780 -0.05640 1180 GLN B C   
1576 O O   . GLN B 104 ? 1.18270 0.81490 1.00450 0.20600  -0.10500 -0.05760 1180 GLN B O   
1577 C CB  . GLN B 104 ? 1.12130 0.74890 0.92110 0.28710  -0.11990 -0.10500 1180 GLN B CB  
1578 C CG  . GLN B 104 ? 1.15760 0.83500 0.95830 0.36810  -0.12770 -0.12050 1180 GLN B CG  
1579 C CD  . GLN B 104 ? 1.01060 0.88070 0.95360 0.36460  -0.09100 -0.12160 1180 GLN B CD  
1580 O OE1 . GLN B 104 ? 0.98860 0.97210 1.01220 0.37780  -0.07020 -0.13400 1180 GLN B OE1 
1581 N NE2 . GLN B 104 ? 0.95770 0.86080 0.92820 0.34380  -0.08350 -0.10770 1180 GLN B NE2 
1582 N N   . LYS B 105 ? 1.24300 0.69130 0.96180 0.12100  -0.12540 -0.03710 1181 LYS B N   
1583 C CA  . LYS B 105 ? 1.38610 0.72280 1.02520 0.08720  -0.14190 -0.01290 1181 LYS B CA  
1584 C C   . LYS B 105 ? 1.20410 0.65100 0.93660 0.03920  -0.10720 0.00790  1181 LYS B C   
1585 O O   . LYS B 105 ? 1.26860 0.68710 0.96710 0.05320  -0.11490 0.01540  1181 LYS B O   
1586 C CB  . LYS B 105 ? 1.55430 0.74740 1.10560 0.02250  -0.16220 0.00740  1181 LYS B CB  
1587 C CG  . LYS B 105 ? 1.56380 0.68930 1.07630 -0.04580 -0.16310 0.04260  1181 LYS B CG  
1588 C CD  . LYS B 105 ? 1.73010 0.74190 1.17720 -0.12200 -0.17860 0.06620  1181 LYS B CD  
1589 C CE  . LYS B 105 ? 2.00040 0.86580 1.31180 -0.09400 -0.22120 0.05760  1181 LYS B CE  
1590 N NZ  . LYS B 105 ? 2.17210 0.98200 1.42050 -0.11480 -0.23190 0.07700  1181 LYS B NZ  
1591 N N   . GLU B 106 ? 1.00040 0.55950 0.83800 -0.01470 -0.07180 0.01740  1182 GLU B N   
1592 C CA  . GLU B 106 ? 0.93270 0.59670 0.86000 -0.06510 -0.03550 0.03800  1182 GLU B CA  
1593 C C   . GLU B 106 ? 0.90160 0.69060 0.90540 -0.01390 -0.01900 0.02050  1182 GLU B C   
1594 O O   . GLU B 106 ? 0.97120 0.78490 0.98890 -0.02750 -0.00860 0.03320  1182 GLU B O   
1595 C CB  . GLU B 106 ? 0.77170 0.51830 0.78510 -0.12890 -0.00380 0.05100  1182 GLU B CB  
1596 C CG  . GLU B 106 ? 0.91150 0.55570 0.86440 -0.19830 -0.01480 0.07780  1182 GLU B CG  
1597 C CD  . GLU B 106 ? 1.03320 0.59260 0.92660 -0.19130 -0.04160 0.06580  1182 GLU B CD  
1598 O OE1 . GLU B 106 ? 1.10850 0.61500 0.97690 -0.25520 -0.04600 0.08690  1182 GLU B OE1 
1599 O OE2 . GLU B 106 ? 1.15140 0.70220 1.02380 -0.12140 -0.05780 0.03570  1182 GLU B OE2 
1600 N N   . ILE B 107 ? 0.72130 0.58670 0.77110 0.04060  -0.01720 -0.00660 1183 ILE B N   
1601 C CA  . ILE B 107 ? 0.59150 0.58250 0.71530 0.09090  -0.00470 -0.02410 1183 ILE B CA  
1602 C C   . ILE B 107 ? 0.76360 0.68850 0.81190 0.13840  -0.03240 -0.02730 1183 ILE B C   
1603 O O   . ILE B 107 ? 0.62780 0.62470 0.72050 0.14110  -0.02080 -0.02420 1183 ILE B O   
1604 C CB  . ILE B 107 ? 0.68100 0.74870 0.84970 0.14350  -0.00290 -0.05080 1183 ILE B CB  
1605 C CG1 . ILE B 107 ? 0.54090 0.67910 0.78670 0.09770  0.02510  -0.04750 1183 ILE B CG1 
1606 C CG2 . ILE B 107 ? 0.80950 0.99820 1.04280 0.19660  0.00400  -0.06690 1183 ILE B CG2 
1607 C CD1 . ILE B 107 ? 0.56040 0.75900 0.83750 0.14780  0.02540  -0.07210 1183 ILE B CD1 
1608 N N   . ASP B 108 ? 0.82240 0.61230 0.75690 0.17620  -0.06900 -0.03380 1184 ASP B N   
1609 C CA  . ASP B 108 ? 0.93180 0.63980 0.77770 0.22810  -0.10010 -0.03710 1184 ASP B CA  
1610 C C   . ASP B 108 ? 1.04350 0.71610 0.87340 0.17240  -0.09310 -0.00990 1184 ASP B C   
1611 O O   . ASP B 108 ? 1.11230 0.83730 0.96320 0.19540  -0.09130 -0.01100 1184 ASP B O   
1612 C CB  . ASP B 108 ? 1.26490 0.81450 0.98020 0.27070  -0.14020 -0.04630 1184 ASP B CB  
1613 C CG  . ASP B 108 ? 1.27410 0.85750 0.99260 0.34470  -0.14990 -0.07590 1184 ASP B CG  
1614 O OD1 . ASP B 108 ? 1.05190 0.79140 0.88020 0.36330  -0.12500 -0.08900 1184 ASP B OD1 
1615 O OD2 . ASP B 108 ? 1.34020 0.79000 0.94650 0.38430  -0.18280 -0.08530 1184 ASP B OD2 
1616 N N   . ARG B 109 ? 1.08710 0.68800 0.88970 0.09960  -0.08700 0.01430  1185 ARG B N   
1617 C CA  . ARG B 109 ? 1.06410 0.62030 0.84100 0.04160  -0.07980 0.04430  1185 ARG B CA  
1618 C C   . ARG B 109 ? 0.94040 0.63910 0.82310 0.02480  -0.04510 0.04830  1185 ARG B C   
1619 O O   . ARG B 109 ? 1.10250 0.77930 0.95590 0.02270  -0.04820 0.06000  1185 ARG B O   
1620 C CB  . ARG B 109 ? 1.06870 0.56150 0.82480 -0.03830 -0.07240 0.07050  1185 ARG B CB  
1621 C CG  . ARG B 109 ? 1.16660 0.58410 0.86710 -0.09010 -0.07300 0.10300  1185 ARG B CG  
1622 C CD  . ARG B 109 ? 1.53370 0.76580 1.09110 -0.09300 -0.11340 0.11440  1185 ARG B CD  
1623 N NE  . ARG B 109 ? 1.72060 0.88600 1.24500 -0.11720 -0.12670 0.11370  1185 ARG B NE  
1624 C CZ  . ARG B 109 ? 1.84030 0.84360 1.24070 -0.10750 -0.16650 0.11360  1185 ARG B CZ  
1625 N NH1 . ARG B 109 ? 1.91430 0.80550 1.21040 -0.07130 -0.19660 0.11400  1185 ARG B NH1 
1626 N NH2 . ARG B 109 ? 1.82320 0.79770 1.21220 -0.13100 -0.17410 0.10940  1185 ARG B NH2 
1627 N N   . LEU B 110 ? 0.72150 0.55430 0.71640 0.01350  -0.01440 0.03920  1186 LEU B N   
1628 C CA  . LEU B 110 ? 0.59200 0.56010 0.68750 -0.00100 0.01830  0.04040  1186 LEU B CA  
1629 C C   . LEU B 110 ? 0.66870 0.67650 0.76420 0.06170  0.00350  0.02280  1186 LEU B C   
1630 O O   . LEU B 110 ? 0.80740 0.83940 0.91250 0.04840  0.01190  0.03260  1186 LEU B O   
1631 C CB  . LEU B 110 ? 0.51050 0.60370 0.71570 -0.01490 0.04840  0.03060  1186 LEU B CB  
1632 C CG  . LEU B 110 ? 0.48460 0.58030 0.71960 -0.08530 0.07290  0.05130  1186 LEU B CG  
1633 C CD1 . LEU B 110 ? 0.39760 0.62410 0.74270 -0.09150 0.10270  0.04020  1186 LEU B CD1 
1634 C CD2 . LEU B 110 ? 0.49200 0.57590 0.72270 -0.14070 0.09140  0.08000  1186 LEU B CD2 
1635 N N   . ASN B 111 ? 0.60040 0.62040 0.68710 0.12790  -0.01720 -0.00180 1187 ASN B N   
1636 C CA  . ASN B 111 ? 0.61270 0.68080 0.70160 0.19310  -0.03400 -0.01880 1187 ASN B CA  
1637 C C   . ASN B 111 ? 0.71180 0.65980 0.69360 0.20790  -0.06250 -0.00780 1187 ASN B C   
1638 O O   . ASN B 111 ? 0.71050 0.70180 0.70350 0.22700  -0.06600 -0.00910 1187 ASN B O   
1639 C CB  . ASN B 111 ? 0.58710 0.69670 0.68750 0.26180  -0.04840 -0.04500 1187 ASN B CB  
1640 C CG  . ASN B 111 ? 0.56150 0.81440 0.77980 0.25040  -0.01810 -0.05540 1187 ASN B CG  
1641 O OD1 . ASN B 111 ? 0.62600 0.89140 0.85260 0.27650  -0.02020 -0.06930 1187 ASN B OD1 
1642 N ND2 . ASN B 111 ? 0.34030 0.69810 0.64560 0.21240  0.00980  -0.04900 1187 ASN B ND2 
1643 N N   . GLU B 112 ? 0.85570 0.65600 0.73520 0.19580  -0.08280 0.00380  1188 GLU B N   
1644 C CA  . GLU B 112 ? 1.01600 0.68720 0.78350 0.20590  -0.11070 0.01690  1188 GLU B CA  
1645 C C   . GLU B 112 ? 1.07390 0.77530 0.86880 0.15170  -0.08860 0.03910  1188 GLU B C   
1646 O O   . GLU B 112 ? 0.98370 0.69320 0.75970 0.18010  -0.09950 0.03810  1188 GLU B O   
1647 C CB  . GLU B 112 ? 1.26590 0.77290 0.92280 0.19020  -0.13400 0.02760  1188 GLU B CB  
1648 C CG  . GLU B 112 ? 1.42370 0.80060 0.98330 0.15340  -0.14750 0.05520  1188 GLU B CG  
1649 C CD  . GLU B 112 ? 1.64670 0.84270 1.07140 0.16120  -0.18380 0.06100  1188 GLU B CD  
1650 O OE1 . GLU B 112 ? 1.76020 0.87280 1.09590 0.22400  -0.21740 0.05170  1188 GLU B OE1 
1651 O OE2 . GLU B 112 ? 1.72520 0.86210 1.13100 0.10410  -0.17970 0.07550  1188 GLU B OE2 
1652 N N   . VAL B 113 ? 1.02350 0.74480 0.86130 0.07870  -0.05840 0.05830  1189 VAL B N   
1653 C CA  . VAL B 113 ? 0.92240 0.66430 0.77880 0.02390  -0.03430 0.08240  1189 VAL B CA  
1654 C C   . VAL B 113 ? 0.80690 0.68040 0.74670 0.04450  -0.01820 0.06910  1189 VAL B C   
1655 O O   . VAL B 113 ? 0.89920 0.76320 0.81710 0.03450  -0.01620 0.08080  1189 VAL B O   
1656 C CB  . VAL B 113 ? 0.86300 0.62170 0.76100 -0.05240 -0.00230 0.10430  1189 VAL B CB  
1657 C CG1 . VAL B 113 ? 0.77740 0.56660 0.69480 -0.09910 0.02420  0.12760  1189 VAL B CG1 
1658 C CG2 . VAL B 113 ? 0.95930 0.58840 0.77420 -0.08200 -0.02000 0.12040  1189 VAL B CG2 
1659 N N   . ALA B 114 ? 0.62900 0.61730 0.65670 0.07030  -0.00810 0.04640  1190 ALA B N   
1660 C CA  . ALA B 114 ? 0.70170 0.81820 0.80970 0.09090  0.00310  0.03190  1190 ALA B CA  
1661 C C   . ALA B 114 ? 0.76910 0.85910 0.82160 0.14490  -0.02830 0.02410  1190 ALA B C   
1662 O O   . ALA B 114 ? 0.64550 0.78290 0.71980 0.13570  -0.02100 0.02760  1190 ALA B O   
1663 C CB  . ALA B 114 ? 0.60280 0.83060 0.79940 0.11370  0.01310  0.01020  1190 ALA B CB  
1664 N N   . LYS B 115 ? 0.76530 0.77990 0.74480 0.20060  -0.06270 0.01410  1191 LYS B N   
1665 C CA  . LYS B 115 ? 0.91380 0.88950 0.82700 0.26010  -0.09720 0.00730  1191 LYS B CA  
1666 C C   . LYS B 115 ? 1.00860 0.85960 0.82470 0.23390  -0.10750 0.03100  1191 LYS B C   
1667 O O   . LYS B 115 ? 1.04970 0.90820 0.84470 0.25380  -0.11960 0.03190  1191 LYS B O   
1668 C CB  . LYS B 115 ? 1.02800 0.95370 0.88690 0.32960  -0.12880 -0.00980 1191 LYS B CB  
1669 C CG  . LYS B 115 ? 1.10820 0.98640 0.89080 0.39770  -0.16620 -0.01630 1191 LYS B CG  
1670 C CD  . LYS B 115 ? 1.15710 0.89380 0.82470 0.44520  -0.19960 -0.01970 1191 LYS B CD  
1671 C CE  . LYS B 115 ? 1.26130 0.93780 0.84260 0.51180  -0.23680 -0.02300 1191 LYS B CE  
1672 N NZ  . LYS B 115 ? 1.43010 0.91600 0.87030 0.52100  -0.26470 -0.01160 1191 LYS B NZ  
1673 N N   . ASN B 116 ? 1.06530 0.80740 0.82330 0.18990  -0.10400 0.05040  1192 ASN B N   
1674 C CA  . ASN B 116 ? 1.15300 0.77040 0.81400 0.15900  -0.11290 0.07690  1192 ASN B CA  
1675 C C   . ASN B 116 ? 1.09920 0.77660 0.80160 0.11500  -0.08590 0.09190  1192 ASN B C   
1676 O O   . ASN B 116 ? 1.27800 0.87520 0.90310 0.10930  -0.09750 0.10890  1192 ASN B O   
1677 C CB  . ASN B 116 ? 1.28150 0.79100 0.88900 0.10680  -0.10940 0.09800  1192 ASN B CB  
1678 C CG  . ASN B 116 ? 1.39600 0.79240 0.91900 0.14490  -0.14330 0.08910  1192 ASN B CG  
1679 O OD1 . ASN B 116 ? 1.45950 0.87100 0.97460 0.21600  -0.16590 0.06430  1192 ASN B OD1 
1680 N ND2 . ASN B 116 ? 1.37980 0.66280 0.83740 0.09720  -0.14710 0.11000  1192 ASN B ND2 
1681 N N   . LEU B 117 ? 0.99850 0.80190 0.80990 0.08400  -0.05120 0.08740  1193 LEU B N   
1682 C CA  . LEU B 117 ? 0.92940 0.77990 0.77470 0.03650  -0.02150 0.10330  1193 LEU B CA  
1683 C C   . LEU B 117 ? 1.03000 0.91380 0.86650 0.07270  -0.03630 0.09390  1193 LEU B C   
1684 O O   . LEU B 117 ? 1.13010 1.01730 0.95980 0.04140  -0.02030 0.10870  1193 LEU B O   
1685 C CB  . LEU B 117 ? 0.74040 0.70920 0.69800 -0.00150 0.01770  0.09970  1193 LEU B CB  
1686 C CG  . LEU B 117 ? 0.78090 0.72070 0.74550 -0.06280 0.04400  0.12210  1193 LEU B CG  
1687 C CD1 . LEU B 117 ? 0.52160 0.58160 0.59760 -0.08820 0.07890  0.11450  1193 LEU B CD1 
1688 C CD2 . LEU B 117 ? 0.69870 0.57590 0.60880 -0.10890 0.05720  0.15340  1193 LEU B CD2 
1689 N N   . ASN B 118 ? 0.93000 0.83740 0.76330 0.13700  -0.06620 0.07130  1194 ASN B N   
1690 C CA  . ASN B 118 ? 0.99870 0.92450 0.80810 0.17830  -0.08930 0.06310  1194 ASN B CA  
1691 C C   . ASN B 118 ? 1.15650 0.95180 0.85090 0.17420  -0.10660 0.08460  1194 ASN B C   
1692 O O   . ASN B 118 ? 1.24120 1.05080 0.92010 0.17920  -0.11150 0.08710  1194 ASN B O   
1693 C CB  . ASN B 118 ? 0.90800 0.87550 0.72640 0.25130  -0.12040 0.03820  1194 ASN B CB  
1694 C CG  . ASN B 118 ? 0.87840 0.99500 0.81560 0.25540  -0.10340 0.01820  1194 ASN B CG  
1695 O OD1 . ASN B 118 ? 0.76320 0.96930 0.76870 0.22470  -0.08220 0.01720  1194 ASN B OD1 
1696 N ND2 . ASN B 118 ? 1.00850 1.14720 0.96600 0.29230  -0.11230 0.00310  1194 ASN B ND2 
1697 N N   . GLU B 119 ? 1.22200 0.89270 0.83600 0.16270  -0.11590 0.10040  1195 GLU B N   
1698 C CA  . GLU B 119 ? 1.40330 0.93670 0.89850 0.15660  -0.13400 0.12360  1195 GLU B CA  
1699 C C   . GLU B 119 ? 1.31070 0.82860 0.80530 0.08360  -0.10040 0.15230  1195 GLU B C   
1700 O O   . GLU B 119 ? 1.39760 0.80770 0.79870 0.06770  -0.10960 0.17600  1195 GLU B O   
1701 C CB  . GLU B 119 ? 1.51720 0.91830 0.92110 0.17570  -0.16150 0.12810  1195 GLU B CB  
1702 C CG  . GLU B 119 ? 1.60120 0.99560 0.97770 0.25910  -0.19920 0.10260  1195 GLU B CG  
1703 C CD  . GLU B 119 ? 1.69300 1.06130 1.06960 0.27940  -0.20780 0.08940  1195 GLU B CD  
1704 O OE1 . GLU B 119 ? 1.77600 1.04170 1.09980 0.23930  -0.20590 0.10620  1195 GLU B OE1 
1705 O OE2 . GLU B 119 ? 1.67550 1.13040 1.10650 0.33310  -0.21600 0.06310  1195 GLU B OE2 
1706 N N   . SER B 120 ? 1.22960 0.85210 0.82270 0.04290  -0.06270 0.15110  1196 SER B N   
1707 C CA  . SER B 120 ? 1.16760 0.79900 0.77390 -0.02210 -0.02580 0.17690  1196 SER B CA  
1708 C C   . SER B 120 ? 1.10690 0.82720 0.75890 -0.02100 -0.01010 0.16980  1196 SER B C   
1709 O O   . SER B 120 ? 1.16850 0.90210 0.82930 -0.06710 0.02130  0.18920  1196 SER B O   
1710 C CB  . SER B 120 ? 1.17890 0.85360 0.85250 -0.06820 0.00510  0.18310  1196 SER B CB  
1711 O OG  . SER B 120 ? 1.45450 1.02060 1.06070 -0.09290 -0.00460 0.20330  1196 SER B OG  
1712 N N   . LEU B 121 ? 1.04970 0.82830 0.72650 0.02940  -0.03160 0.14380  1197 LEU B N   
1713 C CA  . LEU B 121 ? 0.91490 0.77920 0.63580 0.02880  -0.02020 0.13470  1197 LEU B CA  
1714 C C   . LEU B 121 ? 1.20250 0.99140 0.83280 0.03030  -0.03180 0.15120  1197 LEU B C   
1715 O O   . LEU B 121 ? 1.45850 1.13700 0.99600 0.04500  -0.05580 0.16450  1197 LEU B O   
1716 C CB  . LEU B 121 ? 0.92780 0.88650 0.70960 0.07750  -0.04100 0.10330  1197 LEU B CB  
1717 C CG  . LEU B 121 ? 0.74750 0.80120 0.63040 0.07200  -0.02380 0.08700  1197 LEU B CG  
1718 C CD1 . LEU B 121 ? 0.70290 0.85050 0.64000 0.12130  -0.04650 0.05910  1197 LEU B CD1 
1719 C CD2 . LEU B 121 ? 0.84180 0.96150 0.79370 0.01790  0.01940  0.09360  1197 LEU B CD2 
1720 N N   . ILE B 122 ? 1.17290 1.01420 0.82490 0.01400  -0.01450 0.15110  1198 ILE B N   
1721 C CA  . ILE B 122 ? 1.18570 0.96590 0.75620 0.01160  -0.02010 0.16680  1198 ILE B CA  
1722 C C   . ILE B 122 ? 1.18460 1.00880 0.75560 0.05710  -0.05070 0.14410  1198 ILE B C   
1723 O O   . ILE B 122 ? 1.15040 1.07560 0.79790 0.05280  -0.03970 0.12630  1198 ILE B O   
1724 C CB  . ILE B 122 ? 1.09000 0.89380 0.67790 -0.04020 0.02340  0.18420  1198 ILE B CB  
1725 C CG1 . ILE B 122 ? 1.07630 0.85810 0.67870 -0.08630 0.05450  0.20680  1198 ILE B CG1 
1726 C CG2 . ILE B 122 ? 1.12650 0.86760 0.62740 -0.04170 0.01950  0.20090  1198 ILE B CG2 
1727 C CD1 . ILE B 122 ? 0.95820 0.77190 0.58130 -0.13320 0.09960  0.22540  1198 ILE B CD1 
1728 N N   . ASP B 123 ? 1.24580 0.99190 0.72900 0.09370  -0.08620 0.14810  1199 ASP B N   
1729 C CA  . ASP B 123 ? 1.23730 1.00340 0.69460 0.12960  -0.11460 0.13560  1199 ASP B CA  
1730 C C   . ASP B 123 ? 1.34060 1.01810 0.70130 0.11340  -0.11180 0.15950  1199 ASP B C   
1731 O O   . ASP B 123 ? 1.42350 0.99880 0.69060 0.13390  -0.13560 0.17370  1199 ASP B O   
1732 C CB  . ASP B 123 ? 1.28410 1.03550 0.71500 0.19290  -0.16020 0.12070  1199 ASP B CB  
1733 C CG  . ASP B 123 ? 1.42720 1.26350 0.88740 0.23020  -0.18710 0.09850  1199 ASP B CG  
1734 O OD1 . ASP B 123 ? 1.52770 1.36900 0.96470 0.21700  -0.18550 0.10170  1199 ASP B OD1 
1735 O OD2 . ASP B 123 ? 1.40030 1.30030 0.90550 0.27260  -0.21030 0.07850  1199 ASP B OD2 
1736 N N   . LEU B 124 ? 1.24760 0.96370 0.62920 0.07770  -0.08210 0.16400  1200 LEU B N   
1737 C CA  . LEU B 124 ? 1.32210 0.96950 0.62250 0.05490  -0.06870 0.18790  1200 LEU B CA  
1738 C C   . LEU B 124 ? 1.42330 1.01960 0.64010 0.09690  -0.10940 0.18540  1200 LEU B C   
1739 O O   . LEU B 124 ? 1.41100 1.05620 0.65310 0.14020  -0.14380 0.16120  1200 LEU B O   
1740 C CB  . LEU B 124 ? 1.24370 0.96410 0.59550 0.02130  -0.03320 0.18370  1200 LEU B CB  
1741 C CG  . LEU B 124 ? 1.17570 0.91870 0.57730 -0.02740 0.01470  0.19850  1200 LEU B CG  
1742 C CD1 . LEU B 124 ? 1.10270 0.91900 0.55280 -0.05070 0.04590  0.19010  1200 LEU B CD1 
1743 C CD2 . LEU B 124 ? 1.25800 0.90570 0.58300 -0.05550 0.03220  0.23530  1200 LEU B CD2 
1744 N N   . GLN B 125 ? 1.65820 1.16540 0.78020 0.08410  -0.10460 0.21100  1201 GLN B N   
1745 C CA  . GLN B 125 ? 1.76870 1.21940 0.80000 0.11850  -0.13880 0.21290  1201 GLN B CA  
1746 C C   . GLN B 125 ? 1.78670 1.30570 0.83920 0.11570  -0.13450 0.19770  1201 GLN B C   
1747 O O   . GLN B 125 ? 1.67260 1.19600 0.72350 0.07650  -0.09680 0.21000  1201 GLN B O   
1748 C CB  . GLN B 125 ? 1.86310 1.18960 0.78360 0.10120  -0.13230 0.24880  1201 GLN B CB  
1749 C CG  . GLN B 125 ? 2.00210 1.23040 0.85580 0.12810  -0.16380 0.25930  1201 GLN B CG  
1750 C CD  . GLN B 125 ? 2.15820 1.33530 0.93130 0.18230  -0.21070 0.25350  1201 GLN B CD  
1751 O OE1 . GLN B 125 ? 2.21260 1.46150 1.02400 0.22210  -0.23740 0.22600  1201 GLN B OE1 
1752 N NE2 . GLN B 125 ? 2.19440 1.27830 0.89940 0.17730  -0.21440 0.27060  1201 GLN B NE2 
1753 N N   . GLU B 126 ? 2.00770 1.57980 1.07870 0.15610  -0.17230 0.17210  1202 GLU B N   
1754 C CA  . GLU B 126 ? 1.92030 1.55190 1.00230 0.15800  -0.18020 0.15500  1202 GLU B CA  
1755 C C   . GLU B 126 ? 2.01170 1.55670 0.98250 0.15640  -0.18240 0.17440  1202 GLU B C   
1756 O O   . GLU B 126 ? 2.04840 1.60450 1.00700 0.13150  -0.16070 0.17550  1202 GLU B O   
1757 C CB  . GLU B 126 ? 1.88700 1.59140 1.00800 0.20300  -0.22610 0.12730  1202 GLU B CB  
1758 C CG  . GLU B 126 ? 1.81880 1.64140 1.06220 0.19570  -0.21870 0.10380  1202 GLU B CG  
1759 C CD  . GLU B 126 ? 1.83060 1.68470 1.11760 0.23310  -0.24200 0.09360  1202 GLU B CD  
1760 O OE1 . GLU B 126 ? 1.86820 1.73240 1.13220 0.28170  -0.28520 0.08430  1202 GLU B OE1 
1761 O OE2 . GLU B 126 ? 1.75900 1.62990 1.10200 0.21580  -0.21710 0.09490  1202 GLU B OE2 
1762 N N   . THR C 3   ? 1.53480 1.43080 1.20540 -0.00380 -0.04910 0.14300  912  THR C N   
1763 C CA  . THR C 3   ? 1.53920 1.50590 1.29850 0.03510  -0.03180 0.12540  912  THR C CA  
1764 C C   . THR C 3   ? 1.50770 1.52630 1.27280 -0.00320 -0.02330 0.13070  912  THR C C   
1765 O O   . THR C 3   ? 1.42170 1.41390 1.20020 0.01120  -0.02440 0.12690  912  THR C O   
1766 C CB  . THR C 3   ? 1.50530 1.56280 1.33950 0.07050  -0.01500 0.10970  912  THR C CB  
1767 O OG1 . THR C 3   ? 1.52650 1.67820 1.37010 0.03260  -0.00320 0.11380  912  THR C OG1 
1768 C CG2 . THR C 3   ? 1.42750 1.43620 1.25030 0.10280  -0.02370 0.10510  912  THR C CG2 
1769 N N   . GLN C 4   ? 1.50640 1.59340 1.25770 -0.05190 -0.01620 0.13890  913  GLN C N   
1770 C CA  . GLN C 4   ? 1.50890 1.65860 1.26650 -0.09180 -0.00740 0.14230  913  GLN C CA  
1771 C C   . GLN C 4   ? 1.57270 1.62910 1.25660 -0.12720 -0.02290 0.15730  913  GLN C C   
1772 O O   . GLN C 4   ? 1.56490 1.65960 1.25890 -0.15010 -0.01680 0.15790  913  GLN C O   
1773 C CB  . GLN C 4   ? 1.52660 1.77290 1.28350 -0.13640 0.00320  0.14540  913  GLN C CB  
1774 C CG  . GLN C 4   ? 1.40770 1.78330 1.25620 -0.10910 0.02350  0.12710  913  GLN C CG  
1775 C CD  . GLN C 4   ? 1.29840 1.68820 1.19250 -0.05880 0.02790  0.11500  913  GLN C CD  
1776 O OE1 . GLN C 4   ? 1.35390 1.68050 1.20840 -0.05540 0.01770  0.12120  913  GLN C OE1 
1777 N NE2 . GLN C 4   ? 1.12220 1.59510 1.09910 -0.01900 0.04290  0.09730  913  GLN C NE2 
1778 N N   . ASN C 5   ? 1.60470 1.54400 1.21700 -0.13100 -0.04290 0.16820  914  ASN C N   
1779 C CA  . ASN C 5   ? 1.72970 1.56170 1.27360 -0.15170 -0.06060 0.17990  914  ASN C CA  
1780 C C   . ASN C 5   ? 1.74420 1.55380 1.33590 -0.10230 -0.05970 0.16670  914  ASN C C   
1781 O O   . ASN C 5   ? 1.78290 1.58570 1.36770 -0.12070 -0.05970 0.16950  914  ASN C O   
1782 C CB  . ASN C 5   ? 1.77400 1.48520 1.22980 -0.16230 -0.08400 0.19300  914  ASN C CB  
1783 C CG  . ASN C 5   ? 1.81010 1.40770 1.19190 -0.18350 -0.10380 0.20440  914  ASN C CG  
1784 O OD1 . ASN C 5   ? 1.91850 1.46070 1.21660 -0.23590 -0.11630 0.22200  914  ASN C OD1 
1785 N ND2 . ASN C 5   ? 1.78680 1.34590 1.19540 -0.14420 -0.10740 0.19430  914  ASN C ND2 
1786 N N   . VAL C 6   ? 1.67190 1.47290 1.30970 -0.04350 -0.05850 0.15230  915  VAL C N   
1787 C CA  . VAL C 6   ? 1.55060 1.32950 1.23540 0.00740  -0.05710 0.13750  915  VAL C CA  
1788 C C   . VAL C 6   ? 1.40820 1.28240 1.15850 0.00750  -0.03810 0.13000  915  VAL C C   
1789 O O   . VAL C 6   ? 1.42870 1.27490 1.18400 0.01480  -0.04010 0.12740  915  VAL C O   
1790 C CB  . VAL C 6   ? 1.53760 1.31190 1.26660 0.06640  -0.05540 0.12150  915  VAL C CB  
1791 C CG1 . VAL C 6   ? 1.38070 1.14060 1.15870 0.11450  -0.05200 0.10520  915  VAL C CG1 
1792 C CG2 . VAL C 6   ? 1.66940 1.35180 1.33470 0.07000  -0.07530 0.12740  915  VAL C CG2 
1793 N N   . LEU C 7   ? 1.34690 1.32960 1.14530 0.00160  -0.02110 0.12560  916  LEU C N   
1794 C CA  . LEU C 7   ? 1.16470 1.24790 1.02600 0.00220  -0.00360 0.11750  916  LEU C CA  
1795 C C   . LEU C 7   ? 1.18460 1.25970 1.00510 -0.04660 -0.00750 0.12920  916  LEU C C   
1796 O O   . LEU C 7   ? 1.13960 1.22050 0.98740 -0.03360 -0.00400 0.12380  916  LEU C O   
1797 C CB  . LEU C 7   ? 1.03570 1.22980 0.93930 -0.00380 0.01130  0.11230  916  LEU C CB  
1798 C CG  . LEU C 7   ? 1.05940 1.29030 1.02860 0.05130  0.02090  0.09590  916  LEU C CG  
1799 C CD1 . LEU C 7   ? 1.12180 1.44960 1.11890 0.04060  0.03240  0.09220  916  LEU C CD1 
1800 C CD2 . LEU C 7   ? 1.01910 1.28140 1.05470 0.09280  0.03100  0.08150  916  LEU C CD2 
1801 N N   . TYR C 8   ? 1.28810 1.34890 1.04360 -0.10160 -0.01440 0.14430  917  TYR C N   
1802 C CA  . TYR C 8   ? 1.32960 1.38760 1.04080 -0.15590 -0.01740 0.15580  917  TYR C CA  
1803 C C   . TYR C 8   ? 1.42600 1.37900 1.10130 -0.14780 -0.03160 0.15980  917  TYR C C   
1804 O O   . TYR C 8   ? 1.50000 1.47410 1.18850 -0.15820 -0.02750 0.15850  917  TYR C O   
1805 C CB  . TYR C 8   ? 1.49390 1.54510 1.13450 -0.21750 -0.02320 0.17130  917  TYR C CB  
1806 C CG  . TYR C 8   ? 1.58180 1.63900 1.17860 -0.27610 -0.02440 0.18160  917  TYR C CG  
1807 C CD1 . TYR C 8   ? 1.62350 1.78380 1.27080 -0.28590 -0.00940 0.17320  917  TYR C CD1 
1808 C CD2 . TYR C 8   ? 1.57990 1.53870 1.08360 -0.32140 -0.04120 0.19890  917  TYR C CD2 
1809 C CE1 . TYR C 8   ? 1.63530 1.80600 1.24450 -0.33960 -0.01000 0.18100  917  TYR C CE1 
1810 C CE2 . TYR C 8   ? 1.61160 1.57620 1.07420 -0.37710 -0.04180 0.20770  917  TYR C CE2 
1811 C CZ  . TYR C 8   ? 1.63400 1.70720 1.15070 -0.38660 -0.02560 0.19840  917  TYR C CZ  
1812 O OH  . TYR C 8   ? 1.63390 1.71780 1.11210 -0.44140 -0.02550 0.20550  917  TYR C OH  
1813 N N   . GLU C 9   ? 1.45360 1.30020 1.08770 -0.12720 -0.04800 0.16270  918  GLU C N   
1814 C CA  . GLU C 9   ? 1.54140 1.28200 1.13630 -0.11870 -0.06390 0.16520  918  GLU C CA  
1815 C C   . GLU C 9   ? 1.39560 1.16440 1.06300 -0.06970 -0.05430 0.14880  918  GLU C C   
1816 O O   . GLU C 9   ? 1.40260 1.13390 1.05600 -0.07620 -0.05930 0.15000  918  GLU C O   
1817 C CB  . GLU C 9   ? 1.59320 1.21790 1.12450 -0.10830 -0.08520 0.17080  918  GLU C CB  
1818 C CG  . GLU C 9   ? 1.77630 1.35580 1.21900 -0.16760 -0.09750 0.19050  918  GLU C CG  
1819 C CD  . GLU C 9   ? 1.90660 1.34950 1.26250 -0.17090 -0.12390 0.20020  918  GLU C CD  
1820 O OE1 . GLU C 9   ? 1.92850 1.29950 1.28650 -0.12720 -0.13560 0.19110  918  GLU C OE1 
1821 O OE2 . GLU C 9   ? 1.90910 1.31720 1.19240 -0.21880 -0.13340 0.21660  918  GLU C OE2 
1822 N N   . ASN C 10  ? 1.20890 1.04440 0.94930 -0.02590 -0.04040 0.13430  919  ASN C N   
1823 C CA  . ASN C 10  ? 1.16530 1.03680 0.97710 0.01900  -0.02920 0.11850  919  ASN C CA  
1824 C C   . ASN C 10  ? 1.14870 1.09600 0.98630 -0.00630 -0.01770 0.11980  919  ASN C C   
1825 O O   . ASN C 10  ? 1.16290 1.09690 1.01970 0.00940  -0.01670 0.11440  919  ASN C O   
1826 C CB  . ASN C 10  ? 1.14430 1.07110 1.02340 0.06680  -0.01680 0.10350  919  ASN C CB  
1827 C CG  . ASN C 10  ? 1.23250 1.08150 1.10280 0.10760  -0.02710 0.09580  919  ASN C CG  
1828 O OD1 . ASN C 10  ? 1.38010 1.13960 1.21200 0.11360  -0.04160 0.09650  919  ASN C OD1 
1829 N ND2 . ASN C 10  ? 1.12440 1.00910 1.03110 0.13680  -0.01990 0.08680  919  ASN C ND2 
1830 N N   . GLN C 11  ? 0.99380 1.01990 0.83200 -0.04350 -0.00940 0.12550  920  GLN C N   
1831 C CA  . GLN C 11  ? 0.95360 1.06410 0.81820 -0.06800 0.00160  0.12470  920  GLN C CA  
1832 C C   . GLN C 11  ? 1.02380 1.07210 0.83130 -0.10560 -0.00930 0.13580  920  GLN C C   
1833 O O   . GLN C 11  ? 1.10580 1.17350 0.94040 -0.09780 -0.00490 0.13090  920  GLN C O   
1834 C CB  . GLN C 11  ? 0.94880 1.15490 0.82020 -0.10200 0.01110  0.12680  920  GLN C CB  
1835 C CG  . GLN C 11  ? 1.07880 1.35590 1.01200 -0.06410 0.02280  0.11430  920  GLN C CG  
1836 C CD  . GLN C 11  ? 1.11110 1.50330 1.11500 -0.04970 0.03830  0.10150  920  GLN C CD  
1837 O OE1 . GLN C 11  ? 1.18500 1.64570 1.18620 -0.08710 0.04310  0.10330  920  GLN C OE1 
1838 N NE2 . GLN C 11  ? 1.01320 1.42670 1.07920 0.00490  0.04580  0.08770  920  GLN C NE2 
1839 N N   . LYS C 12  ? 1.08780 1.06020 0.81710 -0.14410 -0.02350 0.15010  921  LYS C N   
1840 C CA  . LYS C 12  ? 1.17060 1.06650 0.83600 -0.18010 -0.03650 0.16110  921  LYS C CA  
1841 C C   . LYS C 12  ? 1.29640 1.13570 0.98250 -0.13800 -0.04120 0.15260  921  LYS C C   
1842 O O   . LYS C 12  ? 1.36270 1.21710 1.05680 -0.14950 -0.03840 0.15200  921  LYS C O   
1843 C CB  . LYS C 12  ? 1.25590 1.05180 0.83260 -0.21200 -0.05480 0.17600  921  LYS C CB  
1844 C CG  . LYS C 12  ? 1.26530 1.09470 0.79650 -0.27010 -0.05360 0.18840  921  LYS C CG  
1845 C CD  . LYS C 12  ? 1.51440 1.23230 0.96330 -0.28540 -0.07320 0.20120  921  LYS C CD  
1846 C CE  . LYS C 12  ? 1.65840 1.36850 1.03250 -0.35460 -0.07790 0.21780  921  LYS C CE  
1847 N NZ  . LYS C 12  ? 1.77020 1.38850 1.08080 -0.35580 -0.09480 0.22750  921  LYS C NZ  
1848 N N   . LEU C 13  ? 1.26580 1.04630 0.96090 -0.09150 -0.04780 0.14520  922  LEU C N   
1849 C CA  . LEU C 13  ? 1.09410 0.81640 0.80760 -0.04800 -0.05300 0.13460  922  LEU C CA  
1850 C C   . LEU C 13  ? 1.14650 0.94720 0.92970 -0.02820 -0.03700 0.12400  922  LEU C C   
1851 O O   . LEU C 13  ? 1.20490 0.97600 0.98050 -0.03170 -0.04060 0.12350  922  LEU C O   
1852 C CB  . LEU C 13  ? 1.05130 0.73570 0.78160 0.00110  -0.05700 0.12430  922  LEU C CB  
1853 C CG  . LEU C 13  ? 1.05640 0.68750 0.80890 0.04820  -0.06140 0.11030  922  LEU C CG  
1854 C CD1 . LEU C 13  ? 1.25100 0.77480 0.93530 0.03240  -0.08180 0.11620  922  LEU C CD1 
1855 C CD2 . LEU C 13  ? 1.00080 0.62000 0.78170 0.09630  -0.06120 0.09750  922  LEU C CD2 
1856 N N   . ILE C 14  ? 1.00610 0.90210 0.85290 -0.00830 -0.02070 0.11580  923  ILE C N   
1857 C CA  . ILE C 14  ? 0.92320 0.89880 0.83800 0.01390  -0.00560 0.10520  923  ILE C CA  
1858 C C   . ILE C 14  ? 0.88220 0.88510 0.77910 -0.02780 -0.00490 0.11270  923  ILE C C   
1859 O O   . ILE C 14  ? 0.89650 0.89780 0.81510 -0.01370 -0.00280 0.10750  923  ILE C O   
1860 C CB  . ILE C 14  ? 0.86750 0.94280 0.84150 0.03250  0.00960  0.09720  923  ILE C CB  
1861 C CG1 . ILE C 14  ? 0.83060 0.88430 0.83350 0.08060  0.01120  0.08670  923  ILE C CG1 
1862 C CG2 . ILE C 14  ? 0.70100 0.86220 0.73190 0.04310  0.02270  0.08930  923  ILE C CG2 
1863 C CD1 . ILE C 14  ? 0.76200 0.89870 0.80560 0.09070  0.02270  0.08150  923  ILE C CD1 
1864 N N   . ALA C 15  ? 0.94850 0.97850 0.80740 -0.07820 -0.00610 0.12390  924  ALA C N   
1865 C CA  . ALA C 15  ? 0.89740 0.96580 0.73850 -0.12350 -0.00430 0.13020  924  ALA C CA  
1866 C C   . ALA C 15  ? 0.90670 0.88020 0.69580 -0.13980 -0.01770 0.13700  924  ALA C C   
1867 O O   . ALA C 15  ? 1.06370 1.06280 0.86380 -0.15030 -0.01440 0.13570  924  ALA C O   
1868 C CB  . ALA C 15  ? 0.81220 0.92570 0.61950 -0.17520 -0.00280 0.13930  924  ALA C CB  
1869 N N   . ASN C 16  ? 1.01180 0.87980 0.74620 -0.14030 -0.03300 0.14320  925  ASN C N   
1870 C CA  . ASN C 16  ? 1.17540 0.94490 0.85270 -0.15710 -0.04840 0.14950  925  ASN C CA  
1871 C C   . ASN C 16  ? 1.13010 0.87190 0.84580 -0.11020 -0.04820 0.13710  925  ASN C C   
1872 O O   . ASN C 16  ? 1.13370 0.84450 0.83020 -0.12460 -0.05300 0.13870  925  ASN C O   
1873 C CB  . ASN C 16  ? 1.24850 0.91350 0.85090 -0.17250 -0.06680 0.15940  925  ASN C CB  
1874 C CG  . ASN C 16  ? 1.30390 0.98270 0.85180 -0.23190 -0.06880 0.17420  925  ASN C CG  
1875 O OD1 . ASN C 16  ? 1.26510 1.00110 0.80780 -0.27410 -0.06170 0.17910  925  ASN C OD1 
1876 N ND2 . ASN C 16  ? 1.41620 1.04520 0.92240 -0.23650 -0.07850 0.18080  925  ASN C ND2 
1877 N N   . GLN C 17  ? 1.08970 0.84050 0.85480 -0.05800 -0.04280 0.12480  926  GLN C N   
1878 C CA  . GLN C 17  ? 1.01580 0.75340 0.82530 -0.01100 -0.03970 0.11080  926  GLN C CA  
1879 C C   . GLN C 17  ? 0.98410 0.80690 0.84320 -0.01190 -0.02540 0.10690  926  GLN C C   
1880 O O   . GLN C 17  ? 0.84610 0.64390 0.70750 -0.00620 -0.02740 0.10340  926  GLN C O   
1881 C CB  . GLN C 17  ? 1.02030 0.76190 0.87130 0.03890  -0.03500 0.09870  926  GLN C CB  
1882 C CG  . GLN C 17  ? 1.00310 0.65490 0.80770 0.04800  -0.05070 0.09960  926  GLN C CG  
1883 C CD  . GLN C 17  ? 0.96850 0.51890 0.72340 0.04590  -0.06820 0.09950  926  GLN C CD  
1884 O OE1 . GLN C 17  ? 1.10570 0.61560 0.80360 0.00430  -0.07880 0.11190  926  GLN C OE1 
1885 N NE2 . GLN C 17  ? 1.04260 0.55160 0.81790 0.09040  -0.07140 0.08450  926  GLN C NE2 
1886 N N   . PHE C 18  ? 0.83580 0.75560 0.73120 -0.01910 -0.01240 0.10700  927  PHE C N   
1887 C CA  . PHE C 18  ? 0.73130 0.74190 0.67580 -0.01760 0.00050  0.10230  927  PHE C CA  
1888 C C   . PHE C 18  ? 0.76420 0.76920 0.67290 -0.06070 -0.00410 0.11050  927  PHE C C   
1889 O O   . PHE C 18  ? 0.88210 0.90250 0.81580 -0.04910 -0.00050 0.10530  927  PHE C O   
1890 C CB  . PHE C 18  ? 0.76680 0.87860 0.74620 -0.02260 0.01210  0.10070  927  PHE C CB  
1891 C CG  . PHE C 18  ? 0.79670 1.00270 0.82460 -0.01870 0.02330  0.09450  927  PHE C CG  
1892 C CD1 . PHE C 18  ? 0.78880 1.00970 0.86770 0.02560  0.02970  0.08360  927  PHE C CD1 
1893 C CD2 . PHE C 18  ? 0.71790 0.99760 0.73890 -0.05920 0.02690  0.09870  927  PHE C CD2 
1894 C CE1 . PHE C 18  ? 0.70310 1.00640 0.82350 0.03140  0.03820  0.07790  927  PHE C CE1 
1895 C CE2 . PHE C 18  ? 0.63270 1.00050 0.69870 -0.05220 0.03570  0.09120  927  PHE C CE2 
1896 C CZ  . PHE C 18  ? 0.67440 1.05170 0.78910 -0.00600 0.04070  0.08130  927  PHE C CZ  
1897 N N   . ASN C 19  ? 0.78740 0.77060 0.63770 -0.11010 -0.01170 0.12270  928  ASN C N   
1898 C CA  . ASN C 19  ? 0.86130 0.83880 0.67000 -0.15880 -0.01630 0.13120  928  ASN C CA  
1899 C C   . ASN C 19  ? 0.88690 0.76740 0.66570 -0.15060 -0.02800 0.13130  928  ASN C C   
1900 O O   . ASN C 19  ? 0.86080 0.75060 0.63700 -0.16660 -0.02750 0.13170  928  ASN C O   
1901 C CB  . ASN C 19  ? 0.93450 0.90350 0.68230 -0.21470 -0.02190 0.14410  928  ASN C CB  
1902 C CG  . ASN C 19  ? 0.95880 1.03820 0.73370 -0.23360 -0.00950 0.14300  928  ASN C CG  
1903 O OD1 . ASN C 19  ? 0.96510 1.13720 0.80080 -0.21380 0.00270  0.13320  928  ASN C OD1 
1904 N ND2 . ASN C 19  ? 0.91960 0.99000 0.64720 -0.27300 -0.01340 0.15260  928  ASN C ND2 
1905 N N   . SER C 20  ? 0.89070 0.68330 0.64750 -0.12610 -0.03850 0.12990  929  SER C N   
1906 C CA  . SER C 20  ? 1.05470 0.75590 0.79170 -0.10650 -0.05000 0.12550  929  SER C CA  
1907 C C   . SER C 20  ? 1.04290 0.78760 0.84120 -0.07150 -0.03930 0.11350  929  SER C C   
1908 O O   . SER C 20  ? 0.87750 0.61840 0.66760 -0.08750 -0.04050 0.11440  929  SER C O   
1909 C CB  . SER C 20  ? 1.12500 0.74580 0.84230 -0.07700 -0.06100 0.12180  929  SER C CB  
1910 O OG  . SER C 20  ? 1.21390 0.77980 0.94430 -0.03860 -0.06610 0.10990  929  SER C OG  
1911 N N   . ALA C 21  ? 0.95850 0.74580 0.81490 -0.02750 -0.02880 0.10300  930  ALA C N   
1912 C CA  . ALA C 21  ? 0.81330 0.63210 0.72630 0.01110  -0.01920 0.09080  930  ALA C CA  
1913 C C   . ALA C 21  ? 0.86750 0.75050 0.79420 -0.01270 -0.01250 0.09400  930  ALA C C   
1914 O O   . ALA C 21  ? 0.85750 0.71110 0.77940 -0.01140 -0.01550 0.09140  930  ALA C O   
1915 C CB  . ALA C 21  ? 0.75020 0.61980 0.71900 0.05140  -0.00770 0.08150  930  ALA C CB  
1916 N N   . ILE C 22  ? 0.80560 0.77240 0.74590 -0.03510 -0.00460 0.09870  931  ILE C N   
1917 C CA  . ILE C 22  ? 0.75430 0.79710 0.71190 -0.05660 0.00230  0.09980  931  ILE C CA  
1918 C C   . ILE C 22  ? 0.88680 0.87800 0.79590 -0.09220 -0.00710 0.10650  931  ILE C C   
1919 O O   . ILE C 22  ? 0.77000 0.78250 0.69910 -0.08650 -0.00400 0.10250  931  ILE C O   
1920 C CB  . ILE C 22  ? 0.68210 0.81410 0.64710 -0.08430 0.00900  0.10350  931  ILE C CB  
1921 C CG1 . ILE C 22  ? 0.64920 0.84080 0.66680 -0.04780 0.01880  0.09540  931  ILE C CG1 
1922 C CG2 . ILE C 22  ? 0.61380 0.81700 0.58850 -0.10990 0.01360  0.10350  931  ILE C CG2 
1923 C CD1 . ILE C 22  ? 0.61340 0.83970 0.69050 -0.00040 0.02700  0.08400  931  ILE C CD1 
1924 N N   . GLY C 23  ? 0.76550 0.69090 0.61180 -0.12740 -0.01860 0.11620  932  GLY C N   
1925 C CA  . GLY C 23  ? 0.91610 0.77700 0.70850 -0.16140 -0.02960 0.12260  932  GLY C CA  
1926 C C   . GLY C 23  ? 0.97720 0.78910 0.78340 -0.12980 -0.03280 0.11430  932  GLY C C   
1927 O O   . GLY C 23  ? 0.91410 0.74530 0.72360 -0.14310 -0.03110 0.11380  932  GLY C O   
1928 N N   . LYS C 24  ? 1.04540 0.80160 0.86180 -0.08880 -0.03660 0.10660  933  LYS C N   
1929 C CA  . LYS C 24  ? 1.00060 0.70790 0.83090 -0.05570 -0.03950 0.09610  933  LYS C CA  
1930 C C   . LYS C 24  ? 0.99670 0.77800 0.88450 -0.03540 -0.02620 0.08910  933  LYS C C   
1931 O O   . LYS C 24  ? 0.87810 0.63750 0.76330 -0.03490 -0.02840 0.08560  933  LYS C O   
1932 C CB  . LYS C 24  ? 0.93930 0.59630 0.78080 -0.01260 -0.04280 0.08640  933  LYS C CB  
1933 C CG  . LYS C 24  ? 1.02190 0.60020 0.80760 -0.02460 -0.05770 0.09170  933  LYS C CG  
1934 C CD  . LYS C 24  ? 1.05430 0.55040 0.83150 0.01190  -0.06810 0.07960  933  LYS C CD  
1935 C CE  . LYS C 24  ? 1.04260 0.47790 0.77870 0.01210  -0.08070 0.08270  933  LYS C CE  
1936 N NZ  . LYS C 24  ? 1.09210 0.55750 0.87240 0.05190  -0.07230 0.07370  933  LYS C NZ  
1937 N N   . ILE C 25  ? 0.86980 0.73260 0.80620 -0.01780 -0.01360 0.08660  934  ILE C N   
1938 C CA  . ILE C 25  ? 0.78370 0.71860 0.77530 0.00550  -0.00170 0.07980  934  ILE C CA  
1939 C C   . ILE C 25  ? 0.83260 0.81060 0.81350 -0.03030 -0.00120 0.08550  934  ILE C C   
1940 O O   . ILE C 25  ? 0.82600 0.80930 0.82370 -0.01930 0.00080  0.08100  934  ILE C O   
1941 C CB  . ILE C 25  ? 0.67540 0.68310 0.71450 0.03020  0.00940  0.07590  934  ILE C CB  
1942 C CG1 . ILE C 25  ? 0.58240 0.54850 0.63870 0.07100  0.01030  0.06750  934  ILE C CG1 
1943 C CG2 . ILE C 25  ? 0.58150 0.66940 0.66790 0.04540  0.01940  0.07120  934  ILE C CG2 
1944 C CD1 . ILE C 25  ? 0.69920 0.71780 0.78350 0.08480  0.01760  0.06630  934  ILE C CD1 
1945 N N   . GLN C 26  ? 0.81930 0.82480 0.77060 -0.07330 -0.00330 0.09470  935  GLN C N   
1946 C CA  . GLN C 26  ? 0.85220 0.89950 0.78800 -0.11300 -0.00320 0.09960  935  GLN C CA  
1947 C C   . GLN C 26  ? 0.87870 0.85580 0.78440 -0.12180 -0.01150 0.09990  935  GLN C C   
1948 O O   . GLN C 26  ? 0.94750 0.96090 0.87150 -0.12200 -0.00790 0.09700  935  GLN C O   
1949 C CB  . GLN C 26  ? 0.95320 1.01800 0.84790 -0.16300 -0.00600 0.10920  935  GLN C CB  
1950 C CG  . GLN C 26  ? 0.92390 1.07890 0.85100 -0.16090 0.00330  0.10760  935  GLN C CG  
1951 C CD  . GLN C 26  ? 0.97300 1.14690 0.85670 -0.21460 0.00100  0.11640  935  GLN C CD  
1952 O OE1 . GLN C 26  ? 0.97450 1.24120 0.87880 -0.22940 0.00870  0.11440  935  GLN C OE1 
1953 N NE2 . GLN C 26  ? 0.91670 1.00190 0.73780 -0.24500 -0.01010 0.12550  935  GLN C NE2 
1954 N N   . ASP C 27  ? 0.99350 0.87400 0.85430 -0.12720 -0.02290 0.10250  936  ASP C N   
1955 C CA  . ASP C 27  ? 1.03070 0.83390 0.85910 -0.13320 -0.03280 0.10110  936  ASP C CA  
1956 C C   . ASP C 27  ? 1.04960 0.86000 0.92430 -0.08990 -0.02700 0.08970  936  ASP C C   
1957 O O   . ASP C 27  ? 1.06220 0.87060 0.93380 -0.09880 -0.02800 0.08820  936  ASP C O   
1958 C CB  . ASP C 27  ? 1.09390 0.79340 0.86900 -0.13900 -0.04730 0.10370  936  ASP C CB  
1959 C CG  . ASP C 27  ? 1.29710 0.91270 1.03310 -0.14680 -0.05970 0.10150  936  ASP C CG  
1960 O OD1 . ASP C 27  ? 1.36900 1.00030 1.09190 -0.17580 -0.05980 0.10470  936  ASP C OD1 
1961 O OD2 . ASP C 27  ? 1.30910 0.84540 1.02820 -0.12320 -0.06970 0.09530  936  ASP C OD2 
1962 N N   . SER C 28  ? 0.90000 0.72080 0.81540 -0.04640 -0.02060 0.08180  937  SER C N   
1963 C CA  . SER C 28  ? 0.77090 0.59280 0.72770 -0.00460 -0.01460 0.07030  937  SER C CA  
1964 C C   . SER C 28  ? 0.82490 0.72880 0.81730 -0.00480 -0.00510 0.07040  937  SER C C   
1965 O O   . SER C 28  ? 0.89340 0.78690 0.89410 0.00430  -0.00460 0.06550  937  SER C O   
1966 C CB  . SER C 28  ? 0.77360 0.59180 0.76270 0.03720  -0.00940 0.06220  937  SER C CB  
1967 O OG  . SER C 28  ? 0.83070 0.73290 0.86540 0.05230  0.00250  0.06190  937  SER C OG  
1968 N N   . LEU C 29  ? 0.69620 0.67960 0.70750 -0.01510 0.00150  0.07490  938  LEU C N   
1969 C CA  . LEU C 29  ? 0.71850 0.78530 0.76320 -0.01370 0.00900  0.07380  938  LEU C CA  
1970 C C   . LEU C 29  ? 0.76800 0.82920 0.78360 -0.04870 0.00380  0.07790  938  LEU C C   
1971 O O   . LEU C 29  ? 0.81640 0.90080 0.85240 -0.03710 0.00670  0.07400  938  LEU C O   
1972 C CB  . LEU C 29  ? 0.66070 0.81330 0.72580 -0.02130 0.01490  0.07630  938  LEU C CB  
1973 C CG  . LEU C 29  ? 0.70180 0.87570 0.80390 0.01630  0.02150  0.07100  938  LEU C CG  
1974 C CD1 . LEU C 29  ? 0.66430 0.92720 0.78490 0.00570  0.02650  0.07230  938  LEU C CD1 
1975 C CD2 . LEU C 29  ? 0.66200 0.84010 0.80550 0.06180  0.02730  0.06220  938  LEU C CD2 
1976 N N   . SER C 30  ? 0.72520 0.75260 0.69210 -0.09050 -0.00390 0.08550  939  SER C N   
1977 C CA  . SER C 30  ? 0.77670 0.79270 0.71030 -0.12810 -0.00930 0.08940  939  SER C CA  
1978 C C   . SER C 30  ? 0.78420 0.73320 0.71220 -0.11060 -0.01390 0.08370  939  SER C C   
1979 O O   . SER C 30  ? 0.87980 0.85480 0.81600 -0.11610 -0.01230 0.08200  939  SER C O   
1980 C CB  . SER C 30  ? 0.79830 0.78200 0.67650 -0.17600 -0.01700 0.09850  939  SER C CB  
1981 O OG  . SER C 30  ? 0.70420 0.76750 0.58970 -0.19840 -0.01120 0.10250  939  SER C OG  
1982 N N   . SER C 31  ? 0.81260 0.68330 0.72930 -0.08860 -0.01930 0.07950  940  SER C N   
1983 C CA  . SER C 31  ? 0.81580 0.62170 0.72770 -0.06980 -0.02390 0.07130  940  SER C CA  
1984 C C   . SER C 31  ? 0.82530 0.67630 0.78730 -0.03520 -0.01400 0.06360  940  SER C C   
1985 O O   . SER C 31  ? 0.77520 0.60890 0.73460 -0.03520 -0.01560 0.05950  940  SER C O   
1986 C CB  . SER C 31  ? 0.76250 0.48720 0.65730 -0.04950 -0.03130 0.06570  940  SER C CB  
1987 O OG  . SER C 31  ? 0.95190 0.61780 0.79110 -0.08210 -0.04360 0.07260  940  SER C OG  
1988 N N   . THR C 32  ? 0.67220 0.57580 0.67580 -0.00710 -0.00470 0.06150  941  THR C N   
1989 C CA  . THR C 32  ? 0.60940 0.55850 0.65850 0.02550  0.00440  0.05530  941  THR C CA  
1990 C C   . THR C 32  ? 0.66990 0.67730 0.72320 0.00550  0.00590  0.05930  941  THR C C   
1991 O O   . THR C 32  ? 0.67970 0.67930 0.73990 0.01450  0.00650  0.05510  941  THR C O   
1992 C CB  . THR C 32  ? 0.57990 0.57420 0.66710 0.05500  0.01270  0.05330  941  THR C CB  
1993 O OG1 . THR C 32  ? 0.59360 0.52920 0.67160 0.06960  0.01020  0.04930  941  THR C OG1 
1994 C CG2 . THR C 32  ? 0.50390 0.53420 0.63270 0.08980  0.02090  0.04700  941  THR C CG2 
1995 N N   . ALA C 33  ? 0.67460 0.73990 0.72260 -0.02210 0.00610  0.06620  942  ALA C N   
1996 C CA  . ALA C 33  ? 0.60700 0.73550 0.65740 -0.04440 0.00690  0.06880  942  ALA C CA  
1997 C C   . ALA C 33  ? 0.67970 0.75930 0.69780 -0.06750 0.00050  0.06930  942  ALA C C   
1998 O O   . ALA C 33  ? 0.72940 0.83570 0.76230 -0.06090 0.00230  0.06670  942  ALA C O   
1999 C CB  . ALA C 33  ? 0.59580 0.78330 0.63670 -0.07670 0.00720  0.07450  942  ALA C CB  
2000 N N   . SER C 34  ? 0.67110 0.68050 0.64530 -0.09310 -0.00750 0.07240  943  SER C N   
2001 C CA  . SER C 34  ? 0.72210 0.67370 0.66180 -0.11410 -0.01510 0.07170  943  SER C CA  
2002 C C   . SER C 34  ? 0.74980 0.67870 0.71230 -0.08060 -0.01290 0.06290  943  SER C C   
2003 O O   . SER C 34  ? 0.77050 0.71710 0.73310 -0.09020 -0.01300 0.06200  943  SER C O   
2004 C CB  . SER C 34  ? 0.67370 0.53860 0.56640 -0.13230 -0.02530 0.07380  943  SER C CB  
2005 O OG  . SER C 34  ? 0.98780 0.86160 0.84300 -0.17840 -0.02960 0.08280  943  SER C OG  
2006 N N   . ALA C 35  ? 0.70440 0.59590 0.68370 -0.04460 -0.01100 0.05620  944  ALA C N   
2007 C CA  . ALA C 35  ? 0.66530 0.52280 0.66120 -0.01350 -0.00900 0.04600  944  ALA C CA  
2008 C C   . ALA C 35  ? 0.59630 0.51830 0.62850 0.00370  -0.00080 0.04510  944  ALA C C   
2009 O O   . ALA C 35  ? 0.68010 0.58790 0.71200 0.00670  -0.00110 0.04050  944  ALA C O   
2010 C CB  . ALA C 35  ? 0.66900 0.48690 0.67700 0.01900  -0.00740 0.03870  944  ALA C CB  
2011 N N   . LEU C 36  ? 0.60610 0.59610 0.66670 0.01430  0.00550  0.04880  945  LEU C N   
2012 C CA  . LEU C 36  ? 0.60630 0.66050 0.69900 0.03180  0.01140  0.04830  945  LEU C CA  
2013 C C   . LEU C 36  ? 0.64230 0.73250 0.72120 0.00140  0.00790  0.05240  945  LEU C C   
2014 O O   . LEU C 36  ? 0.64600 0.75400 0.73750 0.01280  0.00950  0.05000  945  LEU C O   
2015 C CB  . LEU C 36  ? 0.53340 0.65020 0.65650 0.04980  0.01680  0.05010  945  LEU C CB  
2016 C CG  . LEU C 36  ? 0.54570 0.63490 0.68720 0.08240  0.02140  0.04530  945  LEU C CG  
2017 C CD1 . LEU C 36  ? 0.42040 0.57300 0.58640 0.09260  0.02540  0.04770  945  LEU C CD1 
2018 C CD2 . LEU C 36  ? 0.45720 0.52280 0.61780 0.11580  0.02610  0.03780  945  LEU C CD2 
2019 N N   . GLY C 37  ? 0.68190 0.78140 0.73360 -0.03690 0.00330  0.05820  946  GLY C N   
2020 C CA  . GLY C 37  ? 0.53160 0.66180 0.56520 -0.07130 -0.00010 0.06140  946  GLY C CA  
2021 C C   . GLY C 37  ? 0.54920 0.62400 0.56350 -0.07730 -0.00420 0.05800  946  GLY C C   
2022 O O   . GLY C 37  ? 0.74600 0.85490 0.76990 -0.07680 -0.00330 0.05670  946  GLY C O   
2023 N N   . LYS C 38  ? 0.78270 0.77550 0.77120 -0.08060 -0.00910 0.05540  947  LYS C N   
2024 C CA  . LYS C 38  ? 0.67740 0.61060 0.64620 -0.08470 -0.01390 0.04970  947  LYS C CA  
2025 C C   . LYS C 38  ? 0.62180 0.55900 0.62150 -0.04820 -0.00810 0.04240  947  LYS C C   
2026 O O   . LYS C 38  ? 0.76330 0.70170 0.75910 -0.05470 -0.00920 0.04010  947  LYS C O   
2027 C CB  . LYS C 38  ? 0.66090 0.50830 0.59590 -0.09240 -0.02180 0.04700  947  LYS C CB  
2028 C CG  . LYS C 38  ? 0.77390 0.61060 0.67030 -0.13320 -0.02860 0.05520  947  LYS C CG  
2029 C CD  . LYS C 38  ? 0.94620 0.69400 0.80500 -0.13910 -0.03860 0.05310  947  LYS C CD  
2030 C CE  . LYS C 38  ? 1.04430 0.78690 0.86830 -0.17440 -0.04370 0.06300  947  LYS C CE  
2031 N NZ  . LYS C 38  ? 1.05120 0.69900 0.83110 -0.18160 -0.05610 0.06120  947  LYS C NZ  
2032 N N   . LEU C 39  ? 0.58180 0.52260 0.60990 -0.01300 -0.00210 0.03920  948  LEU C N   
2033 C CA  . LEU C 39  ? 0.70950 0.65860 0.76570 0.02020  0.00430  0.03310  948  LEU C CA  
2034 C C   . LEU C 39  ? 0.77010 0.78850 0.84140 0.01810  0.00640  0.03780  948  LEU C C   
2035 O O   . LEU C 39  ? 0.79980 0.81180 0.86990 0.02010  0.00640  0.03450  948  LEU C O   
2036 C CB  . LEU C 39  ? 0.50700 0.45270 0.58840 0.05430  0.01040  0.02970  948  LEU C CB  
2037 C CG  . LEU C 39  ? 0.63110 0.50310 0.70230 0.06630  0.00900  0.02000  948  LEU C CG  
2038 C CD1 . LEU C 39  ? 0.45310 0.32420 0.54670 0.09530  0.01470  0.01690  948  LEU C CD1 
2039 C CD2 . LEU C 39  ? 0.68020 0.51840 0.75060 0.07630  0.01010  0.01010  948  LEU C CD2 
2040 N N   . GLN C 40  ? 0.62650 0.71010 0.70970 0.01280  0.00740  0.04420  949  GLN C N   
2041 C CA  . GLN C 40  ? 0.63140 0.78730 0.73070 0.01460  0.00810  0.04690  949  GLN C CA  
2042 C C   . GLN C 40  ? 0.63600 0.78910 0.71330 -0.01350 0.00350  0.04730  949  GLN C C   
2043 O O   . GLN C 40  ? 0.71940 0.89100 0.80640 -0.00120 0.00420  0.04580  949  GLN C O   
2044 C CB  . GLN C 40  ? 0.67350 0.90150 0.78440 0.00670  0.00830  0.05140  949  GLN C CB  
2045 C CG  . GLN C 40  ? 0.62960 0.93440 0.75650 0.01040  0.00730  0.05190  949  GLN C CG  
2046 C CD  . GLN C 40  ? 0.59240 0.97470 0.73700 0.01060  0.00770  0.05300  949  GLN C CD  
2047 O OE1 . GLN C 40  ? 0.66160 1.04710 0.79930 -0.00600 0.00840  0.05490  949  GLN C OE1 
2048 N NE2 . GLN C 40  ? 0.45650 0.90270 0.62280 0.02950  0.00660  0.05100  949  GLN C NE2 
2049 N N   . ASP C 41  ? 0.69200 0.82040 0.73870 -0.04990 -0.00130 0.04940  950  ASP C N   
2050 C CA  . ASP C 41  ? 0.74400 0.87020 0.76640 -0.08190 -0.00600 0.04970  950  ASP C CA  
2051 C C   . ASP C 41  ? 0.73770 0.81000 0.75560 -0.06930 -0.00640 0.04340  950  ASP C C   
2052 O O   . ASP C 41  ? 0.74030 0.83690 0.75950 -0.07340 -0.00700 0.04260  950  ASP C O   
2053 C CB  . ASP C 41  ? 0.75590 0.85380 0.74170 -0.12330 -0.01140 0.05300  950  ASP C CB  
2054 C CG  . ASP C 41  ? 0.93670 1.09570 0.92210 -0.14510 -0.01080 0.05870  950  ASP C CG  
2055 O OD1 . ASP C 41  ? 0.96420 1.19870 0.97900 -0.13010 -0.00690 0.05910  950  ASP C OD1 
2056 O OD2 . ASP C 41  ? 1.05910 1.18910 1.01290 -0.17710 -0.01470 0.06210  950  ASP C OD2 
2057 N N   . VAL C 42  ? 0.67010 0.67490 0.68360 -0.05370 -0.00620 0.03790  951  VAL C N   
2058 C CA  . VAL C 42  ? 0.66280 0.61300 0.66860 -0.04570 -0.00700 0.02930  951  VAL C CA  
2059 C C   . VAL C 42  ? 0.74410 0.71850 0.77780 -0.01370 -0.00060 0.02660  951  VAL C C   
2060 O O   . VAL C 42  ? 0.75990 0.72700 0.78900 -0.01580 -0.00100 0.02290  951  VAL C O   
2061 C CB  . VAL C 42  ? 0.76580 0.63950 0.75710 -0.03940 -0.00980 0.02170  951  VAL C CB  
2062 C CG1 . VAL C 42  ? 0.81420 0.64260 0.80410 -0.02600 -0.00950 0.01010  951  VAL C CG1 
2063 C CG2 . VAL C 42  ? 0.86340 0.70260 0.81870 -0.07330 -0.01860 0.02450  951  VAL C CG2 
2064 N N   . VAL C 43  ? 0.68700 0.68740 0.74660 0.01410  0.00490  0.02850  952  VAL C N   
2065 C CA  . VAL C 43  ? 0.54430 0.56600 0.62700 0.04460  0.01030  0.02700  952  VAL C CA  
2066 C C   . VAL C 43  ? 0.74070 0.81640 0.82390 0.03480  0.00780  0.03200  952  VAL C C   
2067 O O   . VAL C 43  ? 0.80820 0.87510 0.89140 0.04360  0.00890  0.02900  952  VAL C O   
2068 C CB  . VAL C 43  ? 0.47660 0.52140 0.58490 0.07400  0.01550  0.02880  952  VAL C CB  
2069 C CG1 . VAL C 43  ? 0.40220 0.47680 0.52910 0.10080  0.01880  0.02960  952  VAL C CG1 
2070 C CG2 . VAL C 43  ? 0.45260 0.44220 0.56280 0.08890  0.01900  0.02180  952  VAL C CG2 
2071 N N   . ASN C 44  ? 0.72100 0.85030 0.80290 0.01540  0.00430  0.03820  953  ASN C N   
2072 C CA  . ASN C 44  ? 0.66940 0.86280 0.75460 0.00740  0.00130  0.04180  953  ASN C CA  
2073 C C   . ASN C 44  ? 0.69230 0.86510 0.75460 -0.01870 -0.00230 0.03970  953  ASN C C   
2074 O O   . ASN C 44  ? 0.75580 0.95330 0.82190 -0.01170 -0.00330 0.03970  953  ASN C O   
2075 C CB  . ASN C 44  ? 0.60290 0.86380 0.69500 -0.00510 -0.00070 0.04630  953  ASN C CB  
2076 C CG  . ASN C 44  ? 0.59240 0.89300 0.71280 0.02760  0.00200  0.04730  953  ASN C CG  
2077 O OD1 . ASN C 44  ? 0.49340 0.78600 0.62850 0.06010  0.00420  0.04590  953  ASN C OD1 
2078 N ND2 . ASN C 44  ? 0.52060 0.86430 0.64760 0.01870  0.00170  0.04920  953  ASN C ND2 
2079 N N   . GLN C 45  ? 0.68630 0.81240 0.72410 -0.04630 -0.00490 0.03770  954  GLN C N   
2080 C CA  . GLN C 45  ? 0.71450 0.81210 0.72880 -0.07080 -0.00870 0.03420  954  GLN C CA  
2081 C C   . GLN C 45  ? 0.82310 0.88320 0.84180 -0.04920 -0.00600 0.02780  954  GLN C C   
2082 O O   . GLN C 45  ? 0.85190 0.92280 0.86400 -0.05790 -0.00770 0.02650  954  GLN C O   
2083 C CB  . GLN C 45  ? 0.76700 0.80650 0.75260 -0.09800 -0.01300 0.03180  954  GLN C CB  
2084 C CG  . GLN C 45  ? 0.86430 0.93460 0.83500 -0.13070 -0.01630 0.03810  954  GLN C CG  
2085 C CD  . GLN C 45  ? 1.01340 1.01790 0.95040 -0.15680 -0.02190 0.03650  954  GLN C CD  
2086 O OE1 . GLN C 45  ? 1.10260 1.04340 1.02410 -0.15630 -0.02520 0.02950  954  GLN C OE1 
2087 N NE2 . GLN C 45  ? 1.04550 1.06470 0.96920 -0.18010 -0.02380 0.04250  954  GLN C NE2 
2088 N N   . ASN C 46  ? 0.78440 0.80320 0.81270 -0.02380 -0.00180 0.02310  955  ASN C N   
2089 C CA  . ASN C 46  ? 0.67170 0.65340 0.70360 -0.00410 0.00190  0.01510  955  ASN C CA  
2090 C C   . ASN C 46  ? 0.78130 0.80910 0.82870 0.01460  0.00450  0.01960  955  ASN C C   
2091 O O   . ASN C 46  ? 0.81420 0.83330 0.85460 0.01340  0.00460  0.01630  955  ASN C O   
2092 C CB  . ASN C 46  ? 0.67180 0.60330 0.71000 0.01630  0.00600  0.00780  955  ASN C CB  
2093 C CG  . ASN C 46  ? 0.81440 0.69020 0.83100 -0.00160 0.00100  0.00070  955  ASN C CG  
2094 O OD1 . ASN C 46  ? 0.88950 0.76510 0.88570 -0.03100 -0.00550 0.00360  955  ASN C OD1 
2095 N ND2 . ASN C 46  ? 0.62460 0.45200 0.64380 0.01580  0.00330  -0.00950 955  ASN C ND2 
2096 N N   . ALA C 47  ? 0.69830 0.77390 0.76370 0.03060  0.00540  0.02660  956  ALA C N   
2097 C CA  . ALA C 47  ? 0.66830 0.78550 0.74710 0.05310  0.00580  0.03090  956  ALA C CA  
2098 C C   . ALA C 47  ? 0.73720 0.89030 0.80530 0.03490  0.00040  0.03340  956  ALA C C   
2099 O O   . ALA C 47  ? 0.87680 1.03230 0.94380 0.04730  0.00030  0.03350  956  ALA C O   
2100 C CB  . ALA C 47  ? 0.55350 0.71710 0.65200 0.07110  0.00580  0.03620  956  ALA C CB  
2101 N N   . GLN C 48  ? 0.75110 0.92940 0.80950 0.00490  -0.00380 0.03510  957  GLN C N   
2102 C CA  . GLN C 48  ? 0.84180 1.06040 0.89010 -0.01590 -0.00900 0.03660  957  GLN C CA  
2103 C C   . GLN C 48  ? 0.75340 0.92420 0.78300 -0.03040 -0.00900 0.03110  957  GLN C C   
2104 O O   . GLN C 48  ? 0.75940 0.95100 0.78510 -0.03070 -0.01120 0.03140  957  GLN C O   
2105 C CB  . GLN C 48  ? 0.90670 1.16600 0.94920 -0.04600 -0.01240 0.03900  957  GLN C CB  
2106 C CG  . GLN C 48  ? 0.95370 1.27550 1.01640 -0.03200 -0.01290 0.04290  957  GLN C CG  
2107 C CD  . GLN C 48  ? 0.99350 1.36740 1.04980 -0.06430 -0.01600 0.04410  957  GLN C CD  
2108 O OE1 . GLN C 48  ? 1.14240 1.52490 1.18120 -0.09490 -0.01880 0.04290  957  GLN C OE1 
2109 N NE2 . GLN C 48  ? 0.83220 1.24330 0.90230 -0.05880 -0.01510 0.04580  957  GLN C NE2 
2110 N N   . ALA C 49  ? 0.68880 0.79830 0.70660 -0.04110 -0.00730 0.02520  958  ALA C N   
2111 C CA  . ALA C 49  ? 0.66200 0.72220 0.66300 -0.05240 -0.00750 0.01710  958  ALA C CA  
2112 C C   . ALA C 49  ? 0.70360 0.75470 0.71220 -0.02710 -0.00340 0.01460  958  ALA C C   
2113 O O   . ALA C 49  ? 0.71510 0.76580 0.71340 -0.03650 -0.00480 0.01200  958  ALA C O   
2114 C CB  . ALA C 49  ? 0.65450 0.65120 0.64480 -0.05930 -0.00730 0.00950  958  ALA C CB  
2115 N N   . LEU C 50  ? 0.75390 0.79780 0.77820 0.00250  0.00150  0.01550  959  LEU C N   
2116 C CA  . LEU C 50  ? 0.72150 0.75290 0.74980 0.02610  0.00590  0.01380  959  LEU C CA  
2117 C C   . LEU C 50  ? 0.70780 0.79020 0.73630 0.03150  0.00170  0.02180  959  LEU C C   
2118 O O   . LEU C 50  ? 0.76300 0.83500 0.78120 0.03150  0.00200  0.01980  959  LEU C O   
2119 C CB  . LEU C 50  ? 0.69350 0.70860 0.73720 0.05430  0.01160  0.01350  959  LEU C CB  
2120 C CG  . LEU C 50  ? 0.68360 0.68030 0.72840 0.07740  0.01690  0.01160  959  LEU C CG  
2121 C CD1 . LEU C 50  ? 0.66090 0.62110 0.69010 0.06530  0.01920  0.00220  959  LEU C CD1 
2122 C CD2 . LEU C 50  ? 0.61390 0.58410 0.67160 0.10010  0.02360  0.00820  959  LEU C CD2 
2123 N N   . ASN C 51  ? 0.68920 0.82670 0.72810 0.03570  -0.00260 0.02960  960  ASN C N   
2124 C CA  . ASN C 51  ? 0.60080 0.79310 0.64060 0.04350  -0.00860 0.03590  960  ASN C CA  
2125 C C   . ASN C 51  ? 0.63540 0.84140 0.65930 0.01590  -0.01280 0.03430  960  ASN C C   
2126 O O   . ASN C 51  ? 0.70540 0.92330 0.72240 0.02280  -0.01560 0.03600  960  ASN C O   
2127 C CB  . ASN C 51  ? 0.61250 0.86420 0.66860 0.05380  -0.01260 0.04140  960  ASN C CB  
2128 C CG  . ASN C 51  ? 0.67260 0.91290 0.74440 0.08440  -0.00900 0.04290  960  ASN C CG  
2129 O OD1 . ASN C 51  ? 0.65760 0.86300 0.72780 0.10620  -0.00570 0.04250  960  ASN C OD1 
2130 N ND2 . ASN C 51  ? 0.68130 0.95100 0.76690 0.08480  -0.00930 0.04420  960  ASN C ND2 
2131 N N   . THR C 52  ? 0.60620 0.80670 0.62210 -0.01500 -0.01350 0.03090  961  THR C N   
2132 C CA  . THR C 52  ? 0.69150 0.90060 0.69090 -0.04430 -0.01720 0.02820  961  THR C CA  
2133 C C   . THR C 52  ? 0.72050 0.87830 0.70710 -0.04560 -0.01420 0.02170  961  THR C C   
2134 O O   . THR C 52  ? 0.66370 0.83720 0.63960 -0.05720 -0.01730 0.02100  961  THR C O   
2135 C CB  . THR C 52  ? 0.66300 0.86690 0.65340 -0.07700 -0.01850 0.02590  961  THR C CB  
2136 O OG1 . THR C 52  ? 0.82300 1.08330 0.82450 -0.07800 -0.02080 0.03140  961  THR C OG1 
2137 C CG2 . THR C 52  ? 0.62270 0.82670 0.59420 -0.10890 -0.02190 0.02200  961  THR C CG2 
2138 N N   . LEU C 53  ? 0.66040 0.76150 0.64800 -0.03560 -0.00850 0.01570  962  LEU C N   
2139 C CA  . LEU C 53  ? 0.60320 0.65690 0.58110 -0.03330 -0.00450 0.00710  962  LEU C CA  
2140 C C   . LEU C 53  ? 0.63460 0.70390 0.61320 -0.01140 -0.00360 0.01210  962  LEU C C   
2141 O O   . LEU C 53  ? 0.75790 0.82670 0.72380 -0.02010 -0.00480 0.01010  962  LEU C O   
2142 C CB  . LEU C 53  ? 0.57510 0.57400 0.55710 -0.02400 0.00130  -0.00150 962  LEU C CB  
2143 C CG  . LEU C 53  ? 0.65250 0.60640 0.62710 -0.01980 0.00650  -0.01290 962  LEU C CG  
2144 C CD1 . LEU C 53  ? 0.66280 0.60250 0.62110 -0.04620 0.00330  -0.02160 962  LEU C CD1 
2145 C CD2 . LEU C 53  ? 0.64110 0.54960 0.62290 -0.00660 0.01220  -0.02240 962  LEU C CD2 
2146 N N   . VAL C 54  ? 0.64480 0.72760 0.63570 0.01550  -0.00250 0.01880  963  VAL C N   
2147 C CA  . VAL C 54  ? 0.68490 0.77620 0.67220 0.03850  -0.00310 0.02450  963  VAL C CA  
2148 C C   . VAL C 54  ? 0.65730 0.79410 0.63520 0.03010  -0.01120 0.02990  963  VAL C C   
2149 O O   . VAL C 54  ? 0.74150 0.86830 0.70530 0.03400  -0.01180 0.03050  963  VAL C O   
2150 C CB  . VAL C 54  ? 0.71550 0.82020 0.71690 0.06840  -0.00310 0.03130  963  VAL C CB  
2151 C CG1 . VAL C 54  ? 0.70590 0.82940 0.69960 0.09010  -0.00810 0.03900  963  VAL C CG1 
2152 C CG2 . VAL C 54  ? 0.71170 0.76710 0.71970 0.08060  0.00580  0.02550  963  VAL C CG2 
2153 N N   . LYS C 55  ? 0.78450 0.97150 0.76880 0.01870  -0.01720 0.03320  964  LYS C N   
2154 C CA  . LYS C 55  ? 0.87590 1.11490 0.85340 0.01280  -0.02550 0.03730  964  LYS C CA  
2155 C C   . LYS C 55  ? 0.94150 1.16130 0.90200 -0.01300 -0.02480 0.03160  964  LYS C C   
2156 O O   . LYS C 55  ? 0.88450 1.11500 0.83300 -0.00910 -0.02850 0.03380  964  LYS C O   
2157 C CB  . LYS C 55  ? 0.88500 1.18590 0.87410 0.00350  -0.03100 0.03970  964  LYS C CB  
2158 C CG  . LYS C 55  ? 1.06970 1.40680 1.07510 0.03300  -0.03450 0.04520  964  LYS C CG  
2159 C CD  . LYS C 55  ? 1.08490 1.48930 1.10270 0.02310  -0.03940 0.04540  964  LYS C CD  
2160 C CE  . LYS C 55  ? 0.89990 1.33300 0.93600 0.05240  -0.04150 0.04850  964  LYS C CE  
2161 N NZ  . LYS C 55  ? 0.77190 1.28790 0.81810 0.05210  -0.04970 0.04780  964  LYS C NZ  
2162 N N   . GLN C 56  ? 0.90970 1.10000 0.86750 -0.03790 -0.02090 0.02400  965  GLN C N   
2163 C CA  . GLN C 56  ? 0.85090 1.02470 0.79290 -0.06430 -0.02100 0.01690  965  GLN C CA  
2164 C C   . GLN C 56  ? 0.80040 0.92800 0.73270 -0.05470 -0.01590 0.01190  965  GLN C C   
2165 O O   . GLN C 56  ? 0.80970 0.93890 0.72850 -0.06710 -0.01740 0.00910  965  GLN C O   
2166 C CB  . GLN C 56  ? 0.86270 1.01450 0.80220 -0.09150 -0.02000 0.00980  965  GLN C CB  
2167 C CG  . GLN C 56  ? 1.02250 1.18720 0.94770 -0.12280 -0.02390 0.00540  965  GLN C CG  
2168 C CD  . GLN C 56  ? 1.11600 1.28520 1.03760 -0.15010 -0.02640 0.00360  965  GLN C CD  
2169 O OE1 . GLN C 56  ? 1.05760 1.21080 0.98550 -0.14740 -0.02490 0.00450  965  GLN C OE1 
2170 N NE2 . GLN C 56  ? 1.15000 1.33990 1.05910 -0.17820 -0.03030 0.00100  965  GLN C NE2 
2171 N N   . LEU C 57  ? 0.77240 0.86330 0.71080 -0.03420 -0.00980 0.01050  966  LEU C N   
2172 C CA  . LEU C 57  ? 0.75270 0.80070 0.68130 -0.02580 -0.00360 0.00470  966  LEU C CA  
2173 C C   . LEU C 57  ? 0.81970 0.88830 0.73700 -0.01160 -0.00720 0.01370  966  LEU C C   
2174 O O   . LEU C 57  ? 0.91120 0.96390 0.81240 -0.02030 -0.00570 0.00950  966  LEU C O   
2175 C CB  . LEU C 57  ? 0.76030 0.77040 0.69880 -0.00740 0.00380  0.00110  966  LEU C CB  
2176 C CG  . LEU C 57  ? 0.71460 0.68760 0.65840 -0.01940 0.00790  -0.01150 966  LEU C CG  
2177 C CD1 . LEU C 57  ? 0.63760 0.57730 0.59140 0.00130  0.01530  -0.01570 966  LEU C CD1 
2178 C CD2 . LEU C 57  ? 0.71460 0.66080 0.64530 -0.04020 0.00940  -0.02500 966  LEU C CD2 
2179 N N   . SER C 58  ? 0.71880 0.82040 0.64280 0.01000  -0.01250 0.02480  967  SER C N   
2180 C CA  . SER C 58  ? 0.75530 0.87580 0.66610 0.02740  -0.01870 0.03400  967  SER C CA  
2181 C C   . SER C 58  ? 0.78110 0.93420 0.68000 0.00830  -0.02530 0.03420  967  SER C C   
2182 O O   . SER C 58  ? 0.70530 0.85130 0.58520 0.01180  -0.02760 0.03690  967  SER C O   
2183 C CB  . SER C 58  ? 0.72950 0.88260 0.65080 0.05480  -0.02520 0.04370  967  SER C CB  
2184 O OG  . SER C 58  ? 1.02060 1.22250 0.95870 0.04660  -0.02980 0.04430  967  SER C OG  
2185 N N   . SER C 59  ? 0.74160 0.92640 0.64950 -0.01330 -0.02790 0.03110  968  SER C N   
2186 C CA  . SER C 59  ? 0.75970 0.97900 0.65800 -0.03520 -0.03360 0.02970  968  SER C CA  
2187 C C   . SER C 59  ? 0.80680 0.98550 0.68940 -0.05420 -0.02820 0.02100  968  SER C C   
2188 O O   . SER C 59  ? 0.91570 1.10760 0.78300 -0.05880 -0.03220 0.02260  968  SER C O   
2189 C CB  . SER C 59  ? 0.83190 1.08760 0.74180 -0.05630 -0.03600 0.02730  968  SER C CB  
2190 O OG  . SER C 59  ? 0.86070 1.13190 0.75980 -0.08380 -0.03840 0.02250  968  SER C OG  
2191 N N   . ASN C 60  ? 0.84120 0.97340 0.72740 -0.06390 -0.02010 0.01120  969  ASN C N   
2192 C CA  . ASN C 60  ? 0.82970 0.92320 0.70370 -0.08190 -0.01470 -0.00080 969  ASN C CA  
2193 C C   . ASN C 60  ? 0.88680 0.95690 0.74590 -0.06770 -0.01140 0.00080  969  ASN C C   
2194 O O   . ASN C 60  ? 0.94240 1.00640 0.78610 -0.08190 -0.01080 -0.00440 969  ASN C O   
2195 C CB  . ASN C 60  ? 0.83550 0.88560 0.71730 -0.09060 -0.00830 -0.01330 969  ASN C CB  
2196 C CG  . ASN C 60  ? 0.80040 0.86140 0.68670 -0.11360 -0.01210 -0.01750 969  ASN C CG  
2197 O OD1 . ASN C 60  ? 0.89560 1.00080 0.78140 -0.12430 -0.01840 -0.01100 969  ASN C OD1 
2198 N ND2 . ASN C 60  ? 0.66300 0.68300 0.55180 -0.12180 -0.00870 -0.02910 969  ASN C ND2 
2199 N N   . PHE C 61  ? 0.89040 0.94630 0.75190 -0.04220 -0.00910 0.00740  970  PHE C N   
2200 C CA  . PHE C 61  ? 0.98350 1.01060 0.82640 -0.03020 -0.00550 0.00940  970  PHE C CA  
2201 C C   . PHE C 61  ? 0.96270 1.01990 0.78740 -0.02450 -0.01480 0.02080  970  PHE C C   
2202 O O   . PHE C 61  ? 1.09210 1.12990 0.89450 -0.02880 -0.01320 0.02000  970  PHE C O   
2203 C CB  . PHE C 61  ? 0.98390 0.98580 0.83250 -0.00520 -0.00090 0.01330  970  PHE C CB  
2204 C CG  . PHE C 61  ? 0.92410 0.88620 0.78400 -0.00970 0.00970  -0.00030 970  PHE C CG  
2205 C CD1 . PHE C 61  ? 0.93900 0.86860 0.78870 -0.02540 0.01750  -0.01450 970  PHE C CD1 
2206 C CD2 . PHE C 61  ? 0.82600 0.78530 0.70640 0.00260  0.01160  -0.00000 970  PHE C CD2 
2207 C CE1 . PHE C 61  ? 0.90580 0.80190 0.76620 -0.02750 0.02630  -0.02920 970  PHE C CE1 
2208 C CE2 . PHE C 61  ? 0.85460 0.77790 0.74450 0.00010  0.02040  -0.01320 970  PHE C CE2 
2209 C CZ  . PHE C 61  ? 0.89500 0.78730 0.77520 -0.01420 0.02740  -0.02830 970  PHE C CZ  
2210 N N   . GLY C 62  ? 0.97420 1.07890 0.80750 -0.01490 -0.02460 0.03010  971  GLY C N   
2211 C CA  . GLY C 62  ? 1.00070 1.14310 0.81890 -0.00880 -0.03580 0.03940  971  GLY C CA  
2212 C C   . GLY C 62  ? 0.88510 1.03700 0.69130 -0.03600 -0.03630 0.03310  971  GLY C C   
2213 O O   . GLY C 62  ? 0.94610 1.09550 0.72900 -0.03410 -0.04020 0.03730  971  GLY C O   
2214 N N   . ALA C 63  ? 0.88290 1.04300 0.70250 -0.06080 -0.03290 0.02330  972  ALA C N   
2215 C CA  . ALA C 63  ? 0.86980 1.03920 0.68070 -0.08940 -0.03310 0.01520  972  ALA C CA  
2216 C C   . ALA C 63  ? 0.95860 1.08020 0.75320 -0.09870 -0.02490 0.00640  972  ALA C C   
2217 O O   . ALA C 63  ? 0.97900 1.10860 0.75640 -0.11130 -0.02720 0.00490  972  ALA C O   
2218 C CB  . ALA C 63  ? 0.74500 0.92630 0.57240 -0.11150 -0.03190 0.00690  972  ALA C CB  
2219 N N   . ILE C 64  ? 0.98100 1.05750 0.78040 -0.09290 -0.01570 -0.00010 973  ILE C N   
2220 C CA  . ILE C 64  ? 0.84430 0.87780 0.62980 -0.10250 -0.00660 -0.01160 973  ILE C CA  
2221 C C   . ILE C 64  ? 1.01310 1.03930 0.77240 -0.09130 -0.00830 -0.00190 973  ILE C C   
2222 O O   . ILE C 64  ? 1.12810 1.14940 0.86890 -0.10720 -0.00700 -0.00690 973  ILE C O   
2223 C CB  . ILE C 64  ? 0.79510 0.78760 0.59340 -0.09700 0.00310  -0.02190 973  ILE C CB  
2224 C CG1 . ILE C 64  ? 0.82790 0.81920 0.64580 -0.11070 0.00380  -0.03320 973  ILE C CG1 
2225 C CG2 . ILE C 64  ? 0.79890 0.75360 0.58180 -0.10360 0.01250  -0.03340 973  ILE C CG2 
2226 C CD1 . ILE C 64  ? 0.82240 0.78120 0.65570 -0.09970 0.01050  -0.04040 973  ILE C CD1 
2227 N N   . SER C 65  ? 1.09420 1.11780 0.84990 -0.06520 -0.01170 0.01140  974  SER C N   
2228 C CA  . SER C 65  ? 1.18760 1.19380 0.91320 -0.05220 -0.01430 0.02170  974  SER C CA  
2229 C C   . SER C 65  ? 1.11600 1.15680 0.82350 -0.05710 -0.02540 0.02940  974  SER C C   
2230 O O   . SER C 65  ? 1.15230 1.17410 0.83010 -0.06140 -0.02550 0.03190  974  SER C O   
2231 C CB  . SER C 65  ? 1.17620 1.17030 0.90170 -0.02180 -0.01700 0.03350  974  SER C CB  
2232 O OG  . SER C 65  ? 1.20010 1.23560 0.92790 -0.00290 -0.03080 0.04660  974  SER C OG  
2233 N N   . SER C 66  ? 1.03130 1.12150 0.75500 -0.05890 -0.03390 0.03190  975  SER C N   
2234 C CA  . SER C 66  ? 1.04010 1.17170 0.75130 -0.06590 -0.04440 0.03650  975  SER C CA  
2235 C C   . SER C 66  ? 1.05640 1.17830 0.75670 -0.09630 -0.03850 0.02490  975  SER C C   
2236 O O   . SER C 66  ? 1.08830 1.21500 0.76290 -0.09960 -0.04360 0.02930  975  SER C O   
2237 C CB  . SER C 66  ? 1.02620 1.21390 0.76040 -0.06530 -0.05230 0.03810  975  SER C CB  
2238 O OG  . SER C 66  ? 1.04830 1.27600 0.77460 -0.08050 -0.05940 0.03730  975  SER C OG  
2239 N N   . VAL C 67  ? 0.95080 1.05980 0.66890 -0.11660 -0.02930 0.01000  976  VAL C N   
2240 C CA  . VAL C 67  ? 0.92770 1.02800 0.63950 -0.14580 -0.02360 -0.00460 976  VAL C CA  
2241 C C   . VAL C 67  ? 1.03040 1.08810 0.71890 -0.14820 -0.01560 -0.00880 976  VAL C C   
2242 O O   . VAL C 67  ? 1.07060 1.13020 0.74120 -0.16600 -0.01500 -0.01400 976  VAL C O   
2243 C CB  . VAL C 67  ? 0.90650 0.99820 0.64210 -0.16260 -0.01740 -0.02020 976  VAL C CB  
2244 C CG1 . VAL C 67  ? 0.92180 0.99760 0.65060 -0.18890 -0.01150 -0.03780 976  VAL C CG1 
2245 C CG2 . VAL C 67  ? 0.89270 1.02600 0.64630 -0.16680 -0.02480 -0.01670 976  VAL C CG2 
2246 N N   . LEU C 68  ? 0.94000 0.96180 0.62810 -0.13280 -0.00920 -0.00740 977  LEU C N   
2247 C CA  . LEU C 68  ? 1.09970 1.07980 0.76450 -0.13700 -0.00020 -0.01250 977  LEU C CA  
2248 C C   . LEU C 68  ? 1.15670 1.13660 0.78570 -0.12980 -0.00760 0.00290  977  LEU C C   
2249 O O   . LEU C 68  ? 1.17150 1.13750 0.77660 -0.14730 -0.00340 -0.00280 977  LEU C O   
2250 C CB  . LEU C 68  ? 1.04880 0.99420 0.72360 -0.12190 0.00800  -0.01470 977  LEU C CB  
2251 C CG  . LEU C 68  ? 0.96240 0.89520 0.66400 -0.13250 0.01730  -0.03450 977  LEU C CG  
2252 C CD1 . LEU C 68  ? 0.91020 0.81230 0.62140 -0.11540 0.02470  -0.03570 977  LEU C CD1 
2253 C CD2 . LEU C 68  ? 0.93170 0.85190 0.62500 -0.15800 0.02530  -0.05430 977  LEU C CD2 
2254 N N   . ASN C 69  ? 1.24770 1.24390 0.87220 -0.10510 -0.01910 0.02070  978  ASN C N   
2255 C CA  . ASN C 69  ? 1.34380 1.33800 0.93150 -0.09350 -0.02950 0.03650  978  ASN C CA  
2256 C C   . ASN C 69  ? 1.40590 1.43150 0.98110 -0.11220 -0.03550 0.03490  978  ASN C C   
2257 O O   . ASN C 69  ? 1.43080 1.43940 0.96940 -0.11610 -0.03820 0.04080  978  ASN C O   
2258 C CB  . ASN C 69  ? 1.31810 1.32810 0.90720 -0.06020 -0.04250 0.05320  978  ASN C CB  
2259 C CG  . ASN C 69  ? 1.32780 1.29600 0.91320 -0.03980 -0.03820 0.05820  978  ASN C CG  
2260 O OD1 . ASN C 69  ? 1.41630 1.39810 1.01930 -0.01580 -0.04410 0.06500  978  ASN C OD1 
2261 N ND2 . ASN C 69  ? 1.22780 1.14710 0.79000 -0.05010 -0.02760 0.05400  978  ASN C ND2 
2262 N N   . ASP C 70  ? 1.44490 1.51170 1.04690 -0.12470 -0.03720 0.02710  979  ASP C N   
2263 C CA  . ASP C 70  ? 1.49750 1.59570 1.09080 -0.14470 -0.04180 0.02360  979  ASP C CA  
2264 C C   . ASP C 70  ? 1.46500 1.53680 1.04610 -0.17260 -0.03030 0.00860  979  ASP C C   
2265 O O   . ASP C 70  ? 1.48070 1.55580 1.03510 -0.18440 -0.03290 0.00990  979  ASP C O   
2266 C CB  . ASP C 70  ? 1.48050 1.62660 1.10520 -0.15330 -0.04550 0.01780  979  ASP C CB  
2267 C CG  . ASP C 70  ? 1.49320 1.69060 1.11160 -0.14500 -0.06030 0.02840  979  ASP C CG  
2268 O OD1 . ASP C 70  ? 1.51460 1.71420 1.10370 -0.14620 -0.06620 0.03400  979  ASP C OD1 
2269 O OD2 . ASP C 70  ? 1.44330 1.68020 1.08510 -0.13770 -0.06610 0.03030  979  ASP C OD2 
2270 N N   . ILE C 71  ? 1.41390 1.46090 1.01430 -0.18250 -0.01790 -0.00670 980  ILE C N   
2271 C CA  . ILE C 71  ? 1.28550 1.30960 0.87750 -0.20820 -0.00640 -0.02500 980  ILE C CA  
2272 C C   . ILE C 71  ? 1.25680 1.24780 0.81020 -0.20720 -0.00330 -0.01840 980  ILE C C   
2273 O O   . ILE C 71  ? 1.32130 1.31330 0.85350 -0.22760 -0.00120 -0.02450 980  ILE C O   
2274 C CB  . ILE C 71  ? 1.14230 1.14600 0.76220 -0.21400 0.00460  -0.04350 980  ILE C CB  
2275 C CG1 . ILE C 71  ? 1.18560 1.21750 0.83520 -0.22290 0.00110  -0.05210 980  ILE C CG1 
2276 C CG2 . ILE C 71  ? 1.23420 1.21140 0.84280 -0.23430 0.01660  -0.06270 980  ILE C CG2 
2277 C CD1 . ILE C 71  ? 1.22900 1.24070 0.90600 -0.22000 0.00770  -0.06490 980  ILE C CD1 
2278 N N   . LEU C 72  ? 1.33680 1.29980 0.87920 -0.18520 -0.00360 -0.00600 981  LEU C N   
2279 C CA  . LEU C 72  ? 1.34440 1.26750 0.84540 -0.18420 -0.00070 0.00160  981  LEU C CA  
2280 C C   . LEU C 72  ? 1.41300 1.34740 0.87710 -0.18360 -0.01310 0.01690  981  LEU C C   
2281 O O   . LEU C 72  ? 1.49940 1.40970 0.92770 -0.19960 -0.00890 0.01580  981  LEU C O   
2282 C CB  . LEU C 72  ? 1.35990 1.25260 0.85900 -0.15800 -0.00070 0.01280  981  LEU C CB  
2283 C CG  . LEU C 72  ? 1.35180 1.22470 0.87950 -0.15900 0.01290  -0.00250 981  LEU C CG  
2284 C CD1 . LEU C 72  ? 1.17580 1.02360 0.70310 -0.13150 0.01150  0.00980  981  LEU C CD1 
2285 C CD2 . LEU C 72  ? 1.34630 1.19300 0.86120 -0.18490 0.02800  -0.02150 981  LEU C CD2 
2286 N N   . SER C 73  ? 1.50340 1.47440 0.97490 -0.16640 -0.02790 0.02960  982  SER C N   
2287 C CA  . SER C 73  ? 1.61590 1.60420 1.05500 -0.16240 -0.04210 0.04350  982  SER C CA  
2288 C C   . SER C 73  ? 1.61590 1.62760 1.05150 -0.19320 -0.03880 0.03130  982  SER C C   
2289 O O   . SER C 73  ? 1.78750 1.78760 1.18350 -0.20150 -0.04250 0.03730  982  SER C O   
2290 C CB  . SER C 73  ? 1.66120 1.68910 1.11360 -0.13540 -0.05840 0.05660  982  SER C CB  
2291 O OG  . SER C 73  ? 1.62530 1.70690 1.10390 -0.14810 -0.06160 0.04880  982  SER C OG  
2292 N N   . ARG C 74  ? 1.57960 1.62010 1.05260 -0.20950 -0.03270 0.01470  983  ARG C N   
2293 C CA  . ARG C 74  ? 1.50710 1.56800 0.98130 -0.24020 -0.02820 -0.00070 983  ARG C CA  
2294 C C   . ARG C 74  ? 1.59460 1.61750 1.04330 -0.26110 -0.01560 -0.01140 983  ARG C C   
2295 O O   . ARG C 74  ? 1.61390 1.64280 1.03500 -0.27800 -0.01730 -0.01180 983  ARG C O   
2296 C CB  . ARG C 74  ? 1.44990 1.53570 0.96720 -0.25240 -0.02320 -0.01780 983  ARG C CB  
2297 C CG  . ARG C 74  ? 1.42480 1.56010 0.96220 -0.24510 -0.03500 -0.01130 983  ARG C CG  
2298 C CD  . ARG C 74  ? 1.49260 1.64410 1.06760 -0.25820 -0.03030 -0.02710 983  ARG C CD  
2299 N NE  . ARG C 74  ? 1.62790 1.82540 1.22080 -0.25120 -0.04070 -0.01980 983  ARG C NE  
2300 C CZ  . ARG C 74  ? 1.64990 1.86850 1.27000 -0.26420 -0.03990 -0.03020 983  ARG C CZ  
2301 N NH1 . ARG C 74  ? 1.63480 1.83020 1.26790 -0.28280 -0.03040 -0.04880 983  ARG C NH1 
2302 N NH2 . ARG C 74  ? 1.59920 1.86210 1.23170 -0.25900 -0.04910 -0.02290 983  ARG C NH2 
2303 N N   . LEU C 75  ? 1.58120 1.56910 1.03820 -0.26070 -0.00360 -0.02050 984  LEU C N   
2304 C CA  . LEU C 75  ? 1.56030 1.51520 0.99690 -0.28220 0.01040  -0.03470 984  LEU C CA  
2305 C C   . LEU C 75  ? 1.58710 1.51390 0.97070 -0.28210 0.00700  -0.01850 984  LEU C C   
2306 O O   . LEU C 75  ? 1.55480 1.47090 0.91360 -0.30740 0.01490  -0.02860 984  LEU C O   
2307 C CB  . LEU C 75  ? 1.44350 1.37000 0.90120 -0.27680 0.02250  -0.04640 984  LEU C CB  
2308 C CG  . LEU C 75  ? 1.29970 1.23720 0.79250 -0.29380 0.03250  -0.07420 984  LEU C CG  
2309 C CD1 . LEU C 75  ? 1.34630 1.32200 0.87080 -0.29210 0.02400  -0.07610 984  LEU C CD1 
2310 C CD2 . LEU C 75  ? 1.36690 1.27740 0.87970 -0.28440 0.04260  -0.08440 984  LEU C CD2 
2311 N N   . ASP C 76  ? 1.66670 1.58070 1.03200 -0.25500 -0.00480 0.00480  985  ASP C N   
2312 C CA  . ASP C 76  ? 1.73130 1.61320 1.04040 -0.25120 -0.01170 0.02300  985  ASP C CA  
2313 C C   . ASP C 76  ? 1.76990 1.67990 1.05620 -0.26220 -0.02210 0.02840  985  ASP C C   
2314 O O   . ASP C 76  ? 1.67890 1.56260 0.91680 -0.27530 -0.02250 0.03450  985  ASP C O   
2315 C CB  . ASP C 76  ? 1.74630 1.60780 1.04370 -0.21570 -0.02390 0.04500  985  ASP C CB  
2316 C CG  . ASP C 76  ? 1.70090 1.50890 0.98260 -0.21160 -0.01400 0.04590  985  ASP C CG  
2317 O OD1 . ASP C 76  ? 1.65580 1.45880 0.96520 -0.22460 0.00180  0.02730  985  ASP C OD1 
2318 O OD2 . ASP C 76  ? 1.68920 1.45990 0.92900 -0.19570 -0.02270 0.06440  985  ASP C OD2 
2319 N N   . LYS C 77  ? 1.82680 1.78770 1.14480 -0.25810 -0.03010 0.02630  986  LYS C N   
2320 C CA  . LYS C 77  ? 1.88830 1.88460 1.19110 -0.26750 -0.04050 0.02990  986  LYS C CA  
2321 C C   . LYS C 77  ? 1.89330 1.90170 1.20030 -0.30430 -0.02810 0.00840  986  LYS C C   
2322 O O   . LYS C 77  ? 1.98490 2.00840 1.26550 -0.31800 -0.03360 0.01090  986  LYS C O   
2323 C CB  . LYS C 77  ? 1.87380 1.92180 1.20880 -0.24910 -0.05340 0.03510  986  LYS C CB  
2324 C CG  . LYS C 77  ? 1.92740 1.97180 1.24870 -0.21230 -0.06970 0.05700  986  LYS C CG  
2325 C CD  . LYS C 77  ? 1.91440 2.01660 1.26030 -0.19550 -0.08410 0.06190  986  LYS C CD  
2326 C CE  . LYS C 77  ? 1.93440 2.03410 1.25050 -0.16170 -0.10340 0.08280  986  LYS C CE  
2327 N NZ  . LYS C 77  ? 1.90210 2.06360 1.24530 -0.14380 -0.11710 0.08530  986  LYS C NZ  
2328 N N   . VAL C 78  ? 1.86510 1.86820 1.20340 -0.31870 -0.01300 -0.01290 987  VAL C N   
2329 C CA  . VAL C 78  ? 1.75090 1.76340 1.09420 -0.35240 -0.00080 -0.03700 987  VAL C CA  
2330 C C   . VAL C 78  ? 1.78050 1.75240 1.08270 -0.36960 0.00960  -0.04010 987  VAL C C   
2331 O O   . VAL C 78  ? 1.82020 1.80060 1.09920 -0.39440 0.01220  -0.04730 987  VAL C O   
2332 C CB  . VAL C 78  ? 1.62790 1.65290 1.02100 -0.35830 0.00870  -0.06000 987  VAL C CB  
2333 C CG1 . VAL C 78  ? 1.54590 1.57200 0.94150 -0.38940 0.02180  -0.08730 987  VAL C CG1 
2334 C CG2 . VAL C 78  ? 1.61620 1.68340 1.04310 -0.35030 -0.00110 -0.05880 987  VAL C CG2 
2335 N N   . GLU C 79  ? 1.82830 1.75880 1.12020 -0.35840 0.01530  -0.03490 988  GLU C N   
2336 C CA  . GLU C 79  ? 1.74920 1.63690 0.99700 -0.37510 0.02530  -0.03590 988  GLU C CA  
2337 C C   . GLU C 79  ? 1.79060 1.65830 0.98120 -0.37040 0.01260  -0.01050 988  GLU C C   
2338 O O   . GLU C 79  ? 1.91560 1.73920 1.07400 -0.35600 0.00980  0.00630  988  GLU C O   
2339 C CB  . GLU C 79  ? 1.69460 1.54430 0.94860 -0.36280 0.03420  -0.03680 988  GLU C CB  
2340 C CG  . GLU C 79  ? 1.67700 1.54010 0.98150 -0.36790 0.04710  -0.06330 988  GLU C CG  
2341 C CD  . GLU C 79  ? 1.73250 1.56180 1.04590 -0.35350 0.05520  -0.06420 988  GLU C CD  
2342 O OE1 . GLU C 79  ? 1.79590 1.59690 1.08720 -0.33190 0.04780  -0.04130 988  GLU C OE1 
2343 O OE2 . GLU C 79  ? 1.70110 1.53290 1.04350 -0.36310 0.06810  -0.08870 988  GLU C OE2 
2344 N N   . ASP C 87  ? 1.78840 1.62790 1.21880 0.04720  -0.07770 0.11760  1163 ASP C N   
2345 C CA  . ASP C 87  ? 1.72240 1.59410 1.20730 0.03730  -0.06540 0.10360  1163 ASP C CA  
2346 C C   . ASP C 87  ? 1.70980 1.53470 1.20000 0.02970  -0.04810 0.09570  1163 ASP C C   
2347 O O   . ASP C 87  ? 1.69570 1.48150 1.16610 0.04990  -0.05040 0.10440  1163 ASP C O   
2348 C CB  . ASP C 87  ? 1.67420 1.59560 1.19330 0.06390  -0.07680 0.10730  1163 ASP C CB  
2349 C CG  . ASP C 87  ? 1.64670 1.54960 1.14940 0.10140  -0.08970 0.12050  1163 ASP C CG  
2350 O OD1 . ASP C 87  ? 1.57750 1.44140 1.08210 0.10900  -0.08140 0.12010  1163 ASP C OD1 
2351 O OD2 . ASP C 87  ? 1.71010 1.63770 1.19740 0.12320  -0.10840 0.13000  1163 ASP C OD2 
2352 N N   . VAL C 88  ? 1.64100 1.46940 1.15520 0.00210  -0.03200 0.07880  1164 VAL C N   
2353 C CA  . VAL C 88  ? 1.57250 1.36720 1.10060 -0.00620 -0.01480 0.06680  1164 VAL C CA  
2354 C C   . VAL C 88  ? 1.51180 1.34040 1.09230 -0.00460 -0.01010 0.05640  1164 VAL C C   
2355 O O   . VAL C 88  ? 1.45410 1.30380 1.05550 -0.02730 -0.00370 0.04250  1164 VAL C O   
2356 C CB  . VAL C 88  ? 1.46690 1.23240 0.97380 -0.03840 -0.00070 0.05400  1164 VAL C CB  
2357 C CG1 . VAL C 88  ? 1.37340 1.10880 0.89470 -0.04570 0.01650  0.03950  1164 VAL C CG1 
2358 C CG2 . VAL C 88  ? 1.44030 1.17160 0.89100 -0.04150 -0.00630 0.06600  1164 VAL C CG2 
2359 N N   . ASP C 89  ? 1.45120 1.28260 1.04970 0.02170  -0.01400 0.06290  1165 ASP C N   
2360 C CA  . ASP C 89  ? 1.41210 1.27680 1.05650 0.02850  -0.01280 0.05730  1165 ASP C CA  
2361 C C   . ASP C 89  ? 1.36110 1.19250 1.02070 0.03240  0.00030  0.04900  1165 ASP C C   
2362 O O   . ASP C 89  ? 1.43380 1.22370 1.07310 0.02060  0.01110  0.04240  1165 ASP C O   
2363 C CB  . ASP C 89  ? 1.55320 1.45680 1.20690 0.05590  -0.02910 0.07080  1165 ASP C CB  
2364 C CG  . ASP C 89  ? 1.63530 1.51490 1.27640 0.08760  -0.03510 0.08240  1165 ASP C CG  
2365 O OD1 . ASP C 89  ? 1.65450 1.48230 1.27150 0.08740  -0.02770 0.08270  1165 ASP C OD1 
2366 O OD2 . ASP C 89  ? 1.65190 1.56590 1.30720 0.11180  -0.04720 0.09000  1165 ASP C OD2 
2367 N N   . LEU C 90  ? 1.21510 1.06610 0.90810 0.04770  -0.00070 0.04890  1166 LEU C N   
2368 C CA  . LEU C 90  ? 1.26240 1.09340 0.98000 0.04750  0.01200  0.03740  1166 LEU C CA  
2369 C C   . LEU C 90  ? 1.27360 1.12190 1.01480 0.07460  0.00630  0.04530  1166 LEU C C   
2370 O O   . LEU C 90  ? 1.24530 1.12100 0.98230 0.09310  -0.00730 0.05850  1166 LEU C O   
2371 C CB  . LEU C 90  ? 1.16650 1.01020 0.90730 0.02220  0.01980  0.02040  1166 LEU C CB  
2372 C CG  . LEU C 90  ? 1.09260 0.98270 0.84680 0.01210  0.01070  0.02170  1166 LEU C CG  
2373 C CD1 . LEU C 90  ? 0.98560 0.91050 0.76580 0.02970  0.00280  0.02950  1166 LEU C CD1 
2374 C CD2 . LEU C 90  ? 0.98730 0.87690 0.75420 -0.01480 0.01820  0.00380  1166 LEU C CD2 
2375 N N   . GLY C 91  ? 1.22740 1.06170 0.99210 0.07720  0.01620  0.03640  1167 GLY C N   
2376 C CA  . GLY C 91  ? 1.27530 1.11520 1.05880 0.10320  0.01360  0.04260  1167 GLY C CA  
2377 C C   . GLY C 91  ? 1.19090 1.08320 1.00100 0.11050  0.00370  0.04750  1167 GLY C C   
2378 O O   . GLY C 91  ? 1.20970 1.12600 1.03410 0.09030  0.00430  0.04040  1167 GLY C O   
2379 N N   . ASP C 92  ? 1.14110 1.05060 0.95680 0.13780  -0.00510 0.05810  1168 ASP C N   
2380 C CA  . ASP C 92  ? 1.04050 1.00490 0.88220 0.14720  -0.01450 0.06210  1168 ASP C CA  
2381 C C   . ASP C 92  ? 1.07380 1.03730 0.94610 0.14950  -0.00650 0.05550  1168 ASP C C   
2382 O O   . ASP C 92  ? 1.15300 1.08420 1.02520 0.16460  -0.00070 0.05520  1168 ASP C O   
2383 C CB  . ASP C 92  ? 0.95030 0.93700 0.78310 0.17750  -0.02900 0.07460  1168 ASP C CB  
2384 C CG  . ASP C 92  ? 1.07800 1.13050 0.93410 0.18300  -0.03940 0.07680  1168 ASP C CG  
2385 O OD1 . ASP C 92  ? 1.13440 1.21300 1.00710 0.15940  -0.03600 0.07040  1168 ASP C OD1 
2386 O OD2 . ASP C 92  ? 1.15500 1.23230 1.01110 0.21040  -0.05100 0.08390  1168 ASP C OD2 
2387 N N   . ILE C 93  ? 1.00650 1.00220 0.90160 0.13410  -0.00630 0.05040  1169 ILE C N   
2388 C CA  . ILE C 93  ? 1.00500 0.99960 0.92740 0.13350  0.00040  0.04410  1169 ILE C CA  
2389 C C   . ILE C 93  ? 0.94330 0.99270 0.88610 0.14250  -0.00850 0.05000  1169 ILE C C   
2390 O O   . ILE C 93  ? 1.02280 1.07310 0.98550 0.15070  -0.00480 0.04820  1169 ILE C O   
2391 C CB  . ILE C 93  ? 0.95780 0.93050 0.88550 0.10580  0.00940  0.03090  1169 ILE C CB  
2392 C CG1 . ILE C 93  ? 0.91680 0.91280 0.83770 0.08080  0.00470  0.02870  1169 ILE C CG1 
2393 C CG2 . ILE C 93  ? 0.97880 0.89830 0.89400 0.10320  0.02050  0.02180  1169 ILE C CG2 
2394 C CD1 . ILE C 93  ? 0.90130 0.93770 0.84000 0.06980  -0.00040 0.02930  1169 ILE C CD1 
2395 N N   . SER C 94  ? 0.92830 1.02350 0.86600 0.14250  -0.01970 0.05610  1170 SER C N   
2396 C CA  . SER C 94  ? 0.92900 1.08620 0.88520 0.14820  -0.02860 0.05960  1170 SER C CA  
2397 C C   . SER C 94  ? 1.03850 1.20160 1.00980 0.17710  -0.02970 0.06300  1170 SER C C   
2398 O O   . SER C 94  ? 1.06000 1.26440 1.05290 0.17680  -0.03180 0.06210  1170 SER C O   
2399 C CB  . SER C 94  ? 0.95400 1.15670 0.89880 0.15130  -0.04120 0.06490  1170 SER C CB  
2400 O OG  . SER C 94  ? 0.92540 1.12010 0.85430 0.18120  -0.04920 0.07210  1170 SER C OG  
2401 N N   . GLY C 95  ? 1.18440 1.30730 1.14340 0.19940  -0.02820 0.06610  1171 GLY C N   
2402 C CA  . GLY C 95  ? 1.19860 1.31650 1.16960 0.22730  -0.02800 0.06830  1171 GLY C CA  
2403 C C   . GLY C 95  ? 1.20400 1.31280 1.19890 0.21830  -0.01740 0.06180  1171 GLY C C   
2404 O O   . GLY C 95  ? 1.14330 1.28440 1.15860 0.23310  -0.02050 0.06300  1171 GLY C O   
2405 N N   . ILE C 96  ? 1.80660 0.95310 0.91890 -0.00040 -0.04130 -0.12920 1172 ILE C N   
2406 C CA  . ILE C 96  ? 1.43060 0.66050 0.68780 -0.04420 -0.03210 -0.14230 1172 ILE C CA  
2407 C C   . ILE C 96  ? 1.50430 0.83940 0.83280 -0.02250 -0.06750 -0.13530 1172 ILE C C   
2408 O O   . ILE C 96  ? 1.50280 0.94390 0.88000 -0.01650 -0.10370 -0.11910 1172 ILE C O   
2409 C CB  . ILE C 96  ? 1.31420 0.64900 0.70900 -0.10520 -0.02530 -0.15600 1172 ILE C CB  
2410 C CG1 . ILE C 96  ? 1.46860 0.77030 0.84760 -0.11890 0.01050  -0.14860 1172 ILE C CG1 
2411 C CG2 . ILE C 96  ? 1.16760 0.62440 0.71770 -0.12220 -0.03210 -0.16680 1172 ILE C CG2 
2412 C CD1 . ILE C 96  ? 1.56440 0.81090 0.86350 -0.13000 0.01370  -0.14680 1172 ILE C CD1 
2413 N N   . ASN C 97  ? 1.45500 0.79850 0.81890 -0.00750 -0.05500 -0.13240 1173 ASN C N   
2414 C CA  . ASN C 97  ? 1.31180 0.79520 0.77940 0.01530  -0.07940 -0.10910 1173 ASN C CA  
2415 C C   . ASN C 97  ? 1.20770 0.67710 0.72830 -0.01320 -0.06360 -0.13090 1173 ASN C C   
2416 O O   . ASN C 97  ? 1.27510 0.62410 0.72460 -0.00740 -0.02890 -0.14440 1173 ASN C O   
2417 C CB  . ASN C 97  ? 1.45310 0.97050 0.87550 0.10290  -0.08170 -0.06430 1173 ASN C CB  
2418 C CG  . ASN C 97  ? 1.38760 1.04740 0.90770 0.12900  -0.09880 -0.03970 1173 ASN C CG  
2419 O OD1 . ASN C 97  ? 1.26360 0.90350 0.78250 0.15260  -0.07800 -0.03670 1173 ASN C OD1 
2420 N ND2 . ASN C 97  ? 1.35650 1.16080 0.95710 0.12520  -0.13630 -0.02080 1173 ASN C ND2 
2421 N N   . ALA C 98  ? 1.15490 0.73910 0.79310 -0.04660 -0.09050 -0.13460 1174 ALA C N   
2422 C CA  . ALA C 98  ? 1.07280 0.66450 0.77300 -0.07170 -0.08390 -0.15130 1174 ALA C CA  
2423 C C   . ALA C 98  ? 1.17730 0.85450 0.90760 -0.01660 -0.08620 -0.11240 1174 ALA C C   
2424 O O   . ALA C 98  ? 1.24700 1.05640 1.04330 -0.00900 -0.11680 -0.08540 1174 ALA C O   
2425 C CB  . ALA C 98  ? 1.01150 0.71200 0.84290 -0.12700 -0.10170 -0.16670 1174 ALA C CB  
2426 N N   . SER C 99  ? 1.15010 0.75810 0.83370 0.01920  -0.05560 -0.11020 1175 SER C N   
2427 C CA  . SER C 99  ? 1.13200 0.81670 0.83820 0.07540  -0.05270 -0.07640 1175 SER C CA  
2428 C C   . SER C 99  ? 0.96360 0.75850 0.78730 0.03070  -0.07530 -0.07840 1175 SER C C   
2429 O O   . SER C 99  ? 0.98230 0.75560 0.85110 -0.03740 -0.08720 -0.11220 1175 SER C O   
2430 C CB  . SER C 99  ? 1.23220 0.80200 0.85430 0.12030  -0.01590 -0.07920 1175 SER C CB  
2431 O OG  . SER C 99  ? 1.31630 0.77370 0.81830 0.16330  0.00300  -0.07430 1175 SER C OG  
2432 N N   . VAL C 100 ? 0.82920 0.73560 0.69550 0.06940  -0.08050 -0.04400 1176 VAL C N   
2433 C CA  . VAL C 100 ? 0.80780 0.81120 0.77220 0.03290  -0.09680 -0.03990 1176 VAL C CA  
2434 C C   . VAL C 100 ? 0.84920 0.81640 0.78710 0.07220  -0.06710 -0.03530 1176 VAL C C   
2435 O O   . VAL C 100 ? 0.87440 0.77540 0.72620 0.13960  -0.03940 -0.02550 1176 VAL C O   
2436 C CB  . VAL C 100 ? 0.70880 0.88760 0.75310 0.03400  -0.12870 -0.00270 1176 VAL C CB  
2437 C CG1 . VAL C 100 ? 0.67870 0.88820 0.74900 -0.00840 -0.16200 -0.00970 1176 VAL C CG1 
2438 C CG2 . VAL C 100 ? 0.70110 0.95410 0.71690 0.11880  -0.11530 0.03740  1176 VAL C CG2 
2439 N N   . VAL C 101 ? 0.59880 0.60060 0.60230 0.03180  -0.07500 -0.04300 1177 VAL C N   
2440 C CA  . VAL C 101 ? 0.69190 0.65590 0.67540 0.05960  -0.04940 -0.04320 1177 VAL C CA  
2441 C C   . VAL C 101 ? 0.73790 0.85820 0.78990 0.07470  -0.05930 -0.00440 1177 VAL C C   
2442 O O   . VAL C 101 ? 0.72210 0.95680 0.85490 0.02910  -0.09190 0.00880  1177 VAL C O   
2443 C CB  . VAL C 101 ? 0.58070 0.44340 0.57330 0.00160  -0.04840 -0.08720 1177 VAL C CB  
2444 C CG1 . VAL C 101 ? 0.63200 0.57320 0.72130 -0.06890 -0.08420 -0.09390 1177 VAL C CG1 
2445 C CG2 . VAL C 101 ? 0.71390 0.50200 0.66010 0.03720  -0.01860 -0.09290 1177 VAL C CG2 
2446 N N   . ASN C 102 ? 0.74050 0.86430 0.75670 0.13670  -0.03210 0.01300  1178 ASN C N   
2447 C CA  . ASN C 102 ? 0.70210 0.97410 0.77400 0.15840  -0.03290 0.04980  1178 ASN C CA  
2448 C C   . ASN C 102 ? 0.66980 0.88030 0.71550 0.17400  -0.00840 0.04040  1178 ASN C C   
2449 O O   . ASN C 102 ? 0.73160 0.86800 0.69550 0.24450  0.02160  0.04040  1178 ASN C O   
2450 C CB  . ASN C 102 ? 0.70340 1.07610 0.75610 0.23780  -0.02460 0.08690  1178 ASN C CB  
2451 C CG  . ASN C 102 ? 0.73170 1.29160 0.86400 0.24200  -0.03180 0.12470  1178 ASN C CG  
2452 O OD1 . ASN C 102 ? 0.48450 1.09470 0.68520 0.17770  -0.04630 0.12540  1178 ASN C OD1 
2453 N ND2 . ASN C 102 ? 0.85790 1.52170 0.97950 0.31690  -0.02280 0.15570  1178 ASN C ND2 
2454 N N   . ILE C 103 ? 0.57550 0.80730 0.68200 0.11070  -0.02350 0.03170  1179 ILE C N   
2455 C CA  . ILE C 103 ? 0.72590 0.90420 0.81580 0.11490  -0.00570 0.02170  1179 ILE C CA  
2456 C C   . ILE C 103 ? 0.74000 1.06170 0.90610 0.08740  -0.01840 0.05230  1179 ILE C C   
2457 O O   . ILE C 103 ? 0.63470 0.91810 0.80450 0.06440  -0.01530 0.04160  1179 ILE C O   
2458 C CB  . ILE C 103 ? 0.58820 0.61630 0.66130 0.06060  -0.01210 -0.02770 1179 ILE C CB  
2459 C CG1 . ILE C 103 ? 0.57420 0.63650 0.72340 -0.02560 -0.05210 -0.04190 1179 ILE C CG1 
2460 C CG2 . ILE C 103 ? 0.61010 0.49800 0.60000 0.08860  0.00680  -0.05510 1179 ILE C CG2 
2461 C CD1 . ILE C 103 ? 0.67580 0.62520 0.82650 -0.07830 -0.06240 -0.08740 1179 ILE C CD1 
2462 N N   . GLN C 104 ? 0.67030 1.15120 0.89190 0.08900  -0.03210 0.08940  1180 GLN C N   
2463 C CA  . GLN C 104 ? 0.48810 1.11960 0.78470 0.05480  -0.04470 0.12270  1180 GLN C CA  
2464 C C   . GLN C 104 ? 0.52850 1.19060 0.79600 0.11220  -0.01020 0.14090  1180 GLN C C   
2465 O O   . GLN C 104 ? 0.57920 1.29200 0.88410 0.07290  -0.01480 0.15280  1180 GLN C O   
2466 C CB  . GLN C 104 ? 0.56840 1.36960 0.92730 0.04920  -0.06440 0.15860  1180 GLN C CB  
2467 C CG  . GLN C 104 ? 0.64040 1.49170 1.03140 -0.01230 -0.07550 0.17330  1180 GLN C CG  
2468 C CD  . GLN C 104 ? 0.56730 1.29740 0.95960 -0.08760 -0.09830 0.14040  1180 GLN C CD  
2469 O OE1 . GLN C 104 ? 0.42710 1.06430 0.81110 -0.11690 -0.11720 0.10870  1180 GLN C OE1 
2470 N NE2 . GLN C 104 ? 0.49340 1.21270 0.88480 -0.10710 -0.09270 0.14370  1180 GLN C NE2 
2471 N N   . LYS C 105 ? 0.59790 1.22270 0.79460 0.20170  0.02170  0.14200  1181 LYS C N   
2472 C CA  . LYS C 105 ? 0.51190 1.14350 0.66290 0.27040  0.05690  0.15350  1181 LYS C CA  
2473 C C   . LYS C 105 ? 0.50890 1.00940 0.62980 0.24090  0.06340  0.12500  1181 LYS C C   
2474 O O   . LYS C 105 ? 0.68430 1.24120 0.81450 0.24750  0.07660  0.14150  1181 LYS C O   
2475 C CB  . LYS C 105 ? 0.65450 1.21990 0.71630 0.36940  0.08320  0.14930  1181 LYS C CB  
2476 C CG  . LYS C 105 ? 0.64910 1.14430 0.63450 0.43970  0.11740  0.14420  1181 LYS C CG  
2477 C CD  . LYS C 105 ? 0.76850 1.18000 0.65090 0.52310  0.13410  0.13980  1181 LYS C CD  
2478 C CE  . LYS C 105 ? 0.93880 1.15790 0.75150 0.51500  0.13170  0.10350  1181 LYS C CE  
2479 N NZ  . LYS C 105 ? 1.01440 1.17530 0.73770 0.56240  0.13350  0.10660  1181 LYS C NZ  
2480 N N   . GLU C 106 ? 0.60410 0.93750 0.68630 0.21310  0.05600  0.08300  1182 GLU C N   
2481 C CA  . GLU C 106 ? 0.70210 0.90120 0.75490 0.18460  0.05860  0.04940  1182 GLU C CA  
2482 C C   . GLU C 106 ? 0.64510 0.89310 0.77200 0.09830  0.02880  0.05060  1182 GLU C C   
2483 O O   . GLU C 106 ? 0.63900 0.86290 0.75540 0.09250  0.03560  0.04850  1182 GLU C O   
2484 C CB  . GLU C 106 ? 0.62360 0.64880 0.62380 0.17330  0.05690  0.00340  1182 GLU C CB  
2485 C CG  . GLU C 106 ? 0.76920 0.70340 0.67350 0.25540  0.08750  -0.00210 1182 GLU C CG  
2486 C CD  . GLU C 106 ? 0.79020 0.76440 0.67770 0.29410  0.08870  0.01470  1182 GLU C CD  
2487 O OE1 . GLU C 106 ? 0.83000 0.69590 0.62820 0.35050  0.10830  0.00370  1182 GLU C OE1 
2488 O OE2 . GLU C 106 ? 0.73710 0.84410 0.69540 0.26740  0.06820  0.03840  1182 GLU C OE2 
2489 N N   . ILE C 107 ? 0.50310 0.80920 0.69480 0.03490  -0.00490 0.05350  1183 ILE C N   
2490 C CA  . ILE C 107 ? 0.51950 0.87260 0.77760 -0.04920 -0.03940 0.05750  1183 ILE C CA  
2491 C C   . ILE C 107 ? 0.62120 1.10870 0.90500 -0.04010 -0.02760 0.10170  1183 ILE C C   
2492 O O   . ILE C 107 ? 0.73950 1.19770 1.02490 -0.07520 -0.03410 0.09800  1183 ILE C O   
2493 C CB  . ILE C 107 ? 0.40530 0.81070 0.72250 -0.10810 -0.07750 0.05820  1183 ILE C CB  
2494 C CG1 . ILE C 107 ? 0.42020 0.69380 0.70800 -0.11660 -0.08560 0.01280  1183 ILE C CG1 
2495 C CG2 . ILE C 107 ? 0.39720 0.79380 0.73630 -0.16890 -0.10210 0.05180  1183 ILE C CG2 
2496 C CD1 . ILE C 107 ? 0.39610 0.70130 0.71780 -0.15510 -0.11310 0.00680  1183 ILE C CD1 
2497 N N   . ASP C 108 ? 0.50200 1.13100 0.80170 0.00760  -0.01030 0.14060  1184 ASP C N   
2498 C CA  . ASP C 108 ? 0.37020 1.15490 0.69930 0.02030  0.00540  0.18520  1184 ASP C CA  
2499 C C   . ASP C 108 ? 0.44610 1.15830 0.71510 0.06160  0.03630  0.17730  1184 ASP C C   
2500 O O   . ASP C 108 ? 0.61360 1.36590 0.90120 0.02300  0.03350  0.19280  1184 ASP C O   
2501 C CB  . ASP C 108 ? 0.50950 1.44750 0.85600 0.08240  0.02280  0.21980  1184 ASP C CB  
2502 C CG  . ASP C 108 ? 0.55440 1.54310 0.93510 0.03330  -0.00820 0.22820  1184 ASP C CG  
2503 O OD1 . ASP C 108 ? 0.43510 1.34590 0.83030 -0.04400 -0.04160 0.20790  1184 ASP C OD1 
2504 O OD2 . ASP C 108 ? 0.51390 1.58850 0.88590 0.07850  0.00320  0.24850  1184 ASP C OD2 
2505 N N   . ARG C 109 ? 0.54260 1.14180 0.73600 0.13470  0.06280  0.15330  1185 ARG C N   
2506 C CA  . ARG C 109 ? 0.65370 1.17000 0.77780 0.18560  0.09280  0.14240  1185 ARG C CA  
2507 C C   . ARG C 109 ? 0.67840 1.09040 0.80260 0.11770  0.07320  0.11710  1185 ARG C C   
2508 O O   . ARG C 109 ? 0.63380 1.06570 0.74490 0.12030  0.08550  0.12990  1185 ARG C O   
2509 C CB  . ARG C 109 ? 0.68370 1.06980 0.72340 0.26230  0.11500  0.11520  1185 ARG C CB  
2510 C CG  . ARG C 109 ? 0.70830 1.00810 0.66730 0.32680  0.14600  0.10460  1185 ARG C CG  
2511 C CD  . ARG C 109 ? 0.77020 1.21190 0.73650 0.36850  0.17040  0.14310  1185 ARG C CD  
2512 N NE  . ARG C 109 ? 1.01490 1.35600 0.89950 0.42440  0.19630  0.12800  1185 ARG C NE  
2513 C CZ  . ARG C 109 ? 1.09780 1.50790 0.97470 0.44440  0.21570  0.14860  1185 ARG C CZ  
2514 N NH1 . ARG C 109 ? 1.05320 1.64110 1.00100 0.40990  0.21440  0.18770  1185 ARG C NH1 
2515 N NH2 . ARG C 109 ? 1.22640 1.51400 1.02110 0.48400  0.22710  0.13000  1185 ARG C NH2 
2516 N N   . LEU C 110 ? 0.67490 0.98210 0.81220 0.05970  0.04230  0.08170  1186 LEU C N   
2517 C CA  . LEU C 110 ? 0.66090 0.86040 0.79680 -0.00130 0.01830  0.05130  1186 LEU C CA  
2518 C C   . LEU C 110 ? 0.71540 1.02450 0.90020 -0.05610 0.00200  0.08550  1186 LEU C C   
2519 O O   . LEU C 110 ? 0.75200 1.02900 0.90640 -0.05320 0.01140  0.08690  1186 LEU C O   
2520 C CB  . LEU C 110 ? 0.69680 0.80050 0.85210 -0.05500 -0.01510 0.01030  1186 LEU C CB  
2521 C CG  . LEU C 110 ? 0.66550 0.62560 0.76210 -0.01680 -0.00020 -0.03250 1186 LEU C CG  
2522 C CD1 . LEU C 110 ? 0.54220 0.42240 0.66490 -0.07830 -0.03360 -0.07390 1186 LEU C CD1 
2523 C CD2 . LEU C 110 ? 0.60810 0.45410 0.63620 0.02200  0.02200  -0.05480 1186 LEU C CD2 
2524 N N   . ASN C 111 ? 0.65750 1.08990 0.91010 -0.10390 -0.02110 0.11360  1187 ASN C N   
2525 C CA  . ASN C 111 ? 0.45530 0.99620 0.75540 -0.16790 -0.04030 0.14970  1187 ASN C CA  
2526 C C   . ASN C 111 ? 0.61280 1.25890 0.89480 -0.12000 -0.00050 0.18860  1187 ASN C C   
2527 O O   . ASN C 111 ? 0.48420 1.14040 0.76260 -0.15830 -0.00520 0.20320  1187 ASN C O   
2528 C CB  . ASN C 111 ? 0.42480 1.03730 0.76720 -0.20640 -0.06620 0.16350  1187 ASN C CB  
2529 C CG  . ASN C 111 ? 0.69420 1.14510 1.00990 -0.22810 -0.09380 0.11010  1187 ASN C CG  
2530 O OD1 . ASN C 111 ? 0.58520 1.03890 0.90970 -0.21950 -0.09890 0.10120  1187 ASN C OD1 
2531 N ND2 . ASN C 111 ? 0.53640 0.85820 0.81740 -0.23890 -0.10210 0.07220  1187 ASN C ND2 
2532 N N   . GLU C 112 ? 0.66080 1.37620 0.92500 -0.03660 0.03700  0.20330  1188 GLU C N   
2533 C CA  . GLU C 112 ? 0.69800 1.50880 0.93660 0.02450  0.07880  0.23420  1188 GLU C CA  
2534 C C   . GLU C 112 ? 0.75020 1.42320 0.92100 0.03680  0.09000  0.21020  1188 GLU C C   
2535 O O   . GLU C 112 ? 0.82810 1.55510 1.00190 0.00750  0.09400  0.23410  1188 GLU C O   
2536 C CB  . GLU C 112 ? 0.75200 1.62520 0.96950 0.12240  0.11200  0.24260  1188 GLU C CB  
2537 C CG  . GLU C 112 ? 0.78010 1.77990 0.97900 0.19180  0.15400  0.27550  1188 GLU C CG  
2538 C CD  . GLU C 112 ? 0.90990 2.08800 1.16550 0.14590  0.14820  0.31990  1188 GLU C CD  
2539 O OE1 . GLU C 112 ? 0.89800 2.10420 1.20600 0.05760  0.11000  0.32830  1188 GLU C OE1 
2540 O OE2 . GLU C 112 ? 1.09350 2.33580 1.31820 0.19600  0.17060  0.33750  1188 GLU C OE2 
2541 N N   . VAL C 113 ? 0.63200 1.13150 0.74440 0.07060  0.09190  0.16440  1189 VAL C N   
2542 C CA  . VAL C 113 ? 0.67700 1.03430 0.71850 0.09170  0.10240  0.13630  1189 VAL C CA  
2543 C C   . VAL C 113 ? 0.65710 0.96730 0.71760 0.00470  0.06780  0.12940  1189 VAL C C   
2544 O O   . VAL C 113 ? 0.87560 1.15790 0.89670 0.01070  0.07880  0.13370  1189 VAL C O   
2545 C CB  . VAL C 113 ? 0.78370 0.96660 0.76650 0.13260  0.10570  0.08670  1189 VAL C CB  
2546 C CG1 . VAL C 113 ? 0.74370 0.78150 0.66040 0.14460  0.11010  0.05550  1189 VAL C CG1 
2547 C CG2 . VAL C 113 ? 0.73890 0.94690 0.68480 0.22260  0.13840  0.09360  1189 VAL C CG2 
2548 N N   . ALA C 114 ? 0.88490 1.18220 0.99800 -0.07130 0.02580  0.11870  1190 ALA C N   
2549 C CA  . ALA C 114 ? 0.77500 1.02260 0.90350 -0.15530 -0.01440 0.11140  1190 ALA C CA  
2550 C C   . ALA C 114 ? 0.82500 1.19600 0.96370 -0.18020 -0.00510 0.16170  1190 ALA C C   
2551 O O   . ALA C 114 ? 0.85610 1.15630 0.95510 -0.19860 -0.01070 0.15620  1190 ALA C O   
2552 C CB  . ALA C 114 ? 0.60530 0.84660 0.79030 -0.22390 -0.05950 0.09790  1190 ALA C CB  
2553 N N   . LYS C 115 ? 0.88410 1.43450 1.07060 -0.17780 0.01060  0.20840  1191 LYS C N   
2554 C CA  . LYS C 115 ? 0.85470 1.55430 1.05820 -0.20230 0.02550  0.26140  1191 LYS C CA  
2555 C C   . LYS C 115 ? 0.83600 1.53750 0.97620 -0.12660 0.07320  0.26860  1191 LYS C C   
2556 O O   . LYS C 115 ? 0.85750 1.56500 0.97300 -0.15570 0.07630  0.28690  1191 LYS C O   
2557 C CB  . LYS C 115 ? 0.79850 1.69780 1.07310 -0.20990 0.03240  0.30440  1191 LYS C CB  
2558 C CG  . LYS C 115 ? 0.86200 1.88620 1.14210 -0.23420 0.03770  0.34660  1191 LYS C CG  
2559 C CD  . LYS C 115 ? 0.92970 2.09640 1.23790 -0.19990 0.04580  0.37010  1191 LYS C CD  
2560 C CE  . LYS C 115 ? 0.97930 2.23540 1.27450 -0.09880 0.09740  0.38050  1191 LYS C CE  
2561 N NZ  . LYS C 115 ? 0.96040 2.33910 1.28010 -0.06830 0.09630  0.39840  1191 LYS C NZ  
2562 N N   . ASN C 116 ? 0.82660 1.51620 0.93490 -0.03250 0.10760  0.25460  1192 ASN C N   
2563 C CA  . ASN C 116 ? 0.89150 1.58840 0.93520 0.05330  0.15440  0.26040  1192 ASN C CA  
2564 C C   . ASN C 116 ? 1.01220 1.54120 0.98480 0.04970  0.14900  0.23020  1192 ASN C C   
2565 O O   . ASN C 116 ? 1.15670 1.70540 1.07810 0.09800  0.18220  0.24310  1192 ASN C O   
2566 C CB  . ASN C 116 ? 0.98850 1.66260 0.99840 0.15390  0.18290  0.24260  1192 ASN C CB  
2567 C CG  . ASN C 116 ? 1.05010 1.91800 1.10890 0.19190  0.20370  0.27970  1192 ASN C CG  
2568 O OD1 . ASN C 116 ? 0.89110 1.89580 1.02560 0.12980  0.18690  0.31060  1192 ASN C OD1 
2569 N ND2 . ASN C 116 ? 1.19320 2.07270 1.20620 0.29520  0.23830  0.27600  1192 ASN C ND2 
2570 N N   . LEU C 117 ? 0.88030 1.25150 0.84710 0.00070  0.10930  0.18910  1193 LEU C N   
2571 C CA  . LEU C 117 ? 0.96990 1.17410 0.87030 -0.00140 0.09910  0.15450  1193 LEU C CA  
2572 C C   . LEU C 117 ? 1.03450 1.27960 0.92830 -0.05810 0.09040  0.18500  1193 LEU C C   
2573 O O   . LEU C 117 ? 1.15860 1.30910 0.98590 -0.03820 0.09740  0.17100  1193 LEU C O   
2574 C CB  . LEU C 117 ? 0.88900 0.93270 0.79410 -0.03920 0.05730  0.10110  1193 LEU C CB  
2575 C CG  . LEU C 117 ? 0.93080 0.87130 0.80300 0.02540  0.07150  0.05970  1193 LEU C CG  
2576 C CD1 . LEU C 117 ? 0.94190 0.74750 0.82900 -0.02190 0.03050  0.00880  1193 LEU C CD1 
2577 C CD2 . LEU C 117 ? 0.92130 0.77820 0.70840 0.10150  0.10390  0.04500  1193 LEU C CD2 
2578 N N   . ASN C 118 ? 0.98200 1.36320 0.93640 -0.12510 0.07680  0.22680  1194 ASN C N   
2579 C CA  . ASN C 118 ? 1.00030 1.43800 0.94550 -0.18380 0.07220  0.26460  1194 ASN C CA  
2580 C C   . ASN C 118 ? 1.02420 1.51780 0.91290 -0.11550 0.12420  0.28660  1194 ASN C C   
2581 O O   . ASN C 118 ? 1.11030 1.55230 0.94860 -0.13920 0.12160  0.29300  1194 ASN C O   
2582 C CB  . ASN C 118 ? 0.98100 1.57980 1.00200 -0.25960 0.05630  0.31080  1194 ASN C CB  
2583 C CG  . ASN C 118 ? 0.88570 1.40670 0.94590 -0.34170 -0.00350 0.29000  1194 ASN C CG  
2584 O OD1 . ASN C 118 ? 0.88510 1.25550 0.90980 -0.38130 -0.04070 0.26050  1194 ASN C OD1 
2585 N ND2 . ASN C 118 ? 0.79260 1.41690 0.92400 -0.36630 -0.01520 0.30450  1194 ASN C ND2 
2586 N N   . GLU C 119 ? 1.01160 1.59780 0.90180 -0.02960 0.16790  0.29520  1195 GLU C N   
2587 C CA  . GLU C 119 ? 1.01530 1.67060 0.85240 0.04920  0.22040  0.31490  1195 GLU C CA  
2588 C C   . GLU C 119 ? 1.12020 1.58830 0.86520 0.11170  0.22750  0.27020  1195 GLU C C   
2589 O O   . GLU C 119 ? 1.12550 1.62260 0.81330 0.18120  0.26770  0.28010  1195 GLU C O   
2590 C CB  . GLU C 119 ? 1.07760 1.88740 0.94550 0.12630  0.25880  0.33390  1195 GLU C CB  
2591 C CG  . GLU C 119 ? 1.12760 2.14850 1.08460 0.07640  0.25760  0.38060  1195 GLU C CG  
2592 C CD  . GLU C 119 ? 1.16050 2.29330 1.15260 0.15480  0.27210  0.38240  1195 GLU C CD  
2593 O OE1 . GLU C 119 ? 1.25110 2.36310 1.19260 0.24610  0.29840  0.37010  1195 GLU C OE1 
2594 O OE2 . GLU C 119 ? 1.09490 2.32400 1.15890 0.12360  0.25090  0.39540  1195 GLU C OE2 
2595 N N   . SER C 120 ? 1.00620 1.29380 0.73700 0.09070  0.19030  0.22140  1196 SER C N   
2596 C CA  . SER C 120 ? 0.99720 1.09830 0.64500 0.14100  0.19070  0.17440  1196 SER C CA  
2597 C C   . SER C 120 ? 1.08800 1.08440 0.69900 0.08150  0.16090  0.16470  1196 SER C C   
2598 O O   . SER C 120 ? 1.26110 1.12340 0.79730 0.12210  0.16430  0.13350  1196 SER C O   
2599 C CB  . SER C 120 ? 1.03480 1.00990 0.68730 0.15800  0.17130  0.12540  1196 SER C CB  
2600 O OG  . SER C 120 ? 1.17930 1.19670 0.81800 0.24350  0.20660  0.12630  1196 SER C OG  
2601 N N   . LEU C 121 ? 1.01860 1.07020 0.67450 -0.00970 0.13130  0.19090  1197 LEU C N   
2602 C CA  . LEU C 121 ? 1.05340 0.99460 0.67140 -0.07300 0.09450  0.18140  1197 LEU C CA  
2603 C C   . LEU C 121 ? 1.13550 1.09030 0.67810 -0.04070 0.12720  0.20480  1197 LEU C C   
2604 O O   . LEU C 121 ? 1.15740 1.23890 0.69170 0.02010  0.17800  0.23500  1197 LEU C O   
2605 C CB  . LEU C 121 ? 1.03770 1.04620 0.71710 -0.17580 0.05640  0.21000  1197 LEU C CB  
2606 C CG  . LEU C 121 ? 0.95140 0.92130 0.69620 -0.21430 0.01570  0.18090  1197 LEU C CG  
2607 C CD1 . LEU C 121 ? 0.92300 0.97300 0.72320 -0.31190 -0.01970 0.21490  1197 LEU C CD1 
2608 C CD2 . LEU C 121 ? 0.99800 0.76540 0.70990 -0.21360 -0.02280 0.11640  1197 LEU C CD2 
2609 N N   . ILE C 122 ? 1.17440 0.99900 0.66030 -0.07600 0.09770  0.18840  1198 ILE C N   
2610 C CA  . ILE C 122 ? 1.32250 1.12030 0.72160 -0.04860 0.12120  0.20220  1198 ILE C CA  
2611 C C   . ILE C 122 ? 1.35410 1.17500 0.74590 -0.14190 0.09500  0.23880  1198 ILE C C   
2612 O O   . ILE C 122 ? 1.31860 1.05080 0.73210 -0.21250 0.03970  0.21980  1198 ILE C O   
2613 C CB  . ILE C 122 ? 1.44830 1.04470 0.77330 -0.00050 0.10590  0.14370  1198 ILE C CB  
2614 C CG1 . ILE C 122 ? 1.43110 0.98440 0.76510 0.07580  0.12240  0.10430  1198 ILE C CG1 
2615 C CG2 . ILE C 122 ? 1.56680 1.13430 0.79780 0.03500  0.13120  0.15670  1198 ILE C CG2 
2616 C CD1 . ILE C 122 ? 1.54800 0.90730 0.81460 0.11740  0.10590  0.04530  1198 ILE C CD1 
2617 N N   . ASP C 123 ? 1.53810 1.46680 0.89430 -0.14150 0.13210  0.28760  1199 ASP C N   
2618 C CA  . ASP C 123 ? 1.66210 1.66370 1.02190 -0.23740 0.11740  0.33800  1199 ASP C CA  
2619 C C   . ASP C 123 ? 1.75950 1.61950 1.02130 -0.26360 0.09510  0.33240  1199 ASP C C   
2620 O O   . ASP C 123 ? 1.70510 1.42750 0.89790 -0.19980 0.09680  0.29110  1199 ASP C O   
2621 C CB  . ASP C 123 ? 1.72330 1.95940 1.11590 -0.23460 0.17250  0.40080  1199 ASP C CB  
2622 C CG  . ASP C 123 ? 1.70850 2.08770 1.19220 -0.32040 0.15610  0.44040  1199 ASP C CG  
2623 O OD1 . ASP C 123 ? 1.63750 1.97660 1.18210 -0.34300 0.11900  0.41460  1199 ASP C OD1 
2624 O OD2 . ASP C 123 ? 1.74480 2.25500 1.25530 -0.35250 0.17370  0.47780  1199 ASP C OD2 
2625 N N   . LEU C 124 ? 1.79840 1.69520 1.05260 -0.35700 0.07440  0.37500  1200 LEU C N   
2626 C CA  . LEU C 124 ? 1.92370 1.70320 1.08330 -0.40360 0.04880  0.38330  1200 LEU C CA  
2627 C C   . LEU C 124 ? 1.98850 1.82090 1.07330 -0.34060 0.10840  0.40600  1200 LEU C C   
2628 O O   . LEU C 124 ? 1.98140 1.99600 1.09690 -0.34870 0.15270  0.45520  1200 LEU C O   
2629 C CB  . LEU C 124 ? 1.88130 1.72960 1.08610 -0.50350 0.01900  0.41840  1200 LEU C CB  
2630 C CG  . LEU C 124 ? 1.66220 1.49280 0.94960 -0.56820 -0.03960 0.39980  1200 LEU C CG  
2631 C CD1 . LEU C 124 ? 1.55470 1.51540 0.93430 -0.54780 -0.01710 0.40630  1200 LEU C CD1 
2632 C CD2 . LEU C 124 ? 1.70660 1.59910 1.02220 -0.64750 -0.06810 0.42460  1200 LEU C CD2 
2633 N N   . GLN C 125 ? 2.06030 1.74540 1.06980 -0.26860 0.10900  0.36150  1201 GLN C N   
2634 C CA  . GLN C 125 ? 2.19050 1.89400 1.11300 -0.20190 0.16000  0.37500  1201 GLN C CA  
2635 C C   . GLN C 125 ? 2.33500 1.86230 1.14890 -0.23210 0.12400  0.36360  1201 GLN C C   
2636 O O   . GLN C 125 ? 2.37320 1.71230 1.15300 -0.20480 0.08250  0.30490  1201 GLN C O   
2637 C CB  . GLN C 125 ? 2.17910 1.85580 1.09770 -0.08500 0.19140  0.33180  1201 GLN C CB  
2638 C CG  . GLN C 125 ? 2.28340 1.95940 1.10620 -0.00650 0.23940  0.33740  1201 GLN C CG  
2639 C CD  . GLN C 125 ? 2.28630 2.19390 1.13740 0.02120  0.30570  0.38930  1201 GLN C CD  
2640 O OE1 . GLN C 125 ? 2.37840 2.32770 1.19270 0.04950  0.33300  0.39450  1201 GLN C OE1 
2641 N NE2 . GLN C 125 ? 2.19140 2.25430 1.14620 0.00160  0.31700  0.41040  1201 GLN C NE2 
2642 N N   . GLU C 126 ? 2.36290 1.96330 1.15490 -0.27640 0.13670  0.40890  1202 GLU C N   
2643 C CA  . GLU C 126 ? 2.45320 1.91300 1.16570 -0.29940 0.10330  0.39740  1202 GLU C CA  
2644 C C   . GLU C 126 ? 2.48810 2.07170 1.16510 -0.28980 0.15570  0.44700  1202 GLU C C   
2645 O O   . GLU C 126 ? 2.40430 2.14910 1.09820 -0.23660 0.22050  0.47580  1202 GLU C O   
2646 C CB  . GLU C 126 ? 2.51050 1.88140 1.25340 -0.39620 0.03160  0.38730  1202 GLU C CB  
2647 C CG  . GLU C 126 ? 2.50790 2.02830 1.31290 -0.47740 0.03670  0.43960  1202 GLU C CG  
2648 C CD  . GLU C 126 ? 2.46450 1.89030 1.28530 -0.56870 -0.03730 0.42490  1202 GLU C CD  
2649 O OE1 . GLU C 126 ? 2.47030 1.97900 1.30790 -0.63330 -0.03810 0.46250  1202 GLU C OE1 
2650 O OE2 . GLU C 126 ? 2.40120 1.67190 1.21590 -0.57180 -0.09560 0.37160  1202 GLU C OE2 
2651 N N   . THR D 3   ? 2.02580 1.57550 1.06310 -0.15180 0.03870  -0.04440 912  THR D N   
2652 C CA  . THR D 3   ? 2.08790 1.59830 1.19800 -0.10660 0.04150  -0.03050 912  THR D CA  
2653 C C   . THR D 3   ? 2.08420 1.78950 1.25370 -0.10740 0.01870  -0.02980 912  THR D C   
2654 O O   . THR D 3   ? 2.07830 1.76040 1.27950 -0.11180 0.01990  -0.02930 912  THR D O   
2655 C CB  . THR D 3   ? 2.05750 1.48620 1.23530 0.00210  0.05010  -0.00160 912  THR D CB  
2656 O OG1 . THR D 3   ? 2.01440 1.59480 1.25580 0.07180  0.03440  0.01390  912  THR D OG1 
2657 C CG2 . THR D 3   ? 2.02020 1.26950 1.14900 0.01710  0.07220  0.00460  912  THR D CG2 
2658 N N   . GLN D 4   ? 2.01490 1.90690 1.19920 -0.10060 0.00010  -0.02720 913  GLN D N   
2659 C CA  . GLN D 4   ? 2.00250 2.09290 1.25450 -0.07520 -0.01900 -0.01620 913  GLN D CA  
2660 C C   . GLN D 4   ? 2.04110 2.22070 1.26050 -0.17250 -0.03040 -0.03640 913  GLN D C   
2661 O O   . GLN D 4   ? 1.87560 2.20080 1.15050 -0.15460 -0.04370 -0.02630 913  GLN D O   
2662 C CB  . GLN D 4   ? 1.93980 2.19420 1.21720 -0.02560 -0.03040 -0.00040 913  GLN D CB  
2663 C CG  . GLN D 4   ? 1.83410 2.24360 1.19800 0.05180  -0.03890 0.02460  913  GLN D CG  
2664 C CD  . GLN D 4   ? 1.77870 2.25320 1.18310 0.14610  -0.03620 0.04920  913  GLN D CD  
2665 O OE1 . GLN D 4   ? 1.79460 2.13530 1.20130 0.19750  -0.02300 0.05570  913  GLN D OE1 
2666 N NE2 . GLN D 4   ? 1.70590 2.39020 1.14350 0.17290  -0.04700 0.06600  913  GLN D NE2 
2667 N N   . ASN D 5   ? 2.08450 2.18050 1.21470 -0.27090 -0.02390 -0.06280 914  ASN D N   
2668 C CA  . ASN D 5   ? 2.06490 2.20010 1.15700 -0.36880 -0.02950 -0.08410 914  ASN D CA  
2669 C C   . ASN D 5   ? 1.97130 1.98730 1.09920 -0.35040 -0.01740 -0.08160 914  ASN D C   
2670 O O   . ASN D 5   ? 1.88580 2.00740 1.05620 -0.35890 -0.02930 -0.07960 914  ASN D O   
2671 C CB  . ASN D 5   ? 2.14750 2.20580 1.12390 -0.47910 -0.02080 -0.11370 914  ASN D CB  
2672 C CG  . ASN D 5   ? 2.13520 2.37860 1.07110 -0.54220 -0.04140 -0.12310 914  ASN D CG  
2673 O OD1 . ASN D 5   ? 2.05100 2.50110 1.03940 -0.53340 -0.06360 -0.11140 914  ASN D OD1 
2674 N ND2 . ASN D 5   ? 2.23460 2.40740 1.07320 -0.60870 -0.03310 -0.14290 914  ASN D ND2 
2675 N N   . VAL D 6   ? 2.03460 1.84400 1.14630 -0.32400 0.00580  -0.07900 915  VAL D N   
2676 C CA  . VAL D 6   ? 2.04010 1.71470 1.18180 -0.30270 0.02080  -0.07310 915  VAL D CA  
2677 C C   . VAL D 6   ? 1.95200 1.72790 1.19660 -0.22270 0.00710  -0.05180 915  VAL D C   
2678 O O   . VAL D 6   ? 1.96680 1.74250 1.23660 -0.23860 0.00640  -0.05410 915  VAL D O   
2679 C CB  . VAL D 6   ? 2.13790 1.59770 1.25290 -0.26940 0.04730  -0.06450 915  VAL D CB  
2680 C CG1 . VAL D 6   ? 2.15250 1.49290 1.31160 -0.23220 0.06110  -0.05070 915  VAL D CG1 
2681 C CG2 . VAL D 6   ? 2.22150 1.56340 1.22420 -0.35220 0.06660  -0.08580 915  VAL D CG2 
2682 N N   . LEU D 7   ? 1.87680 1.73420 1.17380 -0.14140 -0.00150 -0.03200 916  LEU D N   
2683 C CA  . LEU D 7   ? 1.76130 1.71520 1.14760 -0.05900 -0.01090 -0.01020 916  LEU D CA  
2684 C C   . LEU D 7   ? 1.80330 1.93250 1.20750 -0.09660 -0.02810 -0.01520 916  LEU D C   
2685 O O   . LEU D 7   ? 1.78210 1.92170 1.23690 -0.06730 -0.02920 -0.00700 916  LEU D O   
2686 C CB  . LEU D 7   ? 1.70270 1.72880 1.12360 0.02270  -0.01430 0.00960  916  LEU D CB  
2687 C CG  . LEU D 7   ? 1.72340 1.59190 1.15960 0.09290  0.00160  0.02430  916  LEU D CG  
2688 C CD1 . LEU D 7   ? 1.65060 1.60000 1.11030 0.16280  -0.00120 0.04100  916  LEU D CD1 
2689 C CD2 . LEU D 7   ? 1.76100 1.54490 1.25390 0.14670  0.00890  0.03830  916  LEU D CD2 
2690 N N   . TYR D 8   ? 1.78130 2.04830 1.14570 -0.15770 -0.04130 -0.02600 917  TYR D N   
2691 C CA  . TYR D 8   ? 1.65540 2.10730 1.03490 -0.19730 -0.05880 -0.02740 917  TYR D CA  
2692 C C   . TYR D 8   ? 1.63660 2.01430 0.98650 -0.27570 -0.05520 -0.04790 917  TYR D C   
2693 O O   . TYR D 8   ? 1.58890 2.03670 0.98380 -0.26570 -0.06170 -0.04160 917  TYR D O   
2694 C CB  . TYR D 8   ? 1.68100 2.30870 1.02480 -0.24630 -0.07470 -0.03080 917  TYR D CB  
2695 C CG  . TYR D 8   ? 1.68710 2.53450 1.07190 -0.24730 -0.09230 -0.01730 917  TYR D CG  
2696 C CD1 . TYR D 8   ? 1.64410 2.58360 1.10560 -0.14790 -0.09270 0.01240  917  TYR D CD1 
2697 C CD2 . TYR D 8   ? 1.71230 2.67020 1.05710 -0.34630 -0.10600 -0.03220 917  TYR D CD2 
2698 C CE1 . TYR D 8   ? 1.56410 2.70220 1.06170 -0.14170 -0.10520 0.02930  917  TYR D CE1 
2699 C CE2 . TYR D 8   ? 1.63350 2.79830 1.01820 -0.34420 -0.12160 -0.01550 917  TYR D CE2 
2700 C CZ  . TYR D 8   ? 1.52080 2.77690 0.98260 -0.23920 -0.12060 0.01670  917  TYR D CZ  
2701 O OH  . TYR D 8   ? 1.35720 2.79400 0.87500 -0.22800 -0.12750 0.03690  917  TYR D OH  
2702 N N   . GLU D 9   ? 1.67370 1.90830 0.94820 -0.34740 -0.04230 -0.07040 918  GLU D N   
2703 C CA  . GLU D 9   ? 1.70720 1.84260 0.94400 -0.42160 -0.03220 -0.08990 918  GLU D CA  
2704 C C   . GLU D 9   ? 1.73650 1.77860 1.03470 -0.36300 -0.02290 -0.07720 918  GLU D C   
2705 O O   . GLU D 9   ? 1.78360 1.84130 1.08910 -0.40170 -0.02440 -0.08470 918  GLU D O   
2706 C CB  . GLU D 9   ? 1.83950 1.79630 0.98500 -0.48230 -0.01060 -0.10960 918  GLU D CB  
2707 C CG  . GLU D 9   ? 1.96390 1.99230 1.02740 -0.57090 -0.01750 -0.13010 918  GLU D CG  
2708 C CD  . GLU D 9   ? 2.09830 1.94140 1.05850 -0.65060 0.00840  -0.15390 918  GLU D CD  
2709 O OE1 . GLU D 9   ? 2.14460 1.79940 1.09850 -0.61250 0.03290  -0.14730 918  GLU D OE1 
2710 O OE2 . GLU D 9   ? 2.12060 2.00750 1.00550 -0.75080 0.00560  -0.17720 918  GLU D OE2 
2711 N N   . ASN D 10  ? 1.68900 1.63480 1.02600 -0.27740 -0.01330 -0.05890 919  ASN D N   
2712 C CA  . ASN D 10  ? 1.67470 1.53670 1.07230 -0.21580 -0.00570 -0.04380 919  ASN D CA  
2713 C C   . ASN D 10  ? 1.57450 1.59580 1.04040 -0.17590 -0.02270 -0.03180 919  ASN D C   
2714 O O   . ASN D 10  ? 1.66160 1.65910 1.15380 -0.18050 -0.02110 -0.03200 919  ASN D O   
2715 C CB  . ASN D 10  ? 1.70730 1.44340 1.12660 -0.13730 0.00700  -0.02570 919  ASN D CB  
2716 C CG  . ASN D 10  ? 1.76250 1.30680 1.12320 -0.16820 0.02980  -0.03160 919  ASN D CG  
2717 O OD1 . ASN D 10  ? 1.76870 1.25210 1.07360 -0.24460 0.04020  -0.04900 919  ASN D OD1 
2718 N ND2 . ASN D 10  ? 1.76820 1.21300 1.13880 -0.10720 0.04030  -0.01510 919  ASN D ND2 
2719 N N   . GLN D 11  ? 1.44420 1.62290 0.93510 -0.13770 -0.03630 -0.02010 920  GLN D N   
2720 C CA  . GLN D 11  ? 1.29880 1.63430 0.85050 -0.08990 -0.04830 -0.00350 920  GLN D CA  
2721 C C   . GLN D 11  ? 1.36240 1.80770 0.90280 -0.16360 -0.05990 -0.01540 920  GLN D C   
2722 O O   . GLN D 11  ? 1.21820 1.74270 0.80640 -0.13100 -0.06510 -0.00360 920  GLN D O   
2723 C CB  . GLN D 11  ? 1.35160 1.84100 0.92190 -0.03920 -0.05670 0.01400  920  GLN D CB  
2724 C CG  . GLN D 11  ? 1.39920 1.81120 0.99380 0.04980  -0.04570 0.03080  920  GLN D CG  
2725 C CD  . GLN D 11  ? 1.41190 1.99150 1.03620 0.11270  -0.05090 0.05290  920  GLN D CD  
2726 O OE1 . GLN D 11  ? 1.38740 2.12360 0.99230 0.07600  -0.06290 0.05280  920  GLN D OE1 
2727 N NE2 . GLN D 11  ? 1.43160 1.98140 1.10140 0.20880  -0.04030 0.07400  920  GLN D NE2 
2728 N N   . LYS D 12  ? 1.36560 1.82160 0.84180 -0.25860 -0.06350 -0.03710 921  LYS D N   
2729 C CA  . LYS D 12  ? 1.29630 1.83960 0.74980 -0.34460 -0.07320 -0.05200 921  LYS D CA  
2730 C C   . LYS D 12  ? 1.27550 1.67090 0.72510 -0.37250 -0.06020 -0.06410 921  LYS D C   
2731 O O   . LYS D 12  ? 1.25170 1.71820 0.72380 -0.39420 -0.06720 -0.06500 921  LYS D O   
2732 C CB  . LYS D 12  ? 1.35040 1.93360 0.72560 -0.44250 -0.07830 -0.07300 921  LYS D CB  
2733 C CG  . LYS D 12  ? 1.34960 2.14970 0.72700 -0.44810 -0.09800 -0.06210 921  LYS D CG  
2734 C CD  . LYS D 12  ? 1.43710 2.28610 0.73260 -0.56190 -0.10510 -0.08520 921  LYS D CD  
2735 C CE  . LYS D 12  ? 1.42660 2.50240 0.76900 -0.57180 -0.11950 -0.06790 921  LYS D CE  
2736 N NZ  . LYS D 12  ? 1.51310 2.60350 0.81500 -0.66320 -0.11520 -0.08280 921  LYS D NZ  
2737 N N   . LEU D 13  ? 1.32890 1.52980 0.74850 -0.37320 -0.04080 -0.07150 922  LEU D N   
2738 C CA  . LEU D 13  ? 1.33390 1.38210 0.75020 -0.39070 -0.02420 -0.07810 922  LEU D CA  
2739 C C   . LEU D 13  ? 1.25100 1.31740 0.74660 -0.31560 -0.02800 -0.05920 922  LEU D C   
2740 O O   . LEU D 13  ? 1.24650 1.34320 0.75710 -0.34400 -0.03080 -0.06400 922  LEU D O   
2741 C CB  . LEU D 13  ? 1.37590 1.22750 0.75150 -0.38480 -0.00140 -0.07980 922  LEU D CB  
2742 C CG  . LEU D 13  ? 1.47170 1.15520 0.83590 -0.40110 0.02060  -0.08220 922  LEU D CG  
2743 C CD1 . LEU D 13  ? 1.44440 1.13630 0.76110 -0.49550 0.02520  -0.10400 922  LEU D CD1 
2744 C CD2 . LEU D 13  ? 1.43620 0.93950 0.75760 -0.38960 0.04460  -0.07810 922  LEU D CD2 
2745 N N   . ILE D 14  ? 1.25270 1.30380 0.79320 -0.22580 -0.02750 -0.03910 923  ILE D N   
2746 C CA  . ILE D 14  ? 1.18260 1.22970 0.79080 -0.14870 -0.02790 -0.02060 923  ILE D CA  
2747 C C   . ILE D 14  ? 1.15140 1.36470 0.79090 -0.15270 -0.04290 -0.01760 923  ILE D C   
2748 O O   . ILE D 14  ? 1.12700 1.31460 0.79090 -0.15440 -0.04120 -0.01770 923  ILE D O   
2749 C CB  . ILE D 14  ? 1.14800 1.17640 0.78890 -0.05710 -0.02530 -0.00050 923  ILE D CB  
2750 C CG1 . ILE D 14  ? 1.16900 1.01660 0.78960 -0.04410 -0.00910 0.00140  923  ILE D CG1 
2751 C CG2 . ILE D 14  ? 1.08670 1.15170 0.78810 0.01650  -0.02720 0.01730  923  ILE D CG2 
2752 C CD1 . ILE D 14  ? 1.15090 0.98880 0.78890 0.03020  -0.00700 0.01780  923  ILE D CD1 
2753 N N   . ALA D 15  ? 1.09620 1.47650 0.73420 -0.15360 -0.05610 -0.01280 924  ALA D N   
2754 C CA  . ALA D 15  ? 1.06890 1.63020 0.73570 -0.15180 -0.06980 -0.00380 924  ALA D CA  
2755 C C   . ALA D 15  ? 1.09010 1.66260 0.73820 -0.23490 -0.07390 -0.02130 924  ALA D C   
2756 O O   . ALA D 15  ? 1.07310 1.70110 0.75840 -0.21640 -0.07750 -0.01330 924  ALA D O   
2757 C CB  . ALA D 15  ? 1.08100 1.81280 0.73740 -0.15370 -0.08150 0.00480  924  ALA D CB  
2758 N N   . ASN D 16  ? 1.23820 1.75730 0.82690 -0.32280 -0.07140 -0.04400 925  ASN D N   
2759 C CA  . ASN D 16  ? 1.24420 1.76830 0.80620 -0.40900 -0.07250 -0.06230 925  ASN D CA  
2760 C C   . ASN D 16  ? 1.24490 1.62900 0.83150 -0.39040 -0.05910 -0.06330 925  ASN D C   
2761 O O   . ASN D 16  ? 1.33980 1.78680 0.95510 -0.39710 -0.06490 -0.06130 925  ASN D O   
2762 C CB  . ASN D 16  ? 1.36050 1.84250 0.84270 -0.50670 -0.06810 -0.08680 925  ASN D CB  
2763 C CG  . ASN D 16  ? 1.40860 2.08230 0.86730 -0.56110 -0.08720 -0.08930 925  ASN D CG  
2764 O OD1 . ASN D 16  ? 1.44430 2.28720 0.94890 -0.51620 -0.10280 -0.06860 925  ASN D OD1 
2765 N ND2 . ASN D 16  ? 1.43490 2.08480 0.81850 -0.65930 -0.08450 -0.11290 925  ASN D ND2 
2766 N N   . GLN D 17  ? 1.25110 1.46020 0.82870 -0.36490 -0.04210 -0.06350 926  GLN D N   
2767 C CA  . GLN D 17  ? 1.22820 1.29930 0.82880 -0.34430 -0.02810 -0.06060 926  GLN D CA  
2768 C C   . GLN D 17  ? 1.20290 1.34310 0.87150 -0.27350 -0.03710 -0.04280 926  GLN D C   
2769 O O   . GLN D 17  ? 1.15940 1.27290 0.84760 -0.28300 -0.03430 -0.04420 926  GLN D O   
2770 C CB  . GLN D 17  ? 1.24140 1.14030 0.82950 -0.31160 -0.01040 -0.05490 926  GLN D CB  
2771 C CG  . GLN D 17  ? 1.41030 1.20870 0.92400 -0.37760 0.00500  -0.07080 926  GLN D CG  
2772 C CD  . GLN D 17  ? 1.46480 1.21770 0.93850 -0.45850 0.01660  -0.08820 926  GLN D CD  
2773 O OE1 . GLN D 17  ? 1.52510 1.14440 0.99450 -0.46080 0.03610  -0.08550 926  GLN D OE1 
2774 N NE2 . GLN D 17  ? 1.43550 1.30350 0.87870 -0.52620 0.00560  -0.10450 926  GLN D NE2 
2775 N N   . PHE D 18  ? 1.22260 1.44370 0.92150 -0.20440 -0.04510 -0.02610 927  PHE D N   
2776 C CA  . PHE D 18  ? 1.02630 1.30730 0.78040 -0.12920 -0.04940 -0.00730 927  PHE D CA  
2777 C C   . PHE D 18  ? 1.10380 1.53610 0.87190 -0.15500 -0.06140 -0.00710 927  PHE D C   
2778 O O   . PHE D 18  ? 1.10620 1.52940 0.90480 -0.13410 -0.06020 -0.00220 927  PHE D O   
2779 C CB  . PHE D 18  ? 1.01110 1.34570 0.78270 -0.05340 -0.05070 0.01070  927  PHE D CB  
2780 C CG  . PHE D 18  ? 0.96450 1.35530 0.78100 0.02500  -0.05020 0.03060  927  PHE D CG  
2781 C CD1 . PHE D 18  ? 0.97070 1.24400 0.81090 0.06530  -0.04100 0.03550  927  PHE D CD1 
2782 C CD2 . PHE D 18  ? 0.99010 1.55030 0.82060 0.05810  -0.05690 0.04610  927  PHE D CD2 
2783 C CE1 . PHE D 18  ? 0.99510 1.30820 0.86640 0.13460  -0.03770 0.05240  927  PHE D CE1 
2784 C CE2 . PHE D 18  ? 0.97170 1.57150 0.83490 0.13380  -0.05110 0.06590  927  PHE D CE2 
2785 C CZ  . PHE D 18  ? 0.99740 1.46800 0.87790 0.17070  -0.04120 0.06740  927  PHE D CZ  
2786 N N   . ASN D 19  ? 1.09690 1.66770 0.84220 -0.20010 -0.07290 -0.01090 928  ASN D N   
2787 C CA  . ASN D 19  ? 1.14920 1.88470 0.90460 -0.23180 -0.08580 -0.00790 928  ASN D CA  
2788 C C   . ASN D 19  ? 1.17480 1.84550 0.91840 -0.29960 -0.08290 -0.02620 928  ASN D C   
2789 O O   . ASN D 19  ? 1.18230 1.91830 0.95650 -0.28990 -0.08740 -0.01930 928  ASN D O   
2790 C CB  . ASN D 19  ? 1.18990 2.08240 0.91730 -0.27660 -0.09880 -0.00790 928  ASN D CB  
2791 C CG  . ASN D 19  ? 1.12240 2.12160 0.86930 -0.20380 -0.10190 0.01600  928  ASN D CG  
2792 O OD1 . ASN D 19  ? 1.13380 2.12150 0.91890 -0.11510 -0.09460 0.03560  928  ASN D OD1 
2793 N ND2 . ASN D 19  ? 1.00920 2.11320 0.72600 -0.24210 -0.11120 0.01500  928  ASN D ND2 
2794 N N   . SER D 20  ? 1.24720 1.79010 0.94580 -0.36250 -0.07320 -0.04710 929  SER D N   
2795 C CA  . SER D 20  ? 1.23790 1.68350 0.91920 -0.42250 -0.06330 -0.06390 929  SER D CA  
2796 C C   . SER D 20  ? 1.20130 1.56950 0.93090 -0.36400 -0.05660 -0.05310 929  SER D C   
2797 O O   . SER D 20  ? 1.20290 1.62880 0.95490 -0.37570 -0.06130 -0.05260 929  SER D O   
2798 C CB  . SER D 20  ? 1.26760 1.56630 0.88920 -0.47810 -0.04700 -0.08200 929  SER D CB  
2799 O OG  . SER D 20  ? 1.29050 1.48380 0.89450 -0.52620 -0.03210 -0.09440 929  SER D OG  
2800 N N   . ALA D 21  ? 1.18370 1.43550 0.92870 -0.30270 -0.04700 -0.04350 930  ALA D N   
2801 C CA  . ALA D 21  ? 1.16860 1.32910 0.95260 -0.25060 -0.03960 -0.03330 930  ALA D CA  
2802 C C   . ALA D 21  ? 1.19010 1.46960 1.01720 -0.20690 -0.05050 -0.02080 930  ALA D C   
2803 O O   . ALA D 21  ? 1.24300 1.49620 1.08940 -0.21220 -0.04820 -0.02170 930  ALA D O   
2804 C CB  . ALA D 21  ? 1.25520 1.30650 1.04730 -0.18970 -0.03110 -0.02180 930  ALA D CB  
2805 N N   . ILE D 22  ? 1.15560 1.55940 0.99490 -0.16290 -0.05970 -0.00760 931  ILE D N   
2806 C CA  . ILE D 22  ? 1.08290 1.59970 0.95800 -0.10970 -0.06550 0.00940  931  ILE D CA  
2807 C C   . ILE D 22  ? 1.02140 1.63410 0.89810 -0.16620 -0.07380 0.00270  931  ILE D C   
2808 O O   . ILE D 22  ? 1.07550 1.68980 0.97850 -0.14280 -0.07270 0.00860  931  ILE D O   
2809 C CB  . ILE D 22  ? 0.99470 1.63400 0.87620 -0.05380 -0.06960 0.02810  931  ILE D CB  
2810 C CG1 . ILE D 22  ? 1.08490 1.62390 0.97150 0.01560  -0.05910 0.03750  931  ILE D CG1 
2811 C CG2 . ILE D 22  ? 0.96360 1.74070 0.87150 -0.01320 -0.07320 0.04700  931  ILE D CG2 
2812 C CD1 . ILE D 22  ? 1.19820 1.84970 1.09070 0.07730  -0.05890 0.05770  931  ILE D CD1 
2813 N N   . GLY D 23  ? 0.94640 1.63340 0.79310 -0.23950 -0.08150 -0.00920 932  GLY D N   
2814 C CA  . GLY D 23  ? 1.01950 1.79650 0.86160 -0.30530 -0.08940 -0.01730 932  GLY D CA  
2815 C C   . GLY D 23  ? 1.00140 1.66690 0.85240 -0.32690 -0.08070 -0.02810 932  GLY D C   
2816 O O   . GLY D 23  ? 0.94010 1.67800 0.81680 -0.32160 -0.08560 -0.02180 932  GLY D O   
2817 N N   . LYS D 24  ? 1.03170 1.53090 0.86210 -0.34750 -0.06690 -0.04120 933  LYS D N   
2818 C CA  . LYS D 24  ? 1.03290 1.40890 0.87070 -0.36340 -0.05470 -0.04840 933  LYS D CA  
2819 C C   . LYS D 24  ? 1.03300 1.39200 0.91710 -0.28860 -0.05490 -0.03250 933  LYS D C   
2820 O O   . LYS D 24  ? 1.03790 1.39490 0.94030 -0.29910 -0.05380 -0.03390 933  LYS D O   
2821 C CB  . LYS D 24  ? 0.99970 1.20370 0.80760 -0.38230 -0.03710 -0.05700 933  LYS D CB  
2822 C CG  . LYS D 24  ? 1.11430 1.29950 0.86410 -0.45590 -0.03130 -0.07400 933  LYS D CG  
2823 C CD  . LYS D 24  ? 1.20200 1.21420 0.91610 -0.49050 -0.00740 -0.08270 933  LYS D CD  
2824 C CE  . LYS D 24  ? 1.25990 1.22670 0.91120 -0.53860 0.00150  -0.09510 933  LYS D CE  
2825 N NZ  . LYS D 24  ? 1.21280 0.99840 0.83110 -0.54770 0.02830  -0.09550 933  LYS D NZ  
2826 N N   . ILE D 25  ? 0.96440 1.30350 0.86280 -0.21750 -0.05460 -0.01870 934  ILE D N   
2827 C CA  . ILE D 25  ? 1.00500 1.31370 0.93720 -0.14540 -0.05220 -0.00410 934  ILE D CA  
2828 C C   . ILE D 25  ? 0.96700 1.41650 0.92010 -0.12730 -0.06090 0.00520  934  ILE D C   
2829 O O   . ILE D 25  ? 1.03980 1.46260 1.01280 -0.11270 -0.05850 0.00760  934  ILE D O   
2830 C CB  . ILE D 25  ? 1.00180 1.26480 0.93620 -0.07810 -0.04810 0.00810  934  ILE D CB  
2831 C CG1 . ILE D 25  ? 0.96250 1.07130 0.88130 -0.09150 -0.03790 0.00240  934  ILE D CG1 
2832 C CG2 . ILE D 25  ? 0.98980 1.25050 0.94920 -0.00370 -0.04520 0.02360  934  ILE D CG2 
2833 C CD1 . ILE D 25  ? 0.98840 1.06860 0.90080 -0.04390 -0.03540 0.01120  934  ILE D CD1 
2834 N N   . GLN D 26  ? 1.02910 1.62590 0.97660 -0.12980 -0.07020 0.01180  935  GLN D N   
2835 C CA  . GLN D 26  ? 1.07280 1.82590 1.03810 -0.11140 -0.07780 0.02630  935  GLN D CA  
2836 C C   . GLN D 26  ? 1.07630 1.84160 1.04880 -0.16570 -0.08110 0.01590  935  GLN D C   
2837 O O   . GLN D 26  ? 1.14080 1.94290 1.13570 -0.13040 -0.08060 0.02700  935  GLN D O   
2838 C CB  . GLN D 26  ? 1.04730 1.96070 1.00090 -0.12570 -0.08790 0.03490  935  GLN D CB  
2839 C CG  . GLN D 26  ? 0.94940 1.88760 0.90270 -0.05540 -0.08360 0.05240  935  GLN D CG  
2840 C CD  . GLN D 26  ? 0.94410 2.03610 0.88390 -0.07540 -0.09330 0.06080  935  GLN D CD  
2841 O OE1 . GLN D 26  ? 1.02000 2.22040 0.96930 -0.01460 -0.09150 0.08560  935  GLN D OE1 
2842 N NE2 . GLN D 26  ? 0.95160 2.05260 0.86510 -0.16140 -0.10190 0.04130  935  GLN D NE2 
2843 N N   . ASP D 27  ? 1.04200 1.77500 0.99250 -0.24760 -0.08210 -0.00420 936  ASP D N   
2844 C CA  . ASP D 27  ? 1.04850 1.78000 1.00150 -0.30610 -0.08220 -0.01610 936  ASP D CA  
2845 C C   . ASP D 27  ? 1.08670 1.67950 1.05770 -0.28160 -0.07110 -0.01840 936  ASP D C   
2846 O O   . ASP D 27  ? 1.05350 1.67270 1.04330 -0.28870 -0.07210 -0.01770 936  ASP D O   
2847 C CB  . ASP D 27  ? 1.12260 1.83420 1.03710 -0.39860 -0.08070 -0.03720 936  ASP D CB  
2848 C CG  . ASP D 27  ? 1.15880 2.03800 1.05750 -0.44730 -0.09460 -0.03670 936  ASP D CG  
2849 O OD1 . ASP D 27  ? 1.12940 2.13780 1.04290 -0.40230 -0.10500 -0.01720 936  ASP D OD1 
2850 O OD2 . ASP D 27  ? 1.12820 2.00970 0.99750 -0.53100 -0.09360 -0.05420 936  ASP D OD2 
2851 N N   . SER D 28  ? 1.07550 1.53210 1.04140 -0.25480 -0.06140 -0.01950 937  SER D N   
2852 C CA  . SER D 28  ? 0.99580 1.31960 0.97760 -0.22960 -0.05120 -0.01820 937  SER D CA  
2853 C C   . SER D 28  ? 0.93950 1.30050 0.94890 -0.16140 -0.05430 -0.00300 937  SER D C   
2854 O O   . SER D 28  ? 0.87680 1.20000 0.90220 -0.16280 -0.05130 -0.00380 937  SER D O   
2855 C CB  . SER D 28  ? 0.96530 1.15610 0.93400 -0.21490 -0.04140 -0.01820 937  SER D CB  
2856 O OG  . SER D 28  ? 1.04730 1.11780 1.01080 -0.25100 -0.02880 -0.02500 937  SER D OG  
2857 N N   . LEU D 29  ? 0.92360 1.35560 0.93470 -0.10420 -0.05800 0.01100  938  LEU D N   
2858 C CA  . LEU D 29  ? 0.81860 1.27660 0.84450 -0.03140 -0.05560 0.02750  938  LEU D CA  
2859 C C   . LEU D 29  ? 0.90520 1.48380 0.94420 -0.03690 -0.06130 0.03350  938  LEU D C   
2860 O O   . LEU D 29  ? 0.98300 1.55040 1.03140 0.00930  -0.05640 0.04300  938  LEU D O   
2861 C CB  . LEU D 29  ? 0.82830 1.33060 0.84600 0.03030  -0.05320 0.04260  938  LEU D CB  
2862 C CG  . LEU D 29  ? 0.93990 1.31550 0.95300 0.08500  -0.04270 0.04740  938  LEU D CG  
2863 C CD1 . LEU D 29  ? 0.92880 1.16890 0.93670 0.04670  -0.04060 0.03410  938  LEU D CD1 
2864 C CD2 . LEU D 29  ? 0.89530 1.32420 0.89850 0.14360  -0.03820 0.06250  938  LEU D CD2 
2865 N N   . SER D 30  ? 0.88090 1.57230 0.91700 -0.09020 -0.07050 0.02930  939  SER D N   
2866 C CA  . SER D 30  ? 0.89540 1.71430 0.94470 -0.10530 -0.07740 0.03610  939  SER D CA  
2867 C C   . SER D 30  ? 0.83960 1.58770 0.89940 -0.14850 -0.07540 0.02180  939  SER D C   
2868 O O   . SER D 30  ? 0.89590 1.68140 0.97200 -0.12490 -0.07530 0.03030  939  SER D O   
2869 C CB  . SER D 30  ? 0.90350 1.86840 0.94390 -0.15220 -0.08850 0.03760  939  SER D CB  
2870 O OG  . SER D 30  ? 0.88830 1.96240 0.92730 -0.09770 -0.09000 0.05990  939  SER D OG  
2871 N N   . SER D 31  ? 0.77150 1.41860 0.82000 -0.20590 -0.07150 0.00280  940  SER D N   
2872 C CA  . SER D 31  ? 0.79170 1.35780 0.84800 -0.24670 -0.06530 -0.00940 940  SER D CA  
2873 C C   . SER D 31  ? 0.84090 1.31090 0.91370 -0.19330 -0.05860 -0.00280 940  SER D C   
2874 O O   . SER D 31  ? 0.68970 1.15260 0.77830 -0.20230 -0.05710 -0.00410 940  SER D O   
2875 C CB  . SER D 31  ? 0.83840 1.30800 0.87230 -0.30800 -0.05700 -0.02630 940  SER D CB  
2876 O OG  . SER D 31  ? 0.83660 1.38520 0.84620 -0.35760 -0.06250 -0.03360 940  SER D OG  
2877 N N   . THR D 32  ? 0.79940 1.19650 0.86660 -0.14260 -0.05450 0.00400  941  THR D N   
2878 C CA  . THR D 32  ? 0.82980 1.13390 0.90510 -0.09220 -0.04830 0.01080  941  THR D CA  
2879 C C   . THR D 32  ? 0.87350 1.26060 0.95750 -0.04740 -0.05050 0.02270  941  THR D C   
2880 O O   . THR D 32  ? 0.74980 1.10310 0.84470 -0.04700 -0.04830 0.02170  941  THR D O   
2881 C CB  . THR D 32  ? 0.87200 1.09260 0.93500 -0.05050 -0.04340 0.01620  941  THR D CB  
2882 O OG1 . THR D 32  ? 0.91870 1.06440 0.97270 -0.09420 -0.03990 0.00690  941  THR D OG1 
2883 C CG2 . THR D 32  ? 0.90000 1.02270 0.96530 -0.00660 -0.03710 0.02250  941  THR D CG2 
2884 N N   . ALA D 33  ? 0.90120 1.39670 0.97890 -0.01130 -0.05340 0.03530  942  ALA D N   
2885 C CA  . ALA D 33  ? 0.93160 1.51990 1.01170 0.03950  -0.05180 0.05230  942  ALA D CA  
2886 C C   . ALA D 33  ? 0.85940 1.51560 0.95660 0.00170  -0.05760 0.04950  942  ALA D C   
2887 O O   . ALA D 33  ? 0.90660 1.56810 1.00690 0.03810  -0.05310 0.05830  942  ALA D O   
2888 C CB  . ALA D 33  ? 0.95130 1.66250 1.02300 0.07190  -0.05310 0.06880  942  ALA D CB  
2889 N N   . SER D 34  ? 0.76210 1.46730 0.86610 -0.06840 -0.06570 0.03780  943  SER D N   
2890 C CA  . SER D 34  ? 0.74810 1.51020 0.86780 -0.11540 -0.07050 0.03240  943  SER D CA  
2891 C C   . SER D 34  ? 0.70650 1.35050 0.83620 -0.11800 -0.06380 0.02390  943  SER D C   
2892 O O   . SER D 34  ? 0.79870 1.47050 0.93830 -0.09070 -0.06280 0.03200  943  SER D O   
2893 C CB  . SER D 34  ? 0.77540 1.58140 0.89030 -0.19480 -0.07660 0.01860  943  SER D CB  
2894 O OG  . SER D 34  ? 0.82790 1.67520 0.95600 -0.24170 -0.07880 0.01240  943  SER D OG  
2895 N N   . ALA D 35  ? 0.73580 1.25400 0.86100 -0.14550 -0.05820 0.01080  944  ALA D N   
2896 C CA  . ALA D 35  ? 0.67360 1.08020 0.80870 -0.15430 -0.05110 0.00480  944  ALA D CA  
2897 C C   . ALA D 35  ? 0.69120 1.06770 0.82650 -0.09010 -0.04870 0.01580  944  ALA D C   
2898 O O   . ALA D 35  ? 0.72860 1.10430 0.87610 -0.09130 -0.04770 0.01600  944  ALA D O   
2899 C CB  . ALA D 35  ? 0.73840 1.02440 0.86450 -0.17920 -0.04380 -0.00310 944  ALA D CB  
2900 N N   . LEU D 36  ? 0.69300 1.04620 0.81150 -0.03590 -0.04610 0.02460  945  LEU D N   
2901 C CA  . LEU D 36  ? 0.80360 1.11110 0.90960 0.02560  -0.03980 0.03420  945  LEU D CA  
2902 C C   . LEU D 36  ? 0.84570 1.25320 0.95310 0.05380  -0.03990 0.04490  945  LEU D C   
2903 O O   . LEU D 36  ? 0.89270 1.25440 0.99120 0.08500  -0.03390 0.04870  945  LEU D O   
2904 C CB  . LEU D 36  ? 0.85070 1.12650 0.93350 0.07620  -0.03440 0.04230  945  LEU D CB  
2905 C CG  . LEU D 36  ? 0.93170 1.09080 1.01020 0.06140  -0.03250 0.03530  945  LEU D CG  
2906 C CD1 . LEU D 36  ? 0.98340 1.13670 1.04170 0.10750  -0.02790 0.04330  945  LEU D CD1 
2907 C CD2 . LEU D 36  ? 0.84030 0.88140 0.91660 0.06260  -0.02810 0.03290  945  LEU D CD2 
2908 N N   . GLY D 37  ? 0.87670 1.41710 0.99170 0.04450  -0.04570 0.05160  946  GLY D N   
2909 C CA  . GLY D 37  ? 0.87800 1.53050 0.99780 0.06780  -0.04610 0.06570  946  GLY D CA  
2910 C C   . GLY D 37  ? 0.83460 1.47930 0.97500 0.02820  -0.04950 0.05660  946  GLY D C   
2911 O O   . GLY D 37  ? 0.96290 1.60360 1.09920 0.06280  -0.04420 0.06430  946  GLY D O   
2912 N N   . LYS D 38  ? 0.83020 1.46800 0.98810 -0.04110 -0.05560 0.04110  947  LYS D N   
2913 C CA  . LYS D 38  ? 0.80410 1.44400 0.98340 -0.08600 -0.05730 0.03230  947  LYS D CA  
2914 C C   . LYS D 38  ? 0.84670 1.36340 1.02550 -0.07050 -0.05040 0.02790  947  LYS D C   
2915 O O   . LYS D 38  ? 0.77750 1.31050 0.96780 -0.06900 -0.04980 0.02960  947  LYS D O   
2916 C CB  . LYS D 38  ? 0.75880 1.40170 0.94650 -0.16170 -0.05990 0.01720  947  LYS D CB  
2917 C CG  . LYS D 38  ? 0.77940 1.55400 0.96530 -0.19080 -0.06820 0.02000  947  LYS D CG  
2918 C CD  . LYS D 38  ? 0.80530 1.55830 0.98770 -0.26930 -0.06700 0.00230  947  LYS D CD  
2919 C CE  . LYS D 38  ? 0.70440 1.58870 0.88080 -0.31220 -0.07590 0.00280  947  LYS D CE  
2920 N NZ  . LYS D 38  ? 0.73930 1.56000 0.89270 -0.38210 -0.06860 -0.01600 947  LYS D NZ  
2921 N N   . LEU D 39  ? 0.78030 1.18450 0.94580 -0.05950 -0.04590 0.02390  948  LEU D N   
2922 C CA  . LEU D 39  ? 0.84600 1.13440 1.00660 -0.04460 -0.04030 0.02220  948  LEU D CA  
2923 C C   . LEU D 39  ? 0.84760 1.14760 0.98910 0.01500  -0.03660 0.03280  948  LEU D C   
2924 O O   . LEU D 39  ? 0.93200 1.21600 1.07960 0.01240  -0.03540 0.03190  948  LEU D O   
2925 C CB  . LEU D 39  ? 0.66480 0.84530 0.81320 -0.04400 -0.03690 0.01940  948  LEU D CB  
2926 C CG  . LEU D 39  ? 0.59320 0.72790 0.75690 -0.10280 -0.03510 0.01080  948  LEU D CG  
2927 C CD1 . LEU D 39  ? 0.61350 0.65520 0.76440 -0.09750 -0.03160 0.01180  948  LEU D CD1 
2928 C CD2 . LEU D 39  ? 0.61030 0.70510 0.79260 -0.13390 -0.03110 0.00810  948  LEU D CD2 
2929 N N   . GLN D 40  ? 0.86390 1.19550 0.98110 0.06660  -0.03290 0.04370  949  GLN D N   
2930 C CA  . GLN D 40  ? 0.99070 1.32900 1.07850 0.13070  -0.02350 0.05680  949  GLN D CA  
2931 C C   . GLN D 40  ? 0.91900 1.34280 1.02100 0.12910  -0.02520 0.06250  949  GLN D C   
2932 O O   . GLN D 40  ? 0.96110 1.33660 1.04650 0.15270  -0.01870 0.06420  949  GLN D O   
2933 C CB  . GLN D 40  ? 1.11860 1.51060 1.18210 0.18430  -0.01630 0.07190  949  GLN D CB  
2934 C CG  . GLN D 40  ? 1.11310 1.50730 1.13880 0.25460  -0.00060 0.08850  949  GLN D CG  
2935 C CD  . GLN D 40  ? 1.01400 1.45820 1.01250 0.31440  0.01170  0.10750  949  GLN D CD  
2936 O OE1 . GLN D 40  ? 0.97050 1.50510 0.98670 0.30430  0.00500  0.11300  949  GLN D OE1 
2937 N NE2 . GLN D 40  ? 0.99030 1.37630 0.94130 0.37780  0.03180  0.11870  949  GLN D NE2 
2938 N N   . ASP D 41  ? 0.90540 1.45180 1.03350 0.10150  -0.03340 0.06600  950  ASP D N   
2939 C CA  . ASP D 41  ? 0.89430 1.54140 1.03970 0.09740  -0.03620 0.07400  950  ASP D CA  
2940 C C   . ASP D 41  ? 0.85570 1.43360 1.01710 0.06400  -0.03750 0.06080  950  ASP D C   
2941 O O   . ASP D 41  ? 0.88700 1.44740 1.03540 0.09690  -0.03140 0.06690  950  ASP D O   
2942 C CB  . ASP D 41  ? 0.90330 1.68510 1.07450 0.05720  -0.04660 0.07700  950  ASP D CB  
2943 C CG  . ASP D 41  ? 0.93860 1.81900 1.09640 0.09230  -0.04600 0.09540  950  ASP D CG  
2944 O OD1 . ASP D 41  ? 1.01960 1.87290 1.14710 0.15910  -0.03410 0.10940  950  ASP D OD1 
2945 O OD2 . ASP D 41  ? 0.84130 1.82630 1.01630 0.05160  -0.05590 0.09630  950  ASP D OD2 
2946 N N   . VAL D 42  ? 0.78250 1.31580 0.96670 0.00370  -0.04260 0.04470  951  VAL D N   
2947 C CA  . VAL D 42  ? 0.74850 1.23150 0.95360 -0.03430 -0.04240 0.03450  951  VAL D CA  
2948 C C   . VAL D 42  ? 0.85830 1.22930 1.04170 -0.00370 -0.03630 0.03400  951  VAL D C   
2949 O O   . VAL D 42  ? 0.97390 1.33980 1.16270 -0.00200 -0.03490 0.03430  951  VAL D O   
2950 C CB  . VAL D 42  ? 0.65140 1.10160 0.87790 -0.09980 -0.04350 0.02100  951  VAL D CB  
2951 C CG1 . VAL D 42  ? 0.56250 0.95590 0.80850 -0.13180 -0.03930 0.01450  951  VAL D CG1 
2952 C CG2 . VAL D 42  ? 0.55020 1.10800 0.79020 -0.13800 -0.04870 0.01940  951  VAL D CG2 
2953 N N   . VAL D 43  ? 0.75330 1.03890 0.91110 0.01760  -0.03280 0.03330  952  VAL D N   
2954 C CA  . VAL D 43  ? 0.84650 1.02140 0.97740 0.04040  -0.02720 0.03240  952  VAL D CA  
2955 C C   . VAL D 43  ? 0.93330 1.13310 1.03800 0.08790  -0.02110 0.04090  952  VAL D C   
2956 O O   . VAL D 43  ? 0.97000 1.12550 1.07130 0.08220  -0.01970 0.03780  952  VAL D O   
2957 C CB  . VAL D 43  ? 0.88380 0.97290 0.98540 0.06170  -0.02340 0.03250  952  VAL D CB  
2958 C CG1 . VAL D 43  ? 0.89240 0.88130 0.95460 0.09030  -0.01630 0.03320  952  VAL D CG1 
2959 C CG2 . VAL D 43  ? 0.79850 0.84110 0.92260 0.01560  -0.02740 0.02580  952  VAL D CG2 
2960 N N   . ASN D 44  ? 0.98640 1.25880 1.07280 0.13310  -0.01630 0.05330  953  ASN D N   
2961 C CA  . ASN D 44  ? 1.02450 1.31660 1.07450 0.19180  -0.00470 0.06670  953  ASN D CA  
2962 C C   . ASN D 44  ? 0.96030 1.32750 1.03590 0.17870  -0.00860 0.06970  953  ASN D C   
2963 O O   . ASN D 44  ? 1.00910 1.34590 1.05510 0.21180  0.00050  0.07480  953  ASN D O   
2964 C CB  . ASN D 44  ? 0.99080 1.35130 1.01720 0.24530  0.00420  0.08430  953  ASN D CB  
2965 C CG  . ASN D 44  ? 0.99250 1.26700 0.98040 0.27620  0.01390  0.08440  953  ASN D CG  
2966 O OD1 . ASN D 44  ? 0.97000 1.12180 0.92760 0.27910  0.01960  0.07550  953  ASN D OD1 
2967 N ND2 . ASN D 44  ? 0.98290 1.32480 0.97030 0.29900  0.01620  0.09550  953  ASN D ND2 
2968 N N   . GLN D 45  ? 0.95070 1.40790 1.07480 0.13210  -0.02010 0.06670  954  GLN D N   
2969 C CA  . GLN D 45  ? 0.88280 1.41200 1.03750 0.11060  -0.02460 0.06810  954  GLN D CA  
2970 C C   . GLN D 45  ? 0.90060 1.33950 1.06170 0.08410  -0.02480 0.05540  954  GLN D C   
2971 O O   . GLN D 45  ? 0.94590 1.40100 1.10480 0.09870  -0.02200 0.05980  954  GLN D O   
2972 C CB  . GLN D 45  ? 0.86270 1.48780 1.06250 0.05590  -0.03530 0.06410  954  GLN D CB  
2973 C CG  . GLN D 45  ? 0.97590 1.72850 1.17610 0.07540  -0.03760 0.08030  954  GLN D CG  
2974 C CD  . GLN D 45  ? 0.94210 1.77760 1.17820 0.01220  -0.04810 0.07350  954  GLN D CD  
2975 O OE1 . GLN D 45  ? 0.94560 1.76040 1.20780 -0.04130 -0.05110 0.05960  954  GLN D OE1 
2976 N NE2 . GLN D 45  ? 0.91210 1.84100 1.14550 0.01730  -0.05200 0.08420  954  GLN D NE2 
2977 N N   . ASN D 46  ? 0.83750 1.19150 1.00720 0.04670  -0.02750 0.04260  955  ASN D N   
2978 C CA  . ASN D 46  ? 0.85120 1.12190 1.02940 0.01730  -0.02740 0.03360  955  ASN D CA  
2979 C C   . ASN D 46  ? 0.84090 1.02400 0.97010 0.05760  -0.02060 0.03540  955  ASN D C   
2980 O O   . ASN D 46  ? 0.85640 1.00970 0.98540 0.04950  -0.01980 0.03300  955  ASN D O   
2981 C CB  . ASN D 46  ? 0.87270 1.08660 1.07180 -0.03000 -0.02980 0.02510  955  ASN D CB  
2982 C CG  . ASN D 46  ? 0.73890 1.02080 0.97980 -0.07850 -0.03230 0.02110  955  ASN D CG  
2983 O OD1 . ASN D 46  ? 0.60460 0.98100 0.86220 -0.08190 -0.03440 0.02370  955  ASN D OD1 
2984 N ND2 . ASN D 46  ? 0.69640 0.92800 0.95030 -0.11700 -0.03030 0.01590  955  ASN D ND2 
2985 N N   . ALA D 47  ? 0.77250 0.91410 0.85800 0.09860  -0.01420 0.03950  956  ALA D N   
2986 C CA  . ALA D 47  ? 0.93270 0.98640 0.95800 0.13990  -0.00350 0.04130  956  ALA D CA  
2987 C C   . ALA D 47  ? 1.02740 1.12570 1.03270 0.17680  0.00410  0.05000  956  ALA D C   
2988 O O   . ALA D 47  ? 1.22740 1.25660 1.20150 0.18140  0.00890  0.04630  956  ALA D O   
2989 C CB  . ALA D 47  ? 0.97380 0.98790 0.95730 0.17900  0.00520  0.04580  956  ALA D CB  
2990 N N   . GLN D 48  ? 0.95060 1.16190 0.97140 0.20070  0.00530  0.06260  957  GLN D N   
2991 C CA  . GLN D 48  ? 0.94800 1.21630 0.95160 0.24160  0.01390  0.07620  957  GLN D CA  
2992 C C   . GLN D 48  ? 0.90180 1.19790 0.94470 0.20390  0.00510  0.06990  957  GLN D C   
2993 O O   . GLN D 48  ? 0.94670 1.21380 0.95940 0.22860  0.01310  0.07300  957  GLN D O   
2994 C CB  . GLN D 48  ? 1.05720 1.45500 1.07410 0.27210  0.01590  0.09530  957  GLN D CB  
2995 C CG  . GLN D 48  ? 1.17080 1.55140 1.14010 0.32680  0.03040  0.10800  957  GLN D CG  
2996 C CD  . GLN D 48  ? 1.10030 1.62320 1.08180 0.36100  0.03370  0.13250  957  GLN D CD  
2997 O OE1 . GLN D 48  ? 0.86120 1.48660 0.87360 0.35530  0.02840  0.14260  957  GLN D OE1 
2998 N NE2 . GLN D 48  ? 1.15080 1.68640 1.10900 0.39630  0.04270  0.14400  957  GLN D NE2 
2999 N N   . ALA D 49  ? 0.75350 1.10150 0.85710 0.14790  -0.00820 0.06190  958  ALA D N   
3000 C CA  . ALA D 49  ? 0.77900 1.15030 0.92480 0.10670  -0.01480 0.05550  958  ALA D CA  
3001 C C   . ALA D 49  ? 0.85790 1.11950 0.97910 0.09970  -0.01210 0.04670  958  ALA D C   
3002 O O   . ALA D 49  ? 0.84780 1.12200 0.97290 0.10160  -0.01090 0.04790  958  ALA D O   
3003 C CB  . ALA D 49  ? 0.60620 1.01580 0.80680 0.04710  -0.02400 0.04710  958  ALA D CB  
3004 N N   . LEU D 50  ? 0.70260 0.86470 0.79830 0.09110  -0.01140 0.03930  959  LEU D N   
3005 C CA  . LEU D 50  ? 0.75830 0.81570 0.82700 0.07740  -0.01020 0.03190  959  LEU D CA  
3006 C C   . LEU D 50  ? 1.01280 1.02240 1.01400 0.12650  0.00140  0.03560  959  LEU D C   
3007 O O   . LEU D 50  ? 1.12160 1.09520 1.10980 0.11720  0.00200  0.03200  959  LEU D O   
3008 C CB  . LEU D 50  ? 0.89700 0.87120 0.95500 0.05640  -0.01240 0.02630  959  LEU D CB  
3009 C CG  . LEU D 50  ? 0.89860 0.77160 0.92960 0.03500  -0.01290 0.02120  959  LEU D CG  
3010 C CD1 . LEU D 50  ? 0.86120 0.75630 0.92610 0.00210  -0.01720 0.02040  959  LEU D CD1 
3011 C CD2 . LEU D 50  ? 0.77710 0.59300 0.81650 0.00530  -0.01720 0.01950  959  LEU D CD2 
3012 N N   . ASN D 51  ? 1.05740 1.06640 1.01380 0.17820  0.01250  0.04370  960  ASN D N   
3013 C CA  . ASN D 51  ? 1.14390 1.09590 1.02280 0.23260  0.03030  0.04960  960  ASN D CA  
3014 C C   . ASN D 51  ? 1.13780 1.16220 1.02420 0.25500  0.03400  0.05930  960  ASN D C   
3015 O O   . ASN D 51  ? 1.28230 1.24030 1.11670 0.27220  0.04400  0.05770  960  ASN D O   
3016 C CB  . ASN D 51  ? 1.13310 1.06860 0.96300 0.28550  0.04550  0.05950  960  ASN D CB  
3017 C CG  . ASN D 51  ? 1.14360 0.97920 0.94670 0.27090  0.04580  0.04970  960  ASN D CG  
3018 O OD1 . ASN D 51  ? 1.17510 0.90640 0.94360 0.24850  0.04610  0.03850  960  ASN D OD1 
3019 N ND2 . ASN D 51  ? 1.15530 1.02520 0.97420 0.28120  0.04510  0.05450  960  ASN D ND2 
3020 N N   . THR D 52  ? 0.97640 1.12870 0.92140 0.25250  0.02670  0.06890  961  THR D N   
3021 C CA  . THR D 52  ? 0.90230 1.14060 0.86900 0.26590  0.02730  0.07930  961  THR D CA  
3022 C C   . THR D 52  ? 0.96210 1.17220 0.95600 0.22090  0.01830  0.06630  961  THR D C   
3023 O O   . THR D 52  ? 0.94780 1.14740 0.91590 0.24260  0.02520  0.07020  961  THR D O   
3024 C CB  . THR D 52  ? 0.80960 1.19260 0.83940 0.25700  0.01830  0.09040  961  THR D CB  
3025 O OG1 . THR D 52  ? 0.89070 1.31360 0.89610 0.30070  0.02680  0.10590  961  THR D OG1 
3026 C CG2 . THR D 52  ? 0.68890 1.16290 0.74520 0.26600  0.01770  0.10170  961  THR D CG2 
3027 N N   . LEU D 53  ? 0.76290 0.96540 0.80670 0.16250  0.00510  0.05380  962  LEU D N   
3028 C CA  . LEU D 53  ? 0.81990 0.99580 0.89300 0.11710  -0.00190 0.04400  962  LEU D CA  
3029 C C   . LEU D 53  ? 0.88120 0.94450 0.88760 0.12930  0.00490  0.03850  962  LEU D C   
3030 O O   . LEU D 53  ? 1.09370 1.15680 1.09510 0.12970  0.00630  0.03830  962  LEU D O   
3031 C CB  . LEU D 53  ? 0.82200 0.99180 0.94540 0.06080  -0.01150 0.03580  962  LEU D CB  
3032 C CG  . LEU D 53  ? 0.78650 0.92560 0.93830 0.01560  -0.01570 0.03000  962  LEU D CG  
3033 C CD1 . LEU D 53  ? 0.70700 0.92390 0.89930 0.00920  -0.01610 0.03340  962  LEU D CD1 
3034 C CD2 . LEU D 53  ? 0.60080 0.72640 0.79300 -0.03130 -0.02020 0.02660  962  LEU D CD2 
3035 N N   . VAL D 54  ? 1.01060 0.98060 0.96430 0.13750  0.00970  0.03380  963  VAL D N   
3036 C CA  . VAL D 54  ? 1.21500 1.06710 1.09770 0.13860  0.01620  0.02640  963  VAL D CA  
3037 C C   . VAL D 54  ? 1.29750 1.14020 1.12330 0.18730  0.03070  0.03240  963  VAL D C   
3038 O O   . VAL D 54  ? 1.39640 1.18860 1.19400 0.17350  0.03150  0.02640  963  VAL D O   
3039 C CB  . VAL D 54  ? 1.22070 0.97460 1.04900 0.14370  0.02150  0.02160  963  VAL D CB  
3040 C CG1 . VAL D 54  ? 1.29760 0.93240 1.03090 0.15920  0.03450  0.01580  963  VAL D CG1 
3041 C CG2 . VAL D 54  ? 1.09620 0.83560 0.97120 0.08930  0.00750  0.01600  963  VAL D CG2 
3042 N N   . LYS D 55  ? 1.32020 1.21150 1.12790 0.24230  0.04280  0.04570  964  LYS D N   
3043 C CA  . LYS D 55  ? 1.31990 1.20210 1.06680 0.29890  0.06160  0.05670  964  LYS D CA  
3044 C C   . LYS D 55  ? 1.24940 1.19620 1.04010 0.28300  0.05360  0.05800  964  LYS D C   
3045 O O   . LYS D 55  ? 1.30400 1.18330 1.04430 0.28740  0.06080  0.05330  964  LYS D O   
3046 C CB  . LYS D 55  ? 1.33590 1.28550 1.07050 0.36030  0.07570  0.07730  964  LYS D CB  
3047 C CG  . LYS D 55  ? 1.49350 1.36540 1.15960 0.39710  0.09320  0.08040  964  LYS D CG  
3048 C CD  . LYS D 55  ? 1.50210 1.46430 1.16720 0.45720  0.10670  0.10530  964  LYS D CD  
3049 C CE  . LYS D 55  ? 1.50650 1.40660 1.11280 0.49580  0.12520  0.11100  964  LYS D CE  
3050 N NZ  . LYS D 55  ? 1.41580 1.39730 1.00260 0.56770  0.14580  0.14140  964  LYS D NZ  
3051 N N   . GLN D 56  ? 1.08390 1.15230 0.96210 0.26220  0.03990  0.06330  965  GLN D N   
3052 C CA  . GLN D 56  ? 1.07330 1.21910 1.00210 0.24880  0.03310  0.06660  965  GLN D CA  
3053 C C   . GLN D 56  ? 1.12180 1.20920 1.06090 0.19870  0.02440  0.05130  965  GLN D C   
3054 O O   . GLN D 56  ? 1.04610 1.15070 0.98840 0.20180  0.02550  0.05310  965  GLN D O   
3055 C CB  . GLN D 56  ? 0.94760 1.22580 0.96210 0.22980  0.02170  0.07380  965  GLN D CB  
3056 C CG  . GLN D 56  ? 1.09210 1.45430 1.09770 0.28260  0.03030  0.09460  965  GLN D CG  
3057 C CD  . GLN D 56  ? 1.01190 1.49630 1.09290 0.25480  0.01790  0.09950  965  GLN D CD  
3058 O OE1 . GLN D 56  ? 0.91240 1.44270 1.05630 0.20550  0.00640  0.09150  965  GLN D OE1 
3059 N NE2 . GLN D 56  ? 0.94730 1.48520 1.01830 0.28620  0.02220  0.11380  965  GLN D NE2 
3060 N N   . LEU D 57  ? 1.04800 1.07320 0.99200 0.15560  0.01650  0.03920  966  LEU D N   
3061 C CA  . LEU D 57  ? 1.02870 0.99990 0.97880 0.10710  0.00890  0.02870  966  LEU D CA  
3062 C C   . LEU D 57  ? 1.08960 0.95690 0.94850 0.12490  0.01890  0.02360  966  LEU D C   
3063 O O   . LEU D 57  ? 1.08420 0.94600 0.94470 0.10610  0.01610  0.02060  966  LEU D O   
3064 C CB  . LEU D 57  ? 1.10220 1.03860 1.07640 0.06280  0.00000  0.02250  966  LEU D CB  
3065 C CG  . LEU D 57  ? 1.01100 1.03520 1.07390 0.03080  -0.00860 0.02560  966  LEU D CG  
3066 C CD1 . LEU D 57  ? 0.79990 0.77640 0.87680 -0.00920 -0.01440 0.02190  966  LEU D CD1 
3067 C CD2 . LEU D 57  ? 1.01290 1.10720 1.13620 0.00620  -0.01200 0.02830  966  LEU D CD2 
3068 N N   . SER D 58  ? 1.23320 1.01850 1.01180 0.15910  0.03180  0.02250  967  SER D N   
3069 C CA  . SER D 58  ? 1.27840 0.94940 0.95130 0.18080  0.04710  0.01720  967  SER D CA  
3070 C C   . SER D 58  ? 1.29640 0.99840 0.94690 0.22300  0.05860  0.02580  967  SER D C   
3071 O O   . SER D 58  ? 1.33640 0.96360 0.92390 0.21940  0.06530  0.01910  967  SER D O   
3072 C CB  . SER D 58  ? 1.27590 0.85950 0.86910 0.21530  0.06360  0.01690  967  SER D CB  
3073 O OG  . SER D 58  ? 1.21720 0.72620 0.79750 0.17100  0.05560  0.00550  967  SER D OG  
3074 N N   . SER D 59  ? 1.22430 1.03230 0.92020 0.26090  0.06130  0.04120  968  SER D N   
3075 C CA  . SER D 59  ? 1.28820 1.14850 0.97730 0.30300  0.07100  0.05410  968  SER D CA  
3076 C C   . SER D 59  ? 1.18390 1.09320 0.93480 0.25990  0.05560  0.04830  968  SER D C   
3077 O O   . SER D 59  ? 1.24600 1.12540 0.95590 0.27500  0.06330  0.04880  968  SER D O   
3078 C CB  . SER D 59  ? 1.33660 1.31080 1.06540 0.34760  0.07540  0.07480  968  SER D CB  
3079 O OG  . SER D 59  ? 1.28950 1.38920 1.11610 0.32260  0.05930  0.07950  968  SER D OG  
3080 N N   . ASN D 60  ? 1.09390 1.07190 0.93640 0.20940  0.03690  0.04400  969  ASN D N   
3081 C CA  . ASN D 60  ? 0.97390 1.00620 0.88310 0.16810  0.02480  0.04090  969  ASN D CA  
3082 C C   . ASN D 60  ? 1.04360 0.97990 0.90550 0.13510  0.02290  0.02850  969  ASN D C   
3083 O O   . ASN D 60  ? 1.18570 1.13390 1.04810 0.13300  0.02320  0.02890  969  ASN D O   
3084 C CB  . ASN D 60  ? 0.83470 0.94870 0.84180 0.12330  0.01100  0.04050  969  ASN D CB  
3085 C CG  . ASN D 60  ? 0.73250 0.95880 0.79380 0.14450  0.01080  0.05220  969  ASN D CG  
3086 O OD1 . ASN D 60  ? 0.69460 0.94890 0.72540 0.19600  0.02000  0.06390  969  ASN D OD1 
3087 N ND2 . ASN D 60  ? 0.73800 1.02940 0.87610 0.10410  0.00180  0.05090  969  ASN D ND2 
3088 N N   . PHE D 61  ? 1.07930 0.92700 0.90030 0.10910  0.02090  0.01890  970  PHE D N   
3089 C CA  . PHE D 61  ? 1.13030 0.89320 0.90640 0.06840  0.01700  0.00840  970  PHE D CA  
3090 C C   . PHE D 61  ? 1.33910 1.01560 1.01080 0.10030  0.03200  0.00420  970  PHE D C   
3091 O O   . PHE D 61  ? 1.38850 1.03750 1.03990 0.07240  0.02840  -0.00130 970  PHE D O   
3092 C CB  . PHE D 61  ? 1.21550 0.90760 0.97020 0.03360  0.01160  0.00150  970  PHE D CB  
3093 C CG  . PHE D 61  ? 1.09550 0.85350 0.94440 -0.01190 -0.00290 0.00550  970  PHE D CG  
3094 C CD1 . PHE D 61  ? 1.03030 0.84900 0.94450 -0.04940 -0.01150 0.00990  970  PHE D CD1 
3095 C CD2 . PHE D 61  ? 1.05970 0.81690 0.92860 -0.01450 -0.00500 0.00650  970  PHE D CD2 
3096 C CE1 . PHE D 61  ? 0.91920 0.79180 0.91320 -0.08690 -0.01940 0.01650  970  PHE D CE1 
3097 C CE2 . PHE D 61  ? 0.98170 0.79180 0.93020 -0.05380 -0.01490 0.01160  970  PHE D CE2 
3098 C CZ  . PHE D 61  ? 0.84960 0.71490 0.85870 -0.08920 -0.02070 0.01710  970  PHE D CZ  
3099 N N   . GLY D 62  ? 1.29550 0.92800 0.89900 0.15660  0.05030  0.00800  971  GLY D N   
3100 C CA  . GLY D 62  ? 1.37510 0.92880 0.87540 0.19980  0.07120  0.00810  971  GLY D CA  
3101 C C   . GLY D 62  ? 1.34870 0.97160 0.88210 0.21150  0.06980  0.01480  971  GLY D C   
3102 O O   . GLY D 62  ? 1.50950 1.06920 0.98640 0.19750  0.07310  0.00690  971  GLY D O   
3103 N N   . ALA D 63  ? 1.16990 0.92060 0.79300 0.23190  0.06420  0.02870  972  ALA D N   
3104 C CA  . ALA D 63  ? 1.14330 0.97930 0.81140 0.24830  0.06300  0.03840  972  ALA D CA  
3105 C C   . ALA D 63  ? 1.10660 0.96160 0.82250 0.19030  0.04700  0.02900  972  ALA D C   
3106 O O   . ALA D 63  ? 1.08340 0.94940 0.78880 0.20160  0.05040  0.03140  972  ALA D O   
3107 C CB  . ALA D 63  ? 1.03780 1.00670 0.79450 0.27030  0.05850  0.05420  972  ALA D CB  
3108 N N   . ILE D 64  ? 1.02390 0.88630 0.79040 0.13330  0.03150  0.02140  973  ILE D N   
3109 C CA  . ILE D 64  ? 1.11170 1.00300 0.93100 0.07720  0.01780  0.01730  973  ILE D CA  
3110 C C   . ILE D 64  ? 1.21320 0.99870 0.94120 0.05690  0.02030  0.00640  973  ILE D C   
3111 O O   . ILE D 64  ? 1.22480 1.03120 0.95950 0.04660  0.01830  0.00680  973  ILE D O   
3112 C CB  . ILE D 64  ? 1.05200 0.97810 0.94420 0.02840  0.00490  0.01710  973  ILE D CB  
3113 C CG1 . ILE D 64  ? 0.91350 0.95150 0.90040 0.03790  0.00250  0.02670  973  ILE D CG1 
3114 C CG2 . ILE D 64  ? 1.02740 0.95630 0.94730 -0.02800 -0.00510 0.01560  973  ILE D CG2 
3115 C CD1 . ILE D 64  ? 0.85390 0.90710 0.89210 0.00210  -0.00490 0.02650  973  ILE D CD1 
3116 N N   . SER D 65  ? 1.38850 1.06530 1.03340 0.04870  0.02480  -0.00310 974  SER D N   
3117 C CA  . SER D 65  ? 1.53420 1.09650 1.07900 0.01960  0.02740  -0.01560 974  SER D CA  
3118 C C   . SER D 65  ? 1.54690 1.05930 1.00890 0.06150  0.04430  -0.01730 974  SER D C   
3119 O O   . SER D 65  ? 1.64690 1.11410 1.06170 0.03070  0.04220  -0.02510 974  SER D O   
3120 C CB  . SER D 65  ? 1.68800 1.14400 1.15860 0.00730  0.03180  -0.02470 974  SER D CB  
3121 O OG  . SER D 65  ? 1.75040 1.20120 1.20990 0.06040  0.04470  -0.01980 974  SER D OG  
3122 N N   . SER D 66  ? 1.60810 1.13150 1.05150 0.12900  0.06110  -0.00820 975  SER D N   
3123 C CA  . SER D 66  ? 1.64220 1.13060 1.01410 0.17970  0.08030  -0.00410 975  SER D CA  
3124 C C   . SER D 66  ? 1.56940 1.14760 1.01100 0.16410  0.06860  0.00010  975  SER D C   
3125 O O   . SER D 66  ? 1.63820 1.15660 1.01540 0.15080  0.07240  -0.00770 975  SER D O   
3126 C CB  . SER D 66  ? 1.57370 1.08520 0.93240 0.25640  0.09980  0.01200  975  SER D CB  
3127 O OG  . SER D 66  ? 1.40990 1.06770 0.87980 0.27660  0.09080  0.02800  975  SER D OG  
3128 N N   . VAL D 67  ? 1.46210 1.17550 1.02810 0.16180  0.05550  0.01120  976  VAL D N   
3129 C CA  . VAL D 67  ? 1.37780 1.19150 1.02370 0.15270  0.04660  0.01800  976  VAL D CA  
3130 C C   . VAL D 67  ? 1.47880 1.27500 1.13200 0.08650  0.03280  0.00790  976  VAL D C   
3131 O O   . VAL D 67  ? 1.52590 1.33390 1.17190 0.08450  0.03320  0.00820  976  VAL D O   
3132 C CB  . VAL D 67  ? 1.21090 1.16200 0.98210 0.15750  0.03770  0.03070  976  VAL D CB  
3133 C CG1 . VAL D 67  ? 1.27520 1.32340 1.12850 0.14330  0.03050  0.03700  976  VAL D CG1 
3134 C CG2 . VAL D 67  ? 1.17910 1.16330 0.94440 0.22060  0.05000  0.04390  976  VAL D CG2 
3135 N N   . LEU D 68  ? 1.46310 1.23660 1.12950 0.03550  0.02160  0.00160  977  LEU D N   
3136 C CA  . LEU D 68  ? 1.43830 1.20220 1.11090 -0.03040 0.00840  -0.00340 977  LEU D CA  
3137 C C   . LEU D 68  ? 1.60340 1.25730 1.15490 -0.04000 0.01480  -0.01560 977  LEU D C   
3138 O O   . LEU D 68  ? 1.58220 1.26330 1.14290 -0.06580 0.00900  -0.01500 977  LEU D O   
3139 C CB  . LEU D 68  ? 1.36930 1.11640 1.06180 -0.07450 -0.00170 -0.00510 977  LEU D CB  
3140 C CG  . LEU D 68  ? 1.10430 0.96250 0.92230 -0.08960 -0.01040 0.00720  977  LEU D CG  
3141 C CD1 . LEU D 68  ? 1.03870 0.86410 0.86020 -0.12940 -0.01810 0.00640  977  LEU D CD1 
3142 C CD2 . LEU D 68  ? 1.00170 0.95460 0.90120 -0.11580 -0.01640 0.01750  977  LEU D CD2 
3143 N N   . ASN D 69  ? 1.75370 1.28570 1.19230 -0.02120 0.02810  -0.02590 978  ASN D N   
3144 C CA  . ASN D 69  ? 1.93100 1.33440 1.23280 -0.02960 0.03930  -0.03980 978  ASN D CA  
3145 C C   . ASN D 69  ? 1.88770 1.31190 1.17410 0.00820  0.04900  -0.03580 978  ASN D C   
3146 O O   . ASN D 69  ? 2.03950 1.42700 1.27550 -0.02580 0.04610  -0.04360 978  ASN D O   
3147 C CB  . ASN D 69  ? 2.06570 1.33490 1.25010 -0.00230 0.05900  -0.04900 978  ASN D CB  
3148 C CG  . ASN D 69  ? 2.01400 1.22510 1.17540 -0.05540 0.04990  -0.05780 978  ASN D CG  
3149 O OD1 . ASN D 69  ? 1.99810 1.22330 1.17910 -0.12280 0.03170  -0.06100 978  ASN D OD1 
3150 N ND2 . ASN D 69  ? 1.97980 1.12600 1.09630 -0.02450 0.06340  -0.05970 978  ASN D ND2 
3151 N N   . ASP D 70  ? 1.83730 1.32390 1.16690 0.07390  0.05930  -0.02280 979  ASP D N   
3152 C CA  . ASP D 70  ? 1.88880 1.40240 1.20870 0.11960  0.07020  -0.01520 979  ASP D CA  
3153 C C   . ASP D 70  ? 1.76920 1.38690 1.18170 0.08170  0.05220  -0.01140 979  ASP D C   
3154 O O   . ASP D 70  ? 1.76100 1.36440 1.13450 0.09290  0.05800  -0.01210 979  ASP D O   
3155 C CB  . ASP D 70  ? 1.90160 1.48410 1.26610 0.19290  0.08200  0.00260  979  ASP D CB  
3156 C CG  . ASP D 70  ? 1.98120 1.46760 1.24580 0.24800  0.10670  0.00520  979  ASP D CG  
3157 O OD1 . ASP D 70  ? 2.10210 1.45000 1.24840 0.23300  0.11830  -0.00920 979  ASP D OD1 
3158 O OD2 . ASP D 70  ? 1.90270 1.45590 1.20690 0.30530  0.11540  0.02300  979  ASP D OD2 
3159 N N   . ILE D 71  ? 1.60050 1.31820 1.12920 0.04300  0.03390  -0.00580 980  ILE D N   
3160 C CA  . ILE D 71  ? 1.55040 1.37580 1.17680 0.00810  0.02000  0.00150  980  ILE D CA  
3161 C C   . ILE D 71  ? 1.68520 1.45530 1.25460 -0.05330 0.01140  -0.00840 980  ILE D C   
3162 O O   . ILE D 71  ? 1.63220 1.44080 1.21450 -0.06310 0.00870  -0.00560 980  ILE D O   
3163 C CB  . ILE D 71  ? 1.44990 1.38760 1.20710 -0.01020 0.00910  0.01250  980  ILE D CB  
3164 C CG1 . ILE D 71  ? 1.51370 1.53200 1.33710 0.04490  0.01620  0.02390  980  ILE D CG1 
3165 C CG2 . ILE D 71  ? 1.29330 1.31370 1.13070 -0.05960 -0.00240 0.01990  980  ILE D CG2 
3166 C CD1 . ILE D 71  ? 1.48480 1.58390 1.40950 0.03000  0.00950  0.03120  980  ILE D CD1 
3167 N N   . LEU D 72  ? 1.85850 1.54250 1.36330 -0.09330 0.00740  -0.01880 981  LEU D N   
3168 C CA  . LEU D 72  ? 1.79220 1.42340 1.23620 -0.16080 -0.00250 -0.02730 981  LEU D CA  
3169 C C   . LEU D 72  ? 1.84470 1.37580 1.16250 -0.15240 0.00890  -0.04030 981  LEU D C   
3170 O O   . LEU D 72  ? 1.90810 1.44510 1.20620 -0.20140 -0.00040 -0.04270 981  LEU D O   
3171 C CB  . LEU D 72  ? 1.72540 1.28200 1.12390 -0.19920 -0.00730 -0.03470 981  LEU D CB  
3172 C CG  . LEU D 72  ? 1.60940 1.25860 1.12380 -0.22530 -0.02060 -0.02120 981  LEU D CG  
3173 C CD1 . LEU D 72  ? 1.66260 1.22780 1.12240 -0.25550 -0.02350 -0.02870 981  LEU D CD1 
3174 C CD2 . LEU D 72  ? 1.53780 1.29170 1.13580 -0.27470 -0.03480 -0.00680 981  LEU D CD2 
3175 N N   . SER D 73  ? 1.93200 1.37300 1.16280 -0.09360 0.02990  -0.04690 982  SER D N   
3176 C CA  . SER D 73  ? 2.08980 1.42140 1.18930 -0.07200 0.04790  -0.05780 982  SER D CA  
3177 C C   . SER D 73  ? 2.01830 1.43670 1.17220 -0.04250 0.04820  -0.04760 982  SER D C   
3178 O O   . SER D 73  ? 2.02270 1.39390 1.10460 -0.06460 0.04990  -0.05580 982  SER D O   
3179 C CB  . SER D 73  ? 2.20270 1.41860 1.19920 -0.01080 0.07480  -0.06210 982  SER D CB  
3180 O OG  . SER D 73  ? 2.15370 1.44970 1.22380 0.06220  0.08360  -0.04510 982  SER D OG  
3181 N N   . ARG D 74  ? 1.92640 1.46430 1.19820 0.00360  0.04700  -0.03070 983  ARG D N   
3182 C CA  . ARG D 74  ? 1.78890 1.42990 1.13530 0.03210  0.04610  -0.01820 983  ARG D CA  
3183 C C   . ARG D 74  ? 1.74220 1.46040 1.15410 -0.03270 0.02660  -0.01670 983  ARG D C   
3184 O O   . ARG D 74  ? 1.70230 1.42730 1.09180 -0.03600 0.02740  -0.01730 983  ARG D O   
3185 C CB  . ARG D 74  ? 1.61300 1.37510 1.08260 0.07870  0.04590  -0.00060 983  ARG D CB  
3186 C CG  . ARG D 74  ? 1.68300 1.41070 1.10740 0.15670  0.06650  0.00680  983  ARG D CG  
3187 C CD  . ARG D 74  ? 1.69830 1.55730 1.24870 0.18970  0.06270  0.02440  983  ARG D CD  
3188 N NE  . ARG D 74  ? 1.77370 1.60660 1.28870 0.25070  0.07860  0.03310  983  ARG D NE  
3189 C CZ  . ARG D 74  ? 1.62240 1.46140 1.16070 0.25080  0.07660  0.03420  983  ARG D CZ  
3190 N NH1 . ARG D 74  ? 1.43190 1.29700 1.02900 0.19350  0.05960  0.02670  983  ARG D NH1 
3191 N NH2 . ARG D 74  ? 1.61310 1.43480 1.11470 0.31120  0.09320  0.04540  983  ARG D NH2 
3192 N N   . LEU D 75  ? 1.71060 1.48280 1.19610 -0.08080 0.01130  -0.01310 984  LEU D N   
3193 C CA  . LEU D 75  ? 1.62830 1.49610 1.19620 -0.13890 -0.00520 -0.00410 984  LEU D CA  
3194 C C   . LEU D 75  ? 1.83840 1.62890 1.30880 -0.20320 -0.01300 -0.01570 984  LEU D C   
3195 O O   . LEU D 75  ? 1.80760 1.67030 1.33400 -0.25880 -0.02720 -0.00610 984  LEU D O   
3196 C CB  . LEU D 75  ? 1.43760 1.38250 1.11190 -0.15750 -0.01370 0.00710  984  LEU D CB  
3197 C CG  . LEU D 75  ? 1.39250 1.44790 1.16550 -0.20720 -0.02540 0.02300  984  LEU D CG  
3198 C CD1 . LEU D 75  ? 1.14550 1.31440 1.05250 -0.18720 -0.02310 0.03950  984  LEU D CD1 
3199 C CD2 . LEU D 75  ? 1.49310 1.50670 1.22710 -0.27310 -0.03710 0.02110  984  LEU D CD2 
3200 N N   . ASP D 76  ? 1.90560 1.55530 1.23180 -0.19650 -0.00220 -0.03390 985  ASP D N   
3201 C CA  . ASP D 76  ? 2.00290 1.56960 1.21580 -0.25360 -0.00620 -0.04750 985  ASP D CA  
3202 C C   . ASP D 76  ? 2.01230 1.57090 1.18350 -0.22290 0.00350  -0.04980 985  ASP D C   
3203 O O   . ASP D 76  ? 2.25880 1.70170 1.29390 -0.24460 0.01040  -0.06620 985  ASP D O   
3204 C CB  . ASP D 76  ? 2.08980 1.49950 1.16650 -0.27390 0.00140  -0.06650 985  ASP D CB  
3205 C CG  . ASP D 76  ? 2.00920 1.43720 1.12360 -0.32940 -0.01410 -0.06320 985  ASP D CG  
3206 O OD1 . ASP D 76  ? 1.90800 1.47010 1.15600 -0.34640 -0.02880 -0.04470 985  ASP D OD1 
3207 O OD2 . ASP D 76  ? 2.07520 1.38010 1.08250 -0.35410 -0.00940 -0.07820 985  ASP D OD2 
3208 N N   . LYS D 77  ? 1.87520 1.55280 1.15950 -0.17730 0.00440  -0.03360 986  LYS D N   
3209 C CA  . LYS D 77  ? 1.82120 1.52610 1.10230 -0.13980 0.01240  -0.03010 986  LYS D CA  
3210 C C   . LYS D 77  ? 1.98560 1.53120 1.09790 -0.11960 0.03080  -0.04800 986  LYS D C   
3211 O O   . LYS D 77  ? 2.02510 1.50290 1.09150 -0.05800 0.04960  -0.04920 986  LYS D O   
3212 C CB  . LYS D 77  ? 1.70770 1.51830 1.05630 -0.18970 -0.00320 -0.02060 986  LYS D CB  
3213 C CG  . LYS D 77  ? 1.59490 1.54140 1.08700 -0.22270 -0.01790 -0.00220 986  LYS D CG  
3214 C CD  . LYS D 77  ? 1.64010 1.58000 1.10850 -0.30670 -0.03390 -0.00280 986  LYS D CD  
3215 C CE  . LYS D 77  ? 1.49980 1.47930 1.04090 -0.32840 -0.04130 0.00690  986  LYS D CE  
3216 N NZ  . LYS D 77  ? 1.24980 1.37630 0.92050 -0.35910 -0.05050 0.03210  986  LYS D NZ  
3217 N N   . ASP D 87  ? 1.94590 1.12790 1.07640 -0.43170 -0.03480 -0.06580 1163 ASP D N   
3218 C CA  . ASP D 87  ? 2.02170 1.15990 1.12470 -0.34970 -0.01280 -0.07370 1163 ASP D CA  
3219 C C   . ASP D 87  ? 1.92180 1.16170 1.15110 -0.30760 -0.01550 -0.05900 1163 ASP D C   
3220 O O   . ASP D 87  ? 1.78100 1.14940 1.12710 -0.31060 -0.02670 -0.04360 1163 ASP D O   
3221 C CB  . ASP D 87  ? 2.17210 1.14010 1.12260 -0.33570 0.00840  -0.09330 1163 ASP D CB  
3222 C CG  . ASP D 87  ? 2.19030 1.09460 1.11170 -0.36430 0.00620  -0.09680 1163 ASP D CG  
3223 O OD1 . ASP D 87  ? 2.16590 1.13210 1.15040 -0.42250 -0.01550 -0.08670 1163 ASP D OD1 
3224 O OD2 . ASP D 87  ? 2.20790 1.00090 1.04190 -0.32590 0.02790  -0.10750 1163 ASP D OD2 
3225 N N   . VAL D 88  ? 1.94570 1.12740 1.14750 -0.27010 -0.00380 -0.06360 1164 VAL D N   
3226 C CA  . VAL D 88  ? 1.82660 1.08760 1.13170 -0.23840 -0.00660 -0.05190 1164 VAL D CA  
3227 C C   . VAL D 88  ? 1.91980 1.12910 1.20710 -0.27230 -0.01220 -0.05350 1164 VAL D C   
3228 O O   . VAL D 88  ? 2.01030 1.09510 1.18730 -0.26400 0.00150  -0.06690 1164 VAL D O   
3229 C CB  . VAL D 88  ? 1.85110 1.10070 1.14070 -0.15790 0.01320  -0.05310 1164 VAL D CB  
3230 C CG1 . VAL D 88  ? 1.84110 1.10470 1.17050 -0.12800 0.01620  -0.04830 1164 VAL D CG1 
3231 C CG2 . VAL D 88  ? 1.78070 1.13860 1.14840 -0.12700 0.01210  -0.04320 1164 VAL D CG2 
3232 N N   . ASP D 89  ? 1.90460 1.20330 1.29330 -0.30830 -0.02940 -0.03890 1165 ASP D N   
3233 C CA  . ASP D 89  ? 1.96830 1.23950 1.36140 -0.34190 -0.03710 -0.03530 1165 ASP D CA  
3234 C C   . ASP D 89  ? 1.78160 1.12200 1.26860 -0.30280 -0.03600 -0.02580 1165 ASP D C   
3235 O O   . ASP D 89  ? 1.68200 1.10220 1.26030 -0.33140 -0.04800 -0.00990 1165 ASP D O   
3236 C CB  . ASP D 89  ? 2.06090 1.37720 1.48680 -0.41620 -0.05570 -0.02210 1165 ASP D CB  
3237 C CG  . ASP D 89  ? 2.15510 1.41180 1.48560 -0.45110 -0.05610 -0.02910 1165 ASP D CG  
3238 O OD1 . ASP D 89  ? 2.21600 1.42940 1.48010 -0.46450 -0.05340 -0.04010 1165 ASP D OD1 
3239 O OD2 . ASP D 89  ? 2.10260 1.36130 1.42620 -0.46420 -0.05890 -0.02300 1165 ASP D OD2 
3240 N N   . LEU D 90  ? 1.59490 0.91080 1.05990 -0.23960 -0.02080 -0.03290 1166 LEU D N   
3241 C CA  . LEU D 90  ? 1.52680 0.90050 1.06610 -0.20190 -0.01890 -0.02570 1166 LEU D CA  
3242 C C   . LEU D 90  ? 1.63120 0.91160 1.10600 -0.18970 -0.01100 -0.03300 1166 LEU D C   
3243 O O   . LEU D 90  ? 1.76550 0.94790 1.13710 -0.15850 0.00590  -0.04460 1166 LEU D O   
3244 C CB  . LEU D 90  ? 1.53970 0.96810 1.10530 -0.14060 -0.00810 -0.02440 1166 LEU D CB  
3245 C CG  . LEU D 90  ? 1.46470 1.01360 1.12860 -0.14580 -0.01590 -0.01380 1166 LEU D CG  
3246 C CD1 . LEU D 90  ? 1.45350 1.06960 1.15980 -0.08780 -0.00720 -0.00940 1166 LEU D CD1 
3247 C CD2 . LEU D 90  ? 1.33670 0.96090 1.09660 -0.19240 -0.02970 -0.00110 1166 LEU D CD2 
3248 N N   . GLY D 91  ? 1.60130 0.91030 1.13400 -0.21100 -0.02060 -0.02500 1167 GLY D N   
3249 C CA  . GLY D 91  ? 1.71170 0.94620 1.20100 -0.20230 -0.01510 -0.02940 1167 GLY D CA  
3250 C C   . GLY D 91  ? 1.82490 1.06130 1.30850 -0.13410 0.00010  -0.03160 1167 GLY D C   
3251 O O   . GLY D 91  ? 1.79800 1.13210 1.35700 -0.10600 -0.00100 -0.02430 1167 GLY D O   
3252 N N   . ASP D 92  ? 1.88930 1.02320 1.28430 -0.10960 0.01500  -0.03990 1168 ASP D N   
3253 C CA  . ASP D 92  ? 1.92950 1.05630 1.30460 -0.04140 0.03300  -0.03900 1168 ASP D CA  
3254 C C   . ASP D 92  ? 1.79140 0.97490 1.24420 -0.04170 0.02380  -0.03130 1168 ASP D C   
3255 O O   . ASP D 92  ? 1.66490 0.81560 1.12280 -0.08470 0.01370  -0.03150 1168 ASP D O   
3256 C CB  . ASP D 92  ? 2.07520 1.06060 1.31500 -0.01490 0.05730  -0.04940 1168 ASP D CB  
3257 C CG  . ASP D 92  ? 2.14670 1.12180 1.35290 0.06210  0.08130  -0.04430 1168 ASP D CG  
3258 O OD1 . ASP D 92  ? 2.13520 1.22080 1.42720 0.09220  0.07610  -0.03300 1168 ASP D OD1 
3259 O OD2 . ASP D 92  ? 2.19300 1.04890 1.28330 0.09070  0.10690  -0.05040 1168 ASP D OD2 
3260 N N   . ILE D 93  ? 1.75530 1.02440 1.26620 0.00200  0.02690  -0.02350 1169 ILE D N   
3261 C CA  . ILE D 93  ? 1.47330 0.80700 1.06110 0.00270  0.01860  -0.01640 1169 ILE D CA  
3262 C C   . ILE D 93  ? 1.47360 0.80160 1.02990 0.06570  0.03550  -0.01340 1169 ILE D C   
3263 O O   . ILE D 93  ? 1.61150 0.97400 1.21220 0.06850  0.03090  -0.00920 1169 ILE D O   
3264 C CB  . ILE D 93  ? 1.45470 0.91460 1.15590 -0.01830 0.00360  -0.00810 1169 ILE D CB  
3265 C CG1 . ILE D 93  ? 1.39270 0.92410 1.11410 0.01260  0.00830  -0.00480 1169 ILE D CG1 
3266 C CG2 . ILE D 93  ? 1.44890 0.91430 1.18900 -0.08180 -0.01140 -0.00570 1169 ILE D CG2 
3267 C CD1 . ILE D 93  ? 1.40400 1.00640 1.15330 0.06150  0.01510  0.00230  1169 ILE D CD1 
3268 N N   . SER D 94  ? 1.58150 0.86450 1.05980 0.11520  0.05620  -0.01380 1170 SER D N   
3269 C CA  . SER D 94  ? 1.60430 0.89180 1.04940 0.18340  0.07660  -0.00520 1170 SER D CA  
3270 C C   . SER D 94  ? 1.66300 0.87770 1.07160 0.18660  0.08310  -0.00800 1170 SER D C   
3271 O O   . SER D 94  ? 1.70640 0.95860 1.12430 0.23150  0.09260  0.00150  1170 SER D O   
3272 C CB  . SER D 94  ? 1.72480 0.95850 1.07920 0.23500  0.10220  -0.00240 1170 SER D CB  
3273 O OG  . SER D 94  ? 1.82370 0.91350 1.07170 0.22000  0.11530  -0.01490 1170 SER D OG  
3274 N N   . GLY D 95  ? 1.77400 0.89610 1.14580 0.13870  0.07720  -0.01910 1171 GLY D N   
3275 C CA  . GLY D 95  ? 1.62280 0.66970 0.96290 0.13020  0.08040  -0.02260 1171 GLY D CA  
3276 C C   . GLY D 95  ? 1.63410 0.76610 1.07240 0.11350  0.06210  -0.01630 1171 GLY D C   
3277 O O   . GLY D 95  ? 1.72250 0.82100 1.14220 0.13370  0.06980  -0.01470 1171 GLY D O   
3278 N N   . ILE D 96  ? 1.54670 0.77910 1.08130 0.07850  0.04090  -0.01260 1172 ILE D N   
3279 C CA  . ILE D 96  ? 1.52630 0.84400 1.15380 0.06380  0.02630  -0.00600 1172 ILE D CA  
3280 C C   . ILE D 96  ? 1.58130 0.96660 1.22350 0.12010  0.03630  0.00130  1172 ILE D C   
3281 O O   . ILE D 96  ? 1.53040 0.97050 1.17300 0.15230  0.04320  0.00590  1172 ILE D O   
3282 C CB  . ILE D 96  ? 1.45530 0.85740 1.17140 0.01660  0.00760  -0.00260 1172 ILE D CB  
3283 C CG1 . ILE D 96  ? 1.44980 0.80180 1.16650 -0.04230 -0.00380 -0.00340 1172 ILE D CG1 
3284 C CG2 . ILE D 96  ? 1.38090 0.88010 1.18220 0.01580  -0.00020 0.00410  1172 ILE D CG2 
3285 C CD1 . ILE D 96  ? 1.55630 0.87980 1.23740 -0.06390 -0.00460 -0.00760 1172 ILE D CD1 
3286 N N   . ASN D 97  ? 1.51440 0.90030 1.16800 0.13170  0.03710  0.00420  1173 ASN D N   
3287 C CA  . ASN D 97  ? 1.59660 1.04770 1.25940 0.18420  0.04690  0.01320  1173 ASN D CA  
3288 C C   . ASN D 97  ? 1.47270 0.95520 1.18710 0.16850  0.03670  0.01500  1173 ASN D C   
3289 O O   . ASN D 97  ? 1.49370 0.89780 1.18900 0.14600  0.03430  0.01040  1173 ASN D O   
3290 C CB  . ASN D 97  ? 1.72190 1.10020 1.28940 0.24520  0.07370  0.01670  1173 ASN D CB  
3291 C CG  . ASN D 97  ? 1.67840 1.14200 1.25790 0.30230  0.08490  0.03150  1173 ASN D CG  
3292 O OD1 . ASN D 97  ? 1.63620 1.12700 1.24030 0.30970  0.08260  0.03540  1173 ASN D OD1 
3293 N ND2 . ASN D 97  ? 1.61760 1.12990 1.18080 0.34290  0.09680  0.04170  1173 ASN D ND2 
3294 N N   . ALA D 98  ? 1.37860 0.97170 1.15140 0.18010  0.03160  0.02220  1174 ALA D N   
3295 C CA  . ALA D 98  ? 1.29840 0.93560 1.12090 0.16710  0.02280  0.02420  1174 ALA D CA  
3296 C C   . ALA D 98  ? 1.37000 1.00480 1.15130 0.22330  0.03810  0.03170  1174 ALA D C   
3297 O O   . ALA D 98  ? 1.43940 1.13370 1.20560 0.26870  0.04920  0.04180  1174 ALA D O   
3298 C CB  . ALA D 98  ? 1.21340 0.96940 1.11400 0.14300  0.01040  0.02690  1174 ALA D CB  
3299 N N   . SER D 99  ? 2.02860 1.00240 0.81690 0.49380  0.13060  0.11920  1175 SER D N   
3300 C CA  . SER D 99  ? 2.08560 1.04370 0.81550 0.56470  0.11040  0.11400  1175 SER D CA  
3301 C C   . SER D 99  ? 1.82610 1.03100 0.73040 0.59690  0.14640  0.08380  1175 SER D C   
3302 O O   . SER D 99  ? 1.69980 1.06650 0.76640 0.54230  0.18040  0.07570  1175 SER D O   
3303 C CB  . SER D 99  ? 2.15740 0.98980 0.81210 0.50820  0.06450  0.15710  1175 SER D CB  
3304 O OG  . SER D 99  ? 2.23510 0.94320 0.84340 0.42180  0.03900  0.16720  1175 SER D OG  
3305 N N   . VAL D 100 ? 1.88070 1.11110 0.75010 0.68210  0.13950  0.06880  1176 VAL D N   
3306 C CA  . VAL D 100 ? 1.73790 1.18790 0.75520 0.70660  0.16320  0.04740  1176 VAL D CA  
3307 C C   . VAL D 100 ? 1.76790 1.17920 0.75180 0.68630  0.12820  0.07340  1176 VAL D C   
3308 O O   . VAL D 100 ? 1.91040 1.12300 0.74920 0.66930  0.08660  0.10470  1176 VAL D O   
3309 C CB  . VAL D 100 ? 1.76070 1.30100 0.78400 0.82190  0.18700  0.01060  1176 VAL D CB  
3310 C CG1 . VAL D 100 ? 1.70660 1.31050 0.79860 0.80670  0.20840  -0.00370 1176 VAL D CG1 
3311 C CG2 . VAL D 100 ? 1.96180 1.34190 0.81120 0.90690  0.15470  0.01860  1176 VAL D CG2 
3312 N N   . VAL D 101 ? 1.63580 1.23290 0.75130 0.68360  0.14500  0.06100  1177 VAL D N   
3313 C CA  . VAL D 101 ? 1.63470 1.23360 0.74770 0.65810  0.11790  0.08260  1177 VAL D CA  
3314 C C   . VAL D 101 ? 1.64870 1.35120 0.77150 0.75220  0.12150  0.05990  1177 VAL D C   
3315 O O   . VAL D 101 ? 1.66790 1.51280 0.87130 0.80550  0.15680  0.02650  1177 VAL D O   
3316 C CB  . VAL D 101 ? 1.52740 1.25120 0.79210 0.55340  0.13600  0.09300  1177 VAL D CB  
3317 C CG1 . VAL D 101 ? 1.38140 1.35020 0.82630 0.55820  0.18540  0.05640  1177 VAL D CG1 
3318 C CG2 . VAL D 101 ? 1.50260 1.18620 0.74190 0.51410  0.10400  0.12270  1177 VAL D CG2 
3319 N N   . ASN D 102 ? 1.78840 1.41460 0.82600 0.77320  0.08490  0.08020  1178 ASN D N   
3320 C CA  . ASN D 102 ? 1.81690 1.54030 0.86410 0.85090  0.08180  0.06820  1178 ASN D CA  
3321 C C   . ASN D 102 ? 1.84120 1.59980 0.92290 0.79420  0.06030  0.08950  1178 ASN D C   
3322 O O   . ASN D 102 ? 1.93690 1.52830 0.90670 0.76830  0.02020  0.12260  1178 ASN D O   
3323 C CB  . ASN D 102 ? 1.95490 1.53220 0.84080 0.95390  0.05840  0.07220  1178 ASN D CB  
3324 C CG  . ASN D 102 ? 1.96750 1.66870 0.88050 1.04190  0.06320  0.05900  1178 ASN D CG  
3325 O OD1 . ASN D 102 ? 1.87160 1.76780 0.91930 1.02390  0.08120  0.04620  1178 ASN D OD1 
3326 N ND2 . ASN D 102 ? 2.15680 1.75030 0.94380 1.12500  0.04870  0.06240  1178 ASN D ND2 
3327 N N   . ILE D 103 ? 1.77680 1.74400 1.00920 0.77010  0.08730  0.07150  1179 ILE D N   
3328 C CA  . ILE D 103 ? 1.70850 1.74030 0.99040 0.71840  0.07410  0.08620  1179 ILE D CA  
3329 C C   . ILE D 103 ? 1.61420 1.83450 0.97470 0.77380  0.08890  0.06240  1179 ILE D C   
3330 O O   . ILE D 103 ? 1.49000 1.80930 0.92210 0.72690  0.08890  0.06590  1179 ILE D O   
3331 C CB  . ILE D 103 ? 1.50880 1.60240 0.90700 0.60430  0.09630  0.09230  1179 ILE D CB  
3332 C CG1 . ILE D 103 ? 1.38410 1.66880 0.93930 0.59060  0.14950  0.05670  1179 ILE D CG1 
3333 C CG2 . ILE D 103 ? 1.49330 1.39570 0.80730 0.54570  0.07520  0.12490  1179 ILE D CG2 
3334 C CD1 . ILE D 103 ? 1.28050 1.67320 0.97360 0.48780  0.17770  0.05870  1179 ILE D CD1 
3335 N N   . GLN D 104 ? 1.67630 1.94310 1.02220 0.86790  0.10110  0.04120  1180 GLN D N   
3336 C CA  . GLN D 104 ? 1.57290 2.02920 0.99720 0.92600  0.11660  0.02040  1180 GLN D CA  
3337 C C   . GLN D 104 ? 1.72500 2.15980 1.09070 0.94400  0.08010  0.04280  1180 GLN D C   
3338 O O   . GLN D 104 ? 1.65980 2.26700 1.11410 0.94800  0.08970  0.03180  1180 GLN D O   
3339 C CB  . GLN D 104 ? 1.48890 1.93740 0.88360 0.97590  0.11350  0.01320  1180 GLN D CB  
3340 C CG  . GLN D 104 ? 1.42960 2.04530 0.91640 0.96570  0.11360  0.00380  1180 GLN D CG  
3341 C CD  . GLN D 104 ? 1.25940 2.01690 0.90560 0.86110  0.13050  -0.01260 1180 GLN D CD  
3342 O OE1 . GLN D 104 ? 1.24960 2.02030 0.96670 0.80580  0.14540  -0.02560 1180 GLN D OE1 
3343 N NE2 . GLN D 104 ? 1.20540 2.05550 0.90320 0.83010  0.12700  -0.01190 1180 GLN D NE2 
3344 N N   . LYS D 105 ? 1.82280 2.05350 1.04350 0.95270  0.03930  0.07350  1181 LYS D N   
3345 C CA  . LYS D 105 ? 1.86800 2.04470 1.01560 0.96530  -0.00080 0.10030  1181 LYS D CA  
3346 C C   . LYS D 105 ? 1.78370 2.04080 1.01660 0.86790  -0.00210 0.10770  1181 LYS D C   
3347 O O   . LYS D 105 ? 1.66700 2.01410 0.92250 0.87810  -0.01400 0.11230  1181 LYS D O   
3348 C CB  . LYS D 105 ? 2.03260 1.95840 1.00750 0.98420  -0.04160 0.13130  1181 LYS D CB  
3349 C CG  . LYS D 105 ? 2.14260 1.99640 1.04280 0.98690  -0.08290 0.15940  1181 LYS D CG  
3350 C CD  . LYS D 105 ? 2.32380 1.95680 1.09470 0.99800  -0.10550 0.16550  1181 LYS D CD  
3351 C CE  . LYS D 105 ? 2.35980 1.96190 1.07140 1.09290  -0.09080 0.14640  1181 LYS D CE  
3352 N NZ  . LYS D 105 ? 2.33150 2.01660 1.05030 1.15140  -0.09440 0.14620  1181 LYS D NZ  
3353 N N   . GLU D 106 ? 1.80390 2.02470 1.07850 0.77710  0.00980  0.11150  1182 GLU D N   
3354 C CA  . GLU D 106 ? 1.66050 1.94620 1.01900 0.67780  0.01510  0.12020  1182 GLU D CA  
3355 C C   . GLU D 106 ? 1.43960 1.96440 0.96050 0.65610  0.05870  0.08660  1182 GLU D C   
3356 O O   . GLU D 106 ? 1.38480 1.99610 0.96100 0.60920  0.05860  0.08980  1182 GLU D O   
3357 C CB  . GLU D 106 ? 1.67110 1.84460 1.02710 0.59210  0.01810  0.13810  1182 GLU D CB  
3358 C CG  . GLU D 106 ? 1.78430 1.73150 0.99030 0.58350  -0.03050 0.17910  1182 GLU D CG  
3359 C CD  . GLU D 106 ? 1.93800 1.71610 1.01780 0.63930  -0.04700 0.18430  1182 GLU D CD  
3360 O OE1 . GLU D 106 ? 1.89630 1.49960 0.88900 0.59710  -0.07180 0.21410  1182 GLU D OE1 
3361 O OE2 . GLU D 106 ? 2.07470 1.89450 1.14140 0.72380  -0.03450 0.15990  1182 GLU D OE2 
3362 N N   . ILE D 107 ? 1.34810 1.97280 0.94000 0.68650  0.09450  0.05600  1183 ILE D N   
3363 C CA  . ILE D 107 ? 1.13780 1.99320 0.88470 0.66990  0.13760  0.02180  1183 ILE D CA  
3364 C C   . ILE D 107 ? 1.22260 2.19150 0.97210 0.72790  0.12500  0.01670  1183 ILE D C   
3365 O O   . ILE D 107 ? 1.23060 2.32060 1.07390 0.66230  0.13080  0.00710  1183 ILE D O   
3366 C CB  . ILE D 107 ? 1.24010 2.11900 1.04370 0.66730  0.15610  -0.00000 1183 ILE D CB  
3367 C CG1 . ILE D 107 ? 1.31670 2.11790 1.13190 0.61850  0.17800  0.00330  1183 ILE D CG1 
3368 C CG2 . ILE D 107 ? 1.14310 2.13810 1.06770 0.59480  0.15780  -0.02090 1183 ILE D CG2 
3369 C CD1 . ILE D 107 ? 1.30980 2.08780 1.15640 0.60920  0.18310  -0.01160 1183 ILE D CD1 
3370 N N   . ASP D 108 ? 1.30170 2.19510 0.94510 0.82260  0.09710  0.02780  1184 ASP D N   
3371 C CA  . ASP D 108 ? 1.33420 2.32200 0.96710 0.88850  0.08100  0.03030  1184 ASP D CA  
3372 C C   . ASP D 108 ? 1.47590 2.43230 1.07460 0.84340  0.04940  0.05470  1184 ASP D C   
3373 O O   . ASP D 108 ? 1.49610 2.60050 1.15170 0.84480  0.05030  0.04920  1184 ASP D O   
3374 C CB  . ASP D 108 ? 1.44980 2.34000 0.97010 0.99650  0.06060  0.04140  1184 ASP D CB  
3375 C CG  . ASP D 108 ? 1.51620 2.45040 1.07030 0.98940  0.07530  0.02400  1184 ASP D CG  
3376 O OD1 . ASP D 108 ? 1.42320 2.43690 1.08720 0.90520  0.09300  0.00570  1184 ASP D OD1 
3377 O OD2 . ASP D 108 ? 1.63180 2.50920 1.10290 1.06500  0.06590  0.03170  1184 ASP D OD2 
3378 N N   . ARG D 109 ? 1.55080 2.32580 1.06120 0.80360  0.02240  0.08160  1185 ARG D N   
3379 C CA  . ARG D 109 ? 1.47150 2.20530 0.94710 0.75760  -0.00780 0.10700  1185 ARG D CA  
3380 C C   . ARG D 109 ? 1.35600 2.24060 0.96060 0.66550  0.02130  0.09150  1185 ARG D C   
3381 O O   . ARG D 109 ? 1.33050 2.31120 0.96150 0.65360  0.01320  0.09340  1185 ARG D O   
3382 C CB  . ARG D 109 ? 1.57390 2.08210 0.93590 0.72720  -0.03960 0.13960  1185 ARG D CB  
3383 C CG  . ARG D 109 ? 1.82910 2.16940 1.03980 0.81400  -0.07790 0.16160  1185 ARG D CG  
3384 C CD  . ARG D 109 ? 2.05870 2.36270 1.19770 0.83600  -0.11930 0.18910  1185 ARG D CD  
3385 N NE  . ARG D 109 ? 2.21030 2.51180 1.29570 0.93570  -0.12970 0.18760  1185 ARG D NE  
3386 C CZ  . ARG D 109 ? 2.07950 2.53800 1.22710 0.99890  -0.10570 0.16620  1185 ARG D CZ  
3387 N NH1 . ARG D 109 ? 1.89900 2.52670 1.17670 0.96160  -0.06640 0.13670  1185 ARG D NH1 
3388 N NH2 . ARG D 109 ? 2.09060 2.52880 1.19620 1.07400  -0.10760 0.16390  1185 ARG D NH2 
3389 N N   . LEU D 110 ? 1.24940 2.15280 0.93280 0.59980  0.05660  0.07690  1186 LEU D N   
3390 C CA  . LEU D 110 ? 1.15460 2.19850 0.96680 0.50920  0.09240  0.06040  1186 LEU D CA  
3391 C C   . LEU D 110 ? 1.03730 2.29060 0.93370 0.53500  0.11070  0.03260  1186 LEU D C   
3392 O O   . LEU D 110 ? 1.02910 2.35690 0.95380 0.49390  0.10720  0.03490  1186 LEU D O   
3393 C CB  . LEU D 110 ? 1.12820 2.18450 1.02470 0.45290  0.13430  0.04510  1186 LEU D CB  
3394 C CG  . LEU D 110 ? 1.15000 2.03280 0.99750 0.39230  0.12380  0.07540  1186 LEU D CG  
3395 C CD1 . LEU D 110 ? 1.04420 1.98410 1.00530 0.32500  0.17220  0.06000  1186 LEU D CD1 
3396 C CD2 . LEU D 110 ? 1.09960 1.91940 0.91150 0.33490  0.09970  0.10550  1186 LEU D CD2 
3397 N N   . ASN D 111 ? 1.04520 2.35190 0.96840 0.58300  0.11780  0.01190  1187 ASN D N   
3398 C CA  . ASN D 111 ? 1.00040 2.40100 0.96980 0.56780  0.10730  -0.00470 1187 ASN D CA  
3399 C C   . ASN D 111 ? 1.15940 2.63300 1.07650 0.63620  0.08600  0.01100  1187 ASN D C   
3400 O O   . ASN D 111 ? 1.16740 2.73440 1.12730 0.59450  0.08130  0.00220  1187 ASN D O   
3401 C CB  . ASN D 111 ? 0.99020 2.37110 0.96370 0.59510  0.10730  -0.01820 1187 ASN D CB  
3402 C CG  . ASN D 111 ? 1.01720 2.35360 1.06840 0.50740  0.12690  -0.03750 1187 ASN D CG  
3403 O OD1 . ASN D 111 ? 1.00810 2.36340 1.12620 0.42490  0.13500  -0.05100 1187 ASN D OD1 
3404 N ND2 . ASN D 111 ? 0.90970 2.17140 0.94500 0.52850  0.13430  -0.03800 1187 ASN D ND2 
3405 N N   . GLU D 112 ? 1.17780 2.56570 0.99220 0.72540  0.06380  0.03640  1188 GLU D N   
3406 C CA  . GLU D 112 ? 1.28600 2.65770 1.02200 0.77270  0.02190  0.06230  1188 GLU D CA  
3407 C C   . GLU D 112 ? 1.33290 2.71870 1.08180 0.68970  0.01100  0.07330  1188 GLU D C   
3408 O O   . GLU D 112 ? 1.25350 2.76350 1.02870 0.69290  0.00290  0.07340  1188 GLU D O   
3409 C CB  . GLU D 112 ? 1.40850 2.57860 0.99980 0.84410  -0.01690 0.09270  1188 GLU D CB  
3410 C CG  . GLU D 112 ? 1.60950 2.77240 1.12580 0.90490  -0.05670 0.11960  1188 GLU D CG  
3411 C CD  . GLU D 112 ? 1.73730 2.77200 1.14120 1.00820  -0.07930 0.13830  1188 GLU D CD  
3412 O OE1 . GLU D 112 ? 1.74700 2.74390 1.09970 1.03730  -0.09970 0.15460  1188 GLU D OE1 
3413 O OE2 . GLU D 112 ? 1.78950 2.74800 1.16840 1.04250  -0.06530 0.12940  1188 GLU D OE2 
3414 N N   . VAL D 113 ? 1.18070 2.44700 0.91310 0.61670  0.01170  0.08390  1189 VAL D N   
3415 C CA  . VAL D 113 ? 1.14820 2.41130 0.89190 0.53200  0.00510  0.09660  1189 VAL D CA  
3416 C C   . VAL D 113 ? 1.00540 2.47020 0.88380 0.46900  0.04840  0.06380  1189 VAL D C   
3417 O O   . VAL D 113 ? 0.99310 2.52740 0.88250 0.43460  0.03990  0.06800  1189 VAL D O   
3418 C CB  . VAL D 113 ? 1.16350 2.25370 0.86560 0.47020  -0.00000 0.11810  1189 VAL D CB  
3419 C CG1 . VAL D 113 ? 1.12050 2.21780 0.84600 0.38210  0.00020  0.13070  1189 VAL D CG1 
3420 C CG2 . VAL D 113 ? 1.31360 2.19860 0.87390 0.52680  -0.04550 0.15140  1189 VAL D CG2 
3421 N N   . ALA D 114 ? 1.08370 2.63870 1.05820 0.45400  0.09300  0.03230  1190 ALA D N   
3422 C CA  . ALA D 114 ? 1.04110 2.64120 1.10480 0.35990  0.10450  0.00400  1190 ALA D CA  
3423 C C   . ALA D 114 ? 1.03730 2.74430 1.09980 0.38260  0.08680  -0.00400 1190 ALA D C   
3424 O O   . ALA D 114 ? 0.94710 2.68700 1.04320 0.31200  0.08810  -0.01540 1190 ALA D O   
3425 C CB  . ALA D 114 ? 1.04350 2.56800 1.15080 0.32830  0.11800  -0.01790 1190 ALA D CB  
3426 N N   . LYS D 115 ? 1.14570 2.89160 1.16450 0.47850  0.07180  0.00270  1191 LYS D N   
3427 C CA  . LYS D 115 ? 1.06400 2.91440 1.07160 0.51220  0.05550  0.00210  1191 LYS D CA  
3428 C C   . LYS D 115 ? 0.99870 2.92060 0.97080 0.54580  0.03790  0.02740  1191 LYS D C   
3429 O O   . LYS D 115 ? 1.00780 3.01930 0.99560 0.51110  0.03210  0.02310  1191 LYS D O   
3430 C CB  . LYS D 115 ? 1.13600 2.98120 1.10510 0.60180  0.04830  0.00520  1191 LYS D CB  
3431 C CG  . LYS D 115 ? 1.17100 3.11970 1.12860 0.63380  0.03670  0.00790  1191 LYS D CG  
3432 C CD  . LYS D 115 ? 1.10330 3.06040 1.08200 0.63590  0.04260  -0.00740 1191 LYS D CD  
3433 C CE  . LYS D 115 ? 1.08570 3.15120 1.08840 0.60600  0.03840  -0.01410 1191 LYS D CE  
3434 N NZ  . LYS D 115 ? 1.10180 3.18250 1.11840 0.62100  0.04230  -0.02260 1191 LYS D NZ  
3435 N N   . ASN D 116 ? 1.03550 2.85110 0.93620 0.59480  0.01390  0.05700  1192 ASN D N   
3436 C CA  . ASN D 116 ? 1.17780 2.91700 0.98810 0.60010  -0.03200 0.09160  1192 ASN D CA  
3437 C C   . ASN D 116 ? 1.14140 2.92880 0.99230 0.49930  -0.02240 0.08760  1192 ASN D C   
3438 O O   . ASN D 116 ? 1.20780 3.02330 1.02180 0.49980  -0.05180 0.10620  1192 ASN D O   
3439 C CB  . ASN D 116 ? 1.29020 2.80090 0.98050 0.62910  -0.06650 0.12400  1192 ASN D CB  
3440 C CG  . ASN D 116 ? 1.38270 2.82180 0.99700 0.73900  -0.08820 0.13800  1192 ASN D CG  
3441 O OD1 . ASN D 116 ? 1.45030 3.01210 1.10500 0.79860  -0.07660 0.12520  1192 ASN D OD1 
3442 N ND2 . ASN D 116 ? 1.46650 2.70440 0.96860 0.76620  -0.11910 0.16570  1192 ASN D ND2 
3443 N N   . LEU D 117 ? 1.04390 2.83630 0.96540 0.41700  0.01760  0.06650  1193 LEU D N   
3444 C CA  . LEU D 117 ? 1.00900 2.82270 0.96440 0.31750  0.03210  0.06460  1193 LEU D CA  
3445 C C   . LEU D 117 ? 1.00150 3.01370 1.02450 0.29140  0.04640  0.04290  1193 LEU D C   
3446 O O   . LEU D 117 ? 1.04200 3.06920 1.06560 0.22490  0.04610  0.04760  1193 LEU D O   
3447 C CB  . LEU D 117 ? 0.91940 2.69480 0.94080 0.24270  0.07680  0.04880  1193 LEU D CB  
3448 C CG  . LEU D 117 ? 0.94720 2.51660 0.89610 0.22440  0.05850  0.08060  1193 LEU D CG  
3449 C CD1 . LEU D 117 ? 0.88910 2.44050 0.91570 0.15450  0.10600  0.06690  1193 LEU D CD1 
3450 C CD2 . LEU D 117 ? 1.01660 2.50810 0.89990 0.18710  0.02720  0.11180  1193 LEU D CD2 
3451 N N   . ASN D 118 ? 1.05100 3.11150 1.08590 0.32610  0.03990  0.02430  1194 ASN D N   
3452 C CA  . ASN D 118 ? 0.96740 3.11680 1.01180 0.29730  0.03220  0.00940  1194 ASN D CA  
3453 C C   . ASN D 118 ? 0.96130 3.21830 0.97250 0.33030  0.01170  0.03790  1194 ASN D C   
3454 O O   . ASN D 118 ? 1.15670 3.47760 1.17270 0.27550  0.01070  0.02910  1194 ASN D O   
3455 C CB  . ASN D 118 ? 0.99190 3.16820 1.03820 0.34110  0.03050  -0.00500 1194 ASN D CB  
3456 C CG  . ASN D 118 ? 0.97240 3.05740 1.06450 0.28370  0.04790  -0.03600 1194 ASN D CG  
3457 O OD1 . ASN D 118 ? 0.91810 2.95610 1.04110 0.20080  0.05880  -0.05530 1194 ASN D OD1 
3458 N ND2 . ASN D 118 ? 1.02290 3.07100 1.11570 0.33120  0.05130  -0.03930 1194 ASN D ND2 
3459 N N   . GLU D 119 ? 0.94580 3.13460 0.89380 0.40790  -0.02790 0.07410  1195 GLU D N   
3460 C CA  . GLU D 119 ? 1.05100 3.18080 0.91850 0.43050  -0.07060 0.10810  1195 GLU D CA  
3461 C C   . GLU D 119 ? 1.06720 3.08270 0.88530 0.36320  -0.08660 0.12670  1195 GLU D C   
3462 O O   . GLU D 119 ? 1.16450 3.08060 0.91150 0.38230  -0.12250 0.15710  1195 GLU D O   
3463 C CB  . GLU D 119 ? 1.17050 3.17850 0.95970 0.53270  -0.10120 0.13470  1195 GLU D CB  
3464 C CG  . GLU D 119 ? 1.18090 3.30000 1.00520 0.59930  -0.08710 0.12440  1195 GLU D CG  
3465 C CD  . GLU D 119 ? 1.29110 3.29550 1.04640 0.70040  -0.10640 0.14500  1195 GLU D CD  
3466 O OE1 . GLU D 119 ? 1.39060 3.23170 1.05890 0.72370  -0.14040 0.17370  1195 GLU D OE1 
3467 O OE2 . GLU D 119 ? 1.28370 3.35270 1.06760 0.75100  -0.08440 0.13130  1195 GLU D OE2 
3468 N N   . SER D 120 ? 1.01910 3.01700 0.88610 0.28240  -0.05000 0.10730  1196 SER D N   
3469 C CA  . SER D 120 ? 1.06080 2.95680 0.89990 0.20470  -0.05160 0.12230  1196 SER D CA  
3470 C C   . SER D 120 ? 0.94700 2.97630 0.86680 0.11020  -0.01190 0.09460  1196 SER D C   
3471 O O   . SER D 120 ? 1.03800 2.99780 0.94130 0.04250  -0.00820 0.10620  1196 SER D O   
3472 C CB  . SER D 120 ? 1.13290 2.86530 0.95560 0.18760  -0.04040 0.13060  1196 SER D CB  
3473 O OG  . SER D 120 ? 1.23160 2.79940 0.94610 0.25320  -0.08860 0.16740  1196 SER D OG  
3474 N N   . LEU D 121 ? 0.81800 3.02890 0.81690 0.10510  0.01580  0.06140  1197 LEU D N   
3475 C CA  . LEU D 121 ? 0.78860 2.99010 0.82380 0.01220  0.02670  0.02830  1197 LEU D CA  
3476 C C   . LEU D 121 ? 0.81190 3.11600 0.82360 -0.01340 0.00980  0.04270  1197 LEU D C   
3477 O O   . LEU D 121 ? 0.86610 3.15440 0.82240 0.01620  -0.01310 0.08040  1197 LEU D O   
3478 C CB  . LEU D 121 ? 0.78830 2.98870 0.84640 0.01710  0.03220  -0.00840 1197 LEU D CB  
3479 C CG  . LEU D 121 ? 0.75490 2.81140 0.84860 -0.01050 0.05480  -0.03450 1197 LEU D CG  
3480 C CD1 . LEU D 121 ? 0.74860 2.77260 0.84310 0.05100  0.05730  -0.01900 1197 LEU D CD1 
3481 C CD2 . LEU D 121 ? 0.75610 2.81050 0.87040 -0.02330 0.06070  -0.06750 1197 LEU D CD2 
3482 N N   . VAL E 6   ? 1.72290 2.59890 0.97910 0.99270  0.03760  0.15810  915  VAL E N   
3483 C CA  . VAL E 6   ? 1.55440 2.59100 0.97540 0.97870  0.03170  0.12860  915  VAL E CA  
3484 C C   . VAL E 6   ? 1.56780 2.54830 1.07030 0.86800  0.01620  0.12080  915  VAL E C   
3485 O O   . VAL E 6   ? 1.72230 2.63680 1.21280 0.87930  0.01620  0.12490  915  VAL E O   
3486 C CB  . VAL E 6   ? 1.38060 2.63980 0.94940 0.91320  0.02960  0.08600  915  VAL E CB  
3487 C CG1 . VAL E 6   ? 1.28360 2.58700 0.96120 0.83260  0.01630  0.05970  915  VAL E CG1 
3488 C CG2 . VAL E 6   ? 1.58870 2.88730 1.05230 0.99840  0.04820  0.08950  915  VAL E CG2 
3489 N N   . LEU E 7   ? 1.54150 2.53390 1.13430 0.74800  0.01410  0.10060  916  LEU E N   
3490 C CA  . LEU E 7   ? 1.44120 2.40340 1.15640 0.61310  0.00940  0.07730  916  LEU E CA  
3491 C C   . LEU E 7   ? 1.67050 2.35210 1.21410 0.60220  0.02150  0.10080  916  LEU E C   
3492 O O   . LEU E 7   ? 1.61800 2.30480 1.23180 0.57650  0.01620  0.09200  916  LEU E O   
3493 C CB  . LEU E 7   ? 1.35260 2.35360 1.15570 0.50060  0.00760  0.05650  916  LEU E CB  
3494 C CG  . LEU E 7   ? 1.06710 2.36610 1.09270 0.47720  -0.00440 0.02290  916  LEU E CG  
3495 C CD1 . LEU E 7   ? 0.94590 2.25740 1.02530 0.37690  -0.00400 0.00720  916  LEU E CD1 
3496 C CD2 . LEU E 7   ? 0.96790 2.31230 1.14340 0.39350  -0.01190 -0.00710 916  LEU E CD2 
3497 N N   . TYR E 8   ? 1.76180 2.21010 1.08570 0.62480  0.03890  0.12940  917  TYR E N   
3498 C CA  . TYR E 8   ? 1.95190 2.11200 1.09440 0.60440  0.05580  0.15000  917  TYR E CA  
3499 C C   . TYR E 8   ? 2.04630 2.12990 1.07250 0.71820  0.06190  0.17480  917  TYR E C   
3500 O O   . TYR E 8   ? 2.15000 2.03660 1.07410 0.69240  0.07300  0.18440  917  TYR E O   
3501 C CB  . TYR E 8   ? 2.15890 2.09240 1.09500 0.59700  0.07750  0.17190  917  TYR E CB  
3502 C CG  . TYR E 8   ? 2.39130 2.29750 1.17000 0.72890  0.08870  0.20320  917  TYR E CG  
3503 C CD1 . TYR E 8   ? 2.34490 2.41810 1.19080 0.74910  0.08100  0.19680  917  TYR E CD1 
3504 C CD2 . TYR E 8   ? 2.66310 2.37740 1.22320 0.83510  0.10810  0.23940  917  TYR E CD2 
3505 C CE1 . TYR E 8   ? 2.49220 2.54810 1.19300 0.87350  0.09080  0.22620  917  TYR E CE1 
3506 C CE2 . TYR E 8   ? 2.77500 2.47490 1.26660 0.93420  0.11880  0.25320  917  TYR E CE2 
3507 C CZ  . TYR E 8   ? 2.68840 2.55700 1.25080 0.95360  0.10980  0.24730  917  TYR E CZ  
3508 O OH  . TYR E 8   ? 2.78410 2.64330 1.28590 1.04990  0.12150  0.25890  917  TYR E OH  
3509 N N   . GLU E 9   ? 2.00870 2.23470 1.03940 0.83980  0.05640  0.18470  918  GLU E N   
3510 C CA  . GLU E 9   ? 2.05580 2.25390 1.01090 0.94930  0.05880  0.20340  918  GLU E CA  
3511 C C   . GLU E 9   ? 1.87240 2.21910 1.02680 0.89720  0.04170  0.17500  918  GLU E C   
3512 O O   . GLU E 9   ? 1.93430 2.16100 1.02260 0.91440  0.04660  0.18540  918  GLU E O   
3513 C CB  . GLU E 9   ? 2.04340 2.35420 1.00860 1.06260  0.06800  0.20060  918  GLU E CB  
3514 C CG  . GLU E 9   ? 2.25150 2.37920 1.04160 1.11120  0.09180  0.22170  918  GLU E CG  
3515 C CD  . GLU E 9   ? 2.41150 2.49350 1.12200 1.22790  0.11610  0.22480  918  GLU E CD  
3516 O OE1 . GLU E 9   ? 2.35260 2.60170 1.15880 1.27660  0.11870  0.20310  918  GLU E OE1 
3517 O OE2 . GLU E 9   ? 2.62230 2.50060 1.16820 1.26290  0.13790  0.24420  918  GLU E OE2 
3518 N N   . ASN E 10  ? 1.79830 2.38880 1.18360 0.83280  0.02460  0.14060  919  ASN E N   
3519 C CA  . ASN E 10  ? 1.62840 2.36630 1.21950 0.76740  0.01060  0.11090  919  ASN E CA  
3520 C C   . ASN E 10  ? 1.64340 2.20140 1.21510 0.65670  0.01470  0.10800  919  ASN E C   
3521 O O   . ASN E 10  ? 1.58200 2.13940 1.20590 0.64490  0.01040  0.10260  919  ASN E O   
3522 C CB  . ASN E 10  ? 1.36560 2.38180 1.19470 0.71310  -0.00290 0.07470  919  ASN E CB  
3523 C CG  . ASN E 10  ? 1.31610 2.41230 1.14500 0.71850  0.00270  0.05700  919  ASN E CG  
3524 O OD1 . ASN E 10  ? 1.48240 2.53070 1.20030 0.79790  0.01170  0.07000  919  ASN E OD1 
3525 N ND2 . ASN E 10  ? 1.14750 2.34440 1.08910 0.63080  -0.00440 0.02860  919  ASN E ND2 
3526 N N   . GLN E 11  ? 1.64180 2.05640 1.14030 0.57890  0.02300  0.11040  920  GLN E N   
3527 C CA  . GLN E 11  ? 1.71370 1.95590 1.18560 0.46630  0.02810  0.10480  920  GLN E CA  
3528 C C   . GLN E 11  ? 1.86380 1.87480 1.14210 0.51640  0.04280  0.13110  920  GLN E C   
3529 O O   . GLN E 11  ? 1.89500 1.84540 1.20730 0.45290  0.04090  0.12220  920  GLN E O   
3530 C CB  . GLN E 11  ? 1.83820 1.95740 1.23740 0.38720  0.03780  0.10380  920  GLN E CB  
3531 C CG  . GLN E 11  ? 1.63840 1.95960 1.21350 0.32620  0.02570  0.07790  920  GLN E CG  
3532 C CD  . GLN E 11  ? 1.32770 1.78230 1.12180 0.20970  0.01170  0.04440  920  GLN E CD  
3533 O OE1 . GLN E 11  ? 1.01170 1.69120 0.99440 0.21480  -0.00140 0.02490  920  GLN E OE1 
3534 N NE2 . GLN E 11  ? 1.31260 1.62810 1.08020 0.10340  0.01620  0.03670  920  GLN E NE2 
3535 N N   . LYS E 12  ? 1.95360 1.83690 1.03220 0.62490  0.05820  0.16240  921  LYS E N   
3536 C CA  . LYS E 12  ? 2.19770 1.85300 1.07080 0.68950  0.07650  0.19060  921  LYS E CA  
3537 C C   . LYS E 12  ? 2.04710 1.81140 1.00130 0.74880  0.06490  0.18830  921  LYS E C   
3538 O O   . LYS E 12  ? 2.10650 1.72840 0.99300 0.73310  0.07210  0.19400  921  LYS E O   
3539 C CB  . LYS E 12  ? 2.49340 2.01130 1.14550 0.79990  0.09680  0.22510  921  LYS E CB  
3540 C CG  . LYS E 12  ? 2.66140 1.97170 1.16210 0.74240  0.11810  0.23420  921  LYS E CG  
3541 C CD  . LYS E 12  ? 2.80060 2.06490 1.18080 0.82790  0.13290  0.25340  921  LYS E CD  
3542 C CE  . LYS E 12  ? 2.94460 2.05540 1.22110 0.75280  0.14950  0.25610  921  LYS E CE  
3543 N NZ  . LYS E 12  ? 3.11350 2.10770 1.26620 0.82380  0.17170  0.26860  921  LYS E NZ  
3544 N N   . LEU E 13  ? 1.93080 1.93810 1.02190 0.81300  0.04900  0.17890  922  LEU E N   
3545 C CA  . LEU E 13  ? 1.86940 2.00940 1.05460 0.87100  0.03780  0.17290  922  LEU E CA  
3546 C C   . LEU E 13  ? 1.80910 1.97810 1.14010 0.76060  0.02810  0.14890  922  LEU E C   
3547 O O   . LEU E 13  ? 1.93480 1.97780 1.19530 0.76850  0.03330  0.15820  922  LEU E O   
3548 C CB  . LEU E 13  ? 1.67150 2.09030 1.00580 0.92990  0.02430  0.15700  922  LEU E CB  
3549 C CG  . LEU E 13  ? 1.56320 2.11230 1.00730 0.91740  0.02980  0.12630  922  LEU E CG  
3550 C CD1 . LEU E 13  ? 1.60190 2.01540 0.87940 0.99980  0.05250  0.13970  922  LEU E CD1 
3551 C CD2 . LEU E 13  ? 1.50490 2.26060 1.07230 0.87650  0.02450  0.09660  922  LEU E CD2 
3552 N N   . ILE E 14  ? 1.61680 1.93760 1.13610 0.66060  0.01590  0.11990  923  ILE E N   
3553 C CA  . ILE E 14  ? 1.46730 1.85590 1.15570 0.55420  0.00540  0.09460  923  ILE E CA  
3554 C C   . ILE E 14  ? 1.62030 1.76300 1.17430 0.50320  0.01580  0.10620  923  ILE E C   
3555 O O   . ILE E 14  ? 1.58560 1.72960 1.18540 0.49390  0.01150  0.10230  923  ILE E O   
3556 C CB  . ILE E 14  ? 1.31390 1.85120 1.18080 0.45010  -0.00380 0.06630  923  ILE E CB  
3557 C CG1 . ILE E 14  ? 1.13250 1.93880 1.16170 0.49250  -0.01320 0.04860  923  ILE E CG1 
3558 C CG2 . ILE E 14  ? 1.18030 1.72900 1.17680 0.33500  -0.01060 0.04590  923  ILE E CG2 
3559 C CD1 . ILE E 14  ? 1.00520 1.93440 1.16250 0.41130  -0.01760 0.02620  923  ILE E CD1 
3560 N N   . ALA E 15  ? 1.53900 1.48120 0.93130 0.47220  0.03060  0.11890  924  ALA E N   
3561 C CA  . ALA E 15  ? 1.65690 1.35650 0.91230 0.40870  0.04450  0.12550  924  ALA E CA  
3562 C C   . ALA E 15  ? 1.93390 1.48430 1.03120 0.49520  0.05670  0.14950  924  ALA E C   
3563 O O   . ALA E 15  ? 1.99240 1.43470 1.06480 0.44350  0.06010  0.14590  924  ALA E O   
3564 C CB  . ALA E 15  ? 1.80080 1.33040 0.91100 0.36920  0.06130  0.13310  924  ALA E CB  
3565 N N   . ASN E 16  ? 2.03750 1.57990 1.02720 0.62200  0.06370  0.17280  925  ASN E N   
3566 C CA  . ASN E 16  ? 2.09430 1.49740 0.92540 0.71760  0.07680  0.19760  925  ASN E CA  
3567 C C   . ASN E 16  ? 1.90340 1.46170 0.88740 0.73030  0.05930  0.18450  925  ASN E C   
3568 O O   . ASN E 16  ? 1.96360 1.39780 0.88690 0.71630  0.06560  0.18870  925  ASN E O   
3569 C CB  . ASN E 16  ? 2.24740 1.61020 0.92570 0.85250  0.08910  0.22640  925  ASN E CB  
3570 C CG  . ASN E 16  ? 2.54430 1.69500 1.04530 0.83820  0.11610  0.23610  925  ASN E CG  
3571 O OD1 . ASN E 16  ? 2.67570 1.62990 1.07520 0.76040  0.13080  0.23750  925  ASN E OD1 
3572 N ND2 . ASN E 16  ? 2.63060 1.82510 1.10400 0.90880  0.12480  0.23780  925  ASN E ND2 
3573 N N   . GLN E 17  ? 1.79480 1.61340 0.97160 0.74870  0.04000  0.16710  926  GLN E N   
3574 C CA  . GLN E 17  ? 1.64230 1.63490 0.98650 0.75640  0.02440  0.15080  926  GLN E CA  
3575 C C   . GLN E 17  ? 1.54600 1.50990 0.98390 0.63770  0.01880  0.13310  926  GLN E C   
3576 O O   . GLN E 17  ? 1.53940 1.48520 0.98720 0.65080  0.01690  0.13410  926  GLN E O   
3577 C CB  . GLN E 17  ? 1.41920 1.69480 0.96220 0.77180  0.00890  0.12940  926  GLN E CB  
3578 C CG  . GLN E 17  ? 1.45170 1.77890 0.92240 0.85360  0.02080  0.13150  926  GLN E CG  
3579 C CD  . GLN E 17  ? 1.64950 1.85100 0.96240 0.92280  0.04130  0.14210  926  GLN E CD  
3580 O OE1 . GLN E 17  ? 1.63330 1.90550 0.99960 0.91470  0.04100  0.12780  926  GLN E OE1 
3581 N NE2 . GLN E 17  ? 1.94360 1.94880 1.05930 0.98010  0.06100  0.16510  926  GLN E NE2 
3582 N N   . PHE E 18  ? 1.35940 1.32700 0.86640 0.52780  0.01590  0.11700  927  PHE E N   
3583 C CA  . PHE E 18  ? 1.27640 1.21670 0.86890 0.40850  0.01080  0.09950  927  PHE E CA  
3584 C C   . PHE E 18  ? 1.46160 1.15440 0.86960 0.40420  0.02560  0.11550  927  PHE E C   
3585 O O   . PHE E 18  ? 1.41650 1.11470 0.86950 0.39210  0.02070  0.11160  927  PHE E O   
3586 C CB  . PHE E 18  ? 1.20510 1.17470 0.87180 0.30330  0.00780  0.08210  927  PHE E CB  
3587 C CG  . PHE E 18  ? 1.12620 1.07100 0.87540 0.18160  0.00270  0.06380  927  PHE E CG  
3588 C CD1 . PHE E 18  ? 0.93390 1.04720 0.87780 0.14440  -0.01170 0.04590  927  PHE E CD1 
3589 C CD2 . PHE E 18  ? 1.24770 1.00260 0.87760 0.10540  0.01370  0.06400  927  PHE E CD2 
3590 C CE1 . PHE E 18  ? 0.86410 0.95970 0.88200 0.03780  -0.01650 0.03050  927  PHE E CE1 
3591 C CE2 . PHE E 18  ? 1.17330 0.91780 0.88130 -0.00490 0.00820  0.04560  927  PHE E CE2 
3592 C CZ  . PHE E 18  ? 0.98130 0.89800 0.88330 -0.03620 -0.00770 0.03000  927  PHE E CZ  
3593 N N   . ASN E 19  ? 1.60210 1.08600 0.80630 0.41710  0.04500  0.13300  928  ASN E N   
3594 C CA  . ASN E 19  ? 1.90610 1.13040 0.91220 0.40570  0.06550  0.14660  928  ASN E CA  
3595 C C   . ASN E 19  ? 1.94250 1.13370 0.88370 0.50200  0.06880  0.16310  928  ASN E C   
3596 O O   . ASN E 19  ? 1.98680 1.04930 0.86330 0.47020  0.07630  0.16350  928  ASN E O   
3597 C CB  . ASN E 19  ? 2.03060 1.04800 0.82700 0.41660  0.09010  0.16320  928  ASN E CB  
3598 C CG  . ASN E 19  ? 2.03860 1.04010 0.87420 0.30080  0.09040  0.14460  928  ASN E CG  
3599 O OD1 . ASN E 19  ? 1.97750 1.04760 0.94780 0.19690  0.07770  0.12060  928  ASN E OD1 
3600 N ND2 . ASN E 19  ? 2.12220 1.03370 0.83980 0.31790  0.10520  0.15550  928  ASN E ND2 
3601 N N   . SER E 20  ? 1.90670 1.21430 0.86540 0.61410  0.06350  0.17470  929  SER E N   
3602 C CA  . SER E 20  ? 1.97230 1.29730 0.90350 0.71200  0.06280  0.18710  929  SER E CA  
3603 C C   . SER E 20  ? 1.83410 1.29070 0.94590 0.65450  0.04510  0.16610  929  SER E C   
3604 O O   . SER E 20  ? 1.96570 1.30270 1.00850 0.64730  0.05160  0.17110  929  SER E O   
3605 C CB  . SER E 20  ? 1.96620 1.43180 0.91510 0.82760  0.05920  0.19480  929  SER E CB  
3606 O OG  . SER E 20  ? 1.87860 1.44940 0.89350 0.86590  0.06140  0.17780  929  SER E OG  
3607 N N   . ALA E 21  ? 1.71480 1.40030 1.04540 0.60910  0.02580  0.14320  930  ALA E N   
3608 C CA  . ALA E 21  ? 1.44080 1.28070 0.96190 0.56270  0.01000  0.12340  930  ALA E CA  
3609 C C   . ALA E 21  ? 1.44650 1.15480 0.94520 0.46370  0.01250  0.11750  930  ALA E C   
3610 O O   . ALA E 21  ? 1.33780 1.05180 0.86840 0.46700  0.00880  0.11620  930  ALA E O   
3611 C CB  . ALA E 21  ? 1.14830 1.22660 0.88780 0.51840  -0.00490 0.09990  930  ALA E CB  
3612 N N   . ILE E 22  ? 1.45390 1.05120 0.89890 0.37860  0.01900  0.11270  931  ILE E N   
3613 C CA  . ILE E 22  ? 1.52590 0.99970 0.94450 0.27710  0.02230  0.10380  931  ILE E CA  
3614 C C   . ILE E 22  ? 1.71400 0.98370 0.94350 0.32270  0.03880  0.12150  931  ILE E C   
3615 O O   . ILE E 22  ? 1.64870 0.90960 0.91510 0.28940  0.03450  0.11540  931  ILE E O   
3616 C CB  . ILE E 22  ? 1.50830 0.89650 0.88670 0.18490  0.02880  0.09440  931  ILE E CB  
3617 C CG1 . ILE E 22  ? 1.31900 0.91840 0.90820 0.12390  0.01140  0.07330  931  ILE E CG1 
3618 C CG2 . ILE E 22  ? 1.57670 0.79730 0.87220 0.09630  0.03810  0.08730  931  ILE E CG2 
3619 C CD1 . ILE E 22  ? 1.58330 1.11620 1.15110 0.02810  0.01590  0.06150  931  ILE E CD1 
3620 N N   . GLY E 23  ? 1.94880 1.05910 0.98100 0.39710  0.05840  0.14310  932  GLY E N   
3621 C CA  . GLY E 23  ? 2.09970 1.00310 0.93430 0.45080  0.07880  0.16200  932  GLY E CA  
3622 C C   . GLY E 23  ? 1.91190 0.90000 0.81720 0.50060  0.06820  0.16350  932  GLY E C   
3623 O O   . GLY E 23  ? 1.98440 0.86600 0.83840 0.46490  0.07420  0.16140  932  GLY E O   
3624 N N   . LYS E 24  ? 1.87730 1.05830 0.90170 0.57630  0.05320  0.16450  933  LYS E N   
3625 C CA  . LYS E 24  ? 1.80050 1.09230 0.91200 0.62890  0.04220  0.16370  933  LYS E CA  
3626 C C   . LYS E 24  ? 1.62310 0.98590 0.88160 0.52770  0.02900  0.14340  933  LYS E C   
3627 O O   . LYS E 24  ? 1.66550 0.95300 0.88200 0.52760  0.03210  0.14630  933  LYS E O   
3628 C CB  . LYS E 24  ? 1.63440 1.15310 0.87910 0.70200  0.02920  0.15900  933  LYS E CB  
3629 C CG  . LYS E 24  ? 1.81640 1.32410 0.95460 0.77060  0.04700  0.16060  933  LYS E CG  
3630 C CD  . LYS E 24  ? 1.69830 1.44560 0.98020 0.79660  0.03840  0.14330  933  LYS E CD  
3631 C CE  . LYS E 24  ? 1.81930 1.55690 0.98870 0.86790  0.05680  0.14520  933  LYS E CE  
3632 N NZ  . LYS E 24  ? 1.72910 1.67060 1.02060 0.86910  0.04700  0.13170  933  LYS E NZ  
3633 N N   . ILE E 25  ? 1.50490 1.00620 0.92690 0.44520  0.01570  0.12390  934  ILE E N   
3634 C CA  . ILE E 25  ? 1.37610 0.97720 0.96250 0.35060  0.00200  0.10430  934  ILE E CA  
3635 C C   . ILE E 25  ? 1.54240 0.94940 1.00930 0.28260  0.01190  0.10460  934  ILE E C   
3636 O O   . ILE E 25  ? 1.46720 0.89600 0.98920 0.25920  0.00590  0.09960  934  ILE E O   
3637 C CB  . ILE E 25  ? 1.17550 0.93490 0.93110 0.27740  -0.00970 0.08530  934  ILE E CB  
3638 C CG1 . ILE E 25  ? 1.03070 1.00830 0.93070 0.33970  -0.01900 0.08020  934  ILE E CG1 
3639 C CG2 . ILE E 25  ? 1.05090 0.86300 0.93510 0.16930  -0.01950 0.06760  934  ILE E CG2 
3640 C CD1 . ILE E 25  ? 0.91800 1.02090 0.93350 0.29180  -0.02470 0.06580  934  ILE E CD1 
3641 N N   . GLN E 26  ? 1.69700 0.92070 1.00180 0.25390  0.02840  0.10940  935  GLN E N   
3642 C CA  . GLN E 26  ? 1.83490 0.85430 0.99900 0.19010  0.04350  0.10750  935  GLN E CA  
3643 C C   . GLN E 26  ? 1.97890 0.90690 1.04700 0.25240  0.05160  0.12040  935  GLN E C   
3644 O O   . GLN E 26  ? 2.01580 0.90480 1.09390 0.19350  0.05040  0.11120  935  GLN E O   
3645 C CB  . GLN E 26  ? 1.93680 0.75760 0.90940 0.17950  0.06670  0.11450  935  GLN E CB  
3646 C CG  . GLN E 26  ? 1.85000 0.71840 0.89150 0.09390  0.06190  0.09860  935  GLN E CG  
3647 C CD  . GLN E 26  ? 2.14480 0.79590 0.98260 0.07750  0.08840  0.10450  935  GLN E CD  
3648 O OE1 . GLN E 26  ? 2.32880 0.89090 1.03230 0.16340  0.10380  0.12500  935  GLN E OE1 
3649 N NE2 . GLN E 26  ? 2.19380 0.75700 1.00380 -0.03280 0.09540  0.08600  935  GLN E NE2 
3650 N N   . ASP E 27  ? 2.08960 0.98640 1.06600 0.36800  0.05980  0.14070  936  ASP E N   
3651 C CA  . ASP E 27  ? 2.24210 1.05870 1.12310 0.44480  0.06820  0.15500  936  ASP E CA  
3652 C C   . ASP E 27  ? 2.00620 1.00470 1.07110 0.44030  0.04650  0.14490  936  ASP E C   
3653 O O   . ASP E 27  ? 2.04850 0.97530 1.06940 0.43730  0.05030  0.14630  936  ASP E O   
3654 C CB  . ASP E 27  ? 2.33650 1.16330 1.13610 0.54810  0.08180  0.16080  936  ASP E CB  
3655 C CG  . ASP E 27  ? 2.32580 1.18500 1.10820 0.60870  0.08870  0.15580  936  ASP E CG  
3656 O OD1 . ASP E 27  ? 2.37340 1.10170 1.05140 0.58630  0.10460  0.15030  936  ASP E OD1 
3657 O OD2 . ASP E 27  ? 2.25920 1.28050 1.13290 0.67160  0.07950  0.15470  936  ASP E OD2 
3658 N N   . SER E 28  ? 1.87190 1.09420 1.13290 0.43800  0.02670  0.13440  937  SER E N   
3659 C CA  . SER E 28  ? 1.65960 1.07140 1.10910 0.43530  0.00850  0.12390  937  SER E CA  
3660 C C   . SER E 28  ? 1.65690 1.07050 1.18430 0.32420  0.00150  0.10870  937  SER E C   
3661 O O   . SER E 28  ? 1.67430 1.12210 1.25080 0.32700  -0.00390 0.10750  937  SER E O   
3662 C CB  . SER E 28  ? 1.39410 1.03340 1.02070 0.45960  -0.00520 0.11490  937  SER E CB  
3663 O OG  . SER E 28  ? 1.30320 1.04110 1.06890 0.36220  -0.01480 0.09730  937  SER E OG  
3664 N N   . LEU E 29  ? 1.54280 0.92060 1.07700 0.23180  0.00190  0.09760  938  LEU E N   
3665 C CA  . LEU E 29  ? 1.44280 0.83800 1.05910 0.12230  -0.00580 0.08120  938  LEU E CA  
3666 C C   . LEU E 29  ? 1.70500 0.91790 1.17410 0.10030  0.00620  0.08420  938  LEU E C   
3667 O O   . LEU E 29  ? 1.70420 0.96600 1.25490 0.04900  -0.00280 0.07510  938  LEU E O   
3668 C CB  . LEU E 29  ? 1.45920 0.85460 1.10360 0.03510  -0.00670 0.06790  938  LEU E CB  
3669 C CG  . LEU E 29  ? 1.38130 0.98000 1.20810 0.02770  -0.02040 0.05910  938  LEU E CG  
3670 C CD1 . LEU E 29  ? 1.38620 0.96540 1.22680 -0.06520 -0.02030 0.04530  938  LEU E CD1 
3671 C CD2 . LEU E 29  ? 1.23900 1.03420 1.27040 0.01530  -0.03610 0.05030  938  LEU E CD2 
3672 N N   . SER E 30  ? 1.84390 0.85340 1.10340 0.13400  0.02750  0.09570  939  SER E N   
3673 C CA  . SER E 30  ? 2.06320 0.88100 1.16460 0.10870  0.04430  0.09630  939  SER E CA  
3674 C C   . SER E 30  ? 2.04990 0.86580 1.12620 0.19200  0.04470  0.10940  939  SER E C   
3675 O O   . SER E 30  ? 2.08310 0.80840 1.09870 0.16040  0.05100  0.10570  939  SER E O   
3676 C CB  . SER E 30  ? 2.28070 0.87840 1.16940 0.10280  0.07140  0.10080  939  SER E CB  
3677 O OG  . SER E 30  ? 2.30950 0.85320 1.15950 0.00690  0.08040  0.07650  939  SER E OG  
3678 N N   . SER E 31  ? 2.05020 0.96970 1.17560 0.29120  0.03820  0.12210  940  SER E N   
3679 C CA  . SER E 31  ? 1.96070 0.92260 1.09830 0.37470  0.03490  0.13240  940  SER E CA  
3680 C C   . SER E 31  ? 1.79560 0.92980 1.12670 0.32980  0.01440  0.11970  940  SER E C   
3681 O O   . SER E 31  ? 1.80110 0.90690 1.11330 0.34410  0.01490  0.12230  940  SER E O   
3682 C CB  . SER E 31  ? 1.83940 0.90010 0.99470 0.47490  0.03480  0.13990  940  SER E CB  
3683 O OG  . SER E 31  ? 1.77090 0.99530 1.05100 0.51610  0.02350  0.13520  940  SER E OG  
3684 N N   . THR E 32  ? 1.62030 0.92350 1.12760 0.27830  -0.00120 0.10700  941  THR E N   
3685 C CA  . THR E 32  ? 1.39540 0.86490 1.09480 0.22470  -0.01840 0.09450  941  THR E CA  
3686 C C   . THR E 32  ? 1.50910 0.87930 1.16340 0.13750  -0.01660 0.08660  941  THR E C   
3687 O O   . THR E 32  ? 1.50310 0.90760 1.20150 0.13890  -0.02190 0.08670  941  THR E O   
3688 C CB  . THR E 32  ? 1.07060 0.71670 0.94530 0.18540  -0.03050 0.08280  941  THR E CB  
3689 O OG1 . THR E 32  ? 1.01190 0.74270 0.91110 0.27320  -0.03000 0.08910  941  THR E OG1 
3690 C CG2 . THR E 32  ? 0.99860 0.81270 1.06850 0.13450  -0.04450 0.07160  941  THR E CG2 
3691 N N   . ALA E 33  ? 1.46530 0.71760 1.03050 0.06620  -0.00840 0.07900  942  ALA E N   
3692 C CA  . ALA E 33  ? 1.50060 0.65970 1.01700 -0.02700 -0.00520 0.06670  942  ALA E CA  
3693 C C   . ALA E 33  ? 1.60630 0.62760 0.98630 0.00460  0.00690  0.07400  942  ALA E C   
3694 O O   . ALA E 33  ? 1.56880 0.60440 0.98560 -0.04850 0.00140  0.06540  942  ALA E O   
3695 C CB  . ALA E 33  ? 1.54110 0.57650 0.95380 -0.09230 0.00690  0.05740  942  ALA E CB  
3696 N N   . SER E 34  ? 1.78790 0.68090 1.01400 0.08780  0.02370  0.08930  943  SER E N   
3697 C CA  . SER E 34  ? 1.90080 0.65480 0.98370 0.13700  0.03840  0.09910  943  SER E CA  
3698 C C   . SER E 34  ? 1.77630 0.67010 0.98790 0.17160  0.02210  0.10200  943  SER E C   
3699 O O   . SER E 34  ? 1.93190 0.78320 1.12200 0.13540  0.02300  0.09680  943  SER E O   
3700 C CB  . SER E 34  ? 2.11350 0.80300 1.07140 0.22300  0.05650  0.10770  943  SER E CB  
3701 O OG  . SER E 34  ? 2.19370 0.83670 1.07050 0.26770  0.06850  0.10760  943  SER E OG  
3702 N N   . ALA E 35  ? 1.66980 0.72620 1.00970 0.23650  0.00900  0.10860  944  ALA E N   
3703 C CA  . ALA E 35  ? 1.56800 0.76620 1.03380 0.27980  -0.00400 0.11130  944  ALA E CA  
3704 C C   . ALA E 35  ? 1.45870 0.75540 1.06020 0.19290  -0.01790 0.09860  944  ALA E C   
3705 O O   . ALA E 35  ? 1.59010 0.88360 1.19400 0.20010  -0.01960 0.10040  944  ALA E O   
3706 C CB  . ALA E 35  ? 1.36460 0.72670 0.95010 0.34820  -0.01280 0.11500  944  ALA E CB  
3707 N N   . LEU E 36  ? 1.26440 0.64090 0.96850 0.11460  -0.02670 0.08650  945  LEU E N   
3708 C CA  . LEU E 36  ? 1.15720 0.64230 1.00120 0.03220  -0.04020 0.07490  945  LEU E CA  
3709 C C   . LEU E 36  ? 1.28420 0.63350 1.01670 -0.02980 -0.03390 0.06840  945  LEU E C   
3710 O O   . LEU E 36  ? 1.20290 0.62190 1.01540 -0.05820 -0.04300 0.06540  945  LEU E O   
3711 C CB  . LEU E 36  ? 1.10730 0.69020 1.06410 -0.03230 -0.04830 0.06370  945  LEU E CB  
3712 C CG  . LEU E 36  ? 0.84230 0.58830 0.93880 0.01440  -0.05480 0.06590  945  LEU E CG  
3713 C CD1 . LEU E 36  ? 0.80350 0.60600 0.97220 -0.05090 -0.05900 0.05470  945  LEU E CD1 
3714 C CD2 . LEU E 36  ? 0.65590 0.57300 0.92080 0.03540  -0.06420 0.06670  945  LEU E CD2 
3715 N N   . GLY E 37  ? 1.43480 0.60070 0.99070 -0.05080 -0.01740 0.06550  946  GLY E N   
3716 C CA  . GLY E 37  ? 1.46790 0.47940 0.88650 -0.10440 -0.00520 0.05710  946  GLY E CA  
3717 C C   . GLY E 37  ? 1.60010 0.56300 0.95940 -0.05030 -0.00050 0.06640  946  GLY E C   
3718 O O   . GLY E 37  ? 1.66820 0.64050 1.04700 -0.10080 -0.00480 0.05810  946  GLY E O   
3719 N N   . LYS E 38  ? 1.66210 0.57880 0.95160 0.04920  0.00790  0.08260  947  LYS E N   
3720 C CA  . LYS E 38  ? 1.71300 0.57750 0.93740 0.11150  0.01370  0.09250  947  LYS E CA  
3721 C C   . LYS E 38  ? 1.53750 0.58330 0.94110 0.10960  -0.00680 0.09210  947  LYS E C   
3722 O O   . LYS E 38  ? 1.62640 0.63990 1.00530 0.08580  -0.00630 0.08900  947  LYS E O   
3723 C CB  . LYS E 38  ? 1.74630 0.58450 0.89710 0.21590  0.02500  0.10480  947  LYS E CB  
3724 C CG  . LYS E 38  ? 1.92730 0.62940 0.91080 0.21800  0.04940  0.09870  947  LYS E CG  
3725 C CD  . LYS E 38  ? 1.95980 0.66320 0.88250 0.31500  0.06070  0.10630  947  LYS E CD  
3726 C CE  . LYS E 38  ? 2.19980 0.76420 0.95260 0.32470  0.08680  0.10160  947  LYS E CE  
3727 N NZ  . LYS E 38  ? 2.34830 0.88270 1.01280 0.40210  0.10260  0.10410  947  LYS E NZ  
3728 N N   . LEU E 39  ? 1.40980 0.63650 0.98440 0.12970  -0.02210 0.09410  948  LEU E N   
3729 C CA  . LEU E 39  ? 1.13560 0.54430 0.89300 0.12700  -0.03860 0.09370  948  LEU E CA  
3730 C C   . LEU E 39  ? 1.13000 0.55970 0.93530 0.02980  -0.04610 0.08220  948  LEU E C   
3731 O O   . LEU E 39  ? 1.09780 0.56310 0.93870 0.03020  -0.05080 0.08420  948  LEU E O   
3732 C CB  . LEU E 39  ? 1.01620 0.59970 0.93760 0.14850  -0.04840 0.09370  948  LEU E CB  
3733 C CG  . LEU E 39  ? 0.96580 0.59340 0.89160 0.25330  -0.04490 0.10340  948  LEU E CG  
3734 C CD1 . LEU E 39  ? 0.84200 0.64340 0.92880 0.26180  -0.05220 0.09890  948  LEU E CD1 
3735 C CD2 . LEU E 39  ? 0.94180 0.60620 0.89060 0.30730  -0.04580 0.10960  948  LEU E CD2 
3736 N N   . GLN E 40  ? 1.26430 0.66880 1.06230 -0.04950 -0.04660 0.07020  949  GLN E N   
3737 C CA  . GLN E 40  ? 1.38130 0.80830 1.21890 -0.14560 -0.05370 0.05680  949  GLN E CA  
3738 C C   . GLN E 40  ? 1.45190 0.75040 1.15710 -0.15730 -0.04460 0.05430  949  GLN E C   
3739 O O   . GLN E 40  ? 1.33850 0.70710 1.11250 -0.18850 -0.05390 0.05160  949  GLN E O   
3740 C CB  . GLN E 40  ? 1.20490 0.58850 1.01360 -0.22680 -0.05150 0.04180  949  GLN E CB  
3741 C CG  . GLN E 40  ? 1.16080 0.61080 1.02050 -0.30060 -0.05270 0.02340  949  GLN E CG  
3742 C CD  . GLN E 40  ? 1.10250 0.63330 1.01570 -0.32660 -0.04480 0.00470  949  GLN E CD  
3743 O OE1 . GLN E 40  ? 1.26990 0.73570 1.11850 -0.32670 -0.03870 0.00380  949  GLN E OE1 
3744 N NE2 . GLN E 40  ? 0.99100 0.64980 1.01380 -0.33550 -0.04370 -0.00930 949  GLN E NE2 
3745 N N   . ASP E 41  ? 1.60300 0.71670 1.12070 -0.13490 -0.02520 0.05490  950  ASP E N   
3746 C CA  . ASP E 41  ? 1.65650 0.62080 1.02270 -0.15140 -0.01090 0.04960  950  ASP E CA  
3747 C C   . ASP E 41  ? 1.67500 0.69940 1.08830 -0.09130 -0.01740 0.06170  950  ASP E C   
3748 O O   . ASP E 41  ? 1.69860 0.75130 1.13760 -0.13540 -0.02310 0.05490  950  ASP E O   
3749 C CB  . ASP E 41  ? 1.79260 0.59320 0.97470 -0.12470 0.01470  0.04710  950  ASP E CB  
3750 C CG  . ASP E 41  ? 1.85400 0.64400 1.00530 -0.18660 0.02330  0.02950  950  ASP E CG  
3751 O OD1 . ASP E 41  ? 1.74190 0.64770 1.00530 -0.25430 0.01070  0.01650  950  ASP E OD1 
3752 O OD2 . ASP E 41  ? 2.00080 0.67890 1.01950 -0.16020 0.04340  0.02930  950  ASP E OD2 
3753 N N   . VAL E 42  ? 1.66960 0.72740 1.10430 0.00370  -0.01770 0.07790  951  VAL E N   
3754 C CA  . VAL E 42  ? 1.56230 0.66210 1.02440 0.07140  -0.02080 0.08920  951  VAL E CA  
3755 C C   . VAL E 42  ? 1.47610 0.76580 1.12980 0.04590  -0.04060 0.08880  951  VAL E C   
3756 O O   . VAL E 42  ? 1.46200 0.76100 1.11940 0.04850  -0.04290 0.09060  951  VAL E O   
3757 C CB  . VAL E 42  ? 1.39520 0.49620 0.83830 0.17760  -0.01600 0.10370  951  VAL E CB  
3758 C CG1 . VAL E 42  ? 1.31390 0.48990 0.81530 0.24330  -0.02130 0.11300  951  VAL E CG1 
3759 C CG2 . VAL E 42  ? 1.67550 0.58600 0.91920 0.20900  0.00640  0.10580  951  VAL E CG2 
3760 N N   . VAL E 43  ? 1.12540 0.55930 0.93070 0.02360  -0.05280 0.08700  952  VAL E N   
3761 C CA  . VAL E 43  ? 0.94460 0.55950 0.93520 0.00250  -0.06820 0.08820  952  VAL E CA  
3762 C C   . VAL E 43  ? 1.04280 0.63860 1.01800 -0.07560 -0.07250 0.07920  952  VAL E C   
3763 O O   . VAL E 43  ? 1.04340 0.70570 1.07850 -0.06660 -0.07840 0.08440  952  VAL E O   
3764 C CB  . VAL E 43  ? 0.79690 0.55400 0.94010 -0.01660 -0.07670 0.08580  952  VAL E CB  
3765 C CG1 . VAL E 43  ? 0.83360 0.74530 1.14230 -0.06480 -0.08890 0.08440  952  VAL E CG1 
3766 C CG2 . VAL E 43  ? 0.74100 0.56610 0.93870 0.06710  -0.07410 0.09400  952  VAL E CG2 
3767 N N   . ASN E 44  ? 1.23620 0.74050 1.12580 -0.14760 -0.06830 0.06540  953  ASN E N   
3768 C CA  . ASN E 44  ? 1.31350 0.80580 1.18610 -0.23340 -0.07190 0.05170  953  ASN E CA  
3769 C C   . ASN E 44  ? 1.41180 0.79110 1.15650 -0.22150 -0.06250 0.05110  953  ASN E C   
3770 O O   . ASN E 44  ? 1.43680 0.87540 1.22740 -0.25790 -0.07060 0.04760  953  ASN E O   
3771 C CB  . ASN E 44  ? 1.39800 0.82150 1.20850 -0.31200 -0.06730 0.03390  953  ASN E CB  
3772 C CG  . ASN E 44  ? 1.27950 0.87010 1.25040 -0.32170 -0.07200 0.02780  953  ASN E CG  
3773 O OD1 . ASN E 44  ? 1.05550 0.80530 1.17670 -0.30720 -0.07760 0.03000  953  ASN E OD1 
3774 N ND2 . ASN E 44  ? 1.36140 0.92130 1.29300 -0.33150 -0.06070 0.01610  953  ASN E ND2 
3775 N N   . GLN E 45  ? 1.50580 0.72980 1.09530 -0.17180 -0.04530 0.05450  954  GLN E N   
3776 C CA  . GLN E 45  ? 1.62430 0.73710 1.09050 -0.14840 -0.03390 0.05550  954  GLN E CA  
3777 C C   . GLN E 45  ? 1.52520 0.76660 1.11010 -0.09990 -0.04680 0.06900  954  GLN E C   
3778 O O   . GLN E 45  ? 1.53470 0.79180 1.12160 -0.13260 -0.05050 0.06460  954  GLN E O   
3779 C CB  . GLN E 45  ? 1.83130 0.77490 1.13180 -0.08330 -0.01280 0.06180  954  GLN E CB  
3780 C CG  . GLN E 45  ? 2.09110 0.86490 1.23130 -0.13340 0.00740  0.04750  954  GLN E CG  
3781 C CD  . GLN E 45  ? 2.22030 0.86870 1.21290 -0.06290 0.03070  0.05200  954  GLN E CD  
3782 O OE1 . GLN E 45  ? 2.27590 0.93000 1.27000 0.02460  0.03060  0.06850  954  GLN E OE1 
3783 N NE2 . GLN E 45  ? 2.20760 0.76160 1.07810 -0.09970 0.05140  0.03580  954  GLN E NE2 
3784 N N   . ASN E 46  ? 1.48330 0.81760 1.16490 -0.02750 -0.05260 0.08340  955  ASN E N   
3785 C CA  . ASN E 46  ? 1.31810 0.77240 1.11170 0.02750  -0.06130 0.09610  955  ASN E CA  
3786 C C   . ASN E 46  ? 1.14080 0.73550 1.07370 -0.03090 -0.07610 0.09380  955  ASN E C   
3787 O O   . ASN E 46  ? 1.12050 0.74710 1.07370 -0.01910 -0.07910 0.09880  955  ASN E O   
3788 C CB  . ASN E 46  ? 1.28850 0.83150 1.17170 0.10330  -0.06310 0.10680  955  ASN E CB  
3789 C CG  . ASN E 46  ? 1.46140 0.87920 1.20910 0.17830  -0.04920 0.11210  955  ASN E CG  
3790 O OD1 . ASN E 46  ? 1.63410 0.88560 1.21600 0.16680  -0.03600 0.10780  955  ASN E OD1 
3791 N ND2 . ASN E 46  ? 1.36720 0.86560 1.18350 0.25540  -0.05020 0.12070  955  ASN E ND2 
3792 N N   . ALA E 47  ? 1.10510 0.77730 1.12520 -0.09060 -0.08420 0.08690  956  ALA E N   
3793 C CA  . ALA E 47  ? 1.08360 0.89120 1.23580 -0.14810 -0.09760 0.08510  956  ALA E CA  
3794 C C   . ALA E 47  ? 1.27390 1.01870 1.34060 -0.20190 -0.09780 0.07560  956  ALA E C   
3795 O O   . ALA E 47  ? 1.26520 1.10710 1.41500 -0.21180 -0.10660 0.08080  956  ALA E O   
3796 C CB  . ALA E 47  ? 0.94820 0.82170 1.17920 -0.20380 -0.10380 0.07720  956  ALA E CB  
3797 N N   . GLN E 48  ? 1.36270 0.95100 1.26720 -0.23650 -0.08650 0.06130  957  GLN E N   
3798 C CA  . GLN E 48  ? 1.46620 0.98410 1.27390 -0.29500 -0.08310 0.04710  957  GLN E CA  
3799 C C   . GLN E 48  ? 1.45240 0.92560 1.20340 -0.24040 -0.07780 0.05640  957  GLN E C   
3800 O O   . GLN E 48  ? 1.45810 0.98630 1.23870 -0.26800 -0.08480 0.05460  957  GLN E O   
3801 C CB  . GLN E 48  ? 1.60520 0.96270 1.25280 -0.34880 -0.06750 0.02680  957  GLN E CB  
3802 C CG  . GLN E 48  ? 1.50890 0.93600 1.22210 -0.39860 -0.07070 0.01410  957  GLN E CG  
3803 C CD  . GLN E 48  ? 1.66360 0.96620 1.25330 -0.39710 -0.05170 0.00350  957  GLN E CD  
3804 O OE1 . GLN E 48  ? 1.89380 1.03050 1.32600 -0.37670 -0.03470 0.00310  957  GLN E OE1 
3805 N NE2 . GLN E 48  ? 1.51730 0.90340 1.17960 -0.40870 -0.05200 -0.00400 957  GLN E NE2 
3806 N N   . ALA E 49  ? 1.43020 0.81360 1.10550 -0.16450 -0.06620 0.06610  958  ALA E N   
3807 C CA  . ALA E 49  ? 1.43620 0.77670 1.05980 -0.10080 -0.06040 0.07610  958  ALA E CA  
3808 C C   . ALA E 49  ? 1.32380 0.82960 1.10390 -0.07860 -0.07560 0.08910  958  ALA E C   
3809 O O   . ALA E 49  ? 1.33170 0.82880 1.08350 -0.07810 -0.07560 0.08990  958  ALA E O   
3810 C CB  . ALA E 49  ? 1.33690 0.59740 0.89480 -0.01600 -0.04900 0.08630  958  ALA E CB  
3811 N N   . LEU E 50  ? 1.18960 0.83910 1.12720 -0.06200 -0.08620 0.09840  959  LEU E N   
3812 C CA  . LEU E 50  ? 1.00870 0.81940 1.10390 -0.04270 -0.09700 0.11120  959  LEU E CA  
3813 C C   . LEU E 50  ? 0.98250 0.86430 1.12740 -0.11580 -0.10740 0.10600  959  LEU E C   
3814 O O   . LEU E 50  ? 1.08590 1.03580 1.28390 -0.10020 -0.11180 0.11510  959  LEU E O   
3815 C CB  . LEU E 50  ? 0.77910 0.71250 1.01930 -0.01640 -0.10100 0.11890  959  LEU E CB  
3816 C CG  . LEU E 50  ? 0.64740 0.74030 1.04950 0.01000  -0.10650 0.13220  959  LEU E CG  
3817 C CD1 . LEU E 50  ? 0.61180 0.68310 0.97940 0.06560  -0.10210 0.14060  959  LEU E CD1 
3818 C CD2 . LEU E 50  ? 0.54560 0.73780 1.06900 0.04600  -0.10430 0.13700  959  LEU E CD2 
3819 N N   . ASN E 51  ? 0.99610 0.87080 1.12900 -0.19050 -0.11120 0.09190  960  ASN E N   
3820 C CA  . ASN E 51  ? 1.05280 1.00410 1.23250 -0.26380 -0.12180 0.08440  960  ASN E CA  
3821 C C   . ASN E 51  ? 1.18240 1.04640 1.23820 -0.28970 -0.11770 0.07420  960  ASN E C   
3822 O O   . ASN E 51  ? 1.04550 0.99860 1.15810 -0.31400 -0.12690 0.07650  960  ASN E O   
3823 C CB  . ASN E 51  ? 1.05620 1.01770 1.24690 -0.33650 -0.12560 0.06880  960  ASN E CB  
3824 C CG  . ASN E 51  ? 0.89380 0.97080 1.20990 -0.30020 -0.11860 0.06810  960  ASN E CG  
3825 O OD1 . ASN E 51  ? 0.68030 0.86000 1.08410 -0.24660 -0.11210 0.07400  960  ASN E OD1 
3826 N ND2 . ASN E 51  ? 1.00990 1.04990 1.29200 -0.31300 -0.10620 0.04960  960  ASN E ND2 
3827 N N   . THR E 52  ? 1.19800 0.89460 1.08880 -0.28540 -0.10290 0.06310  961  THR E N   
3828 C CA  . THR E 52  ? 1.35510 0.95180 1.11450 -0.30570 -0.09430 0.05190  961  THR E CA  
3829 C C   . THR E 52  ? 1.32590 0.96240 1.12100 -0.23740 -0.09640 0.07020  961  THR E C   
3830 O O   . THR E 52  ? 1.26740 0.94210 1.06370 -0.26120 -0.10120 0.06810  961  THR E O   
3831 C CB  . THR E 52  ? 1.51770 0.91800 1.09130 -0.31660 -0.07340 0.03600  961  THR E CB  
3832 O OG1 . THR E 52  ? 1.49740 0.83670 1.04580 -0.23540 -0.06510 0.05040  961  THR E OG1 
3833 C CG2 . THR E 52  ? 1.55570 0.91750 1.09010 -0.39350 -0.06980 0.01530  961  THR E CG2 
3834 N N   . LEU E 53  ? 1.24610 0.88190 1.07230 -0.15660 -0.09300 0.08650  962  LEU E N   
3835 C CA  . LEU E 53  ? 1.20450 0.88400 1.07360 -0.08580 -0.09390 0.10350  962  LEU E CA  
3836 C C   . LEU E 53  ? 0.97690 0.82060 0.99060 -0.10480 -0.10840 0.11300  962  LEU E C   
3837 O O   . LEU E 53  ? 1.05040 0.89980 1.04040 -0.10910 -0.10990 0.11410  962  LEU E O   
3838 C CB  . LEU E 53  ? 1.03870 0.73010 0.95200 -0.00410 -0.08970 0.11670  962  LEU E CB  
3839 C CG  . LEU E 53  ? 0.96440 0.71760 0.93900 0.06880  -0.08990 0.13230  962  LEU E CG  
3840 C CD1 . LEU E 53  ? 1.15200 0.79590 0.99810 0.08640  -0.08170 0.12960  962  LEU E CD1 
3841 C CD2 . LEU E 53  ? 0.92080 0.69460 0.93950 0.14400  -0.08490 0.14080  962  LEU E CD2 
3842 N N   . VAL E 54  ? 0.90000 0.86870 1.05260 -0.11810 -0.11740 0.11910  963  VAL E N   
3843 C CA  . VAL E 54  ? 0.74250 0.87360 1.04330 -0.12940 -0.12860 0.13140  963  VAL E CA  
3844 C C   . VAL E 54  ? 0.93520 1.06980 1.18950 -0.18930 -0.13500 0.12220  963  VAL E C   
3845 O O   . VAL E 54  ? 0.75020 0.94630 1.04390 -0.16920 -0.13830 0.13360  963  VAL E O   
3846 C CB  . VAL E 54  ? 0.59510 0.83770 1.02850 -0.15170 -0.13480 0.13450  963  VAL E CB  
3847 C CG1 . VAL E 54  ? 0.52170 0.88010 1.03430 -0.17160 -0.13420 0.13160  963  VAL E CG1 
3848 C CG2 . VAL E 54  ? 0.50510 0.78890 1.02070 -0.08500 -0.12840 0.14630  963  VAL E CG2 
3849 N N   . LYS E 55  ? 1.06410 1.13700 1.23580 -0.26050 -0.13550 0.10120  964  LYS E N   
3850 C CA  . LYS E 55  ? 1.11410 1.19860 1.23950 -0.32740 -0.14100 0.08690  964  LYS E CA  
3851 C C   . LYS E 55  ? 1.16080 1.16070 1.17850 -0.30470 -0.13340 0.08530  964  LYS E C   
3852 O O   . LYS E 55  ? 1.12000 1.19920 1.17630 -0.31070 -0.14080 0.09120  964  LYS E O   
3853 C CB  . LYS E 55  ? 1.16670 1.18380 1.20950 -0.40670 -0.13860 0.06030  964  LYS E CB  
3854 C CG  . LYS E 55  ? 1.08120 1.20290 1.23530 -0.42730 -0.14320 0.05690  964  LYS E CG  
3855 C CD  . LYS E 55  ? 1.19340 1.24780 1.26250 -0.46510 -0.12910 0.02700  964  LYS E CD  
3856 C CE  . LYS E 55  ? 1.02990 1.16600 1.19610 -0.42990 -0.11890 0.01760  964  LYS E CE  
3857 N NZ  . LYS E 55  ? 0.96120 1.09050 1.08120 -0.46200 -0.11320 -0.00260 964  LYS E NZ  
3858 N N   . GLN E 56  ? 1.16500 1.01200 1.05430 -0.27540 -0.11850 0.07900  965  GLN E N   
3859 C CA  . GLN E 56  ? 1.20670 0.95860 0.98290 -0.25260 -0.10870 0.07620  965  GLN E CA  
3860 C C   . GLN E 56  ? 1.25120 1.09700 1.12410 -0.18500 -0.11490 0.10030  965  GLN E C   
3861 O O   . GLN E 56  ? 1.35690 1.20370 1.19460 -0.18760 -0.11510 0.09990  965  GLN E O   
3862 C CB  . GLN E 56  ? 1.29180 0.86260 0.91820 -0.22700 -0.08960 0.06740  965  GLN E CB  
3863 C CG  . GLN E 56  ? 1.49060 0.94390 0.97910 -0.21800 -0.07600 0.05940  965  GLN E CG  
3864 C CD  . GLN E 56  ? 1.55520 0.99450 0.97490 -0.30230 -0.07450 0.03630  965  GLN E CD  
3865 O OE1 . GLN E 56  ? 1.57350 1.09320 1.03140 -0.31300 -0.08310 0.03870  965  GLN E OE1 
3866 N NE2 . GLN E 56  ? 1.60950 0.95060 0.92770 -0.36470 -0.06250 0.01230  965  GLN E NE2 
3867 N N   . LEU E 57  ? 1.10540 1.03110 1.09690 -0.12970 -0.11840 0.11910  966  LEU E N   
3868 C CA  . LEU E 57  ? 1.00340 1.02110 1.09410 -0.06480 -0.12090 0.14100  966  LEU E CA  
3869 C C   . LEU E 57  ? 0.91780 1.07350 1.10790 -0.09590 -0.13290 0.14940  966  LEU E C   
3870 O O   . LEU E 57  ? 0.85530 1.03780 1.05160 -0.06820 -0.13300 0.15910  966  LEU E O   
3871 C CB  . LEU E 57  ? 0.81680 0.89480 1.01470 -0.01040 -0.11920 0.15430  966  LEU E CB  
3872 C CG  . LEU E 57  ? 0.98060 0.94710 1.09820 0.04680  -0.10740 0.15200  966  LEU E CG  
3873 C CD1 . LEU E 57  ? 0.88200 0.93390 1.12080 0.09140  -0.10660 0.16230  966  LEU E CD1 
3874 C CD2 . LEU E 57  ? 0.97040 0.86970 1.01190 0.09960  -0.09980 0.15580  966  LEU E CD2 
3875 N N   . SER E 58  ? 0.94110 1.18350 1.20690 -0.14830 -0.14220 0.14650  967  SER E N   
3876 C CA  . SER E 58  ? 0.74390 1.12710 1.10930 -0.17710 -0.15370 0.15570  967  SER E CA  
3877 C C   . SER E 58  ? 0.91870 1.26720 1.18570 -0.21760 -0.15660 0.14320  967  SER E C   
3878 O O   . SER E 58  ? 0.85270 1.29300 1.17600 -0.20700 -0.16240 0.15660  967  SER E O   
3879 C CB  . SER E 58  ? 0.64220 1.11320 1.09530 -0.22460 -0.16190 0.15290  967  SER E CB  
3880 O OG  . SER E 58  ? 0.87930 1.25640 1.26400 -0.25250 -0.15790 0.13500  967  SER E OG  
3881 N N   . SER E 59  ? 0.90710 1.12390 1.02880 -0.25930 -0.15020 0.11840  968  SER E N   
3882 C CA  . SER E 59  ? 1.06980 1.22900 1.07450 -0.30230 -0.14810 0.10030  968  SER E CA  
3883 C C   . SER E 59  ? 1.05900 1.17670 1.02350 -0.24390 -0.14170 0.11170  968  SER E C   
3884 O O   . SER E 59  ? 1.00910 1.16810 0.95950 -0.26070 -0.14600 0.11070  968  SER E O   
3885 C CB  . SER E 59  ? 1.22840 1.24280 1.08520 -0.35680 -0.13670 0.07050  968  SER E CB  
3886 O OG  . SER E 59  ? 1.28140 1.22210 1.01510 -0.38930 -0.12920 0.05220  968  SER E OG  
3887 N N   . ASN E 60  ? 1.03480 1.07580 0.97880 -0.17820 -0.13170 0.12100  969  ASN E N   
3888 C CA  . ASN E 60  ? 1.07450 1.06390 0.97300 -0.11810 -0.12400 0.13020  969  ASN E CA  
3889 C C   . ASN E 60  ? 0.93250 1.06550 0.96580 -0.07780 -0.13260 0.15490  969  ASN E C   
3890 O O   . ASN E 60  ? 1.04560 1.18070 1.04840 -0.06660 -0.13220 0.15810  969  ASN E O   
3891 C CB  . ASN E 60  ? 1.18910 1.06850 1.03450 -0.05670 -0.11140 0.13260  969  ASN E CB  
3892 C CG  . ASN E 60  ? 1.43060 1.14060 1.11250 -0.08570 -0.09770 0.11010  969  ASN E CG  
3893 O OD1 . ASN E 60  ? 1.41140 1.08630 1.02500 -0.15900 -0.09660 0.09000  969  ASN E OD1 
3894 N ND2 . ASN E 60  ? 1.59640 1.20040 1.21210 -0.02770 -0.08520 0.11260  969  ASN E ND2 
3895 N N   . PHE E 61  ? 0.86290 1.10810 1.03720 -0.05720 -0.13800 0.17150  970  PHE E N   
3896 C CA  . PHE E 61  ? 0.81720 1.19610 1.12510 -0.01590 -0.14140 0.19630  970  PHE E CA  
3897 C C   . PHE E 61  ? 0.85540 1.33230 1.19640 -0.05980 -0.15230 0.19980  970  PHE E C   
3898 O O   . PHE E 61  ? 0.82980 1.36600 1.21080 -0.02740 -0.15230 0.21590  970  PHE E O   
3899 C CB  . PHE E 61  ? 0.68130 1.15300 1.12770 0.00660  -0.14090 0.21000  970  PHE E CB  
3900 C CG  . PHE E 61  ? 0.63900 1.06100 1.09260 0.06880  -0.12970 0.21290  970  PHE E CG  
3901 C CD1 . PHE E 61  ? 0.69870 1.07960 1.12100 0.12920  -0.12110 0.21870  970  PHE E CD1 
3902 C CD2 . PHE E 61  ? 0.55680 0.98090 1.05130 0.06710  -0.12790 0.20900  970  PHE E CD2 
3903 C CE1 . PHE E 61  ? 0.68840 1.03410 1.11870 0.18730  -0.11100 0.21950  970  PHE E CE1 
3904 C CE2 . PHE E 61  ? 0.56260 0.95060 1.06360 0.12490  -0.11770 0.21010  970  PHE E CE2 
3905 C CZ  . PHE E 61  ? 0.61880 0.95560 1.06800 0.17860  -0.10580 0.20460  970  PHE E CZ  
3906 N N   . GLY E 62  ? 0.91350 1.41570 1.24520 -0.12890 -0.16100 0.18570  971  GLY E N   
3907 C CA  . GLY E 62  ? 0.70230 1.28650 1.03850 -0.17870 -0.17190 0.18250  971  GLY E CA  
3908 C C   . GLY E 62  ? 0.80500 1.32780 1.03580 -0.17730 -0.16900 0.17510  971  GLY E C   
3909 O O   . GLY E 62  ? 0.80570 1.41350 1.08730 -0.15440 -0.17290 0.19220  971  GLY E O   
3910 N N   . ALA E 63  ? 0.98160 1.35660 1.06980 -0.19730 -0.16000 0.15150  972  ALA E N   
3911 C CA  . ALA E 63  ? 1.09260 1.38100 1.05650 -0.20380 -0.15340 0.13850  972  ALA E CA  
3912 C C   . ALA E 63  ? 1.10360 1.40970 1.10340 -0.12960 -0.15000 0.16150  972  ALA E C   
3913 O O   . ALA E 63  ? 1.17440 1.50900 1.14900 -0.13490 -0.15250 0.16250  972  ALA E O   
3914 C CB  . ALA E 63  ? 1.15830 1.27210 0.97360 -0.22310 -0.13900 0.11350  972  ALA E CB  
3915 N N   . ILE E 64  ? 1.06330 1.35790 1.12050 -0.06440 -0.14400 0.17770  973  ILE E N   
3916 C CA  . ILE E 64  ? 1.02190 1.33040 1.11610 0.00930  -0.13830 0.19750  973  ILE E CA  
3917 C C   . ILE E 64  ? 0.91160 1.37360 1.12370 0.01720  -0.14680 0.21970  973  ILE E C   
3918 O O   . ILE E 64  ? 0.91560 1.38700 1.10560 0.03640  -0.14580 0.22620  973  ILE E O   
3919 C CB  . ILE E 64  ? 1.03640 1.31640 1.17670 0.07140  -0.12960 0.20660  973  ILE E CB  
3920 C CG1 . ILE E 64  ? 1.08460 1.20450 1.09470 0.07730  -0.11940 0.18780  973  ILE E CG1 
3921 C CG2 . ILE E 64  ? 1.05530 1.38710 1.26640 0.14180  -0.12390 0.22720  973  ILE E CG2 
3922 C CD1 . ILE E 64  ? 0.97110 1.07470 1.02660 0.12360  -0.11340 0.19280  973  ILE E CD1 
3923 N N   . SER E 65  ? 1.01880 1.59320 1.34840 0.00420  -0.15340 0.23130  974  SER E N   
3924 C CA  . SER E 65  ? 0.87310 1.59830 1.32610 0.01620  -0.15870 0.25590  974  SER E CA  
3925 C C   . SER E 65  ? 0.90310 1.67010 1.30940 -0.02440 -0.16850 0.25150  974  SER E C   
3926 O O   . SER E 65  ? 0.79400 1.63370 1.24640 0.00640  -0.16820 0.27110  974  SER E O   
3927 C CB  . SER E 65  ? 0.81980 1.55540 1.32650 -0.00170 -0.14560 0.23850  974  SER E CB  
3928 O OG  . SER E 65  ? 0.78310 1.50540 1.30400 0.01870  -0.12280 0.22180  974  SER E OG  
3929 N N   . SER E 66  ? 0.92300 1.64690 1.23970 -0.09220 -0.17520 0.22530  975  SER E N   
3930 C CA  . SER E 66  ? 0.95880 1.71080 1.20990 -0.14050 -0.18330 0.21270  975  SER E CA  
3931 C C   . SER E 66  ? 1.00390 1.69140 1.17960 -0.10710 -0.17620 0.21380  975  SER E C   
3932 O O   . SER E 66  ? 0.92270 1.69760 1.13310 -0.09440 -0.18100 0.22880  975  SER E O   
3933 C CB  . SER E 66  ? 1.06830 1.75660 1.21970 -0.21820 -0.18590 0.17830  975  SER E CB  
3934 O OG  . SER E 66  ? 1.25940 1.78770 1.27080 -0.22370 -0.17360 0.15630  975  SER E OG  
3935 N N   . VAL E 67  ? 1.10280 1.64410 1.18120 -0.08970 -0.16440 0.20000  976  VAL E N   
3936 C CA  . VAL E 67  ? 1.14160 1.59740 1.12820 -0.06170 -0.15560 0.19620  976  VAL E CA  
3937 C C   . VAL E 67  ? 1.01950 1.54510 1.09950 0.01110  -0.15350 0.22660  976  VAL E C   
3938 O O   . VAL E 67  ? 1.01810 1.55020 1.06480 0.02330  -0.15280 0.23030  976  VAL E O   
3939 C CB  . VAL E 67  ? 1.13020 1.41400 0.99920 -0.05120 -0.14160 0.17720  976  VAL E CB  
3940 C CG1 . VAL E 67  ? 1.21060 1.41150 0.99370 -0.01690 -0.13180 0.17510  976  VAL E CG1 
3941 C CG2 . VAL E 67  ? 1.31370 1.51480 1.07850 -0.12450 -0.13910 0.14600  976  VAL E CG2 
3942 N N   . LEU E 68  ? 1.07480 1.64730 1.26390 0.05600  -0.15060 0.24600  977  LEU E N   
3943 C CA  . LEU E 68  ? 1.06410 1.70290 1.34800 0.12420  -0.14430 0.27340  977  LEU E CA  
3944 C C   . LEU E 68  ? 1.01690 1.79130 1.37310 0.11620  -0.15210 0.29290  977  LEU E C   
3945 O O   . LEU E 68  ? 1.00470 1.80030 1.36690 0.15320  -0.14780 0.30660  977  LEU E O   
3946 C CB  . LEU E 68  ? 0.96930 1.63430 1.35460 0.16230  -0.13720 0.28520  977  LEU E CB  
3947 C CG  . LEU E 68  ? 0.96690 1.51670 1.30100 0.20300  -0.12590 0.27470  977  LEU E CG  
3948 C CD1 . LEU E 68  ? 0.81770 1.35580 1.21850 0.21300  -0.10940 0.25680  977  LEU E CD1 
3949 C CD2 . LEU E 68  ? 0.94270 1.44940 1.23850 0.25570  -0.11680 0.27930  977  LEU E CD2 
3950 N N   . ASN E 69  ? 1.08310 1.94630 1.48990 0.07100  -0.16290 0.29400  978  ASN E N   
3951 C CA  . ASN E 69  ? 1.08930 2.00400 1.52090 0.05640  -0.15230 0.28960  978  ASN E CA  
3952 C C   . ASN E 69  ? 1.09270 2.08040 1.47470 0.03560  -0.17560 0.30060  978  ASN E C   
3953 O O   . ASN E 69  ? 1.08460 2.09030 1.47770 0.05590  -0.16140 0.30490  978  ASN E O   
3954 C CB  . ASN E 69  ? 1.11740 2.04870 1.57440 0.01580  -0.14910 0.27410  978  ASN E CB  
3955 C CG  . ASN E 69  ? 1.09560 1.94840 1.58730 0.03990  -0.12590 0.25770  978  ASN E CG  
3956 O OD1 . ASN E 69  ? 1.10450 1.90410 1.60540 0.07640  -0.10630 0.25080  978  ASN E OD1 
3957 N ND2 . ASN E 69  ? 1.06570 1.90910 1.56620 0.01210  -0.13000 0.24580  978  ASN E ND2 
3958 N N   . ASP E 70  ? 1.16370 2.06290 1.42560 -0.01410 -0.18040 0.27080  979  ASP E N   
3959 C CA  . ASP E 70  ? 1.19730 2.07390 1.35500 -0.04680 -0.18380 0.25400  979  ASP E CA  
3960 C C   . ASP E 70  ? 1.30010 2.12390 1.42860 0.00970  -0.17390 0.26490  979  ASP E C   
3961 O O   . ASP E 70  ? 1.24190 2.11680 1.35200 0.00820  -0.17760 0.27000  979  ASP E O   
3962 C CB  . ASP E 70  ? 1.33760 2.09970 1.36270 -0.11170 -0.18210 0.21480  979  ASP E CB  
3963 C CG  . ASP E 70  ? 1.42980 2.26580 1.44150 -0.18870 -0.19390 0.19530  979  ASP E CG  
3964 O OD1 . ASP E 70  ? 1.39060 2.33680 1.50380 -0.19500 -0.20340 0.20860  979  ASP E OD1 
3965 O OD2 . ASP E 70  ? 1.55270 2.33700 1.45180 -0.24260 -0.19220 0.16550  979  ASP E OD2 
3966 N N   . ILE E 71  ? 1.28280 2.01110 1.40490 0.05710  -0.16170 0.26710  980  ILE E N   
3967 C CA  . ILE E 71  ? 1.26370 1.92960 1.35330 0.11330  -0.15080 0.27410  980  ILE E CA  
3968 C C   . ILE E 71  ? 1.08920 1.87170 1.29380 0.16530  -0.14940 0.30780  980  ILE E C   
3969 O O   . ILE E 71  ? 1.03060 1.81100 1.20670 0.18970  -0.14600 0.31410  980  ILE E O   
3970 C CB  . ILE E 71  ? 1.26890 1.81060 1.32320 0.14950  -0.13860 0.26550  980  ILE E CB  
3971 C CG1 . ILE E 71  ? 1.28750 1.69050 1.19880 0.10510  -0.13530 0.23280  980  ILE E CG1 
3972 C CG2 . ILE E 71  ? 1.34130 1.85820 1.40790 0.21950  -0.12750 0.27910  980  ILE E CG2 
3973 C CD1 . ILE E 71  ? 1.33320 1.62530 1.21370 0.13350  -0.12510 0.22470  980  ILE E CD1 
3974 N N   . LEU E 72  ? 1.16430 2.03420 1.48740 0.17900  -0.14820 0.32590  981  LEU E N   
3975 C CA  . LEU E 72  ? 1.12250 1.97450 1.49500 0.19560  -0.11670 0.31630  981  LEU E CA  
3976 C C   . LEU E 72  ? 1.17460 2.10990 1.54740 0.17480  -0.12190 0.32560  981  LEU E C   
3977 O O   . LEU E 72  ? 1.15590 2.07940 1.53380 0.19770  -0.10530 0.32800  981  LEU E O   
3978 C CB  . LEU E 72  ? 0.96910 1.77830 1.38860 0.18440  -0.09890 0.29690  981  LEU E CB  
3979 C CG  . LEU E 72  ? 0.99220 1.71310 1.41300 0.20620  -0.08730 0.27950  981  LEU E CG  
3980 C CD1 . LEU E 72  ? 0.89250 1.58170 1.34600 0.18740  -0.07630 0.25720  981  LEU E CD1 
3981 C CD2 . LEU E 72  ? 0.90900 1.57270 1.31430 0.23890  -0.07180 0.27060  981  LEU E CD2 
3982 N N   . SER E 73  ? 1.20660 2.22120 1.56970 0.12810  -0.14390 0.32720  982  SER E N   
3983 C CA  . SER E 73  ? 1.21600 2.31800 1.56880 0.10150  -0.15130 0.33140  982  SER E CA  
3984 C C   . SER E 73  ? 1.32820 2.46280 1.61600 0.10610  -0.17070 0.33990  982  SER E C   
3985 O O   . SER E 73  ? 1.44140 2.62000 1.73020 0.11270  -0.16360 0.34620  982  SER E O   
3986 C CB  . SER E 73  ? 1.20870 2.37400 1.55700 0.04180  -0.16800 0.32010  982  SER E CB  
3987 O OG  . SER E 73  ? 1.14930 2.28160 1.54830 0.04380  -0.14850 0.31350  982  SER E OG  
3988 N N   . ARG E 74  ? 1.26370 2.30020 1.45890 0.09340  -0.17670 0.32180  983  ARG E N   
3989 C CA  . ARG E 74  ? 1.25730 2.21930 1.33920 0.08460  -0.17390 0.30460  983  ARG E CA  
3990 C C   . ARG E 74  ? 1.16640 2.11010 1.27330 0.15520  -0.16240 0.32620  983  ARG E C   
3991 O O   . ARG E 74  ? 1.21580 2.15050 1.26230 0.15560  -0.16210 0.32280  983  ARG E O   
3992 C CB  . ARG E 74  ? 1.38840 2.19620 1.35010 0.05080  -0.16770 0.26930  983  ARG E CB  
3993 C CG  . ARG E 74  ? 1.47130 2.27560 1.36010 -0.03210 -0.17570 0.23810  983  ARG E CG  
3994 C CD  . ARG E 74  ? 1.61460 2.25380 1.37890 -0.06250 -0.16460 0.20460  983  ARG E CD  
3995 N NE  . ARG E 74  ? 1.71750 2.34480 1.40930 -0.14500 -0.16810 0.17200  983  ARG E NE  
3996 C CZ  . ARG E 74  ? 1.83770 2.34120 1.39190 -0.19110 -0.15690 0.13740  983  ARG E CZ  
3997 N NH1 . ARG E 74  ? 1.86190 2.24080 1.33340 -0.16040 -0.14240 0.13190  983  ARG E NH1 
3998 N NH2 . ARG E 74  ? 1.90270 2.40720 1.40020 -0.26910 -0.15820 0.10700  983  ARG E NH2 
3999 N N   . LEU E 75  ? 1.23970 2.17250 1.42630 0.20940  -0.15200 0.34410  984  LEU E N   
4000 C CA  . LEU E 75  ? 1.24720 2.14760 1.46780 0.26860  -0.13060 0.35380  984  LEU E CA  
4001 C C   . LEU E 75  ? 1.29130 2.24250 1.56120 0.26310  -0.11250 0.35590  984  LEU E C   
4002 O O   . LEU E 75  ? 1.35110 2.29790 1.60220 0.28660  -0.10470 0.36130  984  LEU E O   
4003 C CB  . LEU E 75  ? 1.16540 1.97600 1.42910 0.28910  -0.10630 0.33760  984  LEU E CB  
4004 C CG  . LEU E 75  ? 1.14280 1.86180 1.35010 0.32320  -0.10840 0.33340  984  LEU E CG  
4005 C CD1 . LEU E 75  ? 1.11100 1.76120 1.36550 0.32760  -0.08720 0.31070  984  LEU E CD1 
4006 C CD2 . LEU E 75  ? 1.24770 1.92200 1.40470 0.35980  -0.10080 0.33420  984  LEU E CD2 
4007 N N   . ASP E 76  ? 1.35790 2.34360 1.67700 0.23540  -0.10570 0.35250  985  ASP E N   
4008 C CA  . ASP E 76  ? 1.36850 2.38200 1.71760 0.23340  -0.08860 0.35680  985  ASP E CA  
4009 C C   . ASP E 76  ? 1.36450 2.46740 1.68290 0.22630  -0.10200 0.37050  985  ASP E C   
4010 O O   . ASP E 76  ? 1.32090 2.42240 1.64090 0.24810  -0.08670 0.37810  985  ASP E O   
4011 C CB  . ASP E 76  ? 1.36980 2.39140 1.75590 0.20720  -0.08410 0.35040  985  ASP E CB  
4012 C CG  . ASP E 76  ? 1.36410 2.29250 1.77670 0.21500  -0.06760 0.33310  985  ASP E CG  
4013 O OD1 . ASP E 76  ? 1.34850 2.21200 1.75900 0.23850  -0.05240 0.32560  985  ASP E OD1 
4014 O OD2 . ASP E 76  ? 1.36270 2.28640 1.79400 0.19350  -0.07130 0.32410  985  ASP E OD2 
4015 N N   . LYS E 77  ? 1.73580 2.66590 1.28240 -0.26860 -0.25820 -0.32610 986  LYS E N   
4016 C CA  . LYS E 77  ? 1.72800 2.73380 1.28520 -0.30630 -0.27650 -0.31210 986  LYS E CA  
4017 C C   . LYS E 77  ? 1.76690 2.64370 1.31070 -0.34540 -0.27450 -0.34850 986  LYS E C   
4018 O O   . LYS E 77  ? 1.78540 2.70500 1.32150 -0.36490 -0.28540 -0.34200 986  LYS E O   
4019 C CB  . LYS E 77  ? 1.71930 2.82560 1.32980 -0.35160 -0.29290 -0.28860 986  LYS E CB  
4020 C CG  . LYS E 77  ? 1.69410 2.95390 1.32620 -0.31140 -0.29680 -0.24050 986  LYS E CG  
4021 C CD  . LYS E 77  ? 1.65320 3.00710 1.33770 -0.35830 -0.30950 -0.21710 986  LYS E CD  
4022 C CE  . LYS E 77  ? 1.57230 3.06000 1.28390 -0.31170 -0.30850 -0.16920 986  LYS E CE  
4023 N NZ  . LYS E 77  ? 1.58980 3.19910 1.34410 -0.35230 -0.31900 -0.13800 986  LYS E NZ  
4024 N N   . VAL E 78  ? 1.81380 2.54260 1.35870 -0.35280 -0.26020 -0.38030 987  VAL E N   
4025 C CA  . VAL E 78  ? 1.83730 2.42820 1.36770 -0.36790 -0.25320 -0.40770 987  VAL E CA  
4026 C C   . VAL E 78  ? 1.84080 2.36650 1.32420 -0.32020 -0.23640 -0.41890 987  VAL E C   
4027 O O   . VAL E 78  ? 1.87600 2.37340 1.33650 -0.32310 -0.23880 -0.42500 987  VAL E O   
4028 C CB  . VAL E 78  ? 1.83500 2.30660 1.39320 -0.38650 -0.24480 -0.42420 987  VAL E CB  
4029 C CG1 . VAL E 78  ? 1.84790 2.18070 1.39140 -0.37670 -0.23450 -0.44280 987  VAL E CG1 
4030 C CG2 . VAL E 78  ? 1.80700 2.32380 1.39920 -0.43480 -0.25950 -0.41450 987  VAL E CG2 
4031 N N   . GLU E 79  ? 1.83110 2.33200 1.29790 -0.27670 -0.21870 -0.42020 988  GLU E N   
4032 C CA  . GLU E 79  ? 1.81440 2.24150 1.22970 -0.22600 -0.19670 -0.42780 988  GLU E CA  
4033 C C   . GLU E 79  ? 1.81330 2.34120 1.18840 -0.19720 -0.20290 -0.40730 988  GLU E C   
4034 O O   . GLU E 79  ? 1.75480 2.23370 1.07960 -0.14760 -0.18270 -0.40660 988  GLU E O   
4035 C CB  . GLU E 79  ? 1.84130 2.23040 1.24620 -0.18350 -0.17400 -0.42850 988  GLU E CB  
4036 C CG  . GLU E 79  ? 1.91140 2.16140 1.34310 -0.19450 -0.15920 -0.44610 988  GLU E CG  
4037 C CD  . GLU E 79  ? 1.89620 2.09290 1.31430 -0.15100 -0.13280 -0.44620 988  GLU E CD  
4038 O OE1 . GLU E 79  ? 1.89070 2.17700 1.28940 -0.11480 -0.12890 -0.43330 988  GLU E OE1 
4039 O OE2 . GLU E 79  ? 1.84210 1.91230 1.26840 -0.14500 -0.11660 -0.45100 988  GLU E OE2 
4040 N N   . ASP E 87  ? 1.50220 2.19400 1.17940 0.15470  -0.06390 -0.14520 1163 ASP E N   
4041 C CA  . ASP E 87  ? 1.46390 2.20840 1.18130 0.18350  -0.05740 -0.11160 1163 ASP E CA  
4042 C C   . ASP E 87  ? 1.45110 2.06170 1.17530 0.18040  -0.03680 -0.13980 1163 ASP E C   
4043 O O   . ASP E 87  ? 1.38800 1.88300 1.06080 0.22090  -0.00830 -0.14770 1163 ASP E O   
4044 C CB  . ASP E 87  ? 1.39030 2.20320 1.07660 0.26680  -0.04120 -0.05600 1163 ASP E CB  
4045 C CG  . ASP E 87  ? 1.29390 2.13070 1.00620 0.31040  -0.02650 -0.02230 1163 ASP E CG  
4046 O OD1 . ASP E 87  ? 1.26780 2.17050 1.04430 0.27030  -0.04410 -0.02160 1163 ASP E OD1 
4047 O OD2 . ASP E 87  ? 1.26740 2.05410 0.93140 0.38370  0.00280  0.00320  1163 ASP E OD2 
4048 N N   . VAL E 88  ? 1.43680 2.06360 1.21960 0.13100  -0.05100 -0.15480 1164 VAL E N   
4049 C CA  . VAL E 88  ? 1.39420 1.90570 1.19390 0.11500  -0.03660 -0.18610 1164 VAL E CA  
4050 C C   . VAL E 88  ? 1.37370 1.95630 1.23160 0.11650  -0.04120 -0.16020 1164 VAL E C   
4051 O O   . VAL E 88  ? 1.54180 2.12350 1.44400 0.05880  -0.05710 -0.18450 1164 VAL E O   
4052 C CB  . VAL E 88  ? 1.49080 1.93420 1.29740 0.04230  -0.05140 -0.24100 1164 VAL E CB  
4053 C CG1 . VAL E 88  ? 1.55850 1.88040 1.37480 0.03130  -0.03430 -0.27390 1164 VAL E CG1 
4054 C CG2 . VAL E 88  ? 1.48900 1.89060 1.24310 0.03560  -0.05280 -0.26290 1164 VAL E CG2 
4055 N N   . ASP E 89  ? 1.37720 2.02330 1.23230 0.18030  -0.02850 -0.11140 1165 ASP E N   
4056 C CA  . ASP E 89  ? 1.35330 2.06060 1.26000 0.19200  -0.02840 -0.08360 1165 ASP E CA  
4057 C C   . ASP E 89  ? 1.26520 1.83890 1.17100 0.20410  -0.00300 -0.10520 1165 ASP E C   
4058 O O   . ASP E 89  ? 1.10650 1.59310 0.96120 0.25900  0.02640  -0.09900 1165 ASP E O   
4059 C CB  . ASP E 89  ? 1.32550 2.13840 1.22530 0.26240  -0.02030 -0.02380 1165 ASP E CB  
4060 C CG  . ASP E 89  ? 1.38310 2.31130 1.26130 0.27560  -0.03520 0.00320  1165 ASP E CG  
4061 O OD1 . ASP E 89  ? 1.41030 2.43880 1.32300 0.21780  -0.06630 -0.00180 1165 ASP E OD1 
4062 O OD2 . ASP E 89  ? 1.38070 2.29550 1.20380 0.34400  -0.01480 0.02960  1165 ASP E OD2 
4063 N N   . LEU E 90  ? 1.18460 1.74490 1.14180 0.15400  -0.01350 -0.12840 1166 LEU E N   
4064 C CA  . LEU E 90  ? 1.22590 1.65310 1.18570 0.14480  0.00530  -0.16280 1166 LEU E CA  
4065 C C   . LEU E 90  ? 1.27160 1.67560 1.23290 0.20480  0.03160  -0.13280 1166 LEU E C   
4066 O O   . LEU E 90  ? 1.30060 1.59610 1.21470 0.24200  0.05990  -0.14030 1166 LEU E O   
4067 C CB  . LEU E 90  ? 1.21070 1.64160 1.22270 0.07280  -0.01620 -0.19420 1166 LEU E CB  
4068 C CG  . LEU E 90  ? 1.21530 1.56350 1.20840 0.01820  -0.02460 -0.24680 1166 LEU E CG  
4069 C CD1 . LEU E 90  ? 1.17930 1.38500 1.13420 0.04050  0.00410  -0.27540 1166 LEU E CD1 
4070 C CD2 . LEU E 90  ? 1.32920 1.73050 1.29310 0.00150  -0.04250 -0.24750 1166 LEU E CD2 
4071 N N   . GLY E 91  ? 1.24700 1.74690 1.25940 0.20850  0.02200  -0.10220 1167 GLY E N   
4072 C CA  . GLY E 91  ? 1.18890 1.67330 1.21360 0.25650  0.04350  -0.07580 1167 GLY E CA  
4073 C C   . GLY E 91  ? 1.10260 1.67750 1.19950 0.22450  0.02430  -0.06400 1167 GLY E C   
4074 O O   . GLY E 91  ? 0.90530 1.48700 1.03750 0.15700  0.00260  -0.09450 1167 GLY E O   
4075 N N   . ASP E 92  ? 1.11610 1.73950 1.22870 0.27480  0.03620  -0.02280 1168 ASP E N   
4076 C CA  . ASP E 92  ? 1.08150 1.80850 1.25780 0.26050  0.02120  0.00100  1168 ASP E CA  
4077 C C   . ASP E 92  ? 1.03750 1.67450 1.24210 0.24990  0.03460  -0.01990 1168 ASP E C   
4078 O O   . ASP E 92  ? 1.00770 1.54480 1.18000 0.29460  0.06380  -0.02080 1168 ASP E O   
4079 C CB  . ASP E 92  ? 1.08100 1.89190 1.24620 0.33670  0.03400  0.05910  1168 ASP E CB  
4080 C CG  . ASP E 92  ? 1.17710 2.16540 1.38750 0.32410  0.00750  0.09570  1168 ASP E CG  
4081 O OD1 . ASP E 92  ? 1.14780 2.18480 1.40520 0.25150  -0.01950 0.07550  1168 ASP E OD1 
4082 O OD2 . ASP E 92  ? 1.25460 2.33290 1.44950 0.38720  0.01450  0.14530  1168 ASP E OD2 
4083 N N   . ILE E 93  ? 1.04050 1.70860 1.30100 0.19140  0.01480  -0.03620 1169 ILE E N   
4084 C CA  . ILE E 93  ? 0.93800 1.52630 1.22870 0.18580  0.02850  -0.05270 1169 ILE E CA  
4085 C C   . ILE E 93  ? 0.82510 1.52300 1.17830 0.17080  0.01270  -0.02570 1169 ILE E C   
4086 O O   . ILE E 93  ? 0.76490 1.41660 1.14640 0.17630  0.02470  -0.02900 1169 ILE E O   
4087 C CB  . ILE E 93  ? 0.84170 1.31260 1.12960 0.12970  0.02710  -0.11090 1169 ILE E CB  
4088 C CG1 . ILE E 93  ? 0.88300 1.39640 1.18200 0.05710  -0.00430 -0.13650 1169 ILE E CG1 
4089 C CG2 . ILE E 93  ? 0.68040 1.02560 0.90920 0.15920  0.05280  -0.13350 1169 ILE E CG2 
4090 C CD1 . ILE E 93  ? 0.78360 1.34990 1.13730 0.00270  -0.02540 -0.14080 1169 ILE E CD1 
4091 N N   . SER E 94  ? 0.69590 1.53740 1.06820 0.15410  -0.01240 0.00200  1170 SER E N   
4092 C CA  . SER E 94  ? 0.77440 1.74140 1.20420 0.13310  -0.03120 0.03020  1170 SER E CA  
4093 C C   . SER E 94  ? 0.77190 1.75740 1.21560 0.20230  -0.00920 0.07040  1170 SER E C   
4094 O O   . SER E 94  ? 0.58860 1.64830 1.08320 0.18740  -0.01920 0.08830  1170 SER E O   
4095 C CB  . SER E 94  ? 0.77090 1.89280 1.20690 0.11140  -0.05870 0.05650  1170 SER E CB  
4096 O OG  . SER E 94  ? 0.79320 1.96600 1.19160 0.17990  -0.04720 0.09340  1170 SER E OG  
4097 N N   . GLY E 95  ? 0.85680 1.77610 1.25220 0.27420  0.01960  0.08430  1171 GLY E N   
4098 C CA  . GLY E 95  ? 0.76100 1.63460 1.13900 0.33520  0.04540  0.11440  1171 GLY E CA  
4099 C C   . GLY E 95  ? 0.70040 1.46220 1.10210 0.31740  0.05820  0.08630  1171 GLY E C   
4100 O O   . GLY E 95  ? 0.71240 1.45060 1.11260 0.32360  0.06230  0.10560  1171 GLY E O   
4101 N N   . ILE E 96  ? 0.70830 1.38100 1.11530 0.28500  0.06230  0.03780  1172 ILE E N   
4102 C CA  . ILE E 96  ? 0.65750 1.22340 1.08710 0.26720  0.07560  0.00740  1172 ILE E CA  
4103 C C   . ILE E 96  ? 0.45630 1.10020 0.95420 0.22240  0.05420  0.01130  1172 ILE E C   
4104 O O   . ILE E 96  ? 0.49580 1.20000 1.01510 0.16080  0.02580  -0.00290 1172 ILE E O   
4105 C CB  . ILE E 96  ? 0.62930 1.06670 1.03180 0.22750  0.08000  -0.04820 1172 ILE E CB  
4106 C CG1 . ILE E 96  ? 0.61440 0.95070 0.94910 0.27470  0.10810  -0.05370 1172 ILE E CG1 
4107 C CG2 . ILE E 96  ? 0.45820 0.82300 0.89780 0.19340  0.08390  -0.07920 1172 ILE E CG2 
4108 C CD1 . ILE E 96  ? 0.70560 1.06040 0.99470 0.27310  0.09950  -0.05670 1172 ILE E CD1 
4109 N N   . ASN E 97  ? 0.45830 1.06330 0.96810 0.23730  0.06470  0.02480  1173 ASN E N   
4110 C CA  . ASN E 97  ? 0.50660 1.17310 1.07220 0.19900  0.04650  0.03090  1173 ASN E CA  
4111 C C   . ASN E 97  ? 0.58370 1.13670 1.15210 0.19650  0.06000  0.00740  1173 ASN E C   
4112 O O   . ASN E 97  ? 0.53360 0.99410 1.04080 0.22810  0.07340  0.00820  1173 ASN E O   
4113 C CB  . ASN E 97  ? 0.47300 1.23210 1.02410 0.21410  0.03390  0.07640  1173 ASN E CB  
4114 C CG  . ASN E 97  ? 0.60270 1.39430 1.19240 0.18260  0.02070  0.08180  1173 ASN E CG  
4115 O OD1 . ASN E 97  ? 0.65840 1.39410 1.23110 0.20460  0.03180  0.08980  1173 ASN E OD1 
4116 N ND2 . ASN E 97  ? 0.68290 1.55600 1.31410 0.12480  -0.00460 0.07390  1173 ASN E ND2 
4117 N N   . ALA E 98  ? 0.43830 1.01340 1.04470 0.15320  0.04920  -0.01430 1174 ALA E N   
4118 C CA  . ALA E 98  ? 0.44440 0.92500 1.01490 0.14490  0.05840  -0.01650 1174 ALA E CA  
4119 C C   . ALA E 98  ? 0.69210 1.24640 1.28230 0.14350  0.04340  -0.00840 1174 ALA E C   
4120 O O   . ALA E 98  ? 0.72070 1.35840 1.36980 0.10130  0.02390  -0.00840 1174 ALA E O   
4121 C CB  . ALA E 98  ? 0.48130 0.89110 1.08450 0.08470  0.05250  -0.05840 1174 ALA E CB  
4122 N N   . SER E 99  ? 0.74010 1.48070 1.03740 -0.11550 0.07000  0.09140  1175 SER E N   
4123 C CA  . SER E 99  ? 0.76140 1.53890 1.07550 -0.14250 0.07300  0.12060  1175 SER E CA  
4124 C C   . SER E 99  ? 0.76650 1.42060 1.00610 -0.18040 0.04340  0.08210  1175 SER E C   
4125 O O   . SER E 99  ? 0.85790 1.39530 1.04640 -0.16910 0.03030  0.03140  1175 SER E O   
4126 C CB  . SER E 99  ? 0.73150 1.55220 1.12360 -0.08760 0.12100  0.14320  1175 SER E CB  
4127 O OG  . SER E 99  ? 0.70540 1.46320 1.11630 -0.02650 0.14790  0.11150  1175 SER E OG  
4128 N N   . VAL E 100 ? 0.79090 1.47220 1.02420 -0.22410 0.03310  0.10630  1176 VAL E N   
4129 C CA  . VAL E 100 ? 0.91440 1.48530 1.08220 -0.26020 0.00950  0.07870  1176 VAL E CA  
4130 C C   . VAL E 100 ? 0.87410 1.44650 1.08120 -0.23160 0.04170  0.09210  1176 VAL E C   
4131 O O   . VAL E 100 ? 0.85020 1.52450 1.13510 -0.19650 0.07690  0.12810  1176 VAL E O   
4132 C CB  . VAL E 100 ? 0.92060 1.51470 1.04340 -0.33950 -0.03020 0.09430  1176 VAL E CB  
4133 C CG1 . VAL E 100 ? 0.95050 1.53300 1.02880 -0.36800 -0.06500 0.07370  1176 VAL E CG1 
4134 C CG2 . VAL E 100 ? 0.84620 1.58460 1.02670 -0.36270 -0.01770 0.15340  1176 VAL E CG2 
4135 N N   . VAL E 101 ? 0.84090 1.30540 0.99540 -0.24550 0.02950  0.06420  1177 VAL E N   
4136 C CA  . VAL E 101 ? 0.82610 1.27830 1.00790 -0.21810 0.05730  0.07050  1177 VAL E CA  
4137 C C   . VAL E 101 ? 0.88490 1.33940 1.03220 -0.27950 0.03720  0.09290  1177 VAL E C   
4138 O O   . VAL E 101 ? 0.87200 1.26220 0.94810 -0.33360 -0.00150 0.07700  1177 VAL E O   
4139 C CB  . VAL E 101 ? 0.80820 1.12920 0.96080 -0.17060 0.06560  0.01590  1177 VAL E CB  
4140 C CG1 . VAL E 101 ? 0.82070 1.00660 0.87550 -0.20830 0.02540  -0.02580 1177 VAL E CG1 
4141 C CG2 . VAL E 101 ? 0.68840 1.01780 0.88570 -0.12920 0.10070  0.02260  1177 VAL E CG2 
4142 N N   . ASN E 102 ? 0.74680 1.27180 0.94370 -0.27050 0.06330  0.12780  1178 ASN E N   
4143 C CA  . ASN E 102 ? 0.87930 1.40860 1.05010 -0.32240 0.05140  0.15120  1178 ASN E CA  
4144 C C   . ASN E 102 ? 0.96750 1.45260 1.14980 -0.28220 0.07770  0.14190  1178 ASN E C   
4145 O O   . ASN E 102 ? 0.89040 1.46470 1.14800 -0.24170 0.11360  0.16750  1178 ASN E O   
4146 C CB  . ASN E 102 ? 0.78000 1.45950 1.00020 -0.36030 0.05450  0.20840  1178 ASN E CB  
4147 C CG  . ASN E 102 ? 0.79720 1.47280 0.97620 -0.43010 0.03240  0.22830  1178 ASN E CG  
4148 O OD1 . ASN E 102 ? 0.80920 1.39050 0.94260 -0.43690 0.02820  0.21110  1178 ASN E OD1 
4149 N ND2 . ASN E 102 ? 0.81260 1.59040 1.00640 -0.48250 0.01810  0.26430  1178 ASN E ND2 
4150 N N   . ILE E 103 ? 0.79450 1.14700 0.90410 -0.29130 0.06000  0.10580  1179 ILE E N   
4151 C CA  . ILE E 103 ? 0.78670 1.08490 0.89390 -0.25620 0.08030  0.09270  1179 ILE E CA  
4152 C C   . ILE E 103 ? 0.86910 1.10620 0.90800 -0.31250 0.05640  0.09960  1179 ILE E C   
4153 O O   . ILE E 103 ? 0.89430 1.06270 0.91090 -0.28820 0.06600  0.08270  1179 ILE E O   
4154 C CB  . ILE E 103 ? 0.77110 0.95820 0.85860 -0.19630 0.08740  0.03540  1179 ILE E CB  
4155 C CG1 . ILE E 103 ? 0.84470 0.90260 0.84220 -0.22370 0.04810  -0.00780 1179 ILE E CG1 
4156 C CG2 . ILE E 103 ? 0.68720 0.94130 0.85090 -0.13910 0.11720  0.03320  1179 ILE E CG2 
4157 C CD1 . ILE E 103 ? 0.84820 0.78080 0.81000 -0.17300 0.05130  -0.06500 1179 ILE E CD1 
4158 N N   . GLN E 104 ? 1.05640 1.32090 1.06590 -0.38360 0.02770  0.12360  1180 GLN E N   
4159 C CA  . GLN E 104 ? 1.03080 1.23070 0.97040 -0.44640 0.00150  0.13050  1180 GLN E CA  
4160 C C   . GLN E 104 ? 1.03780 1.27790 1.00290 -0.43870 0.02700  0.16040  1180 GLN E C   
4161 O O   . GLN E 104 ? 1.06630 1.20810 0.97090 -0.45100 0.01790  0.14750  1180 GLN E O   
4162 C CB  . GLN E 104 ? 0.99180 1.24440 0.91610 -0.52250 -0.02800 0.15610  1180 GLN E CB  
4163 C CG  . GLN E 104 ? 1.11710 1.28080 0.96160 -0.58940 -0.05890 0.15470  1180 GLN E CG  
4164 C CD  . GLN E 104 ? 1.21760 1.21180 0.98010 -0.57620 -0.08040 0.10100  1180 GLN E CD  
4165 O OE1 . GLN E 104 ? 1.29890 1.24240 1.03630 -0.56940 -0.09990 0.06620  1180 GLN E OE1 
4166 N NE2 . GLN E 104 ? 1.25860 1.16610 0.97780 -0.57140 -0.07710 0.09400  1180 GLN E NE2 
4167 N N   . LYS E 105 ? 0.96170 1.33900 1.01230 -0.41520 0.05840  0.19740  1181 LYS E N   
4168 C CA  . LYS E 105 ? 0.90120 1.34060 0.98810 -0.40520 0.08550  0.22940  1181 LYS E CA  
4169 C C   . LYS E 105 ? 0.99120 1.33950 1.06250 -0.34470 0.10340  0.19430  1181 LYS E C   
4170 O O   . LYS E 105 ? 1.17490 1.50120 1.22250 -0.35550 0.10810  0.20590  1181 LYS E O   
4171 C CB  . LYS E 105 ? 0.92050 1.52370 1.10630 -0.38260 0.11540  0.26960  1181 LYS E CB  
4172 C CG  . LYS E 105 ? 1.00680 1.70270 1.20680 -0.43230 0.09680  0.30290  1181 LYS E CG  
4173 C CD  . LYS E 105 ? 0.99640 1.69690 1.16140 -0.48490 0.07880  0.32600  1181 LYS E CD  
4174 C CE  . LYS E 105 ? 0.91110 1.67270 1.11920 -0.44770 0.10140  0.34560  1181 LYS E CE  
4175 N NZ  . LYS E 105 ? 0.84650 1.64970 1.03900 -0.49430 0.08320  0.37140  1181 LYS E NZ  
4176 N N   . GLU E 106 ? 0.98900 1.28860 1.07310 -0.28400 0.11310  0.15290  1182 GLU E N   
4177 C CA  . GLU E 106 ? 0.94250 1.15320 1.01320 -0.22210 0.12920  0.11170  1182 GLU E CA  
4178 C C   . GLU E 106 ? 1.07980 1.13760 1.04720 -0.24740 0.09800  0.07810  1182 GLU E C   
4179 O O   . GLU E 106 ? 1.19300 1.19550 1.13340 -0.22750 0.10600  0.06750  1182 GLU E O   
4180 C CB  . GLU E 106 ? 0.85830 1.06070 0.97220 -0.15520 0.14720  0.07540  1182 GLU E CB  
4181 C CG  . GLU E 106 ? 0.82590 1.16270 1.04450 -0.11250 0.18570  0.10270  1182 GLU E CG  
4182 C CD  . GLU E 106 ? 0.81300 1.24980 1.07760 -0.13210 0.18390  0.13220  1182 GLU E CD  
4183 O OE1 . GLU E 106 ? 0.61930 1.14310 0.96540 -0.08620 0.21460  0.14360  1182 GLU E OE1 
4184 O OE2 . GLU E 106 ? 0.90880 1.33710 1.12830 -0.19210 0.15220  0.14360  1182 GLU E OE2 
4185 N N   . ILE E 107 ? 1.04830 1.04100 0.95990 -0.28800 0.06370  0.06150  1183 ILE E N   
4186 C CA  . ILE E 107 ? 1.15590 0.99900 0.96540 -0.31690 0.03040  0.02990  1183 ILE E CA  
4187 C C   . ILE E 107 ? 1.29590 1.13820 1.07210 -0.36540 0.02560  0.06570  1183 ILE E C   
4188 O O   . ILE E 107 ? 1.34310 1.09240 1.06860 -0.34920 0.02510  0.04710  1183 ILE E O   
4189 C CB  . ILE E 107 ? 1.37060 1.16650 1.13490 -0.36000 -0.00610 0.01280  1183 ILE E CB  
4190 C CG1 . ILE E 107 ? 1.33080 1.12960 1.12810 -0.30990 0.00080  -0.02160 1183 ILE E CG1 
4191 C CG2 . ILE E 107 ? 1.48560 1.13050 1.14610 -0.39310 -0.04060 -0.01630 1183 ILE E CG2 
4192 C CD1 . ILE E 107 ? 1.27940 1.06250 1.04740 -0.34930 -0.03110 -0.03270 1183 ILE E CD1 
4193 N N   . ASP E 108 ? 1.29090 1.23870 1.09730 -0.42060 0.02390  0.11560  1184 ASP E N   
4194 C CA  . ASP E 108 ? 1.29000 1.25570 1.07340 -0.47320 0.02170  0.15590  1184 ASP E CA  
4195 C C   . ASP E 108 ? 1.24760 1.22360 1.05310 -0.42200 0.05360  0.16020  1184 ASP E C   
4196 O O   . ASP E 108 ? 1.40420 1.29090 1.14640 -0.43280 0.04640  0.15540  1184 ASP E O   
4197 C CB  . ASP E 108 ? 1.26700 1.37090 1.09940 -0.53000 0.02120  0.20780  1184 ASP E CB  
4198 C CG  . ASP E 108 ? 1.31590 1.40300 1.11380 -0.59310 -0.01490 0.20540  1184 ASP E CG  
4199 O OD1 . ASP E 108 ? 1.40110 1.35500 1.12020 -0.61220 -0.04440 0.17080  1184 ASP E OD1 
4200 O OD2 . ASP E 108 ? 1.25460 1.46400 1.10470 -0.62250 -0.01380 0.23750  1184 ASP E OD2 
4201 N N   . ARG E 109 ? 1.29620 1.37270 1.18670 -0.36560 0.08750  0.16670  1185 ARG E N   
4202 C CA  . ARG E 109 ? 1.28820 1.39590 1.21240 -0.31480 0.12040  0.17230  1185 ARG E CA  
4203 C C   . ARG E 109 ? 1.30380 1.26930 1.16440 -0.27170 0.11630  0.12290  1185 ARG E C   
4204 O O   . ARG E 109 ? 1.32260 1.27260 1.16500 -0.26160 0.12770  0.13160  1185 ARG E O   
4205 C CB  . ARG E 109 ? 1.15440 1.38180 1.18140 -0.25650 0.15560  0.17840  1185 ARG E CB  
4206 C CG  . ARG E 109 ? 1.11840 1.38210 1.18570 -0.20080 0.18950  0.17960  1185 ARG E CG  
4207 C CD  . ARG E 109 ? 1.22780 1.64780 1.37310 -0.20740 0.21540  0.23180  1185 ARG E CD  
4208 N NE  . ARG E 109 ? 1.23960 1.77020 1.47150 -0.18400 0.23240  0.24370  1185 ARG E NE  
4209 C CZ  . ARG E 109 ? 1.13030 1.78270 1.44120 -0.15980 0.25700  0.27030  1185 ARG E CZ  
4210 N NH1 . ARG E 109 ? 1.07670 1.75030 1.38920 -0.15300 0.26420  0.28170  1185 ARG E NH1 
4211 N NH2 . ARG E 109 ? 1.05050 1.73390 1.40500 -0.13050 0.25300  0.25710  1185 ARG E NH2 
4212 N N   . LEU E 110 ? 1.35290 1.22300 1.18160 -0.24620 0.10100  0.07320  1186 LEU E N   
4213 C CA  . LEU E 110 ? 1.20620 0.93820 0.97290 -0.20230 0.09490  0.02050  1186 LEU E CA  
4214 C C   . LEU E 110 ? 1.29260 0.91860 0.96150 -0.25290 0.06720  0.02580  1186 LEU E C   
4215 O O   . LEU E 110 ? 1.43830 1.01050 1.07400 -0.22590 0.07560  0.01670  1186 LEU E O   
4216 C CB  . LEU E 110 ? 1.25110 0.91180 1.00470 -0.17360 0.08150  -0.03110 1186 LEU E CB  
4217 C CG  . LEU E 110 ? 1.25970 0.98490 1.09750 -0.10490 0.11200  -0.05230 1186 LEU E CG  
4218 C CD1 . LEU E 110 ? 1.21220 0.84090 1.01950 -0.07570 0.09710  -0.10950 1186 LEU E CD1 
4219 C CD2 . LEU E 110 ? 1.25040 1.00450 1.13010 -0.04300 0.14630  -0.05950 1186 LEU E CD2 
4220 N N   . ASN E 111 ? 1.45760 1.05380 1.08210 -0.32230 0.03560  0.03900  1187 ASN E N   
4221 C CA  . ASN E 111 ? 1.49630 0.99120 1.02850 -0.38020 0.00740  0.04780  1187 ASN E CA  
4222 C C   . ASN E 111 ? 1.42310 0.97540 0.96450 -0.39900 0.02630  0.09530  1187 ASN E C   
4223 O O   . ASN E 111 ? 1.48540 0.94310 0.95840 -0.40160 0.01990  0.09080  1187 ASN E O   
4224 C CB  . ASN E 111 ? 1.55610 1.04300 1.05960 -0.45710 -0.02550 0.06180  1187 ASN E CB  
4225 C CG  . ASN E 111 ? 1.59120 1.02880 1.08370 -0.44500 -0.04620 0.01810  1187 ASN E CG  
4226 O OD1 . ASN E 111 ? 1.45120 0.96040 0.97780 -0.47770 -0.05520 0.03190  1187 ASN E OD1 
4227 N ND2 . ASN E 111 ? 1.63750 0.95520 1.08150 -0.39800 -0.05430 -0.03500 1187 ASN E ND2 
4228 N N   . GLU E 112 ? 1.35600 1.05950 0.97890 -0.41070 0.04880  0.13940  1188 GLU E N   
4229 C CA  . GLU E 112 ? 1.38480 1.17280 1.03180 -0.43150 0.06940  0.18990  1188 GLU E CA  
4230 C C   . GLU E 112 ? 1.45730 1.21170 1.09780 -0.36590 0.09280  0.17260  1188 GLU E C   
4231 O O   . GLU E 112 ? 1.48550 1.19760 1.07530 -0.38700 0.09190  0.19180  1188 GLU E O   
4232 C CB  . GLU E 112 ? 1.30880 1.27000 1.05510 -0.43910 0.09060  0.22930  1188 GLU E CB  
4233 C CG  . GLU E 112 ? 1.32320 1.39010 1.10960 -0.44780 0.11670  0.27750  1188 GLU E CG  
4234 C CD  . GLU E 112 ? 1.47720 1.55780 1.22750 -0.53500 0.10070  0.32240  1188 GLU E CD  
4235 O OE1 . GLU E 112 ? 1.63030 1.58620 1.29410 -0.57450 0.07410  0.31150  1188 GLU E OE1 
4236 O OE2 . GLU E 112 ? 1.49540 1.71190 1.30590 -0.56330 0.11510  0.36740  1188 GLU E OE2 
4237 N N   . VAL E 113 ? 1.42670 1.19860 1.11610 -0.28980 0.11290  0.13710  1189 VAL E N   
4238 C CA  . VAL E 113 ? 1.30940 1.06370 1.00630 -0.21770 0.13780  0.11400  1189 VAL E CA  
4239 C C   . VAL E 113 ? 1.30130 0.88950 0.89800 -0.20460 0.11630  0.07300  1189 VAL E C   
4240 O O   . VAL E 113 ? 1.32680 0.88560 0.89740 -0.17480 0.12840  0.07060  1189 VAL E O   
4241 C CB  . VAL E 113 ? 1.19660 1.01470 0.97790 -0.14320 0.16440  0.08400  1189 VAL E CB  
4242 C CG1 . VAL E 113 ? 1.12860 0.91860 0.91370 -0.06920 0.18690  0.05210  1189 VAL E CG1 
4243 C CG2 . VAL E 113 ? 1.03470 1.01740 0.91530 -0.15090 0.18750  0.12630  1189 VAL E CG2 
4244 N N   . ALA E 114 ? 1.55350 1.03900 1.09590 -0.22320 0.08560  0.04070  1190 ALA E N   
4245 C CA  . ALA E 114 ? 1.66470 0.98660 1.11000 -0.20910 0.06220  -0.00270 1190 ALA E CA  
4246 C C   . ALA E 114 ? 1.76430 1.02520 1.13320 -0.25670 0.05030  0.02940  1190 ALA E C   
4247 O O   . ALA E 114 ? 1.85800 1.02250 1.16640 -0.22180 0.04870  0.00520  1190 ALA E O   
4248 C CB  . ALA E 114 ? 1.64610 0.88660 1.05430 -0.22920 0.03060  -0.03700 1190 ALA E CB  
4249 N N   . LYS E 115 ? 1.61120 0.92550 0.98210 -0.33290 0.04250  0.08130  1191 LYS E N   
4250 C CA  . LYS E 115 ? 1.68110 0.94560 0.98460 -0.38630 0.03340  0.11830  1191 LYS E CA  
4251 C C   . LYS E 115 ? 1.60900 0.97710 0.95760 -0.36810 0.06770  0.15780  1191 LYS E C   
4252 O O   . LYS E 115 ? 1.68530 0.98950 0.97550 -0.36350 0.07000  0.16590  1191 LYS E O   
4253 C CB  . LYS E 115 ? 1.81120 1.06870 1.08880 -0.47840 0.00630  0.14830  1191 LYS E CB  
4254 C CG  . LYS E 115 ? 1.75720 1.16910 1.10890 -0.53010 0.01880  0.20240  1191 LYS E CG  
4255 C CD  . LYS E 115 ? 1.78480 1.16730 1.09590 -0.62260 -0.01090 0.22650  1191 LYS E CD  
4256 C CE  . LYS E 115 ? 1.70700 1.23770 1.08290 -0.68100 -0.00090 0.28110  1191 LYS E CE  
4257 N NZ  . LYS E 115 ? 1.65080 1.29770 1.08490 -0.65450 0.03570  0.31690  1191 LYS E NZ  
4258 N N   . ASN E 116 ? 1.61060 1.13090 1.05830 -0.35270 0.09410  0.17930  1192 ASN E N   
4259 C CA  . ASN E 116 ? 1.54140 1.17480 1.04090 -0.33410 0.12770  0.21660  1192 ASN E CA  
4260 C C   . ASN E 116 ? 1.58210 1.17290 1.06830 -0.25390 0.14610  0.18380  1192 ASN E C   
4261 O O   . ASN E 116 ? 1.66920 1.32260 1.17160 -0.24290 0.16900  0.21330  1192 ASN E O   
4262 C CB  . ASN E 116 ? 1.41550 1.21560 1.02740 -0.32190 0.15210  0.23760  1192 ASN E CB  
4263 C CG  . ASN E 116 ? 1.55390 1.44240 1.19190 -0.40180 0.14420  0.28810  1192 ASN E CG  
4264 O OD1 . ASN E 116 ? 1.68820 1.50690 1.26820 -0.46620 0.11500  0.29490  1192 ASN E OD1 
4265 N ND2 . ASN E 116 ? 1.49120 1.53500 1.21800 -0.39710 0.16980  0.32170  1192 ASN E ND2 
4266 N N   . LEU E 117 ? 1.57650 1.07400 1.03880 -0.19810 0.13790  0.12440  1193 LEU E N   
4267 C CA  . LEU E 117 ? 1.64340 1.10590 1.09920 -0.11610 0.15550  0.08600  1193 LEU E CA  
4268 C C   . LEU E 117 ? 1.72940 1.08170 1.08550 -0.12540 0.14420  0.09140  1193 LEU E C   
4269 O O   . LEU E 117 ? 1.67990 1.01190 1.02520 -0.06210 0.15960  0.06770  1193 LEU E O   
4270 C CB  . LEU E 117 ? 1.46940 0.86430 0.92860 -0.05890 0.14840  0.01960  1193 LEU E CB  
4271 C CG  . LEU E 117 ? 1.44680 0.95380 1.01430 -0.00800 0.17500  0.00260  1193 LEU E CG  
4272 C CD1 . LEU E 117 ? 1.52760 0.95560 1.08950 0.03990  0.16550  -0.06230 1193 LEU E CD1 
4273 C CD2 . LEU E 117 ? 1.32990 0.92680 0.95490 0.04850  0.21080  0.00800  1193 LEU E CD2 
4274 N N   . ASN E 118 ? 1.86730 1.14760 1.15270 -0.19950 0.11800  0.11890  1194 ASN E N   
4275 C CA  . ASN E 118 ? 1.99200 1.17510 1.18300 -0.22200 0.10840  0.13780  1194 ASN E CA  
4276 C C   . ASN E 118 ? 1.97110 1.26100 1.19760 -0.21400 0.14010  0.18280  1194 ASN E C   
4277 O O   . ASN E 118 ? 1.94030 1.17790 1.11710 -0.17740 0.14770  0.17760  1194 ASN E O   
4278 C CB  . ASN E 118 ? 2.12310 1.22580 1.24660 -0.31030 0.07670  0.16320  1194 ASN E CB  
4279 C CG  . ASN E 118 ? 2.16230 1.11650 1.21640 -0.30830 0.04270  0.11300  1194 ASN E CG  
4280 O OD1 . ASN E 118 ? 2.18800 1.04250 1.19130 -0.25110 0.03760  0.06860  1194 ASN E OD1 
4281 N ND2 . ASN E 118 ? 2.13210 1.07120 1.18150 -0.37050 0.01830  0.11860  1194 ASN E ND2 
4282 N N   . GLU E 119 ? 1.89910 1.33870 1.21180 -0.24070 0.15870  0.22260  1195 GLU E N   
4283 C CA  . GLU E 119 ? 1.90510 1.46450 1.26010 -0.24190 0.18860  0.27050  1195 GLU E CA  
4284 C C   . GLU E 119 ? 1.78130 1.41540 1.20090 -0.15140 0.21920  0.24220  1195 GLU E C   
4285 O O   . GLU E 119 ? 1.73540 1.48770 1.20590 -0.14510 0.24610  0.27770  1195 GLU E O   
4286 C CB  . GLU E 119 ? 1.90720 1.59810 1.32910 -0.30770 0.19420  0.32190  1195 GLU E CB  
4287 C CG  . GLU E 119 ? 2.02880 1.67240 1.38970 -0.40220 0.17270  0.36490  1195 GLU E CG  
4288 C CD  . GLU E 119 ? 2.04060 1.63570 1.38690 -0.45850 0.14160  0.35540  1195 GLU E CD  
4289 O OE1 . GLU E 119 ? 1.97410 1.57130 1.35680 -0.42490 0.13560  0.31550  1195 GLU E OE1 
4290 O OE2 . GLU E 119 ? 2.09550 1.65150 1.39440 -0.53680 0.12380  0.38780  1195 GLU E OE2 
4291 N N   . SER E 120 ? 1.74720 1.31910 1.16740 -0.08540 0.21570  0.18030  1196 SER E N   
4292 C CA  . SER E 120 ? 1.58430 1.20550 1.05830 0.00550  0.24250  0.14250  1196 SER E CA  
4293 C C   . SER E 120 ? 1.61580 1.11470 1.00710 0.05560  0.23620  0.10440  1196 SER E C   
4294 O O   . SER E 120 ? 1.54950 1.07490 0.97520 0.13280  0.25590  0.06680  1196 SER E O   
4295 C CB  . SER E 120 ? 1.45570 1.11270 1.00410 0.04520  0.24720  0.10020  1196 SER E CB  
4296 O OG  . SER E 120 ? 1.40310 1.21700 1.05500 0.03980  0.27100  0.13140  1196 SER E OG  
4297 N N   . LEU E 121 ? 1.41090 1.37220 0.81640 -0.12940 0.11930  0.27820  1197 LEU E N   
4298 C CA  . LEU E 121 ? 1.51070 1.31750 0.83110 -0.05870 0.12410  0.28080  1197 LEU E CA  
4299 C C   . LEU E 121 ? 1.58480 1.44560 0.93750 -0.08450 0.12330  0.30250  1197 LEU E C   
4300 O O   . LEU E 121 ? 1.50060 1.48830 0.91830 -0.16570 0.11930  0.31380  1197 LEU E O   
4301 C CB  . LEU E 121 ? 1.80650 1.35620 0.91690 -0.08290 0.12710  0.27250  1197 LEU E CB  
4302 C CG  . LEU E 121 ? 1.80990 1.28570 0.87650 -0.04850 0.13090  0.24940  1197 LEU E CG  
4303 C CD1 . LEU E 121 ? 2.07420 1.28920 0.92250 -0.09300 0.14130  0.24040  1197 LEU E CD1 
4304 C CD2 . LEU E 121 ? 1.71990 1.21900 0.86010 0.08630  0.13680  0.24380  1197 LEU E CD2 
4305 N N   . ILE E 122 ? 1.69090 1.47070 1.00490 -0.01500 0.12800  0.31050  1198 ILE E N   
4306 C CA  . ILE E 122 ? 1.51060 1.35390 0.86650 -0.02410 0.12820  0.33040  1198 ILE E CA  
4307 C C   . ILE E 122 ? 1.96620 1.59920 1.14280 -0.04870 0.12870  0.34540  1198 ILE E C   
4308 O O   . ILE E 122 ? 1.98530 1.43960 1.03870 0.00600  0.13620  0.34280  1198 ILE E O   
4309 C CB  . ILE E 122 ? 1.38080 1.34550 0.86240 0.07880  0.13610  0.32870  1198 ILE E CB  
4310 C CG1 . ILE E 122 ? 1.20380 1.36250 0.85610 0.10200  0.14320  0.31280  1198 ILE E CG1 
4311 C CG2 . ILE E 122 ? 1.39280 1.42090 0.91000 0.06650  0.13750  0.34720  1198 ILE E CG2 
4312 C CD1 . ILE E 122 ? 1.06310 1.35500 0.84430 0.18760  0.15620  0.30630  1198 ILE E CD1 
4313 N N   . ASP E 123 ? 2.03670 1.69120 1.20120 -0.12500 0.12460  0.36220  1199 ASP E N   
4314 C CA  . ASP E 123 ? 2.21580 1.69400 1.22800 -0.14900 0.12820  0.38080  1199 ASP E CA  
4315 C C   . ASP E 123 ? 2.15490 1.75190 1.25170 -0.14620 0.12570  0.40060  1199 ASP E C   
4316 O O   . ASP E 123 ? 2.08830 1.83080 1.27830 -0.21980 0.11950  0.40380  1199 ASP E O   
4317 C CB  . ASP E 123 ? 2.35280 1.71140 1.23430 -0.26970 0.12670  0.37880  1199 ASP E CB  
4318 C CG  . ASP E 123 ? 2.60780 1.71810 1.29040 -0.28250 0.14030  0.39120  1199 ASP E CG  
4319 O OD1 . ASP E 123 ? 2.66890 1.63920 1.27150 -0.19100 0.15470  0.39540  1199 ASP E OD1 
4320 O OD2 . ASP E 123 ? 2.74960 1.80880 1.35780 -0.38240 0.13940  0.39840  1199 ASP E OD2 
4321 N N   . LEU E 124 ? 2.27460 1.81470 1.33660 -0.06600 0.13200  0.41570  1200 LEU E N   
4322 C CA  . LEU E 124 ? 2.06360 1.72490 1.20800 -0.05270 0.13080  0.43290  1200 LEU E CA  
4323 C C   . LEU E 124 ? 2.12930 1.66730 1.15050 -0.11730 0.13060  0.45640  1200 LEU E C   
4324 O O   . LEU E 124 ? 2.18790 1.51390 1.04010 -0.14210 0.13740  0.46140  1200 LEU E O   
4325 C CB  . LEU E 124 ? 1.92230 1.61440 1.10120 0.06870  0.13740  0.43790  1200 LEU E CB  
4326 C CG  . LEU E 124 ? 1.64340 1.49350 0.96870 0.13540  0.13990  0.41440  1200 LEU E CG  
4327 C CD1 . LEU E 124 ? 1.48630 1.54080 0.97500 0.07680  0.13990  0.39970  1200 LEU E CD1 
4328 C CD2 . LEU E 124 ? 1.80000 1.53860 1.06320 0.17340  0.14170  0.39890  1200 LEU E CD2 
4329 N N   . GLN E 125 ? 2.11160 1.78080 1.21730 -0.14790 0.12650  0.46850  1201 GLN E N   
4330 C CA  . GLN E 125 ? 2.17150 1.76580 1.19340 -0.18070 0.12700  0.49500  1201 GLN E CA  
4331 C C   . GLN E 125 ? 2.18930 1.82860 1.24100 -0.08080 0.13230  0.51100  1201 GLN E C   
4332 O O   . GLN E 125 ? 1.97600 1.76540 1.15530 -0.01580 0.13340  0.49680  1201 GLN E O   
4333 C CB  . GLN E 125 ? 1.99440 1.72520 1.10230 -0.28110 0.11920  0.49730  1201 GLN E CB  
4334 C CG  . GLN E 125 ? 2.07390 1.76100 1.14240 -0.30790 0.11800  0.50970  1201 GLN E CG  
4335 C CD  . GLN E 125 ? 1.95630 1.81470 1.16970 -0.36800 0.11040  0.49260  1201 GLN E CD  
4336 O OE1 . GLN E 125 ? 1.85640 1.79500 1.14760 -0.42120 0.10300  0.46880  1201 GLN E OE1 
4337 N NE2 . GLN E 125 ? 1.82340 1.73850 1.07420 -0.35410 0.11160  0.50280  1201 GLN E NE2 
4338 N N   . GLU E 126 ? 2.39590 1.91480 1.33260 -0.07030 0.13740  0.54010  1202 GLU E N   
4339 C CA  . GLU E 126 ? 2.34030 1.89920 1.28660 0.02320  0.14270  0.56300  1202 GLU E CA  
4340 C C   . GLU E 126 ? 2.33220 1.80620 1.18930 -0.00840 0.14360  0.59210  1202 GLU E C   
4341 O O   . GLU E 126 ? 2.32050 1.83180 1.18820 0.05330  0.14340  0.60880  1202 GLU E O   
4342 C CB  . GLU E 126 ? 2.48590 1.94810 1.37530 0.12980  0.15090  0.56290  1202 GLU E CB  
4343 C CG  . GLU E 126 ? 2.63580 1.88400 1.39430 0.10920  0.15820  0.55250  1202 GLU E CG  
4344 C CD  . GLU E 126 ? 2.62890 1.80150 1.35890 0.20980  0.16730  0.54320  1202 GLU E CD  
4345 O OE1 . GLU E 126 ? 2.79390 1.77370 1.40200 0.20760  0.18100  0.53820  1202 GLU E OE1 
4346 O OE2 . GLU E 126 ? 2.47550 1.78770 1.31020 0.28700  0.16350  0.53680  1202 GLU E OE2 
4347 N N   . GLN F 4   ? 1.90020 1.49270 1.16190 0.10480  0.15440  0.03500  913  GLN F N   
4348 C CA  . GLN F 4   ? 1.91880 1.50930 1.19350 0.13940  0.15340  0.00870  913  GLN F CA  
4349 C C   . GLN F 4   ? 1.93560 1.58980 1.27550 0.13830  0.16730  0.01450  913  GLN F C   
4350 O O   . GLN F 4   ? 1.83260 1.47970 1.20080 0.14750  0.15380  -0.00790 913  GLN F O   
4351 C CB  . GLN F 4   ? 1.92780 1.50560 1.15610 0.17070  0.17140  0.00690  913  GLN F CB  
4352 C CG  . GLN F 4   ? 1.94600 1.47000 1.14510 0.20160  0.15340  -0.02830 913  GLN F CG  
4353 C CD  . GLN F 4   ? 1.94010 1.45720 1.09870 0.23440  0.17220  -0.03030 913  GLN F CD  
4354 O OE1 . GLN F 4   ? 1.98790 1.50250 1.10580 0.23360  0.18720  -0.01060 913  GLN F OE1 
4355 N NE2 . GLN F 4   ? 1.83380 1.34630 1.00210 0.26310  0.17180  -0.05480 913  GLN F NE2 
4356 N N   . ASN F 5   ? 1.95430 1.66810 1.31390 0.12820  0.19380  0.04220  914  ASN F N   
4357 C CA  . ASN F 5   ? 1.90280 1.68440 1.32350 0.12390  0.20740  0.05220  914  ASN F CA  
4358 C C   . ASN F 5   ? 1.86060 1.64710 1.32400 0.09500  0.18650  0.05110  914  ASN F C   
4359 O O   . ASN F 5   ? 1.87920 1.70900 1.39300 0.09500  0.19050  0.05210  914  ASN F O   
4360 C CB  . ASN F 5   ? 1.92810 1.77410 1.35720 0.11460  0.23790  0.08090  914  ASN F CB  
4361 C CG  . ASN F 5   ? 2.03060 1.89340 1.43520 0.14750  0.26190  0.08140  914  ASN F CG  
4362 O OD1 . ASN F 5   ? 2.03140 1.88730 1.44040 0.17900  0.26180  0.06390  914  ASN F OD1 
4363 N ND2 . ASN F 5   ? 2.10500 1.99030 1.48310 0.13950  0.28330  0.10120  914  ASN F ND2 
4364 N N   . VAL F 6   ? 1.78680 1.53010 1.22790 0.07260  0.16490  0.04950  915  VAL F N   
4365 C CA  . VAL F 6   ? 1.77770 1.51630 1.25210 0.04540  0.14020  0.04560  915  VAL F CA  
4366 C C   . VAL F 6   ? 1.81870 1.54810 1.32380 0.06080  0.12480  0.01870  915  VAL F C   
4367 O O   . VAL F 6   ? 1.79490 1.55720 1.35050 0.04580  0.11940  0.02130  915  VAL F O   
4368 C CB  . VAL F 6   ? 1.89540 1.57390 1.32540 0.02830  0.11650  0.04220  915  VAL F CB  
4369 C CG1 . VAL F 6   ? 1.85950 1.52950 1.32090 0.00430  0.08810  0.03410  915  VAL F CG1 
4370 C CG2 . VAL F 6   ? 1.97850 1.66080 1.37400 0.00910  0.13340  0.07020  915  VAL F CG2 
4371 N N   . LEU F 7   ? 1.93620 1.62310 1.41130 0.08880  0.11890  -0.00650 916  LEU F N   
4372 C CA  . LEU F 7   ? 1.78820 1.45890 1.28490 0.10250  0.10560  -0.03560 916  LEU F CA  
4373 C C   . LEU F 7   ? 1.66560 1.38730 1.20650 0.11110  0.12540  -0.02720 916  LEU F C   
4374 O O   . LEU F 7   ? 1.48310 1.21600 1.06390 0.10010  0.11480  -0.03430 916  LEU F O   
4375 C CB  . LEU F 7   ? 1.75890 1.37870 1.21080 0.13150  0.10050  -0.06300 916  LEU F CB  
4376 C CG  . LEU F 7   ? 1.70480 1.26690 1.12040 0.12750  0.07110  -0.08580 916  LEU F CG  
4377 C CD1 . LEU F 7   ? 1.69160 1.21110 1.06530 0.15890  0.06870  -0.11360 916  LEU F CD1 
4378 C CD2 . LEU F 7   ? 1.62920 1.18350 1.07770 0.10860  0.04400  -0.10510 916  LEU F CD2 
4379 N N   . TYR F 8   ? 1.69270 1.44360 1.22470 0.13110  0.15240  -0.01320 917  TYR F N   
4380 C CA  . TYR F 8   ? 1.66490 1.46510 1.23210 0.14470  0.17220  -0.00460 917  TYR F CA  
4381 C C   . TYR F 8   ? 1.61410 1.46660 1.23050 0.11770  0.17250  0.01520  917  TYR F C   
4382 O O   . TYR F 8   ? 1.59640 1.46500 1.24900 0.11930  0.16960  0.00980  917  TYR F O   
4383 C CB  . TYR F 8   ? 1.75200 1.58260 1.29970 0.16850  0.20050  0.00960  917  TYR F CB  
4384 C CG  . TYR F 8   ? 1.88140 1.67360 1.38980 0.20290  0.20560  -0.00930 917  TYR F CG  
4385 C CD1 . TYR F 8   ? 1.84040 1.62700 1.35730 0.22800  0.21050  -0.02420 917  TYR F CD1 
4386 C CD2 . TYR F 8   ? 2.02170 1.78260 1.48150 0.21120  0.20680  -0.01150 917  TYR F CD2 
4387 C CE1 . TYR F 8   ? 1.87830 1.62960 1.35880 0.25900  0.21560  -0.04200 917  TYR F CE1 
4388 C CE2 . TYR F 8   ? 2.03030 1.75860 1.45470 0.24370  0.21160  -0.02940 917  TYR F CE2 
4389 C CZ  . TYR F 8   ? 1.92070 1.64510 1.35690 0.26720  0.21600  -0.04500 917  TYR F CZ  
4390 O OH  . TYR F 8   ? 1.80680 1.49850 1.20850 0.29870  0.22070  -0.06340 917  TYR F OH  
4391 N N   . GLU F 9   ? 1.58890 1.46500 1.20400 0.09360  0.17630  0.03680  918  GLU F N   
4392 C CA  . GLU F 9   ? 1.55550 1.48740 1.21640 0.06580  0.17890  0.05740  918  GLU F CA  
4393 C C   . GLU F 9   ? 1.46570 1.37920 1.15680 0.04620  0.15180  0.04520  918  GLU F C   
4394 O O   . GLU F 9   ? 1.37420 1.33310 1.11250 0.03590  0.15330  0.05360  918  GLU F O   
4395 C CB  . GLU F 9   ? 1.52180 1.46900 1.16580 0.04050  0.18700  0.07960  918  GLU F CB  
4396 C CG  . GLU F 9   ? 1.49340 1.47580 1.11660 0.05470  0.21720  0.09470  918  GLU F CG  
4397 C CD  . GLU F 9   ? 1.50520 1.57160 1.17230 0.05720  0.24050  0.11010  918  GLU F CD  
4398 O OE1 . GLU F 9   ? 1.52070 1.60990 1.22710 0.06740  0.23650  0.10320  918  GLU F OE1 
4399 O OE2 . GLU F 9   ? 1.45860 1.56800 1.11900 0.04930  0.26280  0.12780  918  GLU F OE2 
4400 N N   . ASN F 10  ? 1.42650 1.27830 1.09100 0.04250  0.12770  0.02500  919  ASN F N   
4401 C CA  . ASN F 10  ? 1.38150 1.21240 1.07080 0.02660  0.10020  0.00820  919  ASN F CA  
4402 C C   . ASN F 10  ? 1.31380 1.14880 1.02850 0.04470  0.10220  -0.00800 919  ASN F C   
4403 O O   . ASN F 10  ? 1.27220 1.13050 1.02890 0.03110  0.09430  -0.00710 919  ASN F O   
4404 C CB  . ASN F 10  ? 1.53670 1.30300 1.18670 0.02240  0.07430  -0.01270 919  ASN F CB  
4405 C CG  . ASN F 10  ? 1.55410 1.31040 1.18300 -0.00210 0.06570  0.00330  919  ASN F CG  
4406 O OD1 . ASN F 10  ? 1.51260 1.31200 1.16490 -0.02280 0.07620  0.02870  919  ASN F OD1 
4407 N ND2 . ASN F 10  ? 1.56390 1.26220 1.14700 0.00010  0.04600  -0.01270 919  ASN F ND2 
4408 N N   . GLN F 11  ? 1.26410 1.07450 0.95150 0.07410  0.11270  -0.02210 920  GLN F N   
4409 C CA  . GLN F 11  ? 1.31650 1.11420 1.01580 0.09150  0.11380  -0.04140 920  GLN F CA  
4410 C C   . GLN F 11  ? 1.39820 1.25030 1.13620 0.09580  0.13080  -0.02310 920  GLN F C   
4411 O O   . GLN F 11  ? 1.43250 1.28670 1.20010 0.08860  0.12190  -0.03080 920  GLN F O   
4412 C CB  . GLN F 11  ? 1.25680 1.01670 0.91460 0.12180  0.12320  -0.05860 920  GLN F CB  
4413 C CG  . GLN F 11  ? 1.33970 1.04270 0.96280 0.12030  0.10280  -0.08480 920  GLN F CG  
4414 C CD  . GLN F 11  ? 1.44380 1.10590 1.04200 0.14500  0.10520  -0.11310 920  GLN F CD  
4415 O OE1 . GLN F 11  ? 1.35140 1.02070 0.94080 0.16930  0.12600  -0.10900 920  GLN F OE1 
4416 N NE2 . GLN F 11  ? 1.50760 1.12680 1.09370 0.13920  0.08340  -0.14410 920  GLN F NE2 
4417 N N   . LYS F 12  ? 1.29780 1.19390 1.03480 0.10750  0.15370  -0.00110 921  LYS F N   
4418 C CA  . LYS F 12  ? 1.23030 1.18740 1.00400 0.11350  0.16970  0.01650  921  LYS F CA  
4419 C C   . LYS F 12  ? 1.23550 1.21960 1.05390 0.08330  0.15500  0.02380  921  LYS F C   
4420 O O   . LYS F 12  ? 1.27120 1.27130 1.11810 0.08860  0.15470  0.02180  921  LYS F O   
4421 C CB  . LYS F 12  ? 1.19150 1.20110 0.96070 0.12140  0.19330  0.03890  921  LYS F CB  
4422 C CG  . LYS F 12  ? 1.21160 1.20710 0.94120 0.15500  0.21080  0.03430  921  LYS F CG  
4423 C CD  . LYS F 12  ? 1.25850 1.29320 0.97390 0.15390  0.22940  0.05340  921  LYS F CD  
4424 C CE  . LYS F 12  ? 1.28800 1.30380 0.96040 0.18640  0.24430  0.04720  921  LYS F CE  
4425 N NZ  . LYS F 12  ? 1.24890 1.32320 0.91770 0.19080  0.26830  0.06700  921  LYS F NZ  
4426 N N   . LEU F 13  ? 1.19040 1.17630 1.01140 0.05410  0.14290  0.03180  922  LEU F N   
4427 C CA  . LEU F 13  ? 1.05200 1.06460 0.91470 0.02350  0.12780  0.03970  922  LEU F CA  
4428 C C   . LEU F 13  ? 1.17010 1.14990 1.04780 0.02120  0.10770  0.01830  922  LEU F C   
4429 O O   . LEU F 13  ? 1.19570 1.20770 1.11050 0.02100  0.10910  0.02230  922  LEU F O   
4430 C CB  . LEU F 13  ? 1.05800 1.05750 0.90690 -0.00520 0.11540  0.04710  922  LEU F CB  
4431 C CG  . LEU F 13  ? 1.09200 1.11500 0.97990 -0.03770 0.09840  0.05500  922  LEU F CG  
4432 C CD1 . LEU F 13  ? 1.07730 1.17680 1.00780 -0.04390 0.11620  0.07700  922  LEU F CD1 
4433 C CD2 . LEU F 13  ? 1.11440 1.10580 0.97660 -0.06320 0.08260  0.05820  922  LEU F CD2 
4434 N N   . ILE F 14  ? 1.21370 1.13330 1.06190 0.02130  0.09100  -0.00490 923  ILE F N   
4435 C CA  . ILE F 14  ? 1.05250 0.93710 0.91030 0.01650  0.07140  -0.03010 923  ILE F CA  
4436 C C   . ILE F 14  ? 1.03200 0.92960 0.90740 0.03470  0.08500  -0.03200 923  ILE F C   
4437 O O   . ILE F 14  ? 1.05120 0.96390 0.96090 0.02230  0.07590  -0.03310 923  ILE F O   
4438 C CB  . ILE F 14  ? 1.21970 1.04200 1.03570 0.02360  0.05910  -0.05780 923  ILE F CB  
4439 C CG1 . ILE F 14  ? 1.24370 1.04670 1.04100 0.00530  0.03990  -0.05890 923  ILE F CG1 
4440 C CG2 . ILE F 14  ? 1.20870 0.99970 1.03260 0.02250  0.04590  -0.08640 923  ILE F CG2 
4441 C CD1 . ILE F 14  ? 1.24250 0.99130 0.99140 0.01910  0.03240  -0.08210 923  ILE F CD1 
4442 N N   . ALA F 15  ? 1.00890 0.89890 0.85890 0.06400  0.10550  -0.03240 924  ALA F N   
4443 C CA  . ALA F 15  ? 1.05760 0.94910 0.91120 0.08700  0.11980  -0.03490 924  ALA F CA  
4444 C C   . ALA F 15  ? 1.10560 1.05700 1.00080 0.08440  0.12660  -0.01350 924  ALA F C   
4445 O O   . ALA F 15  ? 1.17680 1.12320 1.08800 0.08640  0.12380  -0.01950 924  ALA F O   
4446 C CB  . ALA F 15  ? 1.00460 0.88390 0.82140 0.11930  0.14040  -0.03500 924  ALA F CB  
4447 N N   . ASN F 16  ? 1.06360 1.06990 0.97440 0.07970  0.13580  0.00940  925  ASN F N   
4448 C CA  . ASN F 16  ? 0.97210 1.04560 0.92410 0.07860  0.14380  0.02910  925  ASN F CA  
4449 C C   . ASN F 16  ? 0.87310 0.95570 0.86360 0.04910  0.12290  0.02810  925  ASN F C   
4450 O O   . ASN F 16  ? 0.85840 0.96220 0.87490 0.05500  0.12340  0.03000  925  ASN F O   
4451 C CB  . ASN F 16  ? 0.89560 1.02670 0.85400 0.07660  0.15930  0.05050  925  ASN F CB  
4452 C CG  . ASN F 16  ? 1.08600 1.22450 1.01410 0.11000  0.18250  0.05330  925  ASN F CG  
4453 O OD1 . ASN F 16  ? 1.11420 1.24380 1.03220 0.13980  0.19140  0.04680  925  ASN F OD1 
4454 N ND2 . ASN F 16  ? 1.16880 1.32120 1.07900 0.10570  0.19230  0.06270  925  ASN F ND2 
4455 N N   . GLN F 17  ? 0.98030 1.04460 0.97100 0.02070  0.10440  0.02420  926  GLN F N   
4456 C CA  . GLN F 17  ? 0.98520 1.05130 1.00850 -0.00820 0.08080  0.02000  926  GLN F CA  
4457 C C   . GLN F 17  ? 0.90180 0.92980 0.92580 -0.00290 0.07100  -0.00100 926  GLN F C   
4458 O O   . GLN F 17  ? 0.84950 0.90050 0.90900 -0.01330 0.06260  0.00120  926  GLN F O   
4459 C CB  . GLN F 17  ? 1.01960 1.05750 1.02950 -0.03380 0.06080  0.01450  926  GLN F CB  
4460 C CG  . GLN F 17  ? 1.08940 1.15720 1.09530 -0.04650 0.06830  0.03540  926  GLN F CG  
4461 C CD  . GLN F 17  ? 1.05890 1.19970 1.10540 -0.05290 0.08150  0.05850  926  GLN F CD  
4462 O OE1 . GLN F 17  ? 1.02060 1.19010 1.10750 -0.06410 0.07220  0.06070  926  GLN F OE1 
4463 N NE2 . GLN F 17  ? 1.06120 1.23560 1.09780 -0.04590 0.10360  0.07460  926  GLN F NE2 
4464 N N   . PHE F 18  ? 0.83150 0.80380 0.81760 0.01100  0.07230  -0.02130 927  PHE F N   
4465 C CA  . PHE F 18  ? 0.91980 0.84900 0.89910 0.01440  0.06610  -0.04430 927  PHE F CA  
4466 C C   . PHE F 18  ? 0.90720 0.85500 0.89700 0.03470  0.08220  -0.03540 927  PHE F C   
4467 O O   . PHE F 18  ? 0.92520 0.87120 0.93600 0.02530  0.07370  -0.04110 927  PHE F O   
4468 C CB  . PHE F 18  ? 0.87980 0.75010 0.81400 0.02680  0.06820  -0.06740 927  PHE F CB  
4469 C CG  . PHE F 18  ? 0.87390 0.69930 0.79830 0.02760  0.06470  -0.09260 927  PHE F CG  
4470 C CD1 . PHE F 18  ? 0.88430 0.69950 0.82900 0.00220  0.04360  -0.10930 927  PHE F CD1 
4471 C CD2 . PHE F 18  ? 0.92300 0.71530 0.81600 0.05260  0.08260  -0.10060 927  PHE F CD2 
4472 C CE1 . PHE F 18  ? 0.88010 0.65530 0.81510 -0.00060 0.04200  -0.13370 927  PHE F CE1 
4473 C CE2 . PHE F 18  ? 0.97900 0.72620 0.85980 0.04950  0.08080  -0.12440 927  PHE F CE2 
4474 C CZ  . PHE F 18  ? 0.87790 0.61740 0.78000 0.02180  0.06120  -0.14120 927  PHE F CZ  
4475 N N   . ASN F 19  ? 0.91910 0.88410 0.89280 0.06270  0.10430  -0.02240 928  ASN F N   
4476 C CA  . ASN F 19  ? 0.84670 0.82660 0.82150 0.08950  0.12050  -0.01440 928  ASN F CA  
4477 C C   . ASN F 19  ? 0.94600 0.98570 0.96840 0.07890  0.11580  0.00220  928  ASN F C   
4478 O O   . ASN F 19  ? 1.00700 1.04410 1.03710 0.08840  0.11700  0.00110  928  ASN F O   
4479 C CB  . ASN F 19  ? 0.87580 0.86770 0.82350 0.12260  0.14300  -0.00500 928  ASN F CB  
4480 C CG  . ASN F 19  ? 0.93630 0.86310 0.83480 0.14220  0.15040  -0.02340 928  ASN F CG  
4481 O OD1 . ASN F 19  ? 1.01910 0.89110 0.90310 0.13290  0.14130  -0.04420 928  ASN F OD1 
4482 N ND2 . ASN F 19  ? 0.90990 0.84430 0.78280 0.16970  0.16760  -0.01720 928  ASN F ND2 
4483 N N   . SER F 20  ? 0.89020 0.97880 0.94070 0.05950  0.11060  0.01650  929  SER F N   
4484 C CA  . SER F 20  ? 0.82760 0.97560 0.92740 0.04300  0.10310  0.03070  929  SER F CA  
4485 C C   . SER F 20  ? 0.84430 0.96720 0.96210 0.02330  0.08270  0.01800  929  SER F C   
4486 O O   . SER F 20  ? 0.85030 0.98880 0.98580 0.03260  0.08420  0.02060  929  SER F O   
4487 C CB  . SER F 20  ? 0.90690 1.09440 1.02420 0.01970  0.09960  0.04410  929  SER F CB  
4488 O OG  . SER F 20  ? 0.86500 1.09610 1.02850 -0.00450 0.08640  0.05270  929  SER F OG  
4489 N N   . ALA F 21  ? 0.83340 0.91700 0.94340 -0.00060 0.06450  0.00290  930  ALA F N   
4490 C CA  . ALA F 21  ? 0.70150 0.76470 0.82980 -0.02340 0.04250  -0.01200 930  ALA F CA  
4491 C C   . ALA F 21  ? 0.85030 0.88000 0.96620 -0.00880 0.04830  -0.02420 930  ALA F C   
4492 O O   . ALA F 21  ? 0.81050 0.85630 0.95440 -0.01720 0.04000  -0.02320 930  ALA F O   
4493 C CB  . ALA F 21  ? 0.71550 0.73670 0.82580 -0.04330 0.02470  -0.03060 930  ALA F CB  
4494 N N   . ILE F 22  ? 0.82040 0.80180 0.89330 0.01130  0.06170  -0.03590 931  ILE F N   
4495 C CA  . ILE F 22  ? 0.85990 0.79840 0.91100 0.02500  0.06960  -0.04820 931  ILE F CA  
4496 C C   . ILE F 22  ? 0.89030 0.86600 0.95720 0.04550  0.08100  -0.02930 931  ILE F C   
4497 O O   . ILE F 22  ? 0.97640 0.93880 1.04980 0.04210  0.07700  -0.03430 931  ILE F O   
4498 C CB  . ILE F 22  ? 0.86680 0.75050 0.86700 0.04560  0.08450  -0.06130 931  ILE F CB  
4499 C CG1 . ILE F 22  ? 0.89780 0.73940 0.88140 0.02550  0.07130  -0.08620 931  ILE F CG1 
4500 C CG2 . ILE F 22  ? 0.91440 0.75870 0.88830 0.06470  0.09760  -0.06700 931  ILE F CG2 
4501 C CD1 . ILE F 22  ? 0.99600 0.78430 0.93120 0.04430  0.08490  -0.10160 931  ILE F CD1 
4502 N N   . GLY F 23  ? 0.81790 0.83860 0.88870 0.06690  0.09480  -0.01020 932  GLY F N   
4503 C CA  . GLY F 23  ? 0.92580 0.99140 1.01240 0.09060  0.10520  0.00650  932  GLY F CA  
4504 C C   . GLY F 23  ? 0.89940 0.99960 1.03080 0.07070  0.08990  0.01100  932  GLY F C   
4505 O O   . GLY F 23  ? 0.95330 1.03990 1.08100 0.08260  0.09160  0.00940  932  GLY F O   
4506 N N   . LYS F 24  ? 0.84080 0.97770 1.00870 0.04080  0.07490  0.01540  933  LYS F N   
4507 C CA  . LYS F 24  ? 0.76930 0.94420 0.98440 0.01790  0.05740  0.01960  933  LYS F CA  
4508 C C   . LYS F 24  ? 0.78350 0.90850 0.99170 0.00490  0.04510  0.00170  933  LYS F C   
4509 O O   . LYS F 24  ? 0.85700 1.00050 1.08790 0.00520  0.04010  0.00500  933  LYS F O   
4510 C CB  . LYS F 24  ? 0.75930 0.96440 1.00220 -0.01330 0.04270  0.02400  933  LYS F CB  
4511 C CG  . LYS F 24  ? 0.75190 1.00950 1.00390 -0.00760 0.05530  0.04180  933  LYS F CG  
4512 C CD  . LYS F 24  ? 0.90710 1.18280 1.17860 -0.04050 0.04080  0.04600  933  LYS F CD  
4513 C CE  . LYS F 24  ? 0.98680 1.31370 1.26520 -0.03900 0.05540  0.06370  933  LYS F CE  
4514 N NZ  . LYS F 24  ? 0.97490 1.30210 1.25880 -0.07160 0.04220  0.06690  933  LYS F NZ  
4515 N N   . ILE F 25  ? 0.90190 0.96740 1.07940 -0.00600 0.04070  -0.01790 934  ILE F N   
4516 C CA  . ILE F 25  ? 0.85990 0.87920 1.03070 -0.02320 0.02910  -0.03900 934  ILE F CA  
4517 C C   . ILE F 25  ? 0.70850 0.69620 0.85310 -0.00020 0.04430  -0.04000 934  ILE F C   
4518 O O   . ILE F 25  ? 0.69070 0.67220 0.84780 -0.01120 0.03620  -0.04550 934  ILE F O   
4519 C CB  . ILE F 25  ? 0.83580 0.80470 0.97970 -0.03890 0.02180  -0.06240 934  ILE F CB  
4520 C CG1 . ILE F 25  ? 0.69570 0.69230 0.86750 -0.06530 0.00020  -0.06340 934  ILE F CG1 
4521 C CG2 . ILE F 25  ? 0.81430 0.72960 0.93910 -0.04960 0.01870  -0.08680 934  ILE F CG2 
4522 C CD1 . ILE F 25  ? 0.65280 0.61260 0.79520 -0.07120 -0.00430 -0.08010 934  ILE F CD1 
4523 N N   . GLN F 26  ? 0.82690 0.79540 0.93490 0.03140  0.06510  -0.03440 935  GLN F N   
4524 C CA  . GLN F 26  ? 0.95600 0.89190 1.03150 0.05950  0.08080  -0.03250 935  GLN F CA  
4525 C C   . GLN F 26  ? 0.95840 0.94480 1.06800 0.06750  0.07710  -0.01650 935  GLN F C   
4526 O O   . GLN F 26  ? 0.90160 0.85950 1.00180 0.06730  0.07610  -0.02150 935  GLN F O   
4527 C CB  . GLN F 26  ? 0.94730 0.87000 0.98400 0.09550  0.10130  -0.02580 935  GLN F CB  
4528 C CG  . GLN F 26  ? 1.12350 0.98450 1.11730 0.09340  0.10760  -0.04370 935  GLN F CG  
4529 C CD  . GLN F 26  ? 1.29470 1.14610 1.25140 0.13100  0.12710  -0.03640 935  GLN F CD  
4530 O OE1 . GLN F 26  ? 1.40270 1.19070 1.31140 0.14270  0.13770  -0.04950 935  GLN F OE1 
4531 N NE2 . GLN F 26  ? 1.30520 1.22180 1.28430 0.14990  0.13210  -0.01660 935  GLN F NE2 
4532 N N   . ASP F 27  ? 1.01580 1.07530 1.16310 0.07350  0.07560  0.00120  936  ASP F N   
4533 C CA  . ASP F 27  ? 1.01030 1.12890 1.19610 0.08120  0.07110  0.01540  936  ASP F CA  
4534 C C   . ASP F 27  ? 0.88030 0.99650 1.09590 0.04850  0.05110  0.00720  936  ASP F C   
4535 O O   . ASP F 27  ? 0.87090 0.98790 1.09060 0.05740  0.04980  0.00950  936  ASP F O   
4536 C CB  . ASP F 27  ? 1.04700 1.24770 1.27090 0.08660  0.07300  0.03250  936  ASP F CB  
4537 C CG  . ASP F 27  ? 1.09100 1.31750 1.29620 0.12890  0.09280  0.04310  936  ASP F CG  
4538 O OD1 . ASP F 27  ? 1.19670 1.40720 1.37970 0.15920  0.10020  0.04390  936  ASP F OD1 
4539 O OD2 . ASP F 27  ? 0.90640 1.17010 1.11790 0.13240  0.10050  0.05020  936  ASP F OD2 
4540 N N   . SER F 28  ? 0.85140 0.96170 1.08320 0.01390  0.03550  -0.00340 937  SER F N   
4541 C CA  . SER F 28  ? 0.75130 0.86590 1.01480 -0.01870 0.01360  -0.01300 937  SER F CA  
4542 C C   . SER F 28  ? 0.69360 0.74460 0.92580 -0.02240 0.01520  -0.03030 937  SER F C   
4543 O O   . SER F 28  ? 0.56340 0.62470 0.81670 -0.03220 0.00530  -0.03160 937  SER F O   
4544 C CB  . SER F 28  ? 0.71770 0.83630 0.99730 -0.04950 -0.00320 -0.02210 937  SER F CB  
4545 O OG  . SER F 28  ? 0.90970 0.96360 1.15100 -0.05820 -0.00240 -0.04400 937  SER F OG  
4546 N N   . LEU F 29  ? 0.68230 0.66910 0.86500 -0.01620 0.02780  -0.04390 938  LEU F N   
4547 C CA  . LEU F 29  ? 0.77200 0.69240 0.91820 -0.02110 0.03340  -0.06130 938  LEU F CA  
4548 C C   . LEU F 29  ? 0.88700 0.80150 1.01720 0.00660  0.04570  -0.04820 938  LEU F C   
4549 O O   . LEU F 29  ? 0.95630 0.84950 1.08450 -0.00500 0.04150  -0.05530 938  LEU F O   
4550 C CB  . LEU F 29  ? 0.82190 0.67790 0.91690 -0.01670 0.04680  -0.07730 938  LEU F CB  
4551 C CG  . LEU F 29  ? 0.72370 0.57500 0.82670 -0.04320 0.03390  -0.09560 938  LEU F CG  
4552 C CD1 . LEU F 29  ? 0.92210 0.71110 0.97330 -0.03470 0.04890  -0.11140 938  LEU F CD1 
4553 C CD2 . LEU F 29  ? 0.70670 0.55800 0.83470 -0.07920 0.01360  -0.11530 938  LEU F CD2 
4554 N N   . SER F 30  ? 0.90560 0.83880 1.02330 0.04290  0.05980  -0.03060 939  SER F N   
4555 C CA  . SER F 30  ? 0.94680 0.87410 1.04320 0.07700  0.07140  -0.01840 939  SER F CA  
4556 C C   . SER F 30  ? 0.85970 0.84040 1.00380 0.06890  0.05670  -0.01000 939  SER F C   
4557 O O   . SER F 30  ? 0.92000 0.86930 1.04360 0.07630  0.05940  -0.01110 939  SER F O   
4558 C CB  . SER F 30  ? 0.94260 0.89410 1.02410 0.11730  0.08600  -0.00350 939  SER F CB  
4559 O OG  . SER F 30  ? 0.96350 0.88690 1.00560 0.15450  0.09860  0.00290  939  SER F OG  
4560 N N   . SER F 31  ? 0.71840 0.77310 0.92080 0.05330  0.04200  -0.00230 940  SER F N   
4561 C CA  . SER F 31  ? 0.68460 0.80000 0.93980 0.04410  0.02620  0.00580  940  SER F CA  
4562 C C   . SER F 31  ? 0.74990 0.83320 1.01000 0.01240  0.01260  -0.00950 940  SER F C   
4563 O O   . SER F 31  ? 0.61360 0.70620 0.88370 0.01710  0.00820  -0.00600 940  SER F O   
4564 C CB  . SER F 31  ? 0.66830 0.85940 0.97810 0.03000  0.01460  0.01500  940  SER F CB  
4565 O OG  . SER F 31  ? 0.77980 0.99970 1.08220 0.05690  0.02930  0.02700  940  SER F OG  
4566 N N   . THR F 32  ? 0.72450 0.77250 0.97660 -0.01760 0.00620  -0.02740 941  THR F N   
4567 C CA  . THR F 32  ? 0.67080 0.68940 0.92630 -0.05040 -0.00670 -0.04680 941  THR F CA  
4568 C C   . THR F 32  ? 0.72290 0.68040 0.93120 -0.03830 0.00780  -0.05160 941  THR F C   
4569 O O   . THR F 32  ? 0.65250 0.61750 0.87660 -0.04870 -0.00090 -0.05330 941  THR F O   
4570 C CB  . THR F 32  ? 0.59990 0.58880 0.84710 -0.07860 -0.01370 -0.06830 941  THR F CB  
4571 O OG1 . THR F 32  ? 0.54950 0.58900 0.83320 -0.08710 -0.02650 -0.06180 941  THR F OG1 
4572 C CG2 . THR F 32  ? 0.55330 0.52140 0.80780 -0.11220 -0.02790 -0.09120 941  THR F CG2 
4573 N N   . ALA F 33  ? 0.66300 0.56070 0.81360 -0.01720 0.02910  -0.05340 942  ALA F N   
4574 C CA  . ALA F 33  ? 0.76020 0.58610 0.85190 -0.00240 0.04650  -0.05680 942  ALA F CA  
4575 C C   . ALA F 33  ? 0.85760 0.70770 0.95330 0.02670  0.04820  -0.03800 942  ALA F C   
4576 O O   . ALA F 33  ? 0.98690 0.79480 1.05570 0.02380  0.05200  -0.04230 942  ALA F O   
4577 C CB  . ALA F 33  ? 0.84410 0.61180 0.87760 0.01980  0.06730  -0.05900 942  ALA F CB  
4578 N N   . SER F 34  ? 0.73110 0.64630 0.85670 0.05420  0.04620  -0.01890 943  SER F N   
4579 C CA  . SER F 34  ? 0.78790 0.74600 0.93110 0.08140  0.04340  -0.00270 943  SER F CA  
4580 C C   . SER F 34  ? 0.76430 0.74990 0.94980 0.05210  0.02490  -0.00720 943  SER F C   
4581 O O   . SER F 34  ? 0.67190 0.62330 0.83190 0.05860  0.02790  -0.00780 943  SER F O   
4582 C CB  . SER F 34  ? 0.79800 0.83890 0.98250 0.10440  0.04070  0.01360  943  SER F CB  
4583 O OG  . SER F 34  ? 1.00200 1.02690 1.14430 0.14800  0.05850  0.02190  943  SER F OG  
4584 N N   . ALA F 35  ? 0.56850 0.61140 0.81340 0.02160  0.00600  -0.01040 944  ALA F N   
4585 C CA  . ALA F 35  ? 0.47350 0.55710 0.76850 -0.00560 -0.01520 -0.01420 944  ALA F CA  
4586 C C   . ALA F 35  ? 0.70270 0.72300 0.96690 -0.02850 -0.01460 -0.03150 944  ALA F C   
4587 O O   . ALA F 35  ? 0.48160 0.51410 0.75930 -0.03060 -0.02210 -0.02980 944  ALA F O   
4588 C CB  . ALA F 35  ? 0.41350 0.54860 0.76180 -0.03570 -0.03410 -0.01830 944  ALA F CB  
4589 N N   . LEU F 36  ? 0.71860 0.67540 0.94320 -0.04610 -0.00570 -0.04900 945  LEU F N   
4590 C CA  . LEU F 36  ? 0.66670 0.56170 0.85920 -0.07240 -0.00240 -0.06920 945  LEU F CA  
4591 C C   . LEU F 36  ? 0.78830 0.62420 0.92220 -0.04620 0.01720  -0.06170 945  LEU F C   
4592 O O   . LEU F 36  ? 0.79910 0.60550 0.91900 -0.06280 0.01700  -0.07050 945  LEU F O   
4593 C CB  . LEU F 36  ? 0.67330 0.52060 0.83920 -0.09570 0.00320  -0.09110 945  LEU F CB  
4594 C CG  . LEU F 36  ? 0.59210 0.48680 0.80880 -0.12560 -0.01880 -0.10370 945  LEU F CG  
4595 C CD1 . LEU F 36  ? 0.55770 0.40900 0.74440 -0.13760 -0.01140 -0.12270 945  LEU F CD1 
4596 C CD2 . LEU F 36  ? 0.51370 0.43420 0.74340 -0.15040 -0.03700 -0.11000 945  LEU F CD2 
4597 N N   . GLY F 37  ? 0.74550 0.56300 0.84310 -0.00580 0.03340  -0.04660 946  GLY F N   
4598 C CA  . GLY F 37  ? 0.81180 0.57540 0.85130 0.02630  0.04980  -0.03710 946  GLY F CA  
4599 C C   . GLY F 37  ? 0.71070 0.52100 0.78190 0.03710  0.03790  -0.02540 946  GLY F C   
4600 O O   . GLY F 37  ? 0.80230 0.56650 0.84180 0.03020  0.04220  -0.02980 946  GLY F O   
4601 N N   . LYS F 38  ? 0.64070 0.54020 0.77240 0.05140  0.02380  -0.01180 947  LYS F N   
4602 C CA  . LYS F 38  ? 0.60990 0.56470 0.77630 0.06830  0.01210  0.00030  947  LYS F CA  
4603 C C   . LYS F 38  ? 0.57040 0.53070 0.76490 0.02920  -0.00280 -0.01140 947  LYS F C   
4604 O O   . LYS F 38  ? 0.59200 0.53240 0.76670 0.03900  -0.00150 -0.00840 947  LYS F O   
4605 C CB  . LYS F 38  ? 0.55400 0.60580 0.78300 0.08460  0.00080  0.01350  947  LYS F CB  
4606 C CG  . LYS F 38  ? 0.72290 0.77740 0.92320 0.13020  0.01600  0.02550  947  LYS F CG  
4607 C CD  . LYS F 38  ? 0.71510 0.87000 0.97910 0.14180  0.00640  0.03640  947  LYS F CD  
4608 C CE  . LYS F 38  ? 0.67860 0.84590 0.91790 0.18740  0.02100  0.04600  947  LYS F CE  
4609 N NZ  . LYS F 38  ? 0.56360 0.81850 0.86250 0.18230  0.01470  0.05180  947  LYS F NZ  
4610 N N   . LEU F 39  ? 0.58650 0.56760 0.81950 -0.01240 -0.01600 -0.02570 948  LEU F N   
4611 C CA  . LEU F 39  ? 0.54150 0.52970 0.80210 -0.05210 -0.03170 -0.04100 948  LEU F CA  
4612 C C   . LEU F 39  ? 0.68850 0.58850 0.88320 -0.06160 -0.01510 -0.05280 948  LEU F C   
4613 O O   . LEU F 39  ? 0.69940 0.60160 0.89840 -0.06800 -0.02070 -0.05370 948  LEU F O   
4614 C CB  . LEU F 39  ? 0.45830 0.47590 0.76110 -0.09010 -0.04770 -0.05670 948  LEU F CB  
4615 C CG  . LEU F 39  ? 0.38660 0.49460 0.76040 -0.08970 -0.06860 -0.04600 948  LEU F CG  
4616 C CD1 . LEU F 39  ? 0.32440 0.43990 0.69660 -0.11440 -0.07670 -0.05620 948  LEU F CD1 
4617 C CD2 . LEU F 39  ? 0.31820 0.48120 0.73680 -0.09260 -0.08680 -0.04060 948  LEU F CD2 
4618 N N   . GLN F 40  ? 0.73560 0.55970 0.86900 -0.06130 0.00560  -0.06090 949  GLN F N   
4619 C CA  . GLN F 40  ? 0.90210 0.63500 0.96720 -0.07480 0.02400  -0.07370 949  GLN F CA  
4620 C C   . GLN F 40  ? 1.03950 0.74450 1.06500 -0.04060 0.03350  -0.05670 949  GLN F C   
4621 O O   . GLN F 40  ? 1.16360 0.84380 1.17470 -0.05780 0.03380  -0.06310 949  GLN F O   
4622 C CB  . GLN F 40  ? 0.91580 0.57320 0.92080 -0.07550 0.04520  -0.08360 949  GLN F CB  
4623 C CG  . GLN F 40  ? 1.07490 0.63430 1.00570 -0.09160 0.06620  -0.09710 949  GLN F CG  
4624 C CD  . GLN F 40  ? 1.13460 0.61900 1.00870 -0.09900 0.08630  -0.11100 949  GLN F CD  
4625 O OE1 . GLN F 40  ? 1.08730 0.56770 0.94850 -0.07170 0.09260  -0.10200 949  GLN F OE1 
4626 N NE2 . GLN F 40  ? 1.11970 0.57730 0.97000 -0.12840 0.08980  -0.12690 949  GLN F NE2 
4627 N N   . ASP F 41  ? 0.96230 0.67260 0.96990 0.00730  0.04050  -0.03670 950  ASP F N   
4628 C CA  . ASP F 41  ? 1.04800 0.73040 1.01220 0.04780  0.04880  -0.02080 950  ASP F CA  
4629 C C   . ASP F 41  ? 1.03870 0.77950 1.05300 0.03940  0.03010  -0.01780 950  ASP F C   
4630 O O   . ASP F 41  ? 1.10120 0.78960 1.07460 0.03260  0.03690  -0.02100 950  ASP F O   
4631 C CB  . ASP F 41  ? 1.11340 0.81650 1.06670 0.10190  0.05380  -0.00250 950  ASP F CB  
4632 C CG  . ASP F 41  ? 1.31150 0.94120 1.19840 0.11780  0.07470  -0.00450 950  ASP F CG  
4633 O OD1 . ASP F 41  ? 1.40910 0.95130 1.23880 0.09420  0.08970  -0.01770 950  ASP F OD1 
4634 O OD2 . ASP F 41  ? 1.37220 1.03420 1.26530 0.15290  0.07620  0.00620  950  ASP F OD2 
4635 N N   . VAL F 42  ? 0.95510 0.79750 1.05320 0.03670  0.00790  -0.01290 951  VAL F N   
4636 C CA  . VAL F 42  ? 0.82100 0.73320 0.97530 0.03600  -0.01240 -0.00760 951  VAL F CA  
4637 C C   . VAL F 42  ? 0.77670 0.67520 0.94260 -0.01140 -0.02040 -0.02520 951  VAL F C   
4638 O O   . VAL F 42  ? 0.92510 0.82120 1.08510 -0.00710 -0.02380 -0.02240 951  VAL F O   
4639 C CB  . VAL F 42  ? 0.62770 0.64780 0.86670 0.04070  -0.03300 0.00020  951  VAL F CB  
4640 C CG1 . VAL F 42  ? 0.54390 0.63420 0.84460 0.03140  -0.05560 0.00170  951  VAL F CG1 
4641 C CG2 . VAL F 42  ? 0.67180 0.71440 0.90080 0.09020  -0.02470 0.01680  951  VAL F CG2 
4642 N N   . VAL F 43  ? 0.76120 0.65320 0.94230 -0.05350 -0.02380 -0.04390 952  VAL F N   
4643 C CA  . VAL F 43  ? 0.79840 0.68020 0.98990 -0.09980 -0.03150 -0.06500 952  VAL F CA  
4644 C C   . VAL F 43  ? 0.87270 0.66630 0.98790 -0.10030 -0.01040 -0.06840 952  VAL F C   
4645 O O   . VAL F 43  ? 0.88980 0.69300 1.01630 -0.11720 -0.01800 -0.07390 952  VAL F O   
4646 C CB  . VAL F 43  ? 0.73260 0.61000 0.93890 -0.14040 -0.03540 -0.08780 952  VAL F CB  
4647 C CG1 . VAL F 43  ? 0.77030 0.62820 0.94070 -0.17230 -0.03630 -0.10020 952  VAL F CG1 
4648 C CG2 . VAL F 43  ? 0.52680 0.49170 0.80570 -0.14640 -0.05960 -0.08570 952  VAL F CG2 
4649 N N   . ASN F 44  ? 0.90470 0.61370 0.94310 -0.08300 0.01520  -0.06530 953  ASN F N   
4650 C CA  . ASN F 44  ? 0.87700 0.48500 0.82870 -0.08470 0.03910  -0.06870 953  ASN F CA  
4651 C C   . ASN F 44  ? 1.07060 0.67360 0.99890 -0.04590 0.03980  -0.04870 953  ASN F C   
4652 O O   . ASN F 44  ? 1.16940 0.72480 1.05880 -0.06080 0.04780  -0.05370 953  ASN F O   
4653 C CB  . ASN F 44  ? 0.94990 0.47090 0.82770 -0.07450 0.06430  -0.07050 953  ASN F CB  
4654 C CG  . ASN F 44  ? 1.03010 0.54140 0.91920 -0.11790 0.06630  -0.09510 953  ASN F CG  
4655 O OD1 . ASN F 44  ? 1.00900 0.55380 0.93850 -0.16010 0.05390  -0.11450 953  ASN F OD1 
4656 N ND2 . ASN F 44  ? 1.10760 0.57880 0.96190 -0.10450 0.08000  -0.09480 953  ASN F ND2 
4657 N N   . GLN F 45  ? 0.99670 0.64500 0.94370 0.00240  0.03300  -0.02810 954  GLN F N   
4658 C CA  . GLN F 45  ? 1.03150 0.69120 0.96580 0.04560  0.02970  -0.01000 954  GLN F CA  
4659 C C   . GLN F 45  ? 0.96580 0.68760 0.95910 0.02220  0.00930  -0.01450 954  GLN F C   
4660 O O   . GLN F 45  ? 1.06360 0.74740 1.01690 0.03130  0.01460  -0.01050 954  GLN F O   
4661 C CB  . GLN F 45  ? 1.14060 0.86570 1.10760 0.09500  0.02110  0.00750  954  GLN F CB  
4662 C CG  . GLN F 45  ? 1.31860 0.97960 1.21520 0.13420  0.04140  0.01560  954  GLN F CG  
4663 C CD  . GLN F 45  ? 1.49140 1.06510 1.29550 0.17290  0.05780  0.02500  954  GLN F CD  
4664 O OE1 . GLN F 45  ? 1.55800 1.14340 1.36070 0.18960  0.05090  0.03170  954  GLN F OE1 
4665 N NE2 . GLN F 45  ? 1.51590 0.99810 1.23810 0.18950  0.07940  0.02550  954  GLN F NE2 
4666 N N   . ASN F 46  ? 0.83630 0.64630 0.91740 -0.00610 -0.01310 -0.02260 955  ASN F N   
4667 C CA  . ASN F 46  ? 0.87720 0.75810 1.02590 -0.03050 -0.03670 -0.02880 955  ASN F CA  
4668 C C   . ASN F 46  ? 0.91630 0.74470 1.03560 -0.07560 -0.02990 -0.04830 955  ASN F C   
4669 O O   . ASN F 46  ? 0.84480 0.69460 0.97990 -0.08230 -0.03970 -0.04930 955  ASN F O   
4670 C CB  . ASN F 46  ? 0.65590 0.63330 0.89650 -0.04930 -0.06150 -0.03340 955  ASN F CB  
4671 C CG  . ASN F 46  ? 0.70050 0.74610 0.98110 -0.00810 -0.07060 -0.01450 955  ASN F CG  
4672 O OD1 . ASN F 46  ? 0.75500 0.77830 0.99510 0.03700  -0.05850 0.00060  955  ASN F OD1 
4673 N ND2 . ASN F 46  ? 0.56600 0.69470 0.92420 -0.02340 -0.09190 -0.01640 955  ASN F ND2 
4674 N N   . ALA F 47  ? 0.84770 0.61280 0.92660 -0.10580 -0.01360 -0.06450 956  ALA F N   
4675 C CA  . ALA F 47  ? 0.88810 0.59690 0.93080 -0.15050 -0.00250 -0.08610 956  ALA F CA  
4676 C C   . ALA F 47  ? 1.06000 0.68540 1.01910 -0.13140 0.01900  -0.07600 956  ALA F C   
4677 O O   . ALA F 47  ? 1.11970 0.73750 1.07330 -0.15580 0.01830  -0.08490 956  ALA F O   
4678 C CB  . ALA F 47  ? 0.94290 0.60370 0.95920 -0.18170 0.01150  -0.10580 956  ALA F CB  
4679 N N   . GLN F 48  ? 1.19610 0.76070 1.09020 -0.08810 0.03700  -0.05820 957  GLN F N   
4680 C CA  . GLN F 48  ? 1.34470 0.81630 1.14610 -0.06600 0.05840  -0.04790 957  GLN F CA  
4681 C C   . GLN F 48  ? 1.25100 0.77420 1.08010 -0.03740 0.04210  -0.03320 957  GLN F C   
4682 O O   . GLN F 48  ? 1.33970 0.81590 1.12470 -0.04710 0.05070  -0.03480 957  GLN F O   
4683 C CB  . GLN F 48  ? 1.55010 0.94320 1.27320 -0.02390 0.07940  -0.03410 957  GLN F CB  
4684 C CG  . GLN F 48  ? 1.72190 0.99270 1.33190 -0.01260 0.10580  -0.02900 957  GLN F CG  
4685 C CD  . GLN F 48  ? 1.68900 0.89150 1.25860 -0.07200 0.12370  -0.05120 957  GLN F CD  
4686 O OE1 . GLN F 48  ? 1.56660 0.74490 1.11340 -0.09100 0.12790  -0.05480 957  GLN F OE1 
4687 N NE2 . GLN F 48  ? 1.74250 0.92140 1.30670 -0.10240 0.13390  -0.06760 957  GLN F NE2 
4688 N N   . ALA F 49  ? 1.15200 0.76910 1.05130 -0.00510 0.02000  -0.02050 958  ALA F N   
4689 C CA  . ALA F 49  ? 0.99360 0.67620 0.93340 0.02180  0.00100  -0.00870 958  ALA F CA  
4690 C C   . ALA F 49  ? 0.87370 0.58290 0.84850 -0.02410 -0.01010 -0.02390 958  ALA F C   
4691 O O   . ALA F 49  ? 1.06160 0.74570 1.00420 -0.01470 -0.00730 -0.01910 958  ALA F O   
4692 C CB  . ALA F 49  ? 0.84550 0.63550 0.86950 0.04820  -0.02180 0.00070  958  ALA F CB  
4693 N N   . LEU F 50  ? 0.96200 0.71630 0.99580 -0.07230 -0.02180 -0.04310 959  LEU F N   
4694 C CA  . LEU F 50  ? 0.88490 0.67620 0.96030 -0.11670 -0.03560 -0.06080 959  LEU F CA  
4695 C C   . LEU F 50  ? 0.95510 0.64960 0.94810 -0.14320 -0.01070 -0.07150 959  LEU F C   
4696 O O   . LEU F 50  ? 0.86030 0.56650 0.85810 -0.15490 -0.01630 -0.07500 959  LEU F O   
4697 C CB  . LEU F 50  ? 0.78160 0.62940 0.92480 -0.15900 -0.05150 -0.08120 959  LEU F CB  
4698 C CG  . LEU F 50  ? 0.72810 0.62800 0.89480 -0.19470 -0.06510 -0.09320 959  LEU F CG  
4699 C CD1 . LEU F 50  ? 0.69150 0.64390 0.90460 -0.18010 -0.08290 -0.08790 959  LEU F CD1 
4700 C CD2 . LEU F 50  ? 0.71450 0.68350 0.87590 -0.19330 -0.07160 -0.08010 959  LEU F CD2 
4701 N N   . ASN F 51  ? 1.04850 0.65050 0.96800 -0.15410 0.01650  -0.07730 960  ASN F N   
4702 C CA  . ASN F 51  ? 1.16780 0.66640 0.99920 -0.18220 0.04460  -0.08790 960  ASN F CA  
4703 C C   . ASN F 51  ? 1.36870 0.81010 1.13090 -0.14170 0.05600  -0.06650 960  ASN F C   
4704 O O   . ASN F 51  ? 1.52610 0.93570 1.25740 -0.16550 0.06390  -0.07360 960  ASN F O   
4705 C CB  . ASN F 51  ? 1.13840 0.56440 0.91320 -0.19630 0.06880  -0.09670 960  ASN F CB  
4706 C CG  . ASN F 51  ? 1.06820 0.59900 0.92660 -0.21560 0.04940  -0.10990 960  ASN F CG  
4707 O OD1 . ASN F 51  ? 0.99490 0.60760 0.91290 -0.22700 0.02950  -0.11600 960  ASN F OD1 
4708 N ND2 . ASN F 51  ? 1.15210 0.67240 1.00730 -0.20890 0.05380  -0.11040 960  ASN F ND2 
4709 N N   . THR F 52  ? 1.15670 0.58860 0.89600 -0.08230 0.05610  -0.04260 961  THR F N   
4710 C CA  . THR F 52  ? 1.29750 0.67750 0.96940 -0.03520 0.06420  -0.02220 961  THR F CA  
4711 C C   . THR F 52  ? 1.24870 0.71080 0.98290 -0.03420 0.04070  -0.02050 961  THR F C   
4712 O O   . THR F 52  ? 1.35090 0.76020 1.03060 -0.03850 0.05120  -0.01920 961  THR F O   
4713 C CB  . THR F 52  ? 1.32990 0.69460 0.97090 0.03080  0.06610  -0.00050 961  THR F CB  
4714 O OG1 . THR F 52  ? 1.38690 0.87300 1.12810 0.05340  0.03810  0.00540  961  THR F OG1 
4715 C CG2 . THR F 52  ? 1.29830 0.57890 0.87410 0.03160  0.08910  -0.00230 961  THR F CG2 
4716 N N   . LEU F 53  ? 1.05850 0.64210 0.90050 -0.03110 0.01060  -0.02130 962  LEU F N   
4717 C CA  . LEU F 53  ? 0.95440 0.63050 0.87090 -0.03310 -0.01600 -0.02190 962  LEU F CA  
4718 C C   . LEU F 53  ? 0.94650 0.60000 0.85190 -0.08710 -0.01070 -0.04110 962  LEU F C   
4719 O O   . LEU F 53  ? 1.00660 0.65200 0.89150 -0.07790 -0.01180 -0.03600 962  LEU F O   
4720 C CB  . LEU F 53  ? 0.74810 0.54630 0.77920 -0.03830 -0.04610 -0.02570 962  LEU F CB  
4721 C CG  . LEU F 53  ? 0.69860 0.59840 0.81670 -0.04880 -0.07620 -0.03040 962  LEU F CG  
4722 C CD1 . LEU F 53  ? 0.72030 0.63490 0.82750 0.00040  -0.08260 -0.01260 962  LEU F CD1 
4723 C CD2 . LEU F 53  ? 0.67210 0.67680 0.89150 -0.05570 -0.10300 -0.03400 962  LEU F CD2 
4724 N N   . VAL F 54  ? 1.02590 0.66990 0.94240 -0.14080 -0.00470 -0.06370 963  VAL F N   
4725 C CA  . VAL F 54  ? 1.01720 0.65250 0.93210 -0.19700 -0.00080 -0.08700 963  VAL F CA  
4726 C C   . VAL F 54  ? 1.09020 0.61780 0.89900 -0.19420 0.02790  -0.08090 963  VAL F C   
4727 O O   . VAL F 54  ? 1.09360 0.64020 0.90950 -0.20520 0.02190  -0.08420 963  VAL F O   
4728 C CB  . VAL F 54  ? 0.97950 0.62880 0.91850 -0.23780 0.00250  -0.10890 963  VAL F CB  
4729 C CG1 . VAL F 54  ? 1.06090 0.72140 0.98870 -0.25120 0.01060  -0.11540 963  VAL F CG1 
4730 C CG2 . VAL F 54  ? 0.75920 0.53460 0.81120 -0.22740 -0.03430 -0.10830 963  VAL F CG2 
4731 N N   . LYS F 55  ? 1.18780 0.60550 0.90040 -0.17910 0.05750  -0.07210 964  LYS F N   
4732 C CA  . LYS F 55  ? 1.31770 0.61260 0.91270 -0.17730 0.08860  -0.06570 964  LYS F CA  
4733 C C   . LYS F 55  ? 1.34380 0.64910 0.92520 -0.12900 0.07880  -0.04410 964  LYS F C   
4734 O O   . LYS F 55  ? 1.52730 0.80650 1.07790 -0.15020 0.08610  -0.04900 964  LYS F O   
4735 C CB  . LYS F 55  ? 1.52770 0.70860 1.02670 -0.15930 0.11730  -0.05730 964  LYS F CB  
4736 C CG  . LYS F 55  ? 1.60820 0.79450 1.11430 -0.20390 0.13010  -0.07730 964  LYS F CG  
4737 C CD  . LYS F 55  ? 1.77970 0.88370 1.20840 -0.18390 0.15350  -0.06880 964  LYS F CD  
4738 C CE  . LYS F 55  ? 1.77750 0.93980 1.25360 -0.21270 0.15310  -0.08490 964  LYS F CE  
4739 N NZ  . LYS F 55  ? 1.83650 0.93600 1.26090 -0.18740 0.16710  -0.07630 964  LYS F NZ  
4740 N N   . GLN F 56  ? 1.23000 0.57740 0.83660 -0.06790 0.06240  -0.02320 965  GLN F N   
4741 C CA  . GLN F 56  ? 1.23330 0.59710 0.82960 -0.01350 0.05100  -0.00320 965  GLN F CA  
4742 C C   . GLN F 56  ? 1.23580 0.70340 0.92040 -0.03330 0.02460  -0.01160 965  GLN F C   
4743 O O   . GLN F 56  ? 1.24680 0.69950 0.89990 -0.01100 0.02370  -0.00230 965  GLN F O   
4744 C CB  . GLN F 56  ? 1.21420 0.61590 0.83060 0.05210  0.03790  0.01580  965  GLN F CB  
4745 C CG  . GLN F 56  ? 1.51130 0.79890 1.02250 0.08460  0.06400  0.02710  965  GLN F CG  
4746 C CD  . GLN F 56  ? 1.54800 0.87240 1.07220 0.15350  0.05180  0.04430  965  GLN F CD  
4747 O OE1 . GLN F 56  ? 1.52190 0.90390 1.07460 0.19810  0.03350  0.05510  965  GLN F OE1 
4748 N NE2 . GLN F 56  ? 1.49740 0.78870 0.99840 0.16390  0.06240  0.04580  965  GLN F NE2 
4749 N N   . LEU F 57  ? 1.16230 0.72690 0.94850 -0.07250 0.00360  -0.02900 966  LEU F N   
4750 C CA  . LEU F 57  ? 1.06950 0.73310 0.94140 -0.09590 -0.02300 -0.04020 966  LEU F CA  
4751 C C   . LEU F 57  ? 1.04360 0.65220 0.86570 -0.14260 -0.00570 -0.05540 966  LEU F C   
4752 O O   . LEU F 57  ? 0.95570 0.59510 0.79090 -0.13700 -0.01660 -0.05330 966  LEU F O   
4753 C CB  . LEU F 57  ? 0.94750 0.71370 0.92790 -0.12820 -0.04800 -0.05690 966  LEU F CB  
4754 C CG  . LEU F 57  ? 0.85400 0.70830 0.91060 -0.08790 -0.07320 -0.04380 966  LEU F CG  
4755 C CD1 . LEU F 57  ? 0.81910 0.75590 0.96760 -0.12570 -0.09450 -0.06150 966  LEU F CD1 
4756 C CD2 . LEU F 57  ? 0.79950 0.72140 0.89680 -0.04740 -0.09550 -0.03020 966  LEU F CD2 
4757 N N   . SER F 58  ? 1.00820 0.54290 0.77840 -0.18850 0.01990  -0.07170 967  SER F N   
4758 C CA  . SER F 58  ? 1.10870 0.58780 0.82790 -0.24040 0.04050  -0.08990 967  SER F CA  
4759 C C   . SER F 58  ? 1.35370 0.73480 0.96710 -0.21060 0.06260  -0.07060 967  SER F C   
4760 O O   . SER F 58  ? 1.40990 0.79290 1.01340 -0.23280 0.06430  -0.07760 967  SER F O   
4761 C CB  . SER F 58  ? 1.03810 0.48730 0.73750 -0.27990 0.06160  -0.10710 967  SER F CB  
4762 O OG  . SER F 58  ? 1.04440 0.61390 0.83290 -0.29610 0.04500  -0.12050 967  SER F OG  
4763 N N   . SER F 59  ? 1.19340 0.49630 0.73210 -0.15930 0.07690  -0.04740 968  SER F N   
4764 C CA  . SER F 59  ? 1.34680 0.55370 0.77980 -0.11810 0.09460  -0.02620 968  SER F CA  
4765 C C   . SER F 59  ? 1.41040 0.69670 0.89310 -0.08190 0.06790  -0.01520 968  SER F C   
4766 O O   . SER F 59  ? 1.55340 0.78630 0.97290 -0.08170 0.07970  -0.01090 968  SER F O   
4767 C CB  . SER F 59  ? 1.42310 0.55080 0.78220 -0.06320 0.10760  -0.00530 968  SER F CB  
4768 O OG  . SER F 59  ? 1.52210 0.51820 0.77460 -0.09080 0.14410  -0.01010 968  SER F OG  
4769 N N   . ASN F 60  ? 1.29420 0.69980 0.88200 -0.05170 0.03420  -0.01070 969  ASN F N   
4770 C CA  . ASN F 60  ? 1.20250 0.69980 0.85320 -0.01590 0.00480  -0.00200 969  ASN F CA  
4771 C C   . ASN F 60  ? 1.24840 0.80050 0.94830 -0.06650 -0.00540 -0.02070 969  ASN F C   
4772 O O   . ASN F 60  ? 1.32550 0.87220 1.00110 -0.04890 -0.00790 -0.01380 969  ASN F O   
4773 C CB  . ASN F 60  ? 1.09950 0.71440 0.85630 0.01760  -0.02730 0.00330  969  ASN F CB  
4774 C CG  . ASN F 60  ? 1.25880 0.83240 0.96970 0.07760  -0.02030 0.02260  969  ASN F CG  
4775 O OD1 . ASN F 60  ? 1.44130 0.89490 1.03890 0.09580  0.00740  0.03220  969  ASN F OD1 
4776 N ND2 . ASN F 60  ? 1.21220 0.88360 1.00820 0.10780  -0.04500 0.02740  969  ASN F ND2 
4777 N N   . PHE F 61  ? 1.12070 0.72490 0.88600 -0.12490 -0.01200 -0.04460 970  PHE F N   
4778 C CA  . PHE F 61  ? 1.13330 0.80290 0.95500 -0.17290 -0.02550 -0.06600 970  PHE F CA  
4779 C C   . PHE F 61  ? 1.20260 0.77120 0.92330 -0.20120 0.00610  -0.07060 970  PHE F C   
4780 O O   . PHE F 61  ? 1.19660 0.79330 0.92540 -0.20130 -0.00240 -0.07120 970  PHE F O   
4781 C CB  . PHE F 61  ? 1.11420 0.85460 1.01910 -0.22690 -0.03890 -0.09300 970  PHE F CB  
4782 C CG  . PHE F 61  ? 0.98410 0.84170 1.00130 -0.20460 -0.07580 -0.09040 970  PHE F CG  
4783 C CD1 . PHE F 61  ? 0.96110 0.90750 1.04490 -0.17210 -0.10620 -0.08130 970  PHE F CD1 
4784 C CD2 . PHE F 61  ? 0.84360 0.71900 0.89560 -0.21510 -0.07920 -0.09660 970  PHE F CD2 
4785 C CE1 . PHE F 61  ? 0.84120 0.89030 1.02350 -0.15280 -0.13830 -0.07840 970  PHE F CE1 
4786 C CE2 . PHE F 61  ? 0.81870 0.79540 0.96720 -0.19510 -0.11130 -0.09280 970  PHE F CE2 
4787 C CZ  . PHE F 61  ? 0.80300 0.86540 1.01590 -0.16510 -0.14020 -0.08380 970  PHE F CZ  
4788 N N   . GLY F 62  ? 1.24730 0.70060 0.87390 -0.22360 0.04180  -0.07320 971  GLY F N   
4789 C CA  . GLY F 62  ? 1.40920 0.74590 0.92170 -0.24950 0.07760  -0.07510 971  GLY F CA  
4790 C C   . GLY F 62  ? 1.42550 0.73020 0.88480 -0.19940 0.07700  -0.05180 971  GLY F C   
4791 O O   . GLY F 62  ? 1.45120 0.76630 0.90520 -0.22260 0.07790  -0.05950 971  GLY F O   
4792 N N   . ALA F 63  ? 1.49170 0.76660 0.91770 -0.13080 0.07340  -0.02570 972  ALA F N   
4793 C CA  . ALA F 63  ? 1.56700 0.81530 0.94340 -0.06990 0.06930  -0.00250 972  ALA F CA  
4794 C C   . ALA F 63  ? 1.37130 0.74470 0.84610 -0.06590 0.03570  -0.00750 972  ALA F C   
4795 O O   . ALA F 63  ? 1.41350 0.75520 0.84050 -0.06320 0.04230  -0.00370 972  ALA F O   
4796 C CB  . ALA F 63  ? 1.60250 0.83280 0.95800 0.00180  0.06320  0.01990  972  ALA F CB  
4797 N N   . ILE F 64  ? 1.16820 0.67520 0.77270 -0.06820 0.00160  -0.01640 973  ILE F N   
4798 C CA  . ILE F 64  ? 1.17420 0.80670 0.87940 -0.05910 -0.03430 -0.02050 973  ILE F CA  
4799 C C   . ILE F 64  ? 1.21310 0.84880 0.91590 -0.11690 -0.02770 -0.04030 973  ILE F C   
4800 O O   . ILE F 64  ? 1.24510 0.88630 0.93110 -0.09910 -0.03260 -0.03420 973  ILE F O   
4801 C CB  . ILE F 64  ? 1.03220 0.79700 0.87100 -0.05890 -0.06960 -0.02840 973  ILE F CB  
4802 C CG1 . ILE F 64  ? 0.98270 0.76190 0.83140 0.00590  -0.07960 -0.00780 973  ILE F CG1 
4803 C CG2 . ILE F 64  ? 0.80500 0.69190 0.74560 -0.06820 -0.10390 -0.03920 973  ILE F CG2 
4804 C CD1 . ILE F 64  ? 0.86850 0.74600 0.82360 -0.00110 -0.10380 -0.01480 973  ILE F CD1 
4805 N N   . SER F 65  ? 1.21270 0.84700 0.93090 -0.18280 -0.01690 -0.06460 974  SER F N   
4806 C CA  . SER F 65  ? 1.14660 0.79600 0.87140 -0.24370 -0.01130 -0.08900 974  SER F CA  
4807 C C   . SER F 65  ? 1.27320 0.80740 0.87460 -0.24260 0.02150  -0.07890 974  SER F C   
4808 O O   . SER F 65  ? 1.34910 0.91870 0.96340 -0.25350 0.01400  -0.08490 974  SER F O   
4809 C CB  . SER F 65  ? 1.00910 0.66420 0.75780 -0.31020 -0.00150 -0.11770 974  SER F CB  
4810 O OG  . SER F 65  ? 1.23850 0.76240 0.87220 -0.34020 0.04210  -0.12040 974  SER F OG  
4811 N N   . SER F 66  ? 1.32530 0.72560 0.80910 -0.22680 0.05550  -0.06320 975  SER F N   
4812 C CA  . SER F 66  ? 1.57230 0.84680 0.92390 -0.21820 0.08770  -0.04960 975  SER F CA  
4813 C C   . SER F 66  ? 1.46310 0.78460 0.83160 -0.16450 0.06460  -0.03290 975  SER F C   
4814 O O   . SER F 66  ? 1.52820 0.86150 0.88980 -0.18940 0.06670  -0.04130 975  SER F O   
4815 C CB  . SER F 66  ? 1.72430 0.85670 0.95420 -0.18890 0.11870  -0.02990 975  SER F CB  
4816 O OG  . SER F 66  ? 1.81520 0.92330 1.04870 -0.22590 0.13260  -0.04330 975  SER F OG  
4817 N N   . VAL F 67  ? 1.43700 0.79430 0.83490 -0.09460 0.04200  -0.01240 976  VAL F N   
4818 C CA  . VAL F 67  ? 1.46270 0.86060 0.87170 -0.03110 0.01950  0.00520  976  VAL F CA  
4819 C C   . VAL F 67  ? 1.30750 0.82900 0.81970 -0.05950 -0.00830 -0.01210 976  VAL F C   
4820 O O   . VAL F 67  ? 1.40510 0.91070 0.87950 -0.04970 -0.00610 -0.00760 976  VAL F O   
4821 C CB  . VAL F 67  ? 1.45460 0.89910 0.90590 0.03960  -0.00390 0.02250  976  VAL F CB  
4822 C CG1 . VAL F 67  ? 1.45690 0.96030 0.93410 0.10360  -0.03020 0.03620  976  VAL F CG1 
4823 C CG2 . VAL F 67  ? 1.50940 0.82650 0.85050 0.06880  0.02420  0.03830  976  VAL F CG2 
4824 N N   . LEU F 68  ? 1.18980 0.82300 0.82060 -0.09540 -0.03220 -0.03200 977  LEU F N   
4825 C CA  . LEU F 68  ? 1.20950 0.97080 0.94910 -0.11930 -0.06400 -0.04990 977  LEU F CA  
4826 C C   . LEU F 68  ? 1.27050 0.99180 0.95950 -0.17260 -0.04300 -0.06570 977  LEU F C   
4827 O O   . LEU F 68  ? 1.26860 1.04280 0.98460 -0.16350 -0.05930 -0.06690 977  LEU F O   
4828 C CB  . LEU F 68  ? 1.12900 0.99450 0.98620 -0.15320 -0.08860 -0.07000 977  LEU F CB  
4829 C CG  . LEU F 68  ? 0.92180 0.87010 0.86320 -0.10360 -0.12020 -0.05790 977  LEU F CG  
4830 C CD1 . LEU F 68  ? 0.84200 0.87920 0.88700 -0.14370 -0.14130 -0.07890 977  LEU F CD1 
4831 C CD2 . LEU F 68  ? 0.76140 0.79220 0.75730 -0.05400 -0.15150 -0.04740 977  LEU F CD2 
4832 N N   . ASN F 69  ? 1.27210 0.90460 0.89030 -0.22660 -0.00750 -0.07810 978  ASN F N   
4833 C CA  . ASN F 69  ? 1.45920 1.05300 1.02790 -0.28630 0.01660  -0.09700 978  ASN F CA  
4834 C C   . ASN F 69  ? 1.60920 1.11310 1.07040 -0.25300 0.03580  -0.07560 978  ASN F C   
4835 O O   . ASN F 69  ? 1.63790 1.16940 1.10250 -0.27690 0.03480  -0.08620 978  ASN F O   
4836 C CB  . ASN F 69  ? 1.60220 1.11700 1.11540 -0.34980 0.05220  -0.11560 978  ASN F CB  
4837 C CG  . ASN F 69  ? 1.43980 1.04870 1.06010 -0.38620 0.03180  -0.14080 978  ASN F CG  
4838 O OD1 . ASN F 69  ? 1.28720 1.02830 1.02310 -0.39000 -0.00230 -0.15440 978  ASN F OD1 
4839 N ND2 . ASN F 69  ? 1.30720 0.85370 0.89310 -0.40220 0.05200  -0.14330 978  ASN F ND2 
4840 N N   . ASP F 70  ? 1.67670 1.07860 1.04600 -0.19840 0.05160  -0.04750 979  ASP F N   
4841 C CA  . ASP F 70  ? 1.83510 1.14330 1.09420 -0.15160 0.06700  -0.02330 979  ASP F CA  
4842 C C   . ASP F 70  ? 1.82330 1.24470 1.16330 -0.11040 0.02890  -0.01910 979  ASP F C   
4843 O O   . ASP F 70  ? 1.89770 1.30620 1.20240 -0.12350 0.03590  -0.02170 979  ASP F O   
4844 C CB  . ASP F 70  ? 1.87980 1.07900 1.04550 -0.09260 0.08220  0.00340  979  ASP F CB  
4845 C CG  . ASP F 70  ? 2.04970 1.13610 1.08690 -0.04190 0.09980  0.02780  979  ASP F CG  
4846 O OD1 . ASP F 70  ? 2.20670 1.23570 1.17510 -0.07490 0.12170  0.02370  979  ASP F OD1 
4847 O OD2 . ASP F 70  ? 2.02930 1.08410 1.03270 0.03060  0.09190  0.04980  979  ASP F OD2 
4848 N N   . ILE F 71  ? 1.81760 1.34960 1.26570 -0.06750 -0.00970 -0.01490 980  ILE F N   
4849 C CA  . ILE F 71  ? 1.64590 1.29210 1.17900 -0.02070 -0.04940 -0.01000 980  ILE F CA  
4850 C C   . ILE F 71  ? 1.50040 1.23260 1.10160 -0.07290 -0.06280 -0.03370 980  ILE F C   
4851 O O   . ILE F 71  ? 1.49830 1.25510 1.09610 -0.04740 -0.07390 -0.02830 980  ILE F O   
4852 C CB  . ILE F 71  ? 1.48530 1.23610 1.12730 0.02120  -0.08540 -0.00560 980  ILE F CB  
4853 C CG1 . ILE F 71  ? 1.56660 1.23860 1.13520 0.08790  -0.07510 0.01940  980  ILE F CG1 
4854 C CG2 . ILE F 71  ? 1.24800 1.13730 1.00170 0.04730  -0.12810 -0.00960 980  ILE F CG2 
4855 C CD1 . ILE F 71  ? 1.45980 1.21460 1.11960 0.11850  -0.10090 0.02210  980  ILE F CD1 
4856 N N   . LEU F 72  ? 1.42000 1.19400 1.07630 -0.14170 -0.06140 -0.05990 981  LEU F N   
4857 C CA  . LEU F 72  ? 1.38910 1.25190 1.11550 -0.19520 -0.07540 -0.08720 981  LEU F CA  
4858 C C   . LEU F 72  ? 1.56530 1.34150 1.18730 -0.22240 -0.04270 -0.08890 981  LEU F C   
4859 O O   . LEU F 72  ? 1.65830 1.50160 1.31850 -0.22700 -0.05940 -0.09740 981  LEU F O   
4860 C CB  . LEU F 72  ? 1.18710 1.09650 0.97840 -0.26010 -0.07710 -0.11590 981  LEU F CB  
4861 C CG  . LEU F 72  ? 1.14870 1.16820 1.06260 -0.24330 -0.11550 -0.12000 981  LEU F CG  
4862 C CD1 . LEU F 72  ? 0.98560 1.03100 0.94310 -0.30740 -0.11240 -0.14860 981  LEU F CD1 
4863 C CD2 . LEU F 72  ? 0.94880 1.10320 0.97380 -0.21650 -0.16160 -0.12310 981  LEU F CD2 
4864 N N   . SER F 73  ? 1.61630 1.24830 1.11020 -0.24100 0.00240  -0.08140 982  SER F N   
4865 C CA  . SER F 73  ? 1.77450 1.29970 1.14740 -0.26610 0.04000  -0.07950 982  SER F CA  
4866 C C   . SER F 73  ? 1.86380 1.36530 1.18900 -0.19740 0.03160  -0.05320 982  SER F C   
4867 O O   . SER F 73  ? 1.94370 1.44830 1.24480 -0.21340 0.03670  -0.05850 982  SER F O   
4868 C CB  . SER F 73  ? 1.82550 1.19640 1.07040 -0.29390 0.08820  -0.07450 982  SER F CB  
4869 O OG  . SER F 73  ? 1.70570 1.10020 0.99160 -0.36330 0.09780  -0.10300 982  SER F OG  
4870 N N   . ARG F 74  ? 1.88520 1.36710 1.19780 -0.12310 0.01900  -0.02750 983  ARG F N   
4871 C CA  . ARG F 74  ? 1.91560 1.37830 1.18450 -0.04800 0.00800  -0.00300 983  ARG F CA  
4872 C C   . ARG F 74  ? 1.80770 1.42050 1.19660 -0.03580 -0.03400 -0.01330 983  ARG F C   
4873 O O   . ARG F 74  ? 1.85920 1.45470 1.20310 -0.01330 -0.03300 -0.00560 983  ARG F O   
4874 C CB  . ARG F 74  ? 1.91800 1.34750 1.16480 0.02770  -0.00050 0.02120  983  ARG F CB  
4875 C CG  . ARG F 74  ? 2.05130 1.30420 1.14010 0.03970  0.04180  0.03920  983  ARG F CG  
4876 C CD  . ARG F 74  ? 2.10220 1.32670 1.17200 0.11240  0.03300  0.05970  983  ARG F CD  
4877 N NE  . ARG F 74  ? 2.35760 1.42240 1.29340 0.10660  0.07310  0.07050  983  ARG F NE  
4878 C CZ  . ARG F 74  ? 2.43570 1.43740 1.31790 0.16510  0.07560  0.08850  983  ARG F CZ  
4879 N NH1 . ARG F 74  ? 2.35990 1.44770 1.31200 0.23490  0.04110  0.09740  983  ARG F NH1 
4880 N NH2 . ARG F 74  ? 2.55560 1.40890 1.31370 0.15300  0.11290  0.09620  983  ARG F NH2 
4881 N N   . LEU F 75  ? 1.77840 1.52900 1.31020 -0.05000 -0.06940 -0.03010 984  LEU F N   
4882 C CA  . LEU F 75  ? 1.57580 1.47650 1.23200 -0.03960 -0.11310 -0.04170 984  LEU F CA  
4883 C C   . LEU F 75  ? 1.60770 1.52800 1.26110 -0.09640 -0.10530 -0.06230 984  LEU F C   
4884 O O   . LEU F 75  ? 1.53940 1.52100 1.22400 -0.07070 -0.12690 -0.06130 984  LEU F O   
4885 C CB  . LEU F 75  ? 1.36960 1.39500 1.16590 -0.05300 -0.14760 -0.05690 984  LEU F CB  
4886 C CG  . LEU F 75  ? 1.35070 1.43230 1.20630 0.01660  -0.17730 -0.03990 984  LEU F CG  
4887 C CD1 . LEU F 75  ? 1.25950 1.44600 1.23880 -0.00760 -0.20480 -0.05560 984  LEU F CD1 
4888 C CD2 . LEU F 75  ? 1.29510 1.44800 1.18960 0.07230  -0.20720 -0.03160 984  LEU F CD2 
4889 N N   . ASP F 76  ? 1.65910 1.53590 1.28120 -0.17030 -0.07660 -0.08210 985  ASP F N   
4890 C CA  . ASP F 76  ? 1.70230 1.58910 1.31150 -0.23310 -0.06270 -0.10550 985  ASP F CA  
4891 C C   . ASP F 76  ? 1.82950 1.61500 1.31490 -0.21230 -0.03550 -0.08750 985  ASP F C   
4892 O O   . ASP F 76  ? 1.88180 1.72230 1.38970 -0.22360 -0.04560 -0.09790 985  ASP F O   
4893 C CB  . ASP F 76  ? 1.83350 1.67430 1.41480 -0.31270 -0.03090 -0.12920 985  ASP F CB  
4894 C CG  . ASP F 76  ? 1.81990 1.77660 1.52970 -0.34770 -0.05920 -0.15600 985  ASP F CG  
4895 O OD1 . ASP F 76  ? 1.72740 1.80610 1.55240 -0.31590 -0.10450 -0.15770 985  ASP F OD1 
4896 O OD2 . ASP F 76  ? 1.88950 1.81170 1.58080 -0.40670 -0.03560 -0.17590 985  ASP F OD2 
4897 N N   . LYS F 77  ? 1.85270 1.49350 1.20940 -0.18230 -0.00280 -0.06200 986  LYS F N   
4898 C CA  . LYS F 77  ? 1.93820 1.45760 1.15570 -0.15980 0.02710  -0.04230 986  LYS F CA  
4899 C C   . LYS F 77  ? 2.00060 1.57870 1.24940 -0.08080 -0.00700 -0.02460 986  LYS F C   
4900 O O   . LYS F 77  ? 2.11320 1.66650 1.30790 -0.07730 0.00140  -0.02140 986  LYS F O   
4901 C CB  . LYS F 77  ? 1.99810 1.34530 1.07160 -0.15400 0.07030  -0.02310 986  LYS F CB  
4902 C CG  . LYS F 77  ? 2.00470 1.28740 1.03250 -0.24180 0.10950  -0.04420 986  LYS F CG  
4903 C CD  . LYS F 77  ? 2.10150 1.21090 0.98560 -0.24660 0.15460  -0.02860 986  LYS F CD  
4904 C CE  . LYS F 77  ? 2.11050 1.19950 0.99500 -0.33420 0.18240  -0.05570 986  LYS F CE  
4905 N NZ  . LYS F 77  ? 2.25230 1.16430 0.98730 -0.34890 0.23060  -0.04330 986  LYS F NZ  
4906 N N   . VAL F 78  ? 1.97420 1.63610 1.31330 -0.02360 -0.04470 -0.01620 987  VAL F N   
4907 C CA  . VAL F 78  ? 1.93480 1.66930 1.31950 0.05320  -0.08100 -0.00270 987  VAL F CA  
4908 C C   . VAL F 78  ? 1.77930 1.65490 1.27810 0.02660  -0.11270 -0.02490 987  VAL F C   
4909 O O   . VAL F 78  ? 1.86040 1.74970 1.34120 0.06070  -0.12220 -0.01810 987  VAL F O   
4910 C CB  . VAL F 78  ? 1.83090 1.61730 1.28110 0.11640  -0.11000 0.00960  987  VAL F CB  
4911 C CG1 . VAL F 78  ? 1.71850 1.62120 1.25630 0.17980  -0.15420 0.01360  987  VAL F CG1 
4912 C CG2 . VAL F 78  ? 1.89850 1.54220 1.22220 0.16070  -0.08180 0.03430  987  VAL F CG2 
4913 N N   . GLU F 79  ? 1.76950 1.13080 1.52550 0.14180  -0.07290 0.05680  988  GLU F N   
4914 C CA  . GLU F 79  ? 1.77860 1.17710 1.53400 0.18550  -0.08280 0.06770  988  GLU F CA  
4915 C C   . GLU F 79  ? 1.93540 1.28070 1.58310 0.16160  -0.08940 0.07930  988  GLU F C   
4916 O O   . GLU F 79  ? 1.93990 1.25220 1.56550 0.16740  -0.08990 0.08190  988  GLU F O   
4917 C CB  . GLU F 79  ? 1.67110 1.13900 1.45870 0.22390  -0.09010 0.07440  988  GLU F CB  
4918 C CG  . GLU F 79  ? 1.51670 1.07530 1.42080 0.21470  -0.07230 0.06650  988  GLU F CG  
4919 C CD  . GLU F 79  ? 1.69440 1.32440 1.63130 0.24300  -0.07780 0.07130  988  GLU F CD  
4920 O OE1 . GLU F 79  ? 1.77430 1.46050 1.70080 0.28210  -0.08740 0.07860  988  GLU F OE1 
4921 O OE2 . GLU F 79  ? 1.69420 1.34150 1.67030 0.22740  -0.06940 0.06880  988  GLU F OE2 
4922 N N   . LEU F 90  ? 0.73600 0.91540 0.77250 -0.02700 -0.07120 0.03490  1166 LEU F N   
4923 C CA  . LEU F 90  ? 0.72790 0.83960 0.77370 -0.01520 -0.07540 0.02860  1166 LEU F CA  
4924 C C   . LEU F 90  ? 0.73420 0.95230 0.77430 -0.07230 -0.06790 0.02660  1166 LEU F C   
4925 O O   . LEU F 90  ? 0.87520 1.10510 0.84860 -0.15400 -0.05840 0.02220  1166 LEU F O   
4926 C CB  . LEU F 90  ? 0.80510 0.72490 0.77980 -0.03580 -0.07580 0.01830  1166 LEU F CB  
4927 C CG  . LEU F 90  ? 0.86750 0.66690 0.84920 0.02460  -0.08460 0.02030  1166 LEU F CG  
4928 C CD1 . LEU F 90  ? 0.86790 0.48760 0.78640 0.01240  -0.08480 0.01110  1166 LEU F CD1 
4929 C CD2 . LEU F 90  ? 0.70250 0.54450 0.77420 0.11330  -0.09660 0.02910  1166 LEU F CD2 
4930 N N   . GLY F 91  ? 0.85100 1.13840 0.95520 -0.03260 -0.07240 0.02990  1167 GLY F N   
4931 C CA  . GLY F 91  ? 0.86560 1.24790 0.97180 -0.07830 -0.06670 0.02800  1167 GLY F CA  
4932 C C   . GLY F 91  ? 0.92820 1.18590 0.96300 -0.13490 -0.06310 0.01510  1167 GLY F C   
4933 O O   . GLY F 91  ? 0.92770 1.02700 0.93990 -0.10800 -0.06810 0.00880  1167 GLY F O   
4934 N N   . ASP F 92  ? 1.03390 1.36340 1.03180 -0.21050 -0.05460 0.01190  1168 ASP F N   
4935 C CA  . ASP F 92  ? 1.10880 1.33290 1.03080 -0.27260 -0.04990 -0.00060 1168 ASP F CA  
4936 C C   . ASP F 92  ? 1.08270 1.32280 1.05680 -0.23490 -0.05460 -0.00180 1168 ASP F C   
4937 O O   . ASP F 92  ? 0.88510 1.27590 0.93610 -0.20380 -0.05690 0.00720  1168 ASP F O   
4938 C CB  . ASP F 92  ? 1.09150 1.38630 0.94580 -0.37490 -0.03940 -0.00270 1168 ASP F CB  
4939 C CG  . ASP F 92  ? 1.21950 1.38430 0.97630 -0.44480 -0.03420 -0.01630 1168 ASP F CG  
4940 O OD1 . ASP F 92  ? 1.32210 1.32390 1.05360 -0.41300 -0.03750 -0.02450 1168 ASP F OD1 
4941 O OD2 . ASP F 92  ? 1.21780 1.44580 0.92140 -0.53040 -0.02670 -0.01800 1168 ASP F OD2 
4942 N N   . ILE F 93  ? 1.17420 1.26140 1.10660 -0.23310 -0.05610 -0.01190 1169 ILE F N   
4943 C CA  . ILE F 93  ? 1.01820 1.09380 0.98950 -0.19910 -0.06050 -0.01440 1169 ILE F CA  
4944 C C   . ILE F 93  ? 1.04310 1.03420 0.92750 -0.26980 -0.05300 -0.02710 1169 ILE F C   
4945 O O   . ILE F 93  ? 0.97390 0.97670 0.88400 -0.25650 -0.05470 -0.02950 1169 ILE F O   
4946 C CB  . ILE F 93  ? 0.97500 0.95000 0.99230 -0.10970 -0.07140 -0.01220 1169 ILE F CB  
4947 C CG1 . ILE F 93  ? 1.01890 0.81620 0.96920 -0.10630 -0.07150 -0.01790 1169 ILE F CG1 
4948 C CG2 . ILE F 93  ? 0.95130 1.03630 1.06510 -0.03820 -0.07990 0.00090  1169 ILE F CG2 
4949 C CD1 . ILE F 93  ? 1.21940 0.86870 1.09700 -0.12950 -0.06780 -0.02920 1169 ILE F CD1 
4950 N N   . SER F 94  ? 1.05450 0.96590 0.83790 -0.34300 -0.04490 -0.03450 1170 SER F N   
4951 C CA  . SER F 94  ? 1.16380 0.97130 0.84530 -0.41470 -0.03720 -0.04740 1170 SER F CA  
4952 C C   . SER F 94  ? 1.14440 1.08170 0.84360 -0.45870 -0.03400 -0.04750 1170 SER F C   
4953 O O   . SER F 94  ? 1.22550 1.08370 0.86920 -0.49050 -0.03050 -0.05750 1170 SER F O   
4954 C CB  . SER F 94  ? 1.28030 1.00390 0.85170 -0.49070 -0.02950 -0.05330 1170 SER F CB  
4955 O OG  . SER F 94  ? 1.27250 1.14740 0.84930 -0.54620 -0.02560 -0.04640 1170 SER F OG  
4956 N N   . GLY F 95  ? 1.14040 1.26900 0.91330 -0.45650 -0.03490 -0.03630 1171 GLY F N   
4957 C CA  . GLY F 95  ? 1.14090 1.42220 0.94760 -0.48880 -0.03260 -0.03320 1171 GLY F CA  
4958 C C   . GLY F 95  ? 1.06520 1.35130 0.93940 -0.42690 -0.03860 -0.03360 1171 GLY F C   
4959 O O   . GLY F 95  ? 1.03380 1.38940 0.90680 -0.46470 -0.03570 -0.03580 1171 GLY F O   
4960 N N   . ILE F 96  ? 1.03440 1.25680 0.96660 -0.33710 -0.04720 -0.03060 1172 ILE F N   
4961 C CA  . ILE F 96  ? 0.89700 1.10550 0.88940 -0.27530 -0.05410 -0.03070 1172 ILE F CA  
4962 C C   . ILE F 96  ? 1.05320 1.11010 0.96100 -0.31140 -0.04970 -0.04470 1172 ILE F C   
4963 O O   . ILE F 96  ? 1.20960 1.11090 1.03960 -0.32450 -0.04700 -0.05210 1172 ILE F O   
4964 C CB  . ILE F 96  ? 0.82150 0.99470 0.88850 -0.17590 -0.06510 -0.02300 1172 ILE F CB  
4965 C CG1 . ILE F 96  ? 0.72110 1.05880 0.88060 -0.13120 -0.07000 -0.00880 1172 ILE F CG1 
4966 C CG2 . ILE F 96  ? 0.91310 1.01470 1.01000 -0.12420 -0.07160 -0.02560 1172 ILE F CG2 
4967 C CD1 . ILE F 96  ? 0.84870 1.19890 0.99920 -0.12990 -0.06910 -0.00350 1172 ILE F CD1 
4968 N N   . ASN F 97  ? 1.02090 1.12260 0.93790 -0.32890 -0.04830 -0.04800 1173 ASN F N   
4969 C CA  . ASN F 97  ? 1.13450 1.09820 0.97510 -0.35610 -0.04410 -0.06110 1173 ASN F CA  
4970 C C   . ASN F 97  ? 1.06770 1.08550 0.97700 -0.31410 -0.04890 -0.05940 1173 ASN F C   
4971 O O   . ASN F 97  ? 1.05580 1.24000 1.04340 -0.30510 -0.05160 -0.05060 1173 ASN F O   
4972 C CB  . ASN F 97  ? 1.32330 1.26080 1.05270 -0.46280 -0.03320 -0.07100 1173 ASN F CB  
4973 C CG  . ASN F 97  ? 1.54440 1.32400 1.16960 -0.49600 -0.02830 -0.07840 1173 ASN F CG  
4974 O OD1 . ASN F 97  ? 1.53570 1.16150 1.13450 -0.44990 -0.03010 -0.08270 1173 ASN F OD1 
4975 N ND2 . ASN F 97  ? 1.69050 1.50950 1.25500 -0.57560 -0.02210 -0.07890 1173 ASN F ND2 
4976 N N   . ALA F 98  ? 1.02630 0.90600 0.90670 -0.28510 -0.05000 -0.06680 1174 ALA F N   
4977 C CA  . ALA F 98  ? 0.96390 0.86540 0.89640 -0.24550 -0.05430 -0.06660 1174 ALA F CA  
4978 C C   . ALA F 98  ? 1.01750 0.88260 0.86660 -0.31900 -0.04510 -0.07890 1174 ALA F C   
4979 O O   . ALA F 98  ? 1.09320 0.80670 0.83440 -0.35700 -0.03810 -0.09000 1174 ALA F O   
4980 C CB  . ALA F 98  ? 0.98730 0.76530 0.93910 -0.16670 -0.06130 -0.06540 1174 ALA F CB  
4981 N N   . SER F 99  ? 1.03070 1.03190 0.92520 -0.33910 -0.04510 -0.07640 1175 SER F N   
4982 C CA  . SER F 99  ? 1.17030 1.15690 0.99760 -0.40620 -0.03760 -0.08710 1175 SER F CA  
4983 C C   . SER F 99  ? 1.21630 1.08350 1.03480 -0.35910 -0.03930 -0.09340 1175 SER F C   
4984 O O   . SER F 99  ? 1.16580 1.02610 1.06240 -0.27400 -0.04820 -0.08570 1175 SER F O   
4985 C CB  . SER F 99  ? 1.09190 1.27390 0.98030 -0.43570 -0.03780 -0.08030 1175 SER F CB  
4986 O OG  . SER F 99  ? 0.98810 1.30410 0.99910 -0.36520 -0.04660 -0.06560 1175 SER F OG  
4987 N N   . VAL F 100 ? 1.21820 0.99540 0.94180 -0.41330 -0.03130 -0.10630 1176 VAL F N   
4988 C CA  . VAL F 100 ? 1.23200 0.90520 0.93930 -0.37520 -0.03130 -0.11290 1176 VAL F CA  
4989 C C   . VAL F 100 ? 1.25250 1.04540 1.00050 -0.39690 -0.03130 -0.11310 1176 VAL F C   
4990 O O   . VAL F 100 ? 1.24670 1.19100 1.02580 -0.44340 -0.03080 -0.10830 1176 VAL F O   
4991 C CB  . VAL F 100 ? 1.30800 0.77650 0.87240 -0.41090 -0.02170 -0.12750 1176 VAL F CB  
4992 C CG1 . VAL F 100 ? 1.36180 0.72160 0.89900 -0.37470 -0.02180 -0.12410 1176 VAL F CG1 
4993 C CG2 . VAL F 100 ? 1.36460 0.83860 0.83100 -0.50350 -0.00980 -0.13260 1176 VAL F CG2 
4994 N N   . VAL F 101 ? 1.31970 1.05530 1.07390 -0.35880 -0.03240 -0.11690 1177 VAL F N   
4995 C CA  . VAL F 101 ? 1.22670 1.06340 1.01910 -0.37290 -0.03270 -0.11750 1177 VAL F CA  
4996 C C   . VAL F 101 ? 1.27930 0.97070 0.95760 -0.41010 -0.02370 -0.13300 1177 VAL F C   
4997 O O   . VAL F 101 ? 1.30810 0.83310 0.92500 -0.37790 -0.02120 -0.13870 1177 VAL F O   
4998 C CB  . VAL F 101 ? 1.10190 1.02840 1.02600 -0.28360 -0.04410 -0.10520 1177 VAL F CB  
4999 C CG1 . VAL F 101 ? 1.20000 0.98770 1.12080 -0.21080 -0.04740 -0.10620 1177 VAL F CG1 
5000 C CG2 . VAL F 101 ? 0.98590 1.04650 0.96130 -0.30080 -0.04500 -0.10350 1177 VAL F CG2 
5001 N N   . ASN F 102 ? 1.35330 1.10590 0.99990 -0.47640 -0.01880 -0.13920 1178 ASN F N   
5002 C CA  . ASN F 102 ? 1.54790 1.17550 1.08480 -0.51700 -0.01010 -0.15430 1178 ASN F CA  
5003 C C   . ASN F 102 ? 1.41780 1.16000 1.02050 -0.51080 -0.01280 -0.15240 1178 ASN F C   
5004 O O   . ASN F 102 ? 1.36400 1.25270 0.99120 -0.56830 -0.01260 -0.14950 1178 ASN F O   
5005 C CB  . ASN F 102 ? 1.72700 1.31080 1.14580 -0.59050 0.00470  -0.15290 1178 ASN F CB  
5006 C CG  . ASN F 102 ? 1.91010 1.33860 1.21730 -0.58890 0.01730  -0.15580 1178 ASN F CG  
5007 O OD1 . ASN F 102 ? 1.92610 1.29690 1.24410 -0.54320 0.01530  -0.16080 1178 ASN F OD1 
5008 N ND2 . ASN F 102 ? 2.01900 1.38350 1.21850 -0.63680 0.03040  -0.15100 1178 ASN F ND2 
5009 N N   . ILE F 103 ? 1.33630 1.02070 0.97070 -0.44050 -0.01580 -0.15240 1179 ILE F N   
5010 C CA  . ILE F 103 ? 1.25440 1.02750 0.95160 -0.42230 -0.01880 -0.15070 1179 ILE F CA  
5011 C C   . ILE F 103 ? 1.37620 0.98870 0.98770 -0.41010 -0.01230 -0.16300 1179 ILE F C   
5012 O O   . ILE F 103 ? 1.37360 1.03050 1.04030 -0.37340 -0.01560 -0.16090 1179 ILE F O   
5013 C CB  . ILE F 103 ? 1.10590 1.00330 0.95670 -0.33400 -0.03160 -0.13400 1179 ILE F CB  
5014 C CG1 . ILE F 103 ? 1.00860 0.79350 0.87970 -0.24770 -0.03670 -0.12940 1179 ILE F CG1 
5015 C CG2 . ILE F 103 ? 1.08380 1.14690 1.01220 -0.34830 -0.03670 -0.12230 1179 ILE F CG2 
5016 C CD1 . ILE F 103 ? 0.87190 0.75100 0.87650 -0.16210 -0.04930 -0.11480 1179 ILE F CD1 
5017 N N   . GLN F 104 ? 1.58600 1.01810 1.06410 -0.43900 -0.00310 -0.17510 1180 GLN F N   
5018 C CA  . GLN F 104 ? 1.68210 0.97230 1.08130 -0.40760 0.00630  -0.17740 1180 GLN F CA  
5019 C C   . GLN F 104 ? 1.67130 0.99670 1.03310 -0.46040 0.01210  -0.18440 1180 GLN F C   
5020 O O   . GLN F 104 ? 1.72250 0.98130 1.06630 -0.42270 0.01480  -0.18740 1180 GLN F O   
5021 C CB  . GLN F 104 ? 1.78640 0.95720 1.08780 -0.40480 0.01790  -0.16860 1180 GLN F CB  
5022 C CG  . GLN F 104 ? 1.82940 0.88630 1.07030 -0.35960 0.02600  -0.16470 1180 GLN F CG  
5023 C CD  . GLN F 104 ? 1.72450 0.78110 1.05040 -0.26740 0.01770  -0.16040 1180 GLN F CD  
5024 O OE1 . GLN F 104 ? 1.68700 0.77350 1.04940 -0.25370 0.01430  -0.16630 1180 GLN F OE1 
5025 N NE2 . GLN F 104 ? 1.72300 0.75890 1.08510 -0.20460 0.01460  -0.14820 1180 GLN F NE2 
5026 N N   . LYS F 105 ? 1.61720 1.05420 0.97310 -0.53900 0.01440  -0.18380 1181 LYS F N   
5027 C CA  . LYS F 105 ? 1.69810 1.19420 1.03220 -0.58800 0.01970  -0.18670 1181 LYS F CA  
5028 C C   . LYS F 105 ? 1.60880 1.20250 1.05320 -0.55240 0.00630  -0.19370 1181 LYS F C   
5029 O O   . LYS F 105 ? 1.66350 1.19280 1.07930 -0.53300 0.00930  -0.20080 1181 LYS F O   
5030 C CB  . LYS F 105 ? 1.63130 1.23980 0.94300 -0.66910 0.02680  -0.17800 1181 LYS F CB  
5031 C CG  . LYS F 105 ? 1.79270 1.31210 0.96810 -0.72810 0.04470  -0.17530 1181 LYS F CG  
5032 C CD  . LYS F 105 ? 1.96420 1.29820 1.02770 -0.71400 0.05440  -0.17380 1181 LYS F CD  
5033 C CE  . LYS F 105 ? 2.01370 1.20970 1.00210 -0.68700 0.06180  -0.17790 1181 LYS F CE  
5034 N NZ  . LYS F 105 ? 2.13990 1.21620 0.98760 -0.72860 0.07770  -0.17110 1181 LYS F NZ  
5035 N N   . GLU F 106 ? 1.44700 1.20470 1.02950 -0.51400 -0.00450 -0.17860 1182 GLU F N   
5036 C CA  . GLU F 106 ? 1.26570 1.16000 0.98270 -0.45170 -0.01360 -0.16730 1182 GLU F CA  
5037 C C   . GLU F 106 ? 1.19230 0.97850 0.92460 -0.36420 -0.01590 -0.16690 1182 GLU F C   
5038 O O   . GLU F 106 ? 1.10610 0.94060 0.88380 -0.33940 -0.01830 -0.16570 1182 GLU F O   
5039 C CB  . GLU F 106 ? 1.11590 1.17900 0.96670 -0.41550 -0.02420 -0.14970 1182 GLU F CB  
5040 C CG  . GLU F 106 ? 1.13910 1.35590 1.00260 -0.49100 -0.02310 -0.14620 1182 GLU F CG  
5041 C CD  . GLU F 106 ? 1.16190 1.35910 0.97610 -0.53460 -0.02010 -0.14610 1182 GLU F CD  
5042 O OE1 . GLU F 106 ? 1.08650 1.43720 0.97060 -0.54270 -0.02350 -0.13370 1182 GLU F OE1 
5043 O OE2 . GLU F 106 ? 1.20030 1.22730 0.90420 -0.55570 -0.01340 -0.15710 1182 GLU F OE2 
5044 N N   . ILE F 107 ? 1.20050 0.85360 0.89830 -0.31920 -0.01530 -0.16690 1183 ILE F N   
5045 C CA  . ILE F 107 ? 1.20260 0.74250 0.90240 -0.23630 -0.01650 -0.16570 1183 ILE F CA  
5046 C C   . ILE F 107 ? 1.36830 0.79240 0.95830 -0.26410 -0.00570 -0.18080 1183 ILE F C   
5047 O O   . ILE F 107 ? 1.36430 0.79650 0.99610 -0.21320 -0.00820 -0.17820 1183 ILE F O   
5048 C CB  . ILE F 107 ? 1.24170 0.65570 0.90660 -0.19520 -0.01630 -0.16340 1183 ILE F CB  
5049 C CG1 . ILE F 107 ? 1.12530 0.65180 0.89890 -0.16470 -0.02740 -0.14830 1183 ILE F CG1 
5050 C CG2 . ILE F 107 ? 1.30510 0.60080 0.95800 -0.11580 -0.01600 -0.16190 1183 ILE F CG2 
5051 C CD1 . ILE F 107 ? 1.16690 0.58030 0.90260 -0.13670 -0.02690 -0.14640 1183 ILE F CD1 
5052 N N   . ASP F 108 ? 1.57600 0.89460 1.02720 -0.34300 0.00570  -0.19590 1184 ASP F N   
5053 C CA  . ASP F 108 ? 1.73330 0.94700 1.07300 -0.36900 0.01800  -0.20420 1184 ASP F CA  
5054 C C   . ASP F 108 ? 1.65260 0.97250 1.02960 -0.40380 0.01500  -0.21240 1184 ASP F C   
5055 O O   . ASP F 108 ? 1.68340 0.94770 1.04180 -0.37030 0.01800  -0.21680 1184 ASP F O   
5056 C CB  . ASP F 108 ? 1.90670 1.05710 1.13430 -0.42730 0.03120  -0.19810 1184 ASP F CB  
5057 C CG  . ASP F 108 ? 1.99740 1.05240 1.19270 -0.38250 0.03450  -0.18650 1184 ASP F CG  
5058 O OD1 . ASP F 108 ? 2.02330 1.02640 1.24600 -0.30200 0.03230  -0.17970 1184 ASP F OD1 
5059 O OD2 . ASP F 108 ? 2.07190 1.12200 1.22220 -0.42800 0.03890  -0.18240 1184 ASP F OD2 
5060 N N   . ARG F 109 ? 1.48370 0.97680 0.93200 -0.45270 0.00950  -0.20610 1185 ARG F N   
5061 C CA  . ARG F 109 ? 1.47410 1.11820 0.98340 -0.48200 0.00660  -0.20430 1185 ARG F CA  
5062 C C   . ARG F 109 ? 1.37000 1.07630 0.99610 -0.39050 -0.00170 -0.19380 1185 ARG F C   
5063 O O   . ARG F 109 ? 1.33350 1.05410 0.95190 -0.39780 0.00060  -0.19890 1185 ARG F O   
5064 C CB  . ARG F 109 ? 1.38190 1.20910 0.96030 -0.53440 0.00130  -0.19530 1185 ARG F CB  
5065 C CG  . ARG F 109 ? 1.19100 1.19890 0.85400 -0.55320 -0.00320 -0.18940 1185 ARG F CG  
5066 C CD  . ARG F 109 ? 1.37890 1.40610 0.95340 -0.64530 0.00790  -0.19360 1185 ARG F CD  
5067 N NE  . ARG F 109 ? 1.38920 1.55940 1.03310 -0.64710 0.00650  -0.18650 1185 ARG F NE  
5068 C CZ  . ARG F 109 ? 1.39150 1.51640 0.99870 -0.65350 0.00960  -0.19630 1185 ARG F CZ  
5069 N NH1 . ARG F 109 ? 1.47430 1.40770 0.97000 -0.65330 0.01580  -0.21300 1185 ARG F NH1 
5070 N NH2 . ARG F 109 ? 1.23060 1.49810 0.90960 -0.65030 0.00870  -0.18640 1185 ARG F NH2 
5071 N N   . LEU F 110 ? 1.31810 1.05800 1.04450 -0.31000 -0.01130 -0.17960 1186 LEU F N   
5072 C CA  . LEU F 110 ? 1.12320 0.91830 0.96190 -0.22010 -0.02080 -0.16760 1186 LEU F CA  
5073 C C   . LEU F 110 ? 1.35050 0.99130 1.11370 -0.18340 -0.01400 -0.17610 1186 LEU F C   
5074 O O   . LEU F 110 ? 1.37800 1.06070 1.17460 -0.16440 -0.01520 -0.17570 1186 LEU F O   
5075 C CB  . LEU F 110 ? 0.96050 0.79500 0.89710 -0.14990 -0.03190 -0.15160 1186 LEU F CB  
5076 C CG  . LEU F 110 ? 0.99570 1.01120 1.04040 -0.15930 -0.04120 -0.13890 1186 LEU F CG  
5077 C CD1 . LEU F 110 ? 1.07490 1.11150 1.20980 -0.08300 -0.05250 -0.12350 1186 LEU F CD1 
5078 C CD2 . LEU F 110 ? 0.70490 0.87810 0.83340 -0.16410 -0.04610 -0.13320 1186 LEU F CD2 
5079 N N   . ASN F 111 ? 1.43330 0.90320 1.09710 -0.17190 -0.00660 -0.18310 1187 ASN F N   
5080 C CA  . ASN F 111 ? 1.58690 0.89600 1.16310 -0.13410 0.00180  -0.19110 1187 ASN F CA  
5081 C C   . ASN F 111 ? 1.68670 0.95830 1.16850 -0.19760 0.01210  -0.20710 1187 ASN F C   
5082 O O   . ASN F 111 ? 1.59700 0.82850 1.07020 -0.15760 0.01460  -0.20900 1187 ASN F O   
5083 C CB  . ASN F 111 ? 1.64470 0.79100 1.12900 -0.11620 0.00860  -0.19330 1187 ASN F CB  
5084 C CG  . ASN F 111 ? 1.53880 0.73080 1.13150 -0.03480 -0.00190 -0.17320 1187 ASN F CG  
5085 O OD1 . ASN F 111 ? 1.40570 0.66900 1.10100 0.02820  -0.01200 -0.16310 1187 ASN F OD1 
5086 N ND2 . ASN F 111 ? 1.59930 0.76970 1.17880 -0.03630 0.00010  -0.16380 1187 ASN F ND2 
5087 N N   . GLU F 112 ? 1.77820 1.06650 1.19200 -0.29360 0.01750  -0.21740 1188 GLU F N   
5088 C CA  . GLU F 112 ? 1.91150 1.17210 1.23080 -0.36670 0.02660  -0.23260 1188 GLU F CA  
5089 C C   . GLU F 112 ? 1.78010 1.19220 1.20950 -0.34560 0.01960  -0.22550 1188 GLU F C   
5090 O O   . GLU F 112 ? 1.83670 1.18360 1.21600 -0.33520 0.02550  -0.23360 1188 GLU F O   
5091 C CB  . GLU F 112 ? 2.02620 1.31790 1.28090 -0.46890 0.03150  -0.23590 1188 GLU F CB  
5092 C CG  . GLU F 112 ? 2.16870 1.46090 1.34560 -0.53500 0.04230  -0.23710 1188 GLU F CG  
5093 C CD  . GLU F 112 ? 2.35560 1.47880 1.40380 -0.52640 0.05790  -0.23330 1188 GLU F CD  
5094 O OE1 . GLU F 112 ? 2.41290 1.43310 1.44970 -0.45020 0.05890  -0.23060 1188 GLU F OE1 
5095 O OE2 . GLU F 112 ? 2.42230 1.52680 1.38440 -0.59520 0.06930  -0.22990 1188 GLU F OE2 
5096 N N   . VAL F 113 ? 1.64220 1.24470 1.21360 -0.33540 0.00770  -0.21070 1189 VAL F N   
5097 C CA  . VAL F 113 ? 1.40470 1.16820 1.09030 -0.31630 -0.00010 -0.20220 1189 VAL F CA  
5098 C C   . VAL F 113 ? 1.39620 1.12670 1.13930 -0.21870 -0.00460 -0.19470 1189 VAL F C   
5099 O O   . VAL F 113 ? 1.37190 1.15420 1.14470 -0.20990 -0.00530 -0.19510 1189 VAL F O   
5100 C CB  . VAL F 113 ? 1.16700 1.13230 0.98620 -0.31980 -0.01160 -0.18670 1189 VAL F CB  
5101 C CG1 . VAL F 113 ? 0.99340 1.11330 0.92680 -0.29260 -0.01960 -0.17710 1189 VAL F CG1 
5102 C CG2 . VAL F 113 ? 1.09260 1.11090 0.86120 -0.41640 -0.00730 -0.19190 1189 VAL F CG2 
5103 N N   . ALA F 114 ? 1.39580 1.05130 1.15660 -0.14940 -0.00790 -0.18720 1190 ALA F N   
5104 C CA  . ALA F 114 ? 1.35100 0.97950 1.16900 -0.05420 -0.01320 -0.17740 1190 ALA F CA  
5105 C C   . ALA F 114 ? 1.45010 0.94070 1.15760 -0.05120 -0.00120 -0.19080 1190 ALA F C   
5106 O O   . ALA F 114 ? 1.45090 0.97680 1.21240 -0.00020 -0.00470 -0.18490 1190 ALA F O   
5107 C CB  . ALA F 114 ? 1.39550 0.96230 1.23540 0.00690  -0.01790 -0.16750 1190 ALA F CB  
5108 N N   . LYS F 115 ? 1.55480 0.89280 1.11030 -0.10370 0.01250  -0.20770 1191 LYS F N   
5109 C CA  . LYS F 115 ? 1.76290 0.94610 1.18370 -0.11100 0.02630  -0.22320 1191 LYS F CA  
5110 C C   . LYS F 115 ? 1.75510 1.01290 1.16500 -0.17300 0.02880  -0.23200 1191 LYS F C   
5111 O O   . LYS F 115 ? 1.76170 0.99630 1.16230 -0.14100 0.03200  -0.23450 1191 LYS F O   
5112 C CB  . LYS F 115 ? 1.93010 0.95920 1.20970 -0.14950 0.03830  -0.22980 1191 LYS F CB  
5113 C CG  . LYS F 115 ? 2.07230 1.00270 1.25390 -0.14420 0.05080  -0.22460 1191 LYS F CG  
5114 C CD  . LYS F 115 ? 2.19910 1.03570 1.27460 -0.17890 0.06100  -0.21600 1191 LYS F CD  
5115 C CE  . LYS F 115 ? 2.28030 1.10830 1.26890 -0.28270 0.06850  -0.22660 1191 LYS F CE  
5116 N NZ  . LYS F 115 ? 2.36170 1.07940 1.23250 -0.30870 0.08070  -0.21600 1191 LYS F NZ  
5117 N N   . ASN F 116 ? 1.66270 1.01280 1.07590 -0.25710 0.02740  -0.23550 1192 ASN F N   
5118 C CA  . ASN F 116 ? 1.64280 1.07060 1.03600 -0.33230 0.02990  -0.24410 1192 ASN F CA  
5119 C C   . ASN F 116 ? 1.52070 1.09720 1.04460 -0.28690 0.02090  -0.23300 1192 ASN F C   
5120 O O   . ASN F 116 ? 1.59020 1.19110 1.08030 -0.33030 0.02510  -0.24160 1192 ASN F O   
5121 C CB  . ASN F 116 ? 1.62590 1.16560 1.03200 -0.41940 0.02710  -0.24380 1192 ASN F CB  
5122 C CG  . ASN F 116 ? 1.96120 1.36230 1.21480 -0.49480 0.03730  -0.25800 1192 ASN F CG  
5123 O OD1 . ASN F 116 ? 2.15960 1.38730 1.31510 -0.46670 0.04660  -0.26050 1192 ASN F OD1 
5124 N ND2 . ASN F 116 ? 1.99050 1.48930 1.24160 -0.57870 0.03660  -0.25680 1192 ASN F ND2 
5125 N N   . LEU F 117 ? 1.34990 1.02470 1.01450 -0.20840 0.00850  -0.21460 1193 LEU F N   
5126 C CA  . LEU F 117 ? 1.26190 1.09270 1.06150 -0.16620 -0.00200 -0.20170 1193 LEU F CA  
5127 C C   . LEU F 117 ? 1.39430 1.14400 1.16210 -0.11640 0.00270  -0.20560 1193 LEU F C   
5128 O O   . LEU F 117 ? 1.39030 1.25070 1.23610 -0.10210 -0.00290 -0.19990 1193 LEU F O   
5129 C CB  . LEU F 117 ? 1.10060 1.04390 1.04620 -0.09970 -0.01690 -0.18090 1193 LEU F CB  
5130 C CG  . LEU F 117 ? 0.99760 1.10440 1.02720 -0.13970 -0.02490 -0.17230 1193 LEU F CG  
5131 C CD1 . LEU F 117 ? 0.90350 1.09010 1.05910 -0.06810 -0.03880 -0.15280 1193 LEU F CD1 
5132 C CD2 . LEU F 117 ? 0.83060 1.08540 0.91150 -0.17980 -0.02720 -0.17140 1193 LEU F CD2 
5133 N N   . ASN F 118 ? 1.51780 1.08340 1.17230 -0.09120 0.01300  -0.21460 1194 ASN F N   
5134 C CA  . ASN F 118 ? 1.64110 1.10730 1.23650 -0.04920 0.02070  -0.22060 1194 ASN F CA  
5135 C C   . ASN F 118 ? 1.64540 1.12230 1.17590 -0.11810 0.02830  -0.23520 1194 ASN F C   
5136 O O   . ASN F 118 ? 1.64780 1.12910 1.19070 -0.08220 0.02950  -0.23510 1194 ASN F O   
5137 C CB  . ASN F 118 ? 1.84380 1.10150 1.30750 -0.02000 0.03270  -0.22910 1194 ASN F CB  
5138 C CG  . ASN F 118 ? 1.79090 1.03890 1.32630 0.06790  0.02510  -0.21250 1194 ASN F CG  
5139 O OD1 . ASN F 118 ? 1.55850 0.90690 1.21580 0.13420  0.01400  -0.19610 1194 ASN F OD1 
5140 N ND2 . ASN F 118 ? 1.91130 1.03830 1.36900 0.06680  0.03060  -0.21610 1194 ASN F ND2 
5141 N N   . GLU F 119 ? 1.59830 1.08380 1.06350 -0.21400 0.03260  -0.24650 1195 GLU F N   
5142 C CA  . GLU F 119 ? 1.69510 1.19730 1.09130 -0.29570 0.03920  -0.26050 1195 GLU F CA  
5143 C C   . GLU F 119 ? 1.59170 1.31430 1.13300 -0.30460 0.02740  -0.24860 1195 GLU F C   
5144 O O   . GLU F 119 ? 1.68990 1.45080 1.19900 -0.35890 0.03110  -0.25710 1195 GLU F O   
5145 C CB  . GLU F 119 ? 1.79090 1.21050 1.05520 -0.39480 0.04770  -0.27540 1195 GLU F CB  
5146 C CG  . GLU F 119 ? 1.95700 1.41230 1.15310 -0.49400 0.05270  -0.28800 1195 GLU F CG  
5147 C CD  . GLU F 119 ? 2.12250 1.41550 1.16580 -0.51670 0.06610  -0.30680 1195 GLU F CD  
5148 O OE1 . GLU F 119 ? 2.29690 1.42410 1.25900 -0.46810 0.07580  -0.30250 1195 GLU F OE1 
5149 O OE2 . GLU F 119 ? 1.94940 1.31200 0.98830 -0.56660 0.06770  -0.30850 1195 GLU F OE2 
5150 N N   . SER F 120 ? 1.38830 1.24760 1.08060 -0.25100 0.01390  -0.22920 1196 SER F N   
5151 C CA  . SER F 120 ? 1.27470 1.34380 1.10990 -0.24950 0.00210  -0.21570 1196 SER F CA  
5152 C C   . SER F 120 ? 1.18700 1.29790 1.11060 -0.16650 -0.00440 -0.20530 1196 SER F C   
5153 O O   . SER F 120 ? 0.99740 1.26780 1.02640 -0.16460 -0.01300 -0.19550 1196 SER F O   
5154 C CB  . SER F 120 ? 1.21470 1.40860 1.15380 -0.24520 -0.00860 -0.20100 1196 SER F CB  
5155 O OG  . SER F 120 ? 1.31190 1.53810 1.19750 -0.33620 -0.00450 -0.20810 1196 SER F OG  
5156 N N   . LEU F 121 ? 1.22200 1.19940 1.10290 -0.10110 -0.00020 -0.20640 1197 LEU F N   
5157 C CA  . L