data_6M0X
# 
_entry.id   6M0X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.332 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6M0X         
WWPDB D_1300015803 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6M0X 
_pdbx_database_status.recvd_initial_deposition_date   2020-02-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zhang, Y.' 1  ? 
'Zhang, H.' 2  ? 
'Xu, X.'    3  ? 
'Wang, Y.'  4  ? 
'Chen, W.'  5  ? 
'Wang, Y.'  6  ? 
'Wu, Z.'    7  ? 
'Tang, N.'  8  ? 
'Wang, Y.'  9  ? 
'Zhao, S.'  10 ? 
'Gan, J.'   11 ? 
'Ji, Q.'    12 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Catal' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2520-1158 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Catalytic-state structure and engineering of Streptococcus thermophilus Cas9' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41929-020-00506-9 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhang, Y.' 1  ? 
primary 'Zhang, H.' 2  ? 
primary 'Xu, X.'    3  ? 
primary 'Wang, Y.'  4  ? 
primary 'Chen, W.'  5  ? 
primary 'Wang, Y.'  6  ? 
primary 'Wu, Z.'    7  ? 
primary 'Tang, N.'  8  ? 
primary 'Wang, Y.'  9  ? 
primary 'Zhao, S.'  10 ? 
primary 'Gan, J.'   11 ? 
primary 'Ji, Q.'    12 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   93.280 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6M0X 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     322.165 
_cell.length_a_esd                 ? 
_cell.length_b                     75.250 
_cell.length_b_esd                 ? 
_cell.length_c                     70.008 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6M0X 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CRISPR-associated endonuclease Cas9 1'  129646.898 1  3.1.-.- ? ? ? 
2 polymer     syn 'RNA (71-MER)'                           22882.627  1  ?       ? ? ? 
3 polymer     syn 'DNA (28-MER)'                           8481.477   1  ?       ? ? ? 
4 polymer     syn 
;DNA (5'-D(*AP*AP*AP*GP*GP*AP*GP*C)-3')
;
2484.669   1  ?       ? ? ? 
5 non-polymer syn 'BARIUM ION'                             137.327    14 ?       ? ? ? 
6 non-polymer syn 'MAGNESIUM ION'                          24.305     2  ?       ? ? ? 
7 water       nat water                                    18.015     51 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Cas9** 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGSDLVLGLDIGIGSVGVGILNKVTGEIIHKNSRIFPAAQAENNLVRRTNRQGRRLARRKKHRRVRLNRLFEESGLITDF
TKISINLNPYQLRVKGLTDELSNEELFIALKNMVKHRGISYLDDASDDGNSSVGDYAQIVKENSKQLETKTPGQIQLERY
QTYGQLRGDFTVEKDGKKHRLINVFPTSAYRSEALRILQTQQEFNPQITDEFINRYLEILTGKRKYYHGPGNEKSRTDYG
RYRTSGETLDNIFGILIGKCTFYPDEFRAAKASYTAQEFNLLNDLNNLTVPTETKKLSKEQKNQIINYVKNEKAMGPAKL
FKYIAKLLSCDVADIKGYRIDKSGKAEIHTFEAYRKMKTLETLDIEQMDRETLDKLAYVLTLNTEREGIQEALEHEFADG
SFSQKQVDELVQFRKANSSIFGKGWHNFSVKLMMELIPELYETSEEQMTILTRLGKQKTTSSSNKTKYIDEKLLTEEIYN
PVVAKSVRQAIKIVNAAIKEYGDFDNIVIEMARETNEDDEKKAIQKIQKANKDEKDAAMLKAANQYNGKAELPHSVFHGH
KQLATKIRLWHQQGERCLYTGKTISIHDLINNSNQFEVDAILPLSITFDDSLANKVLVYATANQEKGQRTPYQALDSMDD
AWSFRELKAFVRESKTLSNKKKEYLLTEEDISKFDVRKKFIERNLVDTRYASRVVLNALQEHFRAHKIDTKVSVVRGQFT
SQLRRHWGIEKTRDTYHHHAVDALIIAASSQLNLWKKQKNTLVSYSEDQLLDIETGELISDDEYKESVFKAPYQHFVDTL
KSKEFEDSILFSYQVDSKFNRKISDATIYATRQAKVGKDKADETYVLGKIKDIYTQDGYDAFMKIYKKDKSKFLMYRHDP
QTFEKVIEPILENYPNKQINEKGKEVPCNPFLKYKEEHGYIRKYSKKGNGPEIKSLKYYDSKLGNHIDITPKDSNNKVVL
QSVSPWRADVYFNKTTGKYEILGLKYADLQFEKGTGTYKISQEKYNDIKKKEGVDSDSEFKFTLYKNDLLLVKDTETKEQ
QLFRFLSRTMPKQKHYVELKPYDKQKFEGGEALIKVLGNVANSGQCKKGLGKSNISIYKVRTDVLGNQHIIKNEGDKPKL
DF
;
;MGSDLVLGLDIGIGSVGVGILNKVTGEIIHKNSRIFPAAQAENNLVRRTNRQGRRLARRKKHRRVRLNRLFEESGLITDF
TKISINLNPYQLRVKGLTDELSNEELFIALKNMVKHRGISYLDDASDDGNSSVGDYAQIVKENSKQLETKTPGQIQLERY
QTYGQLRGDFTVEKDGKKHRLINVFPTSAYRSEALRILQTQQEFNPQITDEFINRYLEILTGKRKYYHGPGNEKSRTDYG
RYRTSGETLDNIFGILIGKCTFYPDEFRAAKASYTAQEFNLLNDLNNLTVPTETKKLSKEQKNQIINYVKNEKAMGPAKL
FKYIAKLLSCDVADIKGYRIDKSGKAEIHTFEAYRKMKTLETLDIEQMDRETLDKLAYVLTLNTEREGIQEALEHEFADG
SFSQKQVDELVQFRKANSSIFGKGWHNFSVKLMMELIPELYETSEEQMTILTRLGKQKTTSSSNKTKYIDEKLLTEEIYN
PVVAKSVRQAIKIVNAAIKEYGDFDNIVIEMARETNEDDEKKAIQKIQKANKDEKDAAMLKAANQYNGKAELPHSVFHGH
KQLATKIRLWHQQGERCLYTGKTISIHDLINNSNQFEVDAILPLSITFDDSLANKVLVYATANQEKGQRTPYQALDSMDD
AWSFRELKAFVRESKTLSNKKKEYLLTEEDISKFDVRKKFIERNLVDTRYASRVVLNALQEHFRAHKIDTKVSVVRGQFT
SQLRRHWGIEKTRDTYHHHAVDALIIAASSQLNLWKKQKNTLVSYSEDQLLDIETGELISDDEYKESVFKAPYQHFVDTL
KSKEFEDSILFSYQVDSKFNRKISDATIYATRQAKVGKDKADETYVLGKIKDIYTQDGYDAFMKIYKKDKSKFLMYRHDP
QTFEKVIEPILENYPNKQINEKGKEVPCNPFLKYKEEHGYIRKYSKKGNGPEIKSLKYYDSKLGNHIDITPKDSNNKVVL
QSVSPWRADVYFNKTTGKYEILGLKYADLQFEKGTGTYKISQEKYNDIKKKEGVDSDSEFKFTLYKNDLLLVKDTETKEQ
QLFRFLSRTMPKQKHYVELKPYDKQKFEGGEALIKVLGNVANSGQCKKGLGKSNISIYKVRTDVLGNQHIIKNEGDKPKL
DF
;
A ? 
2 polyribonucleotide      no no GGUGCUAAGAUUAAUCAGGAUGUUUUUGUACUCGAAAGAAGCUACAAAGAUAAGGCUUCAUGCCGAAAUCA 
GGUGCUAAGAUUAAUCAGGAUGUUUUUGUACUCGAAAGAAGCUACAAAGAUAAGGCUUCAUGCCGAAAUCA B ? 
3 polydeoxyribonucleotide no no 
;(DG)(DC)(DT)(DC)(DC)(DT)(DT)(DT)(DA)(DT)(DC)(DC)(DT)(DG)(DA)(DT)(DT)(DA)(DA)(DT)
(DC)(DT)(DT)(DA)(DG)(DC)(DA)(DC)
;
GCTCCTTTATCCTGATTAATCTTAGCAC C ? 
4 polydeoxyribonucleotide no no '(DA)(DA)(DA)(DG)(DG)(DA)(DG)(DC)' AAAGGAGC D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    GLY n 
1 3    SER n 
1 4    ASP n 
1 5    LEU n 
1 6    VAL n 
1 7    LEU n 
1 8    GLY n 
1 9    LEU n 
1 10   ASP n 
1 11   ILE n 
1 12   GLY n 
1 13   ILE n 
1 14   GLY n 
1 15   SER n 
1 16   VAL n 
1 17   GLY n 
1 18   VAL n 
1 19   GLY n 
1 20   ILE n 
1 21   LEU n 
1 22   ASN n 
1 23   LYS n 
1 24   VAL n 
1 25   THR n 
1 26   GLY n 
1 27   GLU n 
1 28   ILE n 
1 29   ILE n 
1 30   HIS n 
1 31   LYS n 
1 32   ASN n 
1 33   SER n 
1 34   ARG n 
1 35   ILE n 
1 36   PHE n 
1 37   PRO n 
1 38   ALA n 
1 39   ALA n 
1 40   GLN n 
1 41   ALA n 
1 42   GLU n 
1 43   ASN n 
1 44   ASN n 
1 45   LEU n 
1 46   VAL n 
1 47   ARG n 
1 48   ARG n 
1 49   THR n 
1 50   ASN n 
1 51   ARG n 
1 52   GLN n 
1 53   GLY n 
1 54   ARG n 
1 55   ARG n 
1 56   LEU n 
1 57   ALA n 
1 58   ARG n 
1 59   ARG n 
1 60   LYS n 
1 61   LYS n 
1 62   HIS n 
1 63   ARG n 
1 64   ARG n 
1 65   VAL n 
1 66   ARG n 
1 67   LEU n 
1 68   ASN n 
1 69   ARG n 
1 70   LEU n 
1 71   PHE n 
1 72   GLU n 
1 73   GLU n 
1 74   SER n 
1 75   GLY n 
1 76   LEU n 
1 77   ILE n 
1 78   THR n 
1 79   ASP n 
1 80   PHE n 
1 81   THR n 
1 82   LYS n 
1 83   ILE n 
1 84   SER n 
1 85   ILE n 
1 86   ASN n 
1 87   LEU n 
1 88   ASN n 
1 89   PRO n 
1 90   TYR n 
1 91   GLN n 
1 92   LEU n 
1 93   ARG n 
1 94   VAL n 
1 95   LYS n 
1 96   GLY n 
1 97   LEU n 
1 98   THR n 
1 99   ASP n 
1 100  GLU n 
1 101  LEU n 
1 102  SER n 
1 103  ASN n 
1 104  GLU n 
1 105  GLU n 
1 106  LEU n 
1 107  PHE n 
1 108  ILE n 
1 109  ALA n 
1 110  LEU n 
1 111  LYS n 
1 112  ASN n 
1 113  MET n 
1 114  VAL n 
1 115  LYS n 
1 116  HIS n 
1 117  ARG n 
1 118  GLY n 
1 119  ILE n 
1 120  SER n 
1 121  TYR n 
1 122  LEU n 
1 123  ASP n 
1 124  ASP n 
1 125  ALA n 
1 126  SER n 
1 127  ASP n 
1 128  ASP n 
1 129  GLY n 
1 130  ASN n 
1 131  SER n 
1 132  SER n 
1 133  VAL n 
1 134  GLY n 
1 135  ASP n 
1 136  TYR n 
1 137  ALA n 
1 138  GLN n 
1 139  ILE n 
1 140  VAL n 
1 141  LYS n 
1 142  GLU n 
1 143  ASN n 
1 144  SER n 
1 145  LYS n 
1 146  GLN n 
1 147  LEU n 
1 148  GLU n 
1 149  THR n 
1 150  LYS n 
1 151  THR n 
1 152  PRO n 
1 153  GLY n 
1 154  GLN n 
1 155  ILE n 
1 156  GLN n 
1 157  LEU n 
1 158  GLU n 
1 159  ARG n 
1 160  TYR n 
1 161  GLN n 
1 162  THR n 
1 163  TYR n 
1 164  GLY n 
1 165  GLN n 
1 166  LEU n 
1 167  ARG n 
1 168  GLY n 
1 169  ASP n 
1 170  PHE n 
1 171  THR n 
1 172  VAL n 
1 173  GLU n 
1 174  LYS n 
1 175  ASP n 
1 176  GLY n 
1 177  LYS n 
1 178  LYS n 
1 179  HIS n 
1 180  ARG n 
1 181  LEU n 
1 182  ILE n 
1 183  ASN n 
1 184  VAL n 
1 185  PHE n 
1 186  PRO n 
1 187  THR n 
1 188  SER n 
1 189  ALA n 
1 190  TYR n 
1 191  ARG n 
1 192  SER n 
1 193  GLU n 
1 194  ALA n 
1 195  LEU n 
1 196  ARG n 
1 197  ILE n 
1 198  LEU n 
1 199  GLN n 
1 200  THR n 
1 201  GLN n 
1 202  GLN n 
1 203  GLU n 
1 204  PHE n 
1 205  ASN n 
1 206  PRO n 
1 207  GLN n 
1 208  ILE n 
1 209  THR n 
1 210  ASP n 
1 211  GLU n 
1 212  PHE n 
1 213  ILE n 
1 214  ASN n 
1 215  ARG n 
1 216  TYR n 
1 217  LEU n 
1 218  GLU n 
1 219  ILE n 
1 220  LEU n 
1 221  THR n 
1 222  GLY n 
1 223  LYS n 
1 224  ARG n 
1 225  LYS n 
1 226  TYR n 
1 227  TYR n 
1 228  HIS n 
1 229  GLY n 
1 230  PRO n 
1 231  GLY n 
1 232  ASN n 
1 233  GLU n 
1 234  LYS n 
1 235  SER n 
1 236  ARG n 
1 237  THR n 
1 238  ASP n 
1 239  TYR n 
1 240  GLY n 
1 241  ARG n 
1 242  TYR n 
1 243  ARG n 
1 244  THR n 
1 245  SER n 
1 246  GLY n 
1 247  GLU n 
1 248  THR n 
1 249  LEU n 
1 250  ASP n 
1 251  ASN n 
1 252  ILE n 
1 253  PHE n 
1 254  GLY n 
1 255  ILE n 
1 256  LEU n 
1 257  ILE n 
1 258  GLY n 
1 259  LYS n 
1 260  CYS n 
1 261  THR n 
1 262  PHE n 
1 263  TYR n 
1 264  PRO n 
1 265  ASP n 
1 266  GLU n 
1 267  PHE n 
1 268  ARG n 
1 269  ALA n 
1 270  ALA n 
1 271  LYS n 
1 272  ALA n 
1 273  SER n 
1 274  TYR n 
1 275  THR n 
1 276  ALA n 
1 277  GLN n 
1 278  GLU n 
1 279  PHE n 
1 280  ASN n 
1 281  LEU n 
1 282  LEU n 
1 283  ASN n 
1 284  ASP n 
1 285  LEU n 
1 286  ASN n 
1 287  ASN n 
1 288  LEU n 
1 289  THR n 
1 290  VAL n 
1 291  PRO n 
1 292  THR n 
1 293  GLU n 
1 294  THR n 
1 295  LYS n 
1 296  LYS n 
1 297  LEU n 
1 298  SER n 
1 299  LYS n 
1 300  GLU n 
1 301  GLN n 
1 302  LYS n 
1 303  ASN n 
1 304  GLN n 
1 305  ILE n 
1 306  ILE n 
1 307  ASN n 
1 308  TYR n 
1 309  VAL n 
1 310  LYS n 
1 311  ASN n 
1 312  GLU n 
1 313  LYS n 
1 314  ALA n 
1 315  MET n 
1 316  GLY n 
1 317  PRO n 
1 318  ALA n 
1 319  LYS n 
1 320  LEU n 
1 321  PHE n 
1 322  LYS n 
1 323  TYR n 
1 324  ILE n 
1 325  ALA n 
1 326  LYS n 
1 327  LEU n 
1 328  LEU n 
1 329  SER n 
1 330  CYS n 
1 331  ASP n 
1 332  VAL n 
1 333  ALA n 
1 334  ASP n 
1 335  ILE n 
1 336  LYS n 
1 337  GLY n 
1 338  TYR n 
1 339  ARG n 
1 340  ILE n 
1 341  ASP n 
1 342  LYS n 
1 343  SER n 
1 344  GLY n 
1 345  LYS n 
1 346  ALA n 
1 347  GLU n 
1 348  ILE n 
1 349  HIS n 
1 350  THR n 
1 351  PHE n 
1 352  GLU n 
1 353  ALA n 
1 354  TYR n 
1 355  ARG n 
1 356  LYS n 
1 357  MET n 
1 358  LYS n 
1 359  THR n 
1 360  LEU n 
1 361  GLU n 
1 362  THR n 
1 363  LEU n 
1 364  ASP n 
1 365  ILE n 
1 366  GLU n 
1 367  GLN n 
1 368  MET n 
1 369  ASP n 
1 370  ARG n 
1 371  GLU n 
1 372  THR n 
1 373  LEU n 
1 374  ASP n 
1 375  LYS n 
1 376  LEU n 
1 377  ALA n 
1 378  TYR n 
1 379  VAL n 
1 380  LEU n 
1 381  THR n 
1 382  LEU n 
1 383  ASN n 
1 384  THR n 
1 385  GLU n 
1 386  ARG n 
1 387  GLU n 
1 388  GLY n 
1 389  ILE n 
1 390  GLN n 
1 391  GLU n 
1 392  ALA n 
1 393  LEU n 
1 394  GLU n 
1 395  HIS n 
1 396  GLU n 
1 397  PHE n 
1 398  ALA n 
1 399  ASP n 
1 400  GLY n 
1 401  SER n 
1 402  PHE n 
1 403  SER n 
1 404  GLN n 
1 405  LYS n 
1 406  GLN n 
1 407  VAL n 
1 408  ASP n 
1 409  GLU n 
1 410  LEU n 
1 411  VAL n 
1 412  GLN n 
1 413  PHE n 
1 414  ARG n 
1 415  LYS n 
1 416  ALA n 
1 417  ASN n 
1 418  SER n 
1 419  SER n 
1 420  ILE n 
1 421  PHE n 
1 422  GLY n 
1 423  LYS n 
1 424  GLY n 
1 425  TRP n 
1 426  HIS n 
1 427  ASN n 
1 428  PHE n 
1 429  SER n 
1 430  VAL n 
1 431  LYS n 
1 432  LEU n 
1 433  MET n 
1 434  MET n 
1 435  GLU n 
1 436  LEU n 
1 437  ILE n 
1 438  PRO n 
1 439  GLU n 
1 440  LEU n 
1 441  TYR n 
1 442  GLU n 
1 443  THR n 
1 444  SER n 
1 445  GLU n 
1 446  GLU n 
1 447  GLN n 
1 448  MET n 
1 449  THR n 
1 450  ILE n 
1 451  LEU n 
1 452  THR n 
1 453  ARG n 
1 454  LEU n 
1 455  GLY n 
1 456  LYS n 
1 457  GLN n 
1 458  LYS n 
1 459  THR n 
1 460  THR n 
1 461  SER n 
1 462  SER n 
1 463  SER n 
1 464  ASN n 
1 465  LYS n 
1 466  THR n 
1 467  LYS n 
1 468  TYR n 
1 469  ILE n 
1 470  ASP n 
1 471  GLU n 
1 472  LYS n 
1 473  LEU n 
1 474  LEU n 
1 475  THR n 
1 476  GLU n 
1 477  GLU n 
1 478  ILE n 
1 479  TYR n 
1 480  ASN n 
1 481  PRO n 
1 482  VAL n 
1 483  VAL n 
1 484  ALA n 
1 485  LYS n 
1 486  SER n 
1 487  VAL n 
1 488  ARG n 
1 489  GLN n 
1 490  ALA n 
1 491  ILE n 
1 492  LYS n 
1 493  ILE n 
1 494  VAL n 
1 495  ASN n 
1 496  ALA n 
1 497  ALA n 
1 498  ILE n 
1 499  LYS n 
1 500  GLU n 
1 501  TYR n 
1 502  GLY n 
1 503  ASP n 
1 504  PHE n 
1 505  ASP n 
1 506  ASN n 
1 507  ILE n 
1 508  VAL n 
1 509  ILE n 
1 510  GLU n 
1 511  MET n 
1 512  ALA n 
1 513  ARG n 
1 514  GLU n 
1 515  THR n 
1 516  ASN n 
1 517  GLU n 
1 518  ASP n 
1 519  ASP n 
1 520  GLU n 
1 521  LYS n 
1 522  LYS n 
1 523  ALA n 
1 524  ILE n 
1 525  GLN n 
1 526  LYS n 
1 527  ILE n 
1 528  GLN n 
1 529  LYS n 
1 530  ALA n 
1 531  ASN n 
1 532  LYS n 
1 533  ASP n 
1 534  GLU n 
1 535  LYS n 
1 536  ASP n 
1 537  ALA n 
1 538  ALA n 
1 539  MET n 
1 540  LEU n 
1 541  LYS n 
1 542  ALA n 
1 543  ALA n 
1 544  ASN n 
1 545  GLN n 
1 546  TYR n 
1 547  ASN n 
1 548  GLY n 
1 549  LYS n 
1 550  ALA n 
1 551  GLU n 
1 552  LEU n 
1 553  PRO n 
1 554  HIS n 
1 555  SER n 
1 556  VAL n 
1 557  PHE n 
1 558  HIS n 
1 559  GLY n 
1 560  HIS n 
1 561  LYS n 
1 562  GLN n 
1 563  LEU n 
1 564  ALA n 
1 565  THR n 
1 566  LYS n 
1 567  ILE n 
1 568  ARG n 
1 569  LEU n 
1 570  TRP n 
1 571  HIS n 
1 572  GLN n 
1 573  GLN n 
1 574  GLY n 
1 575  GLU n 
1 576  ARG n 
1 577  CYS n 
1 578  LEU n 
1 579  TYR n 
1 580  THR n 
1 581  GLY n 
1 582  LYS n 
1 583  THR n 
1 584  ILE n 
1 585  SER n 
1 586  ILE n 
1 587  HIS n 
1 588  ASP n 
1 589  LEU n 
1 590  ILE n 
1 591  ASN n 
1 592  ASN n 
1 593  SER n 
1 594  ASN n 
1 595  GLN n 
1 596  PHE n 
1 597  GLU n 
1 598  VAL n 
1 599  ASP n 
1 600  ALA n 
1 601  ILE n 
1 602  LEU n 
1 603  PRO n 
1 604  LEU n 
1 605  SER n 
1 606  ILE n 
1 607  THR n 
1 608  PHE n 
1 609  ASP n 
1 610  ASP n 
1 611  SER n 
1 612  LEU n 
1 613  ALA n 
1 614  ASN n 
1 615  LYS n 
1 616  VAL n 
1 617  LEU n 
1 618  VAL n 
1 619  TYR n 
1 620  ALA n 
1 621  THR n 
1 622  ALA n 
1 623  ASN n 
1 624  GLN n 
1 625  GLU n 
1 626  LYS n 
1 627  GLY n 
1 628  GLN n 
1 629  ARG n 
1 630  THR n 
1 631  PRO n 
1 632  TYR n 
1 633  GLN n 
1 634  ALA n 
1 635  LEU n 
1 636  ASP n 
1 637  SER n 
1 638  MET n 
1 639  ASP n 
1 640  ASP n 
1 641  ALA n 
1 642  TRP n 
1 643  SER n 
1 644  PHE n 
1 645  ARG n 
1 646  GLU n 
1 647  LEU n 
1 648  LYS n 
1 649  ALA n 
1 650  PHE n 
1 651  VAL n 
1 652  ARG n 
1 653  GLU n 
1 654  SER n 
1 655  LYS n 
1 656  THR n 
1 657  LEU n 
1 658  SER n 
1 659  ASN n 
1 660  LYS n 
1 661  LYS n 
1 662  LYS n 
1 663  GLU n 
1 664  TYR n 
1 665  LEU n 
1 666  LEU n 
1 667  THR n 
1 668  GLU n 
1 669  GLU n 
1 670  ASP n 
1 671  ILE n 
1 672  SER n 
1 673  LYS n 
1 674  PHE n 
1 675  ASP n 
1 676  VAL n 
1 677  ARG n 
1 678  LYS n 
1 679  LYS n 
1 680  PHE n 
1 681  ILE n 
1 682  GLU n 
1 683  ARG n 
1 684  ASN n 
1 685  LEU n 
1 686  VAL n 
1 687  ASP n 
1 688  THR n 
1 689  ARG n 
1 690  TYR n 
1 691  ALA n 
1 692  SER n 
1 693  ARG n 
1 694  VAL n 
1 695  VAL n 
1 696  LEU n 
1 697  ASN n 
1 698  ALA n 
1 699  LEU n 
1 700  GLN n 
1 701  GLU n 
1 702  HIS n 
1 703  PHE n 
1 704  ARG n 
1 705  ALA n 
1 706  HIS n 
1 707  LYS n 
1 708  ILE n 
1 709  ASP n 
1 710  THR n 
1 711  LYS n 
1 712  VAL n 
1 713  SER n 
1 714  VAL n 
1 715  VAL n 
1 716  ARG n 
1 717  GLY n 
1 718  GLN n 
1 719  PHE n 
1 720  THR n 
1 721  SER n 
1 722  GLN n 
1 723  LEU n 
1 724  ARG n 
1 725  ARG n 
1 726  HIS n 
1 727  TRP n 
1 728  GLY n 
1 729  ILE n 
1 730  GLU n 
1 731  LYS n 
1 732  THR n 
1 733  ARG n 
1 734  ASP n 
1 735  THR n 
1 736  TYR n 
1 737  HIS n 
1 738  HIS n 
1 739  HIS n 
1 740  ALA n 
1 741  VAL n 
1 742  ASP n 
1 743  ALA n 
1 744  LEU n 
1 745  ILE n 
1 746  ILE n 
1 747  ALA n 
1 748  ALA n 
1 749  SER n 
1 750  SER n 
1 751  GLN n 
1 752  LEU n 
1 753  ASN n 
1 754  LEU n 
1 755  TRP n 
1 756  LYS n 
1 757  LYS n 
1 758  GLN n 
1 759  LYS n 
1 760  ASN n 
1 761  THR n 
1 762  LEU n 
1 763  VAL n 
1 764  SER n 
1 765  TYR n 
1 766  SER n 
1 767  GLU n 
1 768  ASP n 
1 769  GLN n 
1 770  LEU n 
1 771  LEU n 
1 772  ASP n 
1 773  ILE n 
1 774  GLU n 
1 775  THR n 
1 776  GLY n 
1 777  GLU n 
1 778  LEU n 
1 779  ILE n 
1 780  SER n 
1 781  ASP n 
1 782  ASP n 
1 783  GLU n 
1 784  TYR n 
1 785  LYS n 
1 786  GLU n 
1 787  SER n 
1 788  VAL n 
1 789  PHE n 
1 790  LYS n 
1 791  ALA n 
1 792  PRO n 
1 793  TYR n 
1 794  GLN n 
1 795  HIS n 
1 796  PHE n 
1 797  VAL n 
1 798  ASP n 
1 799  THR n 
1 800  LEU n 
1 801  LYS n 
1 802  SER n 
1 803  LYS n 
1 804  GLU n 
1 805  PHE n 
1 806  GLU n 
1 807  ASP n 
1 808  SER n 
1 809  ILE n 
1 810  LEU n 
1 811  PHE n 
1 812  SER n 
1 813  TYR n 
1 814  GLN n 
1 815  VAL n 
1 816  ASP n 
1 817  SER n 
1 818  LYS n 
1 819  PHE n 
1 820  ASN n 
1 821  ARG n 
1 822  LYS n 
1 823  ILE n 
1 824  SER n 
1 825  ASP n 
1 826  ALA n 
1 827  THR n 
1 828  ILE n 
1 829  TYR n 
1 830  ALA n 
1 831  THR n 
1 832  ARG n 
1 833  GLN n 
1 834  ALA n 
1 835  LYS n 
1 836  VAL n 
1 837  GLY n 
1 838  LYS n 
1 839  ASP n 
1 840  LYS n 
1 841  ALA n 
1 842  ASP n 
1 843  GLU n 
1 844  THR n 
1 845  TYR n 
1 846  VAL n 
1 847  LEU n 
1 848  GLY n 
1 849  LYS n 
1 850  ILE n 
1 851  LYS n 
1 852  ASP n 
1 853  ILE n 
1 854  TYR n 
1 855  THR n 
1 856  GLN n 
1 857  ASP n 
1 858  GLY n 
1 859  TYR n 
1 860  ASP n 
1 861  ALA n 
1 862  PHE n 
1 863  MET n 
1 864  LYS n 
1 865  ILE n 
1 866  TYR n 
1 867  LYS n 
1 868  LYS n 
1 869  ASP n 
1 870  LYS n 
1 871  SER n 
1 872  LYS n 
1 873  PHE n 
1 874  LEU n 
1 875  MET n 
1 876  TYR n 
1 877  ARG n 
1 878  HIS n 
1 879  ASP n 
1 880  PRO n 
1 881  GLN n 
1 882  THR n 
1 883  PHE n 
1 884  GLU n 
1 885  LYS n 
1 886  VAL n 
1 887  ILE n 
1 888  GLU n 
1 889  PRO n 
1 890  ILE n 
1 891  LEU n 
1 892  GLU n 
1 893  ASN n 
1 894  TYR n 
1 895  PRO n 
1 896  ASN n 
1 897  LYS n 
1 898  GLN n 
1 899  ILE n 
1 900  ASN n 
1 901  GLU n 
1 902  LYS n 
1 903  GLY n 
1 904  LYS n 
1 905  GLU n 
1 906  VAL n 
1 907  PRO n 
1 908  CYS n 
1 909  ASN n 
1 910  PRO n 
1 911  PHE n 
1 912  LEU n 
1 913  LYS n 
1 914  TYR n 
1 915  LYS n 
1 916  GLU n 
1 917  GLU n 
1 918  HIS n 
1 919  GLY n 
1 920  TYR n 
1 921  ILE n 
1 922  ARG n 
1 923  LYS n 
1 924  TYR n 
1 925  SER n 
1 926  LYS n 
1 927  LYS n 
1 928  GLY n 
1 929  ASN n 
1 930  GLY n 
1 931  PRO n 
1 932  GLU n 
1 933  ILE n 
1 934  LYS n 
1 935  SER n 
1 936  LEU n 
1 937  LYS n 
1 938  TYR n 
1 939  TYR n 
1 940  ASP n 
1 941  SER n 
1 942  LYS n 
1 943  LEU n 
1 944  GLY n 
1 945  ASN n 
1 946  HIS n 
1 947  ILE n 
1 948  ASP n 
1 949  ILE n 
1 950  THR n 
1 951  PRO n 
1 952  LYS n 
1 953  ASP n 
1 954  SER n 
1 955  ASN n 
1 956  ASN n 
1 957  LYS n 
1 958  VAL n 
1 959  VAL n 
1 960  LEU n 
1 961  GLN n 
1 962  SER n 
1 963  VAL n 
1 964  SER n 
1 965  PRO n 
1 966  TRP n 
1 967  ARG n 
1 968  ALA n 
1 969  ASP n 
1 970  VAL n 
1 971  TYR n 
1 972  PHE n 
1 973  ASN n 
1 974  LYS n 
1 975  THR n 
1 976  THR n 
1 977  GLY n 
1 978  LYS n 
1 979  TYR n 
1 980  GLU n 
1 981  ILE n 
1 982  LEU n 
1 983  GLY n 
1 984  LEU n 
1 985  LYS n 
1 986  TYR n 
1 987  ALA n 
1 988  ASP n 
1 989  LEU n 
1 990  GLN n 
1 991  PHE n 
1 992  GLU n 
1 993  LYS n 
1 994  GLY n 
1 995  THR n 
1 996  GLY n 
1 997  THR n 
1 998  TYR n 
1 999  LYS n 
1 1000 ILE n 
1 1001 SER n 
1 1002 GLN n 
1 1003 GLU n 
1 1004 LYS n 
1 1005 TYR n 
1 1006 ASN n 
1 1007 ASP n 
1 1008 ILE n 
1 1009 LYS n 
1 1010 LYS n 
1 1011 LYS n 
1 1012 GLU n 
1 1013 GLY n 
1 1014 VAL n 
1 1015 ASP n 
1 1016 SER n 
1 1017 ASP n 
1 1018 SER n 
1 1019 GLU n 
1 1020 PHE n 
1 1021 LYS n 
1 1022 PHE n 
1 1023 THR n 
1 1024 LEU n 
1 1025 TYR n 
1 1026 LYS n 
1 1027 ASN n 
1 1028 ASP n 
1 1029 LEU n 
1 1030 LEU n 
1 1031 LEU n 
1 1032 VAL n 
1 1033 LYS n 
1 1034 ASP n 
1 1035 THR n 
1 1036 GLU n 
1 1037 THR n 
1 1038 LYS n 
1 1039 GLU n 
1 1040 GLN n 
1 1041 GLN n 
1 1042 LEU n 
1 1043 PHE n 
1 1044 ARG n 
1 1045 PHE n 
1 1046 LEU n 
1 1047 SER n 
1 1048 ARG n 
1 1049 THR n 
1 1050 MET n 
1 1051 PRO n 
1 1052 LYS n 
1 1053 GLN n 
1 1054 LYS n 
1 1055 HIS n 
1 1056 TYR n 
1 1057 VAL n 
1 1058 GLU n 
1 1059 LEU n 
1 1060 LYS n 
1 1061 PRO n 
1 1062 TYR n 
1 1063 ASP n 
1 1064 LYS n 
1 1065 GLN n 
1 1066 LYS n 
1 1067 PHE n 
1 1068 GLU n 
1 1069 GLY n 
1 1070 GLY n 
1 1071 GLU n 
1 1072 ALA n 
1 1073 LEU n 
1 1074 ILE n 
1 1075 LYS n 
1 1076 VAL n 
1 1077 LEU n 
1 1078 GLY n 
1 1079 ASN n 
1 1080 VAL n 
1 1081 ALA n 
1 1082 ASN n 
1 1083 SER n 
1 1084 GLY n 
1 1085 GLN n 
1 1086 CYS n 
1 1087 LYS n 
1 1088 LYS n 
1 1089 GLY n 
1 1090 LEU n 
1 1091 GLY n 
1 1092 LYS n 
1 1093 SER n 
1 1094 ASN n 
1 1095 ILE n 
1 1096 SER n 
1 1097 ILE n 
1 1098 TYR n 
1 1099 LYS n 
1 1100 VAL n 
1 1101 ARG n 
1 1102 THR n 
1 1103 ASP n 
1 1104 VAL n 
1 1105 LEU n 
1 1106 GLY n 
1 1107 ASN n 
1 1108 GLN n 
1 1109 HIS n 
1 1110 ILE n 
1 1111 ILE n 
1 1112 LYS n 
1 1113 ASN n 
1 1114 GLU n 
1 1115 GLY n 
1 1116 ASP n 
1 1117 LYS n 
1 1118 PRO n 
1 1119 LYS n 
1 1120 LEU n 
1 1121 ASP n 
1 1122 PHE n 
2 1    G   n 
2 2    G   n 
2 3    U   n 
2 4    G   n 
2 5    C   n 
2 6    U   n 
2 7    A   n 
2 8    A   n 
2 9    G   n 
2 10   A   n 
2 11   U   n 
2 12   U   n 
2 13   A   n 
2 14   A   n 
2 15   U   n 
2 16   C   n 
2 17   A   n 
2 18   G   n 
2 19   G   n 
2 20   A   n 
2 21   U   n 
2 22   G   n 
2 23   U   n 
2 24   U   n 
2 25   U   n 
2 26   U   n 
2 27   U   n 
2 28   G   n 
2 29   U   n 
2 30   A   n 
2 31   C   n 
2 32   U   n 
2 33   C   n 
2 34   G   n 
2 35   A   n 
2 36   A   n 
2 37   A   n 
2 38   G   n 
2 39   A   n 
2 40   A   n 
2 41   G   n 
2 42   C   n 
2 43   U   n 
2 44   A   n 
2 45   C   n 
2 46   A   n 
2 47   A   n 
2 48   A   n 
2 49   G   n 
2 50   A   n 
2 51   U   n 
2 52   A   n 
2 53   A   n 
2 54   G   n 
2 55   G   n 
2 56   C   n 
2 57   U   n 
2 58   U   n 
2 59   C   n 
2 60   A   n 
2 61   U   n 
2 62   G   n 
2 63   C   n 
2 64   C   n 
2 65   G   n 
2 66   A   n 
2 67   A   n 
2 68   A   n 
2 69   U   n 
2 70   C   n 
2 71   A   n 
3 1    DG  n 
3 2    DC  n 
3 3    DT  n 
3 4    DC  n 
3 5    DC  n 
3 6    DT  n 
3 7    DT  n 
3 8    DT  n 
3 9    DA  n 
3 10   DT  n 
3 11   DC  n 
3 12   DC  n 
3 13   DT  n 
3 14   DG  n 
3 15   DA  n 
3 16   DT  n 
3 17   DT  n 
3 18   DA  n 
3 19   DA  n 
3 20   DT  n 
3 21   DC  n 
3 22   DT  n 
3 23   DT  n 
3 24   DA  n 
3 25   DG  n 
3 26   DC  n 
3 27   DA  n 
3 28   DC  n 
4 1    DA  n 
4 2    DA  n 
4 3    DA  n 
4 4    DG  n 
4 5    DG  n 
4 6    DA  n 
4 7    DG  n 
4 8    DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   1122 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'cas9-1, csn1, STER_0709' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    LMD-9 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Streptococcus thermophilus LMD-9' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     322159 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 71 'Streptococcus thermophilus' ? 1308 ? 
3 1 sample 1 28 'Streptococcus thermophilus' ? 1308 ? 
4 1 sample 1 8  'Streptococcus thermophilus' ? 1308 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CAS9A_STRTD Q03LF7 ? 1 
;SDLVLGLDIGIGSVGVGILNKVTGEIIHKNSRIFPAAQAENNLVRRTNRQGRRLARRKKHRRVRLNRLFEESGLITDFTK
ISINLNPYQLRVKGLTDELSNEELFIALKNMVKHRGISYLDDASDDGNSSVGDYAQIVKENSKQLETKTPGQIQLERYQT
YGQLRGDFTVEKDGKKHRLINVFPTSAYRSEALRILQTQQEFNPQITDEFINRYLEILTGKRKYYHGPGNEKSRTDYGRY
RTSGETLDNIFGILIGKCTFYPDEFRAAKASYTAQEFNLLNDLNNLTVPTETKKLSKEQKNQIINYVKNEKAMGPAKLFK
YIAKLLSCDVADIKGYRIDKSGKAEIHTFEAYRKMKTLETLDIEQMDRETLDKLAYVLTLNTEREGIQEALEHEFADGSF
SQKQVDELVQFRKANSSIFGKGWHNFSVKLMMELIPELYETSEEQMTILTRLGKQKTTSSSNKTKYIDEKLLTEEIYNPV
VAKSVRQAIKIVNAAIKEYGDFDNIVIEMARETNEDDEKKAIQKIQKANKDEKDAAMLKAANQYNGKAELPHSVFHGHKQ
LATKIRLWHQQGERCLYTGKTISIHDLINNSNQFEVDHILPLSITFDDSLANKVLVYATANQEKGQRTPYQALDSMDDAW
SFRELKAFVRESKTLSNKKKEYLLTEEDISKFDVRKKFIERNLVDTRYASRVVLNALQEHFRAHKIDTKVSVVRGQFTSQ
LRRHWGIEKTRDTYHHHAVDALIIAASSQLNLWKKQKNTLVSYSEDQLLDIETGELISDDEYKESVFKAPYQHFVDTLKS
KEFEDSILFSYQVDSKFNRKISDATIYATRQAKVGKDKADETYVLGKIKDIYTQDGYDAFMKIYKKDKSKFLMYRHDPQT
FEKVIEPILENYPNKQINEKGKEVPCNPFLKYKEEHGYIRKYSKKGNGPEIKSLKYYDSKLGNHIDITPKDSNNKVVLQS
VSPWRADVYFNKTTGKYEILGLKYADLQFEKGTGTYKISQEKYNDIKKKEGVDSDSEFKFTLYKNDLLLVKDTETKEQQL
FRFLSRTMPKQKHYVELKPYDKQKFEGGEALIKVLGNVANSGQCKKGLGKSNISIYKVRTDVLGNQHIIKNEGDKPKLDF

;
2 
2 PDB 6M0X        6M0X   ? 2 ? 1 
3 PDB 6M0X        6M0X   ? 3 ? 1 
4 PDB 6M0X        6M0X   ? 4 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6M0X A 3 ? 1122 ? Q03LF7 2 ? 1121 ? 2 1121 
2 2 6M0X B 1 ? 71   ? 6M0X   0 ? 70   ? 0 70   
3 3 6M0X C 1 ? 28   ? 6M0X   1 ? 28   ? 1 28   
4 4 6M0X D 1 ? 8    ? 6M0X   1 ? 8    ? 1 8    
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6M0X MET A 1   ? UNP Q03LF7 ?   ?   'initiating methionine' 0   1 
1 6M0X GLY A 2   ? UNP Q03LF7 ?   ?   'expression tag'        1   2 
1 6M0X ALA A 600 ? UNP Q03LF7 HIS 599 'engineered mutation'   599 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
BA  non-polymer         . 'BARIUM ION'                         ? 'Ba 2'            137.327 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6M0X 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.59 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.53 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'KCL, BaCL2, MPD, MgCL2' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     200 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-02-04 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.978 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL19U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.978 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL19U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            49.210 
_reflns.entry_id                         6M0X 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.560 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       54046 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.700 
_reflns.pdbx_Rmerge_I_obs                0.103 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            5.300 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.953 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.112 
_reflns.pdbx_Rpim_I_all                  0.043 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         360588 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
2.560 2.650  ? ? ? ? ? ? 5342 99.700  ? ? ? ? 0.720 ? ? ? ? ? ? ? ? 6.300 ? 0.723 ? ? 0.786 0.310 ? 1  1 0.863 ? ? 
2.650 2.760  ? ? ? ? ? ? 5359 100.000 ? ? ? ? 0.587 ? ? ? ? ? ? ? ? 6.500 ? 0.739 ? ? 0.638 0.247 ? 2  1 0.904 ? ? 
2.760 2.880  ? ? ? ? ? ? 5405 100.000 ? ? ? ? 0.431 ? ? ? ? ? ? ? ? 6.500 ? 0.776 ? ? 0.470 0.183 ? 3  1 0.939 ? ? 
2.880 3.040  ? ? ? ? ? ? 5360 100.000 ? ? ? ? 0.303 ? ? ? ? ? ? ? ? 7.000 ? 0.826 ? ? 0.327 0.123 ? 4  1 0.972 ? ? 
3.040 3.230  ? ? ? ? ? ? 5369 100.000 ? ? ? ? 0.182 ? ? ? ? ? ? ? ? 6.900 ? 0.886 ? ? 0.197 0.075 ? 5  1 0.989 ? ? 
3.230 3.470  ? ? ? ? ? ? 5392 100.000 ? ? ? ? 0.133 ? ? ? ? ? ? ? ? 6.500 ? 0.965 ? ? 0.145 0.056 ? 6  1 0.993 ? ? 
3.470 3.820  ? ? ? ? ? ? 5400 100.000 ? ? ? ? 0.103 ? ? ? ? ? ? ? ? 7.000 ? 1.079 ? ? 0.112 0.042 ? 7  1 0.994 ? ? 
3.820 4.380  ? ? ? ? ? ? 5435 100.000 ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 6.900 ? 1.213 ? ? 0.086 0.033 ? 8  1 0.996 ? ? 
4.380 5.510  ? ? ? ? ? ? 5430 100.000 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 6.800 ? 1.203 ? ? 0.071 0.027 ? 9  1 0.996 ? ? 
5.510 50.000 ? ? ? ? ? ? 5554 99.800  ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 6.500 ? 1.074 ? ? 0.053 0.021 ? 10 1 0.998 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                182.970 
_refine.B_iso_mean                               60.1755 
_refine.B_iso_min                                28.570 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6M0X 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.5610 
_refine.ls_d_res_low                             48.8960 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     54010 
_refine.ls_number_reflns_R_free                  2749 
_refine.ls_number_reflns_R_work                  51261 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.7100 
_refine.ls_percent_reflns_R_free                 5.0900 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2272 
_refine.ls_R_factor_R_free                       0.2556 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2256 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5axw 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.4400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3400 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.5610 
_refine_hist.d_res_low                        48.8960 
_refine_hist.number_atoms_solvent             51 
_refine_hist.number_atoms_total               10523 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       1139 
_refine_hist.pdbx_B_iso_mean_ligand           105.26 
_refine_hist.pdbx_B_iso_mean_solvent          44.76 
_refine_hist.pdbx_number_atoms_protein        8229 
_refine_hist.pdbx_number_atoms_nucleic_acid   2227 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 10865 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.901  ? 15146 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.048  ? 1738  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 1567  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 19.827 ? 6284  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.5613 2.6055 . . 113 2506 96.0000  . . . 0.3637 0.0000 0.3106 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6055 2.6529 . . 116 2535 100.0000 . . . 0.3611 0.0000 0.3212 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6529 2.7039 . . 116 2613 100.0000 . . . 0.3426 0.0000 0.3035 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7039 2.7591 . . 138 2504 100.0000 . . . 0.3883 0.0000 0.3041 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7591 2.8191 . . 152 2552 100.0000 . . . 0.3916 0.0000 0.2961 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8191 2.8846 . . 137 2553 100.0000 . . . 0.3309 0.0000 0.2985 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8846 2.9568 . . 146 2527 100.0000 . . . 0.3711 0.0000 0.3011 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9568 3.0367 . . 140 2562 100.0000 . . . 0.3354 0.0000 0.2845 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0367 3.1260 . . 119 2578 100.0000 . . . 0.2907 0.0000 0.2701 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1260 3.2269 . . 128 2554 100.0000 . . . 0.2884 0.0000 0.2574 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2269 3.3422 . . 130 2557 100.0000 . . . 0.2941 0.0000 0.2419 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3422 3.4760 . . 156 2542 100.0000 . . . 0.3159 0.0000 0.2375 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4760 3.6342 . . 151 2561 100.0000 . . . 0.2334 0.0000 0.2272 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6342 3.8257 . . 149 2547 100.0000 . . . 0.2390 0.0000 0.2088 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8257 4.0653 . . 146 2574 100.0000 . . . 0.2135 0.0000 0.1966 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0653 4.3790 . . 121 2604 100.0000 . . . 0.2073 0.0000 0.1866 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3790 4.8193 . . 154 2545 100.0000 . . . 0.2066 0.0000 0.1774 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.8193 5.5159 . . 162 2571 100.0000 . . . 0.2180 0.0000 0.1882 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.5159 6.9462 . . 115 2634 100.0000 . . . 0.2597 0.0000 0.2177 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.9462 48.896 . . 160 2642 99.0000  . . . 0.2001 0.0000 0.1984 . . . . . . . . . . . 
# 
_struct.entry_id                     6M0X 
_struct.title                        'Crystal structure of Streptococcus thermophilus Cas9 in complex with AGGA PAM' 
_struct.pdbx_descriptor              'CRISPR-associated endonuclease Cas9 1/RNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6M0X 
_struct_keywords.text            'Cas9, CRISPR, DNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 5 ? 
U N N 7 ? 
V N N 7 ? 
W N N 7 ? 
X N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ALA A 38   ? ASN A 43   ? ALA A 37   ASN A 42   1 ? 6  
HELX_P HELX_P2  AA2 ASN A 43   ? SER A 74   ? ASN A 42   SER A 73   1 ? 32 
HELX_P HELX_P3  AA3 ASN A 88   ? GLY A 96   ? ASN A 87   GLY A 95   1 ? 9  
HELX_P HELX_P4  AA4 SER A 102  ? LYS A 115  ? SER A 101  LYS A 114  1 ? 14 
HELX_P HELX_P5  AA5 THR A 151  ? GLY A 164  ? THR A 150  GLY A 163  1 ? 14 
HELX_P HELX_P6  AA6 PRO A 186  ? ASN A 205  ? PRO A 185  ASN A 204  1 ? 20 
HELX_P HELX_P7  AA7 THR A 209  ? GLY A 222  ? THR A 208  GLY A 221  1 ? 14 
HELX_P HELX_P8  AA8 PHE A 253  ? ILE A 257  ? PHE A 252  ILE A 256  5 ? 5  
HELX_P HELX_P9  AA9 SER A 273  ? ASN A 287  ? SER A 272  ASN A 286  1 ? 15 
HELX_P HELX_P10 AB1 SER A 298  ? GLU A 312  ? SER A 297  GLU A 311  1 ? 15 
HELX_P HELX_P11 AB2 GLY A 316  ? LEU A 327  ? GLY A 315  LEU A 326  1 ? 12 
HELX_P HELX_P12 AB3 ASP A 331  ? ILE A 335  ? ASP A 330  ILE A 334  5 ? 5  
HELX_P HELX_P13 AB4 PHE A 351  ? THR A 359  ? PHE A 350  THR A 358  1 ? 9  
HELX_P HELX_P14 AB5 ASP A 364  ? MET A 368  ? ASP A 363  MET A 367  5 ? 5  
HELX_P HELX_P15 AB6 ASP A 369  ? ASN A 383  ? ASP A 368  ASN A 382  1 ? 15 
HELX_P HELX_P16 AB7 GLU A 385  ? PHE A 397  ? GLU A 384  PHE A 396  1 ? 13 
HELX_P HELX_P17 AB8 SER A 403  ? ASN A 417  ? SER A 402  ASN A 416  1 ? 15 
HELX_P HELX_P18 AB9 ASN A 417  ? GLY A 422  ? ASN A 416  GLY A 421  1 ? 6  
HELX_P HELX_P19 AC1 SER A 429  ? GLU A 435  ? SER A 428  GLU A 434  1 ? 7  
HELX_P HELX_P20 AC2 LEU A 436  ? THR A 443  ? LEU A 435  THR A 442  1 ? 8  
HELX_P HELX_P21 AC3 GLU A 446  ? GLY A 455  ? GLU A 445  GLY A 454  1 ? 10 
HELX_P HELX_P22 AC4 ASP A 470  ? THR A 475  ? ASP A 469  THR A 474  1 ? 6  
HELX_P HELX_P23 AC5 ASN A 480  ? GLY A 502  ? ASN A 479  GLY A 501  1 ? 23 
HELX_P HELX_P24 AC6 GLU A 517  ? ASN A 547  ? GLU A 516  ASN A 546  1 ? 31 
HELX_P HELX_P25 AC7 PRO A 553  ? HIS A 558  ? PRO A 552  HIS A 557  5 ? 6  
HELX_P HELX_P26 AC8 GLN A 562  ? GLN A 573  ? GLN A 561  GLN A 572  1 ? 12 
HELX_P HELX_P27 AC9 SER A 585  ? ASN A 592  ? SER A 584  ASN A 591  1 ? 8  
HELX_P HELX_P28 AD1 SER A 611  ? ALA A 613  ? SER A 610  ALA A 612  5 ? 3  
HELX_P HELX_P29 AD2 ALA A 620  ? GLY A 627  ? ALA A 619  GLY A 626  1 ? 8  
HELX_P HELX_P30 AD3 THR A 630  ? LEU A 635  ? THR A 629  LEU A 634  1 ? 6  
HELX_P HELX_P31 AD4 SER A 643  ? SER A 654  ? SER A 642  SER A 653  1 ? 12 
HELX_P HELX_P32 AD5 SER A 658  ? THR A 667  ? SER A 657  THR A 666  1 ? 10 
HELX_P HELX_P33 AD6 GLU A 682  ? HIS A 706  ? GLU A 681  HIS A 705  1 ? 25 
HELX_P HELX_P34 AD7 GLY A 717  ? TRP A 727  ? GLY A 716  TRP A 726  1 ? 11 
HELX_P HELX_P35 AD8 TYR A 736  ? GLN A 751  ? TYR A 735  GLN A 750  1 ? 16 
HELX_P HELX_P36 AD9 TYR A 793  ? SER A 802  ? TYR A 792  SER A 801  1 ? 10 
HELX_P HELX_P37 AE1 PHE A 805  ? ILE A 809  ? PHE A 804  ILE A 808  5 ? 5  
HELX_P HELX_P38 AE2 THR A 855  ? LYS A 870  ? THR A 854  LYS A 869  1 ? 16 
HELX_P HELX_P39 AE3 PHE A 873  ? ASP A 879  ? PHE A 872  ASP A 878  1 ? 7  
HELX_P HELX_P40 AE4 ASP A 879  ? VAL A 886  ? ASP A 878  VAL A 885  1 ? 8  
HELX_P HELX_P41 AE5 VAL A 886  ? TYR A 894  ? VAL A 885  TYR A 893  1 ? 9  
HELX_P HELX_P42 AE6 ASN A 909  ? GLY A 919  ? ASN A 908  GLY A 918  1 ? 11 
HELX_P HELX_P43 AE7 ALA A 987  ? LEU A 989  ? ALA A 986  LEU A 988  5 ? 3  
HELX_P HELX_P44 AE8 SER A 1001 ? GLU A 1012 ? SER A 1000 GLU A 1011 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1   metalc ? ? A ASP 169  O   ? ? ? 1_555 I BA  .  BA    ? ? A ASP 168  A BA  1205 1_555 ? ? ? ? ? ? ?             3.006 ? ? 
metalc2   metalc ? ? A LYS 358  O   ? ? ? 1_555 J BA  .  BA    ? ? A LYS 357  A BA  1206 1_555 ? ? ? ? ? ? ?             2.884 ? ? 
metalc3   metalc ? ? A LEU 360  O   ? ? ? 1_555 J BA  .  BA    ? ? A LEU 359  A BA  1206 1_555 ? ? ? ? ? ? ?             2.956 ? ? 
metalc4   metalc ? ? A ASP 364  OD1 ? ? ? 1_555 J BA  .  BA    ? ? A ASP 363  A BA  1206 1_555 ? ? ? ? ? ? ?             3.424 ? ? 
metalc5   metalc ? ? A ASP 399  OD2 ? ? ? 1_555 L MG  .  MG    ? ? A ASP 398  A MG  1208 1_554 ? ? ? ? ? ? ?             2.167 ? ? 
metalc6   metalc ? ? A GLY 422  O   ? ? ? 1_555 E BA  .  BA    ? ? A GLY 421  A BA  1201 1_555 ? ? ? ? ? ? ?             2.906 ? ? 
metalc7   metalc ? ? A THR 515  O   ? ? ? 1_555 G BA  .  BA    ? ? A THR 514  A BA  1203 1_555 ? ? ? ? ? ? ?             3.123 ? ? 
metalc8   metalc ? ? A ASP 599  OD1 ? ? ? 1_555 K MG  .  MG    ? ? A ASP 598  A MG  1207 1_555 ? ? ? ? ? ? ?             2.067 ? ? 
metalc9   metalc ? ? A ASN 623  OD1 ? ? ? 1_555 K MG  .  MG    ? ? A ASN 622  A MG  1207 1_555 ? ? ? ? ? ? ?             2.519 ? ? 
metalc10  metalc ? ? A ASP 825  OD1 ? ? ? 1_555 H BA  .  BA    ? ? A ASP 824  A BA  1204 1_555 ? ? ? ? ? ? ?             2.870 ? ? 
metalc11  metalc ? ? A LYS 849  O   ? ? ? 1_555 F BA  .  BA    ? ? A LYS 848  A BA  1202 1_555 ? ? ? ? ? ? ?             2.988 ? ? 
metalc12  metalc ? ? A SER 962  OG  ? ? ? 1_555 H BA  .  BA    ? ? A SER 961  A BA  1204 1_555 ? ? ? ? ? ? ?             3.112 ? ? 
metalc13  metalc ? ? A SER 1083 O   ? ? ? 1_555 L MG  .  MG    ? ? A SER 1082 A MG  1208 1_555 ? ? ? ? ? ? ?             2.235 ? ? 
metalc14  metalc ? ? E BA  .    BA  ? ? ? 1_555 C DT  17 OP2   ? ? A BA  1201 C DT  17   1_555 ? ? ? ? ? ? ?             2.679 ? ? 
metalc15  metalc ? ? E BA  .    BA  ? ? ? 1_555 W HOH .  O     ? ? A BA  1201 C HOH 204  1_555 ? ? ? ? ? ? ?             3.010 ? ? 
metalc16  metalc ? ? H BA  .    BA  ? ? ? 1_555 U HOH .  O     ? ? A BA  1204 A HOH 1316 1_555 ? ? ? ? ? ? ?             2.677 ? ? 
metalc17  metalc ? ? H BA  .    BA  ? ? ? 1_555 X HOH .  O     ? ? A BA  1204 D HOH 201  1_555 ? ? ? ? ? ? ?             3.012 ? ? 
metalc18  metalc ? ? I BA  .    BA  ? ? ? 1_555 U HOH .  O     ? ? A BA  1205 A HOH 1301 1_555 ? ? ? ? ? ? ?             3.085 ? ? 
metalc19  metalc ? ? K MG  .    MG  ? ? ? 1_555 U HOH .  O     ? ? A MG  1207 A HOH 1309 1_555 ? ? ? ? ? ? ?             2.154 ? ? 
metalc20  metalc ? ? K MG  .    MG  ? ? ? 1_555 U HOH .  O     ? ? A MG  1207 A HOH 1312 1_555 ? ? ? ? ? ? ?             2.071 ? ? 
metalc21  metalc ? ? K MG  .    MG  ? ? ? 1_555 C DC  11 "O3'" ? ? A MG  1207 C DC  11   1_555 ? ? ? ? ? ? ?             2.526 ? ? 
metalc22  metalc ? ? K MG  .    MG  ? ? ? 1_555 C DC  12 OP1   ? ? A MG  1207 C DC  12   1_555 ? ? ? ? ? ? ?             2.217 ? ? 
metalc23  metalc ? ? L MG  .    MG  ? ? ? 1_555 U HOH .  O     ? ? A MG  1208 A HOH 1322 1_556 ? ? ? ? ? ? ?             2.858 ? ? 
metalc24  metalc ? ? U HOH .    O   ? ? ? 1_555 P BA  .  BA    ? ? A HOH 1320 B BA  104  1_555 ? ? ? ? ? ? ?             2.766 ? ? 
metalc25  metalc ? ? B U   3    O4  ? ? ? 1_555 O BA  .  BA    ? ? B U   2    B BA  103  1_555 ? ? ? ? ? ? ?             2.682 ? ? 
metalc26  metalc ? ? B G   34   O6  ? ? ? 1_555 Q BA  .  BA    ? ? B G   33   B BA  105  1_555 ? ? ? ? ? ? ?             2.690 ? ? 
metalc27  metalc ? ? B G   41   O6  ? ? ? 1_555 N BA  .  BA    ? ? B G   40   B BA  102  1_555 ? ? ? ? ? ? ?             2.840 ? ? 
metalc28  metalc ? ? B U   51   OP1 ? ? ? 1_555 M BA  .  BA    ? ? B U   50   B BA  101  1_555 ? ? ? ? ? ? ?             2.716 ? ? 
metalc29  metalc ? ? B G   54   O6  ? ? ? 1_555 M BA  .  BA    ? ? B G   53   B BA  101  1_555 ? ? ? ? ? ? ?             3.117 ? ? 
metalc30  metalc ? ? N BA  .    BA  ? ? ? 1_555 V HOH .  O     ? ? B BA  102  B HOH 208  1_555 ? ? ? ? ? ? ?             2.645 ? ? 
metalc31  metalc ? ? N BA  .    BA  ? ? ? 1_555 V HOH .  O     ? ? B BA  102  B HOH 221  1_555 ? ? ? ? ? ? ?             2.727 ? ? 
metalc32  metalc ? ? Q BA  .    BA  ? ? ? 1_555 V HOH .  O     ? ? B BA  105  B HOH 218  1_555 ? ? ? ? ? ? ?             3.239 ? ? 
metalc33  metalc ? ? R BA  .    BA  ? ? ? 1_555 V HOH .  O     ? ? B BA  106  B HOH 222  1_555 ? ? ? ? ? ? ?             2.801 ? ? 
metalc34  metalc ? ? C DG  1    O6  ? ? ? 1_555 S BA  .  BA    ? ? C DG  1    C BA  101  1_555 ? ? ? ? ? ? ?             3.008 ? ? 
metalc35  metalc ? ? W HOH .    O   ? ? ? 1_555 T BA  .  BA    ? ? C HOH 201  D BA  101  1_555 ? ? ? ? ? ? ?             2.580 ? ? 
metalc36  metalc ? ? T BA  .    BA  ? ? ? 1_555 X HOH .  O     ? ? D BA  101  D HOH 203  1_555 ? ? ? ? ? ? ?             2.608 ? ? 
hydrog1   hydrog ? ? B G   2    N1  ? ? ? 1_555 C DC  28 N3    ? ? B G   1    C DC  28   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog2   hydrog ? ? B G   2    N2  ? ? ? 1_555 C DC  28 O2    ? ? B G   1    C DC  28   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog3   hydrog ? ? B G   2    O6  ? ? ? 1_555 C DC  28 N4    ? ? B G   1    C DC  28   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog4   hydrog ? ? B U   3    N3  ? ? ? 1_555 C DA  27 N1    ? ? B U   2    C DA  27   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog5   hydrog ? ? B U   3    O4  ? ? ? 1_555 C DA  27 N6    ? ? B U   2    C DA  27   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog6   hydrog ? ? B G   4    N1  ? ? ? 1_555 C DC  26 N3    ? ? B G   3    C DC  26   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog7   hydrog ? ? B G   4    N2  ? ? ? 1_555 C DC  26 O2    ? ? B G   3    C DC  26   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog8   hydrog ? ? B G   4    O6  ? ? ? 1_555 C DC  26 N4    ? ? B G   3    C DC  26   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog9   hydrog ? ? B C   5    N3  ? ? ? 1_555 C DG  25 N1    ? ? B C   4    C DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog10  hydrog ? ? B C   5    N4  ? ? ? 1_555 C DG  25 O6    ? ? B C   4    C DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog11  hydrog ? ? B C   5    O2  ? ? ? 1_555 C DG  25 N2    ? ? B C   4    C DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog12  hydrog ? ? B U   6    N3  ? ? ? 1_555 C DA  24 N1    ? ? B U   5    C DA  24   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog13  hydrog ? ? B U   6    O4  ? ? ? 1_555 C DA  24 N6    ? ? B U   5    C DA  24   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog14  hydrog ? ? B A   7    N1  ? ? ? 1_555 C DT  23 N3    ? ? B A   6    C DT  23   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog15  hydrog ? ? B A   7    N6  ? ? ? 1_555 C DT  23 O4    ? ? B A   6    C DT  23   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog16  hydrog ? ? B A   8    N1  ? ? ? 1_555 C DT  22 N3    ? ? B A   7    C DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog17  hydrog ? ? B A   8    N6  ? ? ? 1_555 C DT  22 O4    ? ? B A   7    C DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog18  hydrog ? ? B G   9    N1  ? ? ? 1_555 C DC  21 N3    ? ? B G   8    C DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog19  hydrog ? ? B G   9    N2  ? ? ? 1_555 C DC  21 O2    ? ? B G   8    C DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog20  hydrog ? ? B G   9    O6  ? ? ? 1_555 C DC  21 N4    ? ? B G   8    C DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog21  hydrog ? ? B A   10   N1  ? ? ? 1_555 C DT  20 N3    ? ? B A   9    C DT  20   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog22  hydrog ? ? B A   10   N6  ? ? ? 1_555 C DT  20 O4    ? ? B A   9    C DT  20   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog23  hydrog ? ? B U   11   N3  ? ? ? 1_555 C DA  19 N1    ? ? B U   10   C DA  19   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog24  hydrog ? ? B U   11   O4  ? ? ? 1_555 C DA  19 N6    ? ? B U   10   C DA  19   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog25  hydrog ? ? B U   12   N3  ? ? ? 1_555 C DA  18 N1    ? ? B U   11   C DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog26  hydrog ? ? B U   12   O4  ? ? ? 1_555 C DA  18 N6    ? ? B U   11   C DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog27  hydrog ? ? B A   13   N1  ? ? ? 1_555 C DT  17 N3    ? ? B A   12   C DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog28  hydrog ? ? B A   13   N6  ? ? ? 1_555 C DT  17 O4    ? ? B A   12   C DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog29  hydrog ? ? B A   14   N1  ? ? ? 1_555 C DT  16 N3    ? ? B A   13   C DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog30  hydrog ? ? B A   14   N6  ? ? ? 1_555 C DT  16 O4    ? ? B A   13   C DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog31  hydrog ? ? B U   15   N3  ? ? ? 1_555 C DA  15 N1    ? ? B U   14   C DA  15   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog32  hydrog ? ? B U   15   O4  ? ? ? 1_555 C DA  15 N6    ? ? B U   14   C DA  15   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog33  hydrog ? ? B C   16   N3  ? ? ? 1_555 C DG  14 N1    ? ? B C   15   C DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog34  hydrog ? ? B C   16   N4  ? ? ? 1_555 C DG  14 O6    ? ? B C   15   C DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog35  hydrog ? ? B C   16   O2  ? ? ? 1_555 C DG  14 N2    ? ? B C   15   C DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog36  hydrog ? ? B A   17   N1  ? ? ? 1_555 C DT  13 N3    ? ? B A   16   C DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog37  hydrog ? ? B A   17   N6  ? ? ? 1_555 C DT  13 O4    ? ? B A   16   C DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog38  hydrog ? ? B G   18   N1  ? ? ? 1_555 C DC  12 N3    ? ? B G   17   C DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog39  hydrog ? ? B G   18   N2  ? ? ? 1_555 C DC  12 O2    ? ? B G   17   C DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog40  hydrog ? ? B G   18   O6  ? ? ? 1_555 C DC  12 N4    ? ? B G   17   C DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog41  hydrog ? ? B G   19   N1  ? ? ? 1_555 C DC  11 N3    ? ? B G   18   C DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog42  hydrog ? ? B G   19   N2  ? ? ? 1_555 C DC  11 O2    ? ? B G   18   C DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog43  hydrog ? ? B G   19   O6  ? ? ? 1_555 C DC  11 N4    ? ? B G   18   C DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog44  hydrog ? ? B A   20   N1  ? ? ? 1_555 C DT  10 N3    ? ? B A   19   C DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog45  hydrog ? ? B A   20   N6  ? ? ? 1_555 C DT  10 O4    ? ? B A   19   C DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog46  hydrog ? ? B U   21   N3  ? ? ? 1_555 C DA  9  N1    ? ? B U   20   C DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog47  hydrog ? ? B U   21   O4  ? ? ? 1_555 C DA  9  N6    ? ? B U   20   C DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog48  hydrog ? ? B G   22   N1  ? ? ? 1_555 B U   51 O2    ? ? B G   21   B U   50   1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog49  hydrog ? ? B G   22   O6  ? ? ? 1_555 B U   51 N3    ? ? B G   21   B U   50   1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog50  hydrog ? ? B U   23   N3  ? ? ? 1_555 B A   50 N1    ? ? B U   22   B A   49   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog51  hydrog ? ? B U   23   O4  ? ? ? 1_555 B A   50 N6    ? ? B U   22   B A   49   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog52  hydrog ? ? B U   24   N3  ? ? ? 1_555 B G   49 O6    ? ? B U   23   B G   48   1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog53  hydrog ? ? B U   24   O2  ? ? ? 1_555 B G   49 N1    ? ? B U   23   B G   48   1_555 ? ? ? ? ? ? TYPE_28_PAIR  ?     ? ? 
hydrog54  hydrog ? ? B U   25   N3  ? ? ? 1_555 B A   48 N1    ? ? B U   24   B A   47   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog55  hydrog ? ? B U   25   O4  ? ? ? 1_555 B A   48 N6    ? ? B U   24   B A   47   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog56  hydrog ? ? B U   26   N3  ? ? ? 1_555 B A   47 N1    ? ? B U   25   B A   46   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog57  hydrog ? ? B U   26   O4  ? ? ? 1_555 B A   47 N6    ? ? B U   25   B A   46   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog58  hydrog ? ? B U   27   N3  ? ? ? 1_555 B A   46 N1    ? ? B U   26   B A   45   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog59  hydrog ? ? B U   27   O4  ? ? ? 1_555 B A   46 N6    ? ? B U   26   B A   45   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog60  hydrog ? ? B G   28   N1  ? ? ? 1_555 B C   45 N3    ? ? B G   27   B C   44   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog61  hydrog ? ? B G   28   N2  ? ? ? 1_555 B C   45 O2    ? ? B G   27   B C   44   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog62  hydrog ? ? B G   28   O6  ? ? ? 1_555 B C   45 N4    ? ? B G   27   B C   44   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog63  hydrog ? ? B U   29   N3  ? ? ? 1_555 B A   44 N1    ? ? B U   28   B A   43   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog64  hydrog ? ? B U   29   O4  ? ? ? 1_555 B A   44 N6    ? ? B U   28   B A   43   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog65  hydrog ? ? B A   30   N1  ? ? ? 1_555 B U   43 N3    ? ? B A   29   B U   42   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog66  hydrog ? ? B A   30   N6  ? ? ? 1_555 B U   43 O4    ? ? B A   29   B U   42   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog67  hydrog ? ? B C   31   N4  ? ? ? 1_555 B A   40 N1    ? ? B C   30   B A   39   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ?     ? ? 
hydrog68  hydrog ? ? B C   31   N3  ? ? ? 1_555 B C   42 N4    ? ? B C   30   B C   41   1_555 ? ? ? ? ? ? 'C-C MISPAIR' ?     ? ? 
hydrog69  hydrog ? ? B U   32   N3  ? ? ? 1_555 B A   39 N1    ? ? B U   31   B A   38   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog70  hydrog ? ? B U   32   O4  ? ? ? 1_555 B A   39 N6    ? ? B U   31   B A   38   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog71  hydrog ? ? B C   33   N3  ? ? ? 1_555 B G   38 N1    ? ? B C   32   B G   37   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog72  hydrog ? ? B C   33   N4  ? ? ? 1_555 B G   38 O6    ? ? B C   32   B G   37   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog73  hydrog ? ? B C   33   O2  ? ? ? 1_555 B G   38 N2    ? ? B C   32   B G   37   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog74  hydrog ? ? B G   34   N2  ? ? ? 1_555 B A   37 N7    ? ? B G   33   B A   36   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ?     ? ? 
hydrog75  hydrog ? ? B A   40   N1  ? ? ? 1_555 B C   42 N4    ? ? B A   39   B C   41   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ?     ? ? 
hydrog76  hydrog ? ? B G   41   N2  ? ? ? 1_555 B U   43 O4    ? ? B G   40   B U   42   1_555 ? ? ? ? ? ? 'G-U MISPAIR' ?     ? ? 
hydrog77  hydrog ? ? B A   53   N7  ? ? ? 1_555 B G   65 N2    ? ? B A   52   B G   64   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ?     ? ? 
hydrog78  hydrog ? ? B G   54   N1  ? ? ? 1_555 B C   64 N3    ? ? B G   53   B C   63   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog79  hydrog ? ? B G   54   N2  ? ? ? 1_555 B C   64 O2    ? ? B G   53   B C   63   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog80  hydrog ? ? B G   54   O6  ? ? ? 1_555 B C   64 N4    ? ? B G   53   B C   63   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog81  hydrog ? ? B G   55   N1  ? ? ? 1_555 B C   63 N3    ? ? B G   54   B C   62   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog82  hydrog ? ? B G   55   N2  ? ? ? 1_555 B C   63 O2    ? ? B G   54   B C   62   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog83  hydrog ? ? B G   55   O6  ? ? ? 1_555 B C   63 N4    ? ? B G   54   B C   62   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog84  hydrog ? ? B C   56   N3  ? ? ? 1_555 B G   62 N1    ? ? B C   55   B G   61   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog85  hydrog ? ? B C   56   N4  ? ? ? 1_555 B G   62 O6    ? ? B C   55   B G   61   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog86  hydrog ? ? B C   56   O2  ? ? ? 1_555 B G   62 N2    ? ? B C   55   B G   61   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog87  hydrog ? ? B U   57   N3  ? ? ? 1_555 B A   60 N1    ? ? B U   56   B A   59   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog88  hydrog ? ? B U   57   O4  ? ? ? 1_555 B A   60 N6    ? ? B U   56   B A   59   1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog89  hydrog ? ? C DG  1    N1  ? ? ? 1_555 D DC  8  N3    ? ? C DG  1    D DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog90  hydrog ? ? C DG  1    N2  ? ? ? 1_555 D DC  8  O2    ? ? C DG  1    D DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog91  hydrog ? ? C DG  1    O6  ? ? ? 1_555 D DC  8  N4    ? ? C DG  1    D DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog92  hydrog ? ? C DC  2    N3  ? ? ? 1_555 D DG  7  N1    ? ? C DC  2    D DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog93  hydrog ? ? C DC  2    N4  ? ? ? 1_555 D DG  7  O6    ? ? C DC  2    D DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog94  hydrog ? ? C DC  2    O2  ? ? ? 1_555 D DG  7  N2    ? ? C DC  2    D DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog95  hydrog ? ? C DT  3    N3  ? ? ? 1_555 D DA  6  N1    ? ? C DT  3    D DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog96  hydrog ? ? C DT  3    O4  ? ? ? 1_555 D DA  6  N6    ? ? C DT  3    D DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog97  hydrog ? ? C DC  4    N3  ? ? ? 1_555 D DG  5  N1    ? ? C DC  4    D DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog98  hydrog ? ? C DC  4    N4  ? ? ? 1_555 D DG  5  O6    ? ? C DC  4    D DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog99  hydrog ? ? C DC  4    O2  ? ? ? 1_555 D DG  5  N2    ? ? C DC  4    D DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog100 hydrog ? ? C DC  5    N3  ? ? ? 1_555 D DG  4  N1    ? ? C DC  5    D DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog101 hydrog ? ? C DC  5    N4  ? ? ? 1_555 D DG  4  O6    ? ? C DC  5    D DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog102 hydrog ? ? C DC  5    O2  ? ? ? 1_555 D DG  4  N2    ? ? C DC  5    D DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog103 hydrog ? ? C DT  6    N3  ? ? ? 1_555 D DA  3  N1    ? ? C DT  6    D DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog104 hydrog ? ? C DT  6    O4  ? ? ? 1_555 D DA  3  N6    ? ? C DT  6    D DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog105 hydrog ? ? C DT  7    N3  ? ? ? 1_555 D DA  2  N1    ? ? C DT  7    D DA  2    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog106 hydrog ? ? C DT  7    O4  ? ? ? 1_555 D DA  2  N6    ? ? C DT  7    D DA  2    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog107 hydrog ? ? C DT  8    N3  ? ? ? 1_555 D DA  1  N1    ? ? C DT  8    D DA  1    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
hydrog108 hydrog ? ? C DT  8    O4  ? ? ? 1_555 D DA  1  N6    ? ? C DT  8    D DA  1    1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 5 ? 
AA5 ? 2 ? 
AA6 ? 3 ? 
AA7 ? 2 ? 
AA8 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA8 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 711  ? ARG A 716  ? LYS A 710  ARG A 715  
AA1 2 ASN A 506  ? MET A 511  ? ASN A 505  MET A 510  
AA1 3 VAL A 6    ? ILE A 11   ? VAL A 5    ILE A 10   
AA1 4 SER A 15   ? LEU A 21   ? SER A 14   LEU A 20   
AA1 5 ILE A 28   ? ILE A 35   ? ILE A 27   ILE A 34   
AA1 6 LEU A 810  ? TYR A 813  ? LEU A 809  TYR A 812  
AA2 1 ASP A 169  ? LYS A 174  ? ASP A 168  LYS A 173  
AA2 2 LYS A 177  ? ILE A 182  ? LYS A 176  ILE A 181  
AA3 1 PHE A 596  ? ALA A 600  ? PHE A 595  ALA A 599  
AA3 2 LYS A 615  ? TYR A 619  ? LYS A 614  TYR A 618  
AA4 1 LEU A 936  ? LYS A 942  ? LEU A 935  LYS A 941  
AA4 2 GLU A 843  ? ILE A 850  ? GLU A 842  ILE A 849  
AA4 3 TYR A 829  ? ALA A 834  ? TYR A 828  ALA A 833  
AA4 4 VAL A 958  ? LEU A 960  ? VAL A 957  LEU A 959  
AA4 5 ILE A 947  ? ASP A 948  ? ILE A 946  ASP A 947  
AA5 1 LYS A 897  ? ILE A 899  ? LYS A 896  ILE A 898  
AA5 2 GLU A 905  ? PRO A 907  ? GLU A 904  PRO A 906  
AA6 1 LYS A 978  ? LYS A 985  ? LYS A 977  LYS A 984  
AA6 2 PRO A 965  ? ASN A 973  ? PRO A 964  ASN A 972  
AA6 3 GLU A 1019 ? TYR A 1025 ? GLU A 1018 TYR A 1024 
AA7 1 GLN A 990  ? PHE A 991  ? GLN A 989  PHE A 990  
AA7 2 TYR A 998  ? LYS A 999  ? TYR A 997  LYS A 998  
AA8 1 CYS A 1086 ? GLY A 1089 ? CYS A 1085 GLY A 1088 
AA8 2 TYR A 1056 ? LYS A 1060 ? TYR A 1055 LYS A 1059 
AA8 3 GLN A 1040 ? ARG A 1048 ? GLN A 1039 ARG A 1047 
AA8 4 LEU A 1029 ? ASP A 1034 ? LEU A 1028 ASP A 1033 
AA8 5 ILE A 1095 ? THR A 1102 ? ILE A 1094 THR A 1101 
AA8 6 GLN A 1108 ? ILE A 1111 ? GLN A 1107 ILE A 1110 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O VAL A 715  ? O VAL A 714  N MET A 511  ? N MET A 510  
AA1 2 3 O VAL A 508  ? O VAL A 507  N LEU A 7    ? N LEU A 6    
AA1 3 4 N GLY A 8    ? N GLY A 7    O GLY A 19   ? O GLY A 18   
AA1 4 5 N ILE A 20   ? N ILE A 19   O HIS A 30   ? O HIS A 29   
AA1 5 6 N ILE A 35   ? N ILE A 34   O SER A 812  ? O SER A 811  
AA2 1 2 N LYS A 174  ? N LYS A 173  O LYS A 177  ? O LYS A 176  
AA3 1 2 N GLU A 597  ? N GLU A 596  O VAL A 618  ? O VAL A 617  
AA4 1 2 O SER A 941  ? O SER A 940  N VAL A 846  ? N VAL A 845  
AA4 2 3 O TYR A 845  ? O TYR A 844  N ARG A 832  ? N ARG A 831  
AA4 3 4 N TYR A 829  ? N TYR A 828  O VAL A 959  ? O VAL A 958  
AA4 4 5 O LEU A 960  ? O LEU A 959  N ILE A 947  ? N ILE A 946  
AA5 1 2 N GLN A 898  ? N GLN A 897  O VAL A 906  ? O VAL A 905  
AA6 1 2 O LEU A 984  ? O LEU A 983  N ARG A 967  ? N ARG A 966  
AA6 2 3 N VAL A 970  ? N VAL A 969  O PHE A 1022 ? O PHE A 1021 
AA7 1 2 N GLN A 990  ? N GLN A 989  O LYS A 999  ? O LYS A 998  
AA8 1 2 O LYS A 1088 ? O LYS A 1087 N VAL A 1057 ? N VAL A 1056 
AA8 2 3 O LYS A 1060 ? O LYS A 1059 N ARG A 1044 ? N ARG A 1043 
AA8 3 4 O PHE A 1043 ? O PHE A 1042 N LEU A 1030 ? N LEU A 1029 
AA8 4 5 N LYS A 1033 ? N LYS A 1032 O SER A 1096 ? O SER A 1095 
AA8 5 6 N LYS A 1099 ? N LYS A 1098 O ILE A 1111 ? O ILE A 1110 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A BA 1201 ? 3 'binding site for residue BA A 1201' 
AC2 Software A BA 1202 ? 1 'binding site for residue BA A 1202' 
AC3 Software A BA 1203 ? 1 'binding site for residue BA A 1203' 
AC4 Software A BA 1204 ? 4 'binding site for residue BA A 1204' 
AC5 Software A BA 1205 ? 2 'binding site for residue BA A 1205' 
AC6 Software A BA 1206 ? 3 'binding site for residue BA A 1206' 
AC7 Software A MG 1207 ? 6 'binding site for residue MG A 1207' 
AC8 Software A MG 1208 ? 4 'binding site for residue MG A 1208' 
AC9 Software B BA 101  ? 3 'binding site for residue BA B 101'  
AD1 Software B BA 102  ? 3 'binding site for residue BA B 102'  
AD2 Software B BA 103  ? 1 'binding site for residue BA B 103'  
AD3 Software B BA 104  ? 1 'binding site for residue BA B 104'  
AD4 Software B BA 105  ? 1 'binding site for residue BA B 105'  
AD5 Software B BA 106  ? 1 'binding site for residue BA B 106'  
AD6 Software C BA 101  ? 1 'binding site for residue BA C 101'  
AD7 Software D BA 101  ? 2 'binding site for residue BA D 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 GLY A 422  ? GLY A 421  . ? 1_555 ? 
2  AC1 3 DT  C 17   ? DT  C 17   . ? 1_555 ? 
3  AC1 3 HOH W .    ? HOH C 204  . ? 1_555 ? 
4  AC2 1 LYS A 849  ? LYS A 848  . ? 1_555 ? 
5  AC3 1 THR A 515  ? THR A 514  . ? 1_555 ? 
6  AC4 4 ASP A 825  ? ASP A 824  . ? 1_555 ? 
7  AC4 4 SER A 962  ? SER A 961  . ? 1_555 ? 
8  AC4 4 HOH U .    ? HOH A 1316 . ? 1_555 ? 
9  AC4 4 HOH X .    ? HOH D 201  . ? 1_555 ? 
10 AC5 2 ASP A 169  ? ASP A 168  . ? 1_555 ? 
11 AC5 2 HOH U .    ? HOH A 1301 . ? 1_555 ? 
12 AC6 3 LYS A 358  ? LYS A 357  . ? 1_555 ? 
13 AC6 3 LEU A 360  ? LEU A 359  . ? 1_555 ? 
14 AC6 3 ASP A 364  ? ASP A 363  . ? 1_555 ? 
15 AC7 6 ASP A 599  ? ASP A 598  . ? 1_555 ? 
16 AC7 6 ASN A 623  ? ASN A 622  . ? 1_555 ? 
17 AC7 6 HOH U .    ? HOH A 1309 . ? 1_555 ? 
18 AC7 6 HOH U .    ? HOH A 1312 . ? 1_555 ? 
19 AC7 6 DC  C 11   ? DC  C 11   . ? 1_555 ? 
20 AC7 6 DC  C 12   ? DC  C 12   . ? 1_555 ? 
21 AC8 4 ASP A 399  ? ASP A 398  . ? 1_556 ? 
22 AC8 4 SER A 1083 ? SER A 1082 . ? 1_555 ? 
23 AC8 4 GLY A 1084 ? GLY A 1083 . ? 1_555 ? 
24 AC8 4 HOH U .    ? HOH A 1322 . ? 1_556 ? 
25 AC9 3 U   B 51   ? U   B 50   . ? 1_555 ? 
26 AC9 3 G   B 54   ? G   B 53   . ? 1_555 ? 
27 AC9 3 HOH V .    ? HOH B 213  . ? 1_555 ? 
28 AD1 3 G   B 41   ? G   B 40   . ? 1_555 ? 
29 AD1 3 HOH V .    ? HOH B 208  . ? 1_555 ? 
30 AD1 3 HOH V .    ? HOH B 221  . ? 1_555 ? 
31 AD2 1 U   B 3    ? U   B 2    . ? 1_555 ? 
32 AD3 1 HOH U .    ? HOH A 1320 . ? 1_555 ? 
33 AD4 1 G   B 34   ? G   B 33   . ? 1_555 ? 
34 AD5 1 HOH V .    ? HOH B 222  . ? 1_555 ? 
35 AD6 1 DG  C 1    ? DG  C 1    . ? 1_555 ? 
36 AD7 2 HOH W .    ? HOH C 201  . ? 1_555 ? 
37 AD7 2 HOH X .    ? HOH D 203  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6M0X 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.003104 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000178 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013289 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014308 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
BA 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LEU A 1 5    ? 7.976   -22.269 151.662 1.00 93.16  ? 4    LEU A N     1 
ATOM   2     C  CA    . LEU A 1 5    ? 8.933   -21.433 152.382 1.00 90.31  ? 4    LEU A CA    1 
ATOM   3     C  C     . LEU A 1 5    ? 9.067   -20.058 151.739 1.00 87.87  ? 4    LEU A C     1 
ATOM   4     O  O     . LEU A 1 5    ? 9.060   -19.934 150.518 1.00 87.47  ? 4    LEU A O     1 
ATOM   5     C  CB    . LEU A 1 5    ? 10.297  -22.120 152.452 1.00 89.06  ? 4    LEU A CB    1 
ATOM   6     C  CG    . LEU A 1 5    ? 10.492  -23.047 153.653 1.00 90.50  ? 4    LEU A CG    1 
ATOM   7     C  CD1   . LEU A 1 5    ? 11.741  -23.898 153.497 1.00 89.79  ? 4    LEU A CD1   1 
ATOM   8     C  CD2   . LEU A 1 5    ? 10.556  -22.233 154.930 1.00 89.42  ? 4    LEU A CD2   1 
ATOM   9     N  N     . VAL A 1 6    ? 9.192   -19.024 152.565 1.00 87.71  ? 5    VAL A N     1 
ATOM   10    C  CA    . VAL A 1 6    ? 9.208   -17.642 152.103 1.00 86.54  ? 5    VAL A CA    1 
ATOM   11    C  C     . VAL A 1 6    ? 10.491  -16.967 152.567 1.00 83.33  ? 5    VAL A C     1 
ATOM   12    O  O     . VAL A 1 6    ? 10.898  -17.113 153.725 1.00 83.53  ? 5    VAL A O     1 
ATOM   13    C  CB    . VAL A 1 6    ? 7.967   -16.879 152.607 1.00 86.97  ? 5    VAL A CB    1 
ATOM   14    C  CG1   . VAL A 1 6    ? 8.252   -15.384 152.713 1.00 84.58  ? 5    VAL A CG1   1 
ATOM   15    C  CG2   . VAL A 1 6    ? 6.792   -17.131 151.671 1.00 89.56  ? 5    VAL A CG2   1 
ATOM   16    N  N     . LEU A 1 7    ? 11.116  -16.212 151.665 1.00 79.06  ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A 1 7    ? 12.387  -15.551 151.922 1.00 76.19  ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A 1 7    ? 12.200  -14.042 151.884 1.00 74.66  ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A 1 7    ? 11.701  -13.495 150.896 1.00 74.66  ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A 1 7    ? 13.434  -15.980 150.889 1.00 74.90  ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A 1 7    ? 14.889  -15.562 151.076 1.00 72.17  ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A 1 7    ? 15.543  -16.300 152.236 1.00 72.33  ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A 1 7    ? 15.668  -15.787 149.784 1.00 71.13  ? 6    LEU A CD2   1 
ATOM   24    N  N     . GLY A 1 8    ? 12.620  -13.370 152.948 1.00 79.44  ? 7    GLY A N     1 
ATOM   25    C  CA    . GLY A 1 8    ? 12.582  -11.923 153.017 1.00 77.72  ? 7    GLY A CA    1 
ATOM   26    C  C     . GLY A 1 8    ? 13.985  -11.363 152.896 1.00 75.76  ? 7    GLY A C     1 
ATOM   27    O  O     . GLY A 1 8    ? 14.956  -12.009 153.292 1.00 76.68  ? 7    GLY A O     1 
ATOM   28    N  N     . LEU A 1 9    ? 14.090  -10.150 152.351 1.00 68.87  ? 8    LEU A N     1 
ATOM   29    C  CA    . LEU A 1 9    ? 15.383  -9.510  152.133 1.00 65.43  ? 8    LEU A CA    1 
ATOM   30    C  C     . LEU A 1 9    ? 15.281  -8.020  152.410 1.00 63.77  ? 8    LEU A C     1 
ATOM   31    O  O     . LEU A 1 9    ? 14.424  -7.338  151.841 1.00 64.39  ? 8    LEU A O     1 
ATOM   32    C  CB    . LEU A 1 9    ? 15.881  -9.731  150.704 1.00 64.17  ? 8    LEU A CB    1 
ATOM   33    C  CG    . LEU A 1 9    ? 16.303  -11.140 150.295 1.00 64.91  ? 8    LEU A CG    1 
ATOM   34    C  CD1   . LEU A 1 9    ? 16.534  -11.202 148.778 1.00 64.49  ? 8    LEU A CD1   1 
ATOM   35    C  CD2   . LEU A 1 9    ? 17.556  -11.574 151.063 1.00 63.69  ? 8    LEU A CD2   1 
ATOM   36    N  N     . ASP A 1 10   ? 16.167  -7.516  153.267 1.00 64.66  ? 9    ASP A N     1 
ATOM   37    C  CA    . ASP A 1 10   ? 16.282  -6.089  153.563 1.00 64.48  ? 9    ASP A CA    1 
ATOM   38    C  C     . ASP A 1 10   ? 17.653  -5.646  153.065 1.00 62.09  ? 9    ASP A C     1 
ATOM   39    O  O     . ASP A 1 10   ? 18.636  -5.688  153.804 1.00 61.07  ? 9    ASP A O     1 
ATOM   40    C  CB    . ASP A 1 10   ? 16.092  -5.813  155.052 1.00 67.94  ? 9    ASP A CB    1 
ATOM   41    C  CG    . ASP A 1 10   ? 16.029  -4.332  155.371 1.00 69.83  ? 9    ASP A CG    1 
ATOM   42    O  OD1   . ASP A 1 10   ? 15.946  -3.513  154.438 1.00 70.36  ? 9    ASP A OD1   1 
ATOM   43    O  OD2   . ASP A 1 10   ? 16.035  -3.984  156.566 1.00 73.94  ? 9    ASP A OD2   1 
ATOM   44    N  N     . ILE A 1 11   ? 17.711  -5.219  151.809 1.00 58.02  ? 10   ILE A N     1 
ATOM   45    C  CA    . ILE A 1 11   ? 18.966  -4.899  151.142 1.00 55.81  ? 10   ILE A CA    1 
ATOM   46    C  C     . ILE A 1 11   ? 19.340  -3.458  151.454 1.00 54.36  ? 10   ILE A C     1 
ATOM   47    O  O     . ILE A 1 11   ? 18.518  -2.550  151.295 1.00 54.88  ? 10   ILE A O     1 
ATOM   48    C  CB    . ILE A 1 11   ? 18.845  -5.124  149.627 1.00 55.97  ? 10   ILE A CB    1 
ATOM   49    C  CG1   . ILE A 1 11   ? 18.238  -6.496  149.352 1.00 57.82  ? 10   ILE A CG1   1 
ATOM   50    C  CG2   . ILE A 1 11   ? 20.188  -5.016  148.947 1.00 54.08  ? 10   ILE A CG2   1 
ATOM   51    C  CD1   . ILE A 1 11   ? 17.932  -6.740  147.897 1.00 58.34  ? 10   ILE A CD1   1 
ATOM   52    N  N     . GLY A 1 12   ? 20.584  -3.249  151.896 1.00 52.96  ? 11   GLY A N     1 
ATOM   53    C  CA    . GLY A 1 12   ? 21.075  -1.930  152.240 1.00 51.27  ? 11   GLY A CA    1 
ATOM   54    C  C     . GLY A 1 12   ? 22.488  -1.719  151.719 1.00 49.33  ? 11   GLY A C     1 
ATOM   55    O  O     . GLY A 1 12   ? 23.065  -2.589  151.067 1.00 50.73  ? 11   GLY A O     1 
ATOM   56    N  N     . ILE A 1 13   ? 23.031  -0.537  152.027 1.00 48.07  ? 12   ILE A N     1 
ATOM   57    C  CA    . ILE A 1 13   ? 24.338  -0.178  151.487 1.00 46.32  ? 12   ILE A CA    1 
ATOM   58    C  C     . ILE A 1 13   ? 25.478  -0.900  152.191 1.00 45.51  ? 12   ILE A C     1 
ATOM   59    O  O     . ILE A 1 13   ? 26.556  -1.058  151.609 1.00 44.39  ? 12   ILE A O     1 
ATOM   60    C  CB    . ILE A 1 13   ? 24.569  1.339   151.551 1.00 45.37  ? 12   ILE A CB    1 
ATOM   61    C  CG1   . ILE A 1 13   ? 24.673  1.809   152.996 1.00 45.24  ? 12   ILE A CG1   1 
ATOM   62    C  CG2   . ILE A 1 13   ? 23.462  2.077   150.817 1.00 46.27  ? 12   ILE A CG2   1 
ATOM   63    C  CD1   . ILE A 1 13   ? 25.160  3.219   153.110 1.00 44.21  ? 12   ILE A CD1   1 
ATOM   64    N  N     . GLY A 1 14   ? 25.275  -1.349  153.423 1.00 46.15  ? 13   GLY A N     1 
ATOM   65    C  CA    . GLY A 1 14   ? 26.294  -2.115  154.102 1.00 45.60  ? 13   GLY A CA    1 
ATOM   66    C  C     . GLY A 1 14   ? 25.758  -3.335  154.813 1.00 47.07  ? 13   GLY A C     1 
ATOM   67    O  O     . GLY A 1 14   ? 26.434  -3.916  155.666 1.00 46.92  ? 13   GLY A O     1 
ATOM   68    N  N     . SER A 1 15   ? 24.542  -3.736  154.468 1.00 51.05  ? 14   SER A N     1 
ATOM   69    C  CA    . SER A 1 15   ? 23.915  -4.866  155.131 1.00 53.73  ? 14   SER A CA    1 
ATOM   70    C  C     . SER A 1 15   ? 22.803  -5.406  154.248 1.00 57.94  ? 14   SER A C     1 
ATOM   71    O  O     . SER A 1 15   ? 22.187  -4.667  153.480 1.00 61.07  ? 14   SER A O     1 
ATOM   72    C  CB    . SER A 1 15   ? 23.358  -4.463  156.497 1.00 54.76  ? 14   SER A CB    1 
ATOM   73    O  OG    . SER A 1 15   ? 22.577  -3.286  156.389 1.00 55.00  ? 14   SER A OG    1 
ATOM   74    N  N     . VAL A 1 16   ? 22.568  -6.708  154.365 1.00 53.14  ? 15   VAL A N     1 
ATOM   75    C  CA    . VAL A 1 16   ? 21.382  -7.359  153.825 1.00 55.04  ? 15   VAL A CA    1 
ATOM   76    C  C     . VAL A 1 16   ? 20.826  -8.248  154.924 1.00 56.75  ? 15   VAL A C     1 
ATOM   77    O  O     . VAL A 1 16   ? 21.530  -9.125  155.431 1.00 56.79  ? 15   VAL A O     1 
ATOM   78    C  CB    . VAL A 1 16   ? 21.691  -8.185  152.564 1.00 55.16  ? 15   VAL A CB    1 
ATOM   79    C  CG1   . VAL A 1 16   ? 20.644  -9.265  152.362 1.00 57.44  ? 15   VAL A CG1   1 
ATOM   80    C  CG2   . VAL A 1 16   ? 21.785  -7.285  151.345 1.00 54.09  ? 15   VAL A CG2   1 
ATOM   81    N  N     . GLY A 1 17   ? 19.564  -8.012  155.301 1.00 67.04  ? 16   GLY A N     1 
ATOM   82    C  CA    . GLY A 1 17   ? 18.897  -8.839  156.284 1.00 67.30  ? 16   GLY A CA    1 
ATOM   83    C  C     . GLY A 1 17   ? 18.199  -10.000 155.609 1.00 68.42  ? 16   GLY A C     1 
ATOM   84    O  O     . GLY A 1 17   ? 17.528  -9.824  154.590 1.00 66.95  ? 16   GLY A O     1 
ATOM   85    N  N     . VAL A 1 18   ? 18.358  -11.186 156.183 1.00 63.22  ? 17   VAL A N     1 
ATOM   86    C  CA    . VAL A 1 18   ? 17.811  -12.413 155.623 1.00 65.15  ? 17   VAL A CA    1 
ATOM   87    C  C     . VAL A 1 18   ? 16.906  -13.067 156.654 1.00 67.46  ? 17   VAL A C     1 
ATOM   88    O  O     . VAL A 1 18   ? 17.127  -12.949 157.863 1.00 67.38  ? 17   VAL A O     1 
ATOM   89    C  CB    . VAL A 1 18   ? 18.932  -13.382 155.198 1.00 64.59  ? 17   VAL A CB    1 
ATOM   90    C  CG1   . VAL A 1 18   ? 18.399  -14.429 154.239 1.00 66.33  ? 17   VAL A CG1   1 
ATOM   91    C  CG2   . VAL A 1 18   ? 20.091  -12.620 154.595 1.00 62.04  ? 17   VAL A CG2   1 
ATOM   92    N  N     . GLY A 1 19   ? 15.891  -13.779 156.171 1.00 69.63  ? 18   GLY A N     1 
ATOM   93    C  CA    . GLY A 1 19   ? 14.989  -14.492 157.057 1.00 72.11  ? 18   GLY A CA    1 
ATOM   94    C  C     . GLY A 1 19   ? 13.970  -15.355 156.340 1.00 74.52  ? 18   GLY A C     1 
ATOM   95    O  O     . GLY A 1 19   ? 13.369  -14.918 155.356 1.00 74.65  ? 18   GLY A O     1 
ATOM   96    N  N     . ILE A 1 20   ? 13.757  -16.578 156.821 1.00 76.57  ? 19   ILE A N     1 
ATOM   97    C  CA    . ILE A 1 20   ? 12.898  -17.536 156.139 1.00 79.00  ? 19   ILE A CA    1 
ATOM   98    C  C     . ILE A 1 20   ? 11.808  -18.019 157.083 1.00 81.75  ? 19   ILE A C     1 
ATOM   99    O  O     . ILE A 1 20   ? 11.982  -18.056 158.306 1.00 81.94  ? 19   ILE A O     1 
ATOM   100   C  CB    . ILE A 1 20   ? 13.701  -18.727 155.582 1.00 79.21  ? 19   ILE A CB    1 
ATOM   101   C  CG1   . ILE A 1 20   ? 15.043  -18.242 155.047 1.00 76.32  ? 19   ILE A CG1   1 
ATOM   102   C  CG2   . ILE A 1 20   ? 12.924  -19.420 154.476 1.00 81.13  ? 19   ILE A CG2   1 
ATOM   103   C  CD1   . ILE A 1 20   ? 15.849  -19.313 154.386 1.00 76.48  ? 19   ILE A CD1   1 
ATOM   104   N  N     . LEU A 1 21   ? 10.642  -18.315 156.527 1.00 84.01  ? 20   LEU A N     1 
ATOM   105   C  CA    . LEU A 1 21   ? 9.532   -18.744 157.360 1.00 86.72  ? 20   LEU A CA    1 
ATOM   106   C  C     . LEU A 1 21   ? 8.566   -19.660 156.635 1.00 89.44  ? 20   LEU A C     1 
ATOM   107   O  O     . LEU A 1 21   ? 8.111   -19.369 155.529 1.00 89.35  ? 20   LEU A O     1 
ATOM   108   C  CB    . LEU A 1 21   ? 8.781   -17.528 157.911 1.00 86.38  ? 20   LEU A CB    1 
ATOM   109   C  CG    . LEU A 1 21   ? 7.363   -17.310 157.381 1.00 88.51  ? 20   LEU A CG    1 
ATOM   110   C  CD1   . LEU A 1 21   ? 6.334   -17.610 158.460 1.00 87.37  ? 20   LEU A CD1   1 
ATOM   111   C  CD2   . LEU A 1 21   ? 7.197   -15.893 156.856 1.00 91.93  ? 20   LEU A CD2   1 
ATOM   112   N  N     . ASN A 1 22   ? 8.260   -20.774 157.283 1.00 104.37 ? 21   ASN A N     1 
ATOM   113   C  CA    . ASN A 1 22   ? 7.330   -21.758 156.742 1.00 109.87 ? 21   ASN A CA    1 
ATOM   114   C  C     . ASN A 1 22   ? 5.945   -21.135 156.761 1.00 111.52 ? 21   ASN A C     1 
ATOM   115   O  O     . ASN A 1 22   ? 5.332   -20.980 157.821 1.00 113.11 ? 21   ASN A O     1 
ATOM   116   C  CB    . ASN A 1 22   ? 7.355   -23.072 157.515 1.00 115.75 ? 21   ASN A CB    1 
ATOM   117   C  CG    . ASN A 1 22   ? 6.316   -24.063 157.003 1.00 122.08 ? 21   ASN A CG    1 
ATOM   118   O  OD1   . ASN A 1 22   ? 5.823   -24.897 157.757 1.00 126.52 ? 21   ASN A OD1   1 
ATOM   119   N  ND2   . ASN A 1 22   ? 5.971   -23.964 155.719 1.00 122.20 ? 21   ASN A ND2   1 
ATOM   120   N  N     . LYS A 1 23   ? 5.439   -20.777 155.599 1.00 114.56 ? 22   LYS A N     1 
ATOM   121   C  CA    . LYS A 1 23   ? 4.208   -20.030 155.546 1.00 115.35 ? 22   LYS A CA    1 
ATOM   122   C  C     . LYS A 1 23   ? 3.032   -20.686 156.251 1.00 119.78 ? 22   LYS A C     1 
ATOM   123   O  O     . LYS A 1 23   ? 2.197   -20.006 156.835 1.00 113.46 ? 22   LYS A O     1 
ATOM   124   C  CB    . LYS A 1 23   ? 3.894   -19.610 154.103 1.00 113.62 ? 22   LYS A CB    1 
ATOM   125   C  CG    . LYS A 1 23   ? 3.155   -20.629 153.264 1.00 110.62 ? 22   LYS A CG    1 
ATOM   126   C  CD    . LYS A 1 23   ? 3.554   -20.547 151.805 1.00 111.79 ? 22   LYS A CD    1 
ATOM   127   C  CE    . LYS A 1 23   ? 3.366   -21.894 151.137 1.00 106.90 ? 22   LYS A CE    1 
ATOM   128   N  NZ    . LYS A 1 23   ? 3.456   -21.847 149.654 1.00 108.74 ? 22   LYS A NZ    1 
ATOM   129   N  N     . VAL A 1 24   ? 2.945   -21.998 156.210 1.00 103.69 ? 23   VAL A N     1 
ATOM   130   C  CA    . VAL A 1 24   ? 1.798   -22.613 156.861 1.00 107.26 ? 23   VAL A CA    1 
ATOM   131   C  C     . VAL A 1 24   ? 1.942   -22.534 158.379 1.00 108.10 ? 23   VAL A C     1 
ATOM   132   O  O     . VAL A 1 24   ? 1.067   -22.009 159.078 1.00 109.40 ? 23   VAL A O     1 
ATOM   133   C  CB    . VAL A 1 24   ? 1.620   -24.053 156.345 1.00 109.77 ? 23   VAL A CB    1 
ATOM   134   C  CG1   . VAL A 1 24   ? 1.625   -24.032 154.842 1.00 109.19 ? 23   VAL A CG1   1 
ATOM   135   C  CG2   . VAL A 1 24   ? 2.729   -24.966 156.814 1.00 109.20 ? 23   VAL A CG2   1 
ATOM   136   N  N     . THR A 1 25   ? 3.084   -22.980 158.897 1.00 105.99 ? 24   THR A N     1 
ATOM   137   C  CA    . THR A 1 25   ? 3.289   -23.043 160.334 1.00 106.33 ? 24   THR A CA    1 
ATOM   138   C  C     . THR A 1 25   ? 3.511   -21.662 160.923 1.00 103.99 ? 24   THR A C     1 
ATOM   139   O  O     . THR A 1 25   ? 3.083   -21.389 162.049 1.00 105.02 ? 24   THR A O     1 
ATOM   140   C  CB    . THR A 1 25   ? 4.484   -23.948 160.632 1.00 105.55 ? 24   THR A CB    1 
ATOM   141   O  OG1   . THR A 1 25   ? 4.300   -25.206 159.977 1.00 107.74 ? 24   THR A OG1   1 
ATOM   142   C  CG2   . THR A 1 25   ? 4.632   -24.176 162.118 1.00 106.38 ? 24   THR A CG2   1 
ATOM   143   N  N     . GLY A 1 26   ? 4.153   -20.778 160.173 1.00 100.98 ? 25   GLY A N     1 
ATOM   144   C  CA    . GLY A 1 26   ? 4.646   -19.555 160.753 1.00 101.42 ? 25   GLY A CA    1 
ATOM   145   C  C     . GLY A 1 26   ? 5.917   -19.724 161.548 1.00 100.70 ? 25   GLY A C     1 
ATOM   146   O  O     . GLY A 1 26   ? 6.320   -18.795 162.253 1.00 94.87  ? 25   GLY A O     1 
ATOM   147   N  N     . GLU A 1 27   ? 6.561   -20.881 161.464 1.00 104.00 ? 26   GLU A N     1 
ATOM   148   C  CA    . GLU A 1 27   ? 7.791   -21.104 162.200 1.00 101.84 ? 26   GLU A CA    1 
ATOM   149   C  C     . GLU A 1 27   ? 8.964   -20.469 161.468 1.00 99.29  ? 26   GLU A C     1 
ATOM   150   O  O     . GLU A 1 27   ? 9.009   -20.447 160.235 1.00 96.63  ? 26   GLU A O     1 
ATOM   151   C  CB    . GLU A 1 27   ? 8.031   -22.598 162.393 1.00 104.77 ? 26   GLU A CB    1 
ATOM   152   C  CG    . GLU A 1 27   ? 9.205   -22.914 163.290 1.00 105.10 ? 26   GLU A CG    1 
ATOM   153   C  CD    . GLU A 1 27   ? 9.923   -24.165 162.858 1.00 106.24 ? 26   GLU A CD    1 
ATOM   154   O  OE1   . GLU A 1 27   ? 9.645   -24.643 161.739 1.00 106.93 ? 26   GLU A OE1   1 
ATOM   155   O  OE2   . GLU A 1 27   ? 10.766  -24.667 163.629 1.00 106.16 ? 26   GLU A OE2   1 
ATOM   156   N  N     . ILE A 1 28   ? 9.904   -19.933 162.239 1.00 93.73  ? 27   ILE A N     1 
ATOM   157   C  CA    . ILE A 1 28   ? 11.100  -19.300 161.702 1.00 86.61  ? 27   ILE A CA    1 
ATOM   158   C  C     . ILE A 1 28   ? 12.159  -20.366 161.485 1.00 86.28  ? 27   ILE A C     1 
ATOM   159   O  O     . ILE A 1 28   ? 12.502  -21.113 162.409 1.00 87.28  ? 27   ILE A O     1 
ATOM   160   C  CB    . ILE A 1 28   ? 11.611  -18.208 162.652 1.00 84.65  ? 27   ILE A CB    1 
ATOM   161   C  CG1   . ILE A 1 28   ? 10.518  -17.174 162.902 1.00 85.26  ? 27   ILE A CG1   1 
ATOM   162   C  CG2   . ILE A 1 28   ? 12.864  -17.560 162.094 1.00 81.39  ? 27   ILE A CG2   1 
ATOM   163   C  CD1   . ILE A 1 28   ? 10.933  -16.087 163.855 1.00 83.61  ? 27   ILE A CD1   1 
ATOM   164   N  N     . ILE A 1 29   ? 12.696  -20.429 160.273 1.00 84.96  ? 28   ILE A N     1 
ATOM   165   C  CA    . ILE A 1 29   ? 13.649  -21.480 159.944 1.00 84.89  ? 28   ILE A CA    1 
ATOM   166   C  C     . ILE A 1 29   ? 15.070  -20.926 159.978 1.00 81.83  ? 28   ILE A C     1 
ATOM   167   O  O     . ILE A 1 29   ? 16.013  -21.635 160.352 1.00 81.66  ? 28   ILE A O     1 
ATOM   168   C  CB    . ILE A 1 29   ? 13.318  -22.116 158.580 1.00 85.89  ? 28   ILE A CB    1 
ATOM   169   C  CG1   . ILE A 1 29   ? 12.300  -23.252 158.741 1.00 89.43  ? 28   ILE A CG1   1 
ATOM   170   C  CG2   . ILE A 1 29   ? 14.558  -22.655 157.917 1.00 84.58  ? 28   ILE A CG2   1 
ATOM   171   C  CD1   . ILE A 1 29   ? 10.931  -22.810 159.196 1.00 91.18  ? 28   ILE A CD1   1 
ATOM   172   N  N     . HIS A 1 30   ? 15.233  -19.650 159.625 1.00 79.53  ? 29   HIS A N     1 
ATOM   173   C  CA    . HIS A 1 30   ? 16.559  -19.052 159.594 1.00 76.67  ? 29   HIS A CA    1 
ATOM   174   C  C     . HIS A 1 30   ? 16.438  -17.538 159.714 1.00 74.77  ? 29   HIS A C     1 
ATOM   175   O  O     . HIS A 1 30   ? 15.594  -16.927 159.061 1.00 74.96  ? 29   HIS A O     1 
ATOM   176   C  CB    . HIS A 1 30   ? 17.301  -19.451 158.312 1.00 76.91  ? 29   HIS A CB    1 
ATOM   177   C  CG    . HIS A 1 30   ? 18.793  -19.266 158.374 1.00 72.95  ? 29   HIS A CG    1 
ATOM   178   N  ND1   . HIS A 1 30   ? 19.667  -20.332 158.488 1.00 72.50  ? 29   HIS A ND1   1 
ATOM   179   C  CD2   . HIS A 1 30   ? 19.558  -18.148 158.302 1.00 70.63  ? 29   HIS A CD2   1 
ATOM   180   C  CE1   . HIS A 1 30   ? 20.903  -19.870 158.509 1.00 70.02  ? 29   HIS A CE1   1 
ATOM   181   N  NE2   . HIS A 1 30   ? 20.864  -18.551 158.401 1.00 68.85  ? 29   HIS A NE2   1 
ATOM   182   N  N     . LYS A 1 31   ? 17.262  -16.953 160.589 1.00 73.12  ? 30   LYS A N     1 
ATOM   183   C  CA    . LYS A 1 31   ? 17.446  -15.514 160.698 1.00 71.03  ? 30   LYS A CA    1 
ATOM   184   C  C     . LYS A 1 31   ? 18.925  -15.208 160.514 1.00 68.48  ? 30   LYS A C     1 
ATOM   185   O  O     . LYS A 1 31   ? 19.786  -16.041 160.807 1.00 68.48  ? 30   LYS A O     1 
ATOM   186   C  CB    . LYS A 1 31   ? 16.953  -14.981 162.045 1.00 71.65  ? 30   LYS A CB    1 
ATOM   187   N  N     . ASN A 1 32   ? 19.246  -14.098 159.889 1.00 67.88  ? 31   ASN A N     1 
ATOM   188   C  CA    . ASN A 1 32   ? 20.632  -13.866 159.593 1.00 64.66  ? 31   ASN A CA    1 
ATOM   189   C  C     . ASN A 1 32   ? 20.890  -12.421 159.273 1.00 62.41  ? 31   ASN A C     1 
ATOM   190   O  O     . ASN A 1 32   ? 20.006  -11.721 158.859 1.00 65.54  ? 31   ASN A O     1 
ATOM   191   C  CB    . ASN A 1 32   ? 20.905  -14.753 158.384 1.00 65.25  ? 31   ASN A CB    1 
ATOM   192   C  CG    . ASN A 1 32   ? 22.079  -14.340 157.595 1.00 63.34  ? 31   ASN A CG    1 
ATOM   193   O  OD1   . ASN A 1 32   ? 22.918  -13.633 158.081 1.00 61.70  ? 31   ASN A OD1   1 
ATOM   194   N  ND2   . ASN A 1 32   ? 22.133  -14.757 156.347 1.00 64.89  ? 31   ASN A ND2   1 
ATOM   195   N  N     . SER A 1 33   ? 22.106  -11.964 159.471 1.00 61.05  ? 32   SER A N     1 
ATOM   196   C  CA    . SER A 1 33   ? 22.455  -10.600 159.149 1.00 58.09  ? 32   SER A CA    1 
ATOM   197   C  C     . SER A 1 33   ? 23.748  -10.639 158.407 1.00 56.28  ? 32   SER A C     1 
ATOM   198   O  O     . SER A 1 33   ? 24.677  -11.171 158.907 1.00 55.66  ? 32   SER A O     1 
ATOM   199   C  CB    . SER A 1 33   ? 22.625  -9.812  160.408 1.00 57.62  ? 32   SER A CB    1 
ATOM   200   O  OG    . SER A 1 33   ? 21.577  -8.897  160.553 1.00 58.70  ? 32   SER A OG    1 
ATOM   201   N  N     . ARG A 1 34   ? 23.815  -10.060 157.222 1.00 55.59  ? 33   ARG A N     1 
ATOM   202   C  CA    . ARG A 1 34   ? 25.036  -10.047 156.431 1.00 53.95  ? 33   ARG A CA    1 
ATOM   203   C  C     . ARG A 1 34   ? 25.537  -8.627  156.460 1.00 52.00  ? 33   ARG A C     1 
ATOM   204   O  O     . ARG A 1 34   ? 24.800  -7.724  156.172 1.00 52.00  ? 33   ARG A O     1 
ATOM   205   C  CB    . ARG A 1 34   ? 24.732  -10.505 155.020 1.00 54.48  ? 33   ARG A CB    1 
ATOM   206   C  CG    . ARG A 1 34   ? 25.878  -10.491 154.048 1.00 52.82  ? 33   ARG A CG    1 
ATOM   207   C  CD    . ARG A 1 34   ? 27.040  -11.310 154.523 1.00 52.72  ? 33   ARG A CD    1 
ATOM   208   N  NE    . ARG A 1 34   ? 28.070  -11.410 153.519 1.00 51.63  ? 33   ARG A NE    1 
ATOM   209   C  CZ    . ARG A 1 34   ? 29.111  -12.203 153.629 1.00 51.32  ? 33   ARG A CZ    1 
ATOM   210   N  NH1   . ARG A 1 34   ? 29.235  -12.952 154.688 1.00 52.01  ? 33   ARG A NH1   1 
ATOM   211   N  NH2   . ARG A 1 34   ? 30.014  -12.268 152.690 1.00 50.43  ? 33   ARG A NH2   1 
ATOM   212   N  N     . ILE A 1 35   ? 26.789  -8.438  156.850 1.00 50.48  ? 34   ILE A N     1 
ATOM   213   C  CA    . ILE A 1 35   ? 27.383  -7.123  157.013 1.00 48.85  ? 34   ILE A CA    1 
ATOM   214   C  C     . ILE A 1 35   ? 28.617  -6.869  156.205 1.00 47.16  ? 34   ILE A C     1 
ATOM   215   O  O     . ILE A 1 35   ? 29.503  -7.690  156.169 1.00 47.03  ? 34   ILE A O     1 
ATOM   216   C  CB    . ILE A 1 35   ? 27.797  -6.922  158.470 1.00 48.95  ? 34   ILE A CB    1 
ATOM   217   C  CG1   . ILE A 1 35   ? 26.658  -7.269  159.408 1.00 50.87  ? 34   ILE A CG1   1 
ATOM   218   C  CG2   . ILE A 1 35   ? 28.275  -5.511  158.712 1.00 47.45  ? 34   ILE A CG2   1 
ATOM   219   C  CD1   . ILE A 1 35   ? 25.629  -6.188  159.534 1.00 51.22  ? 34   ILE A CD1   1 
ATOM   220   N  N     . PHE A 1 36   ? 28.660  -5.704  155.567 1.00 48.71  ? 35   PHE A N     1 
ATOM   221   C  CA    . PHE A 1 36   ? 29.787  -5.277  154.759 1.00 49.23  ? 35   PHE A CA    1 
ATOM   222   C  C     . PHE A 1 36   ? 29.809  -3.755  154.757 1.00 52.81  ? 35   PHE A C     1 
ATOM   223   O  O     . PHE A 1 36   ? 29.106  -3.131  153.960 1.00 53.61  ? 35   PHE A O     1 
ATOM   224   C  CB    . PHE A 1 36   ? 29.692  -5.847  153.338 1.00 47.76  ? 35   PHE A CB    1 
ATOM   225   C  CG    . PHE A 1 36   ? 28.332  -5.702  152.699 1.00 47.97  ? 35   PHE A CG    1 
ATOM   226   C  CD1   . PHE A 1 36   ? 27.294  -6.562  153.027 1.00 48.07  ? 35   PHE A CD1   1 
ATOM   227   C  CD2   . PHE A 1 36   ? 28.099  -4.726  151.744 1.00 47.76  ? 35   PHE A CD2   1 
ATOM   228   C  CE1   . PHE A 1 36   ? 26.051  -6.430  152.443 1.00 48.68  ? 35   PHE A CE1   1 
ATOM   229   C  CE2   . PHE A 1 36   ? 26.857  -4.591  151.157 1.00 48.57  ? 35   PHE A CE2   1 
ATOM   230   C  CZ    . PHE A 1 36   ? 25.834  -5.447  151.503 1.00 48.91  ? 35   PHE A CZ    1 
ATOM   231   N  N     . PRO A 1 37   ? 30.585  -3.125  155.643 1.00 61.20  ? 36   PRO A N     1 
ATOM   232   C  CA    . PRO A 1 37   ? 30.516  -1.665  155.791 1.00 62.73  ? 36   PRO A CA    1 
ATOM   233   C  C     . PRO A 1 37   ? 30.652  -0.922  154.472 1.00 65.24  ? 36   PRO A C     1 
ATOM   234   O  O     . PRO A 1 37   ? 31.620  -1.118  153.733 1.00 66.82  ? 36   PRO A O     1 
ATOM   235   C  CB    . PRO A 1 37   ? 31.688  -1.364  156.727 1.00 63.45  ? 36   PRO A CB    1 
ATOM   236   C  CG    . PRO A 1 37   ? 31.846  -2.618  157.517 1.00 63.17  ? 36   PRO A CG    1 
ATOM   237   C  CD    . PRO A 1 37   ? 31.577  -3.722  156.551 1.00 62.41  ? 36   PRO A CD    1 
ATOM   238   N  N     . ALA A 1 38   ? 29.664  -0.080  154.164 1.00 63.82  ? 37   ALA A N     1 
ATOM   239   C  CA    . ALA A 1 38   ? 29.660  0.652   152.903 1.00 64.16  ? 37   ALA A CA    1 
ATOM   240   C  C     . ALA A 1 38   ? 30.771  1.687   152.825 1.00 63.86  ? 37   ALA A C     1 
ATOM   241   O  O     . ALA A 1 38   ? 31.069  2.170   151.727 1.00 66.15  ? 37   ALA A O     1 
ATOM   242   C  CB    . ALA A 1 38   ? 28.311  1.338   152.696 1.00 67.18  ? 37   ALA A CB    1 
ATOM   243   N  N     . ALA A 1 39   ? 31.383  2.038   153.959 1.00 56.14  ? 38   ALA A N     1 
ATOM   244   C  CA    . ALA A 1 39   ? 32.453  3.028   153.963 1.00 53.29  ? 38   ALA A CA    1 
ATOM   245   C  C     . ALA A 1 39   ? 33.621  2.611   153.087 1.00 48.95  ? 38   ALA A C     1 
ATOM   246   O  O     . ALA A 1 39   ? 34.370  3.474   152.618 1.00 45.56  ? 38   ALA A O     1 
ATOM   247   C  CB    . ALA A 1 39   ? 32.941  3.270   155.395 1.00 52.34  ? 38   ALA A CB    1 
ATOM   248   N  N     . GLN A 1 40   ? 33.788  1.310   152.852 1.00 55.73  ? 39   GLN A N     1 
ATOM   249   C  CA    . GLN A 1 40   ? 34.923  0.835   152.072 1.00 56.93  ? 39   GLN A CA    1 
ATOM   250   C  C     . GLN A 1 40   ? 34.817  1.286   150.622 1.00 56.45  ? 39   GLN A C     1 
ATOM   251   O  O     . GLN A 1 40   ? 35.762  1.861   150.070 1.00 58.69  ? 39   GLN A O     1 
ATOM   252   C  CB    . GLN A 1 40   ? 35.012  -0.686  152.169 1.00 58.88  ? 39   GLN A CB    1 
ATOM   253   C  CG    . GLN A 1 40   ? 36.411  -1.213  152.391 1.00 58.52  ? 39   GLN A CG    1 
ATOM   254   C  CD    . GLN A 1 40   ? 36.417  -2.661  152.824 1.00 60.05  ? 39   GLN A CD    1 
ATOM   255   O  OE1   . GLN A 1 40   ? 36.962  -3.006  153.871 1.00 60.46  ? 39   GLN A OE1   1 
ATOM   256   N  NE2   . GLN A 1 40   ? 35.806  -3.519  152.022 1.00 61.34  ? 39   GLN A NE2   1 
ATOM   257   N  N     . ALA A 1 41   ? 33.663  1.048   149.991 1.00 61.09  ? 40   ALA A N     1 
ATOM   258   C  CA    . ALA A 1 41   ? 33.474  1.434   148.597 1.00 61.02  ? 40   ALA A CA    1 
ATOM   259   C  C     . ALA A 1 41   ? 33.135  2.911   148.453 1.00 60.37  ? 40   ALA A C     1 
ATOM   260   O  O     . ALA A 1 41   ? 33.402  3.502   147.400 1.00 60.50  ? 40   ALA A O     1 
ATOM   261   C  CB    . ALA A 1 41   ? 32.381  0.578   147.950 1.00 64.30  ? 40   ALA A CB    1 
ATOM   262   N  N     . GLU A 1 42   ? 32.555  3.527   149.487 1.00 53.90  ? 41   GLU A N     1 
ATOM   263   C  CA    . GLU A 1 42   ? 32.361  4.968   149.441 1.00 54.12  ? 41   GLU A CA    1 
ATOM   264   C  C     . GLU A 1 42   ? 33.689  5.710   149.377 1.00 50.41  ? 41   GLU A C     1 
ATOM   265   O  O     . GLU A 1 42   ? 33.726  6.861   148.930 1.00 48.64  ? 41   GLU A O     1 
ATOM   266   C  CB    . GLU A 1 42   ? 31.542  5.433   150.645 1.00 56.58  ? 41   GLU A CB    1 
ATOM   267   C  CG    . GLU A 1 42   ? 30.086  4.980   150.637 1.00 58.49  ? 41   GLU A CG    1 
ATOM   268   C  CD    . GLU A 1 42   ? 29.266  5.644   151.731 1.00 58.88  ? 41   GLU A CD    1 
ATOM   269   O  OE1   . GLU A 1 42   ? 28.315  6.379   151.398 1.00 58.78  ? 41   GLU A OE1   1 
ATOM   270   O  OE2   . GLU A 1 42   ? 29.580  5.447   152.927 1.00 59.36  ? 41   GLU A OE2   1 
ATOM   271   N  N     . ASN A 1 43   ? 34.782  5.066   149.792 1.00 50.34  ? 42   ASN A N     1 
ATOM   272   C  CA    . ASN A 1 43   ? 36.107  5.646   149.665 1.00 48.55  ? 42   ASN A CA    1 
ATOM   273   C  C     . ASN A 1 43   ? 36.561  5.789   148.223 1.00 46.81  ? 42   ASN A C     1 
ATOM   274   O  O     . ASN A 1 43   ? 37.628  6.363   147.997 1.00 50.74  ? 42   ASN A O     1 
ATOM   275   C  CB    . ASN A 1 43   ? 37.134  4.805   150.419 1.00 48.86  ? 42   ASN A CB    1 
ATOM   276   C  CG    . ASN A 1 43   ? 37.170  5.117   151.894 1.00 47.71  ? 42   ASN A CG    1 
ATOM   277   O  OD1   . ASN A 1 43   ? 36.775  6.201   152.322 1.00 48.60  ? 42   ASN A OD1   1 
ATOM   278   N  ND2   . ASN A 1 43   ? 37.650  4.169   152.682 1.00 46.95  ? 42   ASN A ND2   1 
ATOM   279   N  N     . ASN A 1 44   ? 35.800  5.281   147.247 1.00 47.42  ? 43   ASN A N     1 
ATOM   280   C  CA    . ASN A 1 44   ? 36.209  5.443   145.857 1.00 40.03  ? 43   ASN A CA    1 
ATOM   281   C  C     . ASN A 1 44   ? 36.355  6.909   145.495 1.00 34.80  ? 43   ASN A C     1 
ATOM   282   O  O     . ASN A 1 44   ? 37.191  7.260   144.661 1.00 33.29  ? 43   ASN A O     1 
ATOM   283   C  CB    . ASN A 1 44   ? 35.217  4.764   144.923 1.00 41.36  ? 43   ASN A CB    1 
ATOM   284   C  CG    . ASN A 1 44   ? 35.662  4.812   143.487 1.00 39.11  ? 43   ASN A CG    1 
ATOM   285   O  OD1   . ASN A 1 44   ? 36.596  4.120   143.105 1.00 40.41  ? 43   ASN A OD1   1 
ATOM   286   N  ND2   . ASN A 1 44   ? 35.010  5.639   142.684 1.00 37.93  ? 43   ASN A ND2   1 
ATOM   287   N  N     . LEU A 1 45   ? 35.565  7.775   146.129 1.00 34.56  ? 44   LEU A N     1 
ATOM   288   C  CA    . LEU A 1 45   ? 35.755  9.211   145.980 1.00 33.93  ? 44   LEU A CA    1 
ATOM   289   C  C     . LEU A 1 45   ? 37.178  9.622   146.327 1.00 33.97  ? 44   LEU A C     1 
ATOM   290   O  O     . LEU A 1 45   ? 37.771  10.462  145.643 1.00 36.55  ? 44   LEU A O     1 
ATOM   291   C  CB    . LEU A 1 45   ? 34.762  9.962   146.859 1.00 34.47  ? 44   LEU A CB    1 
ATOM   292   C  CG    . LEU A 1 45   ? 35.039  11.458  146.962 1.00 34.17  ? 44   LEU A CG    1 
ATOM   293   C  CD1   . LEU A 1 45   ? 34.883  12.135  145.606 1.00 34.47  ? 44   LEU A CD1   1 
ATOM   294   C  CD2   . LEU A 1 45   ? 34.116  12.074  147.979 1.00 34.80  ? 44   LEU A CD2   1 
ATOM   295   N  N     . VAL A 1 46   ? 37.741  9.043   147.390 1.00 32.95  ? 45   VAL A N     1 
ATOM   296   C  CA    . VAL A 1 46   ? 39.117  9.339   147.772 1.00 31.71  ? 45   VAL A CA    1 
ATOM   297   C  C     . VAL A 1 46   ? 40.082  8.806   146.727 1.00 31.40  ? 45   VAL A C     1 
ATOM   298   O  O     . VAL A 1 46   ? 41.067  9.462   146.375 1.00 31.88  ? 45   VAL A O     1 
ATOM   299   C  CB    . VAL A 1 46   ? 39.416  8.747   149.164 1.00 31.52  ? 45   VAL A CB    1 
ATOM   300   C  CG1   . VAL A 1 46   ? 40.897  8.915   149.523 1.00 30.82  ? 45   VAL A CG1   1 
ATOM   301   C  CG2   . VAL A 1 46   ? 38.520  9.370   150.217 1.00 31.90  ? 45   VAL A CG2   1 
ATOM   302   N  N     . ARG A 1 47   ? 39.815  7.604   146.224 1.00 31.71  ? 46   ARG A N     1 
ATOM   303   C  CA    . ARG A 1 47   ? 40.679  6.999   145.216 1.00 31.58  ? 46   ARG A CA    1 
ATOM   304   C  C     . ARG A 1 47   ? 40.721  7.829   143.941 1.00 31.67  ? 46   ARG A C     1 
ATOM   305   O  O     . ARG A 1 47   ? 41.797  8.079   143.387 1.00 31.35  ? 46   ARG A O     1 
ATOM   306   C  CB    . ARG A 1 47   ? 40.205  5.587   144.916 1.00 32.11  ? 46   ARG A CB    1 
ATOM   307   C  CG    . ARG A 1 47   ? 41.020  4.899   143.882 1.00 32.15  ? 46   ARG A CG    1 
ATOM   308   C  CD    . ARG A 1 47   ? 40.581  3.483   143.770 1.00 32.79  ? 46   ARG A CD    1 
ATOM   309   N  NE    . ARG A 1 47   ? 41.427  2.752   142.844 1.00 32.94  ? 46   ARG A NE    1 
ATOM   310   C  CZ    . ARG A 1 47   ? 41.091  2.439   141.596 1.00 33.49  ? 46   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A 1 47   ? 41.957  1.784   140.841 1.00 33.69  ? 46   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A 1 47   ? 39.904  2.775   141.101 1.00 33.94  ? 46   ARG A NH2   1 
ATOM   313   N  N     . ARG A 1 48   ? 39.553  8.252   143.446 1.00 32.21  ? 47   ARG A N     1 
ATOM   314   C  CA    . ARG A 1 48   ? 39.537  9.066   142.240 1.00 32.42  ? 47   ARG A CA    1 
ATOM   315   C  C     . ARG A 1 48   ? 40.200  10.407  142.482 1.00 33.96  ? 47   ARG A C     1 
ATOM   316   O  O     . ARG A 1 48   ? 40.974  10.882  141.645 1.00 38.06  ? 47   ARG A O     1 
ATOM   317   C  CB    . ARG A 1 48   ? 38.109  9.275   141.739 1.00 34.28  ? 47   ARG A CB    1 
ATOM   318   C  CG    . ARG A 1 48   ? 38.057  9.906   140.344 1.00 35.22  ? 47   ARG A CG    1 
ATOM   319   C  CD    . ARG A 1 48   ? 36.723  10.555  140.010 1.00 34.95  ? 47   ARG A CD    1 
ATOM   320   N  NE    . ARG A 1 48   ? 35.579  9.723   140.355 1.00 35.60  ? 47   ARG A NE    1 
ATOM   321   C  CZ    . ARG A 1 48   ? 34.607  10.116  141.171 1.00 38.19  ? 47   ARG A CZ    1 
ATOM   322   N  NH1   . ARG A 1 48   ? 34.627  11.340  141.695 1.00 37.19  ? 47   ARG A NH1   1 
ATOM   323   N  NH2   . ARG A 1 48   ? 33.594  9.299   141.458 1.00 41.84  ? 47   ARG A NH2   1 
ATOM   324   N  N     . THR A 1 49   ? 39.894  11.043  143.614 1.00 31.94  ? 48   THR A N     1 
ATOM   325   C  CA    . THR A 1 49   ? 40.490  12.337  143.914 1.00 31.72  ? 48   THR A CA    1 
ATOM   326   C  C     . THR A 1 49   ? 42.005  12.257  143.915 1.00 31.13  ? 48   THR A C     1 
ATOM   327   O  O     . THR A 1 49   ? 42.678  13.130  143.362 1.00 31.12  ? 48   THR A O     1 
ATOM   328   C  CB    . THR A 1 49   ? 39.986  12.848  145.256 1.00 35.41  ? 48   THR A CB    1 
ATOM   329   O  OG1   . THR A 1 49   ? 38.558  12.818  145.259 1.00 35.36  ? 48   THR A OG1   1 
ATOM   330   C  CG2   . THR A 1 49   ? 40.446  14.274  145.485 1.00 31.76  ? 48   THR A CG2   1 
ATOM   331   N  N     . ASN A 1 50   ? 42.558  11.198  144.504 1.00 30.75  ? 49   ASN A N     1 
ATOM   332   C  CA    . ASN A 1 50   ? 44.002  11.066  144.613 1.00 30.30  ? 49   ASN A CA    1 
ATOM   333   C  C     . ASN A 1 50   ? 44.636  10.666  143.294 1.00 30.42  ? 49   ASN A C     1 
ATOM   334   O  O     . ASN A 1 50   ? 45.728  11.137  142.974 1.00 31.18  ? 49   ASN A O     1 
ATOM   335   C  CB    . ASN A 1 50   ? 44.346  10.066  145.717 1.00 30.00  ? 49   ASN A CB    1 
ATOM   336   C  CG    . ASN A 1 50   ? 44.231  10.679  147.102 1.00 29.82  ? 49   ASN A CG    1 
ATOM   337   O  OD1   . ASN A 1 50   ? 43.439  10.232  147.915 1.00 34.83  ? 49   ASN A OD1   1 
ATOM   338   N  ND2   . ASN A 1 50   ? 45.042  11.690  147.380 1.00 29.61  ? 49   ASN A ND2   1 
ATOM   339   N  N     . ARG A 1 51   ? 43.968  9.812   142.508 1.00 30.78  ? 50   ARG A N     1 
ATOM   340   C  CA    . ARG A 1 51   ? 44.455  9.499   141.165 1.00 31.05  ? 50   ARG A CA    1 
ATOM   341   C  C     . ARG A 1 51   ? 44.550  10.748  140.305 1.00 31.27  ? 50   ARG A C     1 
ATOM   342   O  O     . ARG A 1 51   ? 45.544  10.954  139.602 1.00 31.32  ? 50   ARG A O     1 
ATOM   343   C  CB    . ARG A 1 51   ? 43.544  8.474   140.488 1.00 31.73  ? 50   ARG A CB    1 
ATOM   344   C  CG    . ARG A 1 51   ? 43.971  8.105   139.065 1.00 31.96  ? 50   ARG A CG    1 
ATOM   345   C  CD    . ARG A 1 51   ? 43.107  7.024   138.448 1.00 32.54  ? 50   ARG A CD    1 
ATOM   346   N  NE    . ARG A 1 51   ? 41.704  7.383   138.310 1.00 32.94  ? 50   ARG A NE    1 
ATOM   347   C  CZ    . ARG A 1 51   ? 40.723  6.932   139.083 1.00 33.08  ? 50   ARG A CZ    1 
ATOM   348   N  NH1   . ARG A 1 51   ? 40.975  6.092   140.090 1.00 32.83  ? 50   ARG A NH1   1 
ATOM   349   N  NH2   . ARG A 1 51   ? 39.475  7.339   138.855 1.00 33.58  ? 50   ARG A NH2   1 
ATOM   350   N  N     . GLN A 1 52   ? 43.517  11.590  140.348 1.00 32.55  ? 51   GLN A N     1 
ATOM   351   C  CA    . GLN A 1 52   ? 43.509  12.812  139.556 1.00 36.62  ? 51   GLN A CA    1 
ATOM   352   C  C     . GLN A 1 52   ? 44.545  13.809  140.049 1.00 37.12  ? 51   GLN A C     1 
ATOM   353   O  O     . GLN A 1 52   ? 45.214  14.463  139.240 1.00 41.52  ? 51   GLN A O     1 
ATOM   354   C  CB    . GLN A 1 52   ? 42.120  13.428  139.582 1.00 41.54  ? 51   GLN A CB    1 
ATOM   355   C  CG    . GLN A 1 52   ? 41.074  12.562  138.917 1.00 46.60  ? 51   GLN A CG    1 
ATOM   356   C  CD    . GLN A 1 52   ? 39.682  13.051  139.187 1.00 50.36  ? 51   GLN A CD    1 
ATOM   357   O  OE1   . GLN A 1 52   ? 39.453  13.787  140.140 1.00 54.83  ? 51   GLN A OE1   1 
ATOM   358   N  NE2   . GLN A 1 52   ? 38.737  12.635  138.364 1.00 52.25  ? 51   GLN A NE2   1 
ATOM   359   N  N     . GLY A 1 53   ? 44.688  13.947  141.373 1.00 32.14  ? 52   GLY A N     1 
ATOM   360   C  CA    . GLY A 1 53   ? 45.730  14.806  141.907 1.00 31.02  ? 52   GLY A CA    1 
ATOM   361   C  C     . GLY A 1 53   ? 47.114  14.368  141.477 1.00 30.85  ? 52   GLY A C     1 
ATOM   362   O  O     . GLY A 1 53   ? 47.945  15.193  141.107 1.00 31.05  ? 52   GLY A O     1 
ATOM   363   N  N     . ARG A 1 54   ? 47.376  13.061  141.508 1.00 30.60  ? 53   ARG A N     1 
ATOM   364   C  CA    . ARG A 1 54   ? 48.671  12.556  141.071 1.00 30.58  ? 53   ARG A CA    1 
ATOM   365   C  C     . ARG A 1 54   ? 48.919  12.850  139.599 1.00 31.11  ? 53   ARG A C     1 
ATOM   366   O  O     . ARG A 1 54   ? 50.047  13.168  139.210 1.00 35.21  ? 53   ARG A O     1 
ATOM   367   C  CB    . ARG A 1 54   ? 48.777  11.052  141.328 1.00 30.41  ? 53   ARG A CB    1 
ATOM   368   C  CG    . ARG A 1 54   ? 48.714  10.650  142.779 1.00 29.98  ? 53   ARG A CG    1 
ATOM   369   C  CD    . ARG A 1 54   ? 49.085  9.191   142.987 1.00 29.96  ? 53   ARG A CD    1 
ATOM   370   N  NE    . ARG A 1 54   ? 48.304  8.280   142.157 1.00 30.55  ? 53   ARG A NE    1 
ATOM   371   C  CZ    . ARG A 1 54   ? 47.297  7.531   142.594 1.00 31.60  ? 53   ARG A CZ    1 
ATOM   372   N  NH1   . ARG A 1 54   ? 46.647  6.740   141.759 1.00 30.83  ? 53   ARG A NH1   1 
ATOM   373   N  NH2   . ARG A 1 54   ? 46.942  7.570   143.867 1.00 35.87  ? 53   ARG A NH2   1 
ATOM   374   N  N     . ARG A 1 55   ? 47.884  12.752  138.757 1.00 31.46  ? 54   ARG A N     1 
ATOM   375   C  CA    . ARG A 1 55   ? 48.078  13.060  137.339 1.00 32.06  ? 54   ARG A CA    1 
ATOM   376   C  C     . ARG A 1 55   ? 48.420  14.531  137.131 1.00 32.37  ? 54   ARG A C     1 
ATOM   377   O  O     . ARG A 1 55   ? 49.271  14.855  136.295 1.00 32.79  ? 54   ARG A O     1 
ATOM   378   C  CB    . ARG A 1 55   ? 46.848  12.668  136.519 1.00 32.46  ? 54   ARG A CB    1 
ATOM   379   C  CG    . ARG A 1 55   ? 46.683  11.164  136.302 1.00 32.47  ? 54   ARG A CG    1 
ATOM   380   C  CD    . ARG A 1 55   ? 45.909  10.860  135.016 1.00 33.14  ? 54   ARG A CD    1 
ATOM   381   N  NE    . ARG A 1 55   ? 45.546  9.454   134.861 1.00 33.29  ? 54   ARG A NE    1 
ATOM   382   C  CZ    . ARG A 1 55   ? 44.325  8.981   135.075 1.00 33.42  ? 54   ARG A CZ    1 
ATOM   383   N  NH1   . ARG A 1 55   ? 43.359  9.797   135.456 1.00 33.41  ? 54   ARG A NH1   1 
ATOM   384   N  NH2   . ARG A 1 55   ? 44.069  7.700   134.913 1.00 33.68  ? 54   ARG A NH2   1 
ATOM   385   N  N     . LEU A 1 56   ? 47.795  15.435  137.891 1.00 32.29  ? 55   LEU A N     1 
ATOM   386   C  CA    . LEU A 1 56   ? 48.120  16.855  137.750 1.00 32.72  ? 55   LEU A CA    1 
ATOM   387   C  C     . LEU A 1 56   ? 49.556  17.137  138.162 1.00 32.60  ? 55   LEU A C     1 
ATOM   388   O  O     . LEU A 1 56   ? 50.260  17.904  137.496 1.00 33.15  ? 55   LEU A O     1 
ATOM   389   C  CB    . LEU A 1 56   ? 47.163  17.719  138.569 1.00 32.77  ? 55   LEU A CB    1 
ATOM   390   C  CG    . LEU A 1 56   ? 45.711  17.786  138.113 1.00 33.17  ? 55   LEU A CG    1 
ATOM   391   C  CD1   . LEU A 1 56   ? 45.003  18.890  138.847 1.00 33.47  ? 55   LEU A CD1   1 
ATOM   392   C  CD2   . LEU A 1 56   ? 45.634  18.016  136.628 1.00 33.88  ? 55   LEU A CD2   1 
ATOM   393   N  N     . ALA A 1 57   ? 50.006  16.521  139.256 1.00 31.98  ? 56   ALA A N     1 
ATOM   394   C  CA    . ALA A 1 57   ? 51.368  16.729  139.731 1.00 31.91  ? 56   ALA A CA    1 
ATOM   395   C  C     . ALA A 1 57   ? 52.380  16.025  138.842 1.00 32.16  ? 56   ALA A C     1 
ATOM   396   O  O     . ALA A 1 57   ? 53.469  16.551  138.600 1.00 32.56  ? 56   ALA A O     1 
ATOM   397   C  CB    . ALA A 1 57   ? 51.494  16.243  141.174 1.00 31.27  ? 56   ALA A CB    1 
ATOM   398   N  N     . ARG A 1 58   ? 52.047  14.826  138.365 1.00 32.03  ? 57   ARG A N     1 
ATOM   399   C  CA    . ARG A 1 58   ? 52.892  14.149  137.390 1.00 32.44  ? 57   ARG A CA    1 
ATOM   400   C  C     . ARG A 1 58   ? 53.153  15.021  136.173 1.00 33.22  ? 57   ARG A C     1 
ATOM   401   O  O     . ARG A 1 58   ? 54.286  15.106  135.691 1.00 33.69  ? 57   ARG A O     1 
ATOM   402   C  CB    . ARG A 1 58   ? 52.240  12.841  136.958 1.00 32.37  ? 57   ARG A CB    1 
ATOM   403   C  CG    . ARG A 1 58   ? 52.911  12.184  135.778 1.00 32.97  ? 57   ARG A CG    1 
ATOM   404   C  CD    . ARG A 1 58   ? 51.923  11.336  135.026 1.00 33.16  ? 57   ARG A CD    1 
ATOM   405   N  NE    . ARG A 1 58   ? 51.309  10.316  135.864 1.00 32.67  ? 57   ARG A NE    1 
ATOM   406   C  CZ    . ARG A 1 58   ? 50.291  9.556   135.481 1.00 32.80  ? 57   ARG A CZ    1 
ATOM   407   N  NH1   . ARG A 1 58   ? 49.765  9.717   134.280 1.00 33.37  ? 57   ARG A NH1   1 
ATOM   408   N  NH2   . ARG A 1 58   ? 49.799  8.643   136.292 1.00 32.47  ? 57   ARG A NH2   1 
ATOM   409   N  N     . ARG A 1 59   ? 52.117  15.689  135.666 1.00 33.46  ? 58   ARG A N     1 
ATOM   410   C  CA    . ARG A 1 59   ? 52.284  16.470  134.449 1.00 34.32  ? 58   ARG A CA    1 
ATOM   411   C  C     . ARG A 1 59   ? 52.915  17.823  134.731 1.00 34.70  ? 58   ARG A C     1 
ATOM   412   O  O     . ARG A 1 59   ? 53.628  18.357  133.875 1.00 35.48  ? 58   ARG A O     1 
ATOM   413   C  CB    . ARG A 1 59   ? 50.937  16.611  133.728 1.00 34.59  ? 58   ARG A CB    1 
ATOM   414   C  CG    . ARG A 1 59   ? 50.441  15.287  133.155 1.00 34.52  ? 58   ARG A CG    1 
ATOM   415   C  CD    . ARG A 1 59   ? 48.940  15.255  132.926 1.00 34.58  ? 58   ARG A CD    1 
ATOM   416   N  NE    . ARG A 1 59   ? 48.520  13.943  132.447 1.00 34.58  ? 58   ARG A NE    1 
ATOM   417   C  CZ    . ARG A 1 59   ? 47.269  13.508  132.436 1.00 34.56  ? 58   ARG A CZ    1 
ATOM   418   N  NH1   . ARG A 1 59   ? 46.291  14.274  132.878 1.00 34.53  ? 58   ARG A NH1   1 
ATOM   419   N  NH2   . ARG A 1 59   ? 47.005  12.293  131.995 1.00 34.68  ? 58   ARG A NH2   1 
ATOM   420   N  N     . LYS A 1 60   ? 52.708  18.384  135.922 1.00 34.27  ? 59   LYS A N     1 
ATOM   421   C  CA    . LYS A 1 60   ? 53.429  19.606  136.265 1.00 34.72  ? 59   LYS A CA    1 
ATOM   422   C  C     . LYS A 1 60   ? 54.925  19.344  136.340 1.00 34.88  ? 59   LYS A C     1 
ATOM   423   O  O     . LYS A 1 60   ? 55.729  20.139  135.844 1.00 35.68  ? 59   LYS A O     1 
ATOM   424   C  CB    . LYS A 1 60   ? 52.919  20.183  137.577 1.00 34.30  ? 59   LYS A CB    1 
ATOM   425   C  CG    . LYS A 1 60   ? 53.651  21.445  137.965 1.00 34.88  ? 59   LYS A CG    1 
ATOM   426   C  CD    . LYS A 1 60   ? 53.333  21.880  139.373 1.00 34.48  ? 59   LYS A CD    1 
ATOM   427   C  CE    . LYS A 1 60   ? 51.936  22.407  139.494 1.00 34.58  ? 59   LYS A CE    1 
ATOM   428   N  NZ    . LYS A 1 60   ? 51.969  23.857  139.738 1.00 35.40  ? 59   LYS A NZ    1 
ATOM   429   N  N     . LYS A 1 61   ? 55.312  18.205  136.919 1.00 34.24  ? 60   LYS A N     1 
ATOM   430   C  CA    . LYS A 1 61   ? 56.718  17.832  136.973 1.00 34.47  ? 60   LYS A CA    1 
ATOM   431   C  C     . LYS A 1 61   ? 57.235  17.468  135.595 1.00 35.22  ? 60   LYS A C     1 
ATOM   432   O  O     . LYS A 1 61   ? 58.387  17.763  135.262 1.00 36.42  ? 60   LYS A O     1 
ATOM   433   C  CB    . LYS A 1 61   ? 56.926  16.671  137.949 1.00 35.32  ? 60   LYS A CB    1 
ATOM   434   C  CG    . LYS A 1 61   ? 58.222  15.901  137.724 1.00 38.29  ? 60   LYS A CG    1 
ATOM   435   C  CD    . LYS A 1 61   ? 58.173  14.520  138.334 1.00 39.56  ? 60   LYS A CD    1 
ATOM   436   C  CE    . LYS A 1 61   ? 58.023  14.611  139.853 1.00 41.34  ? 60   LYS A CE    1 
ATOM   437   N  NZ    . LYS A 1 61   ? 57.941  13.274  140.543 1.00 43.65  ? 60   LYS A NZ    1 
ATOM   438   N  N     . HIS A 1 62   ? 56.407  16.807  134.788 1.00 35.17  ? 61   HIS A N     1 
ATOM   439   C  CA    . HIS A 1 62   ? 56.825  16.498  133.427 1.00 35.98  ? 61   HIS A CA    1 
ATOM   440   C  C     . HIS A 1 62   ? 57.022  17.755  132.597 1.00 36.93  ? 61   HIS A C     1 
ATOM   441   O  O     . HIS A 1 62   ? 57.803  17.732  131.646 1.00 37.81  ? 61   HIS A O     1 
ATOM   442   C  CB    . HIS A 1 62   ? 55.821  15.570  132.733 1.00 35.83  ? 61   HIS A CB    1 
ATOM   443   C  CG    . HIS A 1 62   ? 56.357  14.921  131.495 1.00 36.62  ? 61   HIS A CG    1 
ATOM   444   N  ND1   . HIS A 1 62   ? 57.531  14.202  131.481 1.00 36.92  ? 61   HIS A ND1   1 
ATOM   445   C  CD2   . HIS A 1 62   ? 55.876  14.877  130.231 1.00 37.27  ? 61   HIS A CD2   1 
ATOM   446   C  CE1   . HIS A 1 62   ? 57.753  13.747  130.262 1.00 37.74  ? 61   HIS A CE1   1 
ATOM   447   N  NE2   . HIS A 1 62   ? 56.762  14.141  129.485 1.00 37.95  ? 61   HIS A NE2   1 
ATOM   448   N  N     . ARG A 1 63   ? 56.353  18.853  132.943 1.00 36.91  ? 62   ARG A N     1 
ATOM   449   C  CA    . ARG A 1 63   ? 56.529  20.070  132.166 1.00 37.96  ? 62   ARG A CA    1 
ATOM   450   C  C     . ARG A 1 63   ? 57.942  20.612  132.304 1.00 38.63  ? 62   ARG A C     1 
ATOM   451   O  O     . ARG A 1 63   ? 58.520  21.100  131.325 1.00 39.73  ? 62   ARG A O     1 
ATOM   452   C  CB    . ARG A 1 63   ? 55.498  21.128  132.570 1.00 37.92  ? 62   ARG A CB    1 
ATOM   453   C  CG    . ARG A 1 63   ? 54.097  20.848  132.043 1.00 37.74  ? 62   ARG A CG    1 
ATOM   454   C  CD    . ARG A 1 63   ? 53.202  22.069  131.954 1.00 38.28  ? 62   ARG A CD    1 
ATOM   455   N  NE    . ARG A 1 63   ? 52.806  22.622  133.239 1.00 37.78  ? 62   ARG A NE    1 
ATOM   456   C  CZ    . ARG A 1 63   ? 51.874  22.107  134.035 1.00 36.92  ? 62   ARG A CZ    1 
ATOM   457   N  NH1   . ARG A 1 63   ? 51.246  20.997  133.700 1.00 36.43  ? 62   ARG A NH1   1 
ATOM   458   N  NH2   . ARG A 1 63   ? 51.578  22.695  135.181 1.00 36.64  ? 62   ARG A NH2   1 
ATOM   459   N  N     . ARG A 1 64   ? 58.526  20.526  133.497 1.00 38.10  ? 63   ARG A N     1 
ATOM   460   C  CA    . ARG A 1 64   ? 59.882  21.023  133.673 1.00 38.83  ? 63   ARG A CA    1 
ATOM   461   C  C     . ARG A 1 64   ? 60.925  20.018  133.224 1.00 39.13  ? 63   ARG A C     1 
ATOM   462   O  O     . ARG A 1 64   ? 62.049  20.416  132.906 1.00 42.36  ? 63   ARG A O     1 
ATOM   463   C  CB    . ARG A 1 64   ? 60.123  21.422  135.126 1.00 38.42  ? 63   ARG A CB    1 
ATOM   464   C  CG    . ARG A 1 64   ? 60.141  20.288  136.138 1.00 37.21  ? 63   ARG A CG    1 
ATOM   465   C  CD    . ARG A 1 64   ? 59.612  20.794  137.468 1.00 36.54  ? 63   ARG A CD    1 
ATOM   466   N  NE    . ARG A 1 64   ? 59.689  19.791  138.523 1.00 35.61  ? 63   ARG A NE    1 
ATOM   467   C  CZ    . ARG A 1 64   ? 58.826  19.712  139.531 1.00 34.78  ? 63   ARG A CZ    1 
ATOM   468   N  NH1   . ARG A 1 64   ? 57.803  20.557  139.618 1.00 34.76  ? 63   ARG A NH1   1 
ATOM   469   N  NH2   . ARG A 1 64   ? 58.966  18.768  140.440 1.00 34.07  ? 63   ARG A NH2   1 
ATOM   470   N  N     . VAL A 1 65   ? 60.579  18.734  133.178 1.00 38.45  ? 64   VAL A N     1 
ATOM   471   C  CA    . VAL A 1 65   ? 61.460  17.747  132.562 1.00 38.94  ? 64   VAL A CA    1 
ATOM   472   C  C     . VAL A 1 65   ? 61.498  17.947  131.055 1.00 40.01  ? 64   VAL A C     1 
ATOM   473   O  O     . VAL A 1 65   ? 62.565  17.943  130.430 1.00 41.06  ? 64   VAL A O     1 
ATOM   474   C  CB    . VAL A 1 65   ? 60.997  16.328  132.928 1.00 38.04  ? 64   VAL A CB    1 
ATOM   475   C  CG1   . VAL A 1 65   ? 61.561  15.309  131.955 1.00 38.73  ? 64   VAL A CG1   1 
ATOM   476   C  CG2   . VAL A 1 65   ? 61.409  16.008  134.346 1.00 37.33  ? 64   VAL A CG2   1 
ATOM   477   N  N     . ARG A 1 66   ? 60.325  18.121  130.452 1.00 39.86  ? 65   ARG A N     1 
ATOM   478   C  CA    . ARG A 1 66   ? 60.236  18.444  129.035 1.00 40.93  ? 65   ARG A CA    1 
ATOM   479   C  C     . ARG A 1 66   ? 60.995  19.724  128.719 1.00 42.07  ? 65   ARG A C     1 
ATOM   480   O  O     . ARG A 1 66   ? 61.624  19.834  127.662 1.00 43.27  ? 65   ARG A O     1 
ATOM   481   C  CB    . ARG A 1 66   ? 58.762  18.566  128.663 1.00 41.19  ? 65   ARG A CB    1 
ATOM   482   C  CG    . ARG A 1 66   ? 58.404  18.062  127.301 1.00 43.27  ? 65   ARG A CG    1 
ATOM   483   C  CD    . ARG A 1 66   ? 57.150  17.214  127.357 1.00 44.78  ? 65   ARG A CD    1 
ATOM   484   N  NE    . ARG A 1 66   ? 56.104  17.793  128.191 1.00 43.24  ? 65   ARG A NE    1 
ATOM   485   C  CZ    . ARG A 1 66   ? 55.111  18.556  127.741 1.00 43.95  ? 65   ARG A CZ    1 
ATOM   486   N  NH1   . ARG A 1 66   ? 55.022  18.860  126.451 1.00 46.73  ? 65   ARG A NH1   1 
ATOM   487   N  NH2   . ARG A 1 66   ? 54.208  19.028  128.589 1.00 43.20  ? 65   ARG A NH2   1 
ATOM   488   N  N     . LEU A 1 67   ? 60.978  20.690  129.640 1.00 41.84  ? 66   LEU A N     1 
ATOM   489   C  CA    . LEU A 1 67   ? 61.737  21.921  129.446 1.00 43.03  ? 66   LEU A CA    1 
ATOM   490   C  C     . LEU A 1 67   ? 63.236  21.678  129.536 1.00 43.72  ? 66   LEU A C     1 
ATOM   491   O  O     . LEU A 1 67   ? 64.013  22.347  128.848 1.00 45.10  ? 66   LEU A O     1 
ATOM   492   C  CB    . LEU A 1 67   ? 61.310  22.966  130.470 1.00 42.67  ? 66   LEU A CB    1 
ATOM   493   C  CG    . LEU A 1 67   ? 62.107  24.266  130.461 1.00 43.93  ? 66   LEU A CG    1 
ATOM   494   C  CD1   . LEU A 1 67   ? 61.797  25.059  129.207 1.00 45.19  ? 66   LEU A CD1   1 
ATOM   495   C  CD2   . LEU A 1 67   ? 61.812  25.092  131.701 1.00 43.49  ? 66   LEU A CD2   1 
ATOM   496   N  N     . ASN A 1 68   ? 63.663  20.737  130.377 1.00 43.24  ? 67   ASN A N     1 
ATOM   497   C  CA    . ASN A 1 68   ? 65.077  20.389  130.428 1.00 47.29  ? 67   ASN A CA    1 
ATOM   498   C  C     . ASN A 1 68   ? 65.537  19.786  129.110 1.00 48.01  ? 67   ASN A C     1 
ATOM   499   O  O     . ASN A 1 68   ? 66.592  20.151  128.583 1.00 48.58  ? 67   ASN A O     1 
ATOM   500   C  CB    . ASN A 1 68   ? 65.342  19.422  131.579 1.00 46.49  ? 67   ASN A CB    1 
ATOM   501   C  CG    . ASN A 1 68   ? 65.435  20.117  132.915 1.00 43.66  ? 67   ASN A CG    1 
ATOM   502   O  OD1   . ASN A 1 68   ? 65.096  21.291  133.044 1.00 45.12  ? 67   ASN A OD1   1 
ATOM   503   N  ND2   . ASN A 1 68   ? 65.893  19.393  133.923 1.00 41.50  ? 67   ASN A ND2   1 
ATOM   504   N  N     . ARG A 1 69   ? 64.760  18.857  128.557 1.00 53.87  ? 68   ARG A N     1 
ATOM   505   C  CA    . ARG A 1 69   ? 65.179  18.238  127.310 1.00 55.05  ? 68   ARG A CA    1 
ATOM   506   C  C     . ARG A 1 69   ? 65.109  19.221  126.149 1.00 52.25  ? 68   ARG A C     1 
ATOM   507   O  O     . ARG A 1 69   ? 65.864  19.083  125.182 1.00 51.49  ? 68   ARG A O     1 
ATOM   508   C  CB    . ARG A 1 69   ? 64.338  17.002  127.029 1.00 59.60  ? 68   ARG A CB    1 
ATOM   509   C  CG    . ARG A 1 69   ? 65.126  15.904  126.342 1.00 64.44  ? 68   ARG A CG    1 
ATOM   510   C  CD    . ARG A 1 69   ? 64.384  14.593  126.413 1.00 66.82  ? 68   ARG A CD    1 
ATOM   511   N  NE    . ARG A 1 69   ? 63.685  14.459  127.687 1.00 66.04  ? 68   ARG A NE    1 
ATOM   512   C  CZ    . ARG A 1 69   ? 63.129  13.334  128.115 1.00 67.35  ? 68   ARG A CZ    1 
ATOM   513   N  NH1   . ARG A 1 69   ? 63.203  12.237  127.381 1.00 67.50  ? 68   ARG A NH1   1 
ATOM   514   N  NH2   . ARG A 1 69   ? 62.507  13.302  129.280 1.00 68.74  ? 68   ARG A NH2   1 
ATOM   515   N  N     . LEU A 1 70   ? 64.233  20.229  126.235 1.00 46.24  ? 69   LEU A N     1 
ATOM   516   C  CA    . LEU A 1 70   ? 64.211  21.273  125.214 1.00 47.58  ? 69   LEU A CA    1 
ATOM   517   C  C     . LEU A 1 70   ? 65.460  22.131  125.288 1.00 48.87  ? 69   LEU A C     1 
ATOM   518   O  O     . LEU A 1 70   ? 66.027  22.502  124.256 1.00 50.41  ? 69   LEU A O     1 
ATOM   519   C  CB    . LEU A 1 70   ? 62.959  22.144  125.351 1.00 47.08  ? 69   LEU A CB    1 
ATOM   520   C  CG    . LEU A 1 70   ? 62.913  23.458  124.565 1.00 48.49  ? 69   LEU A CG    1 
ATOM   521   C  CD1   . LEU A 1 70   ? 62.702  23.207  123.073 1.00 49.52  ? 69   LEU A CD1   1 
ATOM   522   C  CD2   . LEU A 1 70   ? 61.784  24.323  125.095 1.00 47.91  ? 69   LEU A CD2   1 
ATOM   523   N  N     . PHE A 1 71   ? 65.893  22.477  126.500 1.00 48.36  ? 70   PHE A N     1 
ATOM   524   C  CA    . PHE A 1 71   ? 67.132  23.230  126.645 1.00 49.65  ? 70   PHE A CA    1 
ATOM   525   C  C     . PHE A 1 71   ? 68.340  22.391  126.260 1.00 50.51  ? 70   PHE A C     1 
ATOM   526   O  O     . PHE A 1 71   ? 69.296  22.917  125.687 1.00 52.14  ? 70   PHE A O     1 
ATOM   527   C  CB    . PHE A 1 71   ? 67.271  23.764  128.078 1.00 48.93  ? 70   PHE A CB    1 
ATOM   528   C  CG    . PHE A 1 71   ? 66.690  25.136  128.276 1.00 49.22  ? 70   PHE A CG    1 
ATOM   529   C  CD1   . PHE A 1 71   ? 65.328  25.314  128.403 1.00 48.23  ? 70   PHE A CD1   1 
ATOM   530   C  CD2   . PHE A 1 71   ? 67.508  26.247  128.329 1.00 50.63  ? 70   PHE A CD2   1 
ATOM   531   C  CE1   . PHE A 1 71   ? 64.799  26.574  128.583 1.00 48.65  ? 70   PHE A CE1   1 
ATOM   532   C  CE2   . PHE A 1 71   ? 66.976  27.506  128.513 1.00 51.05  ? 70   PHE A CE2   1 
ATOM   533   C  CZ    . PHE A 1 71   ? 65.622  27.666  128.639 1.00 50.06  ? 70   PHE A CZ    1 
ATOM   534   N  N     . GLU A 1 72   ? 68.316  21.093  126.555 1.00 56.49  ? 71   GLU A N     1 
ATOM   535   C  CA    . GLU A 1 72   ? 69.392  20.220  126.100 1.00 64.90  ? 71   GLU A CA    1 
ATOM   536   C  C     . GLU A 1 72   ? 69.460  20.179  124.579 1.00 66.07  ? 71   GLU A C     1 
ATOM   537   O  O     . GLU A 1 72   ? 70.526  20.392  123.988 1.00 68.21  ? 71   GLU A O     1 
ATOM   538   C  CB    . GLU A 1 72   ? 69.201  18.810  126.653 1.00 72.37  ? 71   GLU A CB    1 
ATOM   539   C  CG    . GLU A 1 72   ? 69.863  18.572  127.982 1.00 78.28  ? 71   GLU A CG    1 
ATOM   540   C  CD    . GLU A 1 72   ? 69.956  17.099  128.319 1.00 83.48  ? 71   GLU A CD    1 
ATOM   541   O  OE1   . GLU A 1 72   ? 69.040  16.580  128.996 1.00 82.91  ? 71   GLU A OE1   1 
ATOM   542   O  OE2   . GLU A 1 72   ? 70.944  16.458  127.896 1.00 91.04  ? 71   GLU A OE2   1 
ATOM   543   N  N     . GLU A 1 73   ? 68.328  19.894  123.927 1.00 62.70  ? 72   GLU A N     1 
ATOM   544   C  CA    . GLU A 1 73   ? 68.323  19.760  122.475 1.00 63.58  ? 72   GLU A CA    1 
ATOM   545   C  C     . GLU A 1 73   ? 68.690  21.069  121.804 1.00 62.10  ? 72   GLU A C     1 
ATOM   546   O  O     . GLU A 1 73   ? 69.467  21.084  120.846 1.00 61.84  ? 72   GLU A O     1 
ATOM   547   C  CB    . GLU A 1 73   ? 66.958  19.280  121.992 1.00 66.44  ? 72   GLU A CB    1 
ATOM   548   C  CG    . GLU A 1 73   ? 66.658  17.853  122.372 1.00 67.85  ? 72   GLU A CG    1 
ATOM   549   C  CD    . GLU A 1 73   ? 65.190  17.513  122.238 1.00 69.93  ? 72   GLU A CD    1 
ATOM   550   O  OE1   . GLU A 1 73   ? 64.369  18.444  122.092 1.00 72.45  ? 72   GLU A OE1   1 
ATOM   551   O  OE2   . GLU A 1 73   ? 64.856  16.312  122.277 1.00 71.36  ? 72   GLU A OE2   1 
ATOM   552   N  N     . SER A 1 74   ? 68.146  22.179  122.295 1.00 56.96  ? 73   SER A N     1 
ATOM   553   C  CA    . SER A 1 74   ? 68.531  23.477  121.769 1.00 57.09  ? 73   SER A CA    1 
ATOM   554   C  C     . SER A 1 74   ? 70.013  23.759  121.960 1.00 57.10  ? 73   SER A C     1 
ATOM   555   O  O     . SER A 1 74   ? 70.563  24.594  121.237 1.00 60.03  ? 73   SER A O     1 
ATOM   556   C  CB    . SER A 1 74   ? 67.682  24.563  122.418 1.00 54.71  ? 73   SER A CB    1 
ATOM   557   O  OG    . SER A 1 74   ? 66.318  24.380  122.095 1.00 53.77  ? 73   SER A OG    1 
ATOM   558   N  N     . GLY A 1 75   ? 70.678  23.050  122.869 1.00 67.55  ? 74   GLY A N     1 
ATOM   559   C  CA    . GLY A 1 75   ? 72.092  23.252  123.105 1.00 69.65  ? 74   GLY A CA    1 
ATOM   560   C  C     . GLY A 1 75   ? 72.403  24.462  123.948 1.00 72.50  ? 74   GLY A C     1 
ATOM   561   O  O     . GLY A 1 75   ? 73.545  24.928  123.953 1.00 74.82  ? 74   GLY A O     1 
ATOM   562   N  N     . LEU A 1 76   ? 71.412  24.985  124.666 1.00 70.87  ? 75   LEU A N     1 
ATOM   563   C  CA    . LEU A 1 76   ? 71.579  26.198  125.456 1.00 71.29  ? 75   LEU A CA    1 
ATOM   564   C  C     . LEU A 1 76   ? 72.111  25.919  126.854 1.00 70.93  ? 75   LEU A C     1 
ATOM   565   O  O     . LEU A 1 76   ? 72.938  26.688  127.355 1.00 72.69  ? 75   LEU A O     1 
ATOM   566   C  CB    . LEU A 1 76   ? 70.255  26.970  125.537 1.00 71.16  ? 75   LEU A CB    1 
ATOM   567   C  CG    . LEU A 1 76   ? 69.820  27.853  124.360 1.00 73.11  ? 75   LEU A CG    1 
ATOM   568   C  CD1   . LEU A 1 76   ? 69.941  27.178  122.998 1.00 75.72  ? 75   LEU A CD1   1 
ATOM   569   C  CD2   . LEU A 1 76   ? 68.403  28.393  124.598 1.00 71.24  ? 75   LEU A CD2   1 
ATOM   570   N  N     . ILE A 1 77   ? 71.635  24.855  127.505 1.00 60.45  ? 76   ILE A N     1 
ATOM   571   C  CA    . ILE A 1 77   ? 72.153  24.414  128.798 1.00 59.25  ? 76   ILE A CA    1 
ATOM   572   C  C     . ILE A 1 77   ? 72.300  22.901  128.756 1.00 59.94  ? 76   ILE A C     1 
ATOM   573   O  O     . ILE A 1 77   ? 71.324  22.191  128.494 1.00 60.08  ? 76   ILE A O     1 
ATOM   574   C  CB    . ILE A 1 77   ? 71.241  24.814  129.969 1.00 52.78  ? 76   ILE A CB    1 
ATOM   575   C  CG1   . ILE A 1 77   ? 71.185  26.328  130.116 1.00 52.56  ? 76   ILE A CG1   1 
ATOM   576   C  CG2   . ILE A 1 77   ? 71.727  24.191  131.247 1.00 50.77  ? 76   ILE A CG2   1 
ATOM   577   C  CD1   . ILE A 1 77   ? 70.229  26.779  131.169 1.00 51.23  ? 76   ILE A CD1   1 
ATOM   578   N  N     . THR A 1 78   ? 73.508  22.408  129.014 1.00 70.12  ? 77   THR A N     1 
ATOM   579   C  CA    . THR A 1 78   ? 73.759  20.980  129.156 1.00 69.87  ? 77   THR A CA    1 
ATOM   580   C  C     . THR A 1 78   ? 73.888  20.551  130.609 1.00 71.31  ? 77   THR A C     1 
ATOM   581   O  O     . THR A 1 78   ? 73.337  19.517  131.000 1.00 72.09  ? 77   THR A O     1 
ATOM   582   C  CB    . THR A 1 78   ? 75.030  20.588  128.401 1.00 74.52  ? 77   THR A CB    1 
ATOM   583   O  OG1   . THR A 1 78   ? 74.805  20.711  126.991 1.00 75.08  ? 77   THR A OG1   1 
ATOM   584   C  CG2   . THR A 1 78   ? 75.435  19.159  128.729 1.00 76.58  ? 77   THR A CG2   1 
ATOM   585   N  N     . ASP A 1 79   ? 74.590  21.338  131.420 1.00 69.08  ? 78   ASP A N     1 
ATOM   586   C  CA    . ASP A 1 79   ? 74.821  21.033  132.825 1.00 64.90  ? 78   ASP A CA    1 
ATOM   587   C  C     . ASP A 1 79   ? 73.792  21.786  133.661 1.00 60.64  ? 78   ASP A C     1 
ATOM   588   O  O     . ASP A 1 79   ? 73.847  23.015  133.767 1.00 60.99  ? 78   ASP A O     1 
ATOM   589   C  CB    . ASP A 1 79   ? 76.243  21.420  133.223 1.00 64.56  ? 78   ASP A CB    1 
ATOM   590   C  CG    . ASP A 1 79   ? 76.708  20.726  134.482 1.00 63.43  ? 78   ASP A CG    1 
ATOM   591   O  OD1   . ASP A 1 79   ? 75.870  20.473  135.372 1.00 62.81  ? 78   ASP A OD1   1 
ATOM   592   O  OD2   . ASP A 1 79   ? 77.917  20.427  134.571 1.00 63.52  ? 78   ASP A OD2   1 
ATOM   593   N  N     . PHE A 1 80   ? 72.859  21.048  134.259 1.00 55.87  ? 79   PHE A N     1 
ATOM   594   C  CA    . PHE A 1 80   ? 71.834  21.629  135.112 1.00 54.01  ? 79   PHE A CA    1 
ATOM   595   C  C     . PHE A 1 80   ? 72.201  21.576  136.588 1.00 54.77  ? 79   PHE A C     1 
ATOM   596   O  O     . PHE A 1 80   ? 71.340  21.805  137.439 1.00 52.46  ? 79   PHE A O     1 
ATOM   597   C  CB    . PHE A 1 80   ? 70.494  20.927  134.885 1.00 50.09  ? 79   PHE A CB    1 
ATOM   598   C  CG    . PHE A 1 80   ? 69.907  21.159  133.516 1.00 48.41  ? 79   PHE A CG    1 
ATOM   599   C  CD1   . PHE A 1 80   ? 69.077  22.239  133.276 1.00 48.94  ? 79   PHE A CD1   1 
ATOM   600   C  CD2   . PHE A 1 80   ? 70.182  20.291  132.471 1.00 46.98  ? 79   PHE A CD2   1 
ATOM   601   C  CE1   . PHE A 1 80   ? 68.536  22.452  132.026 1.00 48.81  ? 79   PHE A CE1   1 
ATOM   602   C  CE2   . PHE A 1 80   ? 69.645  20.503  131.216 1.00 46.83  ? 79   PHE A CE2   1 
ATOM   603   C  CZ    . PHE A 1 80   ? 68.823  21.583  130.994 1.00 46.79  ? 79   PHE A CZ    1 
ATOM   604   N  N     . THR A 1 81   ? 73.456  21.279  136.914 1.00 61.35  ? 80   THR A N     1 
ATOM   605   C  CA    . THR A 1 81   ? 73.848  21.208  138.315 1.00 63.25  ? 80   THR A CA    1 
ATOM   606   C  C     . THR A 1 81   ? 74.097  22.593  138.897 1.00 65.27  ? 80   THR A C     1 
ATOM   607   O  O     . THR A 1 81   ? 73.674  22.884  140.020 1.00 66.78  ? 80   THR A O     1 
ATOM   608   C  CB    . THR A 1 81   ? 75.090  20.338  138.465 1.00 65.92  ? 80   THR A CB    1 
ATOM   609   O  OG1   . THR A 1 81   ? 76.154  20.890  137.677 1.00 69.14  ? 80   THR A OG1   1 
ATOM   610   C  CG2   . THR A 1 81   ? 74.796  18.925  137.992 1.00 66.68  ? 80   THR A CG2   1 
ATOM   611   N  N     . LYS A 1 82   ? 74.772  23.461  138.154 1.00 69.33  ? 81   LYS A N     1 
ATOM   612   C  CA    . LYS A 1 82   ? 75.076  24.809  138.626 1.00 70.88  ? 81   LYS A CA    1 
ATOM   613   C  C     . LYS A 1 82   ? 73.960  25.799  138.333 1.00 68.69  ? 81   LYS A C     1 
ATOM   614   O  O     . LYS A 1 82   ? 74.232  26.960  138.020 1.00 74.79  ? 81   LYS A O     1 
ATOM   615   C  CB    . LYS A 1 82   ? 76.390  25.270  138.009 1.00 77.43  ? 81   LYS A CB    1 
ATOM   616   C  CG    . LYS A 1 82   ? 76.553  24.877  136.550 1.00 80.40  ? 81   LYS A CG    1 
ATOM   617   C  CD    . LYS A 1 82   ? 77.997  25.027  136.093 1.00 83.28  ? 81   LYS A CD    1 
ATOM   618   C  CE    . LYS A 1 82   ? 78.939  24.207  136.967 1.00 84.30  ? 81   LYS A CE    1 
ATOM   619   N  NZ    . LYS A 1 82   ? 78.545  22.769  137.012 1.00 83.52  ? 81   LYS A NZ    1 
ATOM   620   N  N     . ILE A 1 83   ? 72.700  25.389  138.427 1.00 54.85  ? 82   ILE A N     1 
ATOM   621   C  CA    . ILE A 1 83   ? 71.569  26.268  138.159 1.00 50.42  ? 82   ILE A CA    1 
ATOM   622   C  C     . ILE A 1 83   ? 71.068  26.812  139.484 1.00 47.49  ? 82   ILE A C     1 
ATOM   623   O  O     . ILE A 1 83   ? 70.608  26.051  140.340 1.00 45.54  ? 82   ILE A O     1 
ATOM   624   C  CB    . ILE A 1 83   ? 70.444  25.539  137.407 1.00 46.78  ? 82   ILE A CB    1 
ATOM   625   C  CG1   . ILE A 1 83   ? 70.936  25.063  136.046 1.00 47.42  ? 82   ILE A CG1   1 
ATOM   626   C  CG2   . ILE A 1 83   ? 69.252  26.466  137.205 1.00 46.29  ? 82   ILE A CG2   1 
ATOM   627   C  CD1   . ILE A 1 83   ? 71.184  26.181  135.076 1.00 49.49  ? 82   ILE A CD1   1 
ATOM   628   N  N     . SER A 1 84   ? 71.129  28.128  139.643 1.00 47.96  ? 83   SER A N     1 
ATOM   629   C  CA    . SER A 1 84   ? 70.780  28.741  140.914 1.00 47.57  ? 83   SER A CA    1 
ATOM   630   C  C     . SER A 1 84   ? 69.294  28.627  141.198 1.00 46.10  ? 83   SER A C     1 
ATOM   631   O  O     . SER A 1 84   ? 68.455  28.681  140.299 1.00 45.89  ? 83   SER A O     1 
ATOM   632   C  CB    . SER A 1 84   ? 71.166  30.215  140.939 1.00 49.24  ? 83   SER A CB    1 
ATOM   633   O  OG    . SER A 1 84   ? 70.549  30.851  142.047 1.00 48.82  ? 83   SER A OG    1 
ATOM   634   N  N     . ILE A 1 85   ? 68.970  28.503  142.481 1.00 45.19  ? 84   ILE A N     1 
ATOM   635   C  CA    . ILE A 1 85   ? 67.587  28.464  142.917 1.00 43.94  ? 84   ILE A CA    1 
ATOM   636   C  C     . ILE A 1 85   ? 67.234  29.647  143.805 1.00 44.42  ? 84   ILE A C     1 
ATOM   637   O  O     . ILE A 1 85   ? 66.151  29.677  144.373 1.00 43.52  ? 84   ILE A O     1 
ATOM   638   C  CB    . ILE A 1 85   ? 67.263  27.132  143.615 1.00 42.35  ? 84   ILE A CB    1 
ATOM   639   C  CG1   . ILE A 1 85   ? 68.045  27.007  144.918 1.00 42.36  ? 84   ILE A CG1   1 
ATOM   640   C  CG2   . ILE A 1 85   ? 67.606  25.967  142.705 1.00 42.05  ? 84   ILE A CG2   1 
ATOM   641   C  CD1   . ILE A 1 85   ? 67.656  25.795  145.746 1.00 40.90  ? 84   ILE A CD1   1 
ATOM   642   N  N     . ASN A 1 86   ? 68.111  30.651  143.900 1.00 45.96  ? 85   ASN A N     1 
ATOM   643   C  CA    . ASN A 1 86   ? 67.894  31.768  144.814 1.00 46.61  ? 85   ASN A CA    1 
ATOM   644   C  C     . ASN A 1 86   ? 67.915  33.118  144.109 1.00 48.30  ? 85   ASN A C     1 
ATOM   645   O  O     . ASN A 1 86   ? 68.233  34.136  144.737 1.00 49.46  ? 85   ASN A O     1 
ATOM   646   C  CB    . ASN A 1 86   ? 68.927  31.748  145.941 1.00 46.99  ? 85   ASN A CB    1 
ATOM   647   C  CG    . ASN A 1 86   ? 68.825  30.516  146.794 1.00 45.43  ? 85   ASN A CG    1 
ATOM   648   O  OD1   . ASN A 1 86   ? 69.780  29.753  146.912 1.00 45.41  ? 85   ASN A OD1   1 
ATOM   649   N  ND2   . ASN A 1 86   ? 67.657  30.303  147.387 1.00 44.22  ? 85   ASN A ND2   1 
ATOM   650   N  N     . LEU A 1 87   ? 67.600  33.151  142.821 1.00 48.59  ? 86   LEU A N     1 
ATOM   651   C  CA    . LEU A 1 87   ? 67.329  34.392  142.110 1.00 50.08  ? 86   LEU A CA    1 
ATOM   652   C  C     . LEU A 1 87   ? 65.822  34.578  141.995 1.00 49.34  ? 86   LEU A C     1 
ATOM   653   O  O     . LEU A 1 87   ? 65.056  33.624  142.093 1.00 48.59  ? 86   LEU A O     1 
ATOM   654   C  CB    . LEU A 1 87   ? 67.966  34.391  140.717 1.00 51.13  ? 86   LEU A CB    1 
ATOM   655   C  CG    . LEU A 1 87   ? 69.385  33.849  140.575 1.00 51.67  ? 86   LEU A CG    1 
ATOM   656   C  CD1   . LEU A 1 87   ? 69.687  33.546  139.107 1.00 52.28  ? 86   LEU A CD1   1 
ATOM   657   C  CD2   . LEU A 1 87   ? 70.418  34.828  141.151 1.00 53.39  ? 86   LEU A CD2   1 
ATOM   658   N  N     . ASN A 1 88   ? 65.400  35.815  141.776 1.00 50.66  ? 87   ASN A N     1 
ATOM   659   C  CA    . ASN A 1 88   ? 63.975  36.100  141.691 1.00 50.21  ? 87   ASN A CA    1 
ATOM   660   C  C     . ASN A 1 88   ? 63.468  35.838  140.274 1.00 50.19  ? 87   ASN A C     1 
ATOM   661   O  O     . ASN A 1 88   ? 63.709  36.631  139.360 1.00 51.74  ? 87   ASN A O     1 
ATOM   662   C  CB    . ASN A 1 88   ? 63.690  37.540  142.079 1.00 51.77  ? 87   ASN A CB    1 
ATOM   663   C  CG    . ASN A 1 88   ? 62.219  37.821  142.232 1.00 51.34  ? 87   ASN A CG    1 
ATOM   664   O  OD1   . ASN A 1 88   ? 61.391  37.097  141.708 1.00 50.20  ? 87   ASN A OD1   1 
ATOM   665   N  ND2   . ASN A 1 88   ? 61.884  38.874  142.958 1.00 52.38  ? 87   ASN A ND2   1 
ATOM   666   N  N     . PRO A 1 89   ? 62.728  34.745  140.052 1.00 48.56  ? 88   PRO A N     1 
ATOM   667   C  CA    . PRO A 1 89   ? 62.283  34.461  138.672 1.00 48.63  ? 88   PRO A CA    1 
ATOM   668   C  C     . PRO A 1 89   ? 61.260  35.467  138.174 1.00 49.58  ? 88   PRO A C     1 
ATOM   669   O  O     . PRO A 1 89   ? 61.253  35.786  136.985 1.00 50.56  ? 88   PRO A O     1 
ATOM   670   C  CB    . PRO A 1 89   ? 61.692  33.049  138.783 1.00 46.67  ? 88   PRO A CB    1 
ATOM   671   C  CG    . PRO A 1 89   ? 61.258  32.951  140.204 1.00 45.72  ? 88   PRO A CG    1 
ATOM   672   C  CD    . PRO A 1 89   ? 62.175  33.760  141.031 1.00 46.72  ? 88   PRO A CD    1 
ATOM   673   N  N     . TYR A 1 90   ? 60.449  36.034  139.064 1.00 49.52  ? 89   TYR A N     1 
ATOM   674   C  CA    . TYR A 1 90   ? 59.459  37.018  138.658 1.00 50.58  ? 89   TYR A CA    1 
ATOM   675   C  C     . TYR A 1 90   ? 60.093  38.291  138.145 1.00 52.78  ? 89   TYR A C     1 
ATOM   676   O  O     . TYR A 1 90   ? 59.524  38.947  137.270 1.00 53.90  ? 89   TYR A O     1 
ATOM   677   C  CB    . TYR A 1 90   ? 58.542  37.345  139.819 1.00 50.18  ? 89   TYR A CB    1 
ATOM   678   C  CG    . TYR A 1 90   ? 57.832  36.139  140.312 1.00 48.19  ? 89   TYR A CG    1 
ATOM   679   C  CD1   . TYR A 1 90   ? 58.417  35.299  141.254 1.00 46.95  ? 89   TYR A CD1   1 
ATOM   680   C  CD2   . TYR A 1 90   ? 56.589  35.807  139.808 1.00 47.63  ? 89   TYR A CD2   1 
ATOM   681   C  CE1   . TYR A 1 90   ? 57.764  34.169  141.682 1.00 45.23  ? 89   TYR A CE1   1 
ATOM   682   C  CE2   . TYR A 1 90   ? 55.934  34.700  140.235 1.00 45.94  ? 89   TYR A CE2   1 
ATOM   683   C  CZ    . TYR A 1 90   ? 56.511  33.885  141.170 1.00 44.75  ? 89   TYR A CZ    1 
ATOM   684   O  OH    . TYR A 1 90   ? 55.818  32.780  141.574 1.00 43.19  ? 89   TYR A OH    1 
ATOM   685   N  N     . GLN A 1 91   ? 61.244  38.675  138.681 1.00 53.56  ? 90   GLN A N     1 
ATOM   686   C  CA    . GLN A 1 91   ? 61.875  39.892  138.200 1.00 56.44  ? 90   GLN A CA    1 
ATOM   687   C  C     . GLN A 1 91   ? 62.591  39.661  136.879 1.00 56.50  ? 90   GLN A C     1 
ATOM   688   O  O     . GLN A 1 91   ? 62.637  40.568  136.046 1.00 58.30  ? 90   GLN A O     1 
ATOM   689   C  CB    . GLN A 1 91   ? 62.827  40.441  139.263 1.00 56.88  ? 90   GLN A CB    1 
ATOM   690   C  CG    . GLN A 1 91   ? 63.700  41.569  138.784 1.00 60.09  ? 90   GLN A CG    1 
ATOM   691   C  CD    . GLN A 1 91   ? 65.154  41.179  138.741 1.00 61.45  ? 90   GLN A CD    1 
ATOM   692   O  OE1   . GLN A 1 91   ? 65.531  40.116  139.226 1.00 60.47  ? 90   GLN A OE1   1 
ATOM   693   N  NE2   . GLN A 1 91   ? 65.982  42.028  138.146 1.00 64.64  ? 90   GLN A NE2   1 
ATOM   694   N  N     . LEU A 1 92   ? 63.130  38.457  136.660 1.00 55.20  ? 91   LEU A N     1 
ATOM   695   C  CA    . LEU A 1 92   ? 63.733  38.148  135.368 1.00 55.82  ? 91   LEU A CA    1 
ATOM   696   C  C     . LEU A 1 92   ? 62.665  37.966  134.299 1.00 55.60  ? 91   LEU A C     1 
ATOM   697   O  O     . LEU A 1 92   ? 62.939  38.122  133.107 1.00 56.69  ? 91   LEU A O     1 
ATOM   698   C  CB    . LEU A 1 92   ? 64.609  36.901  135.476 1.00 54.62  ? 91   LEU A CB    1 
ATOM   699   C  CG    . LEU A 1 92   ? 65.611  36.957  136.623 1.00 54.69  ? 91   LEU A CG    1 
ATOM   700   C  CD1   . LEU A 1 92   ? 66.155  35.558  136.932 1.00 53.12  ? 91   LEU A CD1   1 
ATOM   701   C  CD2   . LEU A 1 92   ? 66.740  37.956  136.314 1.00 56.95  ? 91   LEU A CD2   1 
ATOM   702   N  N     . ARG A 1 93   ? 61.452  37.627  134.714 1.00 54.28  ? 92   ARG A N     1 
ATOM   703   C  CA    . ARG A 1 93   ? 60.303  37.628  133.834 1.00 54.27  ? 92   ARG A CA    1 
ATOM   704   C  C     . ARG A 1 93   ? 59.869  39.026  133.433 1.00 56.79  ? 92   ARG A C     1 
ATOM   705   O  O     . ARG A 1 93   ? 59.128  39.179  132.452 1.00 58.01  ? 92   ARG A O     1 
ATOM   706   C  CB    . ARG A 1 93   ? 59.164  36.925  134.535 1.00 52.45  ? 92   ARG A CB    1 
ATOM   707   C  CG    . ARG A 1 93   ? 59.331  35.441  134.552 1.00 50.62  ? 92   ARG A CG    1 
ATOM   708   C  CD    . ARG A 1 93   ? 58.106  34.813  134.055 1.00 49.67  ? 92   ARG A CD    1 
ATOM   709   N  NE    . ARG A 1 93   ? 56.883  35.330  134.631 1.00 49.59  ? 92   ARG A NE    1 
ATOM   710   C  CZ    . ARG A 1 93   ? 56.355  34.785  135.704 1.00 48.20  ? 92   ARG A CZ    1 
ATOM   711   N  NH1   . ARG A 1 93   ? 56.989  33.767  136.270 1.00 46.88  ? 92   ARG A NH1   1 
ATOM   712   N  NH2   . ARG A 1 93   ? 55.205  35.231  136.200 1.00 48.22  ? 92   ARG A NH2   1 
ATOM   713   N  N     . VAL A 1 94   ? 60.299  40.040  134.169 1.00 57.46  ? 93   VAL A N     1 
ATOM   714   C  CA    . VAL A 1 94   ? 60.069  41.418  133.789 1.00 59.66  ? 93   VAL A CA    1 
ATOM   715   C  C     . VAL A 1 94   ? 61.269  41.994  133.051 1.00 61.54  ? 93   VAL A C     1 
ATOM   716   O  O     . VAL A 1 94   ? 61.105  42.669  132.035 1.00 63.18  ? 93   VAL A O     1 
ATOM   717   C  CB    . VAL A 1 94   ? 59.709  42.248  135.038 1.00 60.09  ? 93   VAL A CB    1 
ATOM   718   C  CG1   . VAL A 1 94   ? 59.342  43.657  134.655 1.00 62.45  ? 93   VAL A CG1   1 
ATOM   719   C  CG2   . VAL A 1 94   ? 58.557  41.581  135.786 1.00 58.21  ? 93   VAL A CG2   1 
ATOM   720   N  N     . LYS A 1 95   ? 62.482  41.700  133.525 1.00 61.40  ? 94   LYS A N     1 
ATOM   721   C  CA    . LYS A 1 95   ? 63.681  42.137  132.817 1.00 63.19  ? 94   LYS A CA    1 
ATOM   722   C  C     . LYS A 1 95   ? 63.723  41.562  131.406 1.00 63.58  ? 94   LYS A C     1 
ATOM   723   O  O     . LYS A 1 95   ? 63.991  42.282  130.436 1.00 67.16  ? 94   LYS A O     1 
ATOM   724   C  CB    . LYS A 1 95   ? 64.930  41.731  133.599 1.00 63.69  ? 94   LYS A CB    1 
ATOM   725   C  CG    . LYS A 1 95   ? 66.217  42.400  133.122 1.00 66.97  ? 94   LYS A CG    1 
ATOM   726   C  CD    . LYS A 1 95   ? 67.438  41.563  133.490 1.00 68.43  ? 94   LYS A CD    1 
ATOM   727   C  CE    . LYS A 1 95   ? 68.742  42.233  133.081 1.00 71.27  ? 94   LYS A CE    1 
ATOM   728   N  NZ    . LYS A 1 95   ? 69.307  43.104  134.153 1.00 72.55  ? 94   LYS A NZ    1 
ATOM   729   N  N     . GLY A 1 96   ? 63.451  40.263  131.271 1.00 61.23  ? 95   GLY A N     1 
ATOM   730   C  CA    . GLY A 1 96   ? 63.463  39.626  129.967 1.00 61.22  ? 95   GLY A CA    1 
ATOM   731   C  C     . GLY A 1 96   ? 62.456  40.205  129.002 1.00 62.19  ? 95   GLY A C     1 
ATOM   732   O  O     . GLY A 1 96   ? 62.594  40.022  127.790 1.00 62.91  ? 95   GLY A O     1 
ATOM   733   N  N     . LEU A 1 97   ? 61.449  40.909  129.519 1.00 62.33  ? 96   LEU A N     1 
ATOM   734   C  CA    . LEU A 1 97   ? 60.448  41.546  128.675 1.00 63.43  ? 96   LEU A CA    1 
ATOM   735   C  C     . LEU A 1 97   ? 61.057  42.637  127.797 1.00 66.10  ? 96   LEU A C     1 
ATOM   736   O  O     . LEU A 1 97   ? 60.550  42.907  126.704 1.00 67.14  ? 96   LEU A O     1 
ATOM   737   C  CB    . LEU A 1 97   ? 59.348  42.117  129.568 1.00 63.19  ? 96   LEU A CB    1 
ATOM   738   C  CG    . LEU A 1 97   ? 57.878  41.988  129.205 1.00 62.68  ? 96   LEU A CG    1 
ATOM   739   C  CD1   . LEU A 1 97   ? 57.540  40.548  128.899 1.00 60.57  ? 96   LEU A CD1   1 
ATOM   740   C  CD2   . LEU A 1 97   ? 57.039  42.491  130.367 1.00 62.41  ? 96   LEU A CD2   1 
ATOM   741   N  N     . THR A 1 98   ? 62.140  43.274  128.252 1.00 67.34  ? 97   THR A N     1 
ATOM   742   C  CA    . THR A 1 98   ? 62.751  44.372  127.512 1.00 70.07  ? 97   THR A CA    1 
ATOM   743   C  C     . THR A 1 98   ? 64.262  44.224  127.372 1.00 70.84  ? 97   THR A C     1 
ATOM   744   O  O     . THR A 1 98   ? 64.840  44.706  126.396 1.00 72.81  ? 97   THR A O     1 
ATOM   745   C  CB    . THR A 1 98   ? 62.457  45.717  128.178 1.00 71.70  ? 97   THR A CB    1 
ATOM   746   O  OG1   . THR A 1 98   ? 63.193  45.808  129.402 1.00 71.36  ? 97   THR A OG1   1 
ATOM   747   C  CG2   . THR A 1 98   ? 60.972  45.887  128.464 1.00 71.02  ? 97   THR A CG2   1 
ATOM   748   N  N     . ASP A 1 99   ? 64.923  43.593  128.334 1.00 69.46  ? 98   ASP A N     1 
ATOM   749   C  CA    . ASP A 1 99   ? 66.375  43.501  128.309 1.00 70.33  ? 98   ASP A CA    1 
ATOM   750   C  C     . ASP A 1 99   ? 66.821  42.048  128.283 1.00 68.36  ? 98   ASP A C     1 
ATOM   751   O  O     . ASP A 1 99   ? 66.043  41.129  128.548 1.00 66.18  ? 98   ASP A O     1 
ATOM   752   C  CB    . ASP A 1 99   ? 67.019  44.216  129.511 1.00 71.06  ? 98   ASP A CB    1 
ATOM   753   C  CG    . ASP A 1 99   ? 66.617  45.679  129.612 1.00 73.18  ? 98   ASP A CG    1 
ATOM   754   O  OD1   . ASP A 1 99   ? 65.479  45.963  130.038 1.00 72.58  ? 98   ASP A OD1   1 
ATOM   755   O  OD2   . ASP A 1 99   ? 67.447  46.553  129.285 1.00 75.58  ? 98   ASP A OD2   1 
ATOM   756   N  N     . GLU A 1 100  ? 68.102  41.855  127.979 1.00 69.29  ? 99   GLU A N     1 
ATOM   757   C  CA    . GLU A 1 100  ? 68.618  40.512  127.766 1.00 67.86  ? 99   GLU A CA    1 
ATOM   758   C  C     . GLU A 1 100  ? 68.874  39.802  129.092 1.00 65.99  ? 99   GLU A C     1 
ATOM   759   O  O     . GLU A 1 100  ? 69.241  40.422  130.096 1.00 66.43  ? 99   GLU A O     1 
ATOM   760   C  CB    . GLU A 1 100  ? 69.897  40.543  126.920 1.00 69.70  ? 99   GLU A CB    1 
ATOM   761   C  CG    . GLU A 1 100  ? 70.641  39.201  126.814 1.00 68.53  ? 99   GLU A CG    1 
ATOM   762   C  CD    . GLU A 1 100  ? 71.933  39.309  126.019 1.00 70.60  ? 99   GLU A CD    1 
ATOM   763   O  OE1   . GLU A 1 100  ? 72.506  38.270  125.638 1.00 70.08  ? 99   GLU A OE1   1 
ATOM   764   O  OE2   . GLU A 1 100  ? 72.380  40.444  125.771 1.00 72.89  ? 99   GLU A OE2   1 
ATOM   765   N  N     . LEU A 1 101  ? 68.657  38.489  129.074 1.00 63.98  ? 100  LEU A N     1 
ATOM   766   C  CA    . LEU A 1 101  ? 68.851  37.547  130.158 1.00 62.04  ? 100  LEU A CA    1 
ATOM   767   C  C     . LEU A 1 101  ? 69.923  36.541  129.775 1.00 61.95  ? 100  LEU A C     1 
ATOM   768   O  O     . LEU A 1 101  ? 70.161  36.271  128.598 1.00 62.74  ? 100  LEU A O     1 
ATOM   769   C  CB    . LEU A 1 101  ? 67.561  36.780  130.469 1.00 59.78  ? 100  LEU A CB    1 
ATOM   770   C  CG    . LEU A 1 101  ? 66.246  37.516  130.681 1.00 59.61  ? 100  LEU A CG    1 
ATOM   771   C  CD1   . LEU A 1 101  ? 65.118  36.539  131.044 1.00 57.30  ? 100  LEU A CD1   1 
ATOM   772   C  CD2   . LEU A 1 101  ? 66.426  38.583  131.756 1.00 60.43  ? 100  LEU A CD2   1 
ATOM   773   N  N     . SER A 1 102  ? 70.551  35.969  130.792 1.00 64.41  ? 101  SER A N     1 
ATOM   774   C  CA    . SER A 1 102  ? 71.379  34.796  130.597 1.00 63.38  ? 101  SER A CA    1 
ATOM   775   C  C     . SER A 1 102  ? 70.497  33.590  130.292 1.00 61.50  ? 101  SER A C     1 
ATOM   776   O  O     . SER A 1 102  ? 69.309  33.556  130.621 1.00 58.42  ? 101  SER A O     1 
ATOM   777   C  CB    . SER A 1 102  ? 72.228  34.537  131.846 1.00 65.14  ? 101  SER A CB    1 
ATOM   778   O  OG    . SER A 1 102  ? 72.832  33.250  131.836 1.00 65.13  ? 101  SER A OG    1 
ATOM   779   N  N     . ASN A 1 103  ? 71.091  32.584  129.649 1.00 58.49  ? 102  ASN A N     1 
ATOM   780   C  CA    . ASN A 1 103  ? 70.346  31.353  129.409 1.00 56.71  ? 102  ASN A CA    1 
ATOM   781   C  C     . ASN A 1 103  ? 69.889  30.726  130.715 1.00 54.70  ? 102  ASN A C     1 
ATOM   782   O  O     . ASN A 1 103  ? 68.793  30.159  130.786 1.00 53.15  ? 102  ASN A O     1 
ATOM   783   C  CB    . ASN A 1 103  ? 71.189  30.360  128.609 1.00 57.16  ? 102  ASN A CB    1 
ATOM   784   C  CG    . ASN A 1 103  ? 71.412  30.798  127.171 1.00 58.98  ? 102  ASN A CG    1 
ATOM   785   O  OD1   . ASN A 1 103  ? 72.086  30.106  126.409 1.00 59.64  ? 102  ASN A OD1   1 
ATOM   786   N  ND2   . ASN A 1 103  ? 70.852  31.948  126.793 1.00 59.91  ? 102  ASN A ND2   1 
ATOM   787   N  N     . GLU A 1 104  ? 70.703  30.842  131.765 1.00 58.09  ? 103  GLU A N     1 
ATOM   788   C  CA    . GLU A 1 104  ? 70.288  30.375  133.080 1.00 55.06  ? 103  GLU A CA    1 
ATOM   789   C  C     . GLU A 1 104  ? 69.171  31.243  133.641 1.00 52.56  ? 103  GLU A C     1 
ATOM   790   O  O     . GLU A 1 104  ? 68.211  30.726  134.222 1.00 50.90  ? 103  GLU A O     1 
ATOM   791   C  CB    . GLU A 1 104  ? 71.487  30.356  134.024 1.00 58.63  ? 103  GLU A CB    1 
ATOM   792   C  CG    . GLU A 1 104  ? 71.159  29.960  135.458 1.00 58.56  ? 103  GLU A CG    1 
ATOM   793   C  CD    . GLU A 1 104  ? 72.397  29.867  136.328 1.00 60.94  ? 103  GLU A CD    1 
ATOM   794   O  OE1   . GLU A 1 104  ? 72.291  30.085  137.555 1.00 61.94  ? 103  GLU A OE1   1 
ATOM   795   O  OE2   . GLU A 1 104  ? 73.482  29.585  135.778 1.00 63.36  ? 103  GLU A OE2   1 
ATOM   796   N  N     . GLU A 1 105  ? 69.271  32.564  133.480 1.00 58.18  ? 104  GLU A N     1 
ATOM   797   C  CA    . GLU A 1 105  ? 68.180  33.430  133.912 1.00 58.08  ? 104  GLU A CA    1 
ATOM   798   C  C     . GLU A 1 105  ? 66.914  33.174  133.109 1.00 56.28  ? 104  GLU A C     1 
ATOM   799   O  O     . GLU A 1 105  ? 65.807  33.265  133.655 1.00 55.00  ? 104  GLU A O     1 
ATOM   800   C  CB    . GLU A 1 105  ? 68.575  34.893  133.781 1.00 64.15  ? 104  GLU A CB    1 
ATOM   801   C  CG    . GLU A 1 105  ? 69.765  35.305  134.615 1.00 68.25  ? 104  GLU A CG    1 
ATOM   802   C  CD    . GLU A 1 105  ? 70.113  36.764  134.407 1.00 71.27  ? 104  GLU A CD    1 
ATOM   803   O  OE1   . GLU A 1 105  ? 70.511  37.428  135.387 1.00 72.21  ? 104  GLU A OE1   1 
ATOM   804   O  OE2   . GLU A 1 105  ? 69.974  37.249  133.260 1.00 73.10  ? 104  GLU A OE2   1 
ATOM   805   N  N     . LEU A 1 106  ? 67.056  32.853  131.819 1.00 53.78  ? 105  LEU A N     1 
ATOM   806   C  CA    . LEU A 1 106  ? 65.888  32.551  130.999 1.00 53.17  ? 105  LEU A CA    1 
ATOM   807   C  C     . LEU A 1 106  ? 65.253  31.230  131.410 1.00 51.06  ? 105  LEU A C     1 
ATOM   808   O  O     . LEU A 1 106  ? 64.025  31.121  131.500 1.00 50.09  ? 105  LEU A O     1 
ATOM   809   C  CB    . LEU A 1 106  ? 66.278  32.516  129.521 1.00 54.48  ? 105  LEU A CB    1 
ATOM   810   C  CG    . LEU A 1 106  ? 65.136  32.085  128.610 1.00 53.90  ? 105  LEU A CG    1 
ATOM   811   C  CD1   . LEU A 1 106  ? 64.238  33.276  128.328 1.00 54.80  ? 105  LEU A CD1   1 
ATOM   812   C  CD2   . LEU A 1 106  ? 65.669  31.485  127.325 1.00 54.66  ? 105  LEU A CD2   1 
ATOM   813   N  N     . PHE A 1 107  ? 66.080  30.217  131.667 1.00 50.47  ? 106  PHE A N     1 
ATOM   814   C  CA    . PHE A 1 107  ? 65.575  28.921  132.099 1.00 48.62  ? 106  PHE A CA    1 
ATOM   815   C  C     . PHE A 1 107  ? 64.880  29.013  133.451 1.00 47.35  ? 106  PHE A C     1 
ATOM   816   O  O     . PHE A 1 107  ? 63.887  28.318  133.688 1.00 45.96  ? 106  PHE A O     1 
ATOM   817   C  CB    . PHE A 1 107  ? 66.715  27.905  132.142 1.00 48.54  ? 106  PHE A CB    1 
ATOM   818   C  CG    . PHE A 1 107  ? 66.333  26.601  132.777 1.00 46.79  ? 106  PHE A CG    1 
ATOM   819   C  CD1   . PHE A 1 107  ? 65.590  25.677  132.082 1.00 46.02  ? 106  PHE A CD1   1 
ATOM   820   C  CD2   . PHE A 1 107  ? 66.721  26.294  134.068 1.00 46.01  ? 106  PHE A CD2   1 
ATOM   821   C  CE1   . PHE A 1 107  ? 65.235  24.473  132.650 1.00 44.56  ? 106  PHE A CE1   1 
ATOM   822   C  CE2   . PHE A 1 107  ? 66.359  25.078  134.639 1.00 44.52  ? 106  PHE A CE2   1 
ATOM   823   C  CZ    . PHE A 1 107  ? 65.615  24.177  133.919 1.00 43.82  ? 106  PHE A CZ    1 
ATOM   824   N  N     . ILE A 1 108  ? 65.393  29.853  134.355 1.00 47.91  ? 107  ILE A N     1 
ATOM   825   C  CA    . ILE A 1 108  ? 64.708  30.089  135.624 1.00 46.93  ? 107  ILE A CA    1 
ATOM   826   C  C     . ILE A 1 108  ? 63.379  30.794  135.394 1.00 46.94  ? 107  ILE A C     1 
ATOM   827   O  O     . ILE A 1 108  ? 62.365  30.456  136.014 1.00 45.70  ? 107  ILE A O     1 
ATOM   828   C  CB    . ILE A 1 108  ? 65.610  30.891  136.583 1.00 47.77  ? 107  ILE A CB    1 
ATOM   829   C  CG1   . ILE A 1 108  ? 66.784  30.039  137.066 1.00 47.49  ? 107  ILE A CG1   1 
ATOM   830   C  CG2   . ILE A 1 108  ? 64.820  31.423  137.761 1.00 47.17  ? 107  ILE A CG2   1 
ATOM   831   C  CD1   . ILE A 1 108  ? 67.900  30.844  137.648 1.00 48.78  ? 107  ILE A CD1   1 
ATOM   832   N  N     . ALA A 1 109  ? 63.356  31.783  134.500 1.00 48.45  ? 108  ALA A N     1 
ATOM   833   C  CA    . ALA A 1 109  ? 62.121  32.520  134.245 1.00 48.70  ? 108  ALA A CA    1 
ATOM   834   C  C     . ALA A 1 109  ? 61.055  31.637  133.603 1.00 47.61  ? 108  ALA A C     1 
ATOM   835   O  O     . ALA A 1 109  ? 59.867  31.766  133.920 1.00 47.00  ? 108  ALA A O     1 
ATOM   836   C  CB    . ALA A 1 109  ? 62.408  33.733  133.365 1.00 50.73  ? 108  ALA A CB    1 
ATOM   837   N  N     . LEU A 1 110  ? 61.454  30.734  132.701 1.00 47.44  ? 109  LEU A N     1 
ATOM   838   C  CA    . LEU A 1 110  ? 60.471  29.903  132.010 1.00 46.59  ? 109  LEU A CA    1 
ATOM   839   C  C     . LEU A 1 110  ? 60.026  28.720  132.858 1.00 44.76  ? 109  LEU A C     1 
ATOM   840   O  O     . LEU A 1 110  ? 58.862  28.310  132.785 1.00 47.35  ? 109  LEU A O     1 
ATOM   841   C  CB    . LEU A 1 110  ? 61.019  29.411  130.668 1.00 47.29  ? 109  LEU A CB    1 
ATOM   842   C  CG    . LEU A 1 110  ? 61.507  30.471  129.687 1.00 49.24  ? 109  LEU A CG    1 
ATOM   843   C  CD1   . LEU A 1 110  ? 62.314  29.832  128.554 1.00 49.90  ? 109  LEU A CD1   1 
ATOM   844   C  CD2   . LEU A 1 110  ? 60.334  31.286  129.159 1.00 49.84  ? 109  LEU A CD2   1 
ATOM   845   N  N     . LYS A 1 111  ? 60.941  28.155  133.653 1.00 44.49  ? 110  LYS A N     1 
ATOM   846   C  CA    . LYS A 1 111  ? 60.581  27.061  134.550 1.00 43.70  ? 110  LYS A CA    1 
ATOM   847   C  C     . LYS A 1 111  ? 59.603  27.524  135.614 1.00 41.95  ? 110  LYS A C     1 
ATOM   848   O  O     . LYS A 1 111  ? 58.668  26.800  135.975 1.00 40.79  ? 110  LYS A O     1 
ATOM   849   C  CB    . LYS A 1 111  ? 61.834  26.482  135.196 1.00 42.39  ? 110  LYS A CB    1 
ATOM   850   C  CG    . LYS A 1 111  ? 61.537  25.498  136.293 1.00 40.90  ? 110  LYS A CG    1 
ATOM   851   C  CD    . LYS A 1 111  ? 62.814  25.032  136.948 1.00 41.41  ? 110  LYS A CD    1 
ATOM   852   C  CE    . LYS A 1 111  ? 62.681  23.610  137.467 1.00 39.67  ? 110  LYS A CE    1 
ATOM   853   N  NZ    . LYS A 1 111  ? 64.005  22.945  137.626 1.00 39.91  ? 110  LYS A NZ    1 
ATOM   854   N  N     . ASN A 1 112  ? 59.816  28.722  136.140 1.00 42.79  ? 111  ASN A N     1 
ATOM   855   C  CA    . ASN A 1 112  ? 58.858  29.287  137.075 1.00 42.44  ? 111  ASN A CA    1 
ATOM   856   C  C     . ASN A 1 112  ? 57.491  29.445  136.429 1.00 42.43  ? 111  ASN A C     1 
ATOM   857   O  O     . ASN A 1 112  ? 56.460  29.221  137.070 1.00 41.60  ? 111  ASN A O     1 
ATOM   858   C  CB    . ASN A 1 112  ? 59.373  30.631  137.583 1.00 43.68  ? 111  ASN A CB    1 
ATOM   859   C  CG    . ASN A 1 112  ? 58.320  31.418  138.300 1.00 43.75  ? 111  ASN A CG    1 
ATOM   860   O  OD1   . ASN A 1 112  ? 57.845  32.432  137.806 1.00 44.90  ? 111  ASN A OD1   1 
ATOM   861   N  ND2   . ASN A 1 112  ? 57.920  30.934  139.466 1.00 42.61  ? 111  ASN A ND2   1 
ATOM   862   N  N     . MET A 1 113  ? 57.464  29.814  135.148 1.00 45.69  ? 112  MET A N     1 
ATOM   863   C  CA    . MET A 1 113  ? 56.200  30.048  134.455 1.00 44.72  ? 112  MET A CA    1 
ATOM   864   C  C     . MET A 1 113  ? 55.446  28.743  134.233 1.00 44.41  ? 112  MET A C     1 
ATOM   865   O  O     . MET A 1 113  ? 54.224  28.684  134.402 1.00 42.99  ? 112  MET A O     1 
ATOM   866   C  CB    . MET A 1 113  ? 56.483  30.753  133.131 1.00 47.27  ? 112  MET A CB    1 
ATOM   867   C  CG    . MET A 1 113  ? 55.417  31.711  132.648 1.00 47.80  ? 112  MET A CG    1 
ATOM   868   S  SD    . MET A 1 113  ? 56.153  33.158  131.879 1.00 48.43  ? 112  MET A SD    1 
ATOM   869   C  CE    . MET A 1 113  ? 57.708  32.515  131.294 1.00 48.58  ? 112  MET A CE    1 
ATOM   870   N  N     . VAL A 1 114  ? 56.169  27.678  133.892 1.00 41.81  ? 113  VAL A N     1 
ATOM   871   C  CA    . VAL A 1 114  ? 55.572  26.382  133.605 1.00 40.76  ? 113  VAL A CA    1 
ATOM   872   C  C     . VAL A 1 114  ? 54.953  25.727  134.839 1.00 39.42  ? 113  VAL A C     1 
ATOM   873   O  O     . VAL A 1 114  ? 54.058  24.877  134.707 1.00 38.68  ? 113  VAL A O     1 
ATOM   874   C  CB    . VAL A 1 114  ? 56.657  25.494  132.961 1.00 40.77  ? 113  VAL A CB    1 
ATOM   875   C  CG1   . VAL A 1 114  ? 56.856  24.194  133.724 1.00 39.47  ? 113  VAL A CG1   1 
ATOM   876   C  CG2   . VAL A 1 114  ? 56.340  25.236  131.516 1.00 41.37  ? 113  VAL A CG2   1 
ATOM   877   N  N     . LYS A 1 115  ? 55.392  26.102  136.043 1.00 39.77  ? 114  LYS A N     1 
ATOM   878   C  CA    . LYS A 1 115  ? 54.862  25.504  137.256 1.00 39.13  ? 114  LYS A CA    1 
ATOM   879   C  C     . LYS A 1 115  ? 53.597  26.177  137.755 1.00 38.08  ? 114  LYS A C     1 
ATOM   880   O  O     . LYS A 1 115  ? 52.976  25.672  138.693 1.00 37.20  ? 114  LYS A O     1 
ATOM   881   C  CB    . LYS A 1 115  ? 55.915  25.539  138.366 1.00 45.09  ? 114  LYS A CB    1 
ATOM   882   C  CG    . LYS A 1 115  ? 57.223  24.880  137.971 1.00 50.30  ? 114  LYS A CG    1 
ATOM   883   C  CD    . LYS A 1 115  ? 58.332  25.183  138.952 1.00 52.03  ? 114  LYS A CD    1 
ATOM   884   C  CE    . LYS A 1 115  ? 58.257  24.283  140.166 1.00 54.17  ? 114  LYS A CE    1 
ATOM   885   N  NZ    . LYS A 1 115  ? 57.086  24.574  141.043 1.00 55.23  ? 114  LYS A NZ    1 
ATOM   886   N  N     . HIS A 1 116  ? 53.212  27.310  137.172 1.00 39.20  ? 115  HIS A N     1 
ATOM   887   C  CA    . HIS A 1 116  ? 51.986  27.997  137.523 1.00 39.49  ? 115  HIS A CA    1 
ATOM   888   C  C     . HIS A 1 116  ? 51.458  28.633  136.244 1.00 40.61  ? 115  HIS A C     1 
ATOM   889   O  O     . HIS A 1 116  ? 51.544  29.839  136.046 1.00 41.84  ? 115  HIS A O     1 
ATOM   890   C  CB    . HIS A 1 116  ? 52.220  29.037  138.617 1.00 40.01  ? 115  HIS A CB    1 
ATOM   891   C  CG    . HIS A 1 116  ? 53.273  28.643  139.599 1.00 39.33  ? 115  HIS A CG    1 
ATOM   892   N  ND1   . HIS A 1 116  ? 53.017  27.816  140.670 1.00 38.17  ? 115  HIS A ND1   1 
ATOM   893   C  CD2   . HIS A 1 116  ? 54.592  28.939  139.658 1.00 39.78  ? 115  HIS A CD2   1 
ATOM   894   C  CE1   . HIS A 1 116  ? 54.130  27.633  141.356 1.00 37.92  ? 115  HIS A CE1   1 
ATOM   895   N  NE2   . HIS A 1 116  ? 55.102  28.299  140.759 1.00 39.24  ? 115  HIS A NE2   1 
ATOM   896   N  N     . ARG A 1 117  ? 50.914  27.794  135.358 1.00 40.26  ? 116  ARG A N     1 
ATOM   897   C  CA    . ARG A 1 117  ? 50.493  28.215  134.031 1.00 41.30  ? 116  ARG A CA    1 
ATOM   898   C  C     . ARG A 1 117  ? 49.025  28.620  133.971 1.00 41.69  ? 116  ARG A C     1 
ATOM   899   O  O     . ARG A 1 117  ? 48.496  28.827  132.878 1.00 42.48  ? 116  ARG A O     1 
ATOM   900   C  CB    . ARG A 1 117  ? 50.799  27.113  133.006 1.00 40.92  ? 116  ARG A CB    1 
ATOM   901   C  CG    . ARG A 1 117  ? 50.309  25.706  133.354 1.00 39.58  ? 116  ARG A CG    1 
ATOM   902   C  CD    . ARG A 1 117  ? 48.964  25.402  132.726 1.00 39.68  ? 116  ARG A CD    1 
ATOM   903   N  NE    . ARG A 1 117  ? 48.580  23.997  132.837 1.00 38.62  ? 116  ARG A NE    1 
ATOM   904   C  CZ    . ARG A 1 117  ? 48.849  23.070  131.924 1.00 38.53  ? 116  ARG A CZ    1 
ATOM   905   N  NH1   . ARG A 1 117  ? 48.449  21.819  132.104 1.00 37.68  ? 116  ARG A NH1   1 
ATOM   906   N  NH2   . ARG A 1 117  ? 49.515  23.396  130.830 1.00 41.23  ? 116  ARG A NH2   1 
ATOM   907   N  N     . GLY A 1 118  ? 48.358  28.737  135.104 1.00 41.25  ? 117  GLY A N     1 
ATOM   908   C  CA    . GLY A 1 118  ? 47.092  29.434  135.157 1.00 42.00  ? 117  GLY A CA    1 
ATOM   909   C  C     . GLY A 1 118  ? 45.914  28.645  134.633 1.00 41.68  ? 117  GLY A C     1 
ATOM   910   O  O     . GLY A 1 118  ? 46.025  27.523  134.158 1.00 40.89  ? 117  GLY A O     1 
ATOM   911   N  N     . ILE A 1 119  ? 44.746  29.269  134.737 1.00 42.44  ? 118  ILE A N     1 
ATOM   912   C  CA    . ILE A 1 119  ? 43.518  28.643  134.280 1.00 42.36  ? 118  ILE A CA    1 
ATOM   913   C  C     . ILE A 1 119  ? 43.354  28.857  132.778 1.00 43.36  ? 118  ILE A C     1 
ATOM   914   O  O     . ILE A 1 119  ? 43.898  29.792  132.183 1.00 44.44  ? 118  ILE A O     1 
ATOM   915   C  CB    . ILE A 1 119  ? 42.299  29.176  135.051 1.00 42.87  ? 118  ILE A CB    1 
ATOM   916   C  CG1   . ILE A 1 119  ? 42.259  30.702  135.010 1.00 44.42  ? 118  ILE A CG1   1 
ATOM   917   C  CG2   . ILE A 1 119  ? 42.297  28.657  136.484 1.00 41.76  ? 118  ILE A CG2   1 
ATOM   918   C  CD1   . ILE A 1 119  ? 40.958  31.283  135.510 1.00 45.28  ? 118  ILE A CD1   1 
ATOM   919   N  N     . SER A 1 120  ? 42.599  27.960  132.156 1.00 43.93  ? 119  SER A N     1 
ATOM   920   C  CA    . SER A 1 120  ? 42.261  28.112  130.753 1.00 48.49  ? 119  SER A CA    1 
ATOM   921   C  C     . SER A 1 120  ? 40.796  27.839  130.459 1.00 51.46  ? 119  SER A C     1 
ATOM   922   O  O     . SER A 1 120  ? 40.405  27.915  129.296 1.00 56.24  ? 119  SER A O     1 
ATOM   923   C  CB    . SER A 1 120  ? 43.130  27.194  129.882 1.00 45.11  ? 119  SER A CB    1 
ATOM   924   O  OG    . SER A 1 120  ? 42.853  25.837  130.155 1.00 42.46  ? 119  SER A OG    1 
ATOM   925   N  N     . TYR A 1 121  ? 39.977  27.538  131.460 1.00 61.31  ? 120  TYR A N     1 
ATOM   926   C  CA    . TYR A 1 121  ? 38.563  27.280  131.228 1.00 65.91  ? 120  TYR A CA    1 
ATOM   927   C  C     . TYR A 1 121  ? 37.829  28.572  130.882 1.00 69.37  ? 120  TYR A C     1 
ATOM   928   O  O     . TYR A 1 121  ? 36.716  28.544  130.350 1.00 70.21  ? 120  TYR A O     1 
ATOM   929   C  CB    . TYR A 1 121  ? 37.924  26.616  132.448 1.00 69.34  ? 120  TYR A CB    1 
ATOM   930   C  CG    . TYR A 1 121  ? 37.796  27.514  133.657 1.00 72.16  ? 120  TYR A CG    1 
ATOM   931   C  CD1   . TYR A 1 121  ? 38.841  27.653  134.560 1.00 71.93  ? 120  TYR A CD1   1 
ATOM   932   C  CD2   . TYR A 1 121  ? 36.621  28.212  133.904 1.00 74.24  ? 120  TYR A CD2   1 
ATOM   933   C  CE1   . TYR A 1 121  ? 38.722  28.474  135.668 1.00 72.69  ? 120  TYR A CE1   1 
ATOM   934   C  CE2   . TYR A 1 121  ? 36.495  29.032  135.012 1.00 74.71  ? 120  TYR A CE2   1 
ATOM   935   C  CZ    . TYR A 1 121  ? 37.545  29.158  135.888 1.00 74.29  ? 120  TYR A CZ    1 
ATOM   936   O  OH    . TYR A 1 121  ? 37.415  29.974  136.987 1.00 76.00  ? 120  TYR A OH    1 
ATOM   937   N  N     . LYS A 1 150  ? 49.911  44.838  131.380 1.00 66.89  ? 149  LYS A N     1 
ATOM   938   C  CA    . LYS A 1 150  ? 50.677  44.265  132.485 1.00 64.78  ? 149  LYS A CA    1 
ATOM   939   C  C     . LYS A 1 150  ? 50.648  42.744  132.454 1.00 60.76  ? 149  LYS A C     1 
ATOM   940   O  O     . LYS A 1 150  ? 49.601  42.129  132.629 1.00 60.53  ? 149  LYS A O     1 
ATOM   941   C  CB    . LYS A 1 150  ? 50.149  44.771  133.827 1.00 66.19  ? 149  LYS A CB    1 
ATOM   942   C  CG    . LYS A 1 150  ? 51.122  45.676  134.564 1.00 67.30  ? 149  LYS A CG    1 
ATOM   943   C  CD    . LYS A 1 150  ? 50.429  46.468  135.667 1.00 68.49  ? 149  LYS A CD    1 
ATOM   944   C  CE    . LYS A 1 150  ? 51.381  47.482  136.293 1.00 70.81  ? 149  LYS A CE    1 
ATOM   945   N  NZ    . LYS A 1 150  ? 50.678  48.651  136.899 1.00 73.59  ? 149  LYS A NZ    1 
ATOM   946   N  N     . THR A 1 151  ? 51.807  42.141  132.221 1.00 60.93  ? 150  THR A N     1 
ATOM   947   C  CA    . THR A 1 151  ? 51.890  40.695  132.173 1.00 59.61  ? 150  THR A CA    1 
ATOM   948   C  C     . THR A 1 151  ? 51.731  40.118  133.577 1.00 59.69  ? 150  THR A C     1 
ATOM   949   O  O     . THR A 1 151  ? 52.004  40.801  134.567 1.00 61.71  ? 150  THR A O     1 
ATOM   950   C  CB    . THR A 1 151  ? 53.224  40.250  131.589 1.00 59.46  ? 150  THR A CB    1 
ATOM   951   O  OG1   . THR A 1 151  ? 54.264  40.451  132.555 1.00 58.75  ? 150  THR A OG1   1 
ATOM   952   C  CG2   . THR A 1 151  ? 53.540  41.035  130.335 1.00 61.21  ? 150  THR A CG2   1 
ATOM   953   N  N     . PRO A 1 152  ? 51.280  38.864  133.689 1.00 60.16  ? 151  PRO A N     1 
ATOM   954   C  CA    . PRO A 1 152  ? 51.195  38.231  135.018 1.00 56.94  ? 151  PRO A CA    1 
ATOM   955   C  C     . PRO A 1 152  ? 52.442  38.412  135.866 1.00 57.05  ? 151  PRO A C     1 
ATOM   956   O  O     . PRO A 1 152  ? 52.328  38.742  137.047 1.00 55.65  ? 151  PRO A O     1 
ATOM   957   C  CB    . PRO A 1 152  ? 50.945  36.760  134.670 1.00 56.59  ? 151  PRO A CB    1 
ATOM   958   C  CG    . PRO A 1 152  ? 50.188  36.824  133.390 1.00 58.25  ? 151  PRO A CG    1 
ATOM   959   C  CD    . PRO A 1 152  ? 50.736  37.994  132.631 1.00 59.89  ? 151  PRO A CD    1 
ATOM   960   N  N     . GLY A 1 153  ? 53.629  38.240  135.283 1.00 52.36  ? 152  GLY A N     1 
ATOM   961   C  CA    . GLY A 1 153  ? 54.856  38.414  136.044 1.00 52.42  ? 152  GLY A CA    1 
ATOM   962   C  C     . GLY A 1 153  ? 54.974  39.786  136.678 1.00 54.10  ? 152  GLY A C     1 
ATOM   963   O  O     . GLY A 1 153  ? 55.392  39.910  137.831 1.00 53.82  ? 152  GLY A O     1 
ATOM   964   N  N     . GLN A 1 154  ? 54.600  40.833  135.940 1.00 55.96  ? 153  GLN A N     1 
ATOM   965   C  CA    . GLN A 1 154  ? 54.668  42.185  136.483 1.00 57.81  ? 153  GLN A CA    1 
ATOM   966   C  C     . GLN A 1 154  ? 53.643  42.395  137.584 1.00 57.48  ? 153  GLN A C     1 
ATOM   967   O  O     . GLN A 1 154  ? 53.886  43.164  138.520 1.00 58.35  ? 153  GLN A O     1 
ATOM   968   C  CB    . GLN A 1 154  ? 54.473  43.219  135.376 1.00 60.01  ? 153  GLN A CB    1 
ATOM   969   C  CG    . GLN A 1 154  ? 55.547  43.214  134.310 1.00 60.78  ? 153  GLN A CG    1 
ATOM   970   C  CD    . GLN A 1 154  ? 55.201  44.117  133.130 1.00 62.88  ? 153  GLN A CD    1 
ATOM   971   O  OE1   . GLN A 1 154  ? 55.958  45.028  132.783 1.00 64.81  ? 153  GLN A OE1   1 
ATOM   972   N  NE2   . GLN A 1 154  ? 54.052  43.867  132.512 1.00 62.61  ? 153  GLN A NE2   1 
ATOM   973   N  N     . ILE A 1 155  ? 52.479  41.753  137.472 1.00 56.40  ? 154  ILE A N     1 
ATOM   974   C  CA    . ILE A 1 155  ? 51.500  41.823  138.549 1.00 56.00  ? 154  ILE A CA    1 
ATOM   975   C  C     . ILE A 1 155  ? 52.004  41.057  139.754 1.00 54.96  ? 154  ILE A C     1 
ATOM   976   O  O     . ILE A 1 155  ? 51.861  41.498  140.899 1.00 55.55  ? 154  ILE A O     1 
ATOM   977   C  CB    . ILE A 1 155  ? 50.135  41.294  138.079 1.00 55.38  ? 154  ILE A CB    1 
ATOM   978   C  CG1   . ILE A 1 155  ? 49.596  42.162  136.936 1.00 57.30  ? 154  ILE A CG1   1 
ATOM   979   C  CG2   . ILE A 1 155  ? 49.151  41.256  139.235 1.00 54.91  ? 154  ILE A CG2   1 
ATOM   980   C  CD1   . ILE A 1 155  ? 49.152  41.378  135.728 1.00 57.78  ? 154  ILE A CD1   1 
ATOM   981   N  N     . GLN A 1 156  ? 52.613  39.899  139.513 1.00 52.72  ? 155  GLN A N     1 
ATOM   982   C  CA    . GLN A 1 156  ? 53.144  39.108  140.610 1.00 51.19  ? 155  GLN A CA    1 
ATOM   983   C  C     . GLN A 1 156  ? 54.295  39.838  141.286 1.00 52.14  ? 155  GLN A C     1 
ATOM   984   O  O     . GLN A 1 156  ? 54.278  40.043  142.502 1.00 52.03  ? 155  GLN A O     1 
ATOM   985   C  CB    . GLN A 1 156  ? 53.563  37.733  140.091 1.00 49.50  ? 155  GLN A CB    1 
ATOM   986   C  CG    . GLN A 1 156  ? 52.369  36.911  139.592 1.00 48.48  ? 155  GLN A CG    1 
ATOM   987   C  CD    . GLN A 1 156  ? 52.759  35.636  138.867 1.00 47.15  ? 155  GLN A CD    1 
ATOM   988   O  OE1   . GLN A 1 156  ? 53.695  35.613  138.076 1.00 47.56  ? 155  GLN A OE1   1 
ATOM   989   N  NE2   . GLN A 1 156  ? 52.037  34.568  139.142 1.00 45.67  ? 155  GLN A NE2   1 
ATOM   990   N  N     . LEU A 1 157  ? 55.275  40.299  140.506 1.00 53.26  ? 156  LEU A N     1 
ATOM   991   C  CA    . LEU A 1 157  ? 56.416  40.995  141.091 1.00 54.32  ? 156  LEU A CA    1 
ATOM   992   C  C     . LEU A 1 157  ? 55.980  42.199  141.916 1.00 55.81  ? 156  LEU A C     1 
ATOM   993   O  O     . LEU A 1 157  ? 56.515  42.441  143.007 1.00 55.94  ? 156  LEU A O     1 
ATOM   994   C  CB    . LEU A 1 157  ? 57.386  41.431  140.001 1.00 55.65  ? 156  LEU A CB    1 
ATOM   995   C  CG    . LEU A 1 157  ? 58.640  42.124  140.529 1.00 56.89  ? 156  LEU A CG    1 
ATOM   996   C  CD1   . LEU A 1 157  ? 59.263  41.365  141.720 1.00 55.45  ? 156  LEU A CD1   1 
ATOM   997   C  CD2   . LEU A 1 157  ? 59.649  42.308  139.408 1.00 57.99  ? 156  LEU A CD2   1 
ATOM   998   N  N     . GLU A 1 158  ? 55.016  42.971  141.414 1.00 59.35  ? 157  GLU A N     1 
ATOM   999   C  CA    . GLU A 1 158  ? 54.534  44.111  142.184 1.00 61.70  ? 157  GLU A CA    1 
ATOM   1000  C  C     . GLU A 1 158  ? 53.933  43.679  143.516 1.00 58.96  ? 157  GLU A C     1 
ATOM   1001  O  O     . GLU A 1 158  ? 54.030  44.413  144.499 1.00 59.52  ? 157  GLU A O     1 
ATOM   1002  C  CB    . GLU A 1 158  ? 53.532  44.912  141.363 1.00 60.88  ? 157  GLU A CB    1 
ATOM   1003  C  CG    . GLU A 1 158  ? 54.211  45.816  140.357 1.00 78.13  ? 157  GLU A CG    1 
ATOM   1004  C  CD    . GLU A 1 158  ? 53.228  46.434  139.371 1.00 75.95  ? 157  GLU A CD    1 
ATOM   1005  O  OE1   . GLU A 1 158  ? 52.001  46.291  139.560 1.00 73.74  ? 157  GLU A OE1   1 
ATOM   1006  O  OE2   . GLU A 1 158  ? 53.688  47.063  138.401 1.00 76.27  ? 157  GLU A OE2   1 
ATOM   1007  N  N     . ARG A 1 159  ? 53.324  42.496  143.576 1.00 55.41  ? 158  ARG A N     1 
ATOM   1008  C  CA    . ARG A 1 159  ? 52.845  41.987  144.855 1.00 54.23  ? 158  ARG A CA    1 
ATOM   1009  C  C     . ARG A 1 159  ? 54.003  41.554  145.734 1.00 53.42  ? 158  ARG A C     1 
ATOM   1010  O  O     . ARG A 1 159  ? 53.949  41.681  146.962 1.00 53.35  ? 158  ARG A O     1 
ATOM   1011  C  CB    . ARG A 1 159  ? 51.919  40.806  144.632 1.00 52.42  ? 158  ARG A CB    1 
ATOM   1012  C  CG    . ARG A 1 159  ? 50.564  41.171  144.137 1.00 53.14  ? 158  ARG A CG    1 
ATOM   1013  C  CD    . ARG A 1 159  ? 50.038  40.039  143.343 1.00 51.65  ? 158  ARG A CD    1 
ATOM   1014  N  NE    . ARG A 1 159  ? 48.655  40.220  142.948 1.00 52.16  ? 158  ARG A NE    1 
ATOM   1015  C  CZ    . ARG A 1 159  ? 47.834  39.213  142.667 1.00 50.87  ? 158  ARG A CZ    1 
ATOM   1016  N  NH1   . ARG A 1 159  ? 48.260  37.941  142.732 1.00 48.98  ? 158  ARG A NH1   1 
ATOM   1017  N  NH2   . ARG A 1 159  ? 46.570  39.464  142.317 1.00 51.56  ? 158  ARG A NH2   1 
ATOM   1018  N  N     . TYR A 1 160  ? 55.034  40.990  145.114 1.00 52.81  ? 159  TYR A N     1 
ATOM   1019  C  CA    . TYR A 1 160  ? 56.246  40.649  145.836 1.00 52.31  ? 159  TYR A CA    1 
ATOM   1020  C  C     . TYR A 1 160  ? 56.851  41.879  146.491 1.00 54.17  ? 159  TYR A C     1 
ATOM   1021  O  O     . TYR A 1 160  ? 57.279  41.831  147.645 1.00 53.95  ? 159  TYR A O     1 
ATOM   1022  C  CB    . TYR A 1 160  ? 57.230  40.015  144.863 1.00 51.82  ? 159  TYR A CB    1 
ATOM   1023  C  CG    . TYR A 1 160  ? 58.250  39.130  145.488 1.00 50.64  ? 159  TYR A CG    1 
ATOM   1024  C  CD1   . TYR A 1 160  ? 58.327  38.994  146.861 1.00 50.14  ? 159  TYR A CD1   1 
ATOM   1025  C  CD2   . TYR A 1 160  ? 59.148  38.430  144.705 1.00 50.14  ? 159  TYR A CD2   1 
ATOM   1026  C  CE1   . TYR A 1 160  ? 59.270  38.189  147.436 1.00 49.16  ? 159  TYR A CE1   1 
ATOM   1027  C  CE2   . TYR A 1 160  ? 60.096  37.620  145.276 1.00 49.20  ? 159  TYR A CE2   1 
ATOM   1028  C  CZ    . TYR A 1 160  ? 60.155  37.507  146.643 1.00 48.71  ? 159  TYR A CZ    1 
ATOM   1029  O  OH    . TYR A 1 160  ? 61.102  36.698  147.217 1.00 47.87  ? 159  TYR A OH    1 
ATOM   1030  N  N     . GLN A 1 161  ? 56.888  42.994  145.770 1.00 56.13  ? 160  GLN A N     1 
ATOM   1031  C  CA    . GLN A 1 161  ? 57.567  44.174  146.272 1.00 58.12  ? 160  GLN A CA    1 
ATOM   1032  C  C     . GLN A 1 161  ? 56.726  44.905  147.306 1.00 58.96  ? 160  GLN A C     1 
ATOM   1033  O  O     . GLN A 1 161  ? 57.228  45.271  148.373 1.00 59.49  ? 160  GLN A O     1 
ATOM   1034  C  CB    . GLN A 1 161  ? 57.918  45.100  145.113 1.00 60.07  ? 160  GLN A CB    1 
ATOM   1035  C  CG    . GLN A 1 161  ? 58.793  44.458  144.067 1.00 59.51  ? 160  GLN A CG    1 
ATOM   1036  C  CD    . GLN A 1 161  ? 58.805  45.243  142.780 1.00 61.28  ? 160  GLN A CD    1 
ATOM   1037  O  OE1   . GLN A 1 161  ? 57.822  45.891  142.430 1.00 62.26  ? 160  GLN A OE1   1 
ATOM   1038  N  NE2   . GLN A 1 161  ? 59.924  45.202  142.072 1.00 61.83  ? 160  GLN A NE2   1 
ATOM   1039  N  N     . THR A 1 162  ? 55.445  45.119  147.024 1.00 59.18  ? 161  THR A N     1 
ATOM   1040  C  CA    . THR A 1 162  ? 54.659  45.995  147.881 1.00 60.47  ? 161  THR A CA    1 
ATOM   1041  C  C     . THR A 1 162  ? 54.001  45.272  149.051 1.00 58.96  ? 161  THR A C     1 
ATOM   1042  O  O     . THR A 1 162  ? 53.632  45.932  150.028 1.00 59.99  ? 161  THR A O     1 
ATOM   1043  C  CB    . THR A 1 162  ? 53.594  46.738  147.062 1.00 61.88  ? 161  THR A CB    1 
ATOM   1044  O  OG1   . THR A 1 162  ? 52.511  45.857  146.771 1.00 60.32  ? 161  THR A OG1   1 
ATOM   1045  C  CG2   . THR A 1 162  ? 54.182  47.251  145.753 1.00 63.14  ? 161  THR A CG2   1 
ATOM   1046  N  N     . TYR A 1 163  ? 53.847  43.945  148.988 1.00 56.68  ? 162  TYR A N     1 
ATOM   1047  C  CA    . TYR A 1 163  ? 53.286  43.165  150.087 1.00 55.23  ? 162  TYR A CA    1 
ATOM   1048  C  C     . TYR A 1 163  ? 54.151  41.999  150.534 1.00 53.34  ? 162  TYR A C     1 
ATOM   1049  O  O     . TYR A 1 163  ? 53.721  41.249  151.412 1.00 52.08  ? 162  TYR A O     1 
ATOM   1050  C  CB    . TYR A 1 163  ? 51.899  42.602  149.721 1.00 54.35  ? 162  TYR A CB    1 
ATOM   1051  C  CG    . TYR A 1 163  ? 51.055  43.525  148.886 1.00 56.00  ? 162  TYR A CG    1 
ATOM   1052  C  CD1   . TYR A 1 163  ? 50.689  44.761  149.357 1.00 58.07  ? 162  TYR A CD1   1 
ATOM   1053  C  CD2   . TYR A 1 163  ? 50.636  43.162  147.614 1.00 55.60  ? 162  TYR A CD2   1 
ATOM   1054  C  CE1   . TYR A 1 163  ? 49.927  45.624  148.596 1.00 59.93  ? 162  TYR A CE1   1 
ATOM   1055  C  CE2   . TYR A 1 163  ? 49.860  44.027  146.842 1.00 57.25  ? 162  TYR A CE2   1 
ATOM   1056  C  CZ    . TYR A 1 163  ? 49.509  45.258  147.339 1.00 59.33  ? 162  TYR A CZ    1 
ATOM   1057  O  OH    . TYR A 1 163  ? 48.742  46.141  146.601 1.00 61.31  ? 162  TYR A OH    1 
ATOM   1058  N  N     . GLY A 1 164  ? 55.324  41.797  149.945 1.00 53.20  ? 163  GLY A N     1 
ATOM   1059  C  CA    . GLY A 1 164  ? 56.218  40.750  150.389 1.00 51.66  ? 163  GLY A CA    1 
ATOM   1060  C  C     . GLY A 1 164  ? 55.806  39.323  150.092 1.00 49.52  ? 163  GLY A C     1 
ATOM   1061  O  O     . GLY A 1 164  ? 56.538  38.406  150.467 1.00 48.30  ? 163  GLY A O     1 
ATOM   1062  N  N     . GLN A 1 165  ? 54.696  39.101  149.427 1.00 49.13  ? 164  GLN A N     1 
ATOM   1063  C  CA    . GLN A 1 165  ? 54.311  37.745  149.110 1.00 47.21  ? 164  GLN A CA    1 
ATOM   1064  C  C     . GLN A 1 165  ? 53.464  37.627  147.859 1.00 47.30  ? 164  GLN A C     1 
ATOM   1065  O  O     . GLN A 1 165  ? 52.738  38.520  147.559 1.00 48.72  ? 164  GLN A O     1 
ATOM   1066  C  CB    . GLN A 1 165  ? 53.578  37.162  150.286 1.00 46.18  ? 164  GLN A CB    1 
ATOM   1067  C  CG    . GLN A 1 165  ? 52.322  37.892  150.608 1.00 47.27  ? 164  GLN A CG    1 
ATOM   1068  C  CD    . GLN A 1 165  ? 51.555  37.206  151.673 1.00 46.23  ? 164  GLN A CD    1 
ATOM   1069  O  OE1   . GLN A 1 165  ? 51.498  35.994  151.715 1.00 44.63  ? 164  GLN A OE1   1 
ATOM   1070  N  NE2   . GLN A 1 165  ? 50.968  37.964  152.544 1.00 47.23  ? 164  GLN A NE2   1 
ATOM   1071  N  N     . LEU A 1 166  ? 53.549  36.512  147.138 1.00 45.84  ? 165  LEU A N     1 
ATOM   1072  C  CA    . LEU A 1 166  ? 52.758  36.291  145.926 1.00 45.70  ? 165  LEU A CA    1 
ATOM   1073  C  C     . LEU A 1 166  ? 51.852  35.108  145.929 1.00 44.17  ? 165  LEU A C     1 
ATOM   1074  O  O     . LEU A 1 166  ? 50.800  35.148  145.388 1.00 44.36  ? 165  LEU A O     1 
ATOM   1075  C  CB    . LEU A 1 166  ? 53.659  36.033  144.743 1.00 45.52  ? 165  LEU A CB    1 
ATOM   1076  C  CG    . LEU A 1 166  ? 55.108  35.957  145.050 1.00 46.56  ? 165  LEU A CG    1 
ATOM   1077  C  CD1   . LEU A 1 166  ? 55.751  34.812  144.347 1.00 46.09  ? 165  LEU A CD1   1 
ATOM   1078  C  CD2   . LEU A 1 166  ? 55.661  37.246  144.544 1.00 52.60  ? 165  LEU A CD2   1 
ATOM   1079  N  N     . ARG A 1 167  ? 52.292  34.039  146.544 1.00 42.75  ? 166  ARG A N     1 
ATOM   1080  C  CA    . ARG A 1 167  ? 51.578  32.792  146.539 1.00 41.29  ? 166  ARG A CA    1 
ATOM   1081  C  C     . ARG A 1 167  ? 50.302  32.671  147.298 1.00 41.11  ? 166  ARG A C     1 
ATOM   1082  O  O     . ARG A 1 167  ? 50.083  33.339  148.252 1.00 41.84  ? 166  ARG A O     1 
ATOM   1083  C  CB    . ARG A 1 167  ? 52.517  31.684  146.956 1.00 40.03  ? 166  ARG A CB    1 
ATOM   1084  C  CG    . ARG A 1 167  ? 53.874  31.725  146.313 1.00 40.36  ? 166  ARG A CG    1 
ATOM   1085  C  CD    . ARG A 1 167  ? 53.861  31.269  144.876 1.00 40.32  ? 166  ARG A CD    1 
ATOM   1086  N  NE    . ARG A 1 167  ? 53.074  30.080  144.671 1.00 39.19  ? 166  ARG A NE    1 
ATOM   1087  C  CZ    . ARG A 1 167  ? 53.570  28.862  144.665 1.00 37.99  ? 166  ARG A CZ    1 
ATOM   1088  N  NH1   . ARG A 1 167  ? 52.780  27.840  144.479 1.00 37.15  ? 166  ARG A NH1   1 
ATOM   1089  N  NH2   . ARG A 1 167  ? 54.842  28.664  144.846 1.00 37.75  ? 166  ARG A NH2   1 
ATOM   1090  N  N     . GLY A 1 168  ? 49.467  31.773  146.825 1.00 40.27  ? 167  GLY A N     1 
ATOM   1091  C  CA    . GLY A 1 168  ? 48.191  31.430  147.399 1.00 39.89  ? 167  GLY A CA    1 
ATOM   1092  C  C     . GLY A 1 168  ? 47.207  32.537  147.484 1.00 41.24  ? 167  GLY A C     1 
ATOM   1093  O  O     . GLY A 1 168  ? 47.123  33.306  146.591 1.00 42.32  ? 167  GLY A O     1 
ATOM   1094  N  N     . ASP A 1 169  ? 46.449  32.595  148.558 1.00 44.82  ? 168  ASP A N     1 
ATOM   1095  C  CA    . ASP A 1 169  ? 45.514  33.654  148.732 1.00 49.00  ? 168  ASP A CA    1 
ATOM   1096  C  C     . ASP A 1 169  ? 45.836  34.254  150.047 1.00 53.87  ? 168  ASP A C     1 
ATOM   1097  O  O     . ASP A 1 169  ? 46.023  33.555  150.995 1.00 62.42  ? 168  ASP A O     1 
ATOM   1098  C  CB    . ASP A 1 169  ? 44.078  33.184  148.678 1.00 50.68  ? 168  ASP A CB    1 
ATOM   1099  C  CG    . ASP A 1 169  ? 43.836  32.006  149.470 1.00 52.56  ? 168  ASP A CG    1 
ATOM   1100  O  OD1   . ASP A 1 169  ? 44.741  31.200  149.550 1.00 48.25  ? 168  ASP A OD1   1 
ATOM   1101  O  OD2   . ASP A 1 169  ? 42.744  31.872  150.009 1.00 58.53  ? 168  ASP A OD2   1 
ATOM   1102  N  N     . PHE A 1 170  ? 45.913  35.564  150.091 1.00 56.36  ? 169  PHE A N     1 
ATOM   1103  C  CA    . PHE A 1 170  ? 46.226  36.260  151.306 1.00 53.57  ? 169  PHE A CA    1 
ATOM   1104  C  C     . PHE A 1 170  ? 45.572  37.610  151.387 1.00 54.94  ? 169  PHE A C     1 
ATOM   1105  O  O     . PHE A 1 170  ? 45.048  38.100  150.414 1.00 58.74  ? 169  PHE A O     1 
ATOM   1106  C  CB    . PHE A 1 170  ? 47.692  36.454  151.376 1.00 51.58  ? 169  PHE A CB    1 
ATOM   1107  C  CG    . PHE A 1 170  ? 48.259  37.090  150.183 1.00 49.75  ? 169  PHE A CG    1 
ATOM   1108  C  CD1   . PHE A 1 170  ? 48.676  36.343  149.141 1.00 48.68  ? 169  PHE A CD1   1 
ATOM   1109  C  CD2   . PHE A 1 170  ? 48.416  38.429  150.127 1.00 50.24  ? 169  PHE A CD2   1 
ATOM   1110  C  CE1   . PHE A 1 170  ? 49.243  36.920  148.046 1.00 47.74  ? 169  PHE A CE1   1 
ATOM   1111  C  CE2   . PHE A 1 170  ? 48.980  39.023  149.035 1.00 49.39  ? 169  PHE A CE2   1 
ATOM   1112  C  CZ    . PHE A 1 170  ? 49.390  38.265  147.986 1.00 48.18  ? 169  PHE A CZ    1 
ATOM   1113  N  N     . THR A 1 171  ? 45.602  38.226  152.554 1.00 50.83  ? 170  THR A N     1 
ATOM   1114  C  CA    . THR A 1 171  ? 44.986  39.520  152.707 1.00 52.47  ? 170  THR A CA    1 
ATOM   1115  C  C     . THR A 1 171  ? 45.926  40.681  152.460 1.00 52.09  ? 170  THR A C     1 
ATOM   1116  O  O     . THR A 1 171  ? 47.109  40.588  152.679 1.00 51.54  ? 170  THR A O     1 
ATOM   1117  C  CB    . THR A 1 171  ? 44.384  39.692  154.092 1.00 51.10  ? 170  THR A CB    1 
ATOM   1118  O  OG1   . THR A 1 171  ? 43.482  38.629  154.360 1.00 49.71  ? 170  THR A OG1   1 
ATOM   1119  C  CG2   . THR A 1 171  ? 43.632  40.993  154.167 1.00 53.32  ? 170  THR A CG2   1 
ATOM   1120  N  N     . VAL A 1 172  ? 45.376  41.777  151.971 1.00 54.04  ? 171  VAL A N     1 
ATOM   1121  C  CA    . VAL A 1 172  ? 46.164  42.982  151.750 1.00 56.28  ? 171  VAL A CA    1 
ATOM   1122  C  C     . VAL A 1 172  ? 45.319  44.183  152.168 1.00 61.50  ? 171  VAL A C     1 
ATOM   1123  O  O     . VAL A 1 172  ? 44.088  44.146  152.101 1.00 62.46  ? 171  VAL A O     1 
ATOM   1124  C  CB    . VAL A 1 172  ? 46.630  43.067  150.271 1.00 55.84  ? 171  VAL A CB    1 
ATOM   1125  C  CG1   . VAL A 1 172  ? 46.857  44.499  149.819 1.00 58.21  ? 171  VAL A CG1   1 
ATOM   1126  C  CG2   . VAL A 1 172  ? 47.906  42.254  150.072 1.00 54.89  ? 171  VAL A CG2   1 
ATOM   1127  N  N     . GLU A 1 173  ? 45.984  45.236  152.651 1.00 71.36  ? 172  GLU A N     1 
ATOM   1128  C  CA    . GLU A 1 173  ? 45.293  46.453  153.061 1.00 78.00  ? 172  GLU A CA    1 
ATOM   1129  C  C     . GLU A 1 173  ? 45.005  47.341  151.861 1.00 81.39  ? 172  GLU A C     1 
ATOM   1130  O  O     . GLU A 1 173  ? 45.853  47.516  150.982 1.00 82.25  ? 172  GLU A O     1 
ATOM   1131  C  CB    . GLU A 1 173  ? 46.125  47.228  154.079 1.00 80.56  ? 172  GLU A CB    1 
ATOM   1132  N  N     . LYS A 1 174  ? 43.795  47.919  151.832 1.00 89.92  ? 173  LYS A N     1 
ATOM   1133  C  CA    . LYS A 1 174  ? 43.341  48.741  150.714 1.00 89.78  ? 173  LYS A CA    1 
ATOM   1134  C  C     . LYS A 1 174  ? 42.629  49.981  151.263 1.00 93.26  ? 173  LYS A C     1 
ATOM   1135  O  O     . LYS A 1 174  ? 41.407  50.110  151.183 1.00 90.82  ? 173  LYS A O     1 
ATOM   1136  C  CB    . LYS A 1 174  ? 42.430  47.950  149.773 1.00 90.50  ? 173  LYS A CB    1 
ATOM   1137  N  N     . ASP A 1 175  ? 43.415  50.896  151.827 1.00 89.62  ? 174  ASP A N     1 
ATOM   1138  C  CA    . ASP A 1 175  ? 42.937  52.203  152.268 1.00 92.64  ? 174  ASP A CA    1 
ATOM   1139  C  C     . ASP A 1 175  ? 41.737  52.067  153.202 1.00 89.07  ? 174  ASP A C     1 
ATOM   1140  O  O     . ASP A 1 175  ? 40.623  52.497  152.901 1.00 90.86  ? 174  ASP A O     1 
ATOM   1141  C  CB    . ASP A 1 175  ? 42.598  53.085  151.065 1.00 94.96  ? 174  ASP A CB    1 
ATOM   1142  C  CG    . ASP A 1 175  ? 43.767  53.250  150.117 1.00 95.37  ? 174  ASP A CG    1 
ATOM   1143  O  OD1   . ASP A 1 175  ? 44.894  53.471  150.607 1.00 96.62  ? 174  ASP A OD1   1 
ATOM   1144  O  OD2   . ASP A 1 175  ? 43.563  53.152  148.885 1.00 95.99  ? 174  ASP A OD2   1 
ATOM   1145  N  N     . GLY A 1 176  ? 41.985  51.447  154.353 1.00 89.80  ? 175  GLY A N     1 
ATOM   1146  C  CA    . GLY A 1 176  ? 40.970  51.226  155.354 1.00 89.62  ? 175  GLY A CA    1 
ATOM   1147  C  C     . GLY A 1 176  ? 40.243  49.902  155.228 1.00 89.86  ? 175  GLY A C     1 
ATOM   1148  O  O     . GLY A 1 176  ? 39.718  49.397  156.226 1.00 91.09  ? 175  GLY A O     1 
ATOM   1149  N  N     . LYS A 1 177  ? 40.210  49.326  154.030 1.00 87.19  ? 176  LYS A N     1 
ATOM   1150  C  CA    . LYS A 1 177  ? 39.512  48.078  153.772 1.00 84.90  ? 176  LYS A CA    1 
ATOM   1151  C  C     . LYS A 1 177  ? 40.514  46.956  153.533 1.00 82.51  ? 176  LYS A C     1 
ATOM   1152  O  O     . LYS A 1 177  ? 41.618  47.182  153.030 1.00 83.34  ? 176  LYS A O     1 
ATOM   1153  C  CB    . LYS A 1 177  ? 38.573  48.214  152.565 1.00 85.68  ? 176  LYS A CB    1 
ATOM   1154  C  CG    . LYS A 1 177  ? 37.741  46.969  152.290 1.00 83.28  ? 176  LYS A CG    1 
ATOM   1155  C  CD    . LYS A 1 177  ? 36.478  47.265  151.504 1.00 83.30  ? 176  LYS A CD    1 
ATOM   1156  C  CE    . LYS A 1 177  ? 35.382  46.276  151.877 1.00 81.55  ? 176  LYS A CE    1 
ATOM   1157  N  NZ    . LYS A 1 177  ? 34.173  46.395  151.020 1.00 82.42  ? 176  LYS A NZ    1 
ATOM   1158  N  N     . LYS A 1 178  ? 40.123  45.743  153.920 1.00 82.94  ? 177  LYS A N     1 
ATOM   1159  C  CA    . LYS A 1 178  ? 40.904  44.544  153.657 1.00 79.41  ? 177  LYS A CA    1 
ATOM   1160  C  C     . LYS A 1 178  ? 40.419  43.890  152.372 1.00 74.09  ? 177  LYS A C     1 
ATOM   1161  O  O     . LYS A 1 178  ? 39.225  43.608  152.227 1.00 75.83  ? 177  LYS A O     1 
ATOM   1162  C  CB    . LYS A 1 178  ? 40.783  43.553  154.815 1.00 80.37  ? 177  LYS A CB    1 
ATOM   1163  C  CG    . LYS A 1 178  ? 41.325  44.040  156.144 1.00 80.65  ? 177  LYS A CG    1 
ATOM   1164  C  CD    . LYS A 1 178  ? 42.827  43.838  156.240 1.00 79.23  ? 177  LYS A CD    1 
ATOM   1165  C  CE    . LYS A 1 178  ? 43.592  45.119  155.936 1.00 82.76  ? 177  LYS A CE    1 
ATOM   1166  N  NZ    . LYS A 1 178  ? 45.053  44.977  156.197 1.00 82.64  ? 177  LYS A NZ    1 
ATOM   1167  N  N     . HIS A 1 179  ? 41.345  43.645  151.446 1.00 61.87  ? 178  HIS A N     1 
ATOM   1168  C  CA    . HIS A 1 179  ? 41.052  42.960  150.199 1.00 59.21  ? 178  HIS A CA    1 
ATOM   1169  C  C     . HIS A 1 179  ? 41.833  41.654  150.119 1.00 55.35  ? 178  HIS A C     1 
ATOM   1170  O  O     . HIS A 1 179  ? 42.857  41.472  150.781 1.00 54.51  ? 178  HIS A O     1 
ATOM   1171  C  CB    . HIS A 1 179  ? 41.381  43.842  148.986 1.00 62.67  ? 178  HIS A CB    1 
ATOM   1172  N  N     . ARG A 1 180  ? 41.344  40.753  149.271 1.00 54.12  ? 179  ARG A N     1 
ATOM   1173  C  CA    . ARG A 1 180  ? 41.868  39.401  149.134 1.00 51.84  ? 179  ARG A CA    1 
ATOM   1174  C  C     . ARG A 1 180  ? 42.452  39.184  147.743 1.00 51.39  ? 179  ARG A C     1 
ATOM   1175  O  O     . ARG A 1 180  ? 41.813  39.508  146.739 1.00 52.26  ? 179  ARG A O     1 
ATOM   1176  C  CB    . ARG A 1 180  ? 40.767  38.382  149.410 1.00 50.87  ? 179  ARG A CB    1 
ATOM   1177  C  CG    . ARG A 1 180  ? 40.682  38.018  150.878 1.00 50.35  ? 179  ARG A CG    1 
ATOM   1178  C  CD    . ARG A 1 180  ? 41.470  36.750  151.152 1.00 48.22  ? 179  ARG A CD    1 
ATOM   1179  N  NE    . ARG A 1 180  ? 42.241  36.747  152.391 1.00 47.87  ? 179  ARG A NE    1 
ATOM   1180  C  CZ    . ARG A 1 180  ? 42.950  35.706  152.853 1.00 46.21  ? 179  ARG A CZ    1 
ATOM   1181  N  NH1   . ARG A 1 180  ? 43.616  35.840  154.011 1.00 46.17  ? 179  ARG A NH1   1 
ATOM   1182  N  NH2   . ARG A 1 180  ? 43.004  34.523  152.209 1.00 44.68  ? 179  ARG A NH2   1 
ATOM   1183  N  N     . LEU A 1 181  ? 43.648  38.609  147.682 1.00 50.10  ? 180  LEU A N     1 
ATOM   1184  C  CA    . LEU A 1 181  ? 44.294  38.302  146.417 1.00 49.60  ? 180  LEU A CA    1 
ATOM   1185  C  C     . LEU A 1 181  ? 44.577  36.811  146.326 1.00 47.47  ? 180  LEU A C     1 
ATOM   1186  O  O     . LEU A 1 181  ? 44.625  36.108  147.337 1.00 46.38  ? 180  LEU A O     1 
ATOM   1187  C  CB    . LEU A 1 181  ? 45.599  39.078  146.252 1.00 50.35  ? 180  LEU A CB    1 
ATOM   1188  C  CG    . LEU A 1 181  ? 45.514  40.586  146.443 1.00 52.59  ? 180  LEU A CG    1 
ATOM   1189  C  CD1   . LEU A 1 181  ? 46.849  41.222  146.141 1.00 53.29  ? 180  LEU A CD1   1 
ATOM   1190  C  CD2   . LEU A 1 181  ? 44.454  41.141  145.546 1.00 53.92  ? 180  LEU A CD2   1 
ATOM   1191  N  N     . ILE A 1 182  ? 44.773  36.334  145.098 1.00 46.99  ? 181  ILE A N     1 
ATOM   1192  C  CA    . ILE A 1 182  ? 45.099  34.935  144.854 1.00 45.16  ? 181  ILE A CA    1 
ATOM   1193  C  C     . ILE A 1 182  ? 45.947  34.851  143.594 1.00 45.12  ? 181  ILE A C     1 
ATOM   1194  O  O     . ILE A 1 182  ? 45.806  35.662  142.677 1.00 46.40  ? 181  ILE A O     1 
ATOM   1195  C  CB    . ILE A 1 182  ? 43.822  34.070  144.753 1.00 44.51  ? 181  ILE A CB    1 
ATOM   1196  C  CG1   . ILE A 1 182  ? 44.161  32.594  144.898 1.00 42.65  ? 181  ILE A CG1   1 
ATOM   1197  C  CG2   . ILE A 1 182  ? 43.118  34.310  143.448 1.00 45.31  ? 181  ILE A CG2   1 
ATOM   1198  C  CD1   . ILE A 1 182  ? 43.044  31.785  145.530 1.00 42.02  ? 181  ILE A CD1   1 
ATOM   1199  N  N     . ASN A 1 183  ? 46.853  33.874  143.556 1.00 43.75  ? 182  ASN A N     1 
ATOM   1200  C  CA    . ASN A 1 183  ? 47.823  33.784  142.460 1.00 43.77  ? 182  ASN A CA    1 
ATOM   1201  C  C     . ASN A 1 183  ? 47.244  33.052  141.240 1.00 43.37  ? 182  ASN A C     1 
ATOM   1202  O  O     . ASN A 1 183  ? 47.864  32.152  140.677 1.00 42.46  ? 182  ASN A O     1 
ATOM   1203  C  CB    . ASN A 1 183  ? 49.099  33.116  142.965 1.00 42.71  ? 182  ASN A CB    1 
ATOM   1204  C  CG    . ASN A 1 183  ? 50.288  33.347  142.049 1.00 43.17  ? 182  ASN A CG    1 
ATOM   1205  O  OD1   . ASN A 1 183  ? 50.487  34.456  141.538 1.00 44.64  ? 182  ASN A OD1   1 
ATOM   1206  N  ND2   . ASN A 1 183  ? 51.117  32.317  141.875 1.00 42.06  ? 182  ASN A ND2   1 
ATOM   1207  N  N     . VAL A 1 184  ? 46.044  33.442  140.813 1.00 44.18  ? 183  VAL A N     1 
ATOM   1208  C  CA    . VAL A 1 184  ? 45.336  32.792  139.712 1.00 43.95  ? 183  VAL A CA    1 
ATOM   1209  C  C     . VAL A 1 184  ? 45.269  33.746  138.527 1.00 45.49  ? 183  VAL A C     1 
ATOM   1210  O  O     . VAL A 1 184  ? 44.693  34.835  138.624 1.00 46.92  ? 183  VAL A O     1 
ATOM   1211  C  CB    . VAL A 1 184  ? 43.924  32.355  140.119 1.00 43.69  ? 183  VAL A CB    1 
ATOM   1212  C  CG1   . VAL A 1 184  ? 43.158  31.869  138.884 1.00 43.80  ? 183  VAL A CG1   1 
ATOM   1213  C  CG2   . VAL A 1 184  ? 43.996  31.290  141.185 1.00 42.18  ? 183  VAL A CG2   1 
ATOM   1214  N  N     . PHE A 1 185  ? 45.833  33.328  137.409 1.00 45.32  ? 184  PHE A N     1 
ATOM   1215  C  CA    . PHE A 1 185  ? 45.866  34.118  136.190 1.00 46.77  ? 184  PHE A CA    1 
ATOM   1216  C  C     . PHE A 1 185  ? 45.470  33.258  134.999 1.00 46.38  ? 184  PHE A C     1 
ATOM   1217  O  O     . PHE A 1 185  ? 45.607  32.035  135.042 1.00 44.95  ? 184  PHE A O     1 
ATOM   1218  C  CB    . PHE A 1 185  ? 47.262  34.714  135.970 1.00 47.37  ? 184  PHE A CB    1 
ATOM   1219  C  CG    . PHE A 1 185  ? 47.675  35.676  137.042 1.00 48.05  ? 184  PHE A CG    1 
ATOM   1220  C  CD1   . PHE A 1 185  ? 48.249  35.226  138.212 1.00 46.93  ? 184  PHE A CD1   1 
ATOM   1221  C  CD2   . PHE A 1 185  ? 47.489  37.033  136.878 1.00 49.92  ? 184  PHE A CD2   1 
ATOM   1222  C  CE1   . PHE A 1 185  ? 48.623  36.107  139.200 1.00 47.63  ? 184  PHE A CE1   1 
ATOM   1223  C  CE2   . PHE A 1 185  ? 47.861  37.915  137.863 1.00 50.66  ? 184  PHE A CE2   1 
ATOM   1224  C  CZ    . PHE A 1 185  ? 48.431  37.447  139.028 1.00 49.50  ? 184  PHE A CZ    1 
ATOM   1225  N  N     . PRO A 1 186  ? 44.928  33.857  133.942 1.00 47.71  ? 185  PRO A N     1 
ATOM   1226  C  CA    . PRO A 1 186  ? 44.693  33.100  132.704 1.00 47.52  ? 185  PRO A CA    1 
ATOM   1227  C  C     . PRO A 1 186  ? 45.980  32.547  132.109 1.00 46.97  ? 185  PRO A C     1 
ATOM   1228  O  O     . PRO A 1 186  ? 47.035  33.178  132.172 1.00 47.51  ? 185  PRO A O     1 
ATOM   1229  C  CB    . PRO A 1 186  ? 44.060  34.142  131.778 1.00 49.39  ? 185  PRO A CB    1 
ATOM   1230  C  CG    . PRO A 1 186  ? 43.385  35.067  132.680 1.00 50.22  ? 185  PRO A CG    1 
ATOM   1231  C  CD    . PRO A 1 186  ? 44.266  35.172  133.932 1.00 49.48  ? 185  PRO A CD    1 
ATOM   1232  N  N     . THR A 1 187  ? 45.877  31.332  131.552 1.00 45.97  ? 186  THR A N     1 
ATOM   1233  C  CA    . THR A 1 187  ? 46.957  30.780  130.730 1.00 45.74  ? 186  THR A CA    1 
ATOM   1234  C  C     . THR A 1 187  ? 47.195  31.627  129.489 1.00 47.37  ? 186  THR A C     1 
ATOM   1235  O  O     . THR A 1 187  ? 48.301  31.646  128.942 1.00 47.68  ? 186  THR A O     1 
ATOM   1236  C  CB    . THR A 1 187  ? 46.626  29.345  130.302 1.00 44.61  ? 186  THR A CB    1 
ATOM   1237  O  OG1   . THR A 1 187  ? 46.227  28.599  131.455 1.00 43.27  ? 186  THR A OG1   1 
ATOM   1238  C  CG2   . THR A 1 187  ? 47.828  28.662  129.662 1.00 44.27  ? 186  THR A CG2   1 
ATOM   1239  N  N     . SER A 1 188  ? 46.149  32.273  128.987 1.00 48.51  ? 187  SER A N     1 
ATOM   1240  C  CA    . SER A 1 188  ? 46.329  33.177  127.861 1.00 50.26  ? 187  SER A CA    1 
ATOM   1241  C  C     . SER A 1 188  ? 47.318  34.287  128.208 1.00 51.23  ? 187  SER A C     1 
ATOM   1242  O  O     . SER A 1 188  ? 48.248  34.558  127.441 1.00 53.21  ? 187  SER A O     1 
ATOM   1243  C  CB    . SER A 1 188  ? 44.977  33.746  127.430 1.00 51.41  ? 187  SER A CB    1 
ATOM   1244  O  OG    . SER A 1 188  ? 44.134  34.011  128.532 1.00 51.17  ? 187  SER A OG    1 
ATOM   1245  N  N     . ALA A 1 189  ? 47.173  34.902  129.382 1.00 51.23  ? 188  ALA A N     1 
ATOM   1246  C  CA    . ALA A 1 189  ? 48.095  35.968  129.756 1.00 52.27  ? 188  ALA A CA    1 
ATOM   1247  C  C     . ALA A 1 189  ? 49.502  35.436  130.008 1.00 51.39  ? 188  ALA A C     1 
ATOM   1248  O  O     . ALA A 1 189  ? 50.486  36.094  129.654 1.00 52.47  ? 188  ALA A O     1 
ATOM   1249  C  CB    . ALA A 1 189  ? 47.574  36.707  130.980 1.00 52.52  ? 188  ALA A CB    1 
ATOM   1250  N  N     . TYR A 1 190  ? 49.625  34.254  130.618 1.00 49.55  ? 189  TYR A N     1 
ATOM   1251  C  CA    . TYR A 1 190  ? 50.946  33.658  130.787 1.00 48.78  ? 189  TYR A CA    1 
ATOM   1252  C  C     . TYR A 1 190  ? 51.600  33.397  129.443 1.00 49.40  ? 189  TYR A C     1 
ATOM   1253  O  O     . TYR A 1 190  ? 52.782  33.692  129.245 1.00 50.02  ? 189  TYR A O     1 
ATOM   1254  C  CB    . TYR A 1 190  ? 50.861  32.355  131.579 1.00 46.82  ? 189  TYR A CB    1 
ATOM   1255  C  CG    . TYR A 1 190  ? 50.774  32.504  133.077 1.00 46.11  ? 189  TYR A CG    1 
ATOM   1256  C  CD1   . TYR A 1 190  ? 51.804  33.081  133.807 1.00 46.42  ? 189  TYR A CD1   1 
ATOM   1257  C  CD2   . TYR A 1 190  ? 49.670  32.043  133.757 1.00 45.21  ? 189  TYR A CD2   1 
ATOM   1258  C  CE1   . TYR A 1 190  ? 51.718  33.203  135.193 1.00 45.82  ? 189  TYR A CE1   1 
ATOM   1259  C  CE2   . TYR A 1 190  ? 49.570  32.157  135.106 1.00 44.64  ? 189  TYR A CE2   1 
ATOM   1260  C  CZ    . TYR A 1 190  ? 50.589  32.732  135.831 1.00 44.93  ? 189  TYR A CZ    1 
ATOM   1261  O  OH    . TYR A 1 190  ? 50.441  32.821  137.185 1.00 44.40  ? 189  TYR A OH    1 
ATOM   1262  N  N     . ARG A 1 191  ? 50.842  32.825  128.504 1.00 49.31  ? 190  ARG A N     1 
ATOM   1263  C  CA    . ARG A 1 191  ? 51.354  32.642  127.151 1.00 50.11  ? 190  ARG A CA    1 
ATOM   1264  C  C     . ARG A 1 191  ? 51.696  33.979  126.506 1.00 52.16  ? 190  ARG A C     1 
ATOM   1265  O  O     . ARG A 1 191  ? 52.750  34.128  125.876 1.00 52.96  ? 190  ARG A O     1 
ATOM   1266  C  CB    . ARG A 1 191  ? 50.336  31.894  126.302 1.00 49.82  ? 190  ARG A CB    1 
ATOM   1267  C  CG    . ARG A 1 191  ? 50.919  31.398  125.009 1.00 52.05  ? 190  ARG A CG    1 
ATOM   1268  C  CD    . ARG A 1 191  ? 49.897  31.393  123.910 1.00 57.48  ? 190  ARG A CD    1 
ATOM   1269  N  NE    . ARG A 1 191  ? 50.485  30.929  122.663 1.00 60.81  ? 190  ARG A NE    1 
ATOM   1270  C  CZ    . ARG A 1 191  ? 49.942  31.131  121.476 1.00 64.06  ? 190  ARG A CZ    1 
ATOM   1271  N  NH1   . ARG A 1 191  ? 50.539  30.676  120.386 1.00 68.54  ? 190  ARG A NH1   1 
ATOM   1272  N  NH2   . ARG A 1 191  ? 48.801  31.795  121.388 1.00 64.91  ? 190  ARG A NH2   1 
ATOM   1273  N  N     . SER A 1 192  ? 50.817  34.966  126.658 1.00 53.15  ? 191  SER A N     1 
ATOM   1274  C  CA    . SER A 1 192  ? 51.106  36.293  126.134 1.00 55.24  ? 191  SER A CA    1 
ATOM   1275  C  C     . SER A 1 192  ? 52.421  36.821  126.696 1.00 55.67  ? 191  SER A C     1 
ATOM   1276  O  O     . SER A 1 192  ? 53.288  37.285  125.949 1.00 57.00  ? 191  SER A O     1 
ATOM   1277  C  CB    . SER A 1 192  ? 49.941  37.230  126.455 1.00 56.17  ? 191  SER A CB    1 
ATOM   1278  O  OG    . SER A 1 192  ? 50.192  38.537  125.994 1.00 58.34  ? 191  SER A OG    1 
ATOM   1279  N  N     . GLU A 1 193  ? 52.604  36.710  128.014 1.00 54.59  ? 192  GLU A N     1 
ATOM   1280  C  CA    . GLU A 1 193  ? 53.839  37.158  128.650 1.00 54.94  ? 192  GLU A CA    1 
ATOM   1281  C  C     . GLU A 1 193  ? 55.055  36.409  128.116 1.00 54.60  ? 192  GLU A C     1 
ATOM   1282  O  O     . GLU A 1 193  ? 56.033  37.023  127.676 1.00 55.99  ? 192  GLU A O     1 
ATOM   1283  C  CB    . GLU A 1 193  ? 53.723  36.984  130.159 1.00 54.65  ? 192  GLU A CB    1 
ATOM   1284  C  CG    . GLU A 1 193  ? 55.048  37.005  130.902 1.00 53.49  ? 192  GLU A CG    1 
ATOM   1285  C  CD    . GLU A 1 193  ? 54.823  36.882  132.386 1.00 52.35  ? 192  GLU A CD    1 
ATOM   1286  O  OE1   . GLU A 1 193  ? 55.780  37.026  133.162 1.00 52.49  ? 192  GLU A OE1   1 
ATOM   1287  O  OE2   . GLU A 1 193  ? 53.668  36.650  132.779 1.00 51.59  ? 192  GLU A OE2   1 
ATOM   1288  N  N     . ALA A 1 194  ? 55.013  35.078  128.142 1.00 52.89  ? 193  ALA A N     1 
ATOM   1289  C  CA    . ALA A 1 194  ? 56.174  34.300  127.725 1.00 52.58  ? 193  ALA A CA    1 
ATOM   1290  C  C     . ALA A 1 194  ? 56.555  34.577  126.279 1.00 54.13  ? 193  ALA A C     1 
ATOM   1291  O  O     . ALA A 1 194  ? 57.745  34.583  125.941 1.00 54.82  ? 193  ALA A O     1 
ATOM   1292  C  CB    . ALA A 1 194  ? 55.906  32.810  127.924 1.00 50.64  ? 193  ALA A CB    1 
ATOM   1293  N  N     . LEU A 1 195  ? 55.564  34.809  125.414 1.00 54.78  ? 194  LEU A N     1 
ATOM   1294  C  CA    . LEU A 1 195  ? 55.857  35.089  124.012 1.00 56.36  ? 194  LEU A CA    1 
ATOM   1295  C  C     . LEU A 1 195  ? 56.663  36.369  123.863 1.00 58.36  ? 194  LEU A C     1 
ATOM   1296  O  O     . LEU A 1 195  ? 57.664  36.407  123.140 1.00 63.09  ? 194  LEU A O     1 
ATOM   1297  C  CB    . LEU A 1 195  ? 54.557  35.185  123.219 1.00 56.78  ? 194  LEU A CB    1 
ATOM   1298  C  CG    . LEU A 1 195  ? 54.720  35.571  121.759 1.00 58.58  ? 194  LEU A CG    1 
ATOM   1299  C  CD1   . LEU A 1 195  ? 55.471  34.481  121.021 1.00 58.13  ? 194  LEU A CD1   1 
ATOM   1300  C  CD2   . LEU A 1 195  ? 53.362  35.834  121.133 1.00 59.14  ? 194  LEU A CD2   1 
ATOM   1301  N  N     . ARG A 1 196  ? 56.246  37.428  124.550 1.00 59.05  ? 195  ARG A N     1 
ATOM   1302  C  CA    . ARG A 1 196  ? 56.991  38.674  124.489 1.00 61.06  ? 195  ARG A CA    1 
ATOM   1303  C  C     . ARG A 1 196  ? 58.397  38.526  125.043 1.00 60.92  ? 195  ARG A C     1 
ATOM   1304  O  O     . ARG A 1 196  ? 59.319  39.177  124.554 1.00 62.65  ? 195  ARG A O     1 
ATOM   1305  C  CB    . ARG A 1 196  ? 56.238  39.757  125.240 1.00 61.76  ? 195  ARG A CB    1 
ATOM   1306  C  CG    . ARG A 1 196  ? 54.846  40.005  124.692 1.00 62.18  ? 195  ARG A CG    1 
ATOM   1307  C  CD    . ARG A 1 196  ? 54.168  41.070  125.486 1.00 62.99  ? 195  ARG A CD    1 
ATOM   1308  N  NE    . ARG A 1 196  ? 55.129  42.027  126.022 1.00 64.29  ? 195  ARG A NE    1 
ATOM   1309  C  CZ    . ARG A 1 196  ? 54.855  42.891  126.995 1.00 64.86  ? 195  ARG A CZ    1 
ATOM   1310  N  NH1   . ARG A 1 196  ? 55.797  43.731  127.427 1.00 66.16  ? 195  ARG A NH1   1 
ATOM   1311  N  NH2   . ARG A 1 196  ? 53.640  42.928  127.557 1.00 64.26  ? 195  ARG A NH2   1 
ATOM   1312  N  N     . ILE A 1 197  ? 58.590  37.675  126.049 1.00 59.02  ? 196  ILE A N     1 
ATOM   1313  C  CA    . ILE A 1 197  ? 59.928  37.489  126.602 1.00 58.91  ? 196  ILE A CA    1 
ATOM   1314  C  C     . ILE A 1 197  ? 60.850  36.876  125.557 1.00 59.40  ? 196  ILE A C     1 
ATOM   1315  O  O     . ILE A 1 197  ? 61.903  37.434  125.227 1.00 60.97  ? 196  ILE A O     1 
ATOM   1316  C  CB    . ILE A 1 197  ? 59.872  36.629  127.877 1.00 56.77  ? 196  ILE A CB    1 
ATOM   1317  C  CG1   . ILE A 1 197  ? 59.191  37.397  129.003 1.00 56.65  ? 196  ILE A CG1   1 
ATOM   1318  C  CG2   . ILE A 1 197  ? 61.260  36.195  128.293 1.00 56.57  ? 196  ILE A CG2   1 
ATOM   1319  C  CD1   . ILE A 1 197  ? 58.836  36.549  130.174 1.00 54.57  ? 196  ILE A CD1   1 
ATOM   1320  N  N     . LEU A 1 198  ? 60.456  35.724  125.009 1.00 58.18  ? 197  LEU A N     1 
ATOM   1321  C  CA    . LEU A 1 198  ? 61.341  34.989  124.112 1.00 58.50  ? 197  LEU A CA    1 
ATOM   1322  C  C     . LEU A 1 198  ? 61.583  35.749  122.816 1.00 60.72  ? 197  LEU A C     1 
ATOM   1323  O  O     . LEU A 1 198  ? 62.698  35.733  122.283 1.00 61.85  ? 197  LEU A O     1 
ATOM   1324  C  CB    . LEU A 1 198  ? 60.762  33.604  123.835 1.00 56.81  ? 197  LEU A CB    1 
ATOM   1325  C  CG    . LEU A 1 198  ? 60.639  32.804  125.124 1.00 54.74  ? 197  LEU A CG    1 
ATOM   1326  C  CD1   . LEU A 1 198  ? 59.875  31.509  124.902 1.00 53.16  ? 197  LEU A CD1   1 
ATOM   1327  C  CD2   . LEU A 1 198  ? 62.036  32.533  125.684 1.00 54.75  ? 197  LEU A CD2   1 
ATOM   1328  N  N     . GLN A 1 199  ? 60.553  36.409  122.286 1.00 61.55  ? 198  GLN A N     1 
ATOM   1329  C  CA    . GLN A 1 199  ? 60.755  37.238  121.103 1.00 63.84  ? 198  GLN A CA    1 
ATOM   1330  C  C     . GLN A 1 199  ? 61.719  38.377  121.397 1.00 65.63  ? 198  GLN A C     1 
ATOM   1331  O  O     . GLN A 1 199  ? 62.537  38.744  120.547 1.00 67.44  ? 198  GLN A O     1 
ATOM   1332  C  CB    . GLN A 1 199  ? 59.417  37.774  120.606 1.00 69.14  ? 198  GLN A CB    1 
ATOM   1333  C  CG    . GLN A 1 199  ? 58.734  36.865  119.612 1.00 68.76  ? 198  GLN A CG    1 
ATOM   1334  C  CD    . GLN A 1 199  ? 57.394  37.409  119.197 1.00 69.89  ? 198  GLN A CD    1 
ATOM   1335  O  OE1   . GLN A 1 199  ? 56.823  38.251  119.889 1.00 71.80  ? 198  GLN A OE1   1 
ATOM   1336  N  NE2   . GLN A 1 199  ? 56.884  36.945  118.059 1.00 69.88  ? 198  GLN A NE2   1 
ATOM   1337  N  N     . THR A 1 200  ? 61.651  38.937  122.602 1.00 65.19  ? 199  THR A N     1 
ATOM   1338  C  CA    . THR A 1 200  ? 62.610  39.964  122.984 1.00 66.88  ? 199  THR A CA    1 
ATOM   1339  C  C     . THR A 1 200  ? 64.010  39.385  123.129 1.00 66.79  ? 199  THR A C     1 
ATOM   1340  O  O     . THR A 1 200  ? 64.999  40.046  122.793 1.00 68.72  ? 199  THR A O     1 
ATOM   1341  C  CB    . THR A 1 200  ? 62.153  40.632  124.273 1.00 66.46  ? 199  THR A CB    1 
ATOM   1342  O  OG1   . THR A 1 200  ? 60.863  41.218  124.053 1.00 66.84  ? 199  THR A OG1   1 
ATOM   1343  C  CG2   . THR A 1 200  ? 63.125  41.705  124.693 1.00 68.72  ? 199  THR A CG2   1 
ATOM   1344  N  N     . GLN A 1 201  ? 64.109  38.144  123.601 1.00 64.69  ? 200  GLN A N     1 
ATOM   1345  C  CA    . GLN A 1 201  ? 65.401  37.480  123.703 1.00 69.10  ? 200  GLN A CA    1 
ATOM   1346  C  C     . GLN A 1 201  ? 65.968  37.148  122.333 1.00 70.17  ? 200  GLN A C     1 
ATOM   1347  O  O     . GLN A 1 201  ? 67.190  37.150  122.141 1.00 72.47  ? 200  GLN A O     1 
ATOM   1348  C  CB    . GLN A 1 201  ? 65.253  36.217  124.546 1.00 62.11  ? 200  GLN A CB    1 
ATOM   1349  C  CG    . GLN A 1 201  ? 66.275  36.172  125.651 1.00 61.84  ? 200  GLN A CG    1 
ATOM   1350  C  CD    . GLN A 1 201  ? 66.072  37.331  126.562 1.00 62.42  ? 200  GLN A CD    1 
ATOM   1351  O  OE1   . GLN A 1 201  ? 64.931  37.698  126.892 1.00 61.83  ? 200  GLN A OE1   1 
ATOM   1352  N  NE2   . GLN A 1 201  ? 67.149  38.003  126.873 1.00 63.87  ? 200  GLN A NE2   1 
ATOM   1353  N  N     . GLN A 1 202  ? 65.089  36.833  121.385 1.00 70.30  ? 201  GLN A N     1 
ATOM   1354  C  CA    . GLN A 1 202  ? 65.526  36.430  120.058 1.00 71.58  ? 201  GLN A CA    1 
ATOM   1355  C  C     . GLN A 1 202  ? 66.405  37.491  119.418 1.00 72.96  ? 201  GLN A C     1 
ATOM   1356  O  O     . GLN A 1 202  ? 67.341  37.159  118.684 1.00 72.14  ? 201  GLN A O     1 
ATOM   1357  C  CB    . GLN A 1 202  ? 64.301  36.143  119.186 1.00 71.24  ? 201  GLN A CB    1 
ATOM   1358  C  CG    . GLN A 1 202  ? 64.486  35.017  118.181 1.00 69.82  ? 201  GLN A CG    1 
ATOM   1359  C  CD    . GLN A 1 202  ? 63.171  34.576  117.548 1.00 68.69  ? 201  GLN A CD    1 
ATOM   1360  O  OE1   . GLN A 1 202  ? 62.258  35.380  117.358 1.00 68.71  ? 201  GLN A OE1   1 
ATOM   1361  N  NE2   . GLN A 1 202  ? 63.066  33.290  117.233 1.00 68.99  ? 201  GLN A NE2   1 
ATOM   1362  N  N     . GLU A 1 203  ? 66.130  38.767  119.688 1.00 76.03  ? 202  GLU A N     1 
ATOM   1363  C  CA    . GLU A 1 203  ? 66.929  39.825  119.082 1.00 81.14  ? 202  GLU A CA    1 
ATOM   1364  C  C     . GLU A 1 203  ? 68.292  39.956  119.745 1.00 82.97  ? 202  GLU A C     1 
ATOM   1365  O  O     . GLU A 1 203  ? 69.237  40.440  119.116 1.00 81.71  ? 202  GLU A O     1 
ATOM   1366  C  CB    . GLU A 1 203  ? 66.180  41.155  119.132 1.00 86.51  ? 202  GLU A CB    1 
ATOM   1367  C  CG    . GLU A 1 203  ? 65.200  41.341  117.991 1.00 91.21  ? 202  GLU A CG    1 
ATOM   1368  C  CD    . GLU A 1 203  ? 63.780  41.554  118.469 1.00 93.18  ? 202  GLU A CD    1 
ATOM   1369  O  OE1   . GLU A 1 203  ? 63.603  42.022  119.612 1.00 93.45  ? 202  GLU A OE1   1 
ATOM   1370  O  OE2   . GLU A 1 203  ? 62.840  41.247  117.704 1.00 95.49  ? 202  GLU A OE2   1 
ATOM   1371  N  N     . PHE A 1 204  ? 68.435  39.403  120.935 1.00 74.93  ? 203  PHE A N     1 
ATOM   1372  C  CA    . PHE A 1 204  ? 69.727  39.383  121.582 1.00 85.57  ? 203  PHE A CA    1 
ATOM   1373  C  C     . PHE A 1 204  ? 70.409  38.059  121.383 1.00 95.51  ? 203  PHE A C     1 
ATOM   1374  O  O     . PHE A 1 204  ? 71.608  37.991  121.345 1.00 96.26  ? 203  PHE A O     1 
ATOM   1375  C  CB    . PHE A 1 204  ? 69.619  39.565  123.087 1.00 76.26  ? 203  PHE A CB    1 
ATOM   1376  C  CG    . PHE A 1 204  ? 69.047  40.862  123.510 1.00 72.39  ? 203  PHE A CG    1 
ATOM   1377  C  CD1   . PHE A 1 204  ? 69.817  41.975  123.546 1.00 74.91  ? 203  PHE A CD1   1 
ATOM   1378  C  CD2   . PHE A 1 204  ? 67.749  40.946  123.919 1.00 70.95  ? 203  PHE A CD2   1 
ATOM   1379  C  CE1   . PHE A 1 204  ? 69.297  43.168  123.960 1.00 75.98  ? 203  PHE A CE1   1 
ATOM   1380  C  CE2   . PHE A 1 204  ? 67.220  42.133  124.331 1.00 72.01  ? 203  PHE A CE2   1 
ATOM   1381  C  CZ    . PHE A 1 204  ? 67.996  43.249  124.346 1.00 74.54  ? 203  PHE A CZ    1 
ATOM   1382  N  N     . ASN A 1 205  ? 69.634  36.993  121.293 1.00 127.19 ? 204  ASN A N     1 
ATOM   1383  C  CA    . ASN A 1 205  ? 70.197  35.654  121.183 1.00 132.86 ? 204  ASN A CA    1 
ATOM   1384  C  C     . ASN A 1 205  ? 69.716  34.817  120.011 1.00 127.06 ? 204  ASN A C     1 
ATOM   1385  O  O     . ASN A 1 205  ? 68.520  34.713  119.763 1.00 129.73 ? 204  ASN A O     1 
ATOM   1386  C  CB    . ASN A 1 205  ? 69.914  34.931  122.479 1.00 140.67 ? 204  ASN A CB    1 
ATOM   1387  C  CG    . ASN A 1 205  ? 70.490  33.553  122.514 1.00 144.49 ? 204  ASN A CG    1 
ATOM   1388  O  OD1   . ASN A 1 205  ? 69.845  32.581  122.165 1.00 147.03 ? 204  ASN A OD1   1 
ATOM   1389  N  ND2   . ASN A 1 205  ? 71.717  33.461  122.952 1.00 146.57 ? 204  ASN A ND2   1 
ATOM   1390  N  N     . PRO A 1 206  ? 70.666  34.253  119.268 1.00 94.02  ? 205  PRO A N     1 
ATOM   1391  C  CA    . PRO A 1 206  ? 70.359  33.439  118.082 1.00 86.53  ? 205  PRO A CA    1 
ATOM   1392  C  C     . PRO A 1 206  ? 70.103  31.948  118.323 1.00 81.88  ? 205  PRO A C     1 
ATOM   1393  O  O     . PRO A 1 206  ? 69.642  31.275  117.401 1.00 81.30  ? 205  PRO A O     1 
ATOM   1394  C  CB    . PRO A 1 206  ? 71.608  33.615  117.214 1.00 77.07  ? 205  PRO A CB    1 
ATOM   1395  C  CG    . PRO A 1 206  ? 72.703  33.882  118.189 1.00 77.13  ? 205  PRO A CG    1 
ATOM   1396  C  CD    . PRO A 1 206  ? 72.077  34.677  119.301 1.00 87.53  ? 205  PRO A CD    1 
ATOM   1397  N  N     . GLN A 1 207  ? 70.390  31.436  119.516 1.00 90.08  ? 206  GLN A N     1 
ATOM   1398  C  CA    . GLN A 1 207  ? 70.168  30.027  119.783 1.00 84.02  ? 206  GLN A CA    1 
ATOM   1399  C  C     . GLN A 1 207  ? 68.666  29.830  120.016 1.00 77.62  ? 206  GLN A C     1 
ATOM   1400  O  O     . GLN A 1 207  ? 68.164  28.733  119.973 1.00 70.15  ? 206  GLN A O     1 
ATOM   1401  C  CB    . GLN A 1 207  ? 71.031  29.532  120.941 1.00 85.55  ? 206  GLN A CB    1 
ATOM   1402  C  CG    . GLN A 1 207  ? 72.206  28.621  120.562 1.00 91.50  ? 206  GLN A CG    1 
ATOM   1403  C  CD    . GLN A 1 207  ? 73.325  28.569  121.624 1.00 96.05  ? 206  GLN A CD    1 
ATOM   1404  O  OE1   . GLN A 1 207  ? 73.149  28.034  122.712 1.00 97.18  ? 206  GLN A OE1   1 
ATOM   1405  N  NE2   . GLN A 1 207  ? 74.482  29.117  121.292 1.00 98.13  ? 206  GLN A NE2   1 
ATOM   1406  N  N     . ILE A 1 208  ? 67.954  30.914  120.255 1.00 75.19  ? 207  ILE A N     1 
ATOM   1407  C  CA    . ILE A 1 208  ? 66.536  30.835  120.466 1.00 60.55  ? 207  ILE A CA    1 
ATOM   1408  C  C     . ILE A 1 208  ? 65.813  30.887  119.138 1.00 61.51  ? 207  ILE A C     1 
ATOM   1409  O  O     . ILE A 1 208  ? 65.415  31.928  118.682 1.00 62.97  ? 207  ILE A O     1 
ATOM   1410  C  CB    . ILE A 1 208  ? 66.055  31.972  121.375 1.00 60.43  ? 207  ILE A CB    1 
ATOM   1411  C  CG1   . ILE A 1 208  ? 66.444  31.690  122.814 1.00 59.44  ? 207  ILE A CG1   1 
ATOM   1412  C  CG2   . ILE A 1 208  ? 64.553  32.136  121.354 1.00 59.20  ? 207  ILE A CG2   1 
ATOM   1413  C  CD1   . ILE A 1 208  ? 66.542  32.926  123.665 1.00 60.32  ? 207  ILE A CD1   1 
ATOM   1414  N  N     . THR A 1 209  ? 65.611  29.732  118.543 1.00 60.84  ? 208  THR A N     1 
ATOM   1415  C  CA    . THR A 1 209  ? 64.921  29.609  117.273 1.00 61.68  ? 208  THR A CA    1 
ATOM   1416  C  C     . THR A 1 209  ? 63.422  29.714  117.375 1.00 60.58  ? 208  THR A C     1 
ATOM   1417  O  O     . THR A 1 209  ? 62.888  29.703  118.433 1.00 59.05  ? 208  THR A O     1 
ATOM   1418  C  CB    . THR A 1 209  ? 65.226  28.262  116.659 1.00 61.50  ? 208  THR A CB    1 
ATOM   1419  O  OG1   . THR A 1 209  ? 64.553  27.262  117.396 1.00 59.36  ? 208  THR A OG1   1 
ATOM   1420  C  CG2   . THR A 1 209  ? 66.673  27.987  116.736 1.00 62.52  ? 208  THR A CG2   1 
ATOM   1421  N  N     . ASP A 1 210  ? 62.745  29.844  116.258 1.00 61.50  ? 209  ASP A N     1 
ATOM   1422  C  CA    . ASP A 1 210  ? 61.289  29.865  116.222 1.00 61.25  ? 209  ASP A CA    1 
ATOM   1423  C  C     . ASP A 1 210  ? 60.712  28.553  116.723 1.00 58.55  ? 209  ASP A C     1 
ATOM   1424  O  O     . ASP A 1 210  ? 59.654  28.535  117.360 1.00 57.28  ? 209  ASP A O     1 
ATOM   1425  C  CB    . ASP A 1 210  ? 60.813  30.147  114.800 1.00 63.28  ? 209  ASP A CB    1 
ATOM   1426  C  CG    . ASP A 1 210  ? 61.329  31.457  114.272 1.00 64.55  ? 209  ASP A CG    1 
ATOM   1427  O  OD1   . ASP A 1 210  ? 62.454  31.481  113.730 1.00 68.71  ? 209  ASP A OD1   1 
ATOM   1428  O  OD2   . ASP A 1 210  ? 60.608  32.464  114.402 1.00 64.90  ? 209  ASP A OD2   1 
ATOM   1429  N  N     . GLU A 1 211  ? 61.386  27.441  116.431 1.00 58.32  ? 210  GLU A N     1 
ATOM   1430  C  CA    . GLU A 1 211  ? 60.904  26.153  116.907 1.00 59.48  ? 210  GLU A CA    1 
ATOM   1431  C  C     . GLU A 1 211  ? 60.996  26.071  118.419 1.00 58.44  ? 210  GLU A C     1 
ATOM   1432  O  O     . GLU A 1 211  ? 60.063  25.599  119.074 1.00 54.48  ? 210  GLU A O     1 
ATOM   1433  C  CB    . GLU A 1 211  ? 61.682  25.010  116.255 1.00 66.04  ? 210  GLU A CB    1 
ATOM   1434  C  CG    . GLU A 1 211  ? 61.326  23.623  116.796 1.00 68.78  ? 210  GLU A CG    1 
ATOM   1435  C  CD    . GLU A 1 211  ? 59.908  23.186  116.460 1.00 70.16  ? 210  GLU A CD    1 
ATOM   1436  O  OE1   . GLU A 1 211  ? 59.211  23.900  115.707 1.00 73.68  ? 210  GLU A OE1   1 
ATOM   1437  O  OE2   . GLU A 1 211  ? 59.489  22.116  116.947 1.00 70.55  ? 210  GLU A OE2   1 
ATOM   1438  N  N     . PHE A 1 212  ? 62.107  26.540  118.992 1.00 57.12  ? 211  PHE A N     1 
ATOM   1439  C  CA    . PHE A 1 212  ? 62.216  26.594  120.441 1.00 54.03  ? 211  PHE A CA    1 
ATOM   1440  C  C     . PHE A 1 212  ? 61.040  27.343  121.050 1.00 53.35  ? 211  PHE A C     1 
ATOM   1441  O  O     . PHE A 1 212  ? 60.461  26.895  122.044 1.00 51.73  ? 211  PHE A O     1 
ATOM   1442  C  CB    . PHE A 1 212  ? 63.534  27.245  120.854 1.00 55.01  ? 211  PHE A CB    1 
ATOM   1443  C  CG    . PHE A 1 212  ? 63.634  27.512  122.335 1.00 53.89  ? 211  PHE A CG    1 
ATOM   1444  C  CD1   . PHE A 1 212  ? 64.089  26.536  123.198 1.00 52.63  ? 211  PHE A CD1   1 
ATOM   1445  C  CD2   . PHE A 1 212  ? 63.250  28.733  122.861 1.00 54.20  ? 211  PHE A CD2   1 
ATOM   1446  C  CE1   . PHE A 1 212  ? 64.167  26.778  124.557 1.00 51.67  ? 211  PHE A CE1   1 
ATOM   1447  C  CE2   . PHE A 1 212  ? 63.321  28.978  124.218 1.00 53.25  ? 211  PHE A CE2   1 
ATOM   1448  C  CZ    . PHE A 1 212  ? 63.783  28.000  125.066 1.00 51.97  ? 211  PHE A CZ    1 
ATOM   1449  N  N     . ILE A 1 213  ? 60.675  28.489  120.475 1.00 54.67  ? 212  ILE A N     1 
ATOM   1450  C  CA    . ILE A 1 213  ? 59.533  29.234  120.992 1.00 54.24  ? 212  ILE A CA    1 
ATOM   1451  C  C     . ILE A 1 213  ? 58.260  28.418  120.844 1.00 53.04  ? 212  ILE A C     1 
ATOM   1452  O  O     . ILE A 1 213  ? 57.398  28.419  121.728 1.00 51.86  ? 212  ILE A O     1 
ATOM   1453  C  CB    . ILE A 1 213  ? 59.414  30.596  120.287 1.00 56.16  ? 212  ILE A CB    1 
ATOM   1454  C  CG1   . ILE A 1 213  ? 60.697  31.396  120.467 1.00 57.46  ? 212  ILE A CG1   1 
ATOM   1455  C  CG2   . ILE A 1 213  ? 58.217  31.371  120.801 1.00 55.90  ? 212  ILE A CG2   1 
ATOM   1456  C  CD1   . ILE A 1 213  ? 60.608  32.799  119.943 1.00 59.42  ? 212  ILE A CD1   1 
ATOM   1457  N  N     . ASN A 1 214  ? 58.124  27.704  119.727 1.00 53.43  ? 213  ASN A N     1 
ATOM   1458  C  CA    . ASN A 1 214  ? 56.934  26.893  119.500 1.00 52.47  ? 213  ASN A CA    1 
ATOM   1459  C  C     . ASN A 1 214  ? 56.816  25.797  120.543 1.00 50.57  ? 213  ASN A C     1 
ATOM   1460  O  O     . ASN A 1 214  ? 55.757  25.613  121.150 1.00 49.48  ? 213  ASN A O     1 
ATOM   1461  C  CB    . ASN A 1 214  ? 56.976  26.278  118.099 1.00 53.38  ? 213  ASN A CB    1 
ATOM   1462  C  CG    . ASN A 1 214  ? 56.626  27.266  117.010 1.00 55.15  ? 213  ASN A CG    1 
ATOM   1463  O  OD1   . ASN A 1 214  ? 55.728  28.091  117.165 1.00 55.34  ? 213  ASN A OD1   1 
ATOM   1464  N  ND2   . ASN A 1 214  ? 57.326  27.175  115.889 1.00 58.87  ? 213  ASN A ND2   1 
ATOM   1465  N  N     . ARG A 1 215  ? 57.900  25.053  120.756 1.00 50.28  ? 214  ARG A N     1 
ATOM   1466  C  CA    . ARG A 1 215  ? 57.841  23.871  121.607 1.00 50.55  ? 214  ARG A CA    1 
ATOM   1467  C  C     . ARG A 1 215  ? 57.560  24.223  123.059 1.00 48.79  ? 214  ARG A C     1 
ATOM   1468  O  O     . ARG A 1 215  ? 56.846  23.486  123.751 1.00 49.57  ? 214  ARG A O     1 
ATOM   1469  C  CB    . ARG A 1 215  ? 59.141  23.092  121.505 1.00 48.86  ? 214  ARG A CB    1 
ATOM   1470  C  CG    . ARG A 1 215  ? 59.502  22.769  120.107 1.00 50.34  ? 214  ARG A CG    1 
ATOM   1471  C  CD    . ARG A 1 215  ? 59.728  21.324  119.971 1.00 51.80  ? 214  ARG A CD    1 
ATOM   1472  N  NE    . ARG A 1 215  ? 60.521  20.782  121.053 1.00 53.32  ? 214  ARG A NE    1 
ATOM   1473  C  CZ    . ARG A 1 215  ? 61.776  20.377  120.894 1.00 55.90  ? 214  ARG A CZ    1 
ATOM   1474  N  NH1   . ARG A 1 215  ? 62.385  20.467  119.692 1.00 59.73  ? 214  ARG A NH1   1 
ATOM   1475  N  NH2   . ARG A 1 215  ? 62.432  19.868  121.939 1.00 55.95  ? 214  ARG A NH2   1 
ATOM   1476  N  N     . TYR A 1 216  ? 58.133  25.329  123.542 1.00 48.08  ? 215  TYR A N     1 
ATOM   1477  C  CA    . TYR A 1 216  ? 57.921  25.741  124.923 1.00 47.89  ? 215  TYR A CA    1 
ATOM   1478  C  C     . TYR A 1 216  ? 56.470  26.127  125.157 1.00 50.08  ? 215  TYR A C     1 
ATOM   1479  O  O     . TYR A 1 216  ? 55.852  25.688  126.128 1.00 52.57  ? 215  TYR A O     1 
ATOM   1480  C  CB    . TYR A 1 216  ? 58.867  26.893  125.301 1.00 48.11  ? 215  TYR A CB    1 
ATOM   1481  C  CG    . TYR A 1 216  ? 58.462  27.558  126.608 1.00 47.43  ? 215  TYR A CG    1 
ATOM   1482  C  CD1   . TYR A 1 216  ? 58.952  27.098  127.814 1.00 46.34  ? 215  TYR A CD1   1 
ATOM   1483  C  CD2   . TYR A 1 216  ? 57.573  28.623  126.642 1.00 47.97  ? 215  TYR A CD2   1 
ATOM   1484  C  CE1   . TYR A 1 216  ? 58.564  27.661  129.015 1.00 45.76  ? 215  TYR A CE1   1 
ATOM   1485  C  CE2   . TYR A 1 216  ? 57.178  29.197  127.854 1.00 47.43  ? 215  TYR A CE2   1 
ATOM   1486  C  CZ    . TYR A 1 216  ? 57.685  28.707  129.039 1.00 46.31  ? 215  TYR A CZ    1 
ATOM   1487  O  OH    . TYR A 1 216  ? 57.334  29.248  130.266 1.00 45.83  ? 215  TYR A OH    1 
ATOM   1488  N  N     . LEU A 1 217  ? 55.905  26.945  124.273 1.00 47.84  ? 216  LEU A N     1 
ATOM   1489  C  CA    . LEU A 1 217  ? 54.516  27.357  124.432 1.00 47.64  ? 216  LEU A CA    1 
ATOM   1490  C  C     . LEU A 1 217  ? 53.544  26.189  124.416 1.00 46.46  ? 216  LEU A C     1 
ATOM   1491  O  O     . LEU A 1 217  ? 52.451  26.306  124.977 1.00 45.88  ? 216  LEU A O     1 
ATOM   1492  C  CB    . LEU A 1 217  ? 54.127  28.357  123.343 1.00 49.30  ? 216  LEU A CB    1 
ATOM   1493  C  CG    . LEU A 1 217  ? 54.711  29.759  123.479 1.00 50.64  ? 216  LEU A CG    1 
ATOM   1494  C  CD1   . LEU A 1 217  ? 54.061  30.707  122.473 1.00 52.27  ? 216  LEU A CD1   1 
ATOM   1495  C  CD2   . LEU A 1 217  ? 54.552  30.270  124.912 1.00 49.91  ? 216  LEU A CD2   1 
ATOM   1496  N  N     . GLU A 1 218  ? 53.909  25.072  123.790 1.00 46.22  ? 217  GLU A N     1 
ATOM   1497  C  CA    . GLU A 1 218  ? 53.104  23.865  123.915 1.00 45.26  ? 217  GLU A CA    1 
ATOM   1498  C  C     . GLU A 1 218  ? 53.333  23.191  125.260 1.00 43.63  ? 217  GLU A C     1 
ATOM   1499  O  O     . GLU A 1 218  ? 52.393  22.646  125.848 1.00 42.65  ? 217  GLU A O     1 
ATOM   1500  C  CB    . GLU A 1 218  ? 53.415  22.898  122.773 1.00 46.12  ? 217  GLU A CB    1 
ATOM   1501  C  CG    . GLU A 1 218  ? 52.701  21.545  122.855 1.00 47.19  ? 217  GLU A CG    1 
ATOM   1502  C  CD    . GLU A 1 218  ? 51.178  21.630  122.719 1.00 50.16  ? 217  GLU A CD    1 
ATOM   1503  O  OE1   . GLU A 1 218  ? 50.666  22.666  122.241 1.00 50.02  ? 217  GLU A OE1   1 
ATOM   1504  O  OE2   . GLU A 1 218  ? 50.494  20.649  123.093 1.00 48.56  ? 217  GLU A OE2   1 
ATOM   1505  N  N     . ILE A 1 219  ? 54.574  23.207  125.756 1.00 43.55  ? 218  ILE A N     1 
ATOM   1506  C  CA    . ILE A 1 219  ? 54.840  22.721  127.110 1.00 42.30  ? 218  ILE A CA    1 
ATOM   1507  C  C     . ILE A 1 219  ? 54.024  23.519  128.116 1.00 41.85  ? 218  ILE A C     1 
ATOM   1508  O  O     . ILE A 1 219  ? 53.302  22.960  128.946 1.00 40.76  ? 218  ILE A O     1 
ATOM   1509  C  CB    . ILE A 1 219  ? 56.342  22.805  127.430 1.00 42.57  ? 218  ILE A CB    1 
ATOM   1510  C  CG1   . ILE A 1 219  ? 57.144  21.846  126.545 1.00 42.98  ? 218  ILE A CG1   1 
ATOM   1511  C  CG2   . ILE A 1 219  ? 56.568  22.544  128.896 1.00 41.43  ? 218  ILE A CG2   1 
ATOM   1512  C  CD1   . ILE A 1 219  ? 58.632  22.093  126.589 1.00 43.70  ? 218  ILE A CD1   1 
ATOM   1513  N  N     . LEU A 1 220  ? 54.090  24.844  128.005 1.00 42.84  ? 219  LEU A N     1 
ATOM   1514  C  CA    . LEU A 1 220  ? 53.385  25.737  128.913 1.00 42.71  ? 219  LEU A CA    1 
ATOM   1515  C  C     . LEU A 1 220  ? 51.871  25.605  128.774 1.00 42.45  ? 219  LEU A C     1 
ATOM   1516  O  O     . LEU A 1 220  ? 51.165  25.396  129.763 1.00 41.56  ? 219  LEU A O     1 
ATOM   1517  C  CB    . LEU A 1 220  ? 53.840  27.175  128.653 1.00 44.12  ? 219  LEU A CB    1 
ATOM   1518  C  CG    . LEU A 1 220  ? 53.288  28.235  129.598 1.00 44.28  ? 219  LEU A CG    1 
ATOM   1519  C  CD1   . LEU A 1 220  ? 54.227  28.404  130.798 1.00 43.83  ? 219  LEU A CD1   1 
ATOM   1520  C  CD2   . LEU A 1 220  ? 53.095  29.552  128.881 1.00 45.94  ? 219  LEU A CD2   1 
ATOM   1521  N  N     . THR A 1 221  ? 51.349  25.720  127.554 1.00 44.36  ? 220  THR A N     1 
ATOM   1522  C  CA    . THR A 1 221  ? 49.904  25.810  127.369 1.00 44.63  ? 220  THR A CA    1 
ATOM   1523  C  C     . THR A 1 221  ? 49.230  24.463  127.160 1.00 44.33  ? 220  THR A C     1 
ATOM   1524  O  O     . THR A 1 221  ? 48.017  24.360  127.370 1.00 44.04  ? 220  THR A O     1 
ATOM   1525  C  CB    . THR A 1 221  ? 49.571  26.726  126.183 1.00 46.82  ? 220  THR A CB    1 
ATOM   1526  O  OG1   . THR A 1 221  ? 50.165  26.200  124.994 1.00 48.64  ? 220  THR A OG1   1 
ATOM   1527  C  CG2   . THR A 1 221  ? 50.109  28.128  126.417 1.00 48.05  ? 220  THR A CG2   1 
ATOM   1528  N  N     . GLY A 1 222  ? 49.978  23.433  126.773 1.00 42.15  ? 221  GLY A N     1 
ATOM   1529  C  CA    . GLY A 1 222  ? 49.408  22.136  126.459 1.00 41.55  ? 221  GLY A CA    1 
ATOM   1530  C  C     . GLY A 1 222  ? 48.502  21.504  127.499 1.00 40.42  ? 221  GLY A C     1 
ATOM   1531  O  O     . GLY A 1 222  ? 48.867  21.366  128.672 1.00 39.55  ? 221  GLY A O     1 
ATOM   1532  N  N     . LYS A 1 223  ? 47.310  21.106  127.062 1.00 40.53  ? 222  LYS A N     1 
ATOM   1533  C  CA    . LYS A 1 223  ? 46.358  20.362  127.870 1.00 39.65  ? 222  LYS A CA    1 
ATOM   1534  C  C     . LYS A 1 223  ? 45.857  19.168  127.077 1.00 39.68  ? 222  LYS A C     1 
ATOM   1535  O  O     . LYS A 1 223  ? 45.930  19.139  125.849 1.00 41.39  ? 222  LYS A O     1 
ATOM   1536  C  CB    . LYS A 1 223  ? 45.154  21.210  128.277 1.00 42.31  ? 222  LYS A CB    1 
ATOM   1537  C  CG    . LYS A 1 223  ? 45.434  22.253  129.299 1.00 46.04  ? 222  LYS A CG    1 
ATOM   1538  C  CD    . LYS A 1 223  ? 44.146  22.924  129.714 1.00 48.54  ? 222  LYS A CD    1 
ATOM   1539  C  CE    . LYS A 1 223  ? 43.136  21.903  130.180 1.00 49.52  ? 222  LYS A CE    1 
ATOM   1540  N  NZ    . LYS A 1 223  ? 41.874  22.527  130.663 1.00 51.04  ? 222  LYS A NZ    1 
ATOM   1541  N  N     . ARG A 1 224  ? 45.309  18.196  127.783 1.00 38.86  ? 223  ARG A N     1 
ATOM   1542  C  CA    . ARG A 1 224  ? 44.666  17.062  127.148 1.00 38.96  ? 223  ARG A CA    1 
ATOM   1543  C  C     . ARG A 1 224  ? 43.177  17.338  127.022 1.00 39.41  ? 223  ARG A C     1 
ATOM   1544  O  O     . ARG A 1 224  ? 42.587  17.991  127.886 1.00 39.22  ? 223  ARG A O     1 
ATOM   1545  C  CB    . ARG A 1 224  ? 44.904  15.774  127.933 1.00 38.01  ? 223  ARG A CB    1 
ATOM   1546  C  CG    . ARG A 1 224  ? 46.347  15.310  127.867 1.00 37.78  ? 223  ARG A CG    1 
ATOM   1547  C  CD    . ARG A 1 224  ? 46.692  14.223  128.860 1.00 36.86  ? 223  ARG A CD    1 
ATOM   1548  N  NE    . ARG A 1 224  ? 47.989  13.672  128.502 1.00 36.96  ? 223  ARG A NE    1 
ATOM   1549  C  CZ    . ARG A 1 224  ? 48.155  12.560  127.799 1.00 37.29  ? 223  ARG A CZ    1 
ATOM   1550  N  NH1   . ARG A 1 224  ? 47.103  11.860  127.411 1.00 37.51  ? 223  ARG A NH1   1 
ATOM   1551  N  NH2   . ARG A 1 224  ? 49.370  12.142  127.489 1.00 37.51  ? 223  ARG A NH2   1 
ATOM   1552  N  N     . LYS A 1 225  ? 42.592  16.870  125.918 1.00 40.15  ? 224  LYS A N     1 
ATOM   1553  C  CA    . LYS A 1 225  ? 41.149  16.905  125.745 1.00 40.66  ? 224  LYS A CA    1 
ATOM   1554  C  C     . LYS A 1 225  ? 40.470  16.045  126.794 1.00 39.88  ? 224  LYS A C     1 
ATOM   1555  O  O     . LYS A 1 225  ? 40.894  14.924  127.060 1.00 39.27  ? 224  LYS A O     1 
ATOM   1556  C  CB    . LYS A 1 225  ? 40.768  16.390  124.352 1.00 41.61  ? 224  LYS A CB    1 
ATOM   1557  C  CG    . LYS A 1 225  ? 41.341  17.177  123.223 1.00 42.56  ? 224  LYS A CG    1 
ATOM   1558  C  CD    . LYS A 1 225  ? 40.630  18.487  123.135 1.00 43.34  ? 224  LYS A CD    1 
ATOM   1559  C  CE    . LYS A 1 225  ? 41.576  19.604  122.783 1.00 43.84  ? 224  LYS A CE    1 
ATOM   1560  N  NZ    . LYS A 1 225  ? 40.816  20.880  122.646 1.00 45.87  ? 224  LYS A NZ    1 
ATOM   1561  N  N     . TYR A 1 226  ? 39.369  16.548  127.347 1.00 40.06  ? 225  TYR A N     1 
ATOM   1562  C  CA    . TYR A 1 226  ? 38.649  15.785  128.360 1.00 39.47  ? 225  TYR A CA    1 
ATOM   1563  C  C     . TYR A 1 226  ? 38.092  14.470  127.824 1.00 39.71  ? 225  TYR A C     1 
ATOM   1564  O  O     . TYR A 1 226  ? 37.842  13.558  128.618 1.00 39.15  ? 225  TYR A O     1 
ATOM   1565  C  CB    . TYR A 1 226  ? 37.508  16.620  128.954 1.00 39.87  ? 225  TYR A CB    1 
ATOM   1566  C  CG    . TYR A 1 226  ? 36.256  16.706  128.091 1.00 41.04  ? 225  TYR A CG    1 
ATOM   1567  C  CD1   . TYR A 1 226  ? 35.236  15.772  128.214 1.00 41.22  ? 225  TYR A CD1   1 
ATOM   1568  C  CD2   . TYR A 1 226  ? 36.091  17.728  127.167 1.00 42.07  ? 225  TYR A CD2   1 
ATOM   1569  C  CE1   . TYR A 1 226  ? 34.093  15.848  127.434 1.00 42.38  ? 225  TYR A CE1   1 
ATOM   1570  C  CE2   . TYR A 1 226  ? 34.947  17.811  126.388 1.00 43.22  ? 225  TYR A CE2   1 
ATOM   1571  C  CZ    . TYR A 1 226  ? 33.956  16.867  126.525 1.00 43.36  ? 225  TYR A CZ    1 
ATOM   1572  O  OH    . TYR A 1 226  ? 32.821  16.936  125.750 1.00 44.60  ? 225  TYR A OH    1 
ATOM   1573  N  N     . TYR A 1 227  ? 37.873  14.357  126.512 1.00 40.62  ? 226  TYR A N     1 
ATOM   1574  C  CA    . TYR A 1 227  ? 37.355  13.140  125.887 1.00 41.04  ? 226  TYR A CA    1 
ATOM   1575  C  C     . TYR A 1 227  ? 38.457  12.231  125.348 1.00 40.83  ? 226  TYR A C     1 
ATOM   1576  O  O     . TYR A 1 227  ? 38.157  11.223  124.704 1.00 41.33  ? 226  TYR A O     1 
ATOM   1577  C  CB    . TYR A 1 227  ? 36.361  13.486  124.759 1.00 42.34  ? 226  TYR A CB    1 
ATOM   1578  C  CG    . TYR A 1 227  ? 36.844  14.548  123.809 1.00 43.01  ? 226  TYR A CG    1 
ATOM   1579  C  CD1   . TYR A 1 227  ? 37.597  14.224  122.703 1.00 43.43  ? 226  TYR A CD1   1 
ATOM   1580  C  CD2   . TYR A 1 227  ? 36.554  15.880  124.031 1.00 43.33  ? 226  TYR A CD2   1 
ATOM   1581  C  CE1   . TYR A 1 227  ? 38.052  15.196  121.851 1.00 44.13  ? 226  TYR A CE1   1 
ATOM   1582  C  CE2   . TYR A 1 227  ? 37.003  16.854  123.189 1.00 44.05  ? 226  TYR A CE2   1 
ATOM   1583  C  CZ    . TYR A 1 227  ? 37.747  16.506  122.100 1.00 44.44  ? 226  TYR A CZ    1 
ATOM   1584  O  OH    . TYR A 1 227  ? 38.197  17.480  121.259 1.00 45.27  ? 226  TYR A OH    1 
ATOM   1585  N  N     . HIS A 1 228  ? 39.705  12.538  125.665 1.00 40.24  ? 227  HIS A N     1 
ATOM   1586  C  CA    . HIS A 1 228  ? 40.829  11.698  125.309 1.00 40.01  ? 227  HIS A CA    1 
ATOM   1587  C  C     . HIS A 1 228  ? 41.402  11.035  126.535 1.00 38.95  ? 227  HIS A C     1 
ATOM   1588  O  O     . HIS A 1 228  ? 41.521  9.847   126.577 1.00 38.88  ? 227  HIS A O     1 
ATOM   1589  C  CB    . HIS A 1 228  ? 41.901  12.500  124.646 1.00 40.29  ? 227  HIS A CB    1 
ATOM   1590  C  CG    . HIS A 1 228  ? 41.561  12.881  123.262 1.00 41.48  ? 227  HIS A CG    1 
ATOM   1591  N  ND1   . HIS A 1 228  ? 42.316  13.752  122.528 1.00 42.26  ? 227  HIS A ND1   1 
ATOM   1592  C  CD2   . HIS A 1 228  ? 40.543  12.504  122.468 1.00 42.13  ? 227  HIS A CD2   1 
ATOM   1593  C  CE1   . HIS A 1 228  ? 41.767  13.910  121.347 1.00 43.29  ? 227  HIS A CE1   1 
ATOM   1594  N  NE2   . HIS A 1 228  ? 40.689  13.166  121.288 1.00 43.24  ? 227  HIS A NE2   1 
ATOM   1595  N  N     . GLY A 1 229  ? 41.750  11.827  127.536 1.00 38.23  ? 228  GLY A N     1 
ATOM   1596  C  CA    . GLY A 1 229  ? 42.222  11.320  128.794 1.00 37.27  ? 228  GLY A CA    1 
ATOM   1597  C  C     . GLY A 1 229  ? 43.703  10.993  128.749 1.00 36.96  ? 228  GLY A C     1 
ATOM   1598  O  O     . GLY A 1 229  ? 44.474  11.573  127.983 1.00 37.35  ? 228  GLY A O     1 
ATOM   1599  N  N     . PRO A 1 230  ? 44.126  10.044  129.580 1.00 36.36  ? 229  PRO A N     1 
ATOM   1600  C  CA    . PRO A 1 230  ? 45.555  9.724   129.662 1.00 36.12  ? 229  PRO A CA    1 
ATOM   1601  C  C     . PRO A 1 230  ? 46.025  8.868   128.507 1.00 36.86  ? 229  PRO A C     1 
ATOM   1602  O  O     . PRO A 1 230  ? 45.257  8.198   127.828 1.00 37.45  ? 229  PRO A O     1 
ATOM   1603  C  CB    . PRO A 1 230  ? 45.691  8.942   130.983 1.00 35.36  ? 229  PRO A CB    1 
ATOM   1604  C  CG    . PRO A 1 230  ? 44.331  8.797   131.497 1.00 35.26  ? 229  PRO A CG    1 
ATOM   1605  C  CD    . PRO A 1 230  ? 43.436  9.760   130.867 1.00 35.73  ? 229  PRO A CD    1 
ATOM   1606  N  N     . GLY A 1 231  ? 47.326  8.926   128.288 1.00 37.06  ? 230  GLY A N     1 
ATOM   1607  C  CA    . GLY A 1 231  ? 48.028  7.973   127.460 1.00 38.21  ? 230  GLY A CA    1 
ATOM   1608  C  C     . GLY A 1 231  ? 48.625  8.623   126.224 1.00 40.62  ? 230  GLY A C     1 
ATOM   1609  O  O     . GLY A 1 231  ? 48.426  9.803   125.933 1.00 40.15  ? 230  GLY A O     1 
ATOM   1610  N  N     . ASN A 1 232  ? 49.311  7.793   125.469 1.00 39.11  ? 231  ASN A N     1 
ATOM   1611  C  CA    . ASN A 1 232  ? 49.901  8.127   124.193 1.00 40.13  ? 231  ASN A CA    1 
ATOM   1612  C  C     . ASN A 1 232  ? 49.986  6.839   123.402 1.00 41.23  ? 231  ASN A C     1 
ATOM   1613  O  O     . ASN A 1 232  ? 49.630  5.819   123.901 1.00 40.81  ? 231  ASN A O     1 
ATOM   1614  C  CB    . ASN A 1 232  ? 51.174  8.945   124.283 1.00 42.50  ? 231  ASN A CB    1 
ATOM   1615  C  CG    . ASN A 1 232  ? 52.327  8.177   124.783 1.00 45.37  ? 231  ASN A CG    1 
ATOM   1616  O  OD1   . ASN A 1 232  ? 53.278  8.705   125.287 1.00 49.55  ? 231  ASN A OD1   1 
ATOM   1617  N  ND2   . ASN A 1 232  ? 52.229  6.912   124.655 1.00 46.91  ? 231  ASN A ND2   1 
ATOM   1618  N  N     . GLU A 1 233  ? 50.435  6.877   122.168 1.00 44.31  ? 232  GLU A N     1 
ATOM   1619  C  CA    . GLU A 1 233  ? 50.379  5.681   121.326 1.00 48.35  ? 232  GLU A CA    1 
ATOM   1620  C  C     . GLU A 1 233  ? 51.154  4.520   121.940 1.00 44.65  ? 232  GLU A C     1 
ATOM   1621  O  O     . GLU A 1 233  ? 50.830  3.351   121.697 1.00 45.91  ? 232  GLU A O     1 
ATOM   1622  C  CB    . GLU A 1 233  ? 50.906  5.980   119.914 1.00 54.80  ? 232  GLU A CB    1 
ATOM   1623  C  CG    . GLU A 1 233  ? 50.135  7.072   119.183 1.00 60.20  ? 232  GLU A CG    1 
ATOM   1624  C  CD    . GLU A 1 233  ? 50.820  8.434   119.270 1.00 62.90  ? 232  GLU A CD    1 
ATOM   1625  O  OE1   . GLU A 1 233  ? 51.368  8.895   118.247 1.00 66.33  ? 232  GLU A OE1   1 
ATOM   1626  O  OE2   . GLU A 1 233  ? 50.820  9.042   120.366 1.00 63.90  ? 232  GLU A OE2   1 
ATOM   1627  N  N     . LYS A 1 234  ? 52.167  4.818   122.742 1.00 46.43  ? 233  LYS A N     1 
ATOM   1628  C  CA    . LYS A 1 234  ? 52.954  3.795   123.409 1.00 44.93  ? 233  LYS A CA    1 
ATOM   1629  C  C     . LYS A 1 234  ? 52.559  3.565   124.855 1.00 47.54  ? 233  LYS A C     1 
ATOM   1630  O  O     . LYS A 1 234  ? 52.911  2.521   125.418 1.00 53.96  ? 233  LYS A O     1 
ATOM   1631  C  CB    . LYS A 1 234  ? 54.433  4.163   123.352 1.00 44.26  ? 233  LYS A CB    1 
ATOM   1632  C  CG    . LYS A 1 234  ? 55.103  3.685   122.095 1.00 45.40  ? 233  LYS A CG    1 
ATOM   1633  C  CD    . LYS A 1 234  ? 55.930  4.801   121.528 1.00 45.38  ? 233  LYS A CD    1 
ATOM   1634  C  CE    . LYS A 1 234  ? 56.690  4.333   120.326 1.00 46.27  ? 233  LYS A CE    1 
ATOM   1635  N  NZ    . LYS A 1 234  ? 57.772  5.282   120.022 1.00 46.76  ? 233  LYS A NZ    1 
ATOM   1636  N  N     . SER A 1 235  ? 51.844  4.497   125.469 1.00 43.86  ? 234  SER A N     1 
ATOM   1637  C  CA    . SER A 1 235  ? 51.488  4.405   126.873 1.00 40.63  ? 234  SER A CA    1 
ATOM   1638  C  C     . SER A 1 235  ? 50.010  4.049   126.936 1.00 39.08  ? 234  SER A C     1 
ATOM   1639  O  O     . SER A 1 235  ? 49.145  4.907   127.123 1.00 39.12  ? 234  SER A O     1 
ATOM   1640  C  CB    . SER A 1 235  ? 51.810  5.708   127.600 1.00 38.33  ? 234  SER A CB    1 
ATOM   1641  O  OG    . SER A 1 235  ? 53.114  6.165   127.271 1.00 38.73  ? 234  SER A OG    1 
ATOM   1642  N  N     . ARG A 1 236  ? 49.734  2.758   126.788 1.00 42.05  ? 235  ARG A N     1 
ATOM   1643  C  CA    . ARG A 1 236  ? 48.371  2.254   126.811 1.00 41.22  ? 235  ARG A CA    1 
ATOM   1644  C  C     . ARG A 1 236  ? 47.806  2.327   128.216 1.00 41.17  ? 235  ARG A C     1 
ATOM   1645  O  O     . ARG A 1 236  ? 48.467  1.926   129.176 1.00 44.39  ? 235  ARG A O     1 
ATOM   1646  C  CB    . ARG A 1 236  ? 48.351  0.812   126.317 1.00 43.10  ? 235  ARG A CB    1 
ATOM   1647  C  CG    . ARG A 1 236  ? 48.708  0.696   124.836 1.00 46.58  ? 235  ARG A CG    1 
ATOM   1648  C  CD    . ARG A 1 236  ? 47.550  1.126   124.000 1.00 48.60  ? 235  ARG A CD    1 
ATOM   1649  N  NE    . ARG A 1 236  ? 47.872  1.864   122.786 1.00 49.69  ? 235  ARG A NE    1 
ATOM   1650  C  CZ    . ARG A 1 236  ? 46.953  2.285   121.914 1.00 50.93  ? 235  ARG A CZ    1 
ATOM   1651  N  NH1   . ARG A 1 236  ? 47.334  2.962   120.820 1.00 52.25  ? 235  ARG A NH1   1 
ATOM   1652  N  NH2   . ARG A 1 236  ? 45.643  2.057   122.122 1.00 53.78  ? 235  ARG A NH2   1 
ATOM   1653  N  N     . THR A 1 237  ? 46.580  2.829   128.339 1.00 43.79  ? 236  THR A N     1 
ATOM   1654  C  CA    . THR A 1 237  ? 45.892  2.828   129.621 1.00 40.03  ? 236  THR A CA    1 
ATOM   1655  C  C     . THR A 1 237  ? 44.397  2.908   129.368 1.00 39.42  ? 236  THR A C     1 
ATOM   1656  O  O     . THR A 1 237  ? 43.939  3.759   128.603 1.00 38.72  ? 236  THR A O     1 
ATOM   1657  C  CB    . THR A 1 237  ? 46.370  3.985   130.526 1.00 36.60  ? 236  THR A CB    1 
ATOM   1658  O  OG1   . THR A 1 237  ? 45.449  4.168   131.603 1.00 36.09  ? 236  THR A OG1   1 
ATOM   1659  C  CG2   . THR A 1 237  ? 46.498  5.278   129.756 1.00 37.03  ? 236  THR A CG2   1 
ATOM   1660  N  N     . ASP A 1 238  ? 43.645  2.017   130.001 1.00 37.98  ? 237  ASP A N     1 
ATOM   1661  C  CA    . ASP A 1 238  ? 42.206  1.958   129.809 1.00 38.42  ? 237  ASP A CA    1 
ATOM   1662  C  C     . ASP A 1 238  ? 41.463  3.017   130.603 1.00 37.72  ? 237  ASP A C     1 
ATOM   1663  O  O     . ASP A 1 238  ? 40.242  2.937   130.733 1.00 38.05  ? 237  ASP A O     1 
ATOM   1664  C  CB    . ASP A 1 238  ? 41.687  0.563   130.157 1.00 38.99  ? 237  ASP A CB    1 
ATOM   1665  C  CG    . ASP A 1 238  ? 42.192  -0.504  129.190 1.00 40.06  ? 237  ASP A CG    1 
ATOM   1666  O  OD1   . ASP A 1 238  ? 42.671  -0.146  128.090 1.00 41.50  ? 237  ASP A OD1   1 
ATOM   1667  O  OD2   . ASP A 1 238  ? 42.103  -1.703  129.529 1.00 43.76  ? 237  ASP A OD2   1 
ATOM   1668  N  N     . TYR A 1 239  ? 42.174  3.996   131.148 1.00 36.89  ? 238  TYR A N     1 
ATOM   1669  C  CA    . TYR A 1 239  ? 41.541  5.202   131.653 1.00 36.43  ? 238  TYR A CA    1 
ATOM   1670  C  C     . TYR A 1 239  ? 41.317  6.218   130.550 1.00 36.87  ? 238  TYR A C     1 
ATOM   1671  O  O     . TYR A 1 239  ? 40.571  7.178   130.747 1.00 36.81  ? 238  TYR A O     1 
ATOM   1672  C  CB    . TYR A 1 239  ? 42.398  5.847   132.747 1.00 35.46  ? 238  TYR A CB    1 
ATOM   1673  C  CG    . TYR A 1 239  ? 42.388  5.153   134.096 1.00 34.97  ? 238  TYR A CG    1 
ATOM   1674  C  CD1   . TYR A 1 239  ? 41.243  5.123   134.868 1.00 34.95  ? 238  TYR A CD1   1 
ATOM   1675  C  CD2   . TYR A 1 239  ? 43.543  4.564   134.610 1.00 34.62  ? 238  TYR A CD2   1 
ATOM   1676  C  CE1   . TYR A 1 239  ? 41.238  4.500   136.096 1.00 34.59  ? 238  TYR A CE1   1 
ATOM   1677  C  CE2   . TYR A 1 239  ? 43.543  3.947   135.829 1.00 34.26  ? 238  TYR A CE2   1 
ATOM   1678  C  CZ    . TYR A 1 239  ? 42.395  3.918   136.570 1.00 34.23  ? 238  TYR A CZ    1 
ATOM   1679  O  OH    . TYR A 1 239  ? 42.388  3.299   137.786 1.00 33.97  ? 238  TYR A OH    1 
ATOM   1680  N  N     . GLY A 1 240  ? 41.956  6.037   129.408 1.00 37.40  ? 239  GLY A N     1 
ATOM   1681  C  CA    . GLY A 1 240  ? 41.927  7.028   128.362 1.00 37.87  ? 239  GLY A CA    1 
ATOM   1682  C  C     . GLY A 1 240  ? 41.685  6.419   126.990 1.00 38.93  ? 239  GLY A C     1 
ATOM   1683  O  O     . GLY A 1 240  ? 41.044  5.375   126.832 1.00 39.44  ? 239  GLY A O     1 
ATOM   1684  N  N     . ARG A 1 241  ? 42.240  7.100   125.999 1.00 39.36  ? 240  ARG A N     1 
ATOM   1685  C  CA    . ARG A 1 241  ? 41.922  6.878   124.598 1.00 40.48  ? 240  ARG A CA    1 
ATOM   1686  C  C     . ARG A 1 241  ? 42.635  5.660   124.023 1.00 41.01  ? 240  ARG A C     1 
ATOM   1687  O  O     . ARG A 1 241  ? 42.048  4.905   123.241 1.00 41.92  ? 240  ARG A O     1 
ATOM   1688  C  CB    . ARG A 1 241  ? 42.281  8.146   123.830 1.00 40.79  ? 240  ARG A CB    1 
ATOM   1689  C  CG    . ARG A 1 241  ? 42.326  8.008   122.377 1.00 41.93  ? 240  ARG A CG    1 
ATOM   1690  C  CD    . ARG A 1 241  ? 42.378  9.363   121.721 1.00 42.34  ? 240  ARG A CD    1 
ATOM   1691  N  NE    . ARG A 1 241  ? 43.553  10.135  122.097 1.00 41.83  ? 240  ARG A NE    1 
ATOM   1692  C  CZ    . ARG A 1 241  ? 44.001  11.157  121.376 1.00 44.18  ? 240  ARG A CZ    1 
ATOM   1693  N  NH1   . ARG A 1 241  ? 43.368  11.490  120.258 1.00 45.96  ? 240  ARG A NH1   1 
ATOM   1694  N  NH2   . ARG A 1 241  ? 45.081  11.828  121.743 1.00 44.89  ? 240  ARG A NH2   1 
ATOM   1695  N  N     . TYR A 1 242  ? 43.894  5.453   124.390 1.00 40.57  ? 241  TYR A N     1 
ATOM   1696  C  CA    . TYR A 1 242  ? 44.718  4.392   123.815 1.00 41.21  ? 241  TYR A CA    1 
ATOM   1697  C  C     . TYR A 1 242  ? 44.524  3.129   124.640 1.00 41.03  ? 241  TYR A C     1 
ATOM   1698  O  O     . TYR A 1 242  ? 45.207  2.901   125.638 1.00 40.31  ? 241  TYR A O     1 
ATOM   1699  C  CB    . TYR A 1 242  ? 46.175  4.827   123.778 1.00 41.01  ? 241  TYR A CB    1 
ATOM   1700  C  CG    . TYR A 1 242  ? 46.391  6.194   123.168 1.00 41.14  ? 241  TYR A CG    1 
ATOM   1701  C  CD1   . TYR A 1 242  ? 46.335  7.330   123.947 1.00 40.31  ? 241  TYR A CD1   1 
ATOM   1702  C  CD2   . TYR A 1 242  ? 46.657  6.345   121.813 1.00 42.22  ? 241  TYR A CD2   1 
ATOM   1703  C  CE1   . TYR A 1 242  ? 46.537  8.583   123.407 1.00 40.57  ? 241  TYR A CE1   1 
ATOM   1704  C  CE2   . TYR A 1 242  ? 46.861  7.601   121.259 1.00 42.46  ? 241  TYR A CE2   1 
ATOM   1705  C  CZ    . TYR A 1 242  ? 46.799  8.718   122.069 1.00 41.64  ? 241  TYR A CZ    1 
ATOM   1706  O  OH    . TYR A 1 242  ? 46.999  9.981   121.552 1.00 42.00  ? 241  TYR A OH    1 
ATOM   1707  N  N     . ARG A 1 243  ? 43.585  2.290   124.216 1.00 41.80  ? 242  ARG A N     1 
ATOM   1708  C  CA    . ARG A 1 243  ? 43.189  1.139   125.011 1.00 41.78  ? 242  ARG A CA    1 
ATOM   1709  C  C     . ARG A 1 243  ? 44.241  0.044   124.961 1.00 42.21  ? 242  ARG A C     1 
ATOM   1710  O  O     . ARG A 1 243  ? 44.940  -0.126  123.960 1.00 42.99  ? 242  ARG A O     1 
ATOM   1711  C  CB    . ARG A 1 243  ? 41.861  0.591   124.518 1.00 42.66  ? 242  ARG A CB    1 
ATOM   1712  C  CG    . ARG A 1 243  ? 40.926  1.669   124.061 1.00 42.71  ? 242  ARG A CG    1 
ATOM   1713  C  CD    . ARG A 1 243  ? 40.477  2.491   125.221 1.00 41.65  ? 242  ARG A CD    1 
ATOM   1714  N  NE    . ARG A 1 243  ? 39.716  1.679   126.150 1.00 41.57  ? 242  ARG A NE    1 
ATOM   1715  C  CZ    . ARG A 1 243  ? 39.135  2.155   127.239 1.00 40.84  ? 242  ARG A CZ    1 
ATOM   1716  N  NH1   . ARG A 1 243  ? 38.459  1.340   128.032 1.00 40.94  ? 242  ARG A NH1   1 
ATOM   1717  N  NH2   . ARG A 1 243  ? 39.241  3.445   127.530 1.00 40.13  ? 242  ARG A NH2   1 
ATOM   1718  N  N     . THR A 1 244  ? 44.336  -0.717  126.058 1.00 41.82  ? 243  THR A N     1 
ATOM   1719  C  CA    . THR A 1 244  ? 45.315  -1.799  126.128 1.00 42.47  ? 243  THR A CA    1 
ATOM   1720  C  C     . THR A 1 244  ? 45.046  -2.864  125.074 1.00 43.81  ? 243  THR A C     1 
ATOM   1721  O  O     . THR A 1 244  ? 45.973  -3.555  124.642 1.00 44.57  ? 243  THR A O     1 
ATOM   1722  C  CB    . THR A 1 244  ? 45.339  -2.427  127.531 1.00 42.23  ? 243  THR A CB    1 
ATOM   1723  O  OG1   . THR A 1 244  ? 44.023  -2.844  127.915 1.00 42.71  ? 243  THR A OG1   1 
ATOM   1724  C  CG2   . THR A 1 244  ? 45.870  -1.441  128.558 1.00 40.41  ? 243  THR A CG2   1 
ATOM   1725  N  N     . SER A 1 245  ? 43.795  -3.000  124.630 1.00 44.36  ? 244  SER A N     1 
ATOM   1726  C  CA    . SER A 1 245  ? 43.496  -3.919  123.538 1.00 46.13  ? 244  SER A CA    1 
ATOM   1727  C  C     . SER A 1 245  ? 44.154  -3.508  122.232 1.00 47.17  ? 244  SER A C     1 
ATOM   1728  O  O     . SER A 1 245  ? 44.223  -4.325  121.311 1.00 51.09  ? 244  SER A O     1 
ATOM   1729  C  CB    . SER A 1 245  ? 41.986  -4.027  123.322 1.00 46.37  ? 244  SER A CB    1 
ATOM   1730  O  OG    . SER A 1 245  ? 41.454  -2.808  122.833 1.00 46.00  ? 244  SER A OG    1 
ATOM   1731  N  N     . GLY A 1 246  ? 44.639  -2.280  122.128 1.00 48.48  ? 245  GLY A N     1 
ATOM   1732  C  CA    . GLY A 1 246  ? 45.236  -1.775  120.917 1.00 48.24  ? 245  GLY A CA    1 
ATOM   1733  C  C     . GLY A 1 246  ? 44.357  -0.810  120.153 1.00 51.11  ? 245  GLY A C     1 
ATOM   1734  O  O     . GLY A 1 246  ? 44.862  -0.073  119.299 1.00 55.10  ? 245  GLY A O     1 
ATOM   1735  N  N     . GLU A 1 247  ? 43.061  -0.802  120.438 1.00 48.33  ? 246  GLU A N     1 
ATOM   1736  C  CA    . GLU A 1 247  ? 42.148  0.123   119.799 1.00 46.64  ? 246  GLU A CA    1 
ATOM   1737  C  C     . GLU A 1 247  ? 42.386  1.534   120.314 1.00 45.47  ? 246  GLU A C     1 
ATOM   1738  O  O     . GLU A 1 247  ? 42.757  1.739   121.468 1.00 44.34  ? 246  GLU A O     1 
ATOM   1739  C  CB    . GLU A 1 247  ? 40.707  -0.309  120.057 1.00 52.22  ? 246  GLU A CB    1 
ATOM   1740  C  CG    . GLU A 1 247  ? 39.690  0.811   120.003 1.00 51.31  ? 246  GLU A CG    1 
ATOM   1741  C  CD    . GLU A 1 247  ? 38.261  0.289   120.025 1.00 52.37  ? 246  GLU A CD    1 
ATOM   1742  O  OE1   . GLU A 1 247  ? 37.399  0.850   119.326 1.00 53.99  ? 246  GLU A OE1   1 
ATOM   1743  O  OE2   . GLU A 1 247  ? 37.998  -0.691  120.741 1.00 56.71  ? 246  GLU A OE2   1 
ATOM   1744  N  N     . THR A 1 248  ? 42.204  2.514   119.437 1.00 45.85  ? 247  THR A N     1 
ATOM   1745  C  CA    . THR A 1 248  ? 42.254  3.920   119.811 1.00 45.00  ? 247  THR A CA    1 
ATOM   1746  C  C     . THR A 1 248  ? 40.870  4.514   119.603 1.00 45.29  ? 247  THR A C     1 
ATOM   1747  O  O     . THR A 1 248  ? 40.334  4.464   118.497 1.00 46.41  ? 247  THR A O     1 
ATOM   1748  C  CB    . THR A 1 248  ? 43.300  4.679   118.991 1.00 45.33  ? 247  THR A CB    1 
ATOM   1749  O  OG1   . THR A 1 248  ? 44.589  4.084   119.182 1.00 45.21  ? 247  THR A OG1   1 
ATOM   1750  C  CG2   . THR A 1 248  ? 43.368  6.131   119.422 1.00 44.57  ? 247  THR A CG2   1 
ATOM   1751  N  N     . LEU A 1 249  ? 40.290  5.061   120.662 1.00 44.38  ? 248  LEU A N     1 
ATOM   1752  C  CA    . LEU A 1 249  ? 38.964  5.652   120.600 1.00 44.69  ? 248  LEU A CA    1 
ATOM   1753  C  C     . LEU A 1 249  ? 39.035  7.095   120.121 1.00 44.79  ? 248  LEU A C     1 
ATOM   1754  O  O     . LEU A 1 249  ? 40.059  7.766   120.240 1.00 44.28  ? 248  LEU A O     1 
ATOM   1755  C  CB    . LEU A 1 249  ? 38.283  5.607   121.965 1.00 43.83  ? 248  LEU A CB    1 
ATOM   1756  C  CG    . LEU A 1 249  ? 38.181  4.258   122.663 1.00 43.68  ? 248  LEU A CG    1 
ATOM   1757  C  CD1   . LEU A 1 249  ? 37.387  4.388   123.949 1.00 42.99  ? 248  LEU A CD1   1 
ATOM   1758  C  CD2   . LEU A 1 249  ? 37.548  3.249   121.727 1.00 44.98  ? 248  LEU A CD2   1 
ATOM   1759  N  N     . ASP A 1 250  ? 37.919  7.567   119.565 1.00 45.58  ? 249  ASP A N     1 
ATOM   1760  C  CA    . ASP A 1 250  ? 37.798  8.985   119.253 1.00 48.19  ? 249  ASP A CA    1 
ATOM   1761  C  C     . ASP A 1 250  ? 37.370  9.777   120.476 1.00 44.87  ? 249  ASP A C     1 
ATOM   1762  O  O     . ASP A 1 250  ? 37.798  10.918  120.666 1.00 44.55  ? 249  ASP A O     1 
ATOM   1763  C  CB    . ASP A 1 250  ? 36.794  9.197   118.122 1.00 53.97  ? 249  ASP A CB    1 
ATOM   1764  C  CG    . ASP A 1 250  ? 37.262  8.612   116.823 1.00 57.25  ? 249  ASP A CG    1 
ATOM   1765  O  OD1   . ASP A 1 250  ? 38.482  8.657   116.579 1.00 61.44  ? 249  ASP A OD1   1 
ATOM   1766  O  OD2   . ASP A 1 250  ? 36.415  8.106   116.050 1.00 58.06  ? 249  ASP A OD2   1 
ATOM   1767  N  N     . ASN A 1 251  ? 36.526  9.183   121.307 1.00 44.58  ? 250  ASN A N     1 
ATOM   1768  C  CA    . ASN A 1 251  ? 35.948  9.852   122.460 1.00 43.93  ? 250  ASN A CA    1 
ATOM   1769  C  C     . ASN A 1 251  ? 35.697  8.781   123.505 1.00 43.31  ? 250  ASN A C     1 
ATOM   1770  O  O     . ASN A 1 251  ? 34.915  7.859   123.266 1.00 43.96  ? 250  ASN A O     1 
ATOM   1771  C  CB    . ASN A 1 251  ? 34.654  10.573  122.075 1.00 44.89  ? 250  ASN A CB    1 
ATOM   1772  C  CG    . ASN A 1 251  ? 34.053  11.348  123.223 1.00 44.40  ? 250  ASN A CG    1 
ATOM   1773  O  OD1   . ASN A 1 251  ? 33.925  10.841  124.334 1.00 43.65  ? 250  ASN A OD1   1 
ATOM   1774  N  ND2   . ASN A 1 251  ? 33.679  12.588  122.960 1.00 44.94  ? 250  ASN A ND2   1 
ATOM   1775  N  N     . ILE A 1 252  ? 36.358  8.900   124.658 1.00 42.15  ? 251  ILE A N     1 
ATOM   1776  C  CA    . ILE A 1 252  ? 36.324  7.838   125.659 1.00 41.57  ? 251  ILE A CA    1 
ATOM   1777  C  C     . ILE A 1 252  ? 34.977  7.712   126.344 1.00 41.82  ? 251  ILE A C     1 
ATOM   1778  O  O     . ILE A 1 252  ? 34.749  6.736   127.060 1.00 41.62  ? 251  ILE A O     1 
ATOM   1779  C  CB    . ILE A 1 252  ? 37.419  8.045   126.721 1.00 40.34  ? 251  ILE A CB    1 
ATOM   1780  C  CG1   . ILE A 1 252  ? 37.153  9.309   127.524 1.00 39.85  ? 251  ILE A CG1   1 
ATOM   1781  C  CG2   . ILE A 1 252  ? 38.764  8.157   126.070 1.00 40.21  ? 251  ILE A CG2   1 
ATOM   1782  C  CD1   . ILE A 1 252  ? 38.017  9.421   128.776 1.00 38.69  ? 251  ILE A CD1   1 
ATOM   1783  N  N     . PHE A 1 253  ? 34.074  8.661   126.137 1.00 42.37  ? 252  PHE A N     1 
ATOM   1784  C  CA    . PHE A 1 253  ? 32.741  8.576   126.711 1.00 42.83  ? 252  PHE A CA    1 
ATOM   1785  C  C     . PHE A 1 253  ? 31.746  7.871   125.803 1.00 45.25  ? 252  PHE A C     1 
ATOM   1786  O  O     . PHE A 1 253  ? 30.645  7.539   126.255 1.00 47.90  ? 252  PHE A O     1 
ATOM   1787  C  CB    . PHE A 1 253  ? 32.246  9.977   127.060 1.00 43.68  ? 252  PHE A CB    1 
ATOM   1788  C  CG    . PHE A 1 253  ? 33.098  10.658  128.086 1.00 43.08  ? 252  PHE A CG    1 
ATOM   1789  C  CD1   . PHE A 1 253  ? 32.882  10.441  129.432 1.00 42.08  ? 252  PHE A CD1   1 
ATOM   1790  C  CD2   . PHE A 1 253  ? 34.140  11.479  127.704 1.00 43.25  ? 252  PHE A CD2   1 
ATOM   1791  C  CE1   . PHE A 1 253  ? 33.666  11.045  130.368 1.00 41.45  ? 252  PHE A CE1   1 
ATOM   1792  C  CE2   . PHE A 1 253  ? 34.933  12.082  128.650 1.00 42.58  ? 252  PHE A CE2   1 
ATOM   1793  C  CZ    . PHE A 1 253  ? 34.695  11.865  129.981 1.00 41.53  ? 252  PHE A CZ    1 
ATOM   1794  N  N     . GLY A 1 254  ? 32.111  7.619   124.547 1.00 44.74  ? 253  GLY A N     1 
ATOM   1795  C  CA    . GLY A 1 254  ? 31.236  6.852   123.684 1.00 46.02  ? 253  GLY A CA    1 
ATOM   1796  C  C     . GLY A 1 254  ? 30.967  5.463   124.223 1.00 46.09  ? 253  GLY A C     1 
ATOM   1797  O  O     . GLY A 1 254  ? 29.846  4.961   124.137 1.00 47.08  ? 253  GLY A O     1 
ATOM   1798  N  N     . ILE A 1 255  ? 31.989  4.827   124.796 1.00 45.17  ? 254  ILE A N     1 
ATOM   1799  C  CA    . ILE A 1 255  ? 31.824  3.485   125.337 1.00 45.30  ? 254  ILE A CA    1 
ATOM   1800  C  C     . ILE A 1 255  ? 30.965  3.455   126.586 1.00 45.10  ? 254  ILE A C     1 
ATOM   1801  O  O     . ILE A 1 255  ? 30.615  2.366   127.050 1.00 45.45  ? 254  ILE A O     1 
ATOM   1802  C  CB    . ILE A 1 255  ? 33.189  2.845   125.649 1.00 44.46  ? 254  ILE A CB    1 
ATOM   1803  C  CG1   . ILE A 1 255  ? 33.927  3.662   126.708 1.00 43.06  ? 254  ILE A CG1   1 
ATOM   1804  C  CG2   . ILE A 1 255  ? 34.025  2.752   124.400 1.00 44.85  ? 254  ILE A CG2   1 
ATOM   1805  C  CD1   . ILE A 1 255  ? 35.306  3.137   127.043 1.00 42.26  ? 254  ILE A CD1   1 
ATOM   1806  N  N     . LEU A 1 256  ? 30.614  4.615   127.140 1.00 44.68  ? 255  LEU A N     1 
ATOM   1807  C  CA    . LEU A 1 256  ? 29.776  4.689   128.329 1.00 44.59  ? 255  LEU A CA    1 
ATOM   1808  C  C     . LEU A 1 256  ? 28.316  4.944   128.007 1.00 45.88  ? 255  LEU A C     1 
ATOM   1809  O  O     . LEU A 1 256  ? 27.486  4.937   128.924 1.00 46.09  ? 255  LEU A O     1 
ATOM   1810  C  CB    . LEU A 1 256  ? 30.275  5.788   129.272 1.00 43.44  ? 255  LEU A CB    1 
ATOM   1811  C  CG    . LEU A 1 256  ? 31.668  5.622   129.873 1.00 42.13  ? 255  LEU A CG    1 
ATOM   1812  C  CD1   . LEU A 1 256  ? 32.114  6.928   130.473 1.00 41.27  ? 255  LEU A CD1   1 
ATOM   1813  C  CD2   . LEU A 1 256  ? 31.665  4.521   130.916 1.00 41.86  ? 255  LEU A CD2   1 
ATOM   1814  N  N     . ILE A 1 257  ? 27.996  5.190   126.734 1.00 46.83  ? 256  ILE A N     1 
ATOM   1815  C  CA    . ILE A 1 257  ? 26.611  5.305   126.303 1.00 48.26  ? 256  ILE A CA    1 
ATOM   1816  C  C     . ILE A 1 257  ? 25.864  4.039   126.687 1.00 49.04  ? 256  ILE A C     1 
ATOM   1817  O  O     . ILE A 1 257  ? 26.416  2.934   126.656 1.00 48.89  ? 256  ILE A O     1 
ATOM   1818  C  CB    . ILE A 1 257  ? 26.562  5.568   124.787 1.00 49.20  ? 256  ILE A CB    1 
ATOM   1819  C  CG1   . ILE A 1 257  ? 27.315  6.857   124.460 1.00 48.52  ? 256  ILE A CG1   1 
ATOM   1820  C  CG2   . ILE A 1 257  ? 25.131  5.668   124.290 1.00 50.81  ? 256  ILE A CG2   1 
ATOM   1821  C  CD1   . ILE A 1 257  ? 27.580  7.075   123.010 1.00 49.25  ? 256  ILE A CD1   1 
ATOM   1822  N  N     . GLY A 1 258  ? 24.608  4.199   127.078 1.00 53.46  ? 257  GLY A N     1 
ATOM   1823  C  CA    . GLY A 1 258  ? 23.827  3.073   127.541 1.00 53.59  ? 257  GLY A CA    1 
ATOM   1824  C  C     . GLY A 1 258  ? 23.559  2.044   126.460 1.00 53.37  ? 257  GLY A C     1 
ATOM   1825  O  O     . GLY A 1 258  ? 23.745  2.266   125.263 1.00 53.69  ? 257  GLY A O     1 
ATOM   1826  N  N     . LYS A 1 259  ? 23.124  0.875   126.909 1.00 52.74  ? 258  LYS A N     1 
ATOM   1827  C  CA    . LYS A 1 259  ? 22.678  -0.185  126.023 1.00 54.21  ? 258  LYS A CA    1 
ATOM   1828  C  C     . LYS A 1 259  ? 21.160  -0.173  125.909 1.00 55.92  ? 258  LYS A C     1 
ATOM   1829  O  O     . LYS A 1 259  ? 20.455  0.426   126.725 1.00 55.98  ? 258  LYS A O     1 
ATOM   1830  C  CB    . LYS A 1 259  ? 23.152  -1.554  126.512 1.00 54.15  ? 258  LYS A CB    1 
ATOM   1831  C  CG    . LYS A 1 259  ? 24.643  -1.743  126.426 1.00 52.82  ? 258  LYS A CG    1 
ATOM   1832  C  CD    . LYS A 1 259  ? 25.202  -1.141  125.159 1.00 52.72  ? 258  LYS A CD    1 
ATOM   1833  C  CE    . LYS A 1 259  ? 26.670  -1.463  125.014 1.00 51.66  ? 258  LYS A CE    1 
ATOM   1834  N  NZ    . LYS A 1 259  ? 26.916  -2.884  124.649 1.00 52.54  ? 258  LYS A NZ    1 
ATOM   1835  N  N     . CYS A 1 260  ? 20.667  -0.852  124.875 1.00 57.43  ? 259  CYS A N     1 
ATOM   1836  C  CA    . CYS A 1 260  ? 19.237  -0.903  124.617 1.00 59.27  ? 259  CYS A CA    1 
ATOM   1837  C  C     . CYS A 1 260  ? 18.514  -1.674  125.711 1.00 59.92  ? 259  CYS A C     1 
ATOM   1838  O  O     . CYS A 1 260  ? 19.035  -2.638  126.274 1.00 59.53  ? 259  CYS A O     1 
ATOM   1839  C  CB    . CYS A 1 260  ? 18.950  -1.552  123.257 1.00 60.81  ? 259  CYS A CB    1 
ATOM   1840  S  SG    . CYS A 1 260  ? 17.189  -1.607  122.809 1.00 63.29  ? 259  CYS A SG    1 
ATOM   1841  N  N     . THR A 1 261  ? 17.284  -1.241  125.988 1.00 61.07  ? 260  THR A N     1 
ATOM   1842  C  CA    . THR A 1 261  ? 16.451  -1.901  126.987 1.00 61.98  ? 260  THR A CA    1 
ATOM   1843  C  C     . THR A 1 261  ? 16.180  -3.361  126.638 1.00 65.51  ? 260  THR A C     1 
ATOM   1844  O  O     . THR A 1 261  ? 15.996  -4.183  127.541 1.00 66.97  ? 260  THR A O     1 
ATOM   1845  C  CB    . THR A 1 261  ? 15.137  -1.135  127.140 1.00 63.26  ? 260  THR A CB    1 
ATOM   1846  O  OG1   . THR A 1 261  ? 15.421  0.262   127.285 1.00 62.12  ? 260  THR A OG1   1 
ATOM   1847  C  CG2   . THR A 1 261  ? 14.356  -1.615  128.349 1.00 64.02  ? 260  THR A CG2   1 
ATOM   1848  N  N     . PHE A 1 262  ? 16.153  -3.717  125.349 1.00 64.37  ? 261  PHE A N     1 
ATOM   1849  C  CA    . PHE A 1 262  ? 15.920  -5.104  124.965 1.00 67.45  ? 261  PHE A CA    1 
ATOM   1850  C  C     . PHE A 1 262  ? 17.043  -5.740  124.165 1.00 74.65  ? 261  PHE A C     1 
ATOM   1851  O  O     . PHE A 1 262  ? 17.092  -6.970  124.090 1.00 73.30  ? 261  PHE A O     1 
ATOM   1852  C  CB    . PHE A 1 262  ? 14.620  -5.243  124.159 1.00 68.18  ? 261  PHE A CB    1 
ATOM   1853  C  CG    . PHE A 1 262  ? 13.388  -4.909  124.939 1.00 69.23  ? 261  PHE A CG    1 
ATOM   1854  C  CD1   . PHE A 1 262  ? 12.915  -3.611  124.984 1.00 69.01  ? 261  PHE A CD1   1 
ATOM   1855  C  CD2   . PHE A 1 262  ? 12.706  -5.889  125.634 1.00 70.55  ? 261  PHE A CD2   1 
ATOM   1856  C  CE1   . PHE A 1 262  ? 11.790  -3.294  125.705 1.00 70.09  ? 261  PHE A CE1   1 
ATOM   1857  C  CE2   . PHE A 1 262  ? 11.579  -5.578  126.359 1.00 71.63  ? 261  PHE A CE2   1 
ATOM   1858  C  CZ    . PHE A 1 262  ? 11.120  -4.277  126.394 1.00 71.39  ? 261  PHE A CZ    1 
ATOM   1859  N  N     . TYR A 1 263  ? 17.934  -4.955  123.563 1.00 89.67  ? 262  TYR A N     1 
ATOM   1860  C  CA    . TYR A 1 263  ? 19.109  -5.478  122.871 1.00 93.49  ? 262  TYR A CA    1 
ATOM   1861  C  C     . TYR A 1 263  ? 20.345  -5.134  123.691 1.00 91.76  ? 262  TYR A C     1 
ATOM   1862  O  O     . TYR A 1 263  ? 20.974  -4.091  123.465 1.00 93.27  ? 262  TYR A O     1 
ATOM   1863  C  CB    . TYR A 1 263  ? 19.216  -4.897  121.462 1.00 95.29  ? 262  TYR A CB    1 
ATOM   1864  N  N     . PRO A 1 264  ? 20.727  -5.970  124.664 1.00 90.15  ? 263  PRO A N     1 
ATOM   1865  C  CA    . PRO A 1 264  ? 21.850  -5.618  125.559 1.00 87.64  ? 263  PRO A CA    1 
ATOM   1866  C  C     . PRO A 1 264  ? 23.189  -5.414  124.862 1.00 86.49  ? 263  PRO A C     1 
ATOM   1867  O  O     . PRO A 1 264  ? 24.093  -4.835  125.478 1.00 83.58  ? 263  PRO A O     1 
ATOM   1868  C  CB    . PRO A 1 264  ? 21.936  -6.810  126.522 1.00 88.70  ? 263  PRO A CB    1 
ATOM   1869  C  CG    . PRO A 1 264  ? 20.729  -7.620  126.316 1.00 91.88  ? 263  PRO A CG    1 
ATOM   1870  C  CD    . PRO A 1 264  ? 19.988  -7.172  125.104 1.00 93.20  ? 263  PRO A CD    1 
ATOM   1871  N  N     . ASP A 1 265  ? 23.366  -5.886  123.629 1.00 87.31  ? 264  ASP A N     1 
ATOM   1872  C  CA    . ASP A 1 265  ? 24.619  -5.694  122.916 1.00 84.11  ? 264  ASP A CA    1 
ATOM   1873  C  C     . ASP A 1 265  ? 24.524  -4.597  121.877 1.00 76.87  ? 264  ASP A C     1 
ATOM   1874  O  O     . ASP A 1 265  ? 25.405  -4.489  121.020 1.00 80.55  ? 264  ASP A O     1 
ATOM   1875  C  CB    . ASP A 1 265  ? 25.073  -6.998  122.264 1.00 87.14  ? 264  ASP A CB    1 
ATOM   1876  C  CG    . ASP A 1 265  ? 25.068  -8.167  123.240 1.00 90.93  ? 264  ASP A CG    1 
ATOM   1877  O  OD1   . ASP A 1 265  ? 24.725  -7.965  124.423 1.00 92.74  ? 264  ASP A OD1   1 
ATOM   1878  O  OD2   . ASP A 1 265  ? 25.405  -9.293  122.825 1.00 94.04  ? 264  ASP A OD2   1 
ATOM   1879  N  N     . GLU A 1 266  ? 23.483  -3.779  121.945 1.00 71.62  ? 265  GLU A N     1 
ATOM   1880  C  CA    . GLU A 1 266  ? 23.281  -2.661  121.041 1.00 68.70  ? 265  GLU A CA    1 
ATOM   1881  C  C     . GLU A 1 266  ? 23.290  -1.381  121.857 1.00 56.89  ? 265  GLU A C     1 
ATOM   1882  O  O     . GLU A 1 266  ? 22.574  -1.277  122.855 1.00 56.88  ? 265  GLU A O     1 
ATOM   1883  C  CB    . GLU A 1 266  ? 21.953  -2.800  120.283 1.00 65.92  ? 265  GLU A CB    1 
ATOM   1884  C  CG    . GLU A 1 266  ? 21.973  -3.796  119.130 1.00 62.60  ? 265  GLU A CG    1 
ATOM   1885  C  CD    . GLU A 1 266  ? 22.706  -3.253  117.932 1.00 61.57  ? 265  GLU A CD    1 
ATOM   1886  O  OE1   . GLU A 1 266  ? 23.605  -3.945  117.416 1.00 63.38  ? 265  GLU A OE1   1 
ATOM   1887  O  OE2   . GLU A 1 266  ? 22.386  -2.124  117.511 1.00 63.88  ? 265  GLU A OE2   1 
ATOM   1888  N  N     . PHE A 1 267  ? 24.112  -0.420  121.449 1.00 55.87  ? 266  PHE A N     1 
ATOM   1889  C  CA    . PHE A 1 267  ? 24.052  0.906   122.038 1.00 54.88  ? 266  PHE A CA    1 
ATOM   1890  C  C     . PHE A 1 267  ? 22.744  1.587   121.666 1.00 56.17  ? 266  PHE A C     1 
ATOM   1891  O  O     . PHE A 1 267  ? 22.046  1.190   120.735 1.00 57.73  ? 266  PHE A O     1 
ATOM   1892  C  CB    . PHE A 1 267  ? 25.239  1.761   121.590 1.00 53.72  ? 266  PHE A CB    1 
ATOM   1893  C  CG    . PHE A 1 267  ? 26.533  1.369   122.236 1.00 52.26  ? 266  PHE A CG    1 
ATOM   1894  C  CD1   . PHE A 1 267  ? 26.903  1.909   123.471 1.00 50.86  ? 266  PHE A CD1   1 
ATOM   1895  C  CD2   . PHE A 1 267  ? 27.359  0.427   121.652 1.00 52.40  ? 266  PHE A CD2   1 
ATOM   1896  C  CE1   . PHE A 1 267  ? 28.085  1.532   124.085 1.00 49.61  ? 266  PHE A CE1   1 
ATOM   1897  C  CE2   . PHE A 1 267  ? 28.545  0.044   122.273 1.00 51.19  ? 266  PHE A CE2   1 
ATOM   1898  C  CZ    . PHE A 1 267  ? 28.903  0.603   123.488 1.00 49.78  ? 266  PHE A CZ    1 
ATOM   1899  N  N     . ARG A 1 268  ? 22.409  2.619   122.412 1.00 55.61  ? 267  ARG A N     1 
ATOM   1900  C  CA    . ARG A 1 268  ? 21.190  3.350   122.153 1.00 56.86  ? 267  ARG A CA    1 
ATOM   1901  C  C     . ARG A 1 268  ? 21.408  4.456   121.140 1.00 57.03  ? 267  ARG A C     1 
ATOM   1902  O  O     . ARG A 1 268  ? 22.535  4.848   120.834 1.00 55.95  ? 267  ARG A O     1 
ATOM   1903  C  CB    . ARG A 1 268  ? 20.653  3.966   123.427 1.00 56.44  ? 267  ARG A CB    1 
ATOM   1904  C  CG    . ARG A 1 268  ? 20.876  3.172   124.674 1.00 55.64  ? 267  ARG A CG    1 
ATOM   1905  C  CD    . ARG A 1 268  ? 20.588  4.034   125.857 1.00 55.01  ? 267  ARG A CD    1 
ATOM   1906  N  NE    . ARG A 1 268  ? 20.521  3.309   127.116 1.00 54.59  ? 267  ARG A NE    1 
ATOM   1907  C  CZ    . ARG A 1 268  ? 20.268  3.889   128.296 1.00 54.33  ? 267  ARG A CZ    1 
ATOM   1908  N  NH1   . ARG A 1 268  ? 20.022  5.210   128.390 1.00 56.55  ? 267  ARG A NH1   1 
ATOM   1909  N  NH2   . ARG A 1 268  ? 20.241  3.149   129.411 1.00 53.80  ? 267  ARG A NH2   1 
ATOM   1910  N  N     . ALA A 1 269  ? 20.291  4.973   120.648 1.00 63.30  ? 268  ALA A N     1 
ATOM   1911  C  CA    . ALA A 1 269  ? 20.256  6.043   119.675 1.00 63.78  ? 268  ALA A CA    1 
ATOM   1912  C  C     . ALA A 1 269  ? 20.280  7.396   120.362 1.00 63.23  ? 268  ALA A C     1 
ATOM   1913  O  O     . ALA A 1 269  ? 19.804  7.554   121.489 1.00 63.82  ? 268  ALA A O     1 
ATOM   1914  C  CB    . ALA A 1 269  ? 18.997  5.935   118.827 1.00 66.97  ? 268  ALA A CB    1 
ATOM   1915  N  N     . ALA A 1 270  ? 20.826  8.378   119.659 1.00 58.17  ? 269  ALA A N     1 
ATOM   1916  C  CA    . ALA A 1 270  ? 20.729  9.749   120.115 1.00 57.92  ? 269  ALA A CA    1 
ATOM   1917  C  C     . ALA A 1 270  ? 19.279  10.210  120.090 1.00 59.63  ? 269  ALA A C     1 
ATOM   1918  O  O     . ALA A 1 270  ? 18.490  9.801   119.238 1.00 61.19  ? 269  ALA A O     1 
ATOM   1919  C  CB    . ALA A 1 270  ? 21.584  10.664  119.246 1.00 57.66  ? 269  ALA A CB    1 
ATOM   1920  N  N     . LYS A 1 271  ? 18.925  11.058  121.054 1.00 59.42  ? 270  LYS A N     1 
ATOM   1921  C  CA    . LYS A 1 271  ? 17.616  11.696  121.032 1.00 61.13  ? 270  LYS A CA    1 
ATOM   1922  C  C     . LYS A 1 271  ? 17.386  12.413  119.712 1.00 62.47  ? 270  LYS A C     1 
ATOM   1923  O  O     . LYS A 1 271  ? 16.273  12.413  119.176 1.00 64.31  ? 270  LYS A O     1 
ATOM   1924  C  CB    . LYS A 1 271  ? 17.495  12.691  122.184 1.00 60.65  ? 270  LYS A CB    1 
ATOM   1925  C  CG    . LYS A 1 271  ? 17.681  12.095  123.571 1.00 59.43  ? 270  LYS A CG    1 
ATOM   1926  C  CD    . LYS A 1 271  ? 16.370  12.111  124.351 1.00 60.67  ? 270  LYS A CD    1 
ATOM   1927  C  CE    . LYS A 1 271  ? 16.592  12.466  125.824 1.00 59.58  ? 270  LYS A CE    1 
ATOM   1928  N  NZ    . LYS A 1 271  ? 16.762  11.303  126.732 1.00 58.70  ? 270  LYS A NZ    1 
ATOM   1929  N  N     . ALA A 1 272  ? 18.430  13.036  119.180 1.00 61.67  ? 271  ALA A N     1 
ATOM   1930  C  CA    . ALA A 1 272  ? 18.342  13.844  117.980 1.00 62.87  ? 271  ALA A CA    1 
ATOM   1931  C  C     . ALA A 1 272  ? 18.458  13.023  116.705 1.00 63.58  ? 271  ALA A C     1 
ATOM   1932  O  O     . ALA A 1 272  ? 18.478  13.601  115.616 1.00 66.00  ? 271  ALA A O     1 
ATOM   1933  C  CB    . ALA A 1 272  ? 19.424  14.923  118.003 1.00 61.83  ? 271  ALA A CB    1 
ATOM   1934  N  N     . SER A 1 273  ? 18.538  11.701  116.807 1.00 63.18  ? 272  SER A N     1 
ATOM   1935  C  CA    . SER A 1 273  ? 18.577  10.873  115.616 1.00 64.04  ? 272  SER A CA    1 
ATOM   1936  C  C     . SER A 1 273  ? 17.203  10.838  114.948 1.00 66.29  ? 272  SER A C     1 
ATOM   1937  O  O     . SER A 1 273  ? 16.173  11.089  115.576 1.00 67.09  ? 272  SER A O     1 
ATOM   1938  C  CB    . SER A 1 273  ? 19.036  9.462   115.970 1.00 63.13  ? 272  SER A CB    1 
ATOM   1939  O  OG    . SER A 1 273  ? 18.121  8.846   116.850 1.00 63.50  ? 272  SER A OG    1 
ATOM   1940  N  N     . TYR A 1 274  ? 17.192  10.523  113.652 1.00 67.42  ? 273  TYR A N     1 
ATOM   1941  C  CA    . TYR A 1 274  ? 15.920  10.425  112.944 1.00 69.66  ? 273  TYR A CA    1 
ATOM   1942  C  C     . TYR A 1 274  ? 15.084  9.277   113.492 1.00 70.22  ? 273  TYR A C     1 
ATOM   1943  O  O     . TYR A 1 274  ? 13.889  9.441   113.758 1.00 71.61  ? 273  TYR A O     1 
ATOM   1944  C  CB    . TYR A 1 274  ? 16.154  10.262  111.439 1.00 70.75  ? 273  TYR A CB    1 
ATOM   1945  C  CG    . TYR A 1 274  ? 14.881  10.309  110.615 1.00 73.20  ? 273  TYR A CG    1 
ATOM   1946  C  CD1   . TYR A 1 274  ? 14.127  9.165   110.403 1.00 74.37  ? 273  TYR A CD1   1 
ATOM   1947  C  CD2   . TYR A 1 274  ? 14.430  11.498  110.058 1.00 74.46  ? 273  TYR A CD2   1 
ATOM   1948  C  CE1   . TYR A 1 274  ? 12.966  9.201   109.671 1.00 76.68  ? 273  TYR A CE1   1 
ATOM   1949  C  CE2   . TYR A 1 274  ? 13.263  11.538  109.313 1.00 76.79  ? 273  TYR A CE2   1 
ATOM   1950  C  CZ    . TYR A 1 274  ? 12.539  10.383  109.125 1.00 77.88  ? 273  TYR A CZ    1 
ATOM   1951  O  OH    . TYR A 1 274  ? 11.379  10.397  108.391 1.00 80.28  ? 273  TYR A OH    1 
ATOM   1952  N  N     . THR A 1 275  ? 15.706  8.111   113.690 1.00 69.25  ? 274  THR A N     1 
ATOM   1953  C  CA    . THR A 1 275  ? 14.972  6.941   114.163 1.00 69.90  ? 274  THR A CA    1 
ATOM   1954  C  C     . THR A 1 275  ? 14.264  7.214   115.478 1.00 69.71  ? 274  THR A C     1 
ATOM   1955  O  O     . THR A 1 275  ? 13.129  6.778   115.683 1.00 71.17  ? 274  THR A O     1 
ATOM   1956  C  CB    . THR A 1 275  ? 15.910  5.760   114.343 1.00 68.67  ? 274  THR A CB    1 
ATOM   1957  O  OG1   . THR A 1 275  ? 16.679  5.563   113.159 1.00 68.78  ? 274  THR A OG1   1 
ATOM   1958  C  CG2   . THR A 1 275  ? 15.124  4.520   114.656 1.00 69.68  ? 274  THR A CG2   1 
ATOM   1959  N  N     . ALA A 1 276  ? 14.928  7.912   116.394 1.00 68.01  ? 275  ALA A N     1 
ATOM   1960  C  CA    . ALA A 1 276  ? 14.344  8.141   117.707 1.00 67.76  ? 275  ALA A CA    1 
ATOM   1961  C  C     . ALA A 1 276  ? 13.268  9.209   117.664 1.00 69.29  ? 275  ALA A C     1 
ATOM   1962  O  O     . ALA A 1 276  ? 12.331  9.168   118.465 1.00 70.05  ? 275  ALA A O     1 
ATOM   1963  C  CB    . ALA A 1 276  ? 15.431  8.528   118.709 1.00 65.50  ? 275  ALA A CB    1 
ATOM   1964  N  N     . GLN A 1 277  ? 13.389  10.168  116.744 1.00 69.86  ? 276  GLN A N     1 
ATOM   1965  C  CA    . GLN A 1 277  ? 12.349  11.178  116.594 1.00 71.57  ? 276  GLN A CA    1 
ATOM   1966  C  C     . GLN A 1 277  ? 11.095  10.589  115.970 1.00 73.88  ? 276  GLN A C     1 
ATOM   1967  O  O     . GLN A 1 277  ? 9.977   10.958  116.345 1.00 75.35  ? 276  GLN A O     1 
ATOM   1968  C  CB    . GLN A 1 277  ? 12.851  12.342  115.748 1.00 71.68  ? 276  GLN A CB    1 
ATOM   1969  C  CG    . GLN A 1 277  ? 13.977  13.120  116.370 1.00 69.73  ? 276  GLN A CG    1 
ATOM   1970  C  CD    . GLN A 1 277  ? 14.513  14.176  115.436 1.00 69.99  ? 276  GLN A CD    1 
ATOM   1971  O  OE1   . GLN A 1 277  ? 14.024  15.302  115.410 1.00 71.02  ? 276  GLN A OE1   1 
ATOM   1972  N  NE2   . GLN A 1 277  ? 15.524  13.818  114.660 1.00 69.19  ? 276  GLN A NE2   1 
ATOM   1973  N  N     . GLU A 1 278  ? 11.258  9.682   115.008 1.00 75.92  ? 277  GLU A N     1 
ATOM   1974  C  CA    . GLU A 1 278  ? 10.089  9.066   114.395 1.00 82.88  ? 277  GLU A CA    1 
ATOM   1975  C  C     . GLU A 1 278  ? 9.366   8.176   115.395 1.00 81.25  ? 277  GLU A C     1 
ATOM   1976  O  O     . GLU A 1 278  ? 8.139   8.248   115.525 1.00 82.58  ? 277  GLU A O     1 
ATOM   1977  C  CB    . GLU A 1 278  ? 10.495  8.279   113.147 1.00 84.11  ? 277  GLU A CB    1 
ATOM   1978  C  CG    . GLU A 1 278  ? 9.328   7.905   112.238 1.00 86.52  ? 277  GLU A CG    1 
ATOM   1979  C  CD    . GLU A 1 278  ? 9.766   7.162   110.989 1.00 86.89  ? 277  GLU A CD    1 
ATOM   1980  O  OE1   . GLU A 1 278  ? 10.865  6.582   111.002 1.00 84.86  ? 277  GLU A OE1   1 
ATOM   1981  O  OE2   . GLU A 1 278  ? 9.010   7.158   109.986 1.00 90.48  ? 277  GLU A OE2   1 
ATOM   1982  N  N     . PHE A 1 279  ? 10.112  7.346   116.125 1.00 75.25  ? 278  PHE A N     1 
ATOM   1983  C  CA    . PHE A 1 279  ? 9.504   6.514   117.156 1.00 75.50  ? 278  PHE A CA    1 
ATOM   1984  C  C     . PHE A 1 279  ? 8.800   7.363   118.206 1.00 75.77  ? 278  PHE A C     1 
ATOM   1985  O  O     . PHE A 1 279  ? 7.712   7.010   118.671 1.00 77.26  ? 278  PHE A O     1 
ATOM   1986  C  CB    . PHE A 1 279  ? 10.574  5.635   117.804 1.00 73.46  ? 278  PHE A CB    1 
ATOM   1987  C  CG    . PHE A 1 279  ? 10.106  4.897   119.030 1.00 73.44  ? 278  PHE A CG    1 
ATOM   1988  C  CD1   . PHE A 1 279  ? 9.486   3.665   118.915 1.00 74.78  ? 278  PHE A CD1   1 
ATOM   1989  C  CD2   . PHE A 1 279  ? 10.302  5.426   120.293 1.00 72.16  ? 278  PHE A CD2   1 
ATOM   1990  C  CE1   . PHE A 1 279  ? 9.060   2.981   120.031 1.00 74.89  ? 278  PHE A CE1   1 
ATOM   1991  C  CE2   . PHE A 1 279  ? 9.876   4.748   121.418 1.00 72.22  ? 278  PHE A CE2   1 
ATOM   1992  C  CZ    . PHE A 1 279  ? 9.255   3.523   121.286 1.00 73.60  ? 278  PHE A CZ    1 
ATOM   1993  N  N     . ASN A 1 280  ? 9.401   8.492   118.583 1.00 74.48  ? 279  ASN A N     1 
ATOM   1994  C  CA    . ASN A 1 280  ? 8.870   9.297   119.678 1.00 74.58  ? 279  ASN A CA    1 
ATOM   1995  C  C     . ASN A 1 280  ? 7.512   9.890   119.335 1.00 77.10  ? 279  ASN A C     1 
ATOM   1996  O  O     . ASN A 1 280  ? 6.591   9.869   120.159 1.00 78.13  ? 279  ASN A O     1 
ATOM   1997  C  CB    . ASN A 1 280  ? 9.853   10.407  120.041 1.00 72.80  ? 279  ASN A CB    1 
ATOM   1998  C  CG    . ASN A 1 280  ? 10.896  9.960   121.043 1.00 70.46  ? 279  ASN A CG    1 
ATOM   1999  O  OD1   . ASN A 1 280  ? 10.688  9.007   121.788 1.00 70.28  ? 279  ASN A OD1   1 
ATOM   2000  N  ND2   . ASN A 1 280  ? 12.019  10.657  121.070 1.00 68.77  ? 279  ASN A ND2   1 
ATOM   2001  N  N     . LEU A 1 281  ? 7.372   10.439  118.127 1.00 78.22  ? 280  LEU A N     1 
ATOM   2002  C  CA    . LEU A 1 281  ? 6.103   11.045  117.746 1.00 80.74  ? 280  LEU A CA    1 
ATOM   2003  C  C     . LEU A 1 281  ? 5.062   9.989   117.404 1.00 82.72  ? 280  LEU A C     1 
ATOM   2004  O  O     . LEU A 1 281  ? 3.884   10.152  117.733 1.00 84.64  ? 280  LEU A O     1 
ATOM   2005  C  CB    . LEU A 1 281  ? 6.309   11.998  116.573 1.00 81.38  ? 280  LEU A CB    1 
ATOM   2006  C  CG    . LEU A 1 281  ? 5.134   12.924  116.279 1.00 83.85  ? 280  LEU A CG    1 
ATOM   2007  C  CD1   . LEU A 1 281  ? 4.591   13.480  117.581 1.00 84.00  ? 280  LEU A CD1   1 
ATOM   2008  C  CD2   . LEU A 1 281  ? 5.567   14.051  115.362 1.00 84.06  ? 280  LEU A CD2   1 
ATOM   2009  N  N     . LEU A 1 282  ? 5.479   8.899   116.753 1.00 82.41  ? 281  LEU A N     1 
ATOM   2010  C  CA    . LEU A 1 282  ? 4.558   7.808   116.441 1.00 84.30  ? 281  LEU A CA    1 
ATOM   2011  C  C     . LEU A 1 282  ? 3.852   7.297   117.689 1.00 84.70  ? 281  LEU A C     1 
ATOM   2012  O  O     . LEU A 1 282  ? 2.626   7.147   117.704 1.00 86.98  ? 281  LEU A O     1 
ATOM   2013  C  CB    . LEU A 1 282  ? 5.303   6.658   115.763 1.00 83.57  ? 281  LEU A CB    1 
ATOM   2014  C  CG    . LEU A 1 282  ? 4.957   6.484   114.291 1.00 85.35  ? 281  LEU A CG    1 
ATOM   2015  C  CD1   . LEU A 1 282  ? 5.291   7.763   113.617 1.00 85.22  ? 281  LEU A CD1   1 
ATOM   2016  C  CD2   . LEU A 1 282  ? 5.731   5.344   113.669 1.00 84.67  ? 281  LEU A CD2   1 
ATOM   2017  N  N     . ASN A 1 283  ? 4.619   6.999   118.743 1.00 82.59  ? 282  ASN A N     1 
ATOM   2018  C  CA    . ASN A 1 283  ? 4.019   6.519   119.985 1.00 82.91  ? 282  ASN A CA    1 
ATOM   2019  C  C     . ASN A 1 283  ? 3.234   7.622   120.674 1.00 83.85  ? 282  ASN A C     1 
ATOM   2020  O  O     . ASN A 1 283  ? 2.236   7.342   121.344 1.00 85.36  ? 282  ASN A O     1 
ATOM   2021  C  CB    . ASN A 1 283  ? 5.099   5.952   120.914 1.00 80.85  ? 282  ASN A CB    1 
ATOM   2022  C  CG    . ASN A 1 283  ? 4.547   5.489   122.256 1.00 82.38  ? 282  ASN A CG    1 
ATOM   2023  O  OD1   . ASN A 1 283  ? 4.277   6.289   123.154 1.00 80.56  ? 282  ASN A OD1   1 
ATOM   2024  N  ND2   . ASN A 1 283  ? 4.351   4.186   122.380 1.00 83.32  ? 282  ASN A ND2   1 
ATOM   2025  N  N     . ASP A 1 284  ? 3.656   8.875   120.506 1.00 83.15  ? 283  ASP A N     1 
ATOM   2026  C  CA    . ASP A 1 284  ? 2.868   9.991   121.013 1.00 84.37  ? 283  ASP A CA    1 
ATOM   2027  C  C     . ASP A 1 284  ? 1.487   10.003  120.383 1.00 87.42  ? 283  ASP A C     1 
ATOM   2028  O  O     . ASP A 1 284  ? 0.475   10.163  121.076 1.00 89.02  ? 283  ASP A O     1 
ATOM   2029  C  CB    . ASP A 1 284  ? 3.584   11.311  120.738 1.00 87.10  ? 283  ASP A CB    1 
ATOM   2030  C  CG    . ASP A 1 284  ? 4.406   11.790  121.914 1.00 83.06  ? 283  ASP A CG    1 
ATOM   2031  O  OD1   . ASP A 1 284  ? 4.619   11.009  122.868 1.00 83.36  ? 283  ASP A OD1   1 
ATOM   2032  O  OD2   . ASP A 1 284  ? 4.843   12.958  121.880 1.00 81.44  ? 283  ASP A OD2   1 
ATOM   2033  N  N     . LEU A 1 285  ? 1.429   9.817   119.061 1.00 88.37  ? 284  LEU A N     1 
ATOM   2034  C  CA    . LEU A 1 285  ? 0.168   9.944   118.345 1.00 91.34  ? 284  LEU A CA    1 
ATOM   2035  C  C     . LEU A 1 285  ? -0.789  8.814   118.696 1.00 92.99  ? 284  LEU A C     1 
ATOM   2036  O  O     . LEU A 1 285  ? -1.979  9.057   118.918 1.00 95.32  ? 284  LEU A O     1 
ATOM   2037  C  CB    . LEU A 1 285  ? 0.422   9.999   116.838 1.00 91.88  ? 284  LEU A CB    1 
ATOM   2038  C  CG    . LEU A 1 285  ? 1.294   11.175  116.398 1.00 90.61  ? 284  LEU A CG    1 
ATOM   2039  C  CD1   . LEU A 1 285  ? 1.709   11.048  114.924 1.00 90.90  ? 284  LEU A CD1   1 
ATOM   2040  C  CD2   . LEU A 1 285  ? 0.605   12.519  116.687 1.00 91.99  ? 284  LEU A CD2   1 
ATOM   2041  N  N     . ASN A 1 286  ? -0.294  7.576   118.754 1.00 91.96  ? 285  ASN A N     1 
ATOM   2042  C  CA    . ASN A 1 286  ? -1.180  6.457   119.051 1.00 93.65  ? 285  ASN A CA    1 
ATOM   2043  C  C     . ASN A 1 286  ? -1.740  6.540   120.463 1.00 96.26  ? 285  ASN A C     1 
ATOM   2044  O  O     . ASN A 1 286  ? -2.848  6.059   120.719 1.00 96.17  ? 285  ASN A O     1 
ATOM   2045  C  CB    . ASN A 1 286  ? -0.450  5.139   118.835 1.00 92.47  ? 285  ASN A CB    1 
ATOM   2046  C  CG    . ASN A 1 286  ? 0.031   4.984   117.420 1.00 92.48  ? 285  ASN A CG    1 
ATOM   2047  O  OD1   . ASN A 1 286  ? 0.195   5.972   116.692 1.00 92.52  ? 285  ASN A OD1   1 
ATOM   2048  N  ND2   . ASN A 1 286  ? 0.248   3.741   117.004 1.00 92.59  ? 285  ASN A ND2   1 
ATOM   2049  N  N     . ASN A 1 287  ? -1.007  7.155   121.387 1.00 97.86  ? 286  ASN A N     1 
ATOM   2050  C  CA    . ASN A 1 287  ? -1.537  7.309   122.733 1.00 99.69  ? 286  ASN A CA    1 
ATOM   2051  C  C     . ASN A 1 287  ? -2.600  8.393   122.816 1.00 104.67 ? 286  ASN A C     1 
ATOM   2052  O  O     . ASN A 1 287  ? -3.240  8.527   123.864 1.00 111.36 ? 286  ASN A O     1 
ATOM   2053  C  CB    . ASN A 1 287  ? -0.399  7.589   123.710 1.00 96.82  ? 286  ASN A CB    1 
ATOM   2054  C  CG    . ASN A 1 287  ? 0.480   6.380   123.922 1.00 94.64  ? 286  ASN A CG    1 
ATOM   2055  O  OD1   . ASN A 1 287  ? 0.026   5.245   123.801 1.00 96.22  ? 286  ASN A OD1   1 
ATOM   2056  N  ND2   . ASN A 1 287  ? 1.744   6.612   124.235 1.00 90.87  ? 286  ASN A ND2   1 
ATOM   2057  N  N     . LEU A 1 288  ? -2.807  9.159   121.747 1.00 97.21  ? 287  LEU A N     1 
ATOM   2058  C  CA    . LEU A 1 288  ? -3.975  10.017  121.692 1.00 98.03  ? 287  LEU A CA    1 
ATOM   2059  C  C     . LEU A 1 288  ? -5.225  9.161   121.496 1.00 100.86 ? 287  LEU A C     1 
ATOM   2060  O  O     . LEU A 1 288  ? -5.156  7.964   121.200 1.00 100.84 ? 287  LEU A O     1 
ATOM   2061  C  CB    . LEU A 1 288  ? -3.850  11.045  120.564 1.00 98.51  ? 287  LEU A CB    1 
ATOM   2062  C  CG    . LEU A 1 288  ? -2.573  11.876  120.421 1.00 95.97  ? 287  LEU A CG    1 
ATOM   2063  C  CD1   . LEU A 1 288  ? -2.365  12.274  118.951 1.00 96.51  ? 287  LEU A CD1   1 
ATOM   2064  C  CD2   . LEU A 1 288  ? -2.607  13.120  121.318 1.00 95.79  ? 287  LEU A CD2   1 
ATOM   2065  N  N     . THR A 1 289  ? -6.382  9.784   121.683 1.00 103.44 ? 288  THR A N     1 
ATOM   2066  C  CA    . THR A 1 289  ? -7.661  9.165   121.362 1.00 106.55 ? 288  THR A CA    1 
ATOM   2067  C  C     . THR A 1 289  ? -8.507  10.185  120.619 1.00 109.05 ? 288  THR A C     1 
ATOM   2068  O  O     . THR A 1 289  ? -8.665  11.319  121.082 1.00 109.34 ? 288  THR A O     1 
ATOM   2069  C  CB    . THR A 1 289  ? -8.385  8.665   122.615 1.00 107.60 ? 288  THR A CB    1 
ATOM   2070  O  OG1   . THR A 1 289  ? -8.387  9.693   123.613 1.00 107.18 ? 288  THR A OG1   1 
ATOM   2071  C  CG2   . THR A 1 289  ? -7.694  7.423   123.166 1.00 105.68 ? 288  THR A CG2   1 
ATOM   2072  N  N     . VAL A 1 290  ? -9.035  9.787   119.468 1.00 110.93 ? 289  VAL A N     1 
ATOM   2073  C  CA    . VAL A 1 290  ? -9.678  10.732  118.562 1.00 113.14 ? 289  VAL A CA    1 
ATOM   2074  C  C     . VAL A 1 290  ? -11.062 10.228  118.170 1.00 116.72 ? 289  VAL A C     1 
ATOM   2075  O  O     . VAL A 1 290  ? -11.308 9.013   118.187 1.00 117.21 ? 289  VAL A O     1 
ATOM   2076  C  CB    . VAL A 1 290  ? -8.794  10.976  117.330 1.00 111.81 ? 289  VAL A CB    1 
ATOM   2077  C  CG1   . VAL A 1 290  ? -7.683  11.947  117.676 1.00 109.13 ? 289  VAL A CG1   1 
ATOM   2078  C  CG2   . VAL A 1 290  ? -8.204  9.670   116.858 1.00 110.56 ? 289  VAL A CG2   1 
ATOM   2079  N  N     . PRO A 1 291  ? -11.997 11.124  117.830 1.00 119.40 ? 290  PRO A N     1 
ATOM   2080  C  CA    . PRO A 1 291  ? -13.335 10.662  117.415 1.00 123.00 ? 290  PRO A CA    1 
ATOM   2081  C  C     . PRO A 1 291  ? -13.316 9.797   116.171 1.00 123.63 ? 290  PRO A C     1 
ATOM   2082  O  O     . PRO A 1 291  ? -14.005 8.772   116.117 1.00 125.37 ? 290  PRO A O     1 
ATOM   2083  C  CB    . PRO A 1 291  ? -14.097 11.976  117.180 1.00 125.37 ? 290  PRO A CB    1 
ATOM   2084  C  CG    . PRO A 1 291  ? -13.035 13.011  116.972 1.00 122.99 ? 290  PRO A CG    1 
ATOM   2085  C  CD    . PRO A 1 291  ? -11.903 12.593  117.857 1.00 119.45 ? 290  PRO A CD    1 
ATOM   2086  N  N     . THR A 1 292  ? -12.542 10.180  115.166 1.00 122.36 ? 291  THR A N     1 
ATOM   2087  C  CA    . THR A 1 292  ? -12.470 9.412   113.936 1.00 122.96 ? 291  THR A CA    1 
ATOM   2088  C  C     . THR A 1 292  ? -11.313 8.418   114.001 1.00 119.97 ? 291  THR A C     1 
ATOM   2089  O  O     . THR A 1 292  ? -11.193 7.651   114.958 1.00 118.99 ? 291  THR A O     1 
ATOM   2090  C  CB    . THR A 1 292  ? -12.298 10.332  112.708 1.00 123.52 ? 291  THR A CB    1 
ATOM   2091  O  OG1   . THR A 1 292  ? -13.129 11.491  112.853 1.00 125.70 ? 291  THR A OG1   1 
ATOM   2092  C  CG2   . THR A 1 292  ? -12.686 9.599   111.436 1.00 125.39 ? 291  THR A CG2   1 
ATOM   2093  N  N     . LYS A 1 296  ? -8.646  6.404   117.527 1.00 111.17 ? 295  LYS A N     1 
ATOM   2094  C  CA    . LYS A 1 296  ? -7.268  6.232   117.087 1.00 108.24 ? 295  LYS A CA    1 
ATOM   2095  C  C     . LYS A 1 296  ? -7.075  6.663   115.637 1.00 108.75 ? 295  LYS A C     1 
ATOM   2096  O  O     . LYS A 1 296  ? -7.849  6.292   114.756 1.00 111.19 ? 295  LYS A O     1 
ATOM   2097  C  CB    . LYS A 1 296  ? -6.830  4.778   117.256 1.00 107.31 ? 295  LYS A CB    1 
ATOM   2098  N  N     . LEU A 1 297  ? -6.028  7.448   115.401 1.00 106.49 ? 296  LEU A N     1 
ATOM   2099  C  CA    . LEU A 1 297  ? -5.682  7.873   114.054 1.00 106.70 ? 296  LEU A CA    1 
ATOM   2100  C  C     . LEU A 1 297  ? -5.258  6.678   113.204 1.00 106.46 ? 296  LEU A C     1 
ATOM   2101  O  O     . LEU A 1 297  ? -4.735  5.683   113.710 1.00 105.02 ? 296  LEU A O     1 
ATOM   2102  C  CB    . LEU A 1 297  ? -4.559  8.906   114.101 1.00 104.20 ? 296  LEU A CB    1 
ATOM   2103  C  CG    . LEU A 1 297  ? -4.890  10.180  114.873 1.00 104.44 ? 296  LEU A CG    1 
ATOM   2104  C  CD1   . LEU A 1 297  ? -3.686  10.638  115.667 1.00 101.29 ? 296  LEU A CD1   1 
ATOM   2105  C  CD2   . LEU A 1 297  ? -5.341  11.271  113.934 1.00 106.28 ? 296  LEU A CD2   1 
ATOM   2106  N  N     . SER A 1 298  ? -5.493  6.783   111.899 1.00 108.01 ? 297  SER A N     1 
ATOM   2107  C  CA    . SER A 1 298  ? -5.154  5.704   110.984 1.00 108.12 ? 297  SER A CA    1 
ATOM   2108  C  C     . SER A 1 298  ? -3.676  5.754   110.617 1.00 105.25 ? 297  SER A C     1 
ATOM   2109  O  O     . SER A 1 298  ? -2.968  6.721   110.913 1.00 103.41 ? 297  SER A O     1 
ATOM   2110  C  CB    . SER A 1 298  ? -5.982  5.796   109.711 1.00 111.01 ? 297  SER A CB    1 
ATOM   2111  O  OG    . SER A 1 298  ? -5.715  7.013   109.051 1.00 110.90 ? 297  SER A OG    1 
ATOM   2112  N  N     . LYS A 1 299  ? -3.215  4.695   109.940 1.00 105.03 ? 298  LYS A N     1 
ATOM   2113  C  CA    . LYS A 1 299  ? -1.849  4.692   109.432 1.00 102.67 ? 298  LYS A CA    1 
ATOM   2114  C  C     . LYS A 1 299  ? -1.602  5.923   108.591 1.00 102.75 ? 298  LYS A C     1 
ATOM   2115  O  O     . LYS A 1 299  ? -0.702  6.718   108.877 1.00 100.61 ? 298  LYS A O     1 
ATOM   2116  C  CB    . LYS A 1 299  ? -1.553  3.445   108.603 1.00 103.10 ? 298  LYS A CB    1 
ATOM   2117  C  CG    . LYS A 1 299  ? -0.415  3.680   107.604 1.00 101.73 ? 298  LYS A CG    1 
ATOM   2118  C  CD    . LYS A 1 299  ? 0.411   2.443   107.400 1.00 100.66 ? 298  LYS A CD    1 
ATOM   2119  C  CE    . LYS A 1 299  ? -0.478  1.234   107.240 1.00 102.94 ? 298  LYS A CE    1 
ATOM   2120  N  NZ    . LYS A 1 299  ? 0.322   -0.015  107.261 1.00 101.87 ? 298  LYS A NZ    1 
ATOM   2121  N  N     . GLU A 1 300  ? -2.401  6.094   107.541 1.00 105.34 ? 299  GLU A N     1 
ATOM   2122  C  CA    . GLU A 1 300  ? -2.267  7.294   106.739 1.00 105.74 ? 299  GLU A CA    1 
ATOM   2123  C  C     . GLU A 1 300  ? -2.297  8.514   107.638 1.00 104.92 ? 299  GLU A C     1 
ATOM   2124  O  O     . GLU A 1 300  ? -1.374  9.328   107.608 1.00 103.10 ? 299  GLU A O     1 
ATOM   2125  C  CB    . GLU A 1 300  ? -3.356  7.350   105.660 1.00 109.04 ? 299  GLU A CB    1 
ATOM   2126  C  CG    . GLU A 1 300  ? -2.886  6.656   104.370 1.00 109.43 ? 299  GLU A CG    1 
ATOM   2127  C  CD    . GLU A 1 300  ? -3.828  6.796   103.167 1.00 112.62 ? 299  GLU A CD    1 
ATOM   2128  O  OE1   . GLU A 1 300  ? -3.628  6.059   102.175 1.00 113.34 ? 299  GLU A OE1   1 
ATOM   2129  O  OE2   . GLU A 1 300  ? -4.748  7.638   103.197 1.00 114.48 ? 299  GLU A OE2   1 
ATOM   2130  N  N     . GLN A 1 301  ? -3.275  8.586   108.546 1.00 106.10 ? 300  GLN A N     1 
ATOM   2131  C  CA    . GLN A 1 301  ? -3.430  9.810   109.328 1.00 105.78 ? 300  GLN A CA    1 
ATOM   2132  C  C     . GLN A 1 301  ? -2.144  10.300  109.999 1.00 102.55 ? 300  GLN A C     1 
ATOM   2133  O  O     . GLN A 1 301  ? -1.990  11.511  110.193 1.00 102.22 ? 300  GLN A O     1 
ATOM   2134  C  CB    . GLN A 1 301  ? -4.556  9.648   110.341 1.00 107.27 ? 300  GLN A CB    1 
ATOM   2135  C  CG    . GLN A 1 301  ? -5.870  9.955   109.708 1.00 110.73 ? 300  GLN A CG    1 
ATOM   2136  C  CD    . GLN A 1 301  ? -7.053  9.694   110.603 1.00 112.59 ? 300  GLN A CD    1 
ATOM   2137  O  OE1   . GLN A 1 301  ? -7.514  8.560   110.720 1.00 113.48 ? 300  GLN A OE1   1 
ATOM   2138  N  NE2   . GLN A 1 301  ? -7.602  10.755  111.185 1.00 113.48 ? 300  GLN A NE2   1 
ATOM   2139  N  N     . LYS A 1 302  ? -1.198  9.401   110.299 1.00 100.28 ? 301  LYS A N     1 
ATOM   2140  C  CA    . LYS A 1 302  ? 0.072   9.805   110.914 1.00 97.70  ? 301  LYS A CA    1 
ATOM   2141  C  C     . LYS A 1 302  ? 1.053   10.363  109.900 1.00 96.62  ? 301  LYS A C     1 
ATOM   2142  O  O     . LYS A 1 302  ? 1.721   11.366  110.174 1.00 94.89  ? 301  LYS A O     1 
ATOM   2143  C  CB    . LYS A 1 302  ? 0.700   8.638   111.686 1.00 95.30  ? 301  LYS A CB    1 
ATOM   2144  C  CG    . LYS A 1 302  ? -0.335  7.871   112.487 1.00 96.67  ? 301  LYS A CG    1 
ATOM   2145  C  CD    . LYS A 1 302  ? 0.083   6.441   112.709 1.00 95.74  ? 301  LYS A CD    1 
ATOM   2146  C  CE    . LYS A 1 302  ? -0.908  5.692   113.602 1.00 97.08  ? 301  LYS A CE    1 
ATOM   2147  N  NZ    . LYS A 1 302  ? -0.715  4.242   113.328 1.00 97.16  ? 301  LYS A NZ    1 
ATOM   2148  N  N     . ASN A 1 303  ? 1.202   9.696   108.755 1.00 97.01  ? 302  ASN A N     1 
ATOM   2149  C  CA    . ASN A 1 303  ? 2.134   10.195  107.752 1.00 96.25  ? 302  ASN A CA    1 
ATOM   2150  C  C     . ASN A 1 303  ? 1.757   11.585  107.289 1.00 97.58  ? 302  ASN A C     1 
ATOM   2151  O  O     . ASN A 1 303  ? 2.631   12.350  106.878 1.00 96.50  ? 302  ASN A O     1 
ATOM   2152  C  CB    . ASN A 1 303  ? 2.225   9.271   106.522 1.00 97.24  ? 302  ASN A CB    1 
ATOM   2153  C  CG    . ASN A 1 303  ? 2.295   7.804   106.884 1.00 96.74  ? 302  ASN A CG    1 
ATOM   2154  O  OD1   . ASN A 1 303  ? 1.317   7.220   107.342 1.00 98.14  ? 302  ASN A OD1   1 
ATOM   2155  N  ND2   . ASN A 1 303  ? 3.448   7.192   106.653 1.00 94.91  ? 302  ASN A ND2   1 
ATOM   2156  N  N     . GLN A 1 304  ? 0.477   11.934  107.354 1.00 100.01 ? 303  GLN A N     1 
ATOM   2157  C  CA    . GLN A 1 304  ? 0.113   13.327  107.138 1.00 101.23 ? 303  GLN A CA    1 
ATOM   2158  C  C     . GLN A 1 304  ? 0.853   14.223  108.107 1.00 99.11  ? 303  GLN A C     1 
ATOM   2159  O  O     . GLN A 1 304  ? 1.551   15.153  107.698 1.00 98.46  ? 303  GLN A O     1 
ATOM   2160  C  CB    . GLN A 1 304  ? -1.392  13.568  107.295 1.00 109.85 ? 303  GLN A CB    1 
ATOM   2161  C  CG    . GLN A 1 304  ? -2.230  13.180  106.104 1.00 112.07 ? 303  GLN A CG    1 
ATOM   2162  C  CD    . GLN A 1 304  ? -2.391  11.707  105.968 1.00 111.51 ? 303  GLN A CD    1 
ATOM   2163  O  OE1   . GLN A 1 304  ? -1.517  11.013  105.448 1.00 109.62 ? 303  GLN A OE1   1 
ATOM   2164  N  NE2   . GLN A 1 304  ? -3.517  11.214  106.394 1.00 113.40 ? 303  GLN A NE2   1 
ATOM   2165  N  N     . ILE A 1 305  ? 0.706   13.959  109.404 1.00 98.10  ? 304  ILE A N     1 
ATOM   2166  C  CA    . ILE A 1 305  ? 1.235   14.869  110.410 1.00 96.44  ? 304  ILE A CA    1 
ATOM   2167  C  C     . ILE A 1 305  ? 2.756   14.853  110.385 1.00 93.59  ? 304  ILE A C     1 
ATOM   2168  O  O     . ILE A 1 305  ? 3.408   15.893  110.529 1.00 92.62  ? 304  ILE A O     1 
ATOM   2169  C  CB    . ILE A 1 305  ? 0.665   14.485  111.785 1.00 96.23  ? 304  ILE A CB    1 
ATOM   2170  C  CG1   . ILE A 1 305  ? -0.792  14.050  111.615 1.00 99.14  ? 304  ILE A CG1   1 
ATOM   2171  C  CG2   . ILE A 1 305  ? 0.797   15.647  112.749 1.00 95.56  ? 304  ILE A CG2   1 
ATOM   2172  C  CD1   . ILE A 1 305  ? -1.541  13.776  112.888 1.00 99.53  ? 304  ILE A CD1   1 
ATOM   2173  N  N     . ILE A 1 306  ? 3.342   13.677  110.162 1.00 92.36  ? 305  ILE A N     1 
ATOM   2174  C  CA    . ILE A 1 306  ? 4.794   13.562  110.091 1.00 89.79  ? 305  ILE A CA    1 
ATOM   2175  C  C     . ILE A 1 306  ? 5.340   14.412  108.962 1.00 90.13  ? 305  ILE A C     1 
ATOM   2176  O  O     . ILE A 1 306  ? 6.249   15.227  109.159 1.00 88.64  ? 305  ILE A O     1 
ATOM   2177  C  CB    . ILE A 1 306  ? 5.200   12.094  109.923 1.00 88.92  ? 305  ILE A CB    1 
ATOM   2178  C  CG1   . ILE A 1 306  ? 4.875   11.352  111.205 1.00 88.20  ? 305  ILE A CG1   1 
ATOM   2179  C  CG2   . ILE A 1 306  ? 6.672   11.990  109.554 1.00 86.73  ? 305  ILE A CG2   1 
ATOM   2180  C  CD1   . ILE A 1 306  ? 5.575   10.086  111.312 1.00 86.75  ? 305  ILE A CD1   1 
ATOM   2181  N  N     . ASN A 1 307  ? 4.814   14.204  107.752 1.00 92.16  ? 306  ASN A N     1 
ATOM   2182  C  CA    . ASN A 1 307  ? 5.197   15.039  106.625 1.00 93.16  ? 306  ASN A CA    1 
ATOM   2183  C  C     . ASN A 1 307  ? 4.930   16.507  106.920 1.00 93.59  ? 306  ASN A C     1 
ATOM   2184  O  O     . ASN A 1 307  ? 5.783   17.360  106.663 1.00 92.73  ? 306  ASN A O     1 
ATOM   2185  C  CB    . ASN A 1 307  ? 4.455   14.591  105.364 1.00 95.34  ? 306  ASN A CB    1 
ATOM   2186  C  CG    . ASN A 1 307  ? 5.227   13.552  104.575 1.00 94.55  ? 306  ASN A CG    1 
ATOM   2187  O  OD1   . ASN A 1 307  ? 5.835   13.861  103.550 1.00 94.72  ? 306  ASN A OD1   1 
ATOM   2188  N  ND2   . ASN A 1 307  ? 5.221   12.315  105.058 1.00 93.77  ? 306  ASN A ND2   1 
ATOM   2189  N  N     . TYR A 1 308  ? 3.764   16.826  107.481 1.00 95.23  ? 307  TYR A N     1 
ATOM   2190  C  CA    . TYR A 1 308  ? 3.450   18.229  107.729 1.00 107.33 ? 307  TYR A CA    1 
ATOM   2191  C  C     . TYR A 1 308  ? 4.486   18.873  108.642 1.00 101.57 ? 307  TYR A C     1 
ATOM   2192  O  O     . TYR A 1 308  ? 5.014   19.948  108.339 1.00 100.32 ? 307  TYR A O     1 
ATOM   2193  C  CB    . TYR A 1 308  ? 2.053   18.373  108.324 1.00 107.43 ? 307  TYR A CB    1 
ATOM   2194  C  CG    . TYR A 1 308  ? 1.834   19.733  108.941 1.00 105.49 ? 307  TYR A CG    1 
ATOM   2195  C  CD1   . TYR A 1 308  ? 1.901   20.890  108.171 1.00 104.79 ? 307  TYR A CD1   1 
ATOM   2196  C  CD2   . TYR A 1 308  ? 1.583   19.862  110.298 1.00 104.15 ? 307  TYR A CD2   1 
ATOM   2197  C  CE1   . TYR A 1 308  ? 1.710   22.134  108.738 1.00 105.37 ? 307  TYR A CE1   1 
ATOM   2198  C  CE2   . TYR A 1 308  ? 1.391   21.093  110.871 1.00 104.57 ? 307  TYR A CE2   1 
ATOM   2199  C  CZ    . TYR A 1 308  ? 1.456   22.227  110.093 1.00 105.72 ? 307  TYR A CZ    1 
ATOM   2200  O  OH    . TYR A 1 308  ? 1.262   23.456  110.680 1.00 106.73 ? 307  TYR A OH    1 
ATOM   2201  N  N     . VAL A 1 309  ? 4.812   18.215  109.754 1.00 105.40 ? 308  VAL A N     1 
ATOM   2202  C  CA    . VAL A 1 309  ? 5.740   18.822  110.701 1.00 104.60 ? 308  VAL A CA    1 
ATOM   2203  C  C     . VAL A 1 309  ? 7.164   18.755  110.182 1.00 105.89 ? 308  VAL A C     1 
ATOM   2204  O  O     . VAL A 1 309  ? 7.977   19.643  110.463 1.00 106.23 ? 308  VAL A O     1 
ATOM   2205  C  CB    . VAL A 1 309  ? 5.593   18.146  112.072 1.00 107.22 ? 308  VAL A CB    1 
ATOM   2206  C  CG1   . VAL A 1 309  ? 4.148   18.187  112.469 1.00 110.85 ? 308  VAL A CG1   1 
ATOM   2207  C  CG2   . VAL A 1 309  ? 6.092   16.705  112.028 1.00 107.50 ? 308  VAL A CG2   1 
ATOM   2208  N  N     . LYS A 1 310  ? 7.490   17.728  109.402 1.00 96.78  ? 309  LYS A N     1 
ATOM   2209  C  CA    . LYS A 1 310  ? 8.857   17.588  108.928 1.00 85.49  ? 309  LYS A CA    1 
ATOM   2210  C  C     . LYS A 1 310  ? 9.223   18.707  107.964 1.00 86.41  ? 309  LYS A C     1 
ATOM   2211  O  O     . LYS A 1 310  ? 10.351  19.213  107.996 1.00 84.89  ? 309  LYS A O     1 
ATOM   2212  C  CB    . LYS A 1 310  ? 9.044   16.225  108.269 1.00 85.28  ? 309  LYS A CB    1 
ATOM   2213  C  CG    . LYS A 1 310  ? 10.485  15.780  108.219 1.00 82.94  ? 309  LYS A CG    1 
ATOM   2214  C  CD    . LYS A 1 310  ? 10.813  15.030  106.941 1.00 83.51  ? 309  LYS A CD    1 
ATOM   2215  C  CE    . LYS A 1 310  ? 9.998   13.765  106.813 1.00 84.52  ? 309  LYS A CE    1 
ATOM   2216  N  NZ    . LYS A 1 310  ? 10.018  12.946  108.036 1.00 83.04  ? 309  LYS A NZ    1 
ATOM   2217  N  N     . ASN A 1 311  ? 8.278   19.116  107.113 1.00 88.99  ? 310  ASN A N     1 
ATOM   2218  C  CA    . ASN A 1 311  ? 8.533   20.096  106.066 1.00 98.75  ? 310  ASN A CA    1 
ATOM   2219  C  C     . ASN A 1 311  ? 8.154   21.517  106.463 1.00 97.62  ? 310  ASN A C     1 
ATOM   2220  O  O     . ASN A 1 311  ? 8.467   22.451  105.716 1.00 97.33  ? 310  ASN A O     1 
ATOM   2221  C  CB    . ASN A 1 311  ? 7.793   19.719  104.770 1.00 92.57  ? 310  ASN A CB    1 
ATOM   2222  C  CG    . ASN A 1 311  ? 8.078   18.291  104.315 1.00 91.86  ? 310  ASN A CG    1 
ATOM   2223  O  OD1   . ASN A 1 311  ? 7.327   17.364  104.618 1.00 92.32  ? 310  ASN A OD1   1 
ATOM   2224  N  ND2   . ASN A 1 311  ? 9.164   18.114  103.570 1.00 90.90  ? 310  ASN A ND2   1 
ATOM   2225  N  N     . GLU A 1 312  ? 7.498   21.708  107.607 1.00 114.01 ? 311  GLU A N     1 
ATOM   2226  C  CA    . GLU A 1 312  ? 7.224   23.045  108.114 1.00 114.01 ? 311  GLU A CA    1 
ATOM   2227  C  C     . GLU A 1 312  ? 8.352   23.462  109.043 1.00 109.55 ? 311  GLU A C     1 
ATOM   2228  O  O     . GLU A 1 312  ? 8.864   22.649  109.814 1.00 104.52 ? 311  GLU A O     1 
ATOM   2229  C  CB    . GLU A 1 312  ? 5.885   23.097  108.852 1.00 117.07 ? 311  GLU A CB    1 
ATOM   2230  C  CG    . GLU A 1 312  ? 5.340   24.506  109.013 1.00 121.87 ? 311  GLU A CG    1 
ATOM   2231  C  CD    . GLU A 1 312  ? 4.357   24.875  107.923 1.00 126.26 ? 311  GLU A CD    1 
ATOM   2232  O  OE1   . GLU A 1 312  ? 3.978   23.980  107.141 1.00 127.87 ? 311  GLU A OE1   1 
ATOM   2233  O  OE2   . GLU A 1 312  ? 3.962   26.058  107.848 1.00 127.78 ? 311  GLU A OE2   1 
ATOM   2234  N  N     . LYS A 1 313  ? 8.750   24.729  108.950 1.00 91.06  ? 312  LYS A N     1 
ATOM   2235  C  CA    . LYS A 1 313  ? 9.907   25.213  109.689 1.00 87.99  ? 312  LYS A CA    1 
ATOM   2236  C  C     . LYS A 1 313  ? 9.600   25.328  111.179 1.00 87.16  ? 312  LYS A C     1 
ATOM   2237  O  O     . LYS A 1 313  ? 10.133  24.561  111.988 1.00 84.96  ? 312  LYS A O     1 
ATOM   2238  C  CB    . LYS A 1 313  ? 10.370  26.557  109.123 1.00 88.99  ? 312  LYS A CB    1 
ATOM   2239  N  N     . ALA A 1 314  ? 8.742   26.271  111.552 1.00 89.03  ? 313  ALA A N     1 
ATOM   2240  C  CA    . ALA A 1 314  ? 8.358   26.444  112.945 1.00 88.58  ? 313  ALA A CA    1 
ATOM   2241  C  C     . ALA A 1 314  ? 7.303   25.422  113.349 1.00 89.11  ? 313  ALA A C     1 
ATOM   2242  O  O     . ALA A 1 314  ? 6.387   25.112  112.582 1.00 91.08  ? 313  ALA A O     1 
ATOM   2243  C  CB    . ALA A 1 314  ? 7.833   27.858  113.180 1.00 90.58  ? 313  ALA A CB    1 
ATOM   2244  N  N     . MET A 1 315  ? 7.435   24.898  114.565 1.00 87.43  ? 314  MET A N     1 
ATOM   2245  C  CA    . MET A 1 315  ? 6.529   23.867  115.038 1.00 87.79  ? 314  MET A CA    1 
ATOM   2246  C  C     . MET A 1 315  ? 6.590   23.787  116.550 1.00 86.45  ? 314  MET A C     1 
ATOM   2247  O  O     . MET A 1 315  ? 7.660   23.862  117.152 1.00 84.20  ? 314  MET A O     1 
ATOM   2248  C  CB    . MET A 1 315  ? 6.852   22.500  114.418 1.00 86.72  ? 314  MET A CB    1 
ATOM   2249  C  CG    . MET A 1 315  ? 5.974   21.384  114.934 1.00 87.08  ? 314  MET A CG    1 
ATOM   2250  S  SD    . MET A 1 315  ? 4.239   21.760  114.660 1.00 90.66  ? 314  MET A SD    1 
ATOM   2251  C  CE    . MET A 1 315  ? 4.189   21.725  112.886 1.00 92.18  ? 314  MET A CE    1 
ATOM   2252  N  N     . GLY A 1 316  ? 5.420   23.656  117.151 1.00 97.18  ? 315  GLY A N     1 
ATOM   2253  C  CA    . GLY A 1 316  ? 5.283   23.498  118.587 1.00 97.09  ? 315  GLY A CA    1 
ATOM   2254  C  C     . GLY A 1 316  ? 4.132   22.570  118.890 1.00 100.17 ? 315  GLY A C     1 
ATOM   2255  O  O     . GLY A 1 316  ? 3.587   21.944  117.971 1.00 103.25 ? 315  GLY A O     1 
ATOM   2256  N  N     . PRO A 1 317  ? 3.746   22.455  120.161 1.00 100.53 ? 316  PRO A N     1 
ATOM   2257  C  CA    . PRO A 1 317  ? 2.662   21.553  120.503 1.00 100.39 ? 316  PRO A CA    1 
ATOM   2258  C  C     . PRO A 1 317  ? 1.281   22.086  120.139 1.00 103.56 ? 316  PRO A C     1 
ATOM   2259  O  O     . PRO A 1 317  ? 0.428   21.332  119.631 1.00 101.87 ? 316  PRO A O     1 
ATOM   2260  C  CB    . PRO A 1 317  ? 2.823   21.369  122.001 1.00 100.52 ? 316  PRO A CB    1 
ATOM   2261  C  CG    . PRO A 1 317  ? 3.663   22.540  122.491 1.00 101.16 ? 316  PRO A CG    1 
ATOM   2262  C  CD    . PRO A 1 317  ? 4.189   23.263  121.268 1.00 99.83  ? 316  PRO A CD    1 
ATOM   2263  N  N     . ALA A 1 318  ? 1.031   23.371  120.400 1.00 94.85  ? 317  ALA A N     1 
ATOM   2264  C  CA    . ALA A 1 318  ? -0.223  23.995  120.000 1.00 97.22  ? 317  ALA A CA    1 
ATOM   2265  C  C     . ALA A 1 318  ? -0.367  24.019  118.487 1.00 98.51  ? 317  ALA A C     1 
ATOM   2266  O  O     . ALA A 1 318  ? -1.374  23.554  117.946 1.00 100.60 ? 317  ALA A O     1 
ATOM   2267  C  CB    . ALA A 1 318  ? -0.286  25.412  120.569 1.00 98.18  ? 317  ALA A CB    1 
ATOM   2268  N  N     . LYS A 1 319  ? 0.632   24.564  117.787 1.00 97.38  ? 318  LYS A N     1 
ATOM   2269  C  CA    . LYS A 1 319  ? 0.495   24.780  116.350 1.00 98.85  ? 318  LYS A CA    1 
ATOM   2270  C  C     . LYS A 1 319  ? 0.359   23.468  115.585 1.00 98.64  ? 318  LYS A C     1 
ATOM   2271  O  O     . LYS A 1 319  ? -0.278  23.434  114.526 1.00 100.71 ? 318  LYS A O     1 
ATOM   2272  C  CB    . LYS A 1 319  ? 1.681   25.591  115.830 1.00 97.57  ? 318  LYS A CB    1 
ATOM   2273  C  CG    . LYS A 1 319  ? 1.539   26.054  114.390 1.00 99.36  ? 318  LYS A CG    1 
ATOM   2274  C  CD    . LYS A 1 319  ? 2.305   25.156  113.448 1.00 97.85  ? 318  LYS A CD    1 
ATOM   2275  C  CE    . LYS A 1 319  ? 2.825   25.931  112.256 1.00 98.53  ? 318  LYS A CE    1 
ATOM   2276  N  NZ    . LYS A 1 319  ? 3.092   25.026  111.110 1.00 98.24  ? 318  LYS A NZ    1 
ATOM   2277  N  N     . LEU A 1 320  ? 0.940   22.383  116.095 1.00 96.30  ? 319  LEU A N     1 
ATOM   2278  C  CA    . LEU A 1 320  ? 0.671   21.070  115.519 1.00 96.37  ? 319  LEU A CA    1 
ATOM   2279  C  C     . LEU A 1 320  ? -0.759  20.645  115.814 1.00 98.77  ? 319  LEU A C     1 
ATOM   2280  O  O     . LEU A 1 320  ? -1.513  20.265  114.909 1.00 100.77 ? 319  LEU A O     1 
ATOM   2281  C  CB    . LEU A 1 320  ? 1.668   20.048  116.069 1.00 93.36  ? 319  LEU A CB    1 
ATOM   2282  C  CG    . LEU A 1 320  ? 1.549   18.582  115.661 1.00 93.09  ? 319  LEU A CG    1 
ATOM   2283  C  CD1   . LEU A 1 320  ? 2.932   17.960  115.668 1.00 90.12  ? 319  LEU A CD1   1 
ATOM   2284  C  CD2   . LEU A 1 320  ? 0.650   17.816  116.612 1.00 93.78  ? 319  LEU A CD2   1 
ATOM   2285  N  N     . PHE A 1 321  ? -1.141  20.693  117.088 1.00 98.68  ? 320  PHE A N     1 
ATOM   2286  C  CA    . PHE A 1 321  ? -2.516  20.395  117.461 1.00 101.14 ? 320  PHE A CA    1 
ATOM   2287  C  C     . PHE A 1 321  ? -3.485  21.357  116.788 1.00 104.32 ? 320  PHE A C     1 
ATOM   2288  O  O     . PHE A 1 321  ? -4.578  20.959  116.370 1.00 106.75 ? 320  PHE A O     1 
ATOM   2289  C  CB    . PHE A 1 321  ? -2.663  20.442  118.983 1.00 100.49 ? 320  PHE A CB    1 
ATOM   2290  C  CG    . PHE A 1 321  ? -2.259  19.167  119.668 1.00 98.44  ? 320  PHE A CG    1 
ATOM   2291  C  CD1   . PHE A 1 321  ? -2.749  17.951  119.227 1.00 99.13  ? 320  PHE A CD1   1 
ATOM   2292  C  CD2   . PHE A 1 321  ? -1.389  19.179  120.744 1.00 95.95  ? 320  PHE A CD2   1 
ATOM   2293  C  CE1   . PHE A 1 321  ? -2.386  16.773  119.850 1.00 97.42  ? 320  PHE A CE1   1 
ATOM   2294  C  CE2   . PHE A 1 321  ? -1.024  18.003  121.366 1.00 94.21  ? 320  PHE A CE2   1 
ATOM   2295  C  CZ    . PHE A 1 321  ? -1.524  16.800  120.918 1.00 94.96  ? 320  PHE A CZ    1 
ATOM   2296  N  N     . LYS A 1 322  ? -3.096  22.628  116.658 1.00 114.87 ? 321  LYS A N     1 
ATOM   2297  C  CA    . LYS A 1 322  ? -3.913  23.572  115.906 1.00 118.51 ? 321  LYS A CA    1 
ATOM   2298  C  C     . LYS A 1 322  ? -4.084  23.137  114.463 1.00 122.34 ? 321  LYS A C     1 
ATOM   2299  O  O     . LYS A 1 322  ? -5.047  23.551  113.815 1.00 124.85 ? 321  LYS A O     1 
ATOM   2300  C  CB    . LYS A 1 322  ? -3.304  24.974  115.950 1.00 118.54 ? 321  LYS A CB    1 
ATOM   2301  N  N     . TYR A 1 323  ? -3.173  22.314  113.949 1.00 116.35 ? 322  TYR A N     1 
ATOM   2302  C  CA    . TYR A 1 323  ? -3.299  21.775  112.603 1.00 117.77 ? 322  TYR A CA    1 
ATOM   2303  C  C     . TYR A 1 323  ? -4.153  20.516  112.577 1.00 119.65 ? 322  TYR A C     1 
ATOM   2304  O  O     . TYR A 1 323  ? -5.013  20.372  111.705 1.00 126.27 ? 322  TYR A O     1 
ATOM   2305  C  CB    . TYR A 1 323  ? -1.909  21.498  112.021 1.00 114.78 ? 322  TYR A CB    1 
ATOM   2306  C  CG    . TYR A 1 323  ? -1.881  20.523  110.866 1.00 115.41 ? 322  TYR A CG    1 
ATOM   2307  C  CD1   . TYR A 1 323  ? -2.023  20.962  109.556 1.00 115.81 ? 322  TYR A CD1   1 
ATOM   2308  C  CD2   . TYR A 1 323  ? -1.691  19.165  111.083 1.00 115.36 ? 322  TYR A CD2   1 
ATOM   2309  C  CE1   . TYR A 1 323  ? -1.991  20.073  108.498 1.00 116.00 ? 322  TYR A CE1   1 
ATOM   2310  C  CE2   . TYR A 1 323  ? -1.658  18.272  110.034 1.00 115.61 ? 322  TYR A CE2   1 
ATOM   2311  C  CZ    . TYR A 1 323  ? -1.807  18.730  108.745 1.00 116.17 ? 322  TYR A CZ    1 
ATOM   2312  O  OH    . TYR A 1 323  ? -1.773  17.838  107.700 1.00 116.97 ? 322  TYR A OH    1 
ATOM   2313  N  N     . ILE A 1 324  ? -3.938  19.598  113.520 1.00 117.63 ? 323  ILE A N     1 
ATOM   2314  C  CA    . ILE A 1 324  ? -4.767  18.398  113.575 1.00 117.63 ? 323  ILE A CA    1 
ATOM   2315  C  C     . ILE A 1 324  ? -6.221  18.769  113.825 1.00 120.40 ? 323  ILE A C     1 
ATOM   2316  O  O     . ILE A 1 324  ? -7.138  18.194  113.229 1.00 122.15 ? 323  ILE A O     1 
ATOM   2317  C  CB    . ILE A 1 324  ? -4.243  17.433  114.653 1.00 110.26 ? 323  ILE A CB    1 
ATOM   2318  C  CG1   . ILE A 1 324  ? -2.737  17.255  114.529 1.00 104.82 ? 323  ILE A CG1   1 
ATOM   2319  C  CG2   . ILE A 1 324  ? -4.925  16.083  114.535 1.00 110.16 ? 323  ILE A CG2   1 
ATOM   2320  C  CD1   . ILE A 1 324  ? -2.195  16.205  115.466 1.00 101.07 ? 323  ILE A CD1   1 
ATOM   2321  N  N     . ALA A 1 325  ? -6.454  19.736  114.708 1.00 128.77 ? 324  ALA A N     1 
ATOM   2322  C  CA    . ALA A 1 325  ? -7.807  20.169  115.025 1.00 137.80 ? 324  ALA A CA    1 
ATOM   2323  C  C     . ALA A 1 325  ? -8.388  21.006  113.896 1.00 146.36 ? 324  ALA A C     1 
ATOM   2324  O  O     . ALA A 1 325  ? -9.273  20.549  113.166 1.00 147.91 ? 324  ALA A O     1 
ATOM   2325  C  CB    . ALA A 1 325  ? -7.819  20.964  116.329 1.00 125.49 ? 324  ALA A CB    1 
ATOM   2326  N  N     . LYS A 1 326  ? -7.885  22.228  113.739 1.00 167.28 ? 325  LYS A N     1 
ATOM   2327  C  CA    . LYS A 1 326  ? -8.402  23.162  112.744 1.00 167.14 ? 325  LYS A CA    1 
ATOM   2328  C  C     . LYS A 1 326  ? -8.101  22.743  111.316 1.00 162.78 ? 325  LYS A C     1 
ATOM   2329  O  O     . LYS A 1 326  ? -8.290  23.571  110.415 1.00 166.38 ? 325  LYS A O     1 
ATOM   2330  C  CB    . LYS A 1 326  ? -7.849  24.564  113.002 1.00 168.31 ? 325  LYS A CB    1 
ATOM   2331  N  N     . LEU A 1 327  ? -7.637  21.512  111.063 1.00 149.47 ? 326  LEU A N     1 
ATOM   2332  C  CA    . LEU A 1 327  ? -7.532  21.043  109.686 1.00 143.39 ? 326  LEU A CA    1 
ATOM   2333  C  C     . LEU A 1 327  ? -7.767  19.539  109.565 1.00 138.73 ? 326  LEU A C     1 
ATOM   2334  O  O     . LEU A 1 327  ? -7.356  18.946  108.561 1.00 134.54 ? 326  LEU A O     1 
ATOM   2335  C  CB    . LEU A 1 327  ? -6.168  21.406  109.085 1.00 138.68 ? 326  LEU A CB    1 
ATOM   2336  N  N     . LEU A 1 328  ? -8.410  18.910  110.545 1.00 134.50 ? 327  LEU A N     1 
ATOM   2337  C  CA    . LEU A 1 328  ? -8.802  17.508  110.439 1.00 119.01 ? 327  LEU A CA    1 
ATOM   2338  C  C     . LEU A 1 328  ? -9.831  17.156  111.510 1.00 120.42 ? 327  LEU A C     1 
ATOM   2339  O  O     . LEU A 1 328  ? -10.715 16.322  111.296 1.00 122.37 ? 327  LEU A O     1 
ATOM   2340  C  CB    . LEU A 1 328  ? -7.585  16.591  110.553 1.00 115.65 ? 327  LEU A CB    1 
ATOM   2341  N  N     . ASP A 1 331  ? -11.599 21.103  116.225 1.00 123.62 ? 330  ASP A N     1 
ATOM   2342  C  CA    . ASP A 1 331  ? -11.880 21.091  117.654 1.00 123.41 ? 330  ASP A CA    1 
ATOM   2343  C  C     . ASP A 1 331  ? -10.728 20.449  118.432 1.00 119.61 ? 330  ASP A C     1 
ATOM   2344  O  O     . ASP A 1 331  ? -10.637 19.225  118.517 1.00 118.58 ? 330  ASP A O     1 
ATOM   2345  C  CB    . ASP A 1 331  ? -13.191 20.351  117.934 1.00 126.13 ? 330  ASP A CB    1 
ATOM   2346  C  CG    . ASP A 1 331  ? -14.407 21.064  117.345 1.00 130.15 ? 330  ASP A CG    1 
ATOM   2347  O  OD1   . ASP A 1 331  ? -14.340 22.297  117.155 1.00 130.97 ? 330  ASP A OD1   1 
ATOM   2348  O  OD2   . ASP A 1 331  ? -15.434 20.397  117.078 1.00 132.62 ? 330  ASP A OD2   1 
ATOM   2349  N  N     . VAL A 1 332  ? -9.848  21.281  118.997 1.00 117.63 ? 331  VAL A N     1 
ATOM   2350  C  CA    . VAL A 1 332  ? -8.711  20.747  119.742 1.00 114.06 ? 331  VAL A CA    1 
ATOM   2351  C  C     . VAL A 1 332  ? -9.176  20.133  121.053 1.00 114.07 ? 331  VAL A C     1 
ATOM   2352  O  O     . VAL A 1 332  ? -8.554  19.198  121.566 1.00 111.72 ? 331  VAL A O     1 
ATOM   2353  C  CB    . VAL A 1 332  ? -7.650  21.841  119.965 1.00 112.13 ? 331  VAL A CB    1 
ATOM   2354  C  CG1   . VAL A 1 332  ? -8.175  22.923  120.895 1.00 113.65 ? 331  VAL A CG1   1 
ATOM   2355  C  CG2   . VAL A 1 332  ? -6.373  21.232  120.511 1.00 108.39 ? 331  VAL A CG2   1 
ATOM   2356  N  N     . ALA A 1 333  ? -10.285 20.625  121.603 1.00 116.83 ? 332  ALA A N     1 
ATOM   2357  C  CA    . ALA A 1 333  ? -10.852 20.022  122.799 1.00 117.28 ? 332  ALA A CA    1 
ATOM   2358  C  C     . ALA A 1 333  ? -11.249 18.568  122.581 1.00 118.00 ? 332  ALA A C     1 
ATOM   2359  O  O     . ALA A 1 333  ? -11.376 17.821  123.556 1.00 117.02 ? 332  ALA A O     1 
ATOM   2360  C  CB    . ALA A 1 333  ? -12.064 20.829  123.264 1.00 123.02 ? 332  ALA A CB    1 
ATOM   2361  N  N     . ASP A 1 334  ? -11.446 18.147  121.328 1.00 118.45 ? 333  ASP A N     1 
ATOM   2362  C  CA    . ASP A 1 334  ? -11.848 16.774  121.046 1.00 118.95 ? 333  ASP A CA    1 
ATOM   2363  C  C     . ASP A 1 334  ? -10.699 15.781  121.180 1.00 115.55 ? 333  ASP A C     1 
ATOM   2364  O  O     . ASP A 1 334  ? -10.953 14.585  121.362 1.00 115.65 ? 333  ASP A O     1 
ATOM   2365  C  CB    . ASP A 1 334  ? -12.453 16.677  119.643 1.00 121.22 ? 333  ASP A CB    1 
ATOM   2366  N  N     . ILE A 1 335  ? -9.453  16.239  121.102 1.00 112.69 ? 334  ILE A N     1 
ATOM   2367  C  CA    . ILE A 1 335  ? -8.294  15.358  121.180 1.00 109.49 ? 334  ILE A CA    1 
ATOM   2368  C  C     . ILE A 1 335  ? -7.870  15.219  122.634 1.00 107.66 ? 334  ILE A C     1 
ATOM   2369  O  O     . ILE A 1 335  ? -7.740  16.216  123.354 1.00 107.39 ? 334  ILE A O     1 
ATOM   2370  C  CB    . ILE A 1 335  ? -7.138  15.891  120.321 1.00 107.43 ? 334  ILE A CB    1 
ATOM   2371  C  CG1   . ILE A 1 335  ? -7.635  16.254  118.924 1.00 109.57 ? 334  ILE A CG1   1 
ATOM   2372  C  CG2   . ILE A 1 335  ? -6.026  14.861  120.243 1.00 104.51 ? 334  ILE A CG2   1 
ATOM   2373  C  CD1   . ILE A 1 335  ? -6.598  16.937  118.074 1.00 107.98 ? 334  ILE A CD1   1 
ATOM   2374  N  N     . LYS A 1 336  ? -7.644  13.982  123.066 1.00 106.50 ? 335  LYS A N     1 
ATOM   2375  C  CA    . LYS A 1 336  ? -7.281  13.700  124.444 1.00 104.90 ? 335  LYS A CA    1 
ATOM   2376  C  C     . LYS A 1 336  ? -6.204  12.624  124.463 1.00 102.09 ? 335  LYS A C     1 
ATOM   2377  O  O     . LYS A 1 336  ? -5.925  11.977  123.452 1.00 101.78 ? 335  LYS A O     1 
ATOM   2378  C  CB    . LYS A 1 336  ? -8.503  13.266  125.262 1.00 107.35 ? 335  LYS A CB    1 
ATOM   2379  N  N     . GLY A 1 337  ? -5.594  12.440  125.630 1.00 116.33 ? 336  GLY A N     1 
ATOM   2380  C  CA    . GLY A 1 337  ? -4.552  11.442  125.784 1.00 113.96 ? 336  GLY A CA    1 
ATOM   2381  C  C     . GLY A 1 337  ? -3.156  11.908  125.430 1.00 114.81 ? 336  GLY A C     1 
ATOM   2382  O  O     . GLY A 1 337  ? -2.388  11.151  124.819 1.00 115.29 ? 336  GLY A O     1 
ATOM   2383  N  N     . TYR A 1 338  ? -2.800  13.134  125.800 1.00 105.26 ? 337  TYR A N     1 
ATOM   2384  C  CA    . TYR A 1 338  ? -1.495  13.703  125.510 1.00 100.41 ? 337  TYR A CA    1 
ATOM   2385  C  C     . TYR A 1 338  ? -0.793  14.067  126.808 1.00 96.10  ? 337  TYR A C     1 
ATOM   2386  O  O     . TYR A 1 338  ? -1.424  14.490  127.782 1.00 95.72  ? 337  TYR A O     1 
ATOM   2387  C  CB    . TYR A 1 338  ? -1.613  14.946  124.625 1.00 101.63 ? 337  TYR A CB    1 
ATOM   2388  C  CG    . TYR A 1 338  ? -2.783  15.834  124.988 1.00 104.62 ? 337  TYR A CG    1 
ATOM   2389  C  CD1   . TYR A 1 338  ? -2.646  16.851  125.922 1.00 104.90 ? 337  TYR A CD1   1 
ATOM   2390  C  CD2   . TYR A 1 338  ? -4.029  15.654  124.396 1.00 107.58 ? 337  TYR A CD2   1 
ATOM   2391  C  CE1   . TYR A 1 338  ? -3.715  17.662  126.256 1.00 108.37 ? 337  TYR A CE1   1 
ATOM   2392  C  CE2   . TYR A 1 338  ? -5.101  16.461  124.726 1.00 110.96 ? 337  TYR A CE2   1 
ATOM   2393  C  CZ    . TYR A 1 338  ? -4.940  17.463  125.655 1.00 111.42 ? 337  TYR A CZ    1 
ATOM   2394  O  OH    . TYR A 1 338  ? -6.007  18.265  125.985 1.00 114.83 ? 337  TYR A OH    1 
ATOM   2395  N  N     . ARG A 1 339  ? 0.523   13.911  126.816 1.00 102.13 ? 338  ARG A N     1 
ATOM   2396  C  CA    . ARG A 1 339  ? 1.255   14.178  128.040 1.00 99.65  ? 338  ARG A CA    1 
ATOM   2397  C  C     . ARG A 1 339  ? 1.344   15.670  128.312 1.00 97.96  ? 338  ARG A C     1 
ATOM   2398  O  O     . ARG A 1 339  ? 1.401   16.503  127.401 1.00 99.01  ? 338  ARG A O     1 
ATOM   2399  C  CB    . ARG A 1 339  ? 2.641   13.562  127.994 1.00 97.52  ? 338  ARG A CB    1 
ATOM   2400  C  CG    . ARG A 1 339  ? 2.731   12.342  127.109 1.00 97.51  ? 338  ARG A CG    1 
ATOM   2401  C  CD    . ARG A 1 339  ? 3.979   12.409  126.392 1.00 95.66  ? 338  ARG A CD    1 
ATOM   2402  N  NE    . ARG A 1 339  ? 4.371   13.798  126.268 1.00 94.98  ? 338  ARG A NE    1 
ATOM   2403  C  CZ    . ARG A 1 339  ? 5.515   14.175  125.728 1.00 91.68  ? 338  ARG A CZ    1 
ATOM   2404  N  NH1   . ARG A 1 339  ? 6.345   13.251  125.258 1.00 89.09  ? 338  ARG A NH1   1 
ATOM   2405  N  NH2   . ARG A 1 339  ? 5.841   15.467  125.654 1.00 93.04  ? 338  ARG A NH2   1 
ATOM   2406  N  N     . ILE A 1 340  ? 1.344   15.998  129.591 1.00 84.57  ? 339  ILE A N     1 
ATOM   2407  C  CA    . ILE A 1 340  ? 1.038   17.337  130.056 1.00 85.59  ? 339  ILE A CA    1 
ATOM   2408  C  C     . ILE A 1 340  ? 2.277   17.952  130.690 1.00 83.14  ? 339  ILE A C     1 
ATOM   2409  O  O     . ILE A 1 340  ? 3.164   17.251  131.194 1.00 80.89  ? 339  ILE A O     1 
ATOM   2410  C  CB    . ILE A 1 340  ? -0.155  17.274  131.035 1.00 87.71  ? 339  ILE A CB    1 
ATOM   2411  C  CG1   . ILE A 1 340  ? -0.549  18.659  131.523 1.00 89.08  ? 339  ILE A CG1   1 
ATOM   2412  C  CG2   . ILE A 1 340  ? 0.129   16.355  132.166 1.00 86.38  ? 339  ILE A CG2   1 
ATOM   2413  C  CD1   . ILE A 1 340  ? -1.026  19.495  130.398 1.00 90.91  ? 339  ILE A CD1   1 
ATOM   2414  N  N     . ASP A 1 341  ? 2.347   19.278  130.633 1.00 83.70  ? 340  ASP A N     1 
ATOM   2415  C  CA    . ASP A 1 341  ? 3.440   20.022  131.235 1.00 81.75  ? 340  ASP A CA    1 
ATOM   2416  C  C     . ASP A 1 341  ? 3.406   19.901  132.756 1.00 81.28  ? 340  ASP A C     1 
ATOM   2417  O  O     . ASP A 1 341  ? 2.388   19.553  133.363 1.00 82.94  ? 340  ASP A O     1 
ATOM   2418  C  CB    . ASP A 1 341  ? 3.347   21.496  130.837 1.00 86.21  ? 340  ASP A CB    1 
ATOM   2419  C  CG    . ASP A 1 341  ? 4.607   22.261  131.107 1.00 81.85  ? 340  ASP A CG    1 
ATOM   2420  O  OD1   . ASP A 1 341  ? 4.906   22.512  132.294 1.00 83.20  ? 340  ASP A OD1   1 
ATOM   2421  O  OD2   . ASP A 1 341  ? 5.288   22.631  130.129 1.00 80.28  ? 340  ASP A OD2   1 
ATOM   2422  N  N     . LYS A 1 342  ? 4.557   20.186  133.371 1.00 85.81  ? 341  LYS A N     1 
ATOM   2423  C  CA    . LYS A 1 342  ? 4.593   20.445  134.804 1.00 86.05  ? 341  LYS A CA    1 
ATOM   2424  C  C     . LYS A 1 342  ? 3.575   21.511  135.181 1.00 87.77  ? 341  LYS A C     1 
ATOM   2425  O  O     . LYS A 1 342  ? 2.886   21.398  136.202 1.00 88.93  ? 341  LYS A O     1 
ATOM   2426  C  CB    . LYS A 1 342  ? 5.997   20.891  135.211 1.00 85.51  ? 341  LYS A CB    1 
ATOM   2427  C  CG    . LYS A 1 342  ? 6.612   20.096  136.343 1.00 83.60  ? 341  LYS A CG    1 
ATOM   2428  C  CD    . LYS A 1 342  ? 6.712   18.646  135.948 1.00 82.80  ? 341  LYS A CD    1 
ATOM   2429  C  CE    . LYS A 1 342  ? 7.408   17.845  137.002 1.00 80.85  ? 341  LYS A CE    1 
ATOM   2430  N  NZ    . LYS A 1 342  ? 7.310   16.400  136.698 1.00 80.65  ? 341  LYS A NZ    1 
ATOM   2431  N  N     . SER A 1 343  ? 3.565   22.572  134.388 1.00 87.78  ? 342  SER A N     1 
ATOM   2432  C  CA    . SER A 1 343  ? 2.646   23.689  134.528 1.00 90.75  ? 342  SER A CA    1 
ATOM   2433  C  C     . SER A 1 343  ? 1.189   23.405  134.143 1.00 95.02  ? 342  SER A C     1 
ATOM   2434  O  O     . SER A 1 343  ? 0.262   23.933  134.757 1.00 91.65  ? 342  SER A O     1 
ATOM   2435  C  CB    . SER A 1 343  ? 3.160   24.896  133.737 1.00 89.85  ? 342  SER A CB    1 
ATOM   2436  O  OG    . SER A 1 343  ? 3.249   26.045  134.562 1.00 90.53  ? 342  SER A OG    1 
ATOM   2437  N  N     . GLY A 1 344  ? 0.999   22.598  133.098 1.00 87.81  ? 343  GLY A N     1 
ATOM   2438  C  CA    . GLY A 1 344  ? -0.320  22.358  132.545 1.00 90.57  ? 343  GLY A CA    1 
ATOM   2439  C  C     . GLY A 1 344  ? -0.474  22.624  131.062 1.00 91.53  ? 343  GLY A C     1 
ATOM   2440  O  O     . GLY A 1 344  ? -1.598  22.537  130.556 1.00 94.06  ? 343  GLY A O     1 
ATOM   2441  N  N     . LYS A 1 345  ? 0.598   22.939  130.344 1.00 89.73  ? 344  LYS A N     1 
ATOM   2442  C  CA    . LYS A 1 345  ? 0.523   23.041  128.896 1.00 90.49  ? 344  LYS A CA    1 
ATOM   2443  C  C     . LYS A 1 345  ? 0.673   21.664  128.264 1.00 89.45  ? 344  LYS A C     1 
ATOM   2444  O  O     . LYS A 1 345  ? 1.376   20.789  128.776 1.00 87.23  ? 344  LYS A O     1 
ATOM   2445  C  CB    . LYS A 1 345  ? 1.603   23.982  128.358 1.00 89.20  ? 344  LYS A CB    1 
ATOM   2446  N  N     . ALA A 1 346  ? 0.016   21.436  127.148 1.00 91.19  ? 345  ALA A N     1 
ATOM   2447  C  CA    . ALA A 1 346  ? 0.165   20.156  126.514 1.00 90.39  ? 345  ALA A CA    1 
ATOM   2448  C  C     . ALA A 1 346  ? 1.483   20.159  125.776 1.00 87.89  ? 345  ALA A C     1 
ATOM   2449  O  O     . ALA A 1 346  ? 1.971   21.195  125.375 1.00 87.61  ? 345  ALA A O     1 
ATOM   2450  C  CB    . ALA A 1 346  ? -0.986  19.874  125.578 1.00 93.09  ? 345  ALA A CB    1 
ATOM   2451  N  N     . GLU A 1 347  ? 2.060   18.985  125.609 1.00 86.43  ? 346  GLU A N     1 
ATOM   2452  C  CA    . GLU A 1 347  ? 3.325   18.852  124.921 1.00 88.42  ? 346  GLU A CA    1 
ATOM   2453  C  C     . GLU A 1 347  ? 3.375   17.592  124.083 1.00 84.04  ? 346  GLU A C     1 
ATOM   2454  O  O     . GLU A 1 347  ? 2.690   16.624  124.356 1.00 84.97  ? 346  GLU A O     1 
ATOM   2455  C  CB    . GLU A 1 347  ? 4.476   18.850  125.938 1.00 87.17  ? 346  GLU A CB    1 
ATOM   2456  C  CG    . GLU A 1 347  ? 4.412   17.749  126.984 1.00 87.21  ? 346  GLU A CG    1 
ATOM   2457  C  CD    . GLU A 1 347  ? 5.407   17.947  128.105 1.00 85.03  ? 346  GLU A CD    1 
ATOM   2458  O  OE1   . GLU A 1 347  ? 6.270   18.836  127.978 1.00 85.25  ? 346  GLU A OE1   1 
ATOM   2459  O  OE2   . GLU A 1 347  ? 5.323   17.212  129.110 1.00 83.99  ? 346  GLU A OE2   1 
ATOM   2460  N  N     . ILE A 1 348  ? 4.195   17.609  123.051 1.00 82.77  ? 347  ILE A N     1 
ATOM   2461  C  CA    . ILE A 1 348  ? 4.329   16.453  122.206 1.00 82.64  ? 347  ILE A CA    1 
ATOM   2462  C  C     . ILE A 1 348  ? 5.621   16.533  121.432 1.00 80.66  ? 347  ILE A C     1 
ATOM   2463  O  O     . ILE A 1 348  ? 6.243   17.569  121.376 1.00 80.72  ? 347  ILE A O     1 
ATOM   2464  C  CB    . ILE A 1 348  ? 3.128   16.345  121.254 1.00 85.50  ? 347  ILE A CB    1 
ATOM   2465  C  CG1   . ILE A 1 348  ? 2.987   14.927  120.730 1.00 85.65  ? 347  ILE A CG1   1 
ATOM   2466  C  CG2   . ILE A 1 348  ? 3.225   17.357  120.127 1.00 86.30  ? 347  ILE A CG2   1 
ATOM   2467  C  CD1   . ILE A 1 348  ? 2.047   14.819  119.569 1.00 88.36  ? 347  ILE A CD1   1 
ATOM   2468  N  N     . HIS A 1 349  ? 6.037   15.430  120.848 1.00 79.77  ? 348  HIS A N     1 
ATOM   2469  C  CA    . HIS A 1 349  ? 7.234   15.426  120.043 1.00 78.29  ? 348  HIS A CA    1 
ATOM   2470  C  C     . HIS A 1 349  ? 6.990   16.165  118.736 1.00 80.02  ? 348  HIS A C     1 
ATOM   2471  O  O     . HIS A 1 349  ? 5.937   16.052  118.157 1.00 82.39  ? 348  HIS A O     1 
ATOM   2472  C  CB    . HIS A 1 349  ? 7.645   14.000  119.768 1.00 77.16  ? 348  HIS A CB    1 
ATOM   2473  C  CG    . HIS A 1 349  ? 8.344   13.360  120.915 1.00 75.14  ? 348  HIS A CG    1 
ATOM   2474  N  ND1   . HIS A 1 349  ? 9.643   13.657  121.250 1.00 72.79  ? 348  HIS A ND1   1 
ATOM   2475  C  CD2   . HIS A 1 349  ? 7.918   12.458  121.822 1.00 75.22  ? 348  HIS A CD2   1 
ATOM   2476  C  CE1   . HIS A 1 349  ? 9.993   12.946  122.300 1.00 71.50  ? 348  HIS A CE1   1 
ATOM   2477  N  NE2   . HIS A 1 349  ? 8.965   12.211  122.665 1.00 72.93  ? 348  HIS A NE2   1 
ATOM   2478  N  N     . THR A 1 350  ? 7.963   16.931  118.282 1.00 78.92  ? 349  THR A N     1 
ATOM   2479  C  CA    . THR A 1 350  ? 7.816   17.670  117.047 1.00 80.31  ? 349  THR A CA    1 
ATOM   2480  C  C     . THR A 1 350  ? 8.990   17.648  116.064 1.00 79.22  ? 349  THR A C     1 
ATOM   2481  O  O     . THR A 1 350  ? 9.236   18.632  115.396 1.00 80.72  ? 349  THR A O     1 
ATOM   2482  C  CB    . THR A 1 350  ? 7.385   19.117  117.300 1.00 80.47  ? 349  THR A CB    1 
ATOM   2483  O  OG1   . THR A 1 350  ? 8.530   19.940  117.452 1.00 82.55  ? 349  THR A OG1   1 
ATOM   2484  C  CG2   . THR A 1 350  ? 6.530   19.227  118.516 1.00 81.00  ? 349  THR A CG2   1 
ATOM   2485  N  N     . PHE A 1 351  ? 9.757   16.568  116.021 1.00 77.30  ? 350  PHE A N     1 
ATOM   2486  C  CA    . PHE A 1 351  ? 10.871  16.456  115.085 1.00 76.29  ? 350  PHE A CA    1 
ATOM   2487  C  C     . PHE A 1 351  ? 11.761  17.668  115.166 1.00 75.28  ? 350  PHE A C     1 
ATOM   2488  O  O     . PHE A 1 351  ? 12.251  18.148  114.176 1.00 75.54  ? 350  PHE A O     1 
ATOM   2489  C  CB    . PHE A 1 351  ? 10.347  16.304  113.671 1.00 78.22  ? 350  PHE A CB    1 
ATOM   2490  C  CG    . PHE A 1 351  ? 10.322  14.906  113.197 1.00 78.26  ? 350  PHE A CG    1 
ATOM   2491  C  CD1   . PHE A 1 351  ? 9.244   14.118  113.428 1.00 79.67  ? 350  PHE A CD1   1 
ATOM   2492  C  CD2   . PHE A 1 351  ? 11.379  14.386  112.525 1.00 77.03  ? 350  PHE A CD2   1 
ATOM   2493  C  CE1   . PHE A 1 351  ? 9.219   12.822  113.002 1.00 79.84  ? 350  PHE A CE1   1 
ATOM   2494  C  CE2   . PHE A 1 351  ? 11.365  13.092  112.099 1.00 77.21  ? 350  PHE A CE2   1 
ATOM   2495  C  CZ    . PHE A 1 351  ? 10.279  12.307  112.330 1.00 78.61  ? 350  PHE A CZ    1 
ATOM   2496  N  N     . GLU A 1 352  ? 11.992  18.155  116.360 1.00 79.41  ? 351  GLU A N     1 
ATOM   2497  C  CA    . GLU A 1 352  ? 12.754  19.362  116.534 1.00 80.81  ? 351  GLU A CA    1 
ATOM   2498  C  C     . GLU A 1 352  ? 14.157  19.274  116.011 1.00 80.04  ? 351  GLU A C     1 
ATOM   2499  O  O     . GLU A 1 352  ? 14.663  20.227  115.455 1.00 80.56  ? 351  GLU A O     1 
ATOM   2500  C  CB    . GLU A 1 352  ? 12.731  19.770  117.991 1.00 80.56  ? 351  GLU A CB    1 
ATOM   2501  C  CG    . GLU A 1 352  ? 13.394  21.095  118.261 1.00 79.95  ? 351  GLU A CG    1 
ATOM   2502  C  CD    . GLU A 1 352  ? 13.449  21.418  119.727 1.00 78.73  ? 351  GLU A CD    1 
ATOM   2503  O  OE1   . GLU A 1 352  ? 12.901  20.667  120.536 1.00 78.51  ? 351  GLU A OE1   1 
ATOM   2504  O  OE2   . GLU A 1 352  ? 14.035  22.441  120.066 1.00 80.49  ? 351  GLU A OE2   1 
ATOM   2505  N  N     . ALA A 1 353  ? 14.794  18.138  116.191 1.00 79.71  ? 352  ALA A N     1 
ATOM   2506  C  CA    . ALA A 1 353  ? 16.149  17.996  115.722 1.00 76.38  ? 352  ALA A CA    1 
ATOM   2507  C  C     . ALA A 1 353  ? 16.258  18.132  114.220 1.00 76.27  ? 352  ALA A C     1 
ATOM   2508  O  O     . ALA A 1 353  ? 17.123  18.808  113.719 1.00 74.12  ? 352  ALA A O     1 
ATOM   2509  C  CB    . ALA A 1 353  ? 16.691  16.666  116.165 1.00 75.14  ? 352  ALA A CB    1 
ATOM   2510  N  N     . TYR A 1 354  ? 15.348  17.502  113.514 1.00 77.49  ? 353  TYR A N     1 
ATOM   2511  C  CA    . TYR A 1 354  ? 15.331  17.512  112.055 1.00 77.42  ? 353  TYR A CA    1 
ATOM   2512  C  C     . TYR A 1 354  ? 15.116  18.920  111.516 1.00 75.67  ? 353  TYR A C     1 
ATOM   2513  O  O     . TYR A 1 354  ? 15.833  19.370  110.617 1.00 74.61  ? 353  TYR A O     1 
ATOM   2514  C  CB    . TYR A 1 354  ? 14.243  16.566  111.544 1.00 81.36  ? 353  TYR A CB    1 
ATOM   2515  C  CG    . TYR A 1 354  ? 14.244  16.346  110.050 1.00 83.82  ? 353  TYR A CG    1 
ATOM   2516  C  CD1   . TYR A 1 354  ? 13.641  17.258  109.195 1.00 86.61  ? 353  TYR A CD1   1 
ATOM   2517  C  CD2   . TYR A 1 354  ? 14.832  15.219  109.496 1.00 84.41  ? 353  TYR A CD2   1 
ATOM   2518  C  CE1   . TYR A 1 354  ? 13.631  17.062  107.825 1.00 88.55  ? 353  TYR A CE1   1 
ATOM   2519  C  CE2   . TYR A 1 354  ? 14.828  15.012  108.129 1.00 86.82  ? 353  TYR A CE2   1 
ATOM   2520  C  CZ    . TYR A 1 354  ? 14.221  15.936  107.298 1.00 89.08  ? 353  TYR A CZ    1 
ATOM   2521  O  OH    . TYR A 1 354  ? 14.211  15.737  105.938 1.00 91.69  ? 353  TYR A OH    1 
ATOM   2522  N  N     . ARG A 1 355  ? 14.181  19.619  112.093 1.00 75.68  ? 354  ARG A N     1 
ATOM   2523  C  CA    . ARG A 1 355  ? 13.905  20.920  111.603 1.00 77.28  ? 354  ARG A CA    1 
ATOM   2524  C  C     . ARG A 1 355  ? 15.115  21.796  111.683 1.00 76.05  ? 354  ARG A C     1 
ATOM   2525  O  O     . ARG A 1 355  ? 15.376  22.550  110.791 1.00 77.11  ? 354  ARG A O     1 
ATOM   2526  C  CB    . ARG A 1 355  ? 12.701  21.503  112.338 1.00 78.62  ? 354  ARG A CB    1 
ATOM   2527  C  CG    . ARG A 1 355  ? 11.425  20.770  111.989 1.00 80.95  ? 354  ARG A CG    1 
ATOM   2528  C  CD    . ARG A 1 355  ? 10.433  20.732  113.119 1.00 81.35  ? 354  ARG A CD    1 
ATOM   2529  N  NE    . ARG A 1 355  ? 10.499  21.930  113.929 1.00 80.66  ? 354  ARG A NE    1 
ATOM   2530  C  CZ    . ARG A 1 355  ? 10.321  21.930  115.236 1.00 79.74  ? 354  ARG A CZ    1 
ATOM   2531  N  NH1   . ARG A 1 355  ? 10.407  23.057  115.907 1.00 79.40  ? 354  ARG A NH1   1 
ATOM   2532  N  NH2   . ARG A 1 355  ? 10.056  20.799  115.862 1.00 79.18  ? 354  ARG A NH2   1 
ATOM   2533  N  N     . LYS A 1 356  ? 15.866  21.702  112.753 1.00 78.30  ? 355  LYS A N     1 
ATOM   2534  C  CA    . LYS A 1 356  ? 17.070  22.510  112.888 1.00 76.69  ? 355  LYS A CA    1 
ATOM   2535  C  C     . LYS A 1 356  ? 18.153  22.037  111.929 1.00 74.09  ? 355  LYS A C     1 
ATOM   2536  O  O     . LYS A 1 356  ? 18.897  22.852  111.371 1.00 76.04  ? 355  LYS A O     1 
ATOM   2537  C  CB    . LYS A 1 356  ? 17.566  22.474  114.329 1.00 74.50  ? 355  LYS A CB    1 
ATOM   2538  C  CG    . LYS A 1 356  ? 18.509  23.606  114.673 1.00 72.52  ? 355  LYS A CG    1 
ATOM   2539  C  CD    . LYS A 1 356  ? 17.775  24.898  114.945 1.00 74.03  ? 355  LYS A CD    1 
ATOM   2540  C  CE    . LYS A 1 356  ? 16.889  24.769  116.165 1.00 74.50  ? 355  LYS A CE    1 
ATOM   2541  N  NZ    . LYS A 1 356  ? 16.332  26.083  116.576 1.00 77.19  ? 355  LYS A NZ    1 
ATOM   2542  N  N     . MET A 1 357  ? 18.251  20.724  111.713 1.00 74.13  ? 356  MET A N     1 
ATOM   2543  C  CA    . MET A 1 357  ? 19.227  20.205  110.763 1.00 71.67  ? 356  MET A CA    1 
ATOM   2544  C  C     . MET A 1 357  ? 18.834  20.481  109.315 1.00 73.31  ? 356  MET A C     1 
ATOM   2545  O  O     . MET A 1 357  ? 19.689  20.394  108.427 1.00 72.70  ? 356  MET A O     1 
ATOM   2546  C  CB    . MET A 1 357  ? 19.428  18.702  110.978 1.00 72.34  ? 356  MET A CB    1 
ATOM   2547  C  CG    . MET A 1 357  ? 19.858  18.329  112.388 1.00 71.40  ? 356  MET A CG    1 
ATOM   2548  S  SD    . MET A 1 357  ? 20.404  16.620  112.575 1.00 69.69  ? 356  MET A SD    1 
ATOM   2549  C  CE    . MET A 1 357  ? 21.984  16.712  111.755 1.00 69.09  ? 356  MET A CE    1 
ATOM   2550  N  N     . LYS A 1 358  ? 17.567  20.800  109.050 1.00 74.78  ? 357  LYS A N     1 
ATOM   2551  C  CA    . LYS A 1 358  ? 17.193  21.231  107.708 1.00 76.90  ? 357  LYS A CA    1 
ATOM   2552  C  C     . LYS A 1 358  ? 17.640  22.655  107.421 1.00 77.59  ? 357  LYS A C     1 
ATOM   2553  O  O     . LYS A 1 358  ? 17.727  23.037  106.253 1.00 79.02  ? 357  LYS A O     1 
ATOM   2554  C  CB    . LYS A 1 358  ? 15.678  21.116  107.497 1.00 78.97  ? 357  LYS A CB    1 
ATOM   2555  N  N     . THR A 1 359  ? 17.928  23.441  108.457 1.00 78.48  ? 358  THR A N     1 
ATOM   2556  C  CA    . THR A 1 359  ? 18.366  24.820  108.291 1.00 78.22  ? 358  THR A CA    1 
ATOM   2557  C  C     . THR A 1 359  ? 19.799  24.931  107.797 1.00 78.19  ? 358  THR A C     1 
ATOM   2558  O  O     . THR A 1 359  ? 20.213  26.027  107.409 1.00 79.37  ? 358  THR A O     1 
ATOM   2559  C  CB    . THR A 1 359  ? 18.243  25.570  109.617 1.00 77.48  ? 358  THR A CB    1 
ATOM   2560  O  OG1   . THR A 1 359  ? 19.072  24.928  110.590 1.00 74.29  ? 358  THR A OG1   1 
ATOM   2561  C  CG2   . THR A 1 359  ? 16.803  25.571  110.113 1.00 79.45  ? 358  THR A CG2   1 
ATOM   2562  N  N     . LEU A 1 360  ? 20.567  23.846  107.828 1.00 76.83  ? 359  LEU A N     1 
ATOM   2563  C  CA    . LEU A 1 360  ? 21.953  23.896  107.386 1.00 76.40  ? 359  LEU A CA    1 
ATOM   2564  C  C     . LEU A 1 360  ? 22.031  24.317  105.926 1.00 78.65  ? 359  LEU A C     1 
ATOM   2565  O  O     . LEU A 1 360  ? 21.249  23.862  105.091 1.00 78.72  ? 359  LEU A O     1 
ATOM   2566  C  CB    . LEU A 1 360  ? 22.616  22.532  107.571 1.00 73.77  ? 359  LEU A CB    1 
ATOM   2567  C  CG    . LEU A 1 360  ? 22.792  22.020  109.000 1.00 70.86  ? 359  LEU A CG    1 
ATOM   2568  C  CD1   . LEU A 1 360  ? 22.989  20.520  109.000 1.00 70.16  ? 359  LEU A CD1   1 
ATOM   2569  C  CD2   . LEU A 1 360  ? 23.972  22.700  109.675 1.00 70.31  ? 359  LEU A CD2   1 
ATOM   2570  N  N     . GLU A 1 361  ? 22.987  25.186  105.616 1.00 77.94  ? 360  GLU A N     1 
ATOM   2571  C  CA    . GLU A 1 361  ? 23.109  25.721  104.269 1.00 80.55  ? 360  GLU A CA    1 
ATOM   2572  C  C     . GLU A 1 361  ? 24.117  24.976  103.409 1.00 77.51  ? 360  GLU A C     1 
ATOM   2573  O  O     . GLU A 1 361  ? 23.907  24.864  102.197 1.00 78.80  ? 360  GLU A O     1 
ATOM   2574  C  CB    . GLU A 1 361  ? 23.486  27.204  104.324 1.00 85.75  ? 360  GLU A CB    1 
ATOM   2575  C  CG    . GLU A 1 361  ? 22.484  28.068  105.071 1.00 90.35  ? 360  GLU A CG    1 
ATOM   2576  C  CD    . GLU A 1 361  ? 21.246  28.376  104.258 1.00 95.93  ? 360  GLU A CD    1 
ATOM   2577  O  OE1   . GLU A 1 361  ? 21.047  29.560  103.914 1.00 99.63  ? 360  GLU A OE1   1 
ATOM   2578  O  OE2   . GLU A 1 361  ? 20.473  27.442  103.956 1.00 99.10  ? 360  GLU A OE2   1 
ATOM   2579  N  N     . THR A 1 362  ? 25.200  24.466  103.993 1.00 77.03  ? 361  THR A N     1 
ATOM   2580  C  CA    . THR A 1 362  ? 26.208  23.730  103.241 1.00 75.83  ? 361  THR A CA    1 
ATOM   2581  C  C     . THR A 1 362  ? 25.895  22.250  103.123 1.00 75.39  ? 361  THR A C     1 
ATOM   2582  O  O     . THR A 1 362  ? 26.701  21.505  102.560 1.00 73.41  ? 361  THR A O     1 
ATOM   2583  C  CB    . THR A 1 362  ? 27.579  23.888  103.885 1.00 75.23  ? 361  THR A CB    1 
ATOM   2584  O  OG1   . THR A 1 362  ? 27.587  23.200  105.141 1.00 75.38  ? 361  THR A OG1   1 
ATOM   2585  C  CG2   . THR A 1 362  ? 27.888  25.351  104.105 1.00 75.38  ? 361  THR A CG2   1 
ATOM   2586  N  N     . LEU A 1 363  ? 24.761  21.805  103.650 1.00 74.43  ? 362  LEU A N     1 
ATOM   2587  C  CA    . LEU A 1 363  ? 24.348  20.417  103.544 1.00 76.05  ? 362  LEU A CA    1 
ATOM   2588  C  C     . LEU A 1 363  ? 22.831  20.368  103.568 1.00 78.03  ? 362  LEU A C     1 
ATOM   2589  O  O     . LEU A 1 363  ? 22.176  21.266  104.101 1.00 79.58  ? 362  LEU A O     1 
ATOM   2590  C  CB    . LEU A 1 363  ? 24.925  19.560  104.678 1.00 71.85  ? 362  LEU A CB    1 
ATOM   2591  C  CG    . LEU A 1 363  ? 26.413  19.210  104.612 1.00 69.86  ? 362  LEU A CG    1 
ATOM   2592  C  CD1   . LEU A 1 363  ? 26.874  18.569  105.907 1.00 67.65  ? 362  LEU A CD1   1 
ATOM   2593  C  CD2   . LEU A 1 363  ? 26.688  18.291  103.437 1.00 70.64  ? 362  LEU A CD2   1 
ATOM   2594  N  N     . ASP A 1 364  ? 22.277  19.311  102.990 1.00 87.78  ? 363  ASP A N     1 
ATOM   2595  C  CA    . ASP A 1 364  ? 20.832  19.135  102.928 1.00 93.82  ? 363  ASP A CA    1 
ATOM   2596  C  C     . ASP A 1 364  ? 20.474  17.830  103.621 1.00 92.17  ? 363  ASP A C     1 
ATOM   2597  O  O     . ASP A 1 364  ? 20.779  16.748  103.106 1.00 94.39  ? 363  ASP A O     1 
ATOM   2598  C  CB    . ASP A 1 364  ? 20.341  19.141  101.486 1.00 102.75 ? 363  ASP A CB    1 
ATOM   2599  C  CG    . ASP A 1 364  ? 18.842  19.313  101.389 1.00 106.52 ? 363  ASP A CG    1 
ATOM   2600  O  OD1   . ASP A 1 364  ? 18.357  20.432  101.655 1.00 108.67 ? 363  ASP A OD1   1 
ATOM   2601  O  OD2   . ASP A 1 364  ? 18.149  18.333  101.043 1.00 107.45 ? 363  ASP A OD2   1 
ATOM   2602  N  N     . ILE A 1 365  ? 19.821  17.935  104.783 1.00 83.87  ? 364  ILE A N     1 
ATOM   2603  C  CA    . ILE A 1 365  ? 19.421  16.756  105.542 1.00 81.92  ? 364  ILE A CA    1 
ATOM   2604  C  C     . ILE A 1 365  ? 18.477  15.863  104.748 1.00 81.06  ? 364  ILE A C     1 
ATOM   2605  O  O     . ILE A 1 365  ? 18.420  14.653  104.991 1.00 78.19  ? 364  ILE A O     1 
ATOM   2606  C  CB    . ILE A 1 365  ? 18.782  17.176  106.882 1.00 83.19  ? 364  ILE A CB    1 
ATOM   2607  N  N     . GLU A 1 366  ? 17.733  16.425  103.795 1.00 78.26  ? 365  GLU A N     1 
ATOM   2608  C  CA    . GLU A 1 366  ? 16.849  15.604  102.975 1.00 79.99  ? 365  GLU A CA    1 
ATOM   2609  C  C     . GLU A 1 366  ? 17.620  14.735  101.992 1.00 82.84  ? 365  GLU A C     1 
ATOM   2610  O  O     . GLU A 1 366  ? 17.075  13.743  101.501 1.00 81.18  ? 365  GLU A O     1 
ATOM   2611  C  CB    . GLU A 1 366  ? 15.852  16.487  102.227 1.00 82.42  ? 365  GLU A CB    1 
ATOM   2612  N  N     . GLN A 1 367  ? 18.876  15.079  101.704 1.00 98.27  ? 366  GLN A N     1 
ATOM   2613  C  CA    . GLN A 1 367  ? 19.702  14.292  100.799 1.00 99.18  ? 366  GLN A CA    1 
ATOM   2614  C  C     . GLN A 1 367  ? 20.345  13.090  101.473 1.00 96.58  ? 366  GLN A C     1 
ATOM   2615  O  O     . GLN A 1 367  ? 20.881  12.224  100.774 1.00 95.97  ? 366  GLN A O     1 
ATOM   2616  C  CB    . GLN A 1 367  ? 20.794  15.170  100.185 1.00 101.48 ? 366  GLN A CB    1 
ATOM   2617  N  N     . MET A 1 368  ? 20.313  13.015  102.799 1.00 88.29  ? 367  MET A N     1 
ATOM   2618  C  CA    . MET A 1 368  ? 20.917  11.910  103.525 1.00 83.62  ? 367  MET A CA    1 
ATOM   2619  C  C     . MET A 1 368  ? 19.862  10.869  103.865 1.00 80.78  ? 367  MET A C     1 
ATOM   2620  O  O     . MET A 1 368  ? 18.720  11.209  104.182 1.00 80.90  ? 367  MET A O     1 
ATOM   2621  C  CB    . MET A 1 368  ? 21.587  12.408  104.802 1.00 80.59  ? 367  MET A CB    1 
ATOM   2622  C  CG    . MET A 1 368  ? 22.283  13.746  104.636 1.00 79.12  ? 367  MET A CG    1 
ATOM   2623  S  SD    . MET A 1 368  ? 23.450  14.057  105.965 1.00 74.95  ? 367  MET A SD    1 
ATOM   2624  C  CE    . MET A 1 368  ? 22.643  13.197  107.293 1.00 73.78  ? 367  MET A CE    1 
ATOM   2625  N  N     . ASP A 1 369  ? 20.252  9.598   103.793 1.00 77.11  ? 368  ASP A N     1 
ATOM   2626  C  CA    . ASP A 1 369  ? 19.375  8.513   104.209 1.00 77.85  ? 368  ASP A CA    1 
ATOM   2627  C  C     . ASP A 1 369  ? 19.256  8.481   105.726 1.00 75.15  ? 368  ASP A C     1 
ATOM   2628  O  O     . ASP A 1 369  ? 19.634  9.438   106.406 1.00 71.80  ? 368  ASP A O     1 
ATOM   2629  C  CB    . ASP A 1 369  ? 19.894  7.172   103.697 1.00 75.39  ? 368  ASP A CB    1 
ATOM   2630  C  CG    . ASP A 1 369  ? 21.355  6.969   104.008 1.00 72.89  ? 368  ASP A CG    1 
ATOM   2631  O  OD1   . ASP A 1 369  ? 22.149  7.889   103.717 1.00 72.37  ? 368  ASP A OD1   1 
ATOM   2632  O  OD2   . ASP A 1 369  ? 21.714  5.905   104.563 1.00 72.04  ? 368  ASP A OD2   1 
ATOM   2633  N  N     . ARG A 1 370  ? 18.752  7.376   106.268 1.00 74.67  ? 369  ARG A N     1 
ATOM   2634  C  CA    . ARG A 1 370  ? 18.476  7.323   107.697 1.00 73.06  ? 369  ARG A CA    1 
ATOM   2635  C  C     . ARG A 1 370  ? 19.733  7.030   108.511 1.00 71.87  ? 369  ARG A C     1 
ATOM   2636  O  O     . ARG A 1 370  ? 20.130  7.832   109.358 1.00 73.02  ? 369  ARG A O     1 
ATOM   2637  C  CB    . ARG A 1 370  ? 17.405  6.280   107.990 1.00 74.36  ? 369  ARG A CB    1 
ATOM   2638  C  CG    . ARG A 1 370  ? 17.443  5.833   109.421 1.00 72.80  ? 369  ARG A CG    1 
ATOM   2639  C  CD    . ARG A 1 370  ? 16.349  4.869   109.719 1.00 73.39  ? 369  ARG A CD    1 
ATOM   2640  N  NE    . ARG A 1 370  ? 15.220  5.518   110.373 1.00 73.99  ? 369  ARG A NE    1 
ATOM   2641  C  CZ    . ARG A 1 370  ? 14.038  5.695   109.803 1.00 75.47  ? 369  ARG A CZ    1 
ATOM   2642  N  NH1   . ARG A 1 370  ? 13.054  6.273   110.467 1.00 77.63  ? 369  ARG A NH1   1 
ATOM   2643  N  NH2   . ARG A 1 370  ? 13.834  5.255   108.576 1.00 76.94  ? 369  ARG A NH2   1 
ATOM   2644  N  N     . GLU A 1 371  ? 20.370  5.882   108.269 1.00 69.27  ? 370  GLU A N     1 
ATOM   2645  C  CA    . GLU A 1 371  ? 21.525  5.502   109.068 1.00 67.30  ? 370  GLU A CA    1 
ATOM   2646  C  C     . GLU A 1 371  ? 22.642  6.529   108.988 1.00 66.10  ? 370  GLU A C     1 
ATOM   2647  O  O     . GLU A 1 371  ? 23.544  6.510   109.826 1.00 64.36  ? 370  GLU A O     1 
ATOM   2648  C  CB    . GLU A 1 371  ? 22.051  4.138   108.636 1.00 67.54  ? 370  GLU A CB    1 
ATOM   2649  C  CG    . GLU A 1 371  ? 22.930  4.170   107.417 1.00 68.74  ? 370  GLU A CG    1 
ATOM   2650  C  CD    . GLU A 1 371  ? 23.593  2.834   107.148 1.00 72.46  ? 370  GLU A CD    1 
ATOM   2651  O  OE1   . GLU A 1 371  ? 23.843  2.514   105.962 1.00 74.68  ? 370  GLU A OE1   1 
ATOM   2652  O  OE2   . GLU A 1 371  ? 23.870  2.107   108.127 1.00 72.24  ? 370  GLU A OE2   1 
ATOM   2653  N  N     . THR A 1 372  ? 22.605  7.421   108.004 1.00 67.08  ? 371  THR A N     1 
ATOM   2654  C  CA    . THR A 1 372  ? 23.561  8.516   107.932 1.00 66.17  ? 371  THR A CA    1 
ATOM   2655  C  C     . THR A 1 372  ? 23.136  9.681   108.805 1.00 65.60  ? 371  THR A C     1 
ATOM   2656  O  O     . THR A 1 372  ? 23.984  10.395  109.347 1.00 64.26  ? 371  THR A O     1 
ATOM   2657  C  CB    . THR A 1 372  ? 23.718  8.967   106.478 1.00 67.62  ? 371  THR A CB    1 
ATOM   2658  O  OG1   . THR A 1 372  ? 24.412  7.956   105.751 1.00 67.88  ? 371  THR A OG1   1 
ATOM   2659  C  CG2   . THR A 1 372  ? 24.490  10.260  106.382 1.00 67.05  ? 371  THR A CG2   1 
ATOM   2660  N  N     . LEU A 1 373  ? 21.839  9.890   108.947 1.00 68.47  ? 372  LEU A N     1 
ATOM   2661  C  CA    . LEU A 1 373  ? 21.349  10.958  109.797 1.00 67.05  ? 372  LEU A CA    1 
ATOM   2662  C  C     . LEU A 1 373  ? 21.310  10.543  111.256 1.00 65.37  ? 372  LEU A C     1 
ATOM   2663  O  O     . LEU A 1 373  ? 21.522  11.385  112.135 1.00 63.95  ? 372  LEU A O     1 
ATOM   2664  C  CB    . LEU A 1 373  ? 19.966  11.405  109.319 1.00 72.25  ? 372  LEU A CB    1 
ATOM   2665  C  CG    . LEU A 1 373  ? 19.421  12.713  109.885 1.00 74.40  ? 372  LEU A CG    1 
ATOM   2666  C  CD1   . LEU A 1 373  ? 20.486  13.788  109.912 1.00 74.45  ? 372  LEU A CD1   1 
ATOM   2667  C  CD2   . LEU A 1 373  ? 18.248  13.176  109.063 1.00 79.07  ? 372  LEU A CD2   1 
ATOM   2668  N  N     . ASP A 1 374  ? 21.061  9.260   111.529 1.00 64.91  ? 373  ASP A N     1 
ATOM   2669  C  CA    . ASP A 1 374  ? 21.252  8.745   112.878 1.00 63.43  ? 373  ASP A CA    1 
ATOM   2670  C  C     . ASP A 1 374  ? 22.713  8.813   113.292 1.00 61.53  ? 373  ASP A C     1 
ATOM   2671  O  O     . ASP A 1 374  ? 23.022  9.181   114.430 1.00 60.17  ? 373  ASP A O     1 
ATOM   2672  C  CB    . ASP A 1 374  ? 20.747  7.309   112.985 1.00 63.96  ? 373  ASP A CB    1 
ATOM   2673  C  CG    . ASP A 1 374  ? 19.268  7.193   112.719 1.00 65.86  ? 373  ASP A CG    1 
ATOM   2674  O  OD1   . ASP A 1 374  ? 18.567  8.223   112.760 1.00 66.55  ? 373  ASP A OD1   1 
ATOM   2675  O  OD2   . ASP A 1 374  ? 18.798  6.058   112.523 1.00 66.73  ? 373  ASP A OD2   1 
ATOM   2676  N  N     . LYS A 1 375  ? 23.625  8.456   112.386 1.00 61.52  ? 374  LYS A N     1 
ATOM   2677  C  CA    . LYS A 1 375  ? 25.042  8.525   112.717 1.00 59.89  ? 374  LYS A CA    1 
ATOM   2678  C  C     . LYS A 1 375  ? 25.490  9.968   112.907 1.00 59.29  ? 374  LYS A C     1 
ATOM   2679  O  O     . LYS A 1 375  ? 26.300  10.262  113.792 1.00 57.75  ? 374  LYS A O     1 
ATOM   2680  C  CB    . LYS A 1 375  ? 25.874  7.840   111.637 1.00 60.28  ? 374  LYS A CB    1 
ATOM   2681  C  CG    . LYS A 1 375  ? 27.290  7.540   112.080 1.00 59.36  ? 374  LYS A CG    1 
ATOM   2682  C  CD    . LYS A 1 375  ? 28.200  7.271   110.895 1.00 61.84  ? 374  LYS A CD    1 
ATOM   2683  C  CE    . LYS A 1 375  ? 27.743  6.070   110.087 1.00 64.74  ? 374  LYS A CE    1 
ATOM   2684  N  NZ    . LYS A 1 375  ? 28.062  4.787   110.765 1.00 66.64  ? 374  LYS A NZ    1 
ATOM   2685  N  N     . LEU A 1 376  ? 24.963  10.885  112.100 1.00 60.59  ? 375  LEU A N     1 
ATOM   2686  C  CA    . LEU A 1 376  ? 25.283  12.293  112.292 1.00 60.26  ? 375  LEU A CA    1 
ATOM   2687  C  C     . LEU A 1 376  ? 24.862  12.769  113.678 1.00 59.38  ? 375  LEU A C     1 
ATOM   2688  O  O     . LEU A 1 376  ? 25.601  13.504  114.340 1.00 58.23  ? 375  LEU A O     1 
ATOM   2689  C  CB    . LEU A 1 376  ? 24.610  13.127  111.207 1.00 62.08  ? 375  LEU A CB    1 
ATOM   2690  C  CG    . LEU A 1 376  ? 25.110  14.558  111.072 1.00 62.08  ? 375  LEU A CG    1 
ATOM   2691  C  CD1   . LEU A 1 376  ? 26.612  14.559  111.007 1.00 60.85  ? 375  LEU A CD1   1 
ATOM   2692  C  CD2   . LEU A 1 376  ? 24.537  15.219  109.836 1.00 64.05  ? 375  LEU A CD2   1 
ATOM   2693  N  N     . ALA A 1 377  ? 23.679  12.358  114.135 1.00 63.63  ? 376  ALA A N     1 
ATOM   2694  C  CA    . ALA A 1 377  ? 23.221  12.766  115.456 1.00 63.01  ? 376  ALA A CA    1 
ATOM   2695  C  C     . ALA A 1 377  ? 24.026  12.094  116.559 1.00 62.69  ? 376  ALA A C     1 
ATOM   2696  O  O     . ALA A 1 377  ? 24.140  12.640  117.659 1.00 63.67  ? 376  ALA A O     1 
ATOM   2697  C  CB    . ALA A 1 377  ? 21.738  12.457  115.616 1.00 64.84  ? 376  ALA A CB    1 
ATOM   2698  N  N     . TYR A 1 378  ? 24.581  10.914  116.290 1.00 61.62  ? 377  TYR A N     1 
ATOM   2699  C  CA    . TYR A 1 378  ? 25.501  10.299  117.238 1.00 57.75  ? 377  TYR A CA    1 
ATOM   2700  C  C     . TYR A 1 378  ? 26.711  11.192  117.466 1.00 54.36  ? 377  TYR A C     1 
ATOM   2701  O  O     . TYR A 1 378  ? 27.038  11.532  118.604 1.00 52.97  ? 377  TYR A O     1 
ATOM   2702  C  CB    . TYR A 1 378  ? 25.928  8.921   116.730 1.00 55.43  ? 377  TYR A CB    1 
ATOM   2703  C  CG    . TYR A 1 378  ? 27.103  8.308   117.462 1.00 53.83  ? 377  TYR A CG    1 
ATOM   2704  C  CD1   . TYR A 1 378  ? 28.407  8.526   117.035 1.00 54.54  ? 377  TYR A CD1   1 
ATOM   2705  C  CD2   . TYR A 1 378  ? 26.911  7.499   118.567 1.00 53.15  ? 377  TYR A CD2   1 
ATOM   2706  C  CE1   . TYR A 1 378  ? 29.477  7.969   117.697 1.00 53.16  ? 377  TYR A CE1   1 
ATOM   2707  C  CE2   . TYR A 1 378  ? 27.981  6.941   119.232 1.00 52.39  ? 377  TYR A CE2   1 
ATOM   2708  C  CZ    . TYR A 1 378  ? 29.258  7.177   118.790 1.00 51.53  ? 377  TYR A CZ    1 
ATOM   2709  O  OH    . TYR A 1 378  ? 30.320  6.610   119.449 1.00 50.48  ? 377  TYR A OH    1 
ATOM   2710  N  N     . VAL A 1 379  ? 27.377  11.593  116.386 1.00 54.57  ? 378  VAL A N     1 
ATOM   2711  C  CA    . VAL A 1 379  ? 28.592  12.392  116.490 1.00 53.61  ? 378  VAL A CA    1 
ATOM   2712  C  C     . VAL A 1 379  ? 28.310  13.726  117.162 1.00 53.47  ? 378  VAL A C     1 
ATOM   2713  O  O     . VAL A 1 379  ? 29.082  14.188  118.005 1.00 52.25  ? 378  VAL A O     1 
ATOM   2714  C  CB    . VAL A 1 379  ? 29.207  12.584  115.094 1.00 54.44  ? 378  VAL A CB    1 
ATOM   2715  C  CG1   . VAL A 1 379  ? 30.293  13.637  115.119 1.00 53.82  ? 378  VAL A CG1   1 
ATOM   2716  C  CG2   . VAL A 1 379  ? 29.744  11.270  114.572 1.00 54.39  ? 378  VAL A CG2   1 
ATOM   2717  N  N     . LEU A 1 380  ? 27.210  14.370  116.805 1.00 54.82  ? 379  LEU A N     1 
ATOM   2718  C  CA    . LEU A 1 380  ? 26.941  15.703  117.323 1.00 54.97  ? 379  LEU A CA    1 
ATOM   2719  C  C     . LEU A 1 380  ? 26.353  15.686  118.721 1.00 54.31  ? 379  LEU A C     1 
ATOM   2720  O  O     . LEU A 1 380  ? 26.340  16.728  119.378 1.00 54.15  ? 379  LEU A O     1 
ATOM   2721  C  CB    . LEU A 1 380  ? 25.990  16.451  116.391 1.00 56.85  ? 379  LEU A CB    1 
ATOM   2722  C  CG    . LEU A 1 380  ? 26.440  16.649  114.949 1.00 57.82  ? 379  LEU A CG    1 
ATOM   2723  C  CD1   . LEU A 1 380  ? 25.304  17.241  114.157 1.00 59.78  ? 379  LEU A CD1   1 
ATOM   2724  C  CD2   . LEU A 1 380  ? 27.653  17.545  114.891 1.00 57.19  ? 379  LEU A CD2   1 
ATOM   2725  N  N     . THR A 1 381  ? 25.838  14.548  119.180 1.00 54.09  ? 380  THR A N     1 
ATOM   2726  C  CA    . THR A 1 381  ? 25.369  14.472  120.558 1.00 53.44  ? 380  THR A CA    1 
ATOM   2727  C  C     . THR A 1 381  ? 26.528  14.245  121.514 1.00 55.10  ? 380  THR A C     1 
ATOM   2728  O  O     . THR A 1 381  ? 26.616  14.900  122.556 1.00 57.24  ? 380  THR A O     1 
ATOM   2729  C  CB    . THR A 1 381  ? 24.340  13.353  120.712 1.00 55.21  ? 380  THR A CB    1 
ATOM   2730  O  OG1   . THR A 1 381  ? 23.220  13.608  119.856 1.00 58.96  ? 380  THR A OG1   1 
ATOM   2731  C  CG2   . THR A 1 381  ? 23.859  13.265  122.146 1.00 54.46  ? 380  THR A CG2   1 
ATOM   2732  N  N     . LEU A 1 382  ? 27.439  13.348  121.148 1.00 52.19  ? 381  LEU A N     1 
ATOM   2733  C  CA    . LEU A 1 382  ? 28.515  12.938  122.035 1.00 49.28  ? 381  LEU A CA    1 
ATOM   2734  C  C     . LEU A 1 382  ? 29.664  13.933  122.066 1.00 48.54  ? 381  LEU A C     1 
ATOM   2735  O  O     . LEU A 1 382  ? 30.310  14.077  123.098 1.00 47.34  ? 381  LEU A O     1 
ATOM   2736  C  CB    . LEU A 1 382  ? 29.025  11.564  121.610 1.00 49.01  ? 381  LEU A CB    1 
ATOM   2737  C  CG    . LEU A 1 382  ? 30.256  10.975  122.289 1.00 47.53  ? 381  LEU A CG    1 
ATOM   2738  C  CD1   . LEU A 1 382  ? 29.958  10.578  123.725 1.00 46.71  ? 381  LEU A CD1   1 
ATOM   2739  C  CD2   . LEU A 1 382  ? 30.729  9.781   121.476 1.00 47.76  ? 381  LEU A CD2   1 
ATOM   2740  N  N     . ASN A 1 383  ? 29.948  14.621  120.971 1.00 50.78  ? 382  ASN A N     1 
ATOM   2741  C  CA    . ASN A 1 383  ? 31.119  15.481  120.903 1.00 49.59  ? 382  ASN A CA    1 
ATOM   2742  C  C     . ASN A 1 383  ? 30.729  16.942  121.055 1.00 52.28  ? 382  ASN A C     1 
ATOM   2743  O  O     . ASN A 1 383  ? 29.757  17.402  120.452 1.00 52.25  ? 382  ASN A O     1 
ATOM   2744  C  CB    . ASN A 1 383  ? 31.869  15.278  119.591 1.00 50.93  ? 382  ASN A CB    1 
ATOM   2745  C  CG    . ASN A 1 383  ? 32.528  13.928  119.509 1.00 52.04  ? 382  ASN A CG    1 
ATOM   2746  O  OD1   . ASN A 1 383  ? 33.684  13.762  119.905 1.00 53.23  ? 382  ASN A OD1   1 
ATOM   2747  N  ND2   . ASN A 1 383  ? 31.795  12.943  119.003 1.00 53.69  ? 382  ASN A ND2   1 
ATOM   2748  N  N     . THR A 1 384  ? 31.506  17.669  121.855 1.00 48.82  ? 383  THR A N     1 
ATOM   2749  C  CA    . THR A 1 384  ? 31.251  19.072  122.131 1.00 49.53  ? 383  THR A CA    1 
ATOM   2750  C  C     . THR A 1 384  ? 32.325  20.008  121.601 1.00 49.94  ? 383  THR A C     1 
ATOM   2751  O  O     . THR A 1 384  ? 32.132  21.227  121.639 1.00 51.61  ? 383  THR A O     1 
ATOM   2752  C  CB    . THR A 1 384  ? 31.112  19.299  123.642 1.00 48.20  ? 383  THR A CB    1 
ATOM   2753  O  OG1   . THR A 1 384  ? 32.386  19.114  124.258 1.00 46.80  ? 383  THR A OG1   1 
ATOM   2754  C  CG2   . THR A 1 384  ? 30.136  18.307  124.238 1.00 48.06  ? 383  THR A CG2   1 
ATOM   2755  N  N     . GLU A 1 385  ? 33.446  19.488  121.126 1.00 53.83  ? 384  GLU A N     1 
ATOM   2756  C  CA    . GLU A 1 385  ? 34.564  20.295  120.671 1.00 56.50  ? 384  GLU A CA    1 
ATOM   2757  C  C     . GLU A 1 385  ? 34.762  20.125  119.172 1.00 55.52  ? 384  GLU A C     1 
ATOM   2758  O  O     . GLU A 1 385  ? 34.399  19.101  118.597 1.00 53.51  ? 384  GLU A O     1 
ATOM   2759  C  CB    . GLU A 1 385  ? 35.851  19.900  121.399 1.00 63.06  ? 384  GLU A CB    1 
ATOM   2760  C  CG    . GLU A 1 385  ? 35.994  20.464  122.780 1.00 68.46  ? 384  GLU A CG    1 
ATOM   2761  C  CD    . GLU A 1 385  ? 37.238  21.305  122.895 1.00 73.60  ? 384  GLU A CD    1 
ATOM   2762  O  OE1   . GLU A 1 385  ? 37.778  21.433  124.015 1.00 73.24  ? 384  GLU A OE1   1 
ATOM   2763  O  OE2   . GLU A 1 385  ? 37.674  21.834  121.847 1.00 79.29  ? 384  GLU A OE2   1 
ATOM   2764  N  N     . ARG A 1 386  ? 35.382  21.137  118.558 1.00 53.41  ? 385  ARG A N     1 
ATOM   2765  C  CA    . ARG A 1 386  ? 35.672  21.084  117.131 1.00 56.34  ? 385  ARG A CA    1 
ATOM   2766  C  C     . ARG A 1 386  ? 36.454  19.830  116.768 1.00 53.64  ? 385  ARG A C     1 
ATOM   2767  O  O     . ARG A 1 386  ? 36.074  19.088  115.857 1.00 54.82  ? 385  ARG A O     1 
ATOM   2768  C  CB    . ARG A 1 386  ? 36.449  22.325  116.696 1.00 58.12  ? 385  ARG A CB    1 
ATOM   2769  C  CG    . ARG A 1 386  ? 37.006  22.210  115.271 1.00 59.88  ? 385  ARG A CG    1 
ATOM   2770  C  CD    . ARG A 1 386  ? 38.021  23.301  114.950 1.00 61.96  ? 385  ARG A CD    1 
ATOM   2771  N  NE    . ARG A 1 386  ? 39.073  23.380  115.964 1.00 63.28  ? 385  ARG A NE    1 
ATOM   2772  C  CZ    . ARG A 1 386  ? 39.256  24.423  116.772 1.00 66.66  ? 385  ARG A CZ    1 
ATOM   2773  N  NH1   . ARG A 1 386  ? 38.468  25.486  116.671 1.00 69.33  ? 385  ARG A NH1   1 
ATOM   2774  N  NH2   . ARG A 1 386  ? 40.230  24.410  117.675 1.00 67.04  ? 385  ARG A NH2   1 
ATOM   2775  N  N     . GLU A 1 387  ? 37.555  19.577  117.470 1.00 58.30  ? 386  GLU A N     1 
ATOM   2776  C  CA    . GLU A 1 387  ? 38.427  18.485  117.064 1.00 61.01  ? 386  GLU A CA    1 
ATOM   2777  C  C     . GLU A 1 387  ? 37.749  17.138  117.257 1.00 55.80  ? 386  GLU A C     1 
ATOM   2778  O  O     . GLU A 1 387  ? 37.875  16.248  116.410 1.00 56.10  ? 386  GLU A O     1 
ATOM   2779  C  CB    . GLU A 1 387  ? 39.738  18.560  117.837 1.00 65.80  ? 386  GLU A CB    1 
ATOM   2780  C  CG    . GLU A 1 387  ? 40.312  19.961  117.868 1.00 70.34  ? 386  GLU A CG    1 
ATOM   2781  C  CD    . GLU A 1 387  ? 41.729  19.990  118.378 1.00 72.77  ? 386  GLU A CD    1 
ATOM   2782  O  OE1   . GLU A 1 387  ? 42.414  18.955  118.252 1.00 76.22  ? 386  GLU A OE1   1 
ATOM   2783  O  OE2   . GLU A 1 387  ? 42.156  21.039  118.910 1.00 74.75  ? 386  GLU A OE2   1 
ATOM   2784  N  N     . GLY A 1 388  ? 37.006  16.980  118.349 1.00 53.97  ? 387  GLY A N     1 
ATOM   2785  C  CA    . GLY A 1 388  ? 36.295  15.732  118.566 1.00 52.77  ? 387  GLY A CA    1 
ATOM   2786  C  C     . GLY A 1 388  ? 35.274  15.443  117.481 1.00 54.34  ? 387  GLY A C     1 
ATOM   2787  O  O     . GLY A 1 388  ? 35.147  14.307  117.023 1.00 55.93  ? 387  GLY A O     1 
ATOM   2788  N  N     . ILE A 1 389  ? 34.527  16.468  117.064 1.00 53.26  ? 388  ILE A N     1 
ATOM   2789  C  CA    . ILE A 1 389  ? 33.582  16.306  115.960 1.00 55.06  ? 388  ILE A CA    1 
ATOM   2790  C  C     . ILE A 1 389  ? 34.329  16.006  114.670 1.00 52.40  ? 388  ILE A C     1 
ATOM   2791  O  O     . ILE A 1 389  ? 34.022  15.039  113.963 1.00 52.98  ? 388  ILE A O     1 
ATOM   2792  C  CB    . ILE A 1 389  ? 32.682  17.550  115.822 1.00 52.77  ? 388  ILE A CB    1 
ATOM   2793  C  CG1   . ILE A 1 389  ? 31.712  17.640  116.990 1.00 52.35  ? 388  ILE A CG1   1 
ATOM   2794  C  CG2   . ILE A 1 389  ? 31.883  17.478  114.527 1.00 54.46  ? 388  ILE A CG2   1 
ATOM   2795  C  CD1   . ILE A 1 389  ? 31.108  18.994  117.196 1.00 53.16  ? 388  ILE A CD1   1 
ATOM   2796  N  N     . GLN A 1 390  ? 35.332  16.824  114.358 1.00 52.47  ? 389  GLN A N     1 
ATOM   2797  C  CA    . GLN A 1 390  ? 36.077  16.641  113.124 1.00 53.31  ? 389  GLN A CA    1 
ATOM   2798  C  C     . GLN A 1 390  ? 36.666  15.244  113.027 1.00 52.73  ? 389  GLN A C     1 
ATOM   2799  O  O     . GLN A 1 390  ? 36.593  14.611  111.971 1.00 53.71  ? 389  GLN A O     1 
ATOM   2800  C  CB    . GLN A 1 390  ? 37.169  17.700  113.004 1.00 61.74  ? 389  GLN A CB    1 
ATOM   2801  C  CG    . GLN A 1 390  ? 37.616  17.907  111.568 1.00 63.53  ? 389  GLN A CG    1 
ATOM   2802  C  CD    . GLN A 1 390  ? 38.266  19.256  111.330 1.00 64.96  ? 389  GLN A CD    1 
ATOM   2803  O  OE1   . GLN A 1 390  ? 39.310  19.346  110.691 1.00 70.23  ? 389  GLN A OE1   1 
ATOM   2804  N  NE2   . GLN A 1 390  ? 37.640  20.315  111.829 1.00 66.98  ? 389  GLN A NE2   1 
ATOM   2805  N  N     . GLU A 1 391  ? 37.249  14.744  114.117 1.00 51.27  ? 390  GLU A N     1 
ATOM   2806  C  CA    . GLU A 1 391  ? 37.840  13.410  114.108 1.00 50.79  ? 390  GLU A CA    1 
ATOM   2807  C  C     . GLU A 1 391  ? 36.775  12.335  113.963 1.00 51.19  ? 390  GLU A C     1 
ATOM   2808  O  O     . GLU A 1 391  ? 36.982  11.329  113.280 1.00 51.71  ? 390  GLU A O     1 
ATOM   2809  C  CB    . GLU A 1 391  ? 38.657  13.196  115.386 1.00 55.90  ? 390  GLU A CB    1 
ATOM   2810  C  CG    . GLU A 1 391  ? 39.209  11.784  115.556 1.00 54.53  ? 390  GLU A CG    1 
ATOM   2811  C  CD    . GLU A 1 391  ? 39.752  11.525  116.976 1.00 54.47  ? 390  GLU A CD    1 
ATOM   2812  O  OE1   . GLU A 1 391  ? 40.724  10.755  117.118 1.00 56.16  ? 390  GLU A OE1   1 
ATOM   2813  O  OE2   . GLU A 1 391  ? 39.218  12.092  117.959 1.00 55.23  ? 390  GLU A OE2   1 
ATOM   2814  N  N     . ALA A 1 392  ? 35.633  12.521  114.614 1.00 51.06  ? 391  ALA A N     1 
ATOM   2815  C  CA    . ALA A 1 392  ? 34.572  11.530  114.529 1.00 51.54  ? 391  ALA A CA    1 
ATOM   2816  C  C     . ALA A 1 392  ? 33.960  11.492  113.137 1.00 56.36  ? 391  ALA A C     1 
ATOM   2817  O  O     . ALA A 1 392  ? 33.594  10.417  112.649 1.00 58.24  ? 391  ALA A O     1 
ATOM   2818  C  CB    . ALA A 1 392  ? 33.499  11.822  115.575 1.00 51.13  ? 391  ALA A CB    1 
ATOM   2819  N  N     . LEU A 1 393  ? 33.847  12.651  112.489 1.00 56.27  ? 392  LEU A N     1 
ATOM   2820  C  CA    . LEU A 1 393  ? 33.331  12.695  111.127 1.00 55.77  ? 392  LEU A CA    1 
ATOM   2821  C  C     . LEU A 1 393  ? 34.286  12.014  110.160 1.00 56.24  ? 392  LEU A C     1 
ATOM   2822  O  O     . LEU A 1 393  ? 33.853  11.272  109.274 1.00 57.37  ? 392  LEU A O     1 
ATOM   2823  C  CB    . LEU A 1 393  ? 33.082  14.141  110.713 1.00 56.61  ? 392  LEU A CB    1 
ATOM   2824  C  CG    . LEU A 1 393  ? 31.967  14.847  111.479 1.00 56.61  ? 392  LEU A CG    1 
ATOM   2825  C  CD1   . LEU A 1 393  ? 31.872  16.293  111.071 1.00 57.51  ? 392  LEU A CD1   1 
ATOM   2826  C  CD2   . LEU A 1 393  ? 30.636  14.147  111.272 1.00 57.49  ? 392  LEU A CD2   1 
ATOM   2827  N  N     . GLU A 1 394  ? 35.588  12.236  110.331 1.00 55.48  ? 393  GLU A N     1 
ATOM   2828  C  CA    . GLU A 1 394  ? 36.575  11.619  109.456 1.00 58.26  ? 393  GLU A CA    1 
ATOM   2829  C  C     . GLU A 1 394  ? 36.636  10.110  109.631 1.00 57.03  ? 393  GLU A C     1 
ATOM   2830  O  O     . GLU A 1 394  ? 36.863  9.386   108.657 1.00 58.17  ? 393  GLU A O     1 
ATOM   2831  C  CB    . GLU A 1 394  ? 37.948  12.242  109.707 1.00 61.01  ? 393  GLU A CB    1 
ATOM   2832  C  CG    . GLU A 1 394  ? 37.964  13.722  109.393 1.00 65.37  ? 393  GLU A CG    1 
ATOM   2833  C  CD    . GLU A 1 394  ? 39.350  14.319  109.331 1.00 69.21  ? 393  GLU A CD    1 
ATOM   2834  O  OE1   . GLU A 1 394  ? 39.489  15.516  109.658 1.00 70.48  ? 393  GLU A OE1   1 
ATOM   2835  O  OE2   . GLU A 1 394  ? 40.296  13.600  108.948 1.00 72.35  ? 393  GLU A OE2   1 
ATOM   2836  N  N     . HIS A 1 395  ? 36.433  9.612   110.846 1.00 61.19  ? 394  HIS A N     1 
ATOM   2837  C  CA    . HIS A 1 395  ? 36.677  8.210   111.144 1.00 62.51  ? 394  HIS A CA    1 
ATOM   2838  C  C     . HIS A 1 395  ? 35.427  7.349   111.090 1.00 63.74  ? 394  HIS A C     1 
ATOM   2839  O  O     . HIS A 1 395  ? 35.542  6.121   111.072 1.00 67.77  ? 394  HIS A O     1 
ATOM   2840  C  CB    . HIS A 1 395  ? 37.328  8.071   112.524 1.00 64.90  ? 394  HIS A CB    1 
ATOM   2841  C  CG    . HIS A 1 395  ? 38.697  8.666   112.600 1.00 65.19  ? 394  HIS A CG    1 
ATOM   2842  N  ND1   . HIS A 1 395  ? 39.379  8.817   113.786 1.00 64.70  ? 394  HIS A ND1   1 
ATOM   2843  C  CD2   . HIS A 1 395  ? 39.510  9.148   111.632 1.00 63.98  ? 394  HIS A CD2   1 
ATOM   2844  C  CE1   . HIS A 1 395  ? 40.557  9.366   113.544 1.00 63.97  ? 394  HIS A CE1   1 
ATOM   2845  N  NE2   . HIS A 1 395  ? 40.661  9.577   112.244 1.00 64.26  ? 394  HIS A NE2   1 
ATOM   2846  N  N     . GLU A 1 396  ? 34.242  7.950   111.066 1.00 62.61  ? 395  GLU A N     1 
ATOM   2847  C  CA    . GLU A 1 396  ? 33.010  7.183   111.025 1.00 63.64  ? 395  GLU A CA    1 
ATOM   2848  C  C     . GLU A 1 396  ? 32.286  7.273   109.690 1.00 62.41  ? 395  GLU A C     1 
ATOM   2849  O  O     . GLU A 1 396  ? 31.485  6.386   109.376 1.00 59.59  ? 395  GLU A O     1 
ATOM   2850  C  CB    . GLU A 1 396  ? 32.074  7.639   112.152 1.00 66.30  ? 395  GLU A CB    1 
ATOM   2851  C  CG    . GLU A 1 396  ? 32.686  7.477   113.538 1.00 66.12  ? 395  GLU A CG    1 
ATOM   2852  C  CD    . GLU A 1 396  ? 32.816  6.024   113.957 1.00 66.82  ? 395  GLU A CD    1 
ATOM   2853  O  OE1   . GLU A 1 396  ? 31.931  5.543   114.690 1.00 69.34  ? 395  GLU A OE1   1 
ATOM   2854  O  OE2   . GLU A 1 396  ? 33.792  5.360   113.550 1.00 68.63  ? 395  GLU A OE2   1 
ATOM   2855  N  N     . PHE A 1 397  ? 32.564  8.294   108.892 1.00 58.48  ? 396  PHE A N     1 
ATOM   2856  C  CA    . PHE A 1 397  ? 31.976  8.436   107.574 1.00 60.29  ? 396  PHE A CA    1 
ATOM   2857  C  C     . PHE A 1 397  ? 33.023  8.163   106.507 1.00 61.00  ? 396  PHE A C     1 
ATOM   2858  O  O     . PHE A 1 397  ? 34.219  8.383   106.719 1.00 60.14  ? 396  PHE A O     1 
ATOM   2859  C  CB    . PHE A 1 397  ? 31.388  9.835   107.391 1.00 60.79  ? 396  PHE A CB    1 
ATOM   2860  C  CG    . PHE A 1 397  ? 30.214  10.108  108.277 1.00 60.52  ? 396  PHE A CG    1 
ATOM   2861  C  CD1   . PHE A 1 397  ? 30.401  10.488  109.600 1.00 58.95  ? 396  PHE A CD1   1 
ATOM   2862  C  CD2   . PHE A 1 397  ? 28.925  9.963   107.799 1.00 61.92  ? 396  PHE A CD2   1 
ATOM   2863  C  CE1   . PHE A 1 397  ? 29.324  10.729  110.426 1.00 58.80  ? 396  PHE A CE1   1 
ATOM   2864  C  CE2   . PHE A 1 397  ? 27.838  10.206  108.620 1.00 61.80  ? 396  PHE A CE2   1 
ATOM   2865  C  CZ    . PHE A 1 397  ? 28.041  10.592  109.939 1.00 60.24  ? 396  PHE A CZ    1 
ATOM   2866  N  N     . ALA A 1 398  ? 32.553  7.676   105.356 1.00 62.67  ? 397  ALA A N     1 
ATOM   2867  C  CA    . ALA A 1 398  ? 33.430  7.409   104.227 1.00 66.80  ? 397  ALA A CA    1 
ATOM   2868  C  C     . ALA A 1 398  ? 34.186  8.669   103.829 1.00 69.37  ? 397  ALA A C     1 
ATOM   2869  O  O     . ALA A 1 398  ? 33.686  9.787   103.961 1.00 65.88  ? 397  ALA A O     1 
ATOM   2870  C  CB    . ALA A 1 398  ? 32.627  6.881   103.042 1.00 65.62  ? 397  ALA A CB    1 
ATOM   2871  N  N     . ASP A 1 399  ? 35.395  8.465   103.300 1.00 89.47  ? 398  ASP A N     1 
ATOM   2872  C  CA    . ASP A 1 399  ? 36.378  9.542   103.209 1.00 90.82  ? 398  ASP A CA    1 
ATOM   2873  C  C     . ASP A 1 399  ? 35.842  10.760  102.464 1.00 92.13  ? 398  ASP A C     1 
ATOM   2874  O  O     . ASP A 1 399  ? 36.202  11.898  102.786 1.00 95.25  ? 398  ASP A O     1 
ATOM   2875  C  CB    . ASP A 1 399  ? 37.650  9.020   102.542 1.00 90.18  ? 398  ASP A CB    1 
ATOM   2876  C  CG    . ASP A 1 399  ? 38.388  8.024   103.410 1.00 90.75  ? 398  ASP A CG    1 
ATOM   2877  O  OD1   . ASP A 1 399  ? 38.993  8.447   104.418 1.00 91.93  ? 398  ASP A OD1   1 
ATOM   2878  O  OD2   . ASP A 1 399  ? 38.352  6.818   103.088 1.00 90.57  ? 398  ASP A OD2   1 
ATOM   2879  N  N     . GLY A 1 400  ? 34.985  10.551  101.473 1.00 86.59  ? 399  GLY A N     1 
ATOM   2880  C  CA    . GLY A 1 400  ? 34.513  11.677  100.693 1.00 85.83  ? 399  GLY A CA    1 
ATOM   2881  C  C     . GLY A 1 400  ? 33.187  12.239  101.160 1.00 78.84  ? 399  GLY A C     1 
ATOM   2882  O  O     . GLY A 1 400  ? 32.499  12.926  100.399 1.00 80.50  ? 399  GLY A O     1 
ATOM   2883  N  N     . SER A 1 401  ? 32.817  11.973  102.414 1.00 74.74  ? 400  SER A N     1 
ATOM   2884  C  CA    . SER A 1 401  ? 31.479  12.325  102.874 1.00 71.58  ? 400  SER A CA    1 
ATOM   2885  C  C     . SER A 1 401  ? 31.338  13.789  103.261 1.00 74.26  ? 400  SER A C     1 
ATOM   2886  O  O     . SER A 1 401  ? 30.215  14.300  103.274 1.00 75.96  ? 400  SER A O     1 
ATOM   2887  C  CB    . SER A 1 401  ? 31.076  11.462  104.066 1.00 67.36  ? 400  SER A CB    1 
ATOM   2888  O  OG    . SER A 1 401  ? 31.115  10.085  103.749 1.00 65.47  ? 400  SER A OG    1 
ATOM   2889  N  N     . PHE A 1 402  ? 32.429  14.473  103.581 1.00 72.48  ? 401  PHE A N     1 
ATOM   2890  C  CA    . PHE A 1 402  ? 32.341  15.830  104.094 1.00 71.48  ? 401  PHE A CA    1 
ATOM   2891  C  C     . PHE A 1 402  ? 33.475  16.670  103.532 1.00 69.46  ? 401  PHE A C     1 
ATOM   2892  O  O     . PHE A 1 402  ? 34.585  16.178  103.314 1.00 68.36  ? 401  PHE A O     1 
ATOM   2893  C  CB    . PHE A 1 402  ? 32.401  15.873  105.640 1.00 66.28  ? 401  PHE A CB    1 
ATOM   2894  C  CG    . PHE A 1 402  ? 31.240  15.195  106.318 1.00 64.09  ? 401  PHE A CG    1 
ATOM   2895  C  CD1   . PHE A 1 402  ? 30.035  15.850  106.476 1.00 64.10  ? 401  PHE A CD1   1 
ATOM   2896  C  CD2   . PHE A 1 402  ? 31.359  13.906  106.803 1.00 63.87  ? 401  PHE A CD2   1 
ATOM   2897  C  CE1   . PHE A 1 402  ? 28.971  15.229  107.090 1.00 65.72  ? 401  PHE A CE1   1 
ATOM   2898  C  CE2   . PHE A 1 402  ? 30.296  13.284  107.423 1.00 63.50  ? 401  PHE A CE2   1 
ATOM   2899  C  CZ    . PHE A 1 402  ? 29.104  13.946  107.566 1.00 65.57  ? 401  PHE A CZ    1 
ATOM   2900  N  N     . SER A 1 403  ? 33.188  17.950  103.322 1.00 72.95  ? 402  SER A N     1 
ATOM   2901  C  CA    . SER A 1 403  ? 34.204  18.938  102.997 1.00 72.41  ? 402  SER A CA    1 
ATOM   2902  C  C     . SER A 1 403  ? 34.510  19.789  104.221 1.00 73.39  ? 402  SER A C     1 
ATOM   2903  O  O     . SER A 1 403  ? 33.742  19.831  105.184 1.00 72.78  ? 402  SER A O     1 
ATOM   2904  C  CB    . SER A 1 403  ? 33.751  19.838  101.849 1.00 75.68  ? 402  SER A CB    1 
ATOM   2905  O  OG    . SER A 1 403  ? 33.116  21.001  102.351 1.00 76.46  ? 402  SER A OG    1 
ATOM   2906  N  N     . GLN A 1 404  ? 35.648  20.486  104.162 1.00 69.52  ? 403  GLN A N     1 
ATOM   2907  C  CA    . GLN A 1 404  ? 36.062  21.337  105.274 1.00 69.23  ? 403  GLN A CA    1 
ATOM   2908  C  C     . GLN A 1 404  ? 34.999  22.376  105.614 1.00 70.77  ? 403  GLN A C     1 
ATOM   2909  O  O     . GLN A 1 404  ? 34.732  22.640  106.791 1.00 71.26  ? 403  GLN A O     1 
ATOM   2910  C  CB    . GLN A 1 404  ? 37.386  22.021  104.941 1.00 69.94  ? 403  GLN A CB    1 
ATOM   2911  C  CG    . GLN A 1 404  ? 37.903  22.940  106.037 1.00 70.05  ? 403  GLN A CG    1 
ATOM   2912  C  CD    . GLN A 1 404  ? 38.683  22.204  107.108 1.00 68.09  ? 403  GLN A CD    1 
ATOM   2913  O  OE1   . GLN A 1 404  ? 38.888  20.993  107.027 1.00 66.33  ? 403  GLN A OE1   1 
ATOM   2914  N  NE2   . GLN A 1 404  ? 39.129  22.937  108.117 1.00 69.29  ? 403  GLN A NE2   1 
ATOM   2915  N  N     . LYS A 1 405  ? 34.376  22.973  104.597 1.00 78.37  ? 404  LYS A N     1 
ATOM   2916  C  CA    . LYS A 1 405  ? 33.366  24.000  104.841 1.00 81.27  ? 404  LYS A CA    1 
ATOM   2917  C  C     . LYS A 1 405  ? 32.116  23.406  105.472 1.00 81.64  ? 404  LYS A C     1 
ATOM   2918  O  O     . LYS A 1 405  ? 31.426  24.069  106.255 1.00 83.07  ? 404  LYS A O     1 
ATOM   2919  C  CB    . LYS A 1 405  ? 33.024  24.709  103.531 1.00 86.87  ? 404  LYS A CB    1 
ATOM   2920  C  CG    . LYS A 1 405  ? 31.646  25.360  103.495 1.00 89.68  ? 404  LYS A CG    1 
ATOM   2921  C  CD    . LYS A 1 405  ? 31.232  25.683  102.081 1.00 91.69  ? 404  LYS A CD    1 
ATOM   2922  C  CE    . LYS A 1 405  ? 32.370  26.325  101.315 1.00 91.99  ? 404  LYS A CE    1 
ATOM   2923  N  NZ    . LYS A 1 405  ? 32.697  27.674  101.823 1.00 92.13  ? 404  LYS A NZ    1 
ATOM   2924  N  N     . GLN A 1 406  ? 31.796  22.165  105.122 1.00 76.01  ? 405  GLN A N     1 
ATOM   2925  C  CA    . GLN A 1 406  ? 30.636  21.513  105.707 1.00 72.69  ? 405  GLN A CA    1 
ATOM   2926  C  C     . GLN A 1 406  ? 30.909  21.031  107.122 1.00 72.21  ? 405  GLN A C     1 
ATOM   2927  O  O     . GLN A 1 406  ? 30.004  21.062  107.962 1.00 69.36  ? 405  GLN A O     1 
ATOM   2928  C  CB    . GLN A 1 406  ? 30.185  20.349  104.829 1.00 72.83  ? 405  GLN A CB    1 
ATOM   2929  C  CG    . GLN A 1 406  ? 30.238  20.659  103.352 1.00 72.95  ? 405  GLN A CG    1 
ATOM   2930  C  CD    . GLN A 1 406  ? 29.633  19.556  102.526 1.00 70.99  ? 405  GLN A CD    1 
ATOM   2931  O  OE1   . GLN A 1 406  ? 29.924  18.380  102.737 1.00 70.22  ? 405  GLN A OE1   1 
ATOM   2932  N  NE2   . GLN A 1 406  ? 28.785  19.924  101.574 1.00 72.23  ? 405  GLN A NE2   1 
ATOM   2933  N  N     . VAL A 1 407  ? 32.136  20.592  107.415 1.00 70.42  ? 406  VAL A N     1 
ATOM   2934  C  CA    . VAL A 1 407  ? 32.463  20.330  108.811 1.00 69.18  ? 406  VAL A CA    1 
ATOM   2935  C  C     . VAL A 1 407  ? 32.609  21.643  109.559 1.00 67.29  ? 406  VAL A C     1 
ATOM   2936  O  O     . VAL A 1 407  ? 32.301  21.718  110.750 1.00 67.57  ? 406  VAL A O     1 
ATOM   2937  C  CB    . VAL A 1 407  ? 33.722  19.450  108.956 1.00 67.29  ? 406  VAL A CB    1 
ATOM   2938  C  CG1   . VAL A 1 407  ? 33.670  18.273  108.005 1.00 68.22  ? 406  VAL A CG1   1 
ATOM   2939  C  CG2   . VAL A 1 407  ? 35.002  20.250  108.773 1.00 67.81  ? 406  VAL A CG2   1 
ATOM   2940  N  N     . ASP A 1 408  ? 33.053  22.701  108.878 1.00 74.31  ? 407  ASP A N     1 
ATOM   2941  C  CA    . ASP A 1 408  ? 33.088  24.014  109.508 1.00 75.14  ? 407  ASP A CA    1 
ATOM   2942  C  C     . ASP A 1 408  ? 31.699  24.436  109.963 1.00 75.12  ? 407  ASP A C     1 
ATOM   2943  O  O     . ASP A 1 408  ? 31.538  24.978  111.061 1.00 73.90  ? 407  ASP A O     1 
ATOM   2944  C  CB    . ASP A 1 408  ? 33.673  25.048  108.546 1.00 77.75  ? 407  ASP A CB    1 
ATOM   2945  C  CG    . ASP A 1 408  ? 35.186  25.034  108.526 1.00 79.30  ? 407  ASP A CG    1 
ATOM   2946  O  OD1   . ASP A 1 408  ? 35.784  24.057  109.025 1.00 80.16  ? 407  ASP A OD1   1 
ATOM   2947  O  OD2   . ASP A 1 408  ? 35.777  26.001  108.001 1.00 80.24  ? 407  ASP A OD2   1 
ATOM   2948  N  N     . GLU A 1 409  ? 30.679  24.180  109.140 1.00 74.42  ? 408  GLU A N     1 
ATOM   2949  C  CA    . GLU A 1 409  ? 29.328  24.595  109.499 1.00 77.18  ? 408  GLU A CA    1 
ATOM   2950  C  C     . GLU A 1 409  ? 28.752  23.698  110.583 1.00 73.86  ? 408  GLU A C     1 
ATOM   2951  O  O     . GLU A 1 409  ? 28.048  24.175  111.479 1.00 74.59  ? 408  GLU A O     1 
ATOM   2952  C  CB    . GLU A 1 409  ? 28.422  24.593  108.267 1.00 80.41  ? 408  GLU A CB    1 
ATOM   2953  C  CG    . GLU A 1 409  ? 27.091  25.300  108.491 1.00 80.30  ? 408  GLU A CG    1 
ATOM   2954  C  CD    . GLU A 1 409  ? 26.117  25.102  107.350 1.00 80.40  ? 408  GLU A CD    1 
ATOM   2955  O  OE1   . GLU A 1 409  ? 25.610  23.975  107.188 1.00 81.63  ? 408  GLU A OE1   1 
ATOM   2956  O  OE2   . GLU A 1 409  ? 25.856  26.074  106.611 1.00 81.46  ? 408  GLU A OE2   1 
ATOM   2957  N  N     . LEU A 1 410  ? 29.037  22.396  110.518 1.00 77.16  ? 409  LEU A N     1 
ATOM   2958  C  CA    . LEU A 1 410  ? 28.578  21.492  111.565 1.00 73.94  ? 409  LEU A CA    1 
ATOM   2959  C  C     . LEU A 1 410  ? 29.160  21.868  112.919 1.00 71.38  ? 409  LEU A C     1 
ATOM   2960  O  O     . LEU A 1 410  ? 28.478  21.742  113.941 1.00 69.99  ? 409  LEU A O     1 
ATOM   2961  C  CB    . LEU A 1 410  ? 28.937  20.051  111.208 1.00 74.80  ? 409  LEU A CB    1 
ATOM   2962  C  CG    . LEU A 1 410  ? 28.066  19.461  110.098 1.00 75.33  ? 409  LEU A CG    1 
ATOM   2963  C  CD1   . LEU A 1 410  ? 28.590  18.113  109.635 1.00 73.62  ? 409  LEU A CD1   1 
ATOM   2964  C  CD2   . LEU A 1 410  ? 26.642  19.330  110.582 1.00 75.51  ? 409  LEU A CD2   1 
ATOM   2965  N  N     . VAL A 1 411  ? 30.407  22.344  112.950 1.00 67.10  ? 410  VAL A N     1 
ATOM   2966  C  CA    . VAL A 1 411  ? 31.003  22.763  114.215 1.00 64.17  ? 410  VAL A CA    1 
ATOM   2967  C  C     . VAL A 1 411  ? 30.223  23.932  114.809 1.00 63.32  ? 410  VAL A C     1 
ATOM   2968  O  O     . VAL A 1 411  ? 29.761  23.875  115.954 1.00 63.24  ? 410  VAL A O     1 
ATOM   2969  C  CB    . VAL A 1 411  ? 32.487  23.122  114.025 1.00 61.17  ? 410  VAL A CB    1 
ATOM   2970  C  CG1   . VAL A 1 411  ? 33.024  23.767  115.292 1.00 56.47  ? 410  VAL A CG1   1 
ATOM   2971  C  CG2   . VAL A 1 411  ? 33.295  21.877  113.677 1.00 56.63  ? 410  VAL A CG2   1 
ATOM   2972  N  N     . GLN A 1 412  ? 30.058  25.011  114.035 1.00 68.58  ? 411  GLN A N     1 
ATOM   2973  C  CA    . GLN A 1 412  ? 29.324  26.172  114.530 1.00 70.51  ? 411  GLN A CA    1 
ATOM   2974  C  C     . GLN A 1 412  ? 27.882  25.818  114.841 1.00 68.76  ? 411  GLN A C     1 
ATOM   2975  O  O     . GLN A 1 412  ? 27.268  26.416  115.729 1.00 69.04  ? 411  GLN A O     1 
ATOM   2976  C  CB    . GLN A 1 412  ? 29.377  27.288  113.499 1.00 77.15  ? 411  GLN A CB    1 
ATOM   2977  C  CG    . GLN A 1 412  ? 30.745  27.458  112.893 1.00 80.19  ? 411  GLN A CG    1 
ATOM   2978  C  CD    . GLN A 1 412  ? 31.675  28.231  113.793 1.00 80.37  ? 411  GLN A CD    1 
ATOM   2979  O  OE1   . GLN A 1 412  ? 32.409  27.656  114.601 1.00 78.77  ? 411  GLN A OE1   1 
ATOM   2980  N  NE2   . GLN A 1 412  ? 31.649  29.552  113.661 1.00 81.92  ? 411  GLN A NE2   1 
ATOM   2981  N  N     . PHE A 1 413  ? 27.337  24.837  114.129 1.00 65.77  ? 412  PHE A N     1 
ATOM   2982  C  CA    . PHE A 1 413  ? 25.955  24.431  114.343 1.00 65.44  ? 412  PHE A CA    1 
ATOM   2983  C  C     . PHE A 1 413  ? 25.799  23.714  115.675 1.00 64.46  ? 412  PHE A C     1 
ATOM   2984  O  O     . PHE A 1 413  ? 24.867  23.993  116.435 1.00 66.86  ? 412  PHE A O     1 
ATOM   2985  C  CB    . PHE A 1 413  ? 25.500  23.542  113.191 1.00 66.35  ? 412  PHE A CB    1 
ATOM   2986  C  CG    . PHE A 1 413  ? 24.078  23.095  113.298 1.00 65.03  ? 412  PHE A CG    1 
ATOM   2987  C  CD1   . PHE A 1 413  ? 23.047  23.960  112.992 1.00 66.85  ? 412  PHE A CD1   1 
ATOM   2988  C  CD2   . PHE A 1 413  ? 23.765  21.807  113.674 1.00 64.02  ? 412  PHE A CD2   1 
ATOM   2989  C  CE1   . PHE A 1 413  ? 21.730  23.546  113.071 1.00 67.85  ? 412  PHE A CE1   1 
ATOM   2990  C  CE2   . PHE A 1 413  ? 22.445  21.397  113.756 1.00 65.02  ? 412  PHE A CE2   1 
ATOM   2991  C  CZ    . PHE A 1 413  ? 21.438  22.267  113.455 1.00 66.93  ? 412  PHE A CZ    1 
ATOM   2992  N  N     . ARG A 1 414  ? 26.705  22.781  115.969 1.00 59.83  ? 413  ARG A N     1 
ATOM   2993  C  CA    . ARG A 1 414  ? 26.609  22.016  117.207 1.00 58.33  ? 413  ARG A CA    1 
ATOM   2994  C  C     . ARG A 1 414  ? 26.711  22.929  118.421 1.00 57.82  ? 413  ARG A C     1 
ATOM   2995  O  O     . ARG A 1 414  ? 25.952  22.785  119.386 1.00 57.64  ? 413  ARG A O     1 
ATOM   2996  C  CB    . ARG A 1 414  ? 27.705  20.948  117.235 1.00 56.72  ? 413  ARG A CB    1 
ATOM   2997  C  CG    . ARG A 1 414  ? 27.422  19.759  118.126 1.00 55.56  ? 413  ARG A CG    1 
ATOM   2998  C  CD    . ARG A 1 414  ? 27.718  20.062  119.579 1.00 54.28  ? 413  ARG A CD    1 
ATOM   2999  N  NE    . ARG A 1 414  ? 27.284  18.989  120.464 1.00 53.42  ? 413  ARG A NE    1 
ATOM   3000  C  CZ    . ARG A 1 414  ? 27.120  19.125  121.776 1.00 52.65  ? 413  ARG A CZ    1 
ATOM   3001  N  NH1   . ARG A 1 414  ? 27.349  20.297  122.352 1.00 52.63  ? 413  ARG A NH1   1 
ATOM   3002  N  NH2   . ARG A 1 414  ? 26.725  18.092  122.510 1.00 52.00  ? 413  ARG A NH2   1 
ATOM   3003  N  N     . LYS A 1 415  ? 27.643  23.880  118.383 1.00 66.40  ? 414  LYS A N     1 
ATOM   3004  C  CA    . LYS A 1 415  ? 27.794  24.815  119.489 1.00 66.08  ? 414  LYS A CA    1 
ATOM   3005  C  C     . LYS A 1 415  ? 26.541  25.658  119.675 1.00 67.70  ? 414  LYS A C     1 
ATOM   3006  O  O     . LYS A 1 415  ? 26.105  25.891  120.808 1.00 67.18  ? 414  LYS A O     1 
ATOM   3007  C  CB    . LYS A 1 415  ? 29.018  25.697  119.256 1.00 67.91  ? 414  LYS A CB    1 
ATOM   3008  C  CG    . LYS A 1 415  ? 30.268  24.884  118.969 1.00 69.99  ? 414  LYS A CG    1 
ATOM   3009  C  CD    . LYS A 1 415  ? 31.544  25.707  118.995 1.00 70.97  ? 414  LYS A CD    1 
ATOM   3010  C  CE    . LYS A 1 415  ? 32.706  24.848  119.494 1.00 70.84  ? 414  LYS A CE    1 
ATOM   3011  N  NZ    . LYS A 1 415  ? 34.029  25.533  119.417 1.00 71.95  ? 414  LYS A NZ    1 
ATOM   3012  N  N     . ALA A 1 416  ? 25.934  26.110  118.576 1.00 61.05  ? 415  ALA A N     1 
ATOM   3013  C  CA    . ALA A 1 416  ? 24.750  26.952  118.680 1.00 63.79  ? 415  ALA A CA    1 
ATOM   3014  C  C     . ALA A 1 416  ? 23.512  26.183  119.115 1.00 62.83  ? 415  ALA A C     1 
ATOM   3015  O  O     . ALA A 1 416  ? 22.484  26.810  119.384 1.00 64.26  ? 415  ALA A O     1 
ATOM   3016  C  CB    . ALA A 1 416  ? 24.477  27.645  117.346 1.00 64.59  ? 415  ALA A CB    1 
ATOM   3017  N  N     . ASN A 1 417  ? 23.584  24.857  119.191 1.00 65.89  ? 416  ASN A N     1 
ATOM   3018  C  CA    . ASN A 1 417  ? 22.457  24.007  119.561 1.00 66.18  ? 416  ASN A CA    1 
ATOM   3019  C  C     . ASN A 1 417  ? 22.871  22.982  120.604 1.00 65.39  ? 416  ASN A C     1 
ATOM   3020  O  O     . ASN A 1 417  ? 22.409  21.837  120.601 1.00 64.15  ? 416  ASN A O     1 
ATOM   3021  C  CB    . ASN A 1 417  ? 21.864  23.314  118.339 1.00 67.06  ? 416  ASN A CB    1 
ATOM   3022  C  CG    . ASN A 1 417  ? 21.016  24.243  117.500 1.00 68.81  ? 416  ASN A CG    1 
ATOM   3023  O  OD1   . ASN A 1 417  ? 19.865  24.517  117.835 1.00 69.17  ? 416  ASN A OD1   1 
ATOM   3024  N  ND2   . ASN A 1 417  ? 21.582  24.736  116.404 1.00 70.56  ? 416  ASN A ND2   1 
ATOM   3025  N  N     . SER A 1 418  ? 23.757  23.381  121.515 1.00 65.47  ? 417  SER A N     1 
ATOM   3026  C  CA    . SER A 1 418  ? 24.071  22.525  122.650 1.00 61.71  ? 417  SER A CA    1 
ATOM   3027  C  C     . SER A 1 418  ? 22.814  22.145  123.416 1.00 60.70  ? 417  SER A C     1 
ATOM   3028  O  O     . SER A 1 418  ? 22.732  21.042  123.968 1.00 61.49  ? 417  SER A O     1 
ATOM   3029  C  CB    . SER A 1 418  ? 25.064  23.232  123.568 1.00 59.58  ? 417  SER A CB    1 
ATOM   3030  O  OG    . SER A 1 418  ? 24.582  24.516  123.927 1.00 59.52  ? 417  SER A OG    1 
ATOM   3031  N  N     . SER A 1 419  ? 21.821  23.032  123.441 1.00 59.12  ? 418  SER A N     1 
ATOM   3032  C  CA    . SER A 1 419  ? 20.590  22.764  124.169 1.00 59.89  ? 418  SER A CA    1 
ATOM   3033  C  C     . SER A 1 419  ? 19.829  21.577  123.603 1.00 60.39  ? 418  SER A C     1 
ATOM   3034  O  O     . SER A 1 419  ? 18.978  21.014  124.297 1.00 60.66  ? 418  SER A O     1 
ATOM   3035  C  CB    . SER A 1 419  ? 19.709  24.011  124.161 1.00 61.85  ? 418  SER A CB    1 
ATOM   3036  O  OG    . SER A 1 419  ? 19.855  24.724  122.943 1.00 63.00  ? 418  SER A OG    1 
ATOM   3037  N  N     . ILE A 1 420  ? 20.111  21.185  122.367 1.00 66.70  ? 419  ILE A N     1 
ATOM   3038  C  CA    . ILE A 1 420  ? 19.430  20.067  121.731 1.00 67.18  ? 419  ILE A CA    1 
ATOM   3039  C  C     . ILE A 1 420  ? 20.303  18.822  121.714 1.00 64.20  ? 419  ILE A C     1 
ATOM   3040  O  O     . ILE A 1 420  ? 19.840  17.725  122.022 1.00 66.00  ? 419  ILE A O     1 
ATOM   3041  C  CB    . ILE A 1 420  ? 18.984  20.458  120.306 1.00 70.90  ? 419  ILE A CB    1 
ATOM   3042  C  CG1   . ILE A 1 420  ? 18.283  21.816  120.327 1.00 73.93  ? 419  ILE A CG1   1 
ATOM   3043  C  CG2   . ILE A 1 420  ? 18.072  19.397  119.741 1.00 73.24  ? 419  ILE A CG2   1 
ATOM   3044  C  CD1   . ILE A 1 420  ? 17.838  22.300  118.969 1.00 75.34  ? 419  ILE A CD1   1 
ATOM   3045  N  N     . PHE A 1 421  ? 21.572  18.972  121.346 1.00 58.43  ? 420  PHE A N     1 
ATOM   3046  C  CA    . PHE A 1 421  ? 22.485  17.840  121.351 1.00 56.90  ? 420  PHE A CA    1 
ATOM   3047  C  C     . PHE A 1 421  ? 23.047  17.536  122.734 1.00 55.21  ? 420  PHE A C     1 
ATOM   3048  O  O     . PHE A 1 421  ? 23.755  16.538  122.891 1.00 53.98  ? 420  PHE A O     1 
ATOM   3049  C  CB    . PHE A 1 421  ? 23.630  18.085  120.373 1.00 56.52  ? 420  PHE A CB    1 
ATOM   3050  C  CG    . PHE A 1 421  ? 23.193  18.188  118.953 1.00 58.11  ? 420  PHE A CG    1 
ATOM   3051  C  CD1   . PHE A 1 421  ? 22.723  17.075  118.278 1.00 58.67  ? 420  PHE A CD1   1 
ATOM   3052  C  CD2   . PHE A 1 421  ? 23.255  19.395  118.281 1.00 59.15  ? 420  PHE A CD2   1 
ATOM   3053  C  CE1   . PHE A 1 421  ? 22.319  17.166  116.955 1.00 60.21  ? 420  PHE A CE1   1 
ATOM   3054  C  CE2   . PHE A 1 421  ? 22.850  19.489  116.955 1.00 60.71  ? 420  PHE A CE2   1 
ATOM   3055  C  CZ    . PHE A 1 421  ? 22.388  18.373  116.298 1.00 61.21  ? 420  PHE A CZ    1 
ATOM   3056  N  N     . GLY A 1 422  ? 22.758  18.363  123.729 1.00 55.21  ? 421  GLY A N     1 
ATOM   3057  C  CA    . GLY A 1 422  ? 23.048  18.026  125.102 1.00 53.88  ? 421  GLY A CA    1 
ATOM   3058  C  C     . GLY A 1 422  ? 21.942  17.290  125.821 1.00 54.36  ? 421  GLY A C     1 
ATOM   3059  O  O     . GLY A 1 422  ? 22.044  17.071  127.029 1.00 53.46  ? 421  GLY A O     1 
ATOM   3060  N  N     . LYS A 1 423  ? 20.884  16.893  125.128 1.00 55.82  ? 422  LYS A N     1 
ATOM   3061  C  CA    . LYS A 1 423  ? 19.764  16.254  125.802 1.00 56.53  ? 422  LYS A CA    1 
ATOM   3062  C  C     . LYS A 1 423  ? 19.962  14.757  125.975 1.00 55.71  ? 422  LYS A C     1 
ATOM   3063  O  O     . LYS A 1 423  ? 19.132  14.110  126.616 1.00 56.20  ? 422  LYS A O     1 
ATOM   3064  C  CB    . LYS A 1 423  ? 18.456  16.536  125.044 1.00 58.69  ? 422  LYS A CB    1 
ATOM   3065  N  N     . GLY A 1 424  ? 21.021  14.191  125.417 1.00 54.64  ? 423  GLY A N     1 
ATOM   3066  C  CA    . GLY A 1 424  ? 21.370  12.827  125.746 1.00 53.76  ? 423  GLY A CA    1 
ATOM   3067  C  C     . GLY A 1 424  ? 20.939  11.771  124.754 1.00 54.69  ? 423  GLY A C     1 
ATOM   3068  O  O     . GLY A 1 424  ? 21.073  11.946  123.539 1.00 55.32  ? 423  GLY A O     1 
ATOM   3069  N  N     . TRP A 1 425  ? 20.418  10.660  125.269 1.00 54.88  ? 424  TRP A N     1 
ATOM   3070  C  CA    . TRP A 1 425  ? 20.239  9.453   124.484 1.00 55.52  ? 424  TRP A CA    1 
ATOM   3071  C  C     . TRP A 1 425  ? 18.890  8.823   124.797 1.00 56.95  ? 424  TRP A C     1 
ATOM   3072  O  O     . TRP A 1 425  ? 18.351  8.970   125.896 1.00 56.98  ? 424  TRP A O     1 
ATOM   3073  C  CB    . TRP A 1 425  ? 21.386  8.460   124.732 1.00 54.07  ? 424  TRP A CB    1 
ATOM   3074  C  CG    . TRP A 1 425  ? 22.722  9.107   124.503 1.00 52.73  ? 424  TRP A CG    1 
ATOM   3075  C  CD1   . TRP A 1 425  ? 23.422  9.851   125.408 1.00 51.44  ? 424  TRP A CD1   1 
ATOM   3076  C  CD2   . TRP A 1 425  ? 23.496  9.122   123.290 1.00 52.71  ? 424  TRP A CD2   1 
ATOM   3077  N  NE1   . TRP A 1 425  ? 24.585  10.311  124.847 1.00 50.62  ? 424  TRP A NE1   1 
ATOM   3078  C  CE2   . TRP A 1 425  ? 24.654  9.879   123.550 1.00 51.38  ? 424  TRP A CE2   1 
ATOM   3079  C  CE3   . TRP A 1 425  ? 23.333  8.554   122.024 1.00 53.76  ? 424  TRP A CE3   1 
ATOM   3080  C  CZ2   . TRP A 1 425  ? 25.635  10.086  122.593 1.00 51.10  ? 424  TRP A CZ2   1 
ATOM   3081  C  CZ3   . TRP A 1 425  ? 24.303  8.767   121.076 1.00 53.46  ? 424  TRP A CZ3   1 
ATOM   3082  C  CH2   . TRP A 1 425  ? 25.438  9.527   121.360 1.00 52.16  ? 424  TRP A CH2   1 
ATOM   3083  N  N     . HIS A 1 426  ? 18.339  8.145   123.794 1.00 58.27  ? 425  HIS A N     1 
ATOM   3084  C  CA    . HIS A 1 426  ? 17.058  7.467   123.909 1.00 59.88  ? 425  HIS A CA    1 
ATOM   3085  C  C     . HIS A 1 426  ? 17.248  6.127   124.608 1.00 59.38  ? 425  HIS A C     1 
ATOM   3086  O  O     . HIS A 1 426  ? 18.301  5.502   124.511 1.00 58.21  ? 425  HIS A O     1 
ATOM   3087  C  CB    . HIS A 1 426  ? 16.445  7.263   122.517 1.00 61.58  ? 425  HIS A CB    1 
ATOM   3088  C  CG    . HIS A 1 426  ? 14.960  7.081   122.524 1.00 63.60  ? 425  HIS A CG    1 
ATOM   3089  N  ND1   . HIS A 1 426  ? 14.356  5.890   122.863 1.00 64.38  ? 425  HIS A ND1   1 
ATOM   3090  C  CD2   . HIS A 1 426  ? 13.956  7.942   122.232 1.00 65.13  ? 425  HIS A CD2   1 
ATOM   3091  C  CE1   . HIS A 1 426  ? 13.044  6.028   122.790 1.00 66.29  ? 425  HIS A CE1   1 
ATOM   3092  N  NE2   . HIS A 1 426  ? 12.775  7.261   122.404 1.00 66.78  ? 425  HIS A NE2   1 
ATOM   3093  N  N     . ASN A 1 427  ? 16.214  5.676   125.306 1.00 60.41  ? 426  ASN A N     1 
ATOM   3094  C  CA    . ASN A 1 427  ? 16.364  4.418   126.019 1.00 60.07  ? 426  ASN A CA    1 
ATOM   3095  C  C     . ASN A 1 427  ? 16.435  3.212   125.097 1.00 60.82  ? 426  ASN A C     1 
ATOM   3096  O  O     . ASN A 1 427  ? 16.801  2.127   125.563 1.00 63.56  ? 426  ASN A O     1 
ATOM   3097  C  CB    . ASN A 1 427  ? 15.221  4.235   127.013 1.00 61.15  ? 426  ASN A CB    1 
ATOM   3098  C  CG    . ASN A 1 427  ? 15.612  4.626   128.416 1.00 59.78  ? 426  ASN A CG    1 
ATOM   3099  O  OD1   . ASN A 1 427  ? 16.529  5.419   128.618 1.00 61.03  ? 426  ASN A OD1   1 
ATOM   3100  N  ND2   . ASN A 1 427  ? 14.905  4.087   129.395 1.00 59.32  ? 426  ASN A ND2   1 
ATOM   3101  N  N     . PHE A 1 428  ? 16.098  3.371   123.819 1.00 61.98  ? 427  PHE A N     1 
ATOM   3102  C  CA    . PHE A 1 428  ? 16.085  2.281   122.858 1.00 62.95  ? 427  PHE A CA    1 
ATOM   3103  C  C     . PHE A 1 428  ? 17.241  2.411   121.879 1.00 62.04  ? 427  PHE A C     1 
ATOM   3104  O  O     . PHE A 1 428  ? 17.716  3.512   121.596 1.00 61.28  ? 427  PHE A O     1 
ATOM   3105  C  CB    . PHE A 1 428  ? 14.771  2.263   122.077 1.00 65.23  ? 427  PHE A CB    1 
ATOM   3106  C  CG    . PHE A 1 428  ? 13.656  1.551   122.776 1.00 66.60  ? 427  PHE A CG    1 
ATOM   3107  C  CD1   . PHE A 1 428  ? 13.925  0.611   123.756 1.00 66.00  ? 427  PHE A CD1   1 
ATOM   3108  C  CD2   . PHE A 1 428  ? 12.337  1.817   122.450 1.00 68.63  ? 427  PHE A CD2   1 
ATOM   3109  C  CE1   . PHE A 1 428  ? 12.898  -0.051  124.401 1.00 67.40  ? 427  PHE A CE1   1 
ATOM   3110  C  CE2   . PHE A 1 428  ? 11.308  1.159   123.088 1.00 70.04  ? 427  PHE A CE2   1 
ATOM   3111  C  CZ    . PHE A 1 428  ? 11.590  0.219   124.064 1.00 69.43  ? 427  PHE A CZ    1 
ATOM   3112  N  N     . SER A 1 429  ? 17.686  1.272   121.357 1.00 62.26  ? 428  SER A N     1 
ATOM   3113  C  CA    . SER A 1 429  ? 18.536  1.283   120.179 1.00 62.04  ? 428  SER A CA    1 
ATOM   3114  C  C     . SER A 1 429  ? 17.707  1.600   118.935 1.00 63.84  ? 428  SER A C     1 
ATOM   3115  O  O     . SER A 1 429  ? 16.476  1.652   118.972 1.00 65.34  ? 428  SER A O     1 
ATOM   3116  C  CB    . SER A 1 429  ? 19.241  -0.058  120.011 1.00 61.92  ? 428  SER A CB    1 
ATOM   3117  O  OG    . SER A 1 429  ? 18.304  -1.101  119.849 1.00 63.67  ? 428  SER A OG    1 
ATOM   3118  N  N     . VAL A 1 430  ? 18.398  1.822   117.816 1.00 63.78  ? 429  VAL A N     1 
ATOM   3119  C  CA    . VAL A 1 430  ? 17.699  2.037   116.552 1.00 65.56  ? 429  VAL A CA    1 
ATOM   3120  C  C     . VAL A 1 430  ? 17.172  0.717   116.009 1.00 67.18  ? 429  VAL A C     1 
ATOM   3121  O  O     . VAL A 1 430  ? 16.086  0.658   115.419 1.00 69.06  ? 429  VAL A O     1 
ATOM   3122  C  CB    . VAL A 1 430  ? 18.628  2.735   115.542 1.00 65.05  ? 429  VAL A CB    1 
ATOM   3123  C  CG1   . VAL A 1 430  ? 18.082  2.610   114.111 1.00 66.98  ? 429  VAL A CG1   1 
ATOM   3124  C  CG2   . VAL A 1 430  ? 18.807  4.189   115.910 1.00 64.10  ? 429  VAL A CG2   1 
ATOM   3125  N  N     . LYS A 1 431  ? 17.937  -0.360  116.197 1.00 66.59  ? 430  LYS A N     1 
ATOM   3126  C  CA    . LYS A 1 431  ? 17.514  -1.677  115.743 1.00 68.16  ? 430  LYS A CA    1 
ATOM   3127  C  C     . LYS A 1 431  ? 16.123  -2.013  116.254 1.00 69.65  ? 430  LYS A C     1 
ATOM   3128  O  O     . LYS A 1 431  ? 15.263  -2.485  115.503 1.00 72.21  ? 430  LYS A O     1 
ATOM   3129  C  CB    . LYS A 1 431  ? 18.515  -2.732  116.208 1.00 67.19  ? 430  LYS A CB    1 
ATOM   3130  C  CG    . LYS A 1 431  ? 18.056  -4.155  115.957 1.00 69.18  ? 430  LYS A CG    1 
ATOM   3131  C  CD    . LYS A 1 431  ? 18.606  -5.096  117.006 1.00 69.05  ? 430  LYS A CD    1 
ATOM   3132  C  CE    . LYS A 1 431  ? 18.404  -6.537  116.597 1.00 69.93  ? 430  LYS A CE    1 
ATOM   3133  N  NZ    . LYS A 1 431  ? 19.127  -6.839  115.331 1.00 70.16  ? 430  LYS A NZ    1 
ATOM   3134  N  N     . LEU A 1 432  ? 15.884  -1.763  117.534 1.00 70.62  ? 431  LEU A N     1 
ATOM   3135  C  CA    . LEU A 1 432  ? 14.590  -2.094  118.110 1.00 73.28  ? 431  LEU A CA    1 
ATOM   3136  C  C     . LEU A 1 432  ? 13.493  -1.202  117.551 1.00 72.62  ? 431  LEU A C     1 
ATOM   3137  O  O     . LEU A 1 432  ? 12.386  -1.671  117.276 1.00 73.84  ? 431  LEU A O     1 
ATOM   3138  C  CB    . LEU A 1 432  ? 14.658  -1.979  119.627 1.00 73.63  ? 431  LEU A CB    1 
ATOM   3139  C  CG    . LEU A 1 432  ? 13.387  -2.377  120.365 1.00 75.91  ? 431  LEU A CG    1 
ATOM   3140  C  CD1   . LEU A 1 432  ? 13.765  -3.123  121.607 1.00 75.75  ? 431  LEU A CD1   1 
ATOM   3141  C  CD2   . LEU A 1 432  ? 12.589  -1.154  120.733 1.00 76.28  ? 431  LEU A CD2   1 
ATOM   3142  N  N     . MET A 1 433  ? 13.776  0.089   117.386 1.00 75.95  ? 432  MET A N     1 
ATOM   3143  C  CA    . MET A 1 433  ? 12.760  1.002   116.877 1.00 78.72  ? 432  MET A CA    1 
ATOM   3144  C  C     . MET A 1 433  ? 12.335  0.626   115.461 1.00 80.50  ? 432  MET A C     1 
ATOM   3145  O  O     . MET A 1 433  ? 11.157  0.752   115.103 1.00 80.55  ? 432  MET A O     1 
ATOM   3146  C  CB    . MET A 1 433  ? 13.289  2.429   116.927 1.00 80.67  ? 432  MET A CB    1 
ATOM   3147  C  CG    . MET A 1 433  ? 13.402  2.975   118.321 1.00 79.36  ? 432  MET A CG    1 
ATOM   3148  S  SD    . MET A 1 433  ? 14.422  4.447   118.340 1.00 78.54  ? 432  MET A SD    1 
ATOM   3149  C  CE    . MET A 1 433  ? 13.791  5.251   119.777 1.00 80.21  ? 432  MET A CE    1 
ATOM   3150  N  N     . MET A 1 434  ? 13.278  0.150   114.644 1.00 80.66  ? 433  MET A N     1 
ATOM   3151  C  CA    . MET A 1 434  ? 12.934  -0.270  113.291 1.00 82.42  ? 433  MET A CA    1 
ATOM   3152  C  C     . MET A 1 434  ? 12.124  -1.557  113.265 1.00 82.12  ? 433  MET A C     1 
ATOM   3153  O  O     . MET A 1 434  ? 11.438  -1.818  112.276 1.00 85.70  ? 433  MET A O     1 
ATOM   3154  C  CB    . MET A 1 434  ? 14.200  -0.418  112.446 1.00 81.02  ? 433  MET A CB    1 
ATOM   3155  C  CG    . MET A 1 434  ? 15.033  0.827   112.445 1.00 81.04  ? 433  MET A CG    1 
ATOM   3156  S  SD    . MET A 1 434  ? 13.893  2.201   112.481 1.00 82.39  ? 433  MET A SD    1 
ATOM   3157  C  CE    . MET A 1 434  ? 13.936  2.665   110.776 1.00 85.76  ? 433  MET A CE    1 
ATOM   3158  N  N     . GLU A 1 435  ? 12.196  -2.369  114.310 1.00 78.99  ? 434  GLU A N     1 
ATOM   3159  C  CA    . GLU A 1 435  ? 11.256  -3.460  114.489 1.00 81.04  ? 434  GLU A CA    1 
ATOM   3160  C  C     . GLU A 1 435  ? 9.973   -2.998  115.154 1.00 81.90  ? 434  GLU A C     1 
ATOM   3161  O  O     . GLU A 1 435  ? 9.114   -3.830  115.461 1.00 82.14  ? 434  GLU A O     1 
ATOM   3162  C  CB    . GLU A 1 435  ? 11.894  -4.569  115.319 1.00 83.66  ? 434  GLU A CB    1 
ATOM   3163  C  CG    . GLU A 1 435  ? 13.198  -5.078  114.750 1.00 85.71  ? 434  GLU A CG    1 
ATOM   3164  C  CD    . GLU A 1 435  ? 13.615  -6.391  115.363 1.00 88.97  ? 434  GLU A CD    1 
ATOM   3165  O  OE1   . GLU A 1 435  ? 12.995  -6.793  116.369 1.00 92.82  ? 434  GLU A OE1   1 
ATOM   3166  O  OE2   . GLU A 1 435  ? 14.555  -7.024  114.840 1.00 89.09  ? 434  GLU A OE2   1 
ATOM   3167  N  N     . LEU A 1 436  ? 9.828   -1.710  115.383 1.00 79.06  ? 435  LEU A N     1 
ATOM   3168  C  CA    . LEU A 1 436  ? 8.655   -1.169  116.056 1.00 80.08  ? 435  LEU A CA    1 
ATOM   3169  C  C     . LEU A 1 436  ? 7.988   -0.043  115.283 1.00 81.23  ? 435  LEU A C     1 
ATOM   3170  O  O     . LEU A 1 436  ? 6.760   0.040   115.283 1.00 83.22  ? 435  LEU A O     1 
ATOM   3171  C  CB    . LEU A 1 436  ? 9.035   -0.680  117.471 1.00 78.16  ? 435  LEU A CB    1 
ATOM   3172  C  CG    . LEU A 1 436  ? 8.727   -1.616  118.648 1.00 78.27  ? 435  LEU A CG    1 
ATOM   3173  C  CD1   . LEU A 1 436  ? 9.498   -2.929  118.571 1.00 77.84  ? 435  LEU A CD1   1 
ATOM   3174  C  CD2   . LEU A 1 436  ? 8.998   -0.918  119.957 1.00 76.58  ? 435  LEU A CD2   1 
ATOM   3175  N  N     . ILE A 1 437  ? 8.762   0.830   114.632 1.00 80.14  ? 436  ILE A N     1 
ATOM   3176  C  CA    . ILE A 1 437  ? 8.163   1.950   113.902 1.00 82.71  ? 436  ILE A CA    1 
ATOM   3177  C  C     . ILE A 1 437  ? 7.187   1.476   112.832 1.00 85.23  ? 436  ILE A C     1 
ATOM   3178  O  O     . ILE A 1 437  ? 6.091   2.048   112.735 1.00 86.04  ? 436  ILE A O     1 
ATOM   3179  C  CB    . ILE A 1 437  ? 9.254   2.875   113.354 1.00 82.12  ? 436  ILE A CB    1 
ATOM   3180  C  CG1   . ILE A 1 437  ? 9.942   3.632   114.493 1.00 77.47  ? 436  ILE A CG1   1 
ATOM   3181  C  CG2   . ILE A 1 437  ? 8.675   3.830   112.301 1.00 81.28  ? 436  ILE A CG2   1 
ATOM   3182  C  CD1   . ILE A 1 437  ? 11.082  4.504   114.036 1.00 75.91  ? 436  ILE A CD1   1 
ATOM   3183  N  N     . PRO A 1 438  ? 7.505   0.469   111.984 1.00 84.57  ? 437  PRO A N     1 
ATOM   3184  C  CA    . PRO A 1 438  ? 6.486   -0.072  111.072 1.00 87.30  ? 437  PRO A CA    1 
ATOM   3185  C  C     . PRO A 1 438  ? 5.178   -0.377  111.780 1.00 89.02  ? 437  PRO A C     1 
ATOM   3186  O  O     . PRO A 1 438  ? 4.139   0.184   111.420 1.00 90.90  ? 437  PRO A O     1 
ATOM   3187  C  CB    . PRO A 1 438  ? 7.129   -1.357  110.532 1.00 87.34  ? 437  PRO A CB    1 
ATOM   3188  C  CG    . PRO A 1 438  ? 8.517   -1.418  111.128 1.00 84.60  ? 437  PRO A CG    1 
ATOM   3189  C  CD    . PRO A 1 438  ? 8.834   -0.076  111.675 1.00 82.96  ? 437  PRO A CD    1 
ATOM   3190  N  N     . GLU A 1 439  ? 5.218   -1.234  112.808 1.00 92.57  ? 438  GLU A N     1 
ATOM   3191  C  CA    . GLU A 1 439  ? 3.983   -1.679  113.447 1.00 94.20  ? 438  GLU A CA    1 
ATOM   3192  C  C     . GLU A 1 439  ? 3.287   -0.568  114.226 1.00 95.57  ? 438  GLU A C     1 
ATOM   3193  O  O     . GLU A 1 439  ? 2.099   -0.708  114.537 1.00 98.34  ? 438  GLU A O     1 
ATOM   3194  C  CB    . GLU A 1 439  ? 4.250   -2.900  114.336 1.00 94.17  ? 438  GLU A CB    1 
ATOM   3195  C  CG    . GLU A 1 439  ? 5.006   -3.991  113.587 1.00 94.05  ? 438  GLU A CG    1 
ATOM   3196  C  CD    . GLU A 1 439  ? 4.384   -5.388  113.752 1.00 95.52  ? 438  GLU A CD    1 
ATOM   3197  O  OE1   . GLU A 1 439  ? 3.215   -5.502  114.160 1.00 95.30  ? 438  GLU A OE1   1 
ATOM   3198  O  OE2   . GLU A 1 439  ? 5.056   -6.382  113.435 1.00 96.61  ? 438  GLU A OE2   1 
ATOM   3199  N  N     . LEU A 1 440  ? 3.977   0.542   114.512 1.00 88.46  ? 439  LEU A N     1 
ATOM   3200  C  CA    . LEU A 1 440  ? 3.298   1.722   115.043 1.00 88.82  ? 439  LEU A CA    1 
ATOM   3201  C  C     . LEU A 1 440  ? 2.595   2.510   113.942 1.00 90.73  ? 439  LEU A C     1 
ATOM   3202  O  O     . LEU A 1 440  ? 1.561   3.140   114.194 1.00 92.29  ? 439  LEU A O     1 
ATOM   3203  C  CB    . LEU A 1 440  ? 4.287   2.616   115.796 1.00 86.16  ? 439  LEU A CB    1 
ATOM   3204  C  CG    . LEU A 1 440  ? 4.771   2.044   117.132 1.00 84.49  ? 439  LEU A CG    1 
ATOM   3205  C  CD1   . LEU A 1 440  ? 6.247   2.336   117.370 1.00 81.63  ? 439  LEU A CD1   1 
ATOM   3206  C  CD2   . LEU A 1 440  ? 3.918   2.572   118.284 1.00 85.04  ? 439  LEU A CD2   1 
ATOM   3207  N  N     . TYR A 1 441  ? 3.154   2.509   112.731 1.00 90.70  ? 440  TYR A N     1 
ATOM   3208  C  CA    . TYR A 1 441  ? 2.412   2.989   111.570 1.00 92.91  ? 440  TYR A CA    1 
ATOM   3209  C  C     . TYR A 1 441  ? 1.238   2.068   111.260 1.00 95.66  ? 440  TYR A C     1 
ATOM   3210  O  O     . TYR A 1 441  ? 0.090   2.514   111.172 1.00 97.81  ? 440  TYR A O     1 
ATOM   3211  C  CB    . TYR A 1 441  ? 3.338   3.077   110.358 1.00 92.27  ? 440  TYR A CB    1 
ATOM   3212  C  CG    . TYR A 1 441  ? 4.095   4.371   110.185 1.00 90.75  ? 440  TYR A CG    1 
ATOM   3213  C  CD1   . TYR A 1 441  ? 3.476   5.601   110.357 1.00 91.48  ? 440  TYR A CD1   1 
ATOM   3214  C  CD2   . TYR A 1 441  ? 5.428   4.356   109.813 1.00 88.78  ? 440  TYR A CD2   1 
ATOM   3215  C  CE1   . TYR A 1 441  ? 4.178   6.779   110.176 1.00 90.25  ? 440  TYR A CE1   1 
ATOM   3216  C  CE2   . TYR A 1 441  ? 6.131   5.519   109.634 1.00 87.53  ? 440  TYR A CE2   1 
ATOM   3217  C  CZ    . TYR A 1 441  ? 5.508   6.726   109.816 1.00 88.27  ? 440  TYR A CZ    1 
ATOM   3218  O  OH    . TYR A 1 441  ? 6.242   7.870   109.628 1.00 87.11  ? 440  TYR A OH    1 
ATOM   3219  N  N     . GLU A 1 442  ? 1.517   0.770   111.105 1.00 95.73  ? 441  GLU A N     1 
ATOM   3220  C  CA    . GLU A 1 442  ? 0.517   -0.174  110.616 1.00 103.85 ? 441  GLU A CA    1 
ATOM   3221  C  C     . GLU A 1 442  ? -0.643  -0.325  111.590 1.00 99.93  ? 441  GLU A C     1 
ATOM   3222  O  O     . GLU A 1 442  ? -1.806  -0.329  111.175 1.00 104.38 ? 441  GLU A O     1 
ATOM   3223  C  CB    . GLU A 1 442  ? 1.169   -1.531  110.352 1.00 101.94 ? 441  GLU A CB    1 
ATOM   3224  C  CG    . GLU A 1 442  ? 2.411   -1.465  109.466 1.00 99.95  ? 441  GLU A CG    1 
ATOM   3225  C  CD    . GLU A 1 442  ? 3.252   -2.730  109.530 1.00 101.15 ? 441  GLU A CD    1 
ATOM   3226  O  OE1   . GLU A 1 442  ? 2.972   -3.676  108.765 1.00 103.13 ? 441  GLU A OE1   1 
ATOM   3227  O  OE2   . GLU A 1 442  ? 4.187   -2.784  110.359 1.00 100.51 ? 441  GLU A OE2   1 
ATOM   3228  N  N     . THR A 1 443  ? -0.354  -0.471  112.876 1.00 98.36  ? 442  THR A N     1 
ATOM   3229  C  CA    . THR A 1 443  ? -1.380  -0.618  113.894 1.00 99.66  ? 442  THR A CA    1 
ATOM   3230  C  C     . THR A 1 443  ? -1.351  0.586   114.823 1.00 98.38  ? 442  THR A C     1 
ATOM   3231  O  O     . THR A 1 443  ? -0.392  1.359   114.841 1.00 96.15  ? 442  THR A O     1 
ATOM   3232  C  CB    . THR A 1 443  ? -1.192  -1.910  114.697 1.00 99.29  ? 442  THR A CB    1 
ATOM   3233  O  OG1   . THR A 1 443  ? -0.108  -1.751  115.622 1.00 96.36  ? 442  THR A OG1   1 
ATOM   3234  C  CG2   . THR A 1 443  ? -0.884  -3.069  113.759 1.00 100.04 ? 442  THR A CG2   1 
ATOM   3235  N  N     . SER A 1 444  ? -2.415  0.738   115.602 1.00 99.93  ? 443  SER A N     1 
ATOM   3236  C  CA    . SER A 1 444  ? -2.574  1.886   116.481 1.00 99.22  ? 443  SER A CA    1 
ATOM   3237  C  C     . SER A 1 444  ? -2.069  1.635   117.898 1.00 97.28  ? 443  SER A C     1 
ATOM   3238  O  O     . SER A 1 444  ? -2.334  2.450   118.786 1.00 97.00  ? 443  SER A O     1 
ATOM   3239  C  CB    . SER A 1 444  ? -4.045  2.306   116.525 1.00 102.19 ? 443  SER A CB    1 
ATOM   3240  O  OG    . SER A 1 444  ? -4.876  1.206   116.854 1.00 104.13 ? 443  SER A OG    1 
ATOM   3241  N  N     . GLU A 1 445  ? -1.352  0.540   118.132 1.00 96.05  ? 444  GLU A N     1 
ATOM   3242  C  CA    . GLU A 1 445  ? -0.890  0.212   119.472 1.00 94.38  ? 444  GLU A CA    1 
ATOM   3243  C  C     . GLU A 1 445  ? 0.399   0.949   119.811 1.00 92.27  ? 444  GLU A C     1 
ATOM   3244  O  O     . GLU A 1 445  ? 1.230   1.229   118.943 1.00 90.11  ? 444  GLU A O     1 
ATOM   3245  C  CB    . GLU A 1 445  ? -0.649  -1.285  119.605 1.00 94.48  ? 444  GLU A CB    1 
ATOM   3246  C  CG    . GLU A 1 445  ? -1.884  -2.124  119.589 1.00 97.47  ? 444  GLU A CG    1 
ATOM   3247  C  CD    . GLU A 1 445  ? -1.571  -3.490  119.064 1.00 97.32  ? 444  GLU A CD    1 
ATOM   3248  O  OE1   . GLU A 1 445  ? -2.408  -4.407  119.189 1.00 98.76  ? 444  GLU A OE1   1 
ATOM   3249  O  OE2   . GLU A 1 445  ? -0.443  -3.654  118.552 1.00 95.75  ? 444  GLU A OE2   1 
ATOM   3250  N  N     . GLU A 1 446  ? 0.570   1.243   121.096 1.00 94.01  ? 445  GLU A N     1 
ATOM   3251  C  CA    . GLU A 1 446  ? 1.782   1.883   121.577 1.00 90.03  ? 445  GLU A CA    1 
ATOM   3252  C  C     . GLU A 1 446  ? 2.852   0.828   121.861 1.00 88.21  ? 445  GLU A C     1 
ATOM   3253  O  O     . GLU A 1 446  ? 2.605   -0.377  121.789 1.00 88.60  ? 445  GLU A O     1 
ATOM   3254  C  CB    . GLU A 1 446  ? 1.472   2.738   122.803 1.00 91.69  ? 445  GLU A CB    1 
ATOM   3255  C  CG    . GLU A 1 446  ? 0.531   2.093   123.801 1.00 95.59  ? 445  GLU A CG    1 
ATOM   3256  C  CD    . GLU A 1 446  ? 1.267   1.249   124.807 1.00 96.46  ? 445  GLU A CD    1 
ATOM   3257  O  OE1   . GLU A 1 446  ? 2.222   1.770   125.415 1.00 95.19  ? 445  GLU A OE1   1 
ATOM   3258  O  OE2   . GLU A 1 446  ? 0.905   0.069   124.975 1.00 98.59  ? 445  GLU A OE2   1 
ATOM   3259  N  N     . GLN A 1 447  ? 4.057   1.298   122.198 1.00 82.72  ? 446  GLN A N     1 
ATOM   3260  C  CA    . GLN A 1 447  ? 5.219   0.416   122.284 1.00 80.91  ? 446  GLN A CA    1 
ATOM   3261  C  C     . GLN A 1 447  ? 4.991   -0.739  123.249 1.00 81.29  ? 446  GLN A C     1 
ATOM   3262  O  O     . GLN A 1 447  ? 5.401   -1.872  122.974 1.00 81.28  ? 446  GLN A O     1 
ATOM   3263  C  CB    . GLN A 1 447  ? 6.457   1.217   122.694 1.00 78.17  ? 446  GLN A CB    1 
ATOM   3264  C  CG    . GLN A 1 447  ? 6.252   2.161   123.872 1.00 77.53  ? 446  GLN A CG    1 
ATOM   3265  C  CD    . GLN A 1 447  ? 6.580   1.536   125.216 1.00 76.46  ? 446  GLN A CD    1 
ATOM   3266  O  OE1   . GLN A 1 447  ? 7.304   0.545   125.303 1.00 75.69  ? 446  GLN A OE1   1 
ATOM   3267  N  NE2   . GLN A 1 447  ? 6.048   2.123   126.273 1.00 76.80  ? 446  GLN A NE2   1 
ATOM   3268  N  N     . MET A 1 448  ? 4.346   -0.476  124.385 1.00 85.66  ? 447  MET A N     1 
ATOM   3269  C  CA    . MET A 1 448  ? 4.132   -1.537  125.364 1.00 89.93  ? 447  MET A CA    1 
ATOM   3270  C  C     . MET A 1 448  ? 3.308   -2.662  124.762 1.00 86.28  ? 447  MET A C     1 
ATOM   3271  O  O     . MET A 1 448  ? 3.681   -3.838  124.835 1.00 86.26  ? 447  MET A O     1 
ATOM   3272  C  CB    . MET A 1 448  ? 3.443   -0.975  126.607 1.00 92.71  ? 447  MET A CB    1 
ATOM   3273  C  CG    . MET A 1 448  ? 3.492   -1.891  127.811 1.00 93.48  ? 447  MET A CG    1 
ATOM   3274  S  SD    . MET A 1 448  ? 5.191   -2.413  128.083 1.00 91.21  ? 447  MET A SD    1 
ATOM   3275  C  CE    . MET A 1 448  ? 4.998   -4.055  128.807 1.00 95.80  ? 447  MET A CE    1 
ATOM   3276  N  N     . THR A 1 449  ? 2.197   -2.303  124.130 1.00 86.81  ? 448  THR A N     1 
ATOM   3277  C  CA    . THR A 1 449  ? 1.314   -3.278  123.507 1.00 89.41  ? 448  THR A CA    1 
ATOM   3278  C  C     . THR A 1 449  ? 2.035   -4.108  122.452 1.00 89.11  ? 448  THR A C     1 
ATOM   3279  O  O     . THR A 1 449  ? 1.844   -5.326  122.374 1.00 90.33  ? 448  THR A O     1 
ATOM   3280  C  CB    . THR A 1 449  ? 0.147   -2.525  122.902 1.00 91.61  ? 448  THR A CB    1 
ATOM   3281  O  OG1   . THR A 1 449  ? -0.489  -1.793  123.954 1.00 90.29  ? 448  THR A OG1   1 
ATOM   3282  C  CG2   . THR A 1 449  ? -0.851  -3.496  122.310 1.00 92.81  ? 448  THR A CG2   1 
ATOM   3283  N  N     . ILE A 1 450  ? 2.871   -3.472  121.635 1.00 87.60  ? 449  ILE A N     1 
ATOM   3284  C  CA    . ILE A 1 450  ? 3.510   -4.188  120.536 1.00 87.53  ? 449  ILE A CA    1 
ATOM   3285  C  C     . ILE A 1 450  ? 4.515   -5.201  121.066 1.00 86.05  ? 449  ILE A C     1 
ATOM   3286  O  O     . ILE A 1 450  ? 4.491   -6.377  120.685 1.00 87.20  ? 449  ILE A O     1 
ATOM   3287  C  CB    . ILE A 1 450  ? 4.158   -3.190  119.564 1.00 86.34  ? 449  ILE A CB    1 
ATOM   3288  C  CG1   . ILE A 1 450  ? 3.174   -2.060  119.287 1.00 87.68  ? 449  ILE A CG1   1 
ATOM   3289  C  CG2   . ILE A 1 450  ? 4.548   -3.875  118.273 1.00 86.94  ? 449  ILE A CG2   1 
ATOM   3290  C  CD1   . ILE A 1 450  ? 3.607   -1.123  118.222 1.00 87.12  ? 449  ILE A CD1   1 
ATOM   3291  N  N     . LEU A 1 451  ? 5.396   -4.766  121.973 1.00 83.63  ? 450  LEU A N     1 
ATOM   3292  C  CA    . LEU A 1 451  ? 6.450   -5.643  122.478 1.00 82.12  ? 450  LEU A CA    1 
ATOM   3293  C  C     . LEU A 1 451  ? 5.885   -6.901  123.117 1.00 83.69  ? 450  LEU A C     1 
ATOM   3294  O  O     . LEU A 1 451  ? 6.499   -7.970  123.028 1.00 83.55  ? 450  LEU A O     1 
ATOM   3295  C  CB    . LEU A 1 451  ? 7.322   -4.885  123.473 1.00 79.52  ? 450  LEU A CB    1 
ATOM   3296  C  CG    . LEU A 1 451  ? 8.295   -3.885  122.853 1.00 77.58  ? 450  LEU A CG    1 
ATOM   3297  C  CD1   . LEU A 1 451  ? 8.645   -2.813  123.860 1.00 75.77  ? 450  LEU A CD1   1 
ATOM   3298  C  CD2   . LEU A 1 451  ? 9.550   -4.594  122.360 1.00 76.32  ? 450  LEU A CD2   1 
ATOM   3299  N  N     . THR A 1 452  ? 4.726   -6.795  123.766 1.00 85.30  ? 451  THR A N     1 
ATOM   3300  C  CA    . THR A 1 452  ? 4.020   -7.986  124.219 1.00 87.31  ? 451  THR A CA    1 
ATOM   3301  C  C     . THR A 1 452  ? 3.851   -8.987  123.084 1.00 89.10  ? 451  THR A C     1 
ATOM   3302  O  O     . THR A 1 452  ? 4.190   -10.166 123.224 1.00 89.49  ? 451  THR A O     1 
ATOM   3303  C  CB    . THR A 1 452  ? 2.654   -7.602  124.781 1.00 89.24  ? 451  THR A CB    1 
ATOM   3304  O  OG1   . THR A 1 452  ? 2.830   -6.979  126.060 1.00 90.86  ? 451  THR A OG1   1 
ATOM   3305  C  CG2   . THR A 1 452  ? 1.792   -8.824  124.953 1.00 87.61  ? 451  THR A CG2   1 
ATOM   3306  N  N     . ARG A 1 453  ? 3.241   -8.525  121.998 1.00 90.27  ? 452  ARG A N     1 
ATOM   3307  C  CA    . ARG A 1 453  ? 2.933   -9.363  120.841 1.00 92.48  ? 452  ARG A CA    1 
ATOM   3308  C  C     . ARG A 1 453  ? 4.084   -10.196 120.285 1.00 91.41  ? 452  ARG A C     1 
ATOM   3309  O  O     . ARG A 1 453  ? 3.937   -11.397 120.062 1.00 92.91  ? 452  ARG A O     1 
ATOM   3310  C  CB    . ARG A 1 453  ? 2.330   -8.509  119.720 1.00 93.71  ? 452  ARG A CB    1 
ATOM   3311  C  CG    . ARG A 1 453  ? 2.237   -9.220  118.380 1.00 95.94  ? 452  ARG A CG    1 
ATOM   3312  C  CD    . ARG A 1 453  ? 1.022   -8.756  117.592 1.00 96.24  ? 452  ARG A CD    1 
ATOM   3313  N  NE    . ARG A 1 453  ? 1.320   -7.593  116.762 1.00 95.95  ? 452  ARG A NE    1 
ATOM   3314  C  CZ    . ARG A 1 453  ? 0.934   -6.354  117.046 1.00 95.38  ? 452  ARG A CZ    1 
ATOM   3315  N  NH1   . ARG A 1 453  ? 1.251   -5.356  116.232 1.00 94.99  ? 452  ARG A NH1   1 
ATOM   3316  N  NH2   . ARG A 1 453  ? 0.231   -6.111  118.144 1.00 95.27  ? 452  ARG A NH2   1 
ATOM   3317  N  N     . LEU A 1 454  ? 5.225   -9.557  120.064 1.00 90.97  ? 453  LEU A N     1 
ATOM   3318  C  CA    . LEU A 1 454  ? 6.371   -10.240 119.488 1.00 91.53  ? 453  LEU A CA    1 
ATOM   3319  C  C     . LEU A 1 454  ? 7.060   -11.141 120.501 1.00 91.89  ? 453  LEU A C     1 
ATOM   3320  O  O     . LEU A 1 454  ? 7.858   -11.997 120.108 1.00 92.20  ? 453  LEU A O     1 
ATOM   3321  C  CB    . LEU A 1 454  ? 7.360   -9.226  118.902 1.00 90.31  ? 453  LEU A CB    1 
ATOM   3322  C  CG    . LEU A 1 454  ? 6.892   -8.342  117.730 1.00 92.03  ? 453  LEU A CG    1 
ATOM   3323  C  CD1   . LEU A 1 454  ? 5.897   -7.255  118.137 1.00 92.60  ? 453  LEU A CD1   1 
ATOM   3324  C  CD2   . LEU A 1 454  ? 8.083   -7.715  117.008 1.00 89.47  ? 453  LEU A CD2   1 
ATOM   3325  N  N     . GLY A 1 455  ? 6.760   -10.973 121.786 1.00 98.86  ? 454  GLY A N     1 
ATOM   3326  C  CA    . GLY A 1 455  ? 7.293   -11.836 122.821 1.00 99.20  ? 454  GLY A CA    1 
ATOM   3327  C  C     . GLY A 1 455  ? 8.772   -11.649 123.072 1.00 96.66  ? 454  GLY A C     1 
ATOM   3328  O  O     . GLY A 1 455  ? 9.426   -12.539 123.614 1.00 95.75  ? 454  GLY A O     1 
ATOM   3329  N  N     . TYR A 1 468  ? 22.098  -20.572 138.128 1.00 103.23 ? 467  TYR A N     1 
ATOM   3330  C  CA    . TYR A 1 468  ? 21.635  -19.513 139.023 1.00 102.26 ? 467  TYR A CA    1 
ATOM   3331  C  C     . TYR A 1 468  ? 22.212  -18.187 138.622 1.00 93.11  ? 467  TYR A C     1 
ATOM   3332  O  O     . TYR A 1 468  ? 23.117  -18.134 137.797 1.00 94.21  ? 467  TYR A O     1 
ATOM   3333  C  CB    . TYR A 1 468  ? 22.014  -19.842 140.449 1.00 109.11 ? 467  TYR A CB    1 
ATOM   3334  C  CG    . TYR A 1 468  ? 21.550  -21.228 140.745 1.00 117.06 ? 467  TYR A CG    1 
ATOM   3335  C  CD1   . TYR A 1 468  ? 20.258  -21.611 140.425 1.00 122.37 ? 467  TYR A CD1   1 
ATOM   3336  C  CD2   . TYR A 1 468  ? 22.424  -22.183 141.216 1.00 118.33 ? 467  TYR A CD2   1 
ATOM   3337  C  CE1   . TYR A 1 468  ? 19.820  -22.893 140.651 1.00 125.84 ? 467  TYR A CE1   1 
ATOM   3338  C  CE2   . TYR A 1 468  ? 22.000  -23.488 141.431 1.00 124.37 ? 467  TYR A CE2   1 
ATOM   3339  C  CZ    . TYR A 1 468  ? 20.690  -23.839 141.155 1.00 127.39 ? 467  TYR A CZ    1 
ATOM   3340  O  OH    . TYR A 1 468  ? 20.255  -25.135 141.387 1.00 131.46 ? 467  TYR A OH    1 
ATOM   3341  N  N     . ILE A 1 469  ? 21.688  -17.123 139.230 1.00 76.67  ? 468  ILE A N     1 
ATOM   3342  C  CA    . ILE A 1 469  ? 22.084  -15.781 138.846 1.00 72.48  ? 468  ILE A CA    1 
ATOM   3343  C  C     . ILE A 1 469  ? 23.592  -15.660 138.948 1.00 61.68  ? 468  ILE A C     1 
ATOM   3344  O  O     . ILE A 1 469  ? 24.198  -16.036 139.958 1.00 61.31  ? 468  ILE A O     1 
ATOM   3345  C  CB    . ILE A 1 469  ? 21.375  -14.741 139.722 1.00 62.80  ? 468  ILE A CB    1 
ATOM   3346  C  CG1   . ILE A 1 469  ? 19.882  -15.066 139.846 1.00 64.95  ? 468  ILE A CG1   1 
ATOM   3347  C  CG2   . ILE A 1 469  ? 21.569  -13.374 139.117 1.00 61.07  ? 468  ILE A CG2   1 
ATOM   3348  C  CD1   . ILE A 1 469  ? 19.490  -15.774 141.153 1.00 66.10  ? 468  ILE A CD1   1 
ATOM   3349  N  N     . ASP A 1 470  ? 24.210  -15.173 137.881 1.00 67.84  ? 469  ASP A N     1 
ATOM   3350  C  CA    . ASP A 1 470  ? 25.629  -14.837 137.897 1.00 66.78  ? 469  ASP A CA    1 
ATOM   3351  C  C     . ASP A 1 470  ? 25.729  -13.420 138.434 1.00 63.86  ? 469  ASP A C     1 
ATOM   3352  O  O     . ASP A 1 470  ? 25.481  -12.452 137.711 1.00 62.81  ? 469  ASP A O     1 
ATOM   3353  C  CB    . ASP A 1 470  ? 26.231  -14.955 136.504 1.00 70.60  ? 469  ASP A CB    1 
ATOM   3354  C  CG    . ASP A 1 470  ? 27.738  -14.868 136.516 1.00 72.59  ? 469  ASP A CG    1 
ATOM   3355  O  OD1   . ASP A 1 470  ? 28.309  -14.478 137.554 1.00 73.19  ? 469  ASP A OD1   1 
ATOM   3356  O  OD2   . ASP A 1 470  ? 28.356  -15.184 135.485 1.00 74.73  ? 469  ASP A OD2   1 
ATOM   3357  N  N     . GLU A 1 471  ? 26.094  -13.298 139.713 1.00 58.69  ? 470  GLU A N     1 
ATOM   3358  C  CA    . GLU A 1 471  ? 26.123  -11.990 140.355 1.00 57.36  ? 470  GLU A CA    1 
ATOM   3359  C  C     . GLU A 1 471  ? 27.126  -11.061 139.685 1.00 52.65  ? 470  GLU A C     1 
ATOM   3360  O  O     . GLU A 1 471  ? 26.949  -9.838  139.705 1.00 51.56  ? 470  GLU A O     1 
ATOM   3361  C  CB    . GLU A 1 471  ? 26.437  -12.144 141.848 1.00 54.03  ? 470  GLU A CB    1 
ATOM   3362  C  CG    . GLU A 1 471  ? 27.847  -12.614 142.158 1.00 53.21  ? 470  GLU A CG    1 
ATOM   3363  C  CD    . GLU A 1 471  ? 27.983  -14.111 142.203 1.00 54.84  ? 470  GLU A CD    1 
ATOM   3364  O  OE1   . GLU A 1 471  ? 26.961  -14.814 142.044 1.00 56.65  ? 470  GLU A OE1   1 
ATOM   3365  O  OE2   . GLU A 1 471  ? 29.124  -14.581 142.394 1.00 54.40  ? 470  GLU A OE2   1 
ATOM   3366  N  N     . LYS A 1 472  ? 28.154  -11.618 139.051 1.00 52.49  ? 471  LYS A N     1 
ATOM   3367  C  CA    . LYS A 1 472  ? 29.194  -10.795 138.446 1.00 53.99  ? 471  LYS A CA    1 
ATOM   3368  C  C     . LYS A 1 472  ? 28.759  -10.250 137.091 1.00 54.78  ? 471  LYS A C     1 
ATOM   3369  O  O     . LYS A 1 472  ? 28.870  -9.047  136.833 1.00 53.59  ? 471  LYS A O     1 
ATOM   3370  C  CB    . LYS A 1 472  ? 30.478  -11.611 138.334 1.00 54.54  ? 471  LYS A CB    1 
ATOM   3371  C  CG    . LYS A 1 472  ? 30.650  -12.513 139.532 1.00 56.25  ? 471  LYS A CG    1 
ATOM   3372  C  CD    . LYS A 1 472  ? 32.034  -13.087 139.654 1.00 57.74  ? 471  LYS A CD    1 
ATOM   3373  C  CE    . LYS A 1 472  ? 32.213  -13.696 141.037 1.00 61.23  ? 471  LYS A CE    1 
ATOM   3374  N  NZ    . LYS A 1 472  ? 33.388  -14.605 141.117 1.00 64.57  ? 471  LYS A NZ    1 
ATOM   3375  N  N     . LEU A 1 473  ? 28.257  -11.114 136.211 1.00 65.95  ? 472  LEU A N     1 
ATOM   3376  C  CA    . LEU A 1 473  ? 27.659  -10.622 134.973 1.00 67.28  ? 472  LEU A CA    1 
ATOM   3377  C  C     . LEU A 1 473  ? 26.480  -9.710  135.280 1.00 62.71  ? 472  LEU A C     1 
ATOM   3378  O  O     . LEU A 1 473  ? 26.240  -8.723  134.574 1.00 60.67  ? 472  LEU A O     1 
ATOM   3379  C  CB    . LEU A 1 473  ? 27.233  -11.800 134.101 1.00 73.84  ? 472  LEU A CB    1 
ATOM   3380  C  CG    . LEU A 1 473  ? 27.348  -11.629 132.585 1.00 78.23  ? 472  LEU A CG    1 
ATOM   3381  C  CD1   . LEU A 1 473  ? 27.145  -12.981 131.897 1.00 82.07  ? 472  LEU A CD1   1 
ATOM   3382  C  CD2   . LEU A 1 473  ? 26.371  -10.583 132.023 1.00 79.25  ? 472  LEU A CD2   1 
ATOM   3383  N  N     . LEU A 1 474  ? 25.747  -10.020 136.349 1.00 55.42  ? 473  LEU A N     1 
ATOM   3384  C  CA    . LEU A 1 474  ? 24.663  -9.156  136.791 1.00 53.88  ? 473  LEU A CA    1 
ATOM   3385  C  C     . LEU A 1 474  ? 25.159  -7.746  137.084 1.00 52.00  ? 473  LEU A C     1 
ATOM   3386  O  O     . LEU A 1 474  ? 24.460  -6.765  136.803 1.00 51.95  ? 473  LEU A O     1 
ATOM   3387  C  CB    . LEU A 1 474  ? 24.001  -9.761  138.023 1.00 54.80  ? 473  LEU A CB    1 
ATOM   3388  C  CG    . LEU A 1 474  ? 22.827  -9.014  138.640 1.00 55.18  ? 473  LEU A CG    1 
ATOM   3389  C  CD1   . LEU A 1 474  ? 21.760  -8.709  137.596 1.00 58.67  ? 473  LEU A CD1   1 
ATOM   3390  C  CD2   . LEU A 1 474  ? 22.248  -9.834  139.783 1.00 56.71  ? 473  LEU A CD2   1 
ATOM   3391  N  N     . THR A 1 475  ? 26.364  -7.622  137.644 1.00 50.56  ? 474  THR A N     1 
ATOM   3392  C  CA    . THR A 1 475  ? 26.935  -6.331  138.003 1.00 48.84  ? 474  THR A CA    1 
ATOM   3393  C  C     . THR A 1 475  ? 28.184  -6.012  137.193 1.00 47.70  ? 474  THR A C     1 
ATOM   3394  O  O     . THR A 1 475  ? 29.045  -5.262  137.646 1.00 46.24  ? 474  THR A O     1 
ATOM   3395  C  CB    . THR A 1 475  ? 27.272  -6.264  139.495 1.00 48.09  ? 474  THR A CB    1 
ATOM   3396  O  OG1   . THR A 1 475  ? 28.050  -7.404  139.866 1.00 48.26  ? 474  THR A OG1   1 
ATOM   3397  C  CG2   . THR A 1 475  ? 26.018  -6.195  140.342 1.00 49.03  ? 474  THR A CG2   1 
ATOM   3398  N  N     . GLU A 1 476  ? 28.306  -6.576  135.998 1.00 51.93  ? 475  GLU A N     1 
ATOM   3399  C  CA    . GLU A 1 476  ? 29.486  -6.313  135.182 1.00 56.28  ? 475  GLU A CA    1 
ATOM   3400  C  C     . GLU A 1 476  ? 29.557  -4.851  134.752 1.00 56.12  ? 475  GLU A C     1 
ATOM   3401  O  O     . GLU A 1 476  ? 30.617  -4.226  134.807 1.00 55.10  ? 475  GLU A O     1 
ATOM   3402  C  CB    . GLU A 1 476  ? 29.475  -7.222  133.960 1.00 61.55  ? 475  GLU A CB    1 
ATOM   3403  C  CG    . GLU A 1 476  ? 30.693  -7.105  133.081 1.00 63.39  ? 475  GLU A CG    1 
ATOM   3404  C  CD    . GLU A 1 476  ? 31.292  -8.454  132.785 1.00 66.43  ? 475  GLU A CD    1 
ATOM   3405  O  OE1   . GLU A 1 476  ? 30.528  -9.441  132.763 1.00 67.69  ? 475  GLU A OE1   1 
ATOM   3406  O  OE2   . GLU A 1 476  ? 32.524  -8.528  132.596 1.00 69.94  ? 475  GLU A OE2   1 
ATOM   3407  N  N     . GLU A 1 477  ? 28.448  -4.293  134.303 1.00 64.14  ? 476  GLU A N     1 
ATOM   3408  C  CA    . GLU A 1 477  ? 28.450  -2.995  133.647 1.00 66.74  ? 476  GLU A CA    1 
ATOM   3409  C  C     . GLU A 1 477  ? 27.867  -1.909  134.536 1.00 66.99  ? 476  GLU A C     1 
ATOM   3410  O  O     . GLU A 1 477  ? 27.409  -0.875  134.049 1.00 63.73  ? 476  GLU A O     1 
ATOM   3411  C  CB    . GLU A 1 477  ? 27.670  -3.070  132.342 1.00 75.68  ? 476  GLU A CB    1 
ATOM   3412  C  CG    . GLU A 1 477  ? 28.501  -3.237  131.083 1.00 82.19  ? 476  GLU A CG    1 
ATOM   3413  C  CD    . GLU A 1 477  ? 27.661  -3.746  129.937 1.00 88.75  ? 476  GLU A CD    1 
ATOM   3414  O  OE1   . GLU A 1 477  ? 28.190  -4.424  129.037 1.00 91.64  ? 476  GLU A OE1   1 
ATOM   3415  O  OE2   . GLU A 1 477  ? 26.446  -3.488  129.966 1.00 93.20  ? 476  GLU A OE2   1 
ATOM   3416  N  N     . ILE A 1 478  ? 27.861  -2.133  135.834 1.00 62.30  ? 477  ILE A N     1 
ATOM   3417  C  CA    . ILE A 1 478  ? 27.340  -1.149  136.771 1.00 60.07  ? 477  ILE A CA    1 
ATOM   3418  C  C     . ILE A 1 478  ? 28.519  -0.404  137.385 1.00 52.51  ? 477  ILE A C     1 
ATOM   3419  O  O     . ILE A 1 478  ? 29.462  -1.018  137.899 1.00 52.53  ? 477  ILE A O     1 
ATOM   3420  C  CB    . ILE A 1 478  ? 26.468  -1.821  137.841 1.00 57.50  ? 477  ILE A CB    1 
ATOM   3421  C  CG1   . ILE A 1 478  ? 26.059  -0.832  138.930 1.00 55.99  ? 477  ILE A CG1   1 
ATOM   3422  C  CG2   . ILE A 1 478  ? 27.203  -2.951  138.453 1.00 55.66  ? 477  ILE A CG2   1 
ATOM   3423  C  CD1   . ILE A 1 478  ? 25.306  -1.492  140.011 1.00 56.96  ? 477  ILE A CD1   1 
ATOM   3424  N  N     . TYR A 1 479  ? 28.493  0.921   137.289 1.00 51.29  ? 478  TYR A N     1 
ATOM   3425  C  CA    . TYR A 1 479  ? 29.642  1.704   137.720 1.00 49.63  ? 478  TYR A CA    1 
ATOM   3426  C  C     . TYR A 1 479  ? 29.322  2.456   139.008 1.00 53.73  ? 478  TYR A C     1 
ATOM   3427  O  O     . TYR A 1 479  ? 29.384  3.687   139.078 1.00 55.52  ? 478  TYR A O     1 
ATOM   3428  C  CB    . TYR A 1 479  ? 30.090  2.622   136.591 1.00 50.35  ? 478  TYR A CB    1 
ATOM   3429  C  CG    . TYR A 1 479  ? 30.446  1.821   135.367 1.00 53.31  ? 478  TYR A CG    1 
ATOM   3430  C  CD1   . TYR A 1 479  ? 31.474  0.892   135.405 1.00 54.35  ? 478  TYR A CD1   1 
ATOM   3431  C  CD2   . TYR A 1 479  ? 29.742  1.971   134.178 1.00 54.74  ? 478  TYR A CD2   1 
ATOM   3432  C  CE1   . TYR A 1 479  ? 31.798  0.147   134.290 1.00 55.17  ? 478  TYR A CE1   1 
ATOM   3433  C  CE2   . TYR A 1 479  ? 30.062  1.234   133.063 1.00 55.12  ? 478  TYR A CE2   1 
ATOM   3434  C  CZ    . TYR A 1 479  ? 31.088  0.323   133.123 1.00 55.06  ? 478  TYR A CZ    1 
ATOM   3435  O  OH    . TYR A 1 479  ? 31.406  -0.415  132.008 1.00 56.96  ? 478  TYR A OH    1 
ATOM   3436  N  N     . ASN A 1 480  ? 28.945  1.695   140.030 1.00 50.19  ? 479  ASN A N     1 
ATOM   3437  C  CA    . ASN A 1 480  ? 28.666  2.237   141.355 1.00 41.34  ? 479  ASN A CA    1 
ATOM   3438  C  C     . ASN A 1 480  ? 29.055  1.146   142.323 1.00 41.27  ? 479  ASN A C     1 
ATOM   3439  O  O     . ASN A 1 480  ? 28.267  0.237   142.606 1.00 42.34  ? 479  ASN A O     1 
ATOM   3440  C  CB    . ASN A 1 480  ? 27.199  2.631   141.514 1.00 42.52  ? 479  ASN A CB    1 
ATOM   3441  C  CG    . ASN A 1 480  ? 26.898  3.237   142.861 1.00 42.38  ? 479  ASN A CG    1 
ATOM   3442  O  OD1   . ASN A 1 480  ? 27.433  2.805   143.875 1.00 41.87  ? 479  ASN A OD1   1 
ATOM   3443  N  ND2   . ASN A 1 480  ? 26.027  4.240   142.883 1.00 42.94  ? 479  ASN A ND2   1 
ATOM   3444  N  N     . PRO A 1 481  ? 30.282  1.191   142.848 1.00 40.12  ? 480  PRO A N     1 
ATOM   3445  C  CA    . PRO A 1 481  ? 30.789  0.048   143.617 1.00 40.12  ? 480  PRO A CA    1 
ATOM   3446  C  C     . PRO A 1 481  ? 29.961  -0.281  144.839 1.00 44.95  ? 480  PRO A C     1 
ATOM   3447  O  O     . PRO A 1 481  ? 29.941  -1.445  145.254 1.00 51.12  ? 480  PRO A O     1 
ATOM   3448  C  CB    . PRO A 1 481  ? 32.204  0.492   143.989 1.00 38.75  ? 480  PRO A CB    1 
ATOM   3449  C  CG    . PRO A 1 481  ? 32.133  1.965   143.985 1.00 38.15  ? 480  PRO A CG    1 
ATOM   3450  C  CD    . PRO A 1 481  ? 31.239  2.308   142.845 1.00 38.89  ? 480  PRO A CD    1 
ATOM   3451  N  N     . VAL A 1 482  ? 29.253  0.688   145.418 1.00 43.24  ? 481  VAL A N     1 
ATOM   3452  C  CA    . VAL A 1 482  ? 28.421  0.388   146.579 1.00 43.57  ? 481  VAL A CA    1 
ATOM   3453  C  C     . VAL A 1 482  ? 27.174  -0.370  146.157 1.00 44.90  ? 481  VAL A C     1 
ATOM   3454  O  O     . VAL A 1 482  ? 26.814  -1.388  146.758 1.00 48.51  ? 481  VAL A O     1 
ATOM   3455  C  CB    . VAL A 1 482  ? 28.057  1.672   147.343 1.00 41.45  ? 481  VAL A CB    1 
ATOM   3456  C  CG1   . VAL A 1 482  ? 27.249  1.322   148.585 1.00 42.37  ? 481  VAL A CG1   1 
ATOM   3457  C  CG2   . VAL A 1 482  ? 29.301  2.439   147.725 1.00 39.99  ? 481  VAL A CG2   1 
ATOM   3458  N  N     . VAL A 1 483  ? 26.482  0.123   145.130 1.00 52.25  ? 482  VAL A N     1 
ATOM   3459  C  CA    . VAL A 1 483  ? 25.331  -0.610  144.615 1.00 51.00  ? 482  VAL A CA    1 
ATOM   3460  C  C     . VAL A 1 483  ? 25.767  -1.961  144.074 1.00 51.50  ? 482  VAL A C     1 
ATOM   3461  O  O     . VAL A 1 483  ? 25.130  -2.986  144.338 1.00 54.21  ? 482  VAL A O     1 
ATOM   3462  C  CB    . VAL A 1 483  ? 24.594  0.213   143.544 1.00 51.94  ? 482  VAL A CB    1 
ATOM   3463  C  CG1   . VAL A 1 483  ? 23.621  -0.659  142.806 1.00 56.77  ? 482  VAL A CG1   1 
ATOM   3464  C  CG2   . VAL A 1 483  ? 23.844  1.333   144.183 1.00 51.62  ? 482  VAL A CG2   1 
ATOM   3465  N  N     . ALA A 1 484  ? 26.869  -1.989  143.326 1.00 48.25  ? 483  ALA A N     1 
ATOM   3466  C  CA    . ALA A 1 484  ? 27.334  -3.244  142.751 1.00 48.39  ? 483  ALA A CA    1 
ATOM   3467  C  C     . ALA A 1 484  ? 27.651  -4.263  143.834 1.00 47.40  ? 483  ALA A C     1 
ATOM   3468  O  O     . ALA A 1 484  ? 27.399  -5.462  143.661 1.00 49.76  ? 483  ALA A O     1 
ATOM   3469  C  CB    . ALA A 1 484  ? 28.555  -2.999  141.867 1.00 45.32  ? 483  ALA A CB    1 
ATOM   3470  N  N     . LYS A 1 485  ? 28.183  -3.804  144.969 1.00 46.83  ? 484  LYS A N     1 
ATOM   3471  C  CA    . LYS A 1 485  ? 28.527  -4.730  146.040 1.00 45.94  ? 484  LYS A CA    1 
ATOM   3472  C  C     . LYS A 1 485  ? 27.277  -5.301  146.696 1.00 46.31  ? 484  LYS A C     1 
ATOM   3473  O  O     . LYS A 1 485  ? 27.106  -6.521  146.757 1.00 47.44  ? 484  LYS A O     1 
ATOM   3474  C  CB    . LYS A 1 485  ? 29.413  -4.039  147.077 1.00 44.75  ? 484  LYS A CB    1 
ATOM   3475  C  CG    . LYS A 1 485  ? 29.740  -4.910  148.272 1.00 43.72  ? 484  LYS A CG    1 
ATOM   3476  C  CD    . LYS A 1 485  ? 30.646  -4.197  149.258 1.00 42.43  ? 484  LYS A CD    1 
ATOM   3477  C  CE    . LYS A 1 485  ? 32.027  -3.990  148.684 1.00 41.17  ? 484  LYS A CE    1 
ATOM   3478  N  NZ    . LYS A 1 485  ? 32.972  -3.485  149.700 1.00 40.11  ? 484  LYS A NZ    1 
ATOM   3479  N  N     . SER A 1 486  ? 26.384  -4.439  147.186 1.00 50.06  ? 485  SER A N     1 
ATOM   3480  C  CA    . SER A 1 486  ? 25.223  -4.944  147.913 1.00 54.18  ? 485  SER A CA    1 
ATOM   3481  C  C     . SER A 1 486  ? 24.382  -5.861  147.041 1.00 59.77  ? 485  SER A C     1 
ATOM   3482  O  O     . SER A 1 486  ? 23.844  -6.863  147.526 1.00 61.17  ? 485  SER A O     1 
ATOM   3483  C  CB    . SER A 1 486  ? 24.375  -3.794  148.448 1.00 55.46  ? 485  SER A CB    1 
ATOM   3484  O  OG    . SER A 1 486  ? 24.230  -2.778  147.486 1.00 57.65  ? 485  SER A OG    1 
ATOM   3485  N  N     . VAL A 1 487  ? 24.259  -5.539  145.752 1.00 55.50  ? 486  VAL A N     1 
ATOM   3486  C  CA    . VAL A 1 487  ? 23.593  -6.453  144.833 1.00 51.14  ? 486  VAL A CA    1 
ATOM   3487  C  C     . VAL A 1 487  ? 24.307  -7.794  144.828 1.00 51.50  ? 486  VAL A C     1 
ATOM   3488  O  O     . VAL A 1 487  ? 23.688  -8.846  145.011 1.00 53.11  ? 486  VAL A O     1 
ATOM   3489  C  CB    . VAL A 1 487  ? 23.517  -5.849  143.419 1.00 50.87  ? 486  VAL A CB    1 
ATOM   3490  C  CG1   . VAL A 1 487  ? 23.111  -6.920  142.416 1.00 52.30  ? 486  VAL A CG1   1 
ATOM   3491  C  CG2   . VAL A 1 487  ? 22.516  -4.699  143.379 1.00 51.13  ? 486  VAL A CG2   1 
ATOM   3492  N  N     . ARG A 1 488  ? 25.626  -7.775  144.641 1.00 50.12  ? 487  ARG A N     1 
ATOM   3493  C  CA    . ARG A 1 488  ? 26.390  -9.017  144.649 1.00 50.49  ? 487  ARG A CA    1 
ATOM   3494  C  C     . ARG A 1 488  ? 26.194  -9.791  145.946 1.00 52.10  ? 487  ARG A C     1 
ATOM   3495  O  O     . ARG A 1 488  ? 26.182  -11.026 145.935 1.00 52.94  ? 487  ARG A O     1 
ATOM   3496  C  CB    . ARG A 1 488  ? 27.868  -8.710  144.420 1.00 49.66  ? 487  ARG A CB    1 
ATOM   3497  C  CG    . ARG A 1 488  ? 28.480  -9.468  143.266 1.00 50.06  ? 487  ARG A CG    1 
ATOM   3498  C  CD    . ARG A 1 488  ? 29.936  -9.105  143.025 1.00 48.39  ? 487  ARG A CD    1 
ATOM   3499  N  NE    . ARG A 1 488  ? 30.074  -7.792  142.415 1.00 47.70  ? 487  ARG A NE    1 
ATOM   3500  C  CZ    . ARG A 1 488  ? 30.448  -6.704  143.072 1.00 47.12  ? 487  ARG A CZ    1 
ATOM   3501  N  NH1   . ARG A 1 488  ? 30.727  -6.775  144.360 1.00 48.31  ? 487  ARG A NH1   1 
ATOM   3502  N  NH2   . ARG A 1 488  ? 30.546  -5.545  142.445 1.00 46.90  ? 487  ARG A NH2   1 
ATOM   3503  N  N     . GLN A 1 489  ? 26.024  -9.087  147.069 1.00 54.35  ? 488  GLN A N     1 
ATOM   3504  C  CA    . GLN A 1 489  ? 25.798  -9.764  148.340 1.00 56.01  ? 488  GLN A CA    1 
ATOM   3505  C  C     . GLN A 1 489  ? 24.392  -10.343 148.412 1.00 54.77  ? 488  GLN A C     1 
ATOM   3506  O  O     . GLN A 1 489  ? 24.197  -11.447 148.929 1.00 55.34  ? 488  GLN A O     1 
ATOM   3507  C  CB    . GLN A 1 489  ? 26.026  -8.800  149.505 1.00 59.05  ? 488  GLN A CB    1 
ATOM   3508  C  CG    . GLN A 1 489  ? 27.342  -8.043  149.479 1.00 59.73  ? 488  GLN A CG    1 
ATOM   3509  C  CD    . GLN A 1 489  ? 28.541  -8.911  149.807 1.00 62.64  ? 488  GLN A CD    1 
ATOM   3510  O  OE1   . GLN A 1 489  ? 28.553  -9.625  150.808 1.00 64.39  ? 488  GLN A OE1   1 
ATOM   3511  N  NE2   . GLN A 1 489  ? 29.565  -8.847  148.964 1.00 65.27  ? 488  GLN A NE2   1 
ATOM   3512  N  N     . ALA A 1 490  ? 23.399  -9.608  147.913 1.00 54.09  ? 489  ALA A N     1 
ATOM   3513  C  CA    . ALA A 1 490  ? 22.020  -10.081 147.988 1.00 56.15  ? 489  ALA A CA    1 
ATOM   3514  C  C     . ALA A 1 490  ? 21.791  -11.325 147.137 1.00 57.68  ? 489  ALA A C     1 
ATOM   3515  O  O     . ALA A 1 490  ? 20.962  -12.169 147.491 1.00 59.60  ? 489  ALA A O     1 
ATOM   3516  C  CB    . ALA A 1 490  ? 21.057  -8.973  147.565 1.00 56.23  ? 489  ALA A CB    1 
ATOM   3517  N  N     . ILE A 1 491  ? 22.513  -11.464 146.030 1.00 57.00  ? 490  ILE A N     1 
ATOM   3518  C  CA    . ILE A 1 491  ? 22.330  -12.618 145.159 1.00 58.52  ? 490  ILE A CA    1 
ATOM   3519  C  C     . ILE A 1 491  ? 23.129  -13.819 145.653 1.00 58.97  ? 490  ILE A C     1 
ATOM   3520  O  O     . ILE A 1 491  ? 22.657  -14.956 145.570 1.00 60.89  ? 490  ILE A O     1 
ATOM   3521  C  CB    . ILE A 1 491  ? 22.679  -12.256 143.696 1.00 57.82  ? 490  ILE A CB    1 
ATOM   3522  C  CG1   . ILE A 1 491  ? 21.435  -11.804 142.932 1.00 58.84  ? 490  ILE A CG1   1 
ATOM   3523  C  CG2   . ILE A 1 491  ? 23.261  -13.444 142.959 1.00 58.61  ? 490  ILE A CG2   1 
ATOM   3524  C  CD1   . ILE A 1 491  ? 20.704  -10.664 143.545 1.00 58.46  ? 490  ILE A CD1   1 
ATOM   3525  N  N     . LYS A 1 492  ? 24.338  -13.604 146.181 1.00 57.38  ? 491  LYS A N     1 
ATOM   3526  C  CA    . LYS A 1 492  ? 25.074  -14.719 146.769 1.00 57.93  ? 491  LYS A CA    1 
ATOM   3527  C  C     . LYS A 1 492  ? 24.274  -15.376 147.884 1.00 59.59  ? 491  LYS A C     1 
ATOM   3528  O  O     . LYS A 1 492  ? 24.389  -16.588 148.102 1.00 61.05  ? 491  LYS A O     1 
ATOM   3529  C  CB    . LYS A 1 492  ? 26.434  -14.251 147.295 1.00 56.44  ? 491  LYS A CB    1 
ATOM   3530  C  CG    . LYS A 1 492  ? 27.485  -14.048 146.212 1.00 55.36  ? 491  LYS A CG    1 
ATOM   3531  C  CD    . LYS A 1 492  ? 28.888  -13.923 146.787 1.00 54.65  ? 491  LYS A CD    1 
ATOM   3532  C  CE    . LYS A 1 492  ? 29.933  -13.853 145.677 1.00 54.90  ? 491  LYS A CE    1 
ATOM   3533  N  NZ    . LYS A 1 492  ? 31.331  -13.953 146.183 1.00 54.18  ? 491  LYS A NZ    1 
ATOM   3534  N  N     . ILE A 1 493  ? 23.435  -14.599 148.571 1.00 59.56  ? 492  ILE A N     1 
ATOM   3535  C  CA    . ILE A 1 493  ? 22.632  -15.132 149.667 1.00 61.19  ? 492  ILE A CA    1 
ATOM   3536  C  C     . ILE A 1 493  ? 21.508  -16.019 149.138 1.00 63.61  ? 492  ILE A C     1 
ATOM   3537  O  O     . ILE A 1 493  ? 21.312  -17.146 149.611 1.00 65.37  ? 492  ILE A O     1 
ATOM   3538  C  CB    . ILE A 1 493  ? 22.088  -13.980 150.529 1.00 60.49  ? 492  ILE A CB    1 
ATOM   3539  C  CG1   . ILE A 1 493  ? 23.213  -13.382 151.378 1.00 58.56  ? 492  ILE A CG1   1 
ATOM   3540  C  CG2   . ILE A 1 493  ? 20.918  -14.455 151.380 1.00 62.58  ? 492  ILE A CG2   1 
ATOM   3541  C  CD1   . ILE A 1 493  ? 22.806  -12.183 152.186 1.00 57.77  ? 492  ILE A CD1   1 
ATOM   3542  N  N     . VAL A 1 494  ? 20.748  -15.526 148.153 1.00 67.17  ? 493  VAL A N     1 
ATOM   3543  C  CA    . VAL A 1 494  ? 19.591  -16.287 147.685 1.00 67.95  ? 493  VAL A CA    1 
ATOM   3544  C  C     . VAL A 1 494  ? 20.030  -17.576 147.009 1.00 69.23  ? 493  VAL A C     1 
ATOM   3545  O  O     . VAL A 1 494  ? 19.297  -18.568 147.029 1.00 72.13  ? 493  VAL A O     1 
ATOM   3546  C  CB    . VAL A 1 494  ? 18.697  -15.444 146.753 1.00 67.40  ? 493  VAL A CB    1 
ATOM   3547  C  CG1   . VAL A 1 494  ? 18.372  -14.101 147.385 1.00 65.34  ? 493  VAL A CG1   1 
ATOM   3548  C  CG2   . VAL A 1 494  ? 19.358  -15.254 145.400 1.00 67.29  ? 493  VAL A CG2   1 
ATOM   3549  N  N     . ASN A 1 495  ? 21.226  -17.597 146.418 1.00 70.45  ? 494  ASN A N     1 
ATOM   3550  C  CA    . ASN A 1 495  ? 21.741  -18.830 145.841 1.00 67.81  ? 494  ASN A CA    1 
ATOM   3551  C  C     . ASN A 1 495  ? 22.061  -19.842 146.928 1.00 68.90  ? 494  ASN A C     1 
ATOM   3552  O  O     . ASN A 1 495  ? 21.706  -21.020 146.817 1.00 71.87  ? 494  ASN A O     1 
ATOM   3553  C  CB    . ASN A 1 495  ? 22.964  -18.527 144.980 1.00 66.02  ? 494  ASN A CB    1 
ATOM   3554  C  CG    . ASN A 1 495  ? 22.627  -17.633 143.804 1.00 65.72  ? 494  ASN A CG    1 
ATOM   3555  O  OD1   . ASN A 1 495  ? 21.583  -16.961 143.785 1.00 65.51  ? 494  ASN A OD1   1 
ATOM   3556  N  ND2   . ASN A 1 495  ? 23.508  -17.620 142.806 1.00 64.36  ? 494  ASN A ND2   1 
ATOM   3557  N  N     . ALA A 1 496  ? 22.708  -19.391 148.002 1.00 68.31  ? 495  ALA A N     1 
ATOM   3558  C  CA    . ALA A 1 496  ? 22.977  -20.262 149.136 1.00 69.45  ? 495  ALA A CA    1 
ATOM   3559  C  C     . ALA A 1 496  ? 21.697  -20.639 149.871 1.00 71.45  ? 495  ALA A C     1 
ATOM   3560  O  O     . ALA A 1 496  ? 21.591  -21.751 150.400 1.00 73.36  ? 495  ALA A O     1 
ATOM   3561  C  CB    . ALA A 1 496  ? 23.964  -19.583 150.087 1.00 68.43  ? 495  ALA A CB    1 
ATOM   3562  N  N     . ALA A 1 497  ? 20.718  -19.735 149.919 1.00 69.79  ? 496  ALA A N     1 
ATOM   3563  C  CA    . ALA A 1 497  ? 19.437  -20.088 150.518 1.00 71.99  ? 496  ALA A CA    1 
ATOM   3564  C  C     . ALA A 1 497  ? 18.705  -21.122 149.672 1.00 74.44  ? 496  ALA A C     1 
ATOM   3565  O  O     . ALA A 1 497  ? 18.062  -22.032 150.206 1.00 76.78  ? 496  ALA A O     1 
ATOM   3566  C  CB    . ALA A 1 497  ? 18.582  -18.837 150.703 1.00 71.30  ? 496  ALA A CB    1 
ATOM   3567  N  N     . ILE A 1 498  ? 18.797  -21.001 148.349 1.00 74.03  ? 497  ILE A N     1 
ATOM   3568  C  CA    . ILE A 1 498  ? 18.140  -21.966 147.478 1.00 76.37  ? 497  ILE A CA    1 
ATOM   3569  C  C     . ILE A 1 498  ? 18.847  -23.318 147.555 1.00 77.64  ? 497  ILE A C     1 
ATOM   3570  O  O     . ILE A 1 498  ? 18.195  -24.365 147.546 1.00 80.55  ? 497  ILE A O     1 
ATOM   3571  C  CB    . ILE A 1 498  ? 18.059  -21.414 146.041 1.00 75.58  ? 497  ILE A CB    1 
ATOM   3572  C  CG1   . ILE A 1 498  ? 16.913  -20.406 145.922 1.00 75.57  ? 497  ILE A CG1   1 
ATOM   3573  C  CG2   . ILE A 1 498  ? 17.795  -22.509 145.061 1.00 77.68  ? 497  ILE A CG2   1 
ATOM   3574  C  CD1   . ILE A 1 498  ? 16.892  -19.638 144.624 1.00 74.48  ? 497  ILE A CD1   1 
ATOM   3575  N  N     . LYS A 1 499  ? 20.184  -23.321 147.680 1.00 75.97  ? 498  LYS A N     1 
ATOM   3576  C  CA    . LYS A 1 499  ? 20.906  -24.591 147.809 1.00 81.94  ? 498  LYS A CA    1 
ATOM   3577  C  C     . LYS A 1 499  ? 20.486  -25.345 149.056 1.00 85.79  ? 498  LYS A C     1 
ATOM   3578  O  O     . LYS A 1 499  ? 20.321  -26.568 149.024 1.00 86.48  ? 498  LYS A O     1 
ATOM   3579  C  CB    . LYS A 1 499  ? 22.428  -24.392 147.868 1.00 85.86  ? 498  LYS A CB    1 
ATOM   3580  C  CG    . LYS A 1 499  ? 23.066  -23.930 146.620 1.00 89.17  ? 498  LYS A CG    1 
ATOM   3581  C  CD    . LYS A 1 499  ? 22.277  -24.408 145.461 1.00 94.20  ? 498  LYS A CD    1 
ATOM   3582  C  CE    . LYS A 1 499  ? 21.773  -23.252 144.783 1.00 95.40  ? 498  LYS A CE    1 
ATOM   3583  N  NZ    . LYS A 1 499  ? 20.813  -23.621 143.772 1.00 99.21  ? 498  LYS A NZ    1 
ATOM   3584  N  N     . GLU A 1 500  ? 20.354  -24.643 150.170 1.00 103.77 ? 499  GLU A N     1 
ATOM   3585  C  CA    . GLU A 1 500  ? 20.115  -25.307 151.436 1.00 106.57 ? 499  GLU A CA    1 
ATOM   3586  C  C     . GLU A 1 500  ? 18.645  -25.632 151.637 1.00 104.36 ? 499  GLU A C     1 
ATOM   3587  O  O     . GLU A 1 500  ? 18.317  -26.506 152.447 1.00 105.64 ? 499  GLU A O     1 
ATOM   3588  C  CB    . GLU A 1 500  ? 20.639  -24.423 152.567 1.00 108.89 ? 499  GLU A CB    1 
ATOM   3589  C  CG    . GLU A 1 500  ? 20.743  -25.103 153.907 1.00 113.25 ? 499  GLU A CG    1 
ATOM   3590  C  CD    . GLU A 1 500  ? 21.968  -25.986 154.013 1.00 115.77 ? 499  GLU A CD    1 
ATOM   3591  O  OE1   . GLU A 1 500  ? 21.963  -26.899 154.863 1.00 118.46 ? 499  GLU A OE1   1 
ATOM   3592  O  OE2   . GLU A 1 500  ? 22.934  -25.770 153.250 1.00 116.71 ? 499  GLU A OE2   1 
ATOM   3593  N  N     . TYR A 1 501  ? 17.756  -24.973 150.893 1.00 100.32 ? 500  TYR A N     1 
ATOM   3594  C  CA    . TYR A 1 501  ? 16.330  -25.093 151.137 1.00 99.12  ? 500  TYR A CA    1 
ATOM   3595  C  C     . TYR A 1 501  ? 15.494  -25.371 149.898 1.00 98.92  ? 500  TYR A C     1 
ATOM   3596  O  O     . TYR A 1 501  ? 14.282  -25.561 150.030 1.00 97.66  ? 500  TYR A O     1 
ATOM   3597  C  CB    . TYR A 1 501  ? 15.798  -23.816 151.802 1.00 96.94  ? 500  TYR A CB    1 
ATOM   3598  C  CG    . TYR A 1 501  ? 16.494  -23.457 153.088 1.00 94.89  ? 500  TYR A CG    1 
ATOM   3599  C  CD1   . TYR A 1 501  ? 17.686  -22.753 153.081 1.00 90.32  ? 500  TYR A CD1   1 
ATOM   3600  C  CD2   . TYR A 1 501  ? 15.958  -23.823 154.307 1.00 96.96  ? 500  TYR A CD2   1 
ATOM   3601  C  CE1   . TYR A 1 501  ? 18.325  -22.423 154.251 1.00 88.27  ? 500  TYR A CE1   1 
ATOM   3602  C  CE2   . TYR A 1 501  ? 16.589  -23.503 155.480 1.00 94.83  ? 500  TYR A CE2   1 
ATOM   3603  C  CZ    . TYR A 1 501  ? 17.773  -22.799 155.454 1.00 91.40  ? 500  TYR A CZ    1 
ATOM   3604  O  OH    . TYR A 1 501  ? 18.412  -22.470 156.630 1.00 90.84  ? 500  TYR A OH    1 
ATOM   3605  N  N     . GLY A 1 502  ? 16.088  -25.403 148.712 1.00 85.98  ? 501  GLY A N     1 
ATOM   3606  C  CA    . GLY A 1 502  ? 15.305  -25.460 147.493 1.00 86.14  ? 501  GLY A CA    1 
ATOM   3607  C  C     . GLY A 1 502  ? 14.655  -24.116 147.224 1.00 84.74  ? 501  GLY A C     1 
ATOM   3608  O  O     . GLY A 1 502  ? 14.843  -23.141 147.947 1.00 82.88  ? 501  GLY A O     1 
ATOM   3609  N  N     . ASP A 1 503  ? 13.868  -24.071 146.156 1.00 85.79  ? 502  ASP A N     1 
ATOM   3610  C  CA    . ASP A 1 503  ? 13.232  -22.816 145.795 1.00 84.67  ? 502  ASP A CA    1 
ATOM   3611  C  C     . ASP A 1 503  ? 12.137  -22.464 146.796 1.00 85.83  ? 502  ASP A C     1 
ATOM   3612  O  O     . ASP A 1 503  ? 11.684  -23.294 147.590 1.00 87.95  ? 502  ASP A O     1 
ATOM   3613  C  CB    . ASP A 1 503  ? 12.667  -22.889 144.379 1.00 86.53  ? 502  ASP A CB    1 
ATOM   3614  C  CG    . ASP A 1 503  ? 13.725  -23.230 143.351 1.00 87.30  ? 502  ASP A CG    1 
ATOM   3615  O  OD1   . ASP A 1 503  ? 14.394  -22.302 142.850 1.00 85.19  ? 502  ASP A OD1   1 
ATOM   3616  O  OD2   . ASP A 1 503  ? 13.891  -24.431 143.051 1.00 89.77  ? 502  ASP A OD2   1 
ATOM   3617  N  N     . PHE A 1 504  ? 11.715  -21.208 146.751 1.00 84.53  ? 503  PHE A N     1 
ATOM   3618  C  CA    . PHE A 1 504  ? 10.760  -20.664 147.699 1.00 85.31  ? 503  PHE A CA    1 
ATOM   3619  C  C     . PHE A 1 504  ? 9.461   -20.318 146.990 1.00 86.91  ? 503  PHE A C     1 
ATOM   3620  O  O     . PHE A 1 504  ? 9.443   -20.044 145.788 1.00 86.47  ? 503  PHE A O     1 
ATOM   3621  C  CB    . PHE A 1 504  ? 11.322  -19.416 148.384 1.00 82.61  ? 503  PHE A CB    1 
ATOM   3622  C  CG    . PHE A 1 504  ? 12.668  -19.625 149.014 1.00 80.83  ? 503  PHE A CG    1 
ATOM   3623  C  CD1   . PHE A 1 504  ? 13.818  -19.590 148.247 1.00 78.93  ? 503  PHE A CD1   1 
ATOM   3624  C  CD2   . PHE A 1 504  ? 12.782  -19.857 150.372 1.00 81.16  ? 503  PHE A CD2   1 
ATOM   3625  C  CE1   . PHE A 1 504  ? 15.054  -19.782 148.822 1.00 77.41  ? 503  PHE A CE1   1 
ATOM   3626  C  CE2   . PHE A 1 504  ? 14.016  -20.050 150.952 1.00 79.62  ? 503  PHE A CE2   1 
ATOM   3627  C  CZ    . PHE A 1 504  ? 15.155  -20.013 150.176 1.00 77.75  ? 503  PHE A CZ    1 
ATOM   3628  N  N     . ASP A 1 505  ? 8.368   -20.343 147.748 1.00 90.01  ? 504  ASP A N     1 
ATOM   3629  C  CA    . ASP A 1 505  ? 7.099   -19.879 147.205 1.00 96.46  ? 504  ASP A CA    1 
ATOM   3630  C  C     . ASP A 1 505  ? 7.163   -18.393 146.870 1.00 93.44  ? 504  ASP A C     1 
ATOM   3631  O  O     . ASP A 1 505  ? 6.601   -17.951 145.862 1.00 93.19  ? 504  ASP A O     1 
ATOM   3632  C  CB    . ASP A 1 505  ? 5.973   -20.175 148.198 1.00 97.35  ? 504  ASP A CB    1 
ATOM   3633  C  CG    . ASP A 1 505  ? 4.661   -19.521 147.812 1.00 97.17  ? 504  ASP A CG    1 
ATOM   3634  O  OD1   . ASP A 1 505  ? 3.922   -20.094 146.978 1.00 99.42  ? 504  ASP A OD1   1 
ATOM   3635  O  OD2   . ASP A 1 505  ? 4.366   -18.437 148.359 1.00 94.72  ? 504  ASP A OD2   1 
ATOM   3636  N  N     . ASN A 1 506  ? 7.876   -17.614 147.679 1.00 96.51  ? 505  ASN A N     1 
ATOM   3637  C  CA    . ASN A 1 506  ? 7.918   -16.168 147.534 1.00 95.93  ? 505  ASN A CA    1 
ATOM   3638  C  C     . ASN A 1 506  ? 9.235   -15.676 148.108 1.00 92.72  ? 505  ASN A C     1 
ATOM   3639  O  O     . ASN A 1 506  ? 9.690   -16.167 149.143 1.00 90.43  ? 505  ASN A O     1 
ATOM   3640  C  CB    . ASN A 1 506  ? 6.731   -15.514 148.258 1.00 101.44 ? 505  ASN A CB    1 
ATOM   3641  C  CG    . ASN A 1 506  ? 6.651   -13.996 148.063 1.00 103.19 ? 505  ASN A CG    1 
ATOM   3642  O  OD1   . ASN A 1 506  ? 5.880   -13.326 148.761 1.00 105.27 ? 505  ASN A OD1   1 
ATOM   3643  N  ND2   . ASN A 1 506  ? 7.403   -13.454 147.100 1.00 103.97 ? 505  ASN A ND2   1 
ATOM   3644  N  N     . ILE A 1 507  ? 9.851   -14.725 147.415 1.00 78.76  ? 506  ILE A N     1 
ATOM   3645  C  CA    . ILE A 1 507  ? 10.999  -13.986 147.920 1.00 76.01  ? 506  ILE A CA    1 
ATOM   3646  C  C     . ILE A 1 507  ? 10.616  -12.514 147.942 1.00 74.98  ? 506  ILE A C     1 
ATOM   3647  O  O     . ILE A 1 507  ? 10.308  -11.933 146.894 1.00 74.79  ? 506  ILE A O     1 
ATOM   3648  C  CB    . ILE A 1 507  ? 12.252  -14.219 147.070 1.00 74.18  ? 506  ILE A CB    1 
ATOM   3649  C  CG1   . ILE A 1 507  ? 12.477  -15.713 146.875 1.00 75.64  ? 506  ILE A CG1   1 
ATOM   3650  C  CG2   . ILE A 1 507  ? 13.453  -13.612 147.758 1.00 71.63  ? 506  ILE A CG2   1 
ATOM   3651  C  CD1   . ILE A 1 507  ? 13.683  -16.046 146.047 1.00 74.16  ? 506  ILE A CD1   1 
ATOM   3652  N  N     . VAL A 1 508  ? 10.637  -11.912 149.128 1.00 74.43  ? 507  VAL A N     1 
ATOM   3653  C  CA    . VAL A 1 508  ? 10.074  -10.586 149.362 1.00 74.05  ? 507  VAL A CA    1 
ATOM   3654  C  C     . VAL A 1 508  ? 11.203  -9.592  149.592 1.00 71.21  ? 507  VAL A C     1 
ATOM   3655  O  O     . VAL A 1 508  ? 12.103  -9.841  150.403 1.00 70.08  ? 507  VAL A O     1 
ATOM   3656  C  CB    . VAL A 1 508  ? 9.114   -10.596 150.562 1.00 75.90  ? 507  VAL A CB    1 
ATOM   3657  C  CG1   . VAL A 1 508  ? 8.245   -9.368  150.538 1.00 76.27  ? 507  VAL A CG1   1 
ATOM   3658  C  CG2   . VAL A 1 508  ? 8.273   -11.856 150.551 1.00 78.68  ? 507  VAL A CG2   1 
ATOM   3659  N  N     . ILE A 1 509  ? 11.137  -8.456  148.902 1.00 70.20  ? 508  ILE A N     1 
ATOM   3660  C  CA    . ILE A 1 509  ? 12.159  -7.418  148.976 1.00 67.63  ? 508  ILE A CA    1 
ATOM   3661  C  C     . ILE A 1 509  ? 11.501  -6.126  149.426 1.00 67.73  ? 508  ILE A C     1 
ATOM   3662  O  O     . ILE A 1 509  ? 10.600  -5.616  148.751 1.00 68.77  ? 508  ILE A O     1 
ATOM   3663  C  CB    . ILE A 1 509  ? 12.865  -7.213  147.630 1.00 66.21  ? 508  ILE A CB    1 
ATOM   3664  C  CG1   . ILE A 1 509  ? 13.601  -8.482  147.220 1.00 66.12  ? 508  ILE A CG1   1 
ATOM   3665  C  CG2   . ILE A 1 509  ? 13.822  -6.037  147.711 1.00 63.77  ? 508  ILE A CG2   1 
ATOM   3666  C  CD1   . ILE A 1 509  ? 14.171  -8.416  145.839 1.00 65.14  ? 508  ILE A CD1   1 
ATOM   3667  N  N     . GLU A 1 510  ? 11.952  -5.589  150.554 1.00 70.59  ? 509  GLU A N     1 
ATOM   3668  C  CA    . GLU A 1 510  ? 11.478  -4.280  150.972 1.00 71.50  ? 509  GLU A CA    1 
ATOM   3669  C  C     . GLU A 1 510  ? 12.006  -3.226  150.013 1.00 70.15  ? 509  GLU A C     1 
ATOM   3670  O  O     . GLU A 1 510  ? 13.160  -3.281  149.581 1.00 67.03  ? 509  GLU A O     1 
ATOM   3671  C  CB    . GLU A 1 510  ? 11.914  -3.973  152.402 1.00 76.49  ? 509  GLU A CB    1 
ATOM   3672  C  CG    . GLU A 1 510  ? 11.819  -2.506  152.786 1.00 80.05  ? 509  GLU A CG    1 
ATOM   3673  C  CD    . GLU A 1 510  ? 11.647  -2.311  154.288 1.00 81.60  ? 509  GLU A CD    1 
ATOM   3674  O  OE1   . GLU A 1 510  ? 11.839  -1.181  154.766 1.00 83.39  ? 509  GLU A OE1   1 
ATOM   3675  O  OE2   . GLU A 1 510  ? 11.301  -3.281  154.991 1.00 82.52  ? 509  GLU A OE2   1 
ATOM   3676  N  N     . MET A 1 511  ? 11.144  -2.285  149.647 1.00 65.77  ? 510  MET A N     1 
ATOM   3677  C  CA    . MET A 1 511  ? 11.502  -1.226  148.721 1.00 65.51  ? 510  MET A CA    1 
ATOM   3678  C  C     . MET A 1 511  ? 11.298  0.126   149.386 1.00 64.25  ? 510  MET A C     1 
ATOM   3679  O  O     . MET A 1 511  ? 10.425  0.292   150.240 1.00 65.78  ? 510  MET A O     1 
ATOM   3680  C  CB    . MET A 1 511  ? 10.673  -1.314  147.442 1.00 65.97  ? 510  MET A CB    1 
ATOM   3681  C  CG    . MET A 1 511  ? 10.767  -2.652  146.723 1.00 67.52  ? 510  MET A CG    1 
ATOM   3682  S  SD    . MET A 1 511  ? 12.289  -2.909  145.794 1.00 65.95  ? 510  MET A SD    1 
ATOM   3683  C  CE    . MET A 1 511  ? 12.241  -1.543  144.655 1.00 66.02  ? 510  MET A CE    1 
ATOM   3684  N  N     . ALA A 1 512  ? 11.942  1.137   148.865 1.00 62.42  ? 511  ALA A N     1 
ATOM   3685  C  CA    . ALA A 1 512  ? 11.754  2.434   149.427 1.00 62.06  ? 511  ALA A CA    1 
ATOM   3686  C  C     . ALA A 1 512  ? 11.182  3.316   148.373 1.00 62.87  ? 511  ALA A C     1 
ATOM   3687  O  O     . ALA A 1 512  ? 11.834  4.155   147.813 1.00 61.60  ? 511  ALA A O     1 
ATOM   3688  C  CB    . ALA A 1 512  ? 13.074  2.989   149.908 1.00 59.66  ? 511  ALA A CB    1 
ATOM   3689  N  N     . ARG A 1 513  ? 9.921   3.058   148.125 1.00 66.70  ? 512  ARG A N     1 
ATOM   3690  C  CA    . ARG A 1 513  ? 9.113   3.826   147.219 1.00 68.30  ? 512  ARG A CA    1 
ATOM   3691  C  C     . ARG A 1 513  ? 7.946   4.361   148.019 1.00 72.35  ? 512  ARG A C     1 
ATOM   3692  O  O     . ARG A 1 513  ? 7.459   3.742   148.931 1.00 78.07  ? 512  ARG A O     1 
ATOM   3693  C  CB    . ARG A 1 513  ? 8.597   2.968   146.083 1.00 68.66  ? 512  ARG A CB    1 
ATOM   3694  C  CG    . ARG A 1 513  ? 9.622   2.068   145.442 1.00 67.43  ? 512  ARG A CG    1 
ATOM   3695  C  CD    . ARG A 1 513  ? 9.059   1.456   144.189 1.00 68.58  ? 512  ARG A CD    1 
ATOM   3696  N  NE    . ARG A 1 513  ? 10.088  1.240   143.207 1.00 67.66  ? 512  ARG A NE    1 
ATOM   3697  C  CZ    . ARG A 1 513  ? 10.146  0.199   142.396 1.00 67.27  ? 512  ARG A CZ    1 
ATOM   3698  N  NH1   . ARG A 1 513  ? 11.144  0.088   141.555 1.00 67.52  ? 512  ARG A NH1   1 
ATOM   3699  N  NH2   . ARG A 1 513  ? 9.219   -0.722  142.419 1.00 67.69  ? 512  ARG A NH2   1 
ATOM   3700  N  N     . GLU A 1 514  ? 7.493   5.537   147.687 1.00 77.35  ? 513  GLU A N     1 
ATOM   3701  C  CA    . GLU A 1 514  ? 6.379   6.089   148.398 1.00 84.77  ? 513  GLU A CA    1 
ATOM   3702  C  C     . GLU A 1 514  ? 5.046   5.544   147.939 1.00 95.05  ? 513  GLU A C     1 
ATOM   3703  O  O     . GLU A 1 514  ? 4.939   4.870   146.938 1.00 74.23  ? 513  GLU A O     1 
ATOM   3704  C  CB    . GLU A 1 514  ? 6.328   7.600   148.231 1.00 74.84  ? 513  GLU A CB    1 
ATOM   3705  C  CG    . GLU A 1 514  ? 7.572   8.254   147.717 1.00 68.27  ? 513  GLU A CG    1 
ATOM   3706  C  CD    . GLU A 1 514  ? 7.844   9.529   148.435 1.00 68.47  ? 513  GLU A CD    1 
ATOM   3707  O  OE1   . GLU A 1 514  ? 8.265   9.446   149.596 1.00 68.30  ? 513  GLU A OE1   1 
ATOM   3708  O  OE2   . GLU A 1 514  ? 7.632   10.603  147.858 1.00 69.38  ? 513  GLU A OE2   1 
ATOM   3709  N  N     . THR A 1 515  ? 4.038   5.826   148.736 1.00 103.95 ? 514  THR A N     1 
ATOM   3710  C  CA    . THR A 1 515  ? 2.664   5.575   148.412 1.00 112.10 ? 514  THR A CA    1 
ATOM   3711  C  C     . THR A 1 515  ? 2.091   6.865   148.936 1.00 114.44 ? 514  THR A C     1 
ATOM   3712  O  O     . THR A 1 515  ? 2.163   7.143   150.129 1.00 118.96 ? 514  THR A O     1 
ATOM   3713  C  CB    . THR A 1 515  ? 2.073   4.350   149.087 1.00 116.89 ? 514  THR A CB    1 
ATOM   3714  O  OG1   . THR A 1 515  ? 2.530   3.166   148.429 1.00 116.84 ? 514  THR A OG1   1 
ATOM   3715  C  CG2   . THR A 1 515  ? 0.568   4.421   149.026 1.00 117.83 ? 514  THR A CG2   1 
ATOM   3716  N  N     . ASN A 1 516  ? 1.541   7.661   148.045 1.00 110.44 ? 515  ASN A N     1 
ATOM   3717  C  CA    . ASN A 1 516  ? 0.999   8.927   148.442 1.00 105.41 ? 515  ASN A CA    1 
ATOM   3718  C  C     . ASN A 1 516  ? -0.437  9.119   148.017 1.00 104.45 ? 515  ASN A C     1 
ATOM   3719  O  O     . ASN A 1 516  ? -0.835  8.725   146.935 1.00 104.91 ? 515  ASN A O     1 
ATOM   3720  C  CB    . ASN A 1 516  ? 1.811   10.062  147.835 1.00 96.95  ? 515  ASN A CB    1 
ATOM   3721  C  CG    . ASN A 1 516  ? 3.094   10.321  148.563 1.00 89.72  ? 515  ASN A CG    1 
ATOM   3722  O  OD1   . ASN A 1 516  ? 4.157   10.003  148.073 1.00 85.62  ? 515  ASN A OD1   1 
ATOM   3723  N  ND2   . ASN A 1 516  ? 3.001   10.922  149.731 1.00 89.33  ? 515  ASN A ND2   1 
ATOM   3724  N  N     . GLU A 1 517  ? -1.221  9.740   148.875 1.00 123.90 ? 516  GLU A N     1 
ATOM   3725  C  CA    . GLU A 1 517  ? -2.584  10.028  148.516 1.00 128.46 ? 516  GLU A CA    1 
ATOM   3726  C  C     . GLU A 1 517  ? -2.512  11.304  147.709 1.00 127.59 ? 516  GLU A C     1 
ATOM   3727  O  O     . GLU A 1 517  ? -1.495  11.979  147.675 1.00 124.03 ? 516  GLU A O     1 
ATOM   3728  C  CB    . GLU A 1 517  ? -3.506  10.141  149.723 1.00 135.38 ? 516  GLU A CB    1 
ATOM   3729  C  CG    . GLU A 1 517  ? -4.340  8.890   149.977 1.00 139.15 ? 516  GLU A CG    1 
ATOM   3730  C  CD    . GLU A 1 517  ? -4.294  8.447   151.431 1.00 140.91 ? 516  GLU A CD    1 
ATOM   3731  O  OE1   . GLU A 1 517  ? -3.626  9.129   152.233 1.00 142.52 ? 516  GLU A OE1   1 
ATOM   3732  O  OE2   . GLU A 1 517  ? -4.917  7.422   151.778 1.00 140.00 ? 516  GLU A OE2   1 
ATOM   3733  N  N     . ASP A 1 518  ? -3.612  11.623  147.066 1.00 111.80 ? 517  ASP A N     1 
ATOM   3734  C  CA    . ASP A 1 518  ? -3.725  12.748  146.175 1.00 111.68 ? 517  ASP A CA    1 
ATOM   3735  C  C     . ASP A 1 518  ? -3.478  14.152  146.698 1.00 111.95 ? 517  ASP A C     1 
ATOM   3736  O  O     . ASP A 1 518  ? -2.989  14.979  145.955 1.00 109.89 ? 517  ASP A O     1 
ATOM   3737  C  CB    . ASP A 1 518  ? -5.030  12.640  145.428 1.00 114.32 ? 517  ASP A CB    1 
ATOM   3738  C  CG    . ASP A 1 518  ? -5.122  11.359  144.650 1.00 114.78 ? 517  ASP A CG    1 
ATOM   3739  O  OD1   . ASP A 1 518  ? -4.295  11.172  143.745 1.00 114.68 ? 517  ASP A OD1   1 
ATOM   3740  O  OD2   . ASP A 1 518  ? -6.003  10.524  144.938 1.00 117.43 ? 517  ASP A OD2   1 
ATOM   3741  N  N     . ASP A 1 519  ? -3.819  14.452  147.942 1.00 116.03 ? 518  ASP A N     1 
ATOM   3742  C  CA    . ASP A 1 519  ? -3.575  15.795  148.451 1.00 116.70 ? 518  ASP A CA    1 
ATOM   3743  C  C     . ASP A 1 519  ? -2.095  15.988  148.370 1.00 114.55 ? 518  ASP A C     1 
ATOM   3744  O  O     . ASP A 1 519  ? -1.609  17.051  148.009 1.00 117.53 ? 518  ASP A O     1 
ATOM   3745  C  CB    . ASP A 1 519  ? -3.944  15.907  149.913 1.00 118.72 ? 518  ASP A CB    1 
ATOM   3746  C  CG    . ASP A 1 519  ? -4.878  17.018  150.178 1.00 122.16 ? 518  ASP A CG    1 
ATOM   3747  O  OD1   . ASP A 1 519  ? -5.893  17.122  149.459 1.00 122.00 ? 518  ASP A OD1   1 
ATOM   3748  O  OD2   . ASP A 1 519  ? -4.589  17.796  151.109 1.00 124.41 ? 518  ASP A OD2   1 
ATOM   3749  N  N     . GLU A 1 520  ? -1.391  14.934  148.753 1.00 107.81 ? 519  GLU A N     1 
ATOM   3750  C  CA    . GLU A 1 520  ? 0.050   14.897  148.727 1.00 101.38 ? 519  GLU A CA    1 
ATOM   3751  C  C     . GLU A 1 520  ? 0.610   14.892  147.314 1.00 97.19  ? 519  GLU A C     1 
ATOM   3752  O  O     . GLU A 1 520  ? 1.557   15.606  147.024 1.00 92.70  ? 519  GLU A O     1 
ATOM   3753  C  CB    . GLU A 1 520  ? 0.544   13.686  149.506 1.00 100.81 ? 519  GLU A CB    1 
ATOM   3754  N  N     . LYS A 1 521  ? -0.003  14.101  146.435 1.00 90.75  ? 520  LYS A N     1 
ATOM   3755  C  CA    . LYS A 1 521  ? 0.477   13.994  145.069 1.00 87.61  ? 520  LYS A CA    1 
ATOM   3756  C  C     . LYS A 1 521  ? 0.399   15.322  144.434 1.00 84.90  ? 520  LYS A C     1 
ATOM   3757  O  O     . LYS A 1 521  ? 1.311   15.739  143.778 1.00 81.60  ? 520  LYS A O     1 
ATOM   3758  C  CB    . LYS A 1 521  ? -0.331  13.003  144.276 1.00 84.68  ? 520  LYS A CB    1 
ATOM   3759  C  CG    . LYS A 1 521  ? 0.106   11.589  144.528 1.00 85.77  ? 520  LYS A CG    1 
ATOM   3760  C  CD    . LYS A 1 521  ? -0.304  10.678  143.399 1.00 82.56  ? 520  LYS A CD    1 
ATOM   3761  C  CE    . LYS A 1 521  ? 0.168   9.265   143.668 1.00 84.14  ? 520  LYS A CE    1 
ATOM   3762  N  NZ    . LYS A 1 521  ? 0.631   8.560   142.442 1.00 86.71  ? 520  LYS A NZ    1 
ATOM   3763  N  N     . LYS A 1 522  ? -0.687  16.027  144.658 1.00 86.33  ? 521  LYS A N     1 
ATOM   3764  C  CA    . LYS A 1 522  ? -0.823  17.354  144.111 1.00 87.04  ? 521  LYS A CA    1 
ATOM   3765  C  C     . LYS A 1 522  ? 0.254   18.124  144.824 1.00 91.58  ? 521  LYS A C     1 
ATOM   3766  O  O     . LYS A 1 522  ? 0.782   19.093  144.317 1.00 90.78  ? 521  LYS A O     1 
ATOM   3767  C  CB    . LYS A 1 522  ? -2.193  17.943  144.408 1.00 90.49  ? 521  LYS A CB    1 
ATOM   3768  C  CG    . LYS A 1 522  ? -3.262  17.611  143.397 1.00 92.32  ? 521  LYS A CG    1 
ATOM   3769  C  CD    . LYS A 1 522  ? -4.637  17.802  144.005 1.00 95.80  ? 521  LYS A CD    1 
ATOM   3770  C  CE    . LYS A 1 522  ? -5.577  18.518  143.053 1.00 97.31  ? 521  LYS A CE    1 
ATOM   3771  N  NZ    . LYS A 1 522  ? -5.590  19.995  143.249 1.00 100.92 ? 521  LYS A NZ    1 
ATOM   3772  N  N     . ALA A 1 523  ? 0.567   17.664  146.029 1.00 97.84  ? 522  ALA A N     1 
ATOM   3773  C  CA    . ALA A 1 523  ? 1.577   18.328  146.844 1.00 95.22  ? 522  ALA A CA    1 
ATOM   3774  C  C     . ALA A 1 523  ? 2.980   18.189  146.271 1.00 89.65  ? 522  ALA A C     1 
ATOM   3775  O  O     . ALA A 1 523  ? 3.864   18.951  146.666 1.00 88.21  ? 522  ALA A O     1 
ATOM   3776  C  CB    . ALA A 1 523  ? 1.550   17.826  148.283 1.00 96.04  ? 522  ALA A CB    1 
ATOM   3777  N  N     . ILE A 1 524  ? 3.207   17.262  145.348 1.00 83.68  ? 523  ILE A N     1 
ATOM   3778  C  CA    . ILE A 1 524  ? 4.529   17.113  144.757 1.00 79.76  ? 523  ILE A CA    1 
ATOM   3779  C  C     . ILE A 1 524  ? 4.679   17.965  143.500 1.00 77.03  ? 523  ILE A C     1 
ATOM   3780  O  O     . ILE A 1 524  ? 5.713   18.610  143.306 1.00 74.49  ? 523  ILE A O     1 
ATOM   3781  C  CB    . ILE A 1 524  ? 4.793   15.620  144.481 1.00 75.01  ? 523  ILE A CB    1 
ATOM   3782  C  CG1   . ILE A 1 524  ? 4.871   14.853  145.803 1.00 74.66  ? 523  ILE A CG1   1 
ATOM   3783  C  CG2   . ILE A 1 524  ? 6.055   15.439  143.664 1.00 72.49  ? 523  ILE A CG2   1 
ATOM   3784  C  CD1   . ILE A 1 524  ? 4.972   13.353  145.650 1.00 74.03  ? 523  ILE A CD1   1 
ATOM   3785  N  N     . GLN A 1 525  ? 3.654   18.004  142.642 1.00 84.51  ? 524  GLN A N     1 
ATOM   3786  C  CA    . GLN A 1 525  ? 3.776   18.711  141.369 1.00 85.90  ? 524  GLN A CA    1 
ATOM   3787  C  C     . GLN A 1 525  ? 3.770   20.220  141.557 1.00 86.01  ? 524  GLN A C     1 
ATOM   3788  O  O     . GLN A 1 525  ? 4.436   20.937  140.801 1.00 85.70  ? 524  GLN A O     1 
ATOM   3789  C  CB    . GLN A 1 525  ? 2.664   18.277  140.409 1.00 87.38  ? 524  GLN A CB    1 
ATOM   3790  C  CG    . GLN A 1 525  ? 1.314   18.030  141.061 1.00 91.67  ? 524  GLN A CG    1 
ATOM   3791  C  CD    . GLN A 1 525  ? 0.545   16.912  140.380 1.00 96.52  ? 524  GLN A CD    1 
ATOM   3792  O  OE1   . GLN A 1 525  ? -0.455  16.413  140.902 1.00 99.62  ? 524  GLN A OE1   1 
ATOM   3793  N  NE2   . GLN A 1 525  ? 1.011   16.511  139.202 1.00 98.62  ? 524  GLN A NE2   1 
ATOM   3794  N  N     . LYS A 1 526  ? 3.119   20.680  142.600 1.00 92.44  ? 525  LYS A N     1 
ATOM   3795  C  CA    . LYS A 1 526  ? 3.112   22.080  142.892 1.00 94.18  ? 525  LYS A CA    1 
ATOM   3796  C  C     . LYS A 1 526  ? 4.526   22.514  143.180 1.00 93.24  ? 525  LYS A C     1 
ATOM   3797  O  O     . LYS A 1 526  ? 4.928   23.587  142.788 1.00 92.38  ? 525  LYS A O     1 
ATOM   3798  C  CB    . LYS A 1 526  ? 2.267   22.342  144.124 1.00 99.58  ? 525  LYS A CB    1 
ATOM   3799  C  CG    . LYS A 1 526  ? 2.463   23.729  144.724 1.00 100.52 ? 525  LYS A CG    1 
ATOM   3800  C  CD    . LYS A 1 526  ? 1.339   24.137  145.665 1.00 104.78 ? 525  LYS A CD    1 
ATOM   3801  C  CE    . LYS A 1 526  ? 1.733   25.353  146.486 1.00 109.13 ? 525  LYS A CE    1 
ATOM   3802  N  NZ    . LYS A 1 526  ? 1.037   25.373  147.800 1.00 112.07 ? 525  LYS A NZ    1 
ATOM   3803  N  N     . ILE A 1 527  ? 5.272   21.675  143.894 1.00 86.47  ? 526  ILE A N     1 
ATOM   3804  C  CA    . ILE A 1 527  ? 6.648   21.978  144.265 1.00 81.12  ? 526  ILE A CA    1 
ATOM   3805  C  C     . ILE A 1 527  ? 7.564   21.835  143.059 1.00 76.64  ? 526  ILE A C     1 
ATOM   3806  O  O     . ILE A 1 527  ? 8.366   22.726  142.759 1.00 75.45  ? 526  ILE A O     1 
ATOM   3807  C  CB    . ILE A 1 527  ? 7.111   21.078  145.431 1.00 78.13  ? 526  ILE A CB    1 
ATOM   3808  C  CG1   . ILE A 1 527  ? 6.080   21.080  146.571 1.00 78.80  ? 526  ILE A CG1   1 
ATOM   3809  C  CG2   . ILE A 1 527  ? 8.461   21.542  145.954 1.00 75.90  ? 526  ILE A CG2   1 
ATOM   3810  C  CD1   . ILE A 1 527  ? 6.600   20.566  147.913 1.00 77.42  ? 526  ILE A CD1   1 
ATOM   3811  N  N     . GLN A 1 528  ? 7.458   20.708  142.347 1.00 72.38  ? 527  GLN A N     1 
ATOM   3812  C  CA    . GLN A 1 528  ? 8.257   20.515  141.140 1.00 70.88  ? 527  GLN A CA    1 
ATOM   3813  C  C     . GLN A 1 528  ? 8.000   21.615  140.121 1.00 72.14  ? 527  GLN A C     1 
ATOM   3814  O  O     . GLN A 1 528  ? 8.899   21.974  139.354 1.00 70.86  ? 527  GLN A O     1 
ATOM   3815  C  CB    . GLN A 1 528  ? 7.961   19.147  140.528 1.00 70.71  ? 527  GLN A CB    1 
ATOM   3816  C  CG    . GLN A 1 528  ? 8.327   17.981  141.422 1.00 69.39  ? 527  GLN A CG    1 
ATOM   3817  C  CD    . GLN A 1 528  ? 8.099   16.643  140.754 1.00 69.28  ? 527  GLN A CD    1 
ATOM   3818  O  OE1   . GLN A 1 528  ? 7.339   16.543  139.795 1.00 70.73  ? 527  GLN A OE1   1 
ATOM   3819  N  NE2   . GLN A 1 528  ? 8.767   15.606  141.250 1.00 67.65  ? 527  GLN A NE2   1 
ATOM   3820  N  N     . LYS A 1 529  ? 6.787   22.163  140.103 1.00 79.57  ? 528  LYS A N     1 
ATOM   3821  C  CA    . LYS A 1 529  ? 6.493   23.273  139.206 1.00 80.07  ? 528  LYS A CA    1 
ATOM   3822  C  C     . LYS A 1 529  ? 7.058   24.583  139.744 1.00 82.87  ? 528  LYS A C     1 
ATOM   3823  O  O     . LYS A 1 529  ? 7.519   25.429  138.970 1.00 83.11  ? 528  LYS A O     1 
ATOM   3824  C  CB    . LYS A 1 529  ? 4.982   23.360  138.980 1.00 82.81  ? 528  LYS A CB    1 
ATOM   3825  C  CG    . LYS A 1 529  ? 4.441   24.744  138.652 1.00 85.74  ? 528  LYS A CG    1 
ATOM   3826  C  CD    . LYS A 1 529  ? 2.922   24.726  138.649 1.00 88.41  ? 528  LYS A CD    1 
ATOM   3827  C  CE    . LYS A 1 529  ? 2.370   26.136  138.602 1.00 89.65  ? 528  LYS A CE    1 
ATOM   3828  N  NZ    . LYS A 1 529  ? 3.378   27.076  138.080 1.00 87.23  ? 528  LYS A NZ    1 
ATOM   3829  N  N     . ALA A 1 530  ? 7.054   24.761  141.065 1.00 76.10  ? 529  ALA A N     1 
ATOM   3830  C  CA    . ALA A 1 530  ? 7.683   25.941  141.645 1.00 75.88  ? 529  ALA A CA    1 
ATOM   3831  C  C     . ALA A 1 530  ? 9.185   25.934  141.414 1.00 73.16  ? 529  ALA A C     1 
ATOM   3832  O  O     . ALA A 1 530  ? 9.804   26.999  141.317 1.00 73.03  ? 529  ALA A O     1 
ATOM   3833  C  CB    . ALA A 1 530  ? 7.374   26.020  143.138 1.00 76.46  ? 529  ALA A CB    1 
ATOM   3834  N  N     . ASN A 1 531  ? 9.783   24.747  141.327 1.00 71.68  ? 530  ASN A N     1 
ATOM   3835  C  CA    . ASN A 1 531  ? 11.204  24.649  141.027 1.00 69.16  ? 530  ASN A CA    1 
ATOM   3836  C  C     . ASN A 1 531  ? 11.499  25.139  139.616 1.00 71.90  ? 530  ASN A C     1 
ATOM   3837  O  O     . ASN A 1 531  ? 12.390  25.970  139.411 1.00 69.85  ? 530  ASN A O     1 
ATOM   3838  C  CB    . ASN A 1 531  ? 11.673  23.209  141.211 1.00 73.31  ? 530  ASN A CB    1 
ATOM   3839  C  CG    . ASN A 1 531  ? 11.970  22.877  142.657 1.00 69.72  ? 530  ASN A CG    1 
ATOM   3840  O  OD1   . ASN A 1 531  ? 12.479  23.713  143.398 1.00 69.15  ? 530  ASN A OD1   1 
ATOM   3841  N  ND2   . ASN A 1 531  ? 11.654  21.654  143.065 1.00 68.08  ? 530  ASN A ND2   1 
ATOM   3842  N  N     . LYS A 1 532  ? 10.748  24.642  138.629 1.00 71.51  ? 531  LYS A N     1 
ATOM   3843  C  CA    . LYS A 1 532  ? 10.958  25.070  137.252 1.00 70.23  ? 531  LYS A CA    1 
ATOM   3844  C  C     . LYS A 1 532  ? 10.606  26.538  137.062 1.00 72.35  ? 531  LYS A C     1 
ATOM   3845  O  O     . LYS A 1 532  ? 11.132  27.187  136.151 1.00 73.28  ? 531  LYS A O     1 
ATOM   3846  C  CB    . LYS A 1 532  ? 10.137  24.198  136.303 1.00 71.57  ? 531  LYS A CB    1 
ATOM   3847  C  CG    . LYS A 1 532  ? 10.402  24.459  134.836 1.00 72.38  ? 531  LYS A CG    1 
ATOM   3848  C  CD    . LYS A 1 532  ? 9.604   23.510  133.949 1.00 73.86  ? 531  LYS A CD    1 
ATOM   3849  C  CE    . LYS A 1 532  ? 9.790   23.840  132.470 1.00 73.85  ? 531  LYS A CE    1 
ATOM   3850  N  NZ    . LYS A 1 532  ? 11.229  23.849  132.087 1.00 71.55  ? 531  LYS A NZ    1 
ATOM   3851  N  N     . ASP A 1 533  ? 9.728   27.078  137.911 1.00 73.70  ? 532  ASP A N     1 
ATOM   3852  C  CA    . ASP A 1 533  ? 9.290   28.461  137.750 1.00 75.83  ? 532  ASP A CA    1 
ATOM   3853  C  C     . ASP A 1 533  ? 10.403  29.447  138.079 1.00 74.84  ? 532  ASP A C     1 
ATOM   3854  O  O     . ASP A 1 533  ? 10.557  30.467  137.396 1.00 75.80  ? 532  ASP A O     1 
ATOM   3855  C  CB    . ASP A 1 533  ? 8.071   28.731  138.626 1.00 78.15  ? 532  ASP A CB    1 
ATOM   3856  C  CG    . ASP A 1 533  ? 6.777   28.344  137.956 1.00 80.26  ? 532  ASP A CG    1 
ATOM   3857  O  OD1   . ASP A 1 533  ? 6.632   28.611  136.745 1.00 81.02  ? 532  ASP A OD1   1 
ATOM   3858  O  OD2   . ASP A 1 533  ? 5.903   27.776  138.641 1.00 81.25  ? 532  ASP A OD2   1 
ATOM   3859  N  N     . GLU A 1 534  ? 11.184  29.174  139.127 1.00 78.15  ? 533  GLU A N     1 
ATOM   3860  C  CA    . GLU A 1 534  ? 12.201  30.137  139.523 1.00 79.58  ? 533  GLU A CA    1 
ATOM   3861  C  C     . GLU A 1 534  ? 13.446  30.054  138.657 1.00 75.45  ? 533  GLU A C     1 
ATOM   3862  O  O     . GLU A 1 534  ? 14.191  31.036  138.572 1.00 74.70  ? 533  GLU A O     1 
ATOM   3863  C  CB    . GLU A 1 534  ? 12.561  29.975  141.003 1.00 82.27  ? 533  GLU A CB    1 
ATOM   3864  C  CG    . GLU A 1 534  ? 12.956  28.586  141.453 1.00 81.74  ? 533  GLU A CG    1 
ATOM   3865  C  CD    . GLU A 1 534  ? 13.429  28.574  142.903 1.00 80.30  ? 533  GLU A CD    1 
ATOM   3866  O  OE1   . GLU A 1 534  ? 14.219  29.468  143.276 1.00 78.64  ? 533  GLU A OE1   1 
ATOM   3867  O  OE2   . GLU A 1 534  ? 13.002  27.683  143.671 1.00 82.28  ? 533  GLU A OE2   1 
ATOM   3868  N  N     . LYS A 1 535  ? 13.684  28.922  137.997 1.00 71.80  ? 534  LYS A N     1 
ATOM   3869  C  CA    . LYS A 1 535  ? 14.762  28.880  137.020 1.00 71.44  ? 534  LYS A CA    1 
ATOM   3870  C  C     . LYS A 1 535  ? 14.446  29.804  135.850 1.00 75.90  ? 534  LYS A C     1 
ATOM   3871  O  O     . LYS A 1 535  ? 15.248  30.674  135.497 1.00 76.83  ? 534  LYS A O     1 
ATOM   3872  C  CB    . LYS A 1 535  ? 14.988  27.447  136.540 1.00 69.50  ? 534  LYS A CB    1 
ATOM   3873  C  CG    . LYS A 1 535  ? 14.872  26.414  137.634 1.00 68.81  ? 534  LYS A CG    1 
ATOM   3874  C  CD    . LYS A 1 535  ? 14.689  25.022  137.070 1.00 67.59  ? 534  LYS A CD    1 
ATOM   3875  C  CE    . LYS A 1 535  ? 16.016  24.389  136.717 1.00 63.35  ? 534  LYS A CE    1 
ATOM   3876  N  NZ    . LYS A 1 535  ? 15.813  23.126  135.961 1.00 61.93  ? 534  LYS A NZ    1 
ATOM   3877  N  N     . ASP A 1 536  ? 13.257  29.649  135.254 1.00 82.46  ? 535  ASP A N     1 
ATOM   3878  C  CA    . ASP A 1 536  ? 12.795  30.603  134.251 1.00 83.66  ? 535  ASP A CA    1 
ATOM   3879  C  C     . ASP A 1 536  ? 12.820  32.026  134.792 1.00 84.54  ? 535  ASP A C     1 
ATOM   3880  O  O     . ASP A 1 536  ? 13.262  32.954  134.104 1.00 82.65  ? 535  ASP A O     1 
ATOM   3881  C  CB    . ASP A 1 536  ? 11.383  30.242  133.793 1.00 86.65  ? 535  ASP A CB    1 
ATOM   3882  C  CG    . ASP A 1 536  ? 11.306  28.869  133.158 1.00 87.50  ? 535  ASP A CG    1 
ATOM   3883  O  OD1   . ASP A 1 536  ? 12.291  28.457  132.514 1.00 86.62  ? 535  ASP A OD1   1 
ATOM   3884  O  OD2   . ASP A 1 536  ? 10.258  28.204  133.297 1.00 89.36  ? 535  ASP A OD2   1 
ATOM   3885  N  N     . ALA A 1 537  ? 12.348  32.216  136.029 1.00 80.42  ? 536  ALA A N     1 
ATOM   3886  C  CA    . ALA A 1 537  ? 12.329  33.550  136.619 1.00 76.62  ? 536  ALA A CA    1 
ATOM   3887  C  C     . ALA A 1 537  ? 13.736  34.108  136.753 1.00 75.03  ? 536  ALA A C     1 
ATOM   3888  O  O     . ALA A 1 537  ? 13.956  35.310  136.569 1.00 76.30  ? 536  ALA A O     1 
ATOM   3889  C  CB    . ALA A 1 537  ? 11.632  33.513  137.975 1.00 77.44  ? 536  ALA A CB    1 
ATOM   3890  N  N     . ALA A 1 538  ? 14.704  33.244  137.065 1.00 73.61  ? 537  ALA A N     1 
ATOM   3891  C  CA    . ALA A 1 538  ? 16.089  33.680  137.192 1.00 72.35  ? 537  ALA A CA    1 
ATOM   3892  C  C     . ALA A 1 538  ? 16.708  33.965  135.834 1.00 70.87  ? 537  ALA A C     1 
ATOM   3893  O  O     . ALA A 1 538  ? 17.454  34.937  135.680 1.00 70.81  ? 537  ALA A O     1 
ATOM   3894  C  CB    . ALA A 1 538  ? 16.901  32.621  137.928 1.00 68.12  ? 537  ALA A CB    1 
ATOM   3895  N  N     . MET A 1 539  ? 16.423  33.116  134.841 1.00 80.03  ? 538  MET A N     1 
ATOM   3896  C  CA    . MET A 1 539  ? 16.938  33.341  133.493 1.00 82.30  ? 538  MET A CA    1 
ATOM   3897  C  C     . MET A 1 539  ? 16.328  34.595  132.879 1.00 85.06  ? 538  MET A C     1 
ATOM   3898  O  O     . MET A 1 539  ? 17.039  35.428  132.305 1.00 82.08  ? 538  MET A O     1 
ATOM   3899  C  CB    . MET A 1 539  ? 16.653  32.128  132.607 1.00 87.94  ? 538  MET A CB    1 
ATOM   3900  C  CG    . MET A 1 539  ? 17.122  30.803  133.161 1.00 89.28  ? 538  MET A CG    1 
ATOM   3901  S  SD    . MET A 1 539  ? 18.853  30.816  133.623 1.00 92.12  ? 538  MET A SD    1 
ATOM   3902  C  CE    . MET A 1 539  ? 19.608  31.140  132.035 1.00 92.03  ? 538  MET A CE    1 
ATOM   3903  N  N     . LEU A 1 540  ? 15.002  34.733  132.977 1.00 77.52  ? 539  LEU A N     1 
ATOM   3904  C  CA    . LEU A 1 540  ? 14.332  35.933  132.487 1.00 77.80  ? 539  LEU A CA    1 
ATOM   3905  C  C     . LEU A 1 540  ? 14.960  37.182  133.078 1.00 78.38  ? 539  LEU A C     1 
ATOM   3906  O  O     . LEU A 1 540  ? 15.209  38.166  132.372 1.00 79.69  ? 539  LEU A O     1 
ATOM   3907  C  CB    . LEU A 1 540  ? 12.844  35.874  132.839 1.00 79.93  ? 539  LEU A CB    1 
ATOM   3908  C  CG    . LEU A 1 540  ? 11.778  36.540  131.957 1.00 82.89  ? 539  LEU A CG    1 
ATOM   3909  C  CD1   . LEU A 1 540  ? 10.416  36.298  132.573 1.00 84.62  ? 539  LEU A CD1   1 
ATOM   3910  C  CD2   . LEU A 1 540  ? 12.007  38.025  131.756 1.00 84.73  ? 539  LEU A CD2   1 
ATOM   3911  N  N     . LYS A 1 541  ? 15.239  37.147  134.376 1.00 77.47  ? 540  LYS A N     1 
ATOM   3912  C  CA    . LYS A 1 541  ? 15.803  38.306  135.043 1.00 78.11  ? 540  LYS A CA    1 
ATOM   3913  C  C     . LYS A 1 541  ? 17.251  38.528  134.641 1.00 76.45  ? 540  LYS A C     1 
ATOM   3914  O  O     . LYS A 1 541  ? 17.665  39.663  134.402 1.00 77.67  ? 540  LYS A O     1 
ATOM   3915  C  CB    . LYS A 1 541  ? 15.683  38.122  136.541 1.00 77.60  ? 540  LYS A CB    1 
ATOM   3916  C  CG    . LYS A 1 541  ? 16.211  39.259  137.322 1.00 78.32  ? 540  LYS A CG    1 
ATOM   3917  C  CD    . LYS A 1 541  ? 15.767  39.091  138.727 1.00 78.42  ? 540  LYS A CD    1 
ATOM   3918  C  CE    . LYS A 1 541  ? 16.377  40.131  139.580 1.00 78.96  ? 540  LYS A CE    1 
ATOM   3919  N  NZ    . LYS A 1 541  ? 16.838  39.506  140.845 1.00 77.08  ? 540  LYS A NZ    1 
ATOM   3920  N  N     . ALA A 1 542  ? 18.044  37.462  134.566 1.00 73.79  ? 541  ALA A N     1 
ATOM   3921  C  CA    . ALA A 1 542  ? 19.400  37.619  134.057 1.00 72.35  ? 541  ALA A CA    1 
ATOM   3922  C  C     . ALA A 1 542  ? 19.375  38.196  132.651 1.00 73.74  ? 541  ALA A C     1 
ATOM   3923  O  O     . ALA A 1 542  ? 20.215  39.030  132.295 1.00 74.03  ? 541  ALA A O     1 
ATOM   3924  C  CB    . ALA A 1 542  ? 20.133  36.280  134.079 1.00 69.50  ? 541  ALA A CB    1 
ATOM   3925  N  N     . ALA A 1 543  ? 18.392  37.785  131.851 1.00 74.78  ? 542  ALA A N     1 
ATOM   3926  C  CA    . ALA A 1 543  ? 18.299  38.250  130.473 1.00 76.17  ? 542  ALA A CA    1 
ATOM   3927  C  C     . ALA A 1 543  ? 18.041  39.751  130.403 1.00 78.82  ? 542  ALA A C     1 
ATOM   3928  O  O     . ALA A 1 543  ? 18.718  40.471  129.661 1.00 79.37  ? 542  ALA A O     1 
ATOM   3929  C  CB    . ALA A 1 543  ? 17.203  37.478  129.745 1.00 76.88  ? 542  ALA A CB    1 
ATOM   3930  N  N     . ASN A 1 544  ? 17.062  40.245  131.167 1.00 80.64  ? 543  ASN A N     1 
ATOM   3931  C  CA    . ASN A 1 544  ? 16.736  41.664  131.093 1.00 83.43  ? 543  ASN A CA    1 
ATOM   3932  C  C     . ASN A 1 544  ? 17.833  42.506  131.714 1.00 83.03  ? 543  ASN A C     1 
ATOM   3933  O  O     . ASN A 1 544  ? 18.126  43.604  131.232 1.00 84.71  ? 543  ASN A O     1 
ATOM   3934  C  CB    . ASN A 1 544  ? 15.403  41.963  131.772 1.00 85.61  ? 543  ASN A CB    1 
ATOM   3935  C  CG    . ASN A 1 544  ? 14.335  40.944  131.448 1.00 85.68  ? 543  ASN A CG    1 
ATOM   3936  O  OD1   . ASN A 1 544  ? 13.512  40.617  132.303 1.00 86.11  ? 543  ASN A OD1   1 
ATOM   3937  N  ND2   . ASN A 1 544  ? 14.334  40.441  130.215 1.00 85.37  ? 543  ASN A ND2   1 
ATOM   3938  N  N     . GLN A 1 545  ? 18.439  42.018  132.792 1.00 80.95  ? 544  GLN A N     1 
ATOM   3939  C  CA    . GLN A 1 545  ? 19.544  42.740  133.407 1.00 80.44  ? 544  GLN A CA    1 
ATOM   3940  C  C     . GLN A 1 545  ? 20.734  42.828  132.468 1.00 85.94  ? 544  GLN A C     1 
ATOM   3941  O  O     . GLN A 1 545  ? 21.450  43.834  132.462 1.00 86.50  ? 544  GLN A O     1 
ATOM   3942  C  CB    . GLN A 1 545  ? 19.935  42.056  134.714 1.00 78.31  ? 544  GLN A CB    1 
ATOM   3943  C  CG    . GLN A 1 545  ? 18.801  42.007  135.729 1.00 79.43  ? 544  GLN A CG    1 
ATOM   3944  C  CD    . GLN A 1 545  ? 19.176  42.636  137.035 1.00 79.61  ? 544  GLN A CD    1 
ATOM   3945  O  OE1   . GLN A 1 545  ? 20.354  42.658  137.423 1.00 77.96  ? 544  GLN A OE1   1 
ATOM   3946  N  NE2   . GLN A 1 545  ? 18.175  43.147  137.741 1.00 81.70  ? 544  GLN A NE2   1 
ATOM   3947  N  N     . TYR A 1 546  ? 20.946  41.799  131.658 1.00 93.50  ? 545  TYR A N     1 
ATOM   3948  C  CA    . TYR A 1 546  ? 22.094  41.756  130.752 1.00 96.54  ? 545  TYR A CA    1 
ATOM   3949  C  C     . TYR A 1 546  ? 21.712  42.324  129.390 1.00 99.91  ? 545  TYR A C     1 
ATOM   3950  O  O     . TYR A 1 546  ? 22.118  43.433  129.034 1.00 102.95 ? 545  TYR A O     1 
ATOM   3951  C  CB    . TYR A 1 546  ? 22.608  40.321  130.645 1.00 98.36  ? 545  TYR A CB    1 
ATOM   3952  C  CG    . TYR A 1 546  ? 23.915  40.187  129.908 1.00 100.72 ? 545  TYR A CG    1 
ATOM   3953  C  CD1   . TYR A 1 546  ? 24.995  41.001  130.217 1.00 101.99 ? 545  TYR A CD1   1 
ATOM   3954  C  CD2   . TYR A 1 546  ? 24.076  39.235  128.913 1.00 100.52 ? 545  TYR A CD2   1 
ATOM   3955  C  CE1   . TYR A 1 546  ? 26.194  40.879  129.548 1.00 101.76 ? 545  TYR A CE1   1 
ATOM   3956  C  CE2   . TYR A 1 546  ? 25.271  39.104  128.240 1.00 100.34 ? 545  TYR A CE2   1 
ATOM   3957  C  CZ    . TYR A 1 546  ? 26.326  39.928  128.563 1.00 101.39 ? 545  TYR A CZ    1 
ATOM   3958  O  OH    . TYR A 1 546  ? 27.522  39.808  127.899 1.00 101.74 ? 545  TYR A OH    1 
ATOM   3959  N  N     . ASN A 1 547  ? 20.917  41.570  128.626 1.00 95.22  ? 546  ASN A N     1 
ATOM   3960  C  CA    . ASN A 1 547  ? 20.561  41.940  127.262 1.00 92.26  ? 546  ASN A CA    1 
ATOM   3961  C  C     . ASN A 1 547  ? 19.487  43.011  127.189 1.00 92.87  ? 546  ASN A C     1 
ATOM   3962  O  O     . ASN A 1 547  ? 19.384  43.702  126.169 1.00 91.91  ? 546  ASN A O     1 
ATOM   3963  C  CB    . ASN A 1 547  ? 20.065  40.709  126.505 1.00 89.29  ? 546  ASN A CB    1 
ATOM   3964  C  CG    . ASN A 1 547  ? 21.040  40.243  125.467 1.00 86.02  ? 546  ASN A CG    1 
ATOM   3965  O  OD1   . ASN A 1 547  ? 22.120  40.810  125.320 1.00 84.74  ? 546  ASN A OD1   1 
ATOM   3966  N  ND2   . ASN A 1 547  ? 20.668  39.205  124.730 1.00 84.90  ? 546  ASN A ND2   1 
ATOM   3967  N  N     . GLY A 1 548  ? 18.681  43.160  128.233 1.00 89.37  ? 547  GLY A N     1 
ATOM   3968  C  CA    . GLY A 1 548  ? 17.426  43.858  128.115 1.00 91.10  ? 547  GLY A CA    1 
ATOM   3969  C  C     . GLY A 1 548  ? 16.336  43.046  127.460 1.00 88.72  ? 547  GLY A C     1 
ATOM   3970  O  O     . GLY A 1 548  ? 15.156  43.372  127.627 1.00 90.23  ? 547  GLY A O     1 
ATOM   3971  N  N     . LYS A 1 549  ? 16.691  41.996  126.724 1.00 86.12  ? 548  LYS A N     1 
ATOM   3972  C  CA    . LYS A 1 549  ? 15.711  41.103  126.132 1.00 86.37  ? 548  LYS A CA    1 
ATOM   3973  C  C     . LYS A 1 549  ? 15.271  40.074  127.170 1.00 84.82  ? 548  LYS A C     1 
ATOM   3974  O  O     . LYS A 1 549  ? 15.712  40.086  128.320 1.00 83.61  ? 548  LYS A O     1 
ATOM   3975  C  CB    . LYS A 1 549  ? 16.282  40.438  124.880 1.00 85.19  ? 548  LYS A CB    1 
ATOM   3976  N  N     . ALA A 1 550  ? 14.382  39.170  126.764 1.00 92.78  ? 549  ALA A N     1 
ATOM   3977  C  CA    . ALA A 1 550  ? 13.815  38.179  127.666 1.00 92.05  ? 549  ALA A CA    1 
ATOM   3978  C  C     . ALA A 1 550  ? 14.486  36.818  127.534 1.00 89.73  ? 549  ALA A C     1 
ATOM   3979  O  O     . ALA A 1 550  ? 13.919  35.810  127.968 1.00 89.03  ? 549  ALA A O     1 
ATOM   3980  C  CB    . ALA A 1 550  ? 12.310  38.053  127.431 1.00 93.99  ? 549  ALA A CB    1 
ATOM   3981  N  N     . GLU A 1 551  ? 15.682  36.770  126.952 1.00 90.27  ? 550  GLU A N     1 
ATOM   3982  C  CA    . GLU A 1 551  ? 16.382  35.518  126.718 1.00 90.69  ? 550  GLU A CA    1 
ATOM   3983  C  C     . GLU A 1 551  ? 17.875  35.797  126.637 1.00 88.76  ? 550  GLU A C     1 
ATOM   3984  O  O     . GLU A 1 551  ? 18.299  36.846  126.147 1.00 89.12  ? 550  GLU A O     1 
ATOM   3985  C  CB    . GLU A 1 551  ? 15.883  34.839  125.438 1.00 96.06  ? 550  GLU A CB    1 
ATOM   3986  C  CG    . GLU A 1 551  ? 16.693  33.644  124.980 1.00 96.69  ? 550  GLU A CG    1 
ATOM   3987  C  CD    . GLU A 1 551  ? 15.852  32.645  124.211 1.00 99.03  ? 550  GLU A CD    1 
ATOM   3988  O  OE1   . GLU A 1 551  ? 14.871  32.131  124.789 1.00 100.28 ? 550  GLU A OE1   1 
ATOM   3989  O  OE2   . GLU A 1 551  ? 16.159  32.386  123.027 1.00 101.67 ? 550  GLU A OE2   1 
ATOM   3990  N  N     . LEU A 1 552  ? 18.665  34.857  127.137 1.00 84.14  ? 551  LEU A N     1 
ATOM   3991  C  CA    . LEU A 1 552  ? 20.096  35.090  127.011 1.00 80.61  ? 551  LEU A CA    1 
ATOM   3992  C  C     . LEU A 1 552  ? 20.629  34.463  125.725 1.00 79.06  ? 551  LEU A C     1 
ATOM   3993  O  O     . LEU A 1 552  ? 20.203  33.370  125.343 1.00 81.52  ? 551  LEU A O     1 
ATOM   3994  C  CB    . LEU A 1 552  ? 20.844  34.516  128.211 1.00 77.02  ? 551  LEU A CB    1 
ATOM   3995  C  CG    . LEU A 1 552  ? 20.814  35.404  129.454 1.00 75.89  ? 551  LEU A CG    1 
ATOM   3996  C  CD1   . LEU A 1 552  ? 21.517  34.741  130.610 1.00 74.26  ? 551  LEU A CD1   1 
ATOM   3997  C  CD2   . LEU A 1 552  ? 21.450  36.746  129.155 1.00 75.06  ? 551  LEU A CD2   1 
ATOM   3998  N  N     . PRO A 1 553  ? 21.558  35.141  125.056 1.00 70.55  ? 552  PRO A N     1 
ATOM   3999  C  CA    . PRO A 1 553  ? 22.139  34.581  123.833 1.00 72.80  ? 552  PRO A CA    1 
ATOM   4000  C  C     . PRO A 1 553  ? 22.880  33.291  124.125 1.00 71.56  ? 552  PRO A C     1 
ATOM   4001  O  O     . PRO A 1 553  ? 23.561  33.167  125.142 1.00 65.74  ? 552  PRO A O     1 
ATOM   4002  C  CB    . PRO A 1 553  ? 23.097  35.680  123.366 1.00 70.58  ? 552  PRO A CB    1 
ATOM   4003  C  CG    . PRO A 1 553  ? 23.447  36.416  124.608 1.00 70.39  ? 552  PRO A CG    1 
ATOM   4004  C  CD    . PRO A 1 553  ? 22.194  36.414  125.429 1.00 71.29  ? 552  PRO A CD    1 
ATOM   4005  N  N     . HIS A 1 554  ? 22.758  32.326  123.214 1.00 73.65  ? 553  HIS A N     1 
ATOM   4006  C  CA    . HIS A 1 554  ? 23.439  31.055  123.413 1.00 72.75  ? 553  HIS A CA    1 
ATOM   4007  C  C     . HIS A 1 554  ? 24.954  31.204  123.431 1.00 70.26  ? 553  HIS A C     1 
ATOM   4008  O  O     . HIS A 1 554  ? 25.646  30.272  123.855 1.00 69.38  ? 553  HIS A O     1 
ATOM   4009  C  CB    . HIS A 1 554  ? 23.020  30.059  122.332 1.00 79.52  ? 553  HIS A CB    1 
ATOM   4010  C  CG    . HIS A 1 554  ? 22.989  28.641  122.806 1.00 84.47  ? 553  HIS A CG    1 
ATOM   4011  N  ND1   . HIS A 1 554  ? 22.329  28.258  123.954 1.00 87.96  ? 553  HIS A ND1   1 
ATOM   4012  C  CD2   . HIS A 1 554  ? 23.540  27.515  122.295 1.00 86.35  ? 553  HIS A CD2   1 
ATOM   4013  C  CE1   . HIS A 1 554  ? 22.474  26.957  124.129 1.00 87.15  ? 553  HIS A CE1   1 
ATOM   4014  N  NE2   . HIS A 1 554  ? 23.204  26.482  123.135 1.00 86.88  ? 553  HIS A NE2   1 
ATOM   4015  N  N     . SER A 1 555  ? 25.480  32.353  122.999 1.00 72.07  ? 554  SER A N     1 
ATOM   4016  C  CA    . SER A 1 555  ? 26.921  32.574  123.014 1.00 70.46  ? 554  SER A CA    1 
ATOM   4017  C  C     . SER A 1 555  ? 27.485  32.545  124.430 1.00 69.26  ? 554  SER A C     1 
ATOM   4018  O  O     . SER A 1 555  ? 28.660  32.215  124.623 1.00 69.53  ? 554  SER A O     1 
ATOM   4019  C  CB    . SER A 1 555  ? 27.252  33.912  122.350 1.00 73.78  ? 554  SER A CB    1 
ATOM   4020  O  OG    . SER A 1 555  ? 26.914  33.917  120.972 1.00 76.24  ? 554  SER A OG    1 
ATOM   4021  N  N     . VAL A 1 556  ? 26.673  32.886  125.434 1.00 64.90  ? 555  VAL A N     1 
ATOM   4022  C  CA    . VAL A 1 556  ? 27.208  33.035  126.786 1.00 62.11  ? 555  VAL A CA    1 
ATOM   4023  C  C     . VAL A 1 556  ? 27.341  31.716  127.528 1.00 58.81  ? 555  VAL A C     1 
ATOM   4024  O  O     . VAL A 1 556  ? 28.037  31.666  128.548 1.00 57.53  ? 555  VAL A O     1 
ATOM   4025  C  CB    . VAL A 1 556  ? 26.352  34.001  127.628 1.00 62.40  ? 555  VAL A CB    1 
ATOM   4026  C  CG1   . VAL A 1 556  ? 26.218  35.345  126.928 1.00 64.65  ? 555  VAL A CG1   1 
ATOM   4027  C  CG2   . VAL A 1 556  ? 24.992  33.407  127.915 1.00 62.89  ? 555  VAL A CG2   1 
ATOM   4028  N  N     . PHE A 1 557  ? 26.718  30.643  127.050 1.00 58.49  ? 556  PHE A N     1 
ATOM   4029  C  CA    . PHE A 1 557  ? 26.779  29.352  127.721 1.00 56.71  ? 556  PHE A CA    1 
ATOM   4030  C  C     . PHE A 1 557  ? 27.917  28.469  127.223 1.00 55.08  ? 556  PHE A C     1 
ATOM   4031  O  O     . PHE A 1 557  ? 27.989  27.305  127.620 1.00 53.70  ? 556  PHE A O     1 
ATOM   4032  C  CB    . PHE A 1 557  ? 25.459  28.593  127.552 1.00 57.35  ? 556  PHE A CB    1 
ATOM   4033  C  CG    . PHE A 1 557  ? 24.334  29.113  128.397 1.00 58.57  ? 556  PHE A CG    1 
ATOM   4034  C  CD1   . PHE A 1 557  ? 23.514  30.128  127.940 1.00 60.74  ? 556  PHE A CD1   1 
ATOM   4035  C  CD2   . PHE A 1 557  ? 24.079  28.568  129.640 1.00 57.66  ? 556  PHE A CD2   1 
ATOM   4036  C  CE1   . PHE A 1 557  ? 22.477  30.599  128.721 1.00 61.99  ? 556  PHE A CE1   1 
ATOM   4037  C  CE2   . PHE A 1 557  ? 23.037  29.037  130.419 1.00 58.90  ? 556  PHE A CE2   1 
ATOM   4038  C  CZ    . PHE A 1 557  ? 22.241  30.051  129.962 1.00 61.07  ? 556  PHE A CZ    1 
ATOM   4039  N  N     . HIS A 1 558  ? 28.793  28.974  126.358 1.00 61.15  ? 557  HIS A N     1 
ATOM   4040  C  CA    . HIS A 1 558  ? 29.831  28.129  125.780 1.00 63.10  ? 557  HIS A CA    1 
ATOM   4041  C  C     . HIS A 1 558  ? 31.019  28.038  126.724 1.00 61.74  ? 557  HIS A C     1 
ATOM   4042  O  O     . HIS A 1 558  ? 31.610  29.056  127.092 1.00 59.43  ? 557  HIS A O     1 
ATOM   4043  C  CB    . HIS A 1 558  ? 30.281  28.661  124.420 1.00 72.13  ? 557  HIS A CB    1 
ATOM   4044  C  CG    . HIS A 1 558  ? 31.224  27.744  123.701 1.00 77.86  ? 557  HIS A CG    1 
ATOM   4045  N  ND1   . HIS A 1 558  ? 32.561  28.033  123.529 1.00 80.01  ? 557  HIS A ND1   1 
ATOM   4046  C  CD2   . HIS A 1 558  ? 31.023  26.538  123.118 1.00 80.64  ? 557  HIS A CD2   1 
ATOM   4047  C  CE1   . HIS A 1 558  ? 33.142  27.048  122.868 1.00 80.49  ? 557  HIS A CE1   1 
ATOM   4048  N  NE2   . HIS A 1 558  ? 32.231  26.128  122.608 1.00 80.15  ? 557  HIS A NE2   1 
ATOM   4049  N  N     . GLY A 1 559  ? 31.383  26.813  127.093 1.00 53.81  ? 558  GLY A N     1 
ATOM   4050  C  CA    . GLY A 1 559  ? 32.370  26.619  128.133 1.00 52.20  ? 558  GLY A CA    1 
ATOM   4051  C  C     . GLY A 1 559  ? 31.899  27.062  129.496 1.00 49.24  ? 558  GLY A C     1 
ATOM   4052  O  O     . GLY A 1 559  ? 32.722  27.369  130.363 1.00 48.45  ? 558  GLY A O     1 
ATOM   4053  N  N     . HIS A 1 560  ? 30.584  27.110  129.700 1.00 54.73  ? 559  HIS A N     1 
ATOM   4054  C  CA    . HIS A 1 560  ? 29.982  27.626  130.916 1.00 55.04  ? 559  HIS A CA    1 
ATOM   4055  C  C     . HIS A 1 560  ? 28.543  27.141  131.013 1.00 57.98  ? 559  HIS A C     1 
ATOM   4056  O  O     . HIS A 1 560  ? 27.620  27.941  131.177 1.00 60.88  ? 559  HIS A O     1 
ATOM   4057  C  CB    . HIS A 1 560  ? 30.046  29.152  130.935 1.00 58.19  ? 559  HIS A CB    1 
ATOM   4058  C  CG    . HIS A 1 560  ? 29.754  29.752  132.274 1.00 59.21  ? 559  HIS A CG    1 
ATOM   4059  N  ND1   . HIS A 1 560  ? 29.992  31.078  132.562 1.00 60.87  ? 559  HIS A ND1   1 
ATOM   4060  C  CD2   . HIS A 1 560  ? 29.246  29.207  133.403 1.00 57.80  ? 559  HIS A CD2   1 
ATOM   4061  C  CE1   . HIS A 1 560  ? 29.636  31.324  133.808 1.00 61.04  ? 559  HIS A CE1   1 
ATOM   4062  N  NE2   . HIS A 1 560  ? 29.181  30.205  134.341 1.00 59.34  ? 559  HIS A NE2   1 
ATOM   4063  N  N     . LYS A 1 561  ? 28.345  25.829  130.904 1.00 54.07  ? 560  LYS A N     1 
ATOM   4064  C  CA    . LYS A 1 561  ? 27.010  25.261  130.994 1.00 55.65  ? 560  LYS A CA    1 
ATOM   4065  C  C     . LYS A 1 561  ? 26.414  25.396  132.392 1.00 55.20  ? 560  LYS A C     1 
ATOM   4066  O  O     . LYS A 1 561  ? 25.196  25.291  132.555 1.00 57.80  ? 560  LYS A O     1 
ATOM   4067  C  CB    . LYS A 1 561  ? 27.058  23.796  130.555 1.00 54.54  ? 560  LYS A CB    1 
ATOM   4068  C  CG    . LYS A 1 561  ? 25.812  22.992  130.877 1.00 54.45  ? 560  LYS A CG    1 
ATOM   4069  C  CD    . LYS A 1 561  ? 25.998  21.522  130.584 1.00 51.78  ? 560  LYS A CD    1 
ATOM   4070  C  CE    . LYS A 1 561  ? 25.942  21.226  129.102 1.00 50.28  ? 560  LYS A CE    1 
ATOM   4071  N  NZ    . LYS A 1 561  ? 25.280  19.914  128.911 1.00 50.31  ? 560  LYS A NZ    1 
ATOM   4072  N  N     . GLN A 1 562  ? 27.227  25.657  133.405 1.00 59.78  ? 561  GLN A N     1 
ATOM   4073  C  CA    . GLN A 1 562  ? 26.676  25.787  134.746 1.00 58.77  ? 561  GLN A CA    1 
ATOM   4074  C  C     . GLN A 1 562  ? 26.007  27.130  134.984 1.00 61.70  ? 561  GLN A C     1 
ATOM   4075  O  O     . GLN A 1 562  ? 25.510  27.359  136.089 1.00 60.22  ? 561  GLN A O     1 
ATOM   4076  C  CB    . GLN A 1 562  ? 27.766  25.557  135.797 1.00 59.11  ? 561  GLN A CB    1 
ATOM   4077  C  CG    . GLN A 1 562  ? 28.392  24.177  135.746 1.00 59.13  ? 561  GLN A CG    1 
ATOM   4078  C  CD    . GLN A 1 562  ? 27.377  23.069  135.940 1.00 60.44  ? 561  GLN A CD    1 
ATOM   4079  O  OE1   . GLN A 1 562  ? 26.375  23.240  136.632 1.00 63.54  ? 561  GLN A OE1   1 
ATOM   4080  N  NE2   . GLN A 1 562  ? 27.628  21.924  135.317 1.00 60.12  ? 561  GLN A NE2   1 
ATOM   4081  N  N     . LEU A 1 563  ? 25.965  28.007  133.979 1.00 58.41  ? 562  LEU A N     1 
ATOM   4082  C  CA    . LEU A 1 563  ? 25.391  29.335  134.172 1.00 56.96  ? 562  LEU A CA    1 
ATOM   4083  C  C     . LEU A 1 563  ? 23.934  29.261  134.611 1.00 56.38  ? 562  LEU A C     1 
ATOM   4084  O  O     . LEU A 1 563  ? 23.495  30.050  135.454 1.00 57.39  ? 562  LEU A O     1 
ATOM   4085  C  CB    . LEU A 1 563  ? 25.511  30.152  132.887 1.00 56.26  ? 562  LEU A CB    1 
ATOM   4086  C  CG    . LEU A 1 563  ? 26.363  31.420  132.957 1.00 56.73  ? 562  LEU A CG    1 
ATOM   4087  C  CD1   . LEU A 1 563  ? 26.124  32.294  131.734 1.00 58.49  ? 562  LEU A CD1   1 
ATOM   4088  C  CD2   . LEU A 1 563  ? 26.109  32.189  134.244 1.00 57.34  ? 562  LEU A CD2   1 
ATOM   4089  N  N     . ALA A 1 564  ? 23.167  28.325  134.046 1.00 61.70  ? 563  ALA A N     1 
ATOM   4090  C  CA    . ALA A 1 564  ? 21.751  28.224  134.390 1.00 65.63  ? 563  ALA A CA    1 
ATOM   4091  C  C     . ALA A 1 564  ? 21.559  28.056  135.889 1.00 66.02  ? 563  ALA A C     1 
ATOM   4092  O  O     . ALA A 1 564  ? 20.625  28.613  136.474 1.00 69.30  ? 563  ALA A O     1 
ATOM   4093  C  CB    . ALA A 1 564  ? 21.107  27.061  133.634 1.00 66.34  ? 563  ALA A CB    1 
ATOM   4094  N  N     . THR A 1 565  ? 22.441  27.296  136.526 1.00 63.99  ? 564  THR A N     1 
ATOM   4095  C  CA    . THR A 1 565  ? 22.368  27.081  137.963 1.00 62.90  ? 564  THR A CA    1 
ATOM   4096  C  C     . THR A 1 565  ? 22.983  28.244  138.732 1.00 63.89  ? 564  THR A C     1 
ATOM   4097  O  O     . THR A 1 565  ? 22.400  28.720  139.711 1.00 67.26  ? 564  THR A O     1 
ATOM   4098  C  CB    . THR A 1 565  ? 23.062  25.767  138.304 1.00 61.22  ? 564  THR A CB    1 
ATOM   4099  O  OG1   . THR A 1 565  ? 24.260  25.667  137.527 1.00 60.75  ? 564  THR A OG1   1 
ATOM   4100  C  CG2   . THR A 1 565  ? 22.161  24.597  137.956 1.00 61.91  ? 564  THR A CG2   1 
ATOM   4101  N  N     . LYS A 1 566  ? 24.148  28.721  138.293 1.00 64.91  ? 565  LYS A N     1 
ATOM   4102  C  CA    . LYS A 1 566  ? 24.750  29.896  138.910 1.00 66.23  ? 565  LYS A CA    1 
ATOM   4103  C  C     . LYS A 1 566  ? 23.773  31.058  138.980 1.00 65.40  ? 565  LYS A C     1 
ATOM   4104  O  O     . LYS A 1 566  ? 23.741  31.779  139.978 1.00 63.82  ? 565  LYS A O     1 
ATOM   4105  C  CB    . LYS A 1 566  ? 25.993  30.310  138.139 1.00 54.11  ? 565  LYS A CB    1 
ATOM   4106  C  CG    . LYS A 1 566  ? 27.045  29.226  138.070 1.00 51.94  ? 565  LYS A CG    1 
ATOM   4107  C  CD    . LYS A 1 566  ? 28.413  29.858  138.043 1.00 51.25  ? 565  LYS A CD    1 
ATOM   4108  C  CE    . LYS A 1 566  ? 29.480  28.824  137.747 1.00 49.33  ? 565  LYS A CE    1 
ATOM   4109  N  NZ    . LYS A 1 566  ? 30.598  29.417  136.977 1.00 49.19  ? 565  LYS A NZ    1 
ATOM   4110  N  N     . ILE A 1 567  ? 22.974  31.262  137.925 1.00 69.75  ? 566  ILE A N     1 
ATOM   4111  C  CA    . ILE A 1 567  ? 21.996  32.346  137.921 1.00 69.32  ? 566  ILE A CA    1 
ATOM   4112  C  C     . ILE A 1 567  ? 20.887  32.058  138.918 1.00 68.29  ? 566  ILE A C     1 
ATOM   4113  O  O     . ILE A 1 567  ? 20.342  32.968  139.551 1.00 67.43  ? 566  ILE A O     1 
ATOM   4114  C  CB    . ILE A 1 567  ? 21.438  32.550  136.502 1.00 70.68  ? 566  ILE A CB    1 
ATOM   4115  C  CG1   . ILE A 1 567  ? 22.515  33.106  135.580 1.00 70.77  ? 566  ILE A CG1   1 
ATOM   4116  C  CG2   . ILE A 1 567  ? 20.240  33.479  136.519 1.00 74.37  ? 566  ILE A CG2   1 
ATOM   4117  C  CD1   . ILE A 1 567  ? 22.120  33.099  134.123 1.00 71.08  ? 566  ILE A CD1   1 
ATOM   4118  N  N     . ARG A 1 568  ? 20.545  30.786  139.085 1.00 60.78  ? 567  ARG A N     1 
ATOM   4119  C  CA    . ARG A 1 568  ? 19.429  30.439  139.949 1.00 61.70  ? 567  ARG A CA    1 
ATOM   4120  C  C     . ARG A 1 568  ? 19.743  30.740  141.403 1.00 61.36  ? 567  ARG A C     1 
ATOM   4121  O  O     . ARG A 1 568  ? 18.938  31.364  142.105 1.00 63.05  ? 567  ARG A O     1 
ATOM   4122  C  CB    . ARG A 1 568  ? 19.080  28.972  139.779 1.00 60.68  ? 567  ARG A CB    1 
ATOM   4123  C  CG    . ARG A 1 568  ? 17.812  28.624  140.461 1.00 61.97  ? 567  ARG A CG    1 
ATOM   4124  C  CD    . ARG A 1 568  ? 17.695  27.173  140.684 1.00 60.72  ? 567  ARG A CD    1 
ATOM   4125  N  NE    . ARG A 1 568  ? 16.470  26.883  141.407 1.00 62.13  ? 567  ARG A NE    1 
ATOM   4126  C  CZ    . ARG A 1 568  ? 15.936  25.670  141.513 1.00 61.85  ? 567  ARG A CZ    1 
ATOM   4127  N  NH1   . ARG A 1 568  ? 16.532  24.607  140.950 1.00 60.18  ? 567  ARG A NH1   1 
ATOM   4128  N  NH2   . ARG A 1 568  ? 14.791  25.506  142.187 1.00 63.38  ? 567  ARG A NH2   1 
ATOM   4129  N  N     . LEU A 1 569  ? 20.894  30.257  141.889 1.00 60.26  ? 568  LEU A N     1 
ATOM   4130  C  CA    . LEU A 1 569  ? 21.342  30.627  143.228 1.00 59.92  ? 568  LEU A CA    1 
ATOM   4131  C  C     . LEU A 1 569  ? 21.597  32.122  143.300 1.00 61.46  ? 568  LEU A C     1 
ATOM   4132  O  O     . LEU A 1 569  ? 21.299  32.767  144.308 1.00 63.79  ? 568  LEU A O     1 
ATOM   4133  C  CB    . LEU A 1 569  ? 22.610  29.853  143.609 1.00 59.53  ? 568  LEU A CB    1 
ATOM   4134  C  CG    . LEU A 1 569  ? 22.672  28.334  143.447 1.00 54.88  ? 568  LEU A CG    1 
ATOM   4135  C  CD1   . LEU A 1 569  ? 24.121  27.866  143.426 1.00 52.72  ? 568  LEU A CD1   1 
ATOM   4136  C  CD2   . LEU A 1 569  ? 21.892  27.623  144.547 1.00 55.08  ? 568  LEU A CD2   1 
ATOM   4137  N  N     . TRP A 1 570  ? 22.155  32.684  142.234 1.00 60.73  ? 569  TRP A N     1 
ATOM   4138  C  CA    . TRP A 1 570  ? 22.359  34.123  142.159 1.00 61.84  ? 569  TRP A CA    1 
ATOM   4139  C  C     . TRP A 1 570  ? 21.062  34.894  142.397 1.00 64.44  ? 569  TRP A C     1 
ATOM   4140  O  O     . TRP A 1 570  ? 21.056  35.918  143.089 1.00 66.84  ? 569  TRP A O     1 
ATOM   4141  C  CB    . TRP A 1 570  ? 22.931  34.461  140.793 1.00 61.99  ? 569  TRP A CB    1 
ATOM   4142  C  CG    . TRP A 1 570  ? 23.065  35.878  140.559 1.00 63.53  ? 569  TRP A CG    1 
ATOM   4143  C  CD1   . TRP A 1 570  ? 24.057  36.675  141.013 1.00 63.35  ? 569  TRP A CD1   1 
ATOM   4144  C  CD2   . TRP A 1 570  ? 22.179  36.703  139.809 1.00 65.89  ? 569  TRP A CD2   1 
ATOM   4145  N  NE1   . TRP A 1 570  ? 23.853  37.960  140.593 1.00 65.49  ? 569  TRP A NE1   1 
ATOM   4146  C  CE2   . TRP A 1 570  ? 22.702  38.001  139.849 1.00 67.08  ? 569  TRP A CE2   1 
ATOM   4147  C  CE3   . TRP A 1 570  ? 20.991  36.468  139.104 1.00 67.24  ? 569  TRP A CE3   1 
ATOM   4148  C  CZ2   . TRP A 1 570  ? 22.088  39.062  139.216 1.00 69.54  ? 569  TRP A CZ2   1 
ATOM   4149  C  CZ3   . TRP A 1 570  ? 20.380  37.521  138.480 1.00 69.63  ? 569  TRP A CZ3   1 
ATOM   4150  C  CH2   . TRP A 1 570  ? 20.918  38.804  138.549 1.00 70.79  ? 569  TRP A CH2   1 
ATOM   4151  N  N     . HIS A 1 571  ? 19.953  34.423  141.828 1.00 66.80  ? 570  HIS A N     1 
ATOM   4152  C  CA    . HIS A 1 571  ? 18.671  35.088  142.024 1.00 70.15  ? 570  HIS A CA    1 
ATOM   4153  C  C     . HIS A 1 571  ? 18.138  34.865  143.431 1.00 69.76  ? 570  HIS A C     1 
ATOM   4154  O  O     . HIS A 1 571  ? 17.452  35.736  143.975 1.00 73.07  ? 570  HIS A O     1 
ATOM   4155  C  CB    . HIS A 1 571  ? 17.681  34.586  140.982 1.00 73.93  ? 570  HIS A CB    1 
ATOM   4156  C  CG    . HIS A 1 571  ? 16.286  35.097  141.165 1.00 78.00  ? 570  HIS A CG    1 
ATOM   4157  N  ND1   . HIS A 1 571  ? 15.888  36.351  140.753 1.00 79.86  ? 570  HIS A ND1   1 
ATOM   4158  C  CD2   . HIS A 1 571  ? 15.181  34.505  141.681 1.00 79.29  ? 570  HIS A CD2   1 
ATOM   4159  C  CE1   . HIS A 1 571  ? 14.605  36.516  141.023 1.00 81.65  ? 570  HIS A CE1   1 
ATOM   4160  N  NE2   . HIS A 1 571  ? 14.152  35.411  141.585 1.00 81.16  ? 570  HIS A NE2   1 
ATOM   4161  N  N     . GLN A 1 572  ? 18.484  33.730  144.029 1.00 66.61  ? 571  GLN A N     1 
ATOM   4162  C  CA    . GLN A 1 572  ? 18.032  33.402  145.378 1.00 67.75  ? 571  GLN A CA    1 
ATOM   4163  C  C     . GLN A 1 572  ? 18.765  34.188  146.467 1.00 66.68  ? 571  GLN A C     1 
ATOM   4164  O  O     . GLN A 1 572  ? 18.250  34.347  147.574 1.00 68.03  ? 571  GLN A O     1 
ATOM   4165  C  CB    . GLN A 1 572  ? 18.172  31.900  145.635 1.00 68.44  ? 571  GLN A CB    1 
ATOM   4166  C  CG    . GLN A 1 572  ? 17.098  31.053  144.972 1.00 69.00  ? 571  GLN A CG    1 
ATOM   4167  C  CD    . GLN A 1 572  ? 17.416  29.571  145.016 1.00 66.34  ? 571  GLN A CD    1 
ATOM   4168  O  OE1   . GLN A 1 572  ? 18.449  29.161  145.545 1.00 67.96  ? 571  GLN A OE1   1 
ATOM   4169  N  NE2   . GLN A 1 572  ? 16.525  28.758  144.459 1.00 64.82  ? 571  GLN A NE2   1 
ATOM   4170  N  N     . GLN A 1 573  ? 19.963  34.676  146.157 1.00 65.35  ? 572  GLN A N     1 
ATOM   4171  C  CA    . GLN A 1 573  ? 20.744  35.428  147.128 1.00 65.27  ? 572  GLN A CA    1 
ATOM   4172  C  C     . GLN A 1 573  ? 20.617  36.928  146.951 1.00 67.49  ? 572  GLN A C     1 
ATOM   4173  O  O     . GLN A 1 573  ? 21.536  37.669  147.325 1.00 67.31  ? 572  GLN A O     1 
ATOM   4174  C  CB    . GLN A 1 573  ? 22.204  34.993  147.060 1.00 62.79  ? 572  GLN A CB    1 
ATOM   4175  C  CG    . GLN A 1 573  ? 22.341  33.510  147.246 1.00 60.74  ? 572  GLN A CG    1 
ATOM   4176  C  CD    . GLN A 1 573  ? 23.590  32.953  146.630 1.00 58.53  ? 572  GLN A CD    1 
ATOM   4177  O  OE1   . GLN A 1 573  ? 23.655  31.771  146.330 1.00 57.08  ? 572  GLN A OE1   1 
ATOM   4178  N  NE2   . GLN A 1 573  ? 24.598  33.795  146.450 1.00 58.36  ? 572  GLN A NE2   1 
ATOM   4179  N  N     . GLY A 1 574  ? 19.495  37.394  146.403 1.00 69.69  ? 573  GLY A N     1 
ATOM   4180  C  CA    . GLY A 1 574  ? 19.276  38.805  146.157 1.00 72.07  ? 573  GLY A CA    1 
ATOM   4181  C  C     . GLY A 1 574  ? 20.392  39.423  145.342 1.00 71.48  ? 573  GLY A C     1 
ATOM   4182  O  O     . GLY A 1 574  ? 20.741  40.588  145.538 1.00 72.82  ? 573  GLY A O     1 
ATOM   4183  N  N     . GLU A 1 575  ? 20.971  38.636  144.434 1.00 69.57  ? 574  GLU A N     1 
ATOM   4184  C  CA    . GLU A 1 575  ? 22.082  39.054  143.580 1.00 68.83  ? 574  GLU A CA    1 
ATOM   4185  C  C     . GLU A 1 575  ? 23.263  39.552  144.383 1.00 68.03  ? 574  GLU A C     1 
ATOM   4186  O  O     . GLU A 1 575  ? 24.063  40.352  143.890 1.00 68.35  ? 574  GLU A O     1 
ATOM   4187  C  CB    . GLU A 1 575  ? 21.651  40.133  142.593 1.00 78.15  ? 574  GLU A CB    1 
ATOM   4188  C  CG    . GLU A 1 575  ? 20.441  39.744  141.828 1.00 78.05  ? 574  GLU A CG    1 
ATOM   4189  C  CD    . GLU A 1 575  ? 19.687  40.955  141.339 1.00 80.23  ? 574  GLU A CD    1 
ATOM   4190  O  OE1   . GLU A 1 575  ? 20.327  41.926  140.881 1.00 81.40  ? 574  GLU A OE1   1 
ATOM   4191  O  OE2   . GLU A 1 575  ? 18.454  40.947  141.447 1.00 82.60  ? 574  GLU A OE2   1 
ATOM   4192  N  N     . ARG A 1 576  ? 23.361  39.108  145.627 1.00 68.71  ? 575  ARG A N     1 
ATOM   4193  C  CA    . ARG A 1 576  ? 24.433  39.491  146.519 1.00 67.33  ? 575  ARG A CA    1 
ATOM   4194  C  C     . ARG A 1 576  ? 25.198  38.239  146.907 1.00 65.85  ? 575  ARG A C     1 
ATOM   4195  O  O     . ARG A 1 576  ? 24.611  37.163  147.054 1.00 66.82  ? 575  ARG A O     1 
ATOM   4196  C  CB    . ARG A 1 576  ? 23.881  40.194  147.759 1.00 69.27  ? 575  ARG A CB    1 
ATOM   4197  C  CG    . ARG A 1 576  ? 24.931  40.840  148.633 1.00 69.21  ? 575  ARG A CG    1 
ATOM   4198  C  CD    . ARG A 1 576  ? 24.317  41.300  149.931 1.00 71.06  ? 575  ARG A CD    1 
ATOM   4199  N  NE    . ARG A 1 576  ? 22.986  41.860  149.722 1.00 74.58  ? 575  ARG A NE    1 
ATOM   4200  C  CZ    . ARG A 1 576  ? 22.758  43.102  149.311 1.00 77.13  ? 575  ARG A CZ    1 
ATOM   4201  N  NH1   . ARG A 1 576  ? 23.776  43.915  149.058 1.00 76.22  ? 575  ARG A NH1   1 
ATOM   4202  N  NH2   . ARG A 1 576  ? 21.515  43.532  149.150 1.00 80.96  ? 575  ARG A NH2   1 
ATOM   4203  N  N     . CYS A 1 577  ? 26.512  38.378  147.029 1.00 63.62  ? 576  CYS A N     1 
ATOM   4204  C  CA    . CYS A 1 577  ? 27.331  37.338  147.623 1.00 61.37  ? 576  CYS A CA    1 
ATOM   4205  C  C     . CYS A 1 577  ? 27.164  37.358  149.135 1.00 61.48  ? 576  CYS A C     1 
ATOM   4206  O  O     . CYS A 1 577  ? 27.396  38.386  149.777 1.00 61.75  ? 576  CYS A O     1 
ATOM   4207  C  CB    . CYS A 1 577  ? 28.790  37.546  147.254 1.00 60.68  ? 576  CYS A CB    1 
ATOM   4208  S  SG    . CYS A 1 577  ? 29.892  36.779  148.426 1.00 60.57  ? 576  CYS A SG    1 
ATOM   4209  N  N     . LEU A 1 578  ? 26.772  36.223  149.705 1.00 59.03  ? 577  LEU A N     1 
ATOM   4210  C  CA    . LEU A 1 578  ? 26.373  36.191  151.105 1.00 59.52  ? 577  LEU A CA    1 
ATOM   4211  C  C     . LEU A 1 578  ? 27.549  36.154  152.078 1.00 59.64  ? 577  LEU A C     1 
ATOM   4212  O  O     . LEU A 1 578  ? 27.325  36.178  153.293 1.00 58.68  ? 577  LEU A O     1 
ATOM   4213  C  CB    . LEU A 1 578  ? 25.455  34.998  151.361 1.00 59.01  ? 577  LEU A CB    1 
ATOM   4214  C  CG    . LEU A 1 578  ? 24.223  34.911  150.472 1.00 60.29  ? 577  LEU A CG    1 
ATOM   4215  C  CD1   . LEU A 1 578  ? 23.300  33.818  150.958 1.00 60.08  ? 577  LEU A CD1   1 
ATOM   4216  C  CD2   . LEU A 1 578  ? 23.507  36.238  150.436 1.00 62.92  ? 577  LEU A CD2   1 
ATOM   4217  N  N     . TYR A 1 579  ? 28.786  36.100  151.591 1.00 61.54  ? 578  TYR A N     1 
ATOM   4218  C  CA    . TYR A 1 579  ? 29.953  36.215  152.456 1.00 60.63  ? 578  TYR A CA    1 
ATOM   4219  C  C     . TYR A 1 579  ? 30.601  37.590  152.367 1.00 61.23  ? 578  TYR A C     1 
ATOM   4220  O  O     . TYR A 1 579  ? 31.052  38.122  153.382 1.00 62.82  ? 578  TYR A O     1 
ATOM   4221  C  CB    . TYR A 1 579  ? 30.981  35.123  152.125 1.00 58.53  ? 578  TYR A CB    1 
ATOM   4222  C  CG    . TYR A 1 579  ? 30.425  33.708  152.199 1.00 58.15  ? 578  TYR A CG    1 
ATOM   4223  C  CD1   . TYR A 1 579  ? 29.330  33.412  152.994 1.00 58.98  ? 578  TYR A CD1   1 
ATOM   4224  C  CD2   . TYR A 1 579  ? 30.989  32.674  151.468 1.00 57.32  ? 578  TYR A CD2   1 
ATOM   4225  C  CE1   . TYR A 1 579  ? 28.813  32.136  153.056 1.00 57.04  ? 578  TYR A CE1   1 
ATOM   4226  C  CE2   . TYR A 1 579  ? 30.474  31.393  151.526 1.00 55.88  ? 578  TYR A CE2   1 
ATOM   4227  C  CZ    . TYR A 1 579  ? 29.387  31.134  152.323 1.00 55.80  ? 578  TYR A CZ    1 
ATOM   4228  O  OH    . TYR A 1 579  ? 28.866  29.868  152.400 1.00 55.68  ? 578  TYR A OH    1 
ATOM   4229  N  N     . THR A 1 580  ? 30.628  38.193  151.177 1.00 57.92  ? 579  THR A N     1 
ATOM   4230  C  CA    . THR A 1 580  ? 31.160  39.544  151.028 1.00 59.41  ? 579  THR A CA    1 
ATOM   4231  C  C     . THR A 1 580  ? 30.140  40.598  151.427 1.00 62.02  ? 579  THR A C     1 
ATOM   4232  O  O     . THR A 1 580  ? 30.506  41.647  151.966 1.00 63.38  ? 579  THR A O     1 
ATOM   4233  C  CB    . THR A 1 580  ? 31.588  39.794  149.583 1.00 59.35  ? 579  THR A CB    1 
ATOM   4234  O  OG1   . THR A 1 580  ? 30.427  39.806  148.741 1.00 60.44  ? 579  THR A OG1   1 
ATOM   4235  C  CG2   . THR A 1 580  ? 32.551  38.726  149.113 1.00 56.92  ? 579  THR A CG2   1 
ATOM   4236  N  N     . GLY A 1 581  ? 28.863  40.343  151.159 1.00 62.88  ? 580  GLY A N     1 
ATOM   4237  C  CA    . GLY A 1 581  ? 27.878  41.400  151.196 1.00 65.59  ? 580  GLY A CA    1 
ATOM   4238  C  C     . GLY A 1 581  ? 27.903  42.305  149.986 1.00 66.97  ? 580  GLY A C     1 
ATOM   4239  O  O     . GLY A 1 581  ? 27.357  43.408  150.044 1.00 69.43  ? 580  GLY A O     1 
ATOM   4240  N  N     . LYS A 1 582  ? 28.526  41.874  148.891 1.00 65.59  ? 581  LYS A N     1 
ATOM   4241  C  CA    . LYS A 1 582  ? 28.659  42.676  147.687 1.00 66.79  ? 581  LYS A CA    1 
ATOM   4242  C  C     . LYS A 1 582  ? 27.705  42.186  146.609 1.00 67.01  ? 581  LYS A C     1 
ATOM   4243  O  O     . LYS A 1 582  ? 27.397  40.995  146.520 1.00 65.93  ? 581  LYS A O     1 
ATOM   4244  C  CB    . LYS A 1 582  ? 30.084  42.632  147.142 1.00 66.02  ? 581  LYS A CB    1 
ATOM   4245  C  CG    . LYS A 1 582  ? 31.107  43.323  148.014 1.00 67.73  ? 581  LYS A CG    1 
ATOM   4246  C  CD    . LYS A 1 582  ? 32.487  43.213  147.384 1.00 67.29  ? 581  LYS A CD    1 
ATOM   4247  C  CE    . LYS A 1 582  ? 33.586  43.269  148.440 1.00 66.52  ? 581  LYS A CE    1 
ATOM   4248  N  NZ    . LYS A 1 582  ? 34.879  43.761  147.887 1.00 67.22  ? 581  LYS A NZ    1 
ATOM   4249  N  N     . THR A 1 583  ? 27.257  43.120  145.777 1.00 74.69  ? 582  THR A N     1 
ATOM   4250  C  CA    . THR A 1 583  ? 26.354  42.779  144.690 1.00 73.99  ? 582  THR A CA    1 
ATOM   4251  C  C     . THR A 1 583  ? 27.100  42.055  143.580 1.00 73.95  ? 582  THR A C     1 
ATOM   4252  O  O     . THR A 1 583  ? 28.255  42.364  143.271 1.00 74.35  ? 582  THR A O     1 
ATOM   4253  C  CB    . THR A 1 583  ? 25.681  44.033  144.133 1.00 77.93  ? 582  THR A CB    1 
ATOM   4254  O  OG1   . THR A 1 583  ? 26.627  45.106  144.093 1.00 80.04  ? 582  THR A OG1   1 
ATOM   4255  C  CG2   . THR A 1 583  ? 24.501  44.431  145.000 1.00 80.86  ? 582  THR A CG2   1 
ATOM   4256  N  N     . ILE A 1 584  ? 26.429  41.080  142.985 1.00 66.93  ? 583  ILE A N     1 
ATOM   4257  C  CA    . ILE A 1 584  ? 26.963  40.318  141.868 1.00 65.33  ? 583  ILE A CA    1 
ATOM   4258  C  C     . ILE A 1 584  ? 26.213  40.751  140.615 1.00 67.05  ? 583  ILE A C     1 
ATOM   4259  O  O     . ILE A 1 584  ? 25.026  40.442  140.454 1.00 67.91  ? 583  ILE A O     1 
ATOM   4260  C  CB    . ILE A 1 584  ? 26.830  38.809  142.102 1.00 63.13  ? 583  ILE A CB    1 
ATOM   4261  C  CG1   . ILE A 1 584  ? 27.546  38.412  143.393 1.00 61.60  ? 583  ILE A CG1   1 
ATOM   4262  C  CG2   . ILE A 1 584  ? 27.378  38.045  140.917 1.00 61.67  ? 583  ILE A CG2   1 
ATOM   4263  C  CD1   . ILE A 1 584  ? 27.293  36.986  143.822 1.00 59.77  ? 583  ILE A CD1   1 
ATOM   4264  N  N     . SER A 1 585  ? 26.892  41.497  139.757 1.00 67.69  ? 584  SER A N     1 
ATOM   4265  C  CA    . SER A 1 585  ? 26.288  41.952  138.527 1.00 69.15  ? 584  SER A CA    1 
ATOM   4266  C  C     . SER A 1 585  ? 26.256  40.814  137.550 1.00 69.85  ? 584  SER A C     1 
ATOM   4267  O  O     . SER A 1 585  ? 27.194  40.058  137.459 1.00 65.08  ? 584  SER A O     1 
ATOM   4268  C  CB    . SER A 1 585  ? 27.020  43.153  137.959 1.00 70.81  ? 584  SER A CB    1 
ATOM   4269  O  OG    . SER A 1 585  ? 28.215  42.808  137.338 1.00 69.24  ? 584  SER A OG    1 
ATOM   4270  N  N     . ILE A 1 586  ? 25.174  40.693  136.808 1.00 75.21  ? 585  ILE A N     1 
ATOM   4271  C  CA    . ILE A 1 586  ? 25.060  39.614  135.862 1.00 72.55  ? 585  ILE A CA    1 
ATOM   4272  C  C     . ILE A 1 586  ? 26.163  39.763  134.871 1.00 72.86  ? 585  ILE A C     1 
ATOM   4273  O  O     . ILE A 1 586  ? 26.656  38.794  134.351 1.00 72.19  ? 585  ILE A O     1 
ATOM   4274  C  CB    . ILE A 1 586  ? 23.719  39.569  135.151 1.00 76.09  ? 585  ILE A CB    1 
ATOM   4275  C  CG1   . ILE A 1 586  ? 23.388  38.156  134.689 1.00 78.09  ? 585  ILE A CG1   1 
ATOM   4276  C  CG2   . ILE A 1 586  ? 23.793  40.398  133.895 1.00 75.81  ? 585  ILE A CG2   1 
ATOM   4277  C  CD1   . ILE A 1 586  ? 23.022  37.150  135.763 1.00 81.46  ? 585  ILE A CD1   1 
ATOM   4278  N  N     . HIS A 1 587  ? 26.537  40.990  134.590 1.00 76.14  ? 586  HIS A N     1 
ATOM   4279  C  CA    . HIS A 1 587  ? 27.600  41.223  133.644 1.00 68.29  ? 586  HIS A CA    1 
ATOM   4280  C  C     . HIS A 1 587  ? 28.882  40.641  134.126 1.00 66.03  ? 586  HIS A C     1 
ATOM   4281  O  O     . HIS A 1 587  ? 29.609  40.022  133.379 1.00 64.76  ? 586  HIS A O     1 
ATOM   4282  C  CB    . HIS A 1 587  ? 27.746  42.717  133.411 1.00 70.84  ? 586  HIS A CB    1 
ATOM   4283  C  CG    . HIS A 1 587  ? 26.486  43.338  132.922 1.00 73.31  ? 586  HIS A CG    1 
ATOM   4284  N  ND1   . HIS A 1 587  ? 26.358  43.865  131.660 1.00 73.90  ? 586  HIS A ND1   1 
ATOM   4285  C  CD2   . HIS A 1 587  ? 25.266  43.429  133.494 1.00 75.41  ? 586  HIS A CD2   1 
ATOM   4286  C  CE1   . HIS A 1 587  ? 25.121  44.277  131.484 1.00 76.27  ? 586  HIS A CE1   1 
ATOM   4287  N  NE2   . HIS A 1 587  ? 24.439  44.029  132.584 1.00 77.21  ? 586  HIS A NE2   1 
ATOM   4288  N  N     . ASP A 1 588  ? 29.166  40.847  135.389 1.00 67.38  ? 587  ASP A N     1 
ATOM   4289  C  CA    . ASP A 1 588  ? 30.377  40.316  135.950 1.00 64.16  ? 587  ASP A CA    1 
ATOM   4290  C  C     . ASP A 1 588  ? 30.323  38.811  135.975 1.00 64.34  ? 587  ASP A C     1 
ATOM   4291  O  O     . ASP A 1 588  ? 31.260  38.136  135.610 1.00 64.97  ? 587  ASP A O     1 
ATOM   4292  C  CB    . ASP A 1 588  ? 30.548  40.824  137.364 1.00 64.39  ? 587  ASP A CB    1 
ATOM   4293  C  CG    . ASP A 1 588  ? 31.564  41.910  137.473 1.00 66.36  ? 587  ASP A CG    1 
ATOM   4294  O  OD1   . ASP A 1 588  ? 32.358  42.135  136.541 1.00 66.46  ? 587  ASP A OD1   1 
ATOM   4295  O  OD2   . ASP A 1 588  ? 31.567  42.544  138.526 1.00 67.45  ? 587  ASP A OD2   1 
ATOM   4296  N  N     . LEU A 1 589  ? 29.197  38.272  136.390 1.00 61.24  ? 588  LEU A N     1 
ATOM   4297  C  CA    . LEU A 1 589  ? 29.162  36.853  136.476 1.00 59.46  ? 588  LEU A CA    1 
ATOM   4298  C  C     . LEU A 1 589  ? 29.432  36.236  135.139 1.00 58.95  ? 588  LEU A C     1 
ATOM   4299  O  O     . LEU A 1 589  ? 30.489  35.643  134.963 1.00 57.15  ? 588  LEU A O     1 
ATOM   4300  C  CB    . LEU A 1 589  ? 27.786  36.482  136.948 1.00 60.22  ? 588  LEU A CB    1 
ATOM   4301  C  CG    . LEU A 1 589  ? 27.374  35.041  137.097 1.00 58.86  ? 588  LEU A CG    1 
ATOM   4302  C  CD1   . LEU A 1 589  ? 28.291  34.337  138.063 1.00 56.63  ? 588  LEU A CD1   1 
ATOM   4303  C  CD2   . LEU A 1 589  ? 25.967  35.033  137.629 1.00 60.25  ? 588  LEU A CD2   1 
ATOM   4304  N  N     . ILE A 1 590  ? 28.563  36.434  134.160 1.00 60.56  ? 589  ILE A N     1 
ATOM   4305  C  CA    . ILE A 1 590  ? 28.769  35.881  132.819 1.00 60.30  ? 589  ILE A CA    1 
ATOM   4306  C  C     . ILE A 1 590  ? 30.015  36.341  132.085 1.00 59.86  ? 589  ILE A C     1 
ATOM   4307  O  O     . ILE A 1 590  ? 30.702  35.558  131.471 1.00 58.43  ? 589  ILE A O     1 
ATOM   4308  C  CB    . ILE A 1 590  ? 27.630  36.351  131.898 1.00 62.45  ? 589  ILE A CB    1 
ATOM   4309  C  CG1   . ILE A 1 590  ? 26.279  36.049  132.515 1.00 62.27  ? 589  ILE A CG1   1 
ATOM   4310  C  CG2   . ILE A 1 590  ? 27.724  35.723  130.526 1.00 62.94  ? 589  ILE A CG2   1 
ATOM   4311  C  CD1   . ILE A 1 590  ? 25.115  36.187  131.575 1.00 64.32  ? 589  ILE A CD1   1 
ATOM   4312  N  N     . ASN A 1 591  ? 30.269  37.623  132.108 1.00 61.19  ? 590  ASN A N     1 
ATOM   4313  C  CA    . ASN A 1 591  ? 31.404  38.175  131.404 1.00 61.24  ? 590  ASN A CA    1 
ATOM   4314  C  C     . ASN A 1 591  ? 32.787  37.940  131.932 1.00 63.79  ? 590  ASN A C     1 
ATOM   4315  O  O     . ASN A 1 591  ? 33.740  37.823  131.203 1.00 66.21  ? 590  ASN A O     1 
ATOM   4316  C  CB    . ASN A 1 591  ? 31.120  39.609  130.963 1.00 63.68  ? 590  ASN A CB    1 
ATOM   4317  C  CG    . ASN A 1 591  ? 30.057  39.657  129.883 1.00 65.80  ? 590  ASN A CG    1 
ATOM   4318  O  OD1   . ASN A 1 591  ? 29.038  40.296  130.026 1.00 67.80  ? 590  ASN A OD1   1 
ATOM   4319  N  ND2   . ASN A 1 591  ? 30.276  38.920  128.825 1.00 66.30  ? 590  ASN A ND2   1 
ATOM   4320  N  N     . ASN A 1 592  ? 32.802  37.758  133.249 1.00 72.83  ? 591  ASN A N     1 
ATOM   4321  C  CA    . ASN A 1 592  ? 33.967  37.435  134.049 1.00 75.94  ? 591  ASN A CA    1 
ATOM   4322  C  C     . ASN A 1 592  ? 33.656  36.359  135.090 1.00 76.99  ? 591  ASN A C     1 
ATOM   4323  O  O     . ASN A 1 592  ? 33.693  36.593  136.276 1.00 76.07  ? 591  ASN A O     1 
ATOM   4324  C  CB    . ASN A 1 592  ? 34.496  38.701  134.667 1.00 79.63  ? 591  ASN A CB    1 
ATOM   4325  C  CG    . ASN A 1 592  ? 34.937  39.678  133.620 1.00 81.97  ? 591  ASN A CG    1 
ATOM   4326  O  OD1   . ASN A 1 592  ? 34.882  39.381  132.424 1.00 83.65  ? 591  ASN A OD1   1 
ATOM   4327  N  ND2   . ASN A 1 592  ? 35.387  40.834  134.044 1.00 82.91  ? 591  ASN A ND2   1 
ATOM   4328  N  N     . SER A 1 593  ? 33.412  35.162  134.591 1.00 70.88  ? 592  SER A N     1 
ATOM   4329  C  CA    . SER A 1 593  ? 33.027  33.987  135.337 1.00 71.05  ? 592  SER A CA    1 
ATOM   4330  C  C     . SER A 1 593  ? 34.001  33.495  136.388 1.00 68.77  ? 592  SER A C     1 
ATOM   4331  O  O     . SER A 1 593  ? 33.593  32.876  137.346 1.00 65.53  ? 592  SER A O     1 
ATOM   4332  C  CB    . SER A 1 593  ? 32.765  32.852  134.356 1.00 71.71  ? 592  SER A CB    1 
ATOM   4333  O  OG    . SER A 1 593  ? 33.627  32.898  133.247 1.00 74.33  ? 592  SER A OG    1 
ATOM   4334  N  N     . ASN A 1 594  ? 35.280  33.738  136.188 1.00 76.10  ? 593  ASN A N     1 
ATOM   4335  C  CA    . ASN A 1 594  ? 36.308  33.276  137.097 1.00 75.08  ? 593  ASN A CA    1 
ATOM   4336  C  C     . ASN A 1 594  ? 36.368  33.905  138.470 1.00 70.23  ? 593  ASN A C     1 
ATOM   4337  O  O     . ASN A 1 594  ? 37.041  33.415  139.348 1.00 66.81  ? 593  ASN A O     1 
ATOM   4338  C  CB    . ASN A 1 594  ? 37.643  33.450  136.447 1.00 82.11  ? 593  ASN A CB    1 
ATOM   4339  C  CG    . ASN A 1 594  ? 37.974  34.876  136.259 1.00 85.88  ? 593  ASN A CG    1 
ATOM   4340  O  OD1   . ASN A 1 594  ? 38.739  35.446  137.016 1.00 90.30  ? 593  ASN A OD1   1 
ATOM   4341  N  ND2   . ASN A 1 594  ? 37.381  35.480  135.266 1.00 88.03  ? 593  ASN A ND2   1 
ATOM   4342  N  N     . GLN A 1 595  ? 35.686  35.008  138.648 1.00 68.18  ? 594  GLN A N     1 
ATOM   4343  C  CA    . GLN A 1 595  ? 35.693  35.728  139.895 1.00 64.56  ? 594  GLN A CA    1 
ATOM   4344  C  C     . GLN A 1 595  ? 34.780  35.095  140.886 1.00 58.94  ? 594  GLN A C     1 
ATOM   4345  O  O     . GLN A 1 595  ? 34.665  35.542  141.982 1.00 58.54  ? 594  GLN A O     1 
ATOM   4346  C  CB    . GLN A 1 595  ? 35.166  37.124  139.645 1.00 67.84  ? 594  GLN A CB    1 
ATOM   4347  C  CG    . GLN A 1 595  ? 36.189  38.206  139.389 1.00 68.42  ? 594  GLN A CG    1 
ATOM   4348  C  CD    . GLN A 1 595  ? 35.526  39.519  139.023 1.00 69.61  ? 594  GLN A CD    1 
ATOM   4349  O  OE1   . GLN A 1 595  ? 34.459  39.845  139.518 1.00 69.63  ? 594  GLN A OE1   1 
ATOM   4350  N  NE2   . GLN A 1 595  ? 36.158  40.272  138.153 1.00 70.77  ? 594  GLN A NE2   1 
ATOM   4351  N  N     . PHE A 1 596  ? 34.098  34.054  140.486 1.00 50.56  ? 595  PHE A N     1 
ATOM   4352  C  CA    . PHE A 1 596  ? 33.096  33.430  141.337 1.00 50.35  ? 595  PHE A CA    1 
ATOM   4353  C  C     . PHE A 1 596  ? 33.255  31.921  141.342 1.00 48.48  ? 595  PHE A C     1 
ATOM   4354  O  O     . PHE A 1 596  ? 33.797  31.324  140.407 1.00 47.65  ? 595  PHE A O     1 
ATOM   4355  C  CB    . PHE A 1 596  ? 31.667  33.775  140.909 1.00 52.01  ? 595  PHE A CB    1 
ATOM   4356  C  CG    . PHE A 1 596  ? 31.482  35.215  140.536 1.00 54.05  ? 595  PHE A CG    1 
ATOM   4357  C  CD1   . PHE A 1 596  ? 31.139  36.161  141.486 1.00 55.38  ? 595  PHE A CD1   1 
ATOM   4358  C  CD2   . PHE A 1 596  ? 31.651  35.626  139.232 1.00 54.79  ? 595  PHE A CD2   1 
ATOM   4359  C  CE1   . PHE A 1 596  ? 30.985  37.484  141.135 1.00 57.40  ? 595  PHE A CE1   1 
ATOM   4360  C  CE2   . PHE A 1 596  ? 31.496  36.948  138.889 1.00 56.79  ? 595  PHE A CE2   1 
ATOM   4361  C  CZ    . PHE A 1 596  ? 31.161  37.869  139.837 1.00 58.10  ? 595  PHE A CZ    1 
ATOM   4362  N  N     . GLU A 1 597  ? 32.803  31.322  142.443 1.00 47.94  ? 596  GLU A N     1 
ATOM   4363  C  CA    . GLU A 1 597  ? 32.809  29.885  142.639 1.00 46.42  ? 596  GLU A CA    1 
ATOM   4364  C  C     . GLU A 1 597  ? 31.559  29.506  143.412 1.00 46.88  ? 596  GLU A C     1 
ATOM   4365  O  O     . GLU A 1 597  ? 30.980  30.322  144.130 1.00 48.10  ? 596  GLU A O     1 
ATOM   4366  C  CB    . GLU A 1 597  ? 34.065  29.418  143.379 1.00 44.83  ? 596  GLU A CB    1 
ATOM   4367  C  CG    . GLU A 1 597  ? 35.360  29.897  142.754 1.00 55.47  ? 596  GLU A CG    1 
ATOM   4368  C  CD    . GLU A 1 597  ? 36.581  29.344  143.460 1.00 51.58  ? 596  GLU A CD    1 
ATOM   4369  O  OE1   . GLU A 1 597  ? 36.463  28.922  144.627 1.00 51.70  ? 596  GLU A OE1   1 
ATOM   4370  O  OE2   . GLU A 1 597  ? 37.665  29.326  142.852 1.00 51.31  ? 596  GLU A OE2   1 
ATOM   4371  N  N     . VAL A 1 598  ? 31.130  28.262  143.239 1.00 48.45  ? 597  VAL A N     1 
ATOM   4372  C  CA    . VAL A 1 598  ? 29.976  27.740  143.959 1.00 49.57  ? 597  VAL A CA    1 
ATOM   4373  C  C     . VAL A 1 598  ? 30.486  27.063  145.224 1.00 49.23  ? 597  VAL A C     1 
ATOM   4374  O  O     . VAL A 1 598  ? 31.061  25.971  145.181 1.00 48.28  ? 597  VAL A O     1 
ATOM   4375  C  CB    . VAL A 1 598  ? 29.149  26.779  143.098 1.00 49.22  ? 597  VAL A CB    1 
ATOM   4376  C  CG1   . VAL A 1 598  ? 28.043  26.156  143.931 1.00 49.37  ? 597  VAL A CG1   1 
ATOM   4377  C  CG2   . VAL A 1 598  ? 28.547  27.524  141.935 1.00 51.02  ? 597  VAL A CG2   1 
ATOM   4378  N  N     . ASP A 1 599  ? 30.288  27.726  146.352 1.00 47.49  ? 598  ASP A N     1 
ATOM   4379  C  CA    . ASP A 1 599  ? 30.711  27.181  147.624 1.00 46.24  ? 598  ASP A CA    1 
ATOM   4380  C  C     . ASP A 1 599  ? 29.699  26.168  148.130 1.00 45.05  ? 598  ASP A C     1 
ATOM   4381  O  O     . ASP A 1 599  ? 28.489  26.391  148.064 1.00 46.41  ? 598  ASP A O     1 
ATOM   4382  C  CB    . ASP A 1 599  ? 30.880  28.297  148.652 1.00 49.63  ? 598  ASP A CB    1 
ATOM   4383  C  CG    . ASP A 1 599  ? 30.836  27.781  150.075 1.00 51.62  ? 598  ASP A CG    1 
ATOM   4384  O  OD1   . ASP A 1 599  ? 31.837  27.183  150.524 1.00 52.79  ? 598  ASP A OD1   1 
ATOM   4385  O  OD2   . ASP A 1 599  ? 29.800  27.971  150.744 1.00 53.48  ? 598  ASP A OD2   1 
ATOM   4386  N  N     . ALA A 1 600  ? 30.200  25.050  148.638 1.00 43.68  ? 599  ALA A N     1 
ATOM   4387  C  CA    . ALA A 1 600  ? 29.391  24.181  149.479 1.00 43.79  ? 599  ALA A CA    1 
ATOM   4388  C  C     . ALA A 1 600  ? 29.348  24.788  150.878 1.00 44.34  ? 599  ALA A C     1 
ATOM   4389  O  O     . ALA A 1 600  ? 30.389  24.931  151.526 1.00 43.51  ? 599  ALA A O     1 
ATOM   4390  C  CB    . ALA A 1 600  ? 29.968  22.771  149.497 1.00 42.27  ? 599  ALA A CB    1 
ATOM   4391  N  N     . ILE A 1 601  ? 28.150  25.181  151.322 1.00 45.87  ? 600  ILE A N     1 
ATOM   4392  C  CA    . ILE A 1 601  ? 28.008  25.930  152.571 1.00 46.74  ? 600  ILE A CA    1 
ATOM   4393  C  C     . ILE A 1 601  ? 28.615  25.143  153.721 1.00 45.63  ? 600  ILE A C     1 
ATOM   4394  O  O     . ILE A 1 601  ? 29.588  25.572  154.350 1.00 45.09  ? 600  ILE A O     1 
ATOM   4395  C  CB    . ILE A 1 601  ? 26.530  26.270  152.833 1.00 48.64  ? 600  ILE A CB    1 
ATOM   4396  C  CG1   . ILE A 1 601  ? 25.907  26.923  151.585 1.00 49.75  ? 600  ILE A CG1   1 
ATOM   4397  C  CG2   . ILE A 1 601  ? 26.404  27.165  154.036 1.00 49.73  ? 600  ILE A CG2   1 
ATOM   4398  C  CD1   . ILE A 1 601  ? 24.396  27.126  151.615 1.00 51.68  ? 600  ILE A CD1   1 
ATOM   4399  N  N     . LEU A 1 602  ? 28.059  23.967  153.998 1.00 59.07  ? 601  LEU A N     1 
ATOM   4400  C  CA    . LEU A 1 602  ? 28.699  23.006  154.888 1.00 57.16  ? 601  LEU A CA    1 
ATOM   4401  C  C     . LEU A 1 602  ? 29.613  22.131  154.036 1.00 54.22  ? 601  LEU A C     1 
ATOM   4402  O  O     . LEU A 1 602  ? 29.111  21.357  153.189 1.00 55.00  ? 601  LEU A O     1 
ATOM   4403  C  CB    . LEU A 1 602  ? 27.667  22.143  155.595 1.00 55.00  ? 601  LEU A CB    1 
ATOM   4404  C  CG    . LEU A 1 602  ? 26.417  22.791  156.211 1.00 57.15  ? 601  LEU A CG    1 
ATOM   4405  C  CD1   . LEU A 1 602  ? 25.733  21.798  157.125 1.00 57.68  ? 601  LEU A CD1   1 
ATOM   4406  C  CD2   . LEU A 1 602  ? 26.742  24.069  156.945 1.00 58.73  ? 601  LEU A CD2   1 
ATOM   4407  N  N     . PRO A 1 603  ? 30.916  22.213  154.198 1.00 45.76  ? 602  PRO A N     1 
ATOM   4408  C  CA    . PRO A 1 603  ? 31.839  21.627  153.231 1.00 45.86  ? 602  PRO A CA    1 
ATOM   4409  C  C     . PRO A 1 603  ? 31.560  20.151  152.989 1.00 40.59  ? 602  PRO A C     1 
ATOM   4410  O  O     . PRO A 1 603  ? 31.133  19.418  153.889 1.00 39.62  ? 602  PRO A O     1 
ATOM   4411  C  CB    . PRO A 1 603  ? 33.204  21.836  153.893 1.00 39.16  ? 602  PRO A CB    1 
ATOM   4412  C  CG    . PRO A 1 603  ? 33.006  23.089  154.690 1.00 40.23  ? 602  PRO A CG    1 
ATOM   4413  C  CD    . PRO A 1 603  ? 31.577  23.037  155.190 1.00 41.50  ? 602  PRO A CD    1 
ATOM   4414  N  N     . LEU A 1 604  ? 31.776  19.720  151.745 1.00 49.17  ? 603  LEU A N     1 
ATOM   4415  C  CA    . LEU A 1 604  ? 31.397  18.360  151.365 1.00 51.74  ? 603  LEU A CA    1 
ATOM   4416  C  C     . LEU A 1 604  ? 32.334  17.320  151.944 1.00 51.01  ? 603  LEU A C     1 
ATOM   4417  O  O     . LEU A 1 604  ? 31.966  16.147  152.004 1.00 50.68  ? 603  LEU A O     1 
ATOM   4418  C  CB    . LEU A 1 604  ? 31.355  18.237  149.853 1.00 55.16  ? 603  LEU A CB    1 
ATOM   4419  C  CG    . LEU A 1 604  ? 30.105  17.484  149.410 1.00 58.48  ? 603  LEU A CG    1 
ATOM   4420  C  CD1   . LEU A 1 604  ? 28.931  18.290  149.872 1.00 62.42  ? 603  LEU A CD1   1 
ATOM   4421  C  CD2   . LEU A 1 604  ? 30.088  17.310  147.919 1.00 59.78  ? 603  LEU A CD2   1 
ATOM   4422  N  N     . SER A 1 605  ? 33.536  17.731  152.358 1.00 46.89  ? 604  SER A N     1 
ATOM   4423  C  CA    . SER A 1 605  ? 34.444  16.835  153.057 1.00 44.38  ? 604  SER A CA    1 
ATOM   4424  C  C     . SER A 1 605  ? 33.805  16.258  154.306 1.00 44.12  ? 604  SER A C     1 
ATOM   4425  O  O     . SER A 1 605  ? 34.161  15.159  154.739 1.00 44.55  ? 604  SER A O     1 
ATOM   4426  C  CB    . SER A 1 605  ? 35.704  17.596  153.438 1.00 42.05  ? 604  SER A CB    1 
ATOM   4427  O  OG    . SER A 1 605  ? 36.071  18.465  152.398 1.00 41.33  ? 604  SER A OG    1 
ATOM   4428  N  N     . ILE A 1 606  ? 32.875  16.986  154.897 1.00 42.76  ? 605  ILE A N     1 
ATOM   4429  C  CA    . ILE A 1 606  ? 32.264  16.624  156.160 1.00 43.56  ? 605  ILE A CA    1 
ATOM   4430  C  C     . ILE A 1 606  ? 30.844  16.119  155.962 1.00 47.08  ? 605  ILE A C     1 
ATOM   4431  O  O     . ILE A 1 606  ? 30.455  15.098  156.526 1.00 51.98  ? 605  ILE A O     1 
ATOM   4432  C  CB    . ILE A 1 606  ? 32.295  17.822  157.134 1.00 40.61  ? 605  ILE A CB    1 
ATOM   4433  C  CG1   . ILE A 1 606  ? 33.729  18.312  157.291 1.00 40.08  ? 605  ILE A CG1   1 
ATOM   4434  C  CG2   . ILE A 1 606  ? 31.655  17.460  158.461 1.00 39.18  ? 605  ILE A CG2   1 
ATOM   4435  C  CD1   . ILE A 1 606  ? 33.837  19.674  157.880 1.00 38.16  ? 605  ILE A CD1   1 
ATOM   4436  N  N     . THR A 1 607  ? 30.056  16.822  155.156 1.00 53.54  ? 606  THR A N     1 
ATOM   4437  C  CA    . THR A 1 607  ? 28.628  16.559  155.091 1.00 55.35  ? 606  THR A CA    1 
ATOM   4438  C  C     . THR A 1 607  ? 28.224  15.660  153.937 1.00 58.54  ? 606  THR A C     1 
ATOM   4439  O  O     . THR A 1 607  ? 27.288  14.873  154.090 1.00 61.40  ? 606  THR A O     1 
ATOM   4440  C  CB    . THR A 1 607  ? 27.859  17.879  155.005 1.00 57.37  ? 606  THR A CB    1 
ATOM   4441  O  OG1   . THR A 1 607  ? 28.257  18.587  153.828 1.00 55.70  ? 606  THR A OG1   1 
ATOM   4442  C  CG2   . THR A 1 607  ? 28.171  18.728  156.216 1.00 59.05  ? 606  THR A CG2   1 
ATOM   4443  N  N     . PHE A 1 608  ? 28.907  15.747  152.797 1.00 56.14  ? 607  PHE A N     1 
ATOM   4444  C  CA    . PHE A 1 608  ? 28.550  14.987  151.600 1.00 57.31  ? 607  PHE A CA    1 
ATOM   4445  C  C     . PHE A 1 608  ? 27.153  15.357  151.093 1.00 59.10  ? 607  PHE A C     1 
ATOM   4446  O  O     . PHE A 1 608  ? 26.463  14.542  150.482 1.00 60.74  ? 607  PHE A O     1 
ATOM   4447  C  CB    . PHE A 1 608  ? 28.670  13.477  151.851 1.00 54.26  ? 607  PHE A CB    1 
ATOM   4448  C  CG    . PHE A 1 608  ? 30.051  13.044  152.292 1.00 51.36  ? 607  PHE A CG    1 
ATOM   4449  C  CD1   . PHE A 1 608  ? 30.402  13.035  153.636 1.00 51.79  ? 607  PHE A CD1   1 
ATOM   4450  C  CD2   . PHE A 1 608  ? 31.000  12.656  151.360 1.00 50.59  ? 607  PHE A CD2   1 
ATOM   4451  C  CE1   . PHE A 1 608  ? 31.671  12.646  154.038 1.00 51.69  ? 607  PHE A CE1   1 
ATOM   4452  C  CE2   . PHE A 1 608  ? 32.272  12.261  151.755 1.00 49.60  ? 607  PHE A CE2   1 
ATOM   4453  C  CZ    . PHE A 1 608  ? 32.607  12.258  153.094 1.00 50.66  ? 607  PHE A CZ    1 
ATOM   4454  N  N     . ASP A 1 609  ? 26.744  16.600  151.341 1.00 64.36  ? 608  ASP A N     1 
ATOM   4455  C  CA    . ASP A 1 609  ? 25.441  17.132  150.947 1.00 65.65  ? 608  ASP A CA    1 
ATOM   4456  C  C     . ASP A 1 609  ? 25.636  17.980  149.693 1.00 64.57  ? 608  ASP A C     1 
ATOM   4457  O  O     . ASP A 1 609  ? 25.979  19.162  149.778 1.00 64.08  ? 608  ASP A O     1 
ATOM   4458  C  CB    . ASP A 1 609  ? 24.844  17.948  152.090 1.00 69.15  ? 608  ASP A CB    1 
ATOM   4459  C  CG    . ASP A 1 609  ? 23.385  18.314  151.857 1.00 73.29  ? 608  ASP A CG    1 
ATOM   4460  O  OD1   . ASP A 1 609  ? 22.508  17.441  151.994 1.00 75.75  ? 608  ASP A OD1   1 
ATOM   4461  O  OD2   . ASP A 1 609  ? 23.100  19.482  151.540 1.00 75.16  ? 608  ASP A OD2   1 
ATOM   4462  N  N     . ASP A 1 610  ? 25.412  17.376  148.525 1.00 62.88  ? 609  ASP A N     1 
ATOM   4463  C  CA    . ASP A 1 610  ? 25.666  18.035  147.252 1.00 61.01  ? 609  ASP A CA    1 
ATOM   4464  C  C     . ASP A 1 610  ? 24.410  18.671  146.653 1.00 59.64  ? 609  ASP A C     1 
ATOM   4465  O  O     . ASP A 1 610  ? 24.369  18.912  145.445 1.00 57.79  ? 609  ASP A O     1 
ATOM   4466  C  CB    . ASP A 1 610  ? 26.282  17.042  146.259 1.00 61.30  ? 609  ASP A CB    1 
ATOM   4467  C  CG    . ASP A 1 610  ? 27.156  17.720  145.231 1.00 60.00  ? 609  ASP A CG    1 
ATOM   4468  O  OD1   . ASP A 1 610  ? 27.334  18.948  145.337 1.00 60.68  ? 609  ASP A OD1   1 
ATOM   4469  O  OD2   . ASP A 1 610  ? 27.678  17.036  144.334 1.00 60.50  ? 609  ASP A OD2   1 
ATOM   4470  N  N     . SER A 1 611  ? 23.387  18.935  147.464 1.00 54.83  ? 610  SER A N     1 
ATOM   4471  C  CA    . SER A 1 611  ? 22.131  19.483  146.970 1.00 53.95  ? 610  SER A CA    1 
ATOM   4472  C  C     . SER A 1 611  ? 22.247  20.989  146.736 1.00 50.93  ? 610  SER A C     1 
ATOM   4473  O  O     . SER A 1 611  ? 23.228  21.627  147.112 1.00 50.22  ? 610  SER A O     1 
ATOM   4474  C  CB    . SER A 1 611  ? 20.999  19.183  147.952 1.00 52.55  ? 610  SER A CB    1 
ATOM   4475  O  OG    . SER A 1 611  ? 21.245  19.763  149.217 1.00 52.54  ? 610  SER A OG    1 
ATOM   4476  N  N     . LEU A 1 612  ? 21.225  21.554  146.085 1.00 57.36  ? 611  LEU A N     1 
ATOM   4477  C  CA    . LEU A 1 612  ? 21.209  22.995  145.844 1.00 59.76  ? 611  LEU A CA    1 
ATOM   4478  C  C     . LEU A 1 612  ? 21.207  23.772  147.150 1.00 57.87  ? 611  LEU A C     1 
ATOM   4479  O  O     . LEU A 1 612  ? 21.839  24.829  147.258 1.00 57.52  ? 611  LEU A O     1 
ATOM   4480  C  CB    . LEU A 1 612  ? 19.985  23.392  145.021 1.00 68.70  ? 611  LEU A CB    1 
ATOM   4481  C  CG    . LEU A 1 612  ? 19.955  23.244  143.505 1.00 72.79  ? 611  LEU A CG    1 
ATOM   4482  C  CD1   . LEU A 1 612  ? 19.173  21.989  143.059 1.00 73.91  ? 611  LEU A CD1   1 
ATOM   4483  C  CD2   . LEU A 1 612  ? 19.369  24.521  142.901 1.00 76.31  ? 611  LEU A CD2   1 
ATOM   4484  N  N     . ALA A 1 613  ? 20.479  23.271  148.146 1.00 56.10  ? 612  ALA A N     1 
ATOM   4485  C  CA    . ALA A 1 613  ? 20.343  23.967  149.414 1.00 56.37  ? 612  ALA A CA    1 
ATOM   4486  C  C     . ALA A 1 613  ? 21.648  24.025  150.200 1.00 52.43  ? 612  ALA A C     1 
ATOM   4487  O  O     . ALA A 1 613  ? 21.704  24.727  151.214 1.00 53.17  ? 612  ALA A O     1 
ATOM   4488  C  CB    . ALA A 1 613  ? 19.248  23.304  150.242 1.00 55.14  ? 612  ALA A CB    1 
ATOM   4489  N  N     . ASN A 1 614  ? 22.689  23.320  149.762 1.00 50.56  ? 613  ASN A N     1 
ATOM   4490  C  CA    . ASN A 1 614  ? 24.020  23.438  150.343 1.00 49.06  ? 613  ASN A CA    1 
ATOM   4491  C  C     . ASN A 1 614  ? 24.982  24.115  149.377 1.00 48.37  ? 613  ASN A C     1 
ATOM   4492  O  O     . ASN A 1 614  ? 26.157  23.763  149.292 1.00 46.80  ? 613  ASN A O     1 
ATOM   4493  C  CB    . ASN A 1 614  ? 24.564  22.075  150.756 1.00 47.54  ? 613  ASN A CB    1 
ATOM   4494  C  CG    . ASN A 1 614  ? 25.717  22.192  151.719 1.00 46.38  ? 613  ASN A CG    1 
ATOM   4495  O  OD1   . ASN A 1 614  ? 25.813  23.169  152.456 1.00 47.01  ? 613  ASN A OD1   1 
ATOM   4496  N  ND2   . ASN A 1 614  ? 26.597  21.205  151.720 1.00 44.81  ? 613  ASN A ND2   1 
ATOM   4497  N  N     . LYS A 1 615  ? 24.488  25.095  148.635 1.00 49.67  ? 614  LYS A N     1 
ATOM   4498  C  CA    . LYS A 1 615  ? 25.285  25.813  147.655 1.00 49.33  ? 614  LYS A CA    1 
ATOM   4499  C  C     . LYS A 1 615  ? 24.889  27.276  147.677 1.00 51.04  ? 614  LYS A C     1 
ATOM   4500  O  O     . LYS A 1 615  ? 23.707  27.604  147.796 1.00 52.72  ? 614  LYS A O     1 
ATOM   4501  C  CB    . LYS A 1 615  ? 25.078  25.289  146.219 1.00 49.17  ? 614  LYS A CB    1 
ATOM   4502  C  CG    . LYS A 1 615  ? 25.139  23.776  146.051 1.00 47.96  ? 614  LYS A CG    1 
ATOM   4503  C  CD    . LYS A 1 615  ? 25.954  23.376  144.832 1.00 46.86  ? 614  LYS A CD    1 
ATOM   4504  C  CE    . LYS A 1 615  ? 25.537  21.999  144.335 1.00 46.44  ? 614  LYS A CE    1 
ATOM   4505  N  NZ    . LYS A 1 615  ? 26.215  20.895  145.062 1.00 44.99  ? 614  LYS A NZ    1 
ATOM   4506  N  N     . VAL A 1 616  ? 25.880  28.142  147.528 1.00 50.72  ? 615  VAL A N     1 
ATOM   4507  C  CA    . VAL A 1 616  ? 25.660  29.567  147.354 1.00 52.36  ? 615  VAL A CA    1 
ATOM   4508  C  C     . VAL A 1 616  ? 26.689  30.087  146.367 1.00 51.81  ? 615  VAL A C     1 
ATOM   4509  O  O     . VAL A 1 616  ? 27.833  29.625  146.341 1.00 50.14  ? 615  VAL A O     1 
ATOM   4510  C  CB    . VAL A 1 616  ? 25.753  30.340  148.682 1.00 53.06  ? 615  VAL A CB    1 
ATOM   4511  C  CG1   . VAL A 1 616  ? 24.501  30.124  149.516 1.00 54.30  ? 615  VAL A CG1   1 
ATOM   4512  C  CG2   . VAL A 1 616  ? 27.009  29.931  149.446 1.00 51.27  ? 615  VAL A CG2   1 
ATOM   4513  N  N     . LEU A 1 617  ? 26.276  31.042  145.545 1.00 53.32  ? 616  LEU A N     1 
ATOM   4514  C  CA    . LEU A 1 617  ? 27.177  31.718  144.625 1.00 53.68  ? 616  LEU A CA    1 
ATOM   4515  C  C     . LEU A 1 617  ? 27.870  32.845  145.377 1.00 55.55  ? 616  LEU A C     1 
ATOM   4516  O  O     . LEU A 1 617  ? 27.207  33.723  145.934 1.00 62.95  ? 616  LEU A O     1 
ATOM   4517  C  CB    . LEU A 1 617  ? 26.413  32.259  143.418 1.00 56.43  ? 616  LEU A CB    1 
ATOM   4518  C  CG    . LEU A 1 617  ? 27.217  33.119  142.446 1.00 55.05  ? 616  LEU A CG    1 
ATOM   4519  C  CD1   . LEU A 1 617  ? 28.229  32.270  141.682 1.00 53.18  ? 616  LEU A CD1   1 
ATOM   4520  C  CD2   . LEU A 1 617  ? 26.288  33.848  141.488 1.00 57.08  ? 616  LEU A CD2   1 
ATOM   4521  N  N     . VAL A 1 618  ? 29.199  32.811  145.411 1.00 52.34  ? 617  VAL A N     1 
ATOM   4522  C  CA    . VAL A 1 618  ? 29.980  33.796  146.144 1.00 52.72  ? 617  VAL A CA    1 
ATOM   4523  C  C     . VAL A 1 618  ? 31.187  34.180  145.305 1.00 52.17  ? 617  VAL A C     1 
ATOM   4524  O  O     . VAL A 1 618  ? 31.573  33.480  144.369 1.00 51.10  ? 617  VAL A O     1 
ATOM   4525  C  CB    . VAL A 1 618  ? 30.448  33.283  147.529 1.00 51.58  ? 617  VAL A CB    1 
ATOM   4526  C  CG1   . VAL A 1 618  ? 29.291  32.669  148.318 1.00 51.93  ? 617  VAL A CG1   1 
ATOM   4527  C  CG2   . VAL A 1 618  ? 31.577  32.284  147.367 1.00 49.42  ? 617  VAL A CG2   1 
ATOM   4528  N  N     . TYR A 1 619  ? 31.778  35.318  145.650 1.00 53.06  ? 618  TYR A N     1 
ATOM   4529  C  CA    . TYR A 1 619  ? 33.059  35.696  145.072 1.00 52.56  ? 618  TYR A CA    1 
ATOM   4530  C  C     . TYR A 1 619  ? 34.113  34.639  145.386 1.00 50.35  ? 618  TYR A C     1 
ATOM   4531  O  O     . TYR A 1 619  ? 34.108  34.023  146.454 1.00 49.64  ? 618  TYR A O     1 
ATOM   4532  C  CB    . TYR A 1 619  ? 33.503  37.062  145.599 1.00 53.99  ? 618  TYR A CB    1 
ATOM   4533  C  CG    . TYR A 1 619  ? 32.786  38.228  144.946 1.00 56.28  ? 618  TYR A CG    1 
ATOM   4534  C  CD1   . TYR A 1 619  ? 31.416  38.381  145.063 1.00 59.32  ? 618  TYR A CD1   1 
ATOM   4535  C  CD2   . TYR A 1 619  ? 33.481  39.168  144.203 1.00 57.20  ? 618  TYR A CD2   1 
ATOM   4536  C  CE1   . TYR A 1 619  ? 30.762  39.437  144.467 1.00 59.86  ? 618  TYR A CE1   1 
ATOM   4537  C  CE2   . TYR A 1 619  ? 32.828  40.228  143.604 1.00 59.42  ? 618  TYR A CE2   1 
ATOM   4538  C  CZ    . TYR A 1 619  ? 31.471  40.357  143.738 1.00 60.74  ? 618  TYR A CZ    1 
ATOM   4539  O  OH    . TYR A 1 619  ? 30.819  41.410  143.133 1.00 63.08  ? 618  TYR A OH    1 
ATOM   4540  N  N     . ALA A 1 620  ? 35.029  34.435  144.434 1.00 49.56  ? 619  ALA A N     1 
ATOM   4541  C  CA    . ALA A 1 620  ? 35.962  33.313  144.523 1.00 47.54  ? 619  ALA A CA    1 
ATOM   4542  C  C     . ALA A 1 620  ? 36.885  33.444  145.728 1.00 46.93  ? 619  ALA A C     1 
ATOM   4543  O  O     . ALA A 1 620  ? 37.088  32.478  146.468 1.00 45.59  ? 619  ALA A O     1 
ATOM   4544  C  CB    . ALA A 1 620  ? 36.778  33.199  143.235 1.00 47.11  ? 619  ALA A CB    1 
ATOM   4545  N  N     . THR A 1 621  ? 37.457  34.635  145.940 1.00 48.00  ? 620  THR A N     1 
ATOM   4546  C  CA    . THR A 1 621  ? 38.373  34.821  147.060 1.00 47.56  ? 620  THR A CA    1 
ATOM   4547  C  C     . THR A 1 621  ? 37.678  34.594  148.392 1.00 47.58  ? 620  THR A C     1 
ATOM   4548  O  O     . THR A 1 621  ? 38.307  34.121  149.345 1.00 46.58  ? 620  THR A O     1 
ATOM   4549  C  CB    . THR A 1 621  ? 38.986  36.220  147.046 1.00 49.01  ? 620  THR A CB    1 
ATOM   4550  O  OG1   . THR A 1 621  ? 37.947  37.203  147.110 1.00 50.94  ? 620  THR A OG1   1 
ATOM   4551  C  CG2   . THR A 1 621  ? 39.828  36.434  145.809 1.00 49.00  ? 620  THR A CG2   1 
ATOM   4552  N  N     . ALA A 1 622  ? 36.393  34.932  148.482 1.00 48.83  ? 621  ALA A N     1 
ATOM   4553  C  CA    . ALA A 1 622  ? 35.663  34.714  149.723 1.00 49.02  ? 621  ALA A CA    1 
ATOM   4554  C  C     . ALA A 1 622  ? 35.404  33.237  149.962 1.00 47.41  ? 621  ALA A C     1 
ATOM   4555  O  O     . ALA A 1 622  ? 35.239  32.816  151.109 1.00 47.05  ? 621  ALA A O     1 
ATOM   4556  C  CB    . ALA A 1 622  ? 34.347  35.493  149.708 1.00 50.99  ? 621  ALA A CB    1 
ATOM   4557  N  N     . ASN A 1 623  ? 35.362  32.435  148.903 1.00 51.41  ? 622  ASN A N     1 
ATOM   4558  C  CA    . ASN A 1 623  ? 35.187  30.999  149.074 1.00 50.58  ? 622  ASN A CA    1 
ATOM   4559  C  C     . ASN A 1 623  ? 36.501  30.317  149.426 1.00 49.99  ? 622  ASN A C     1 
ATOM   4560  O  O     . ASN A 1 623  ? 36.511  29.344  150.186 1.00 46.75  ? 622  ASN A O     1 
ATOM   4561  C  CB    . ASN A 1 623  ? 34.577  30.400  147.804 1.00 50.31  ? 622  ASN A CB    1 
ATOM   4562  C  CG    . ASN A 1 623  ? 34.592  28.891  147.800 1.00 49.58  ? 622  ASN A CG    1 
ATOM   4563  O  OD1   . ASN A 1 623  ? 34.013  28.251  148.673 1.00 49.36  ? 622  ASN A OD1   1 
ATOM   4564  N  ND2   . ASN A 1 623  ? 35.236  28.312  146.799 1.00 48.77  ? 622  ASN A ND2   1 
ATOM   4565  N  N     . GLN A 1 624  ? 37.615  30.825  148.905 1.00 49.34  ? 623  GLN A N     1 
ATOM   4566  C  CA    . GLN A 1 624  ? 38.906  30.251  149.246 1.00 50.61  ? 623  GLN A CA    1 
ATOM   4567  C  C     . GLN A 1 624  ? 39.293  30.579  150.684 1.00 50.61  ? 623  GLN A C     1 
ATOM   4568  O  O     . GLN A 1 624  ? 39.853  29.731  151.390 1.00 51.56  ? 623  GLN A O     1 
ATOM   4569  C  CB    . GLN A 1 624  ? 39.963  30.745  148.264 1.00 52.00  ? 623  GLN A CB    1 
ATOM   4570  C  CG    . GLN A 1 624  ? 39.783  30.206  146.860 1.00 52.80  ? 623  GLN A CG    1 
ATOM   4571  C  CD    . GLN A 1 624  ? 39.813  28.700  146.803 1.00 52.23  ? 623  GLN A CD    1 
ATOM   4572  O  OE1   . GLN A 1 624  ? 38.770  28.045  146.700 1.00 54.66  ? 623  GLN A OE1   1 
ATOM   4573  N  NE2   . GLN A 1 624  ? 41.015  28.135  146.835 1.00 52.12  ? 623  GLN A NE2   1 
ATOM   4574  N  N     . GLU A 1 625  ? 38.992  31.794  151.147 1.00 55.20  ? 624  GLU A N     1 
ATOM   4575  C  CA    . GLU A 1 625  ? 39.315  32.120  152.529 1.00 56.02  ? 624  GLU A CA    1 
ATOM   4576  C  C     . GLU A 1 625  ? 38.415  31.370  153.500 1.00 50.95  ? 624  GLU A C     1 
ATOM   4577  O  O     . GLU A 1 625  ? 38.864  30.978  154.580 1.00 51.66  ? 624  GLU A O     1 
ATOM   4578  C  CB    . GLU A 1 625  ? 39.223  33.625  152.764 1.00 60.62  ? 624  GLU A CB    1 
ATOM   4579  C  CG    . GLU A 1 625  ? 39.953  34.065  154.016 1.00 63.63  ? 624  GLU A CG    1 
ATOM   4580  C  CD    . GLU A 1 625  ? 39.622  35.486  154.424 1.00 68.64  ? 624  GLU A CD    1 
ATOM   4581  O  OE1   . GLU A 1 625  ? 38.853  36.145  153.696 1.00 71.87  ? 624  GLU A OE1   1 
ATOM   4582  O  OE2   . GLU A 1 625  ? 40.126  35.940  155.477 1.00 70.51  ? 624  GLU A OE2   1 
ATOM   4583  N  N     . LYS A 1 626  ? 37.157  31.144  153.126 1.00 47.95  ? 625  LYS A N     1 
ATOM   4584  C  CA    . LYS A 1 626  ? 36.254  30.369  153.969 1.00 45.84  ? 625  LYS A CA    1 
ATOM   4585  C  C     . LYS A 1 626  ? 36.820  28.987  154.266 1.00 46.03  ? 625  LYS A C     1 
ATOM   4586  O  O     . LYS A 1 626  ? 36.640  28.463  155.370 1.00 47.04  ? 625  LYS A O     1 
ATOM   4587  C  CB    . LYS A 1 626  ? 34.885  30.255  153.300 1.00 47.49  ? 625  LYS A CB    1 
ATOM   4588  C  CG    . LYS A 1 626  ? 33.857  29.450  154.073 1.00 47.18  ? 625  LYS A CG    1 
ATOM   4589  C  CD    . LYS A 1 626  ? 32.597  29.297  153.259 1.00 46.34  ? 625  LYS A CD    1 
ATOM   4590  C  CE    . LYS A 1 626  ? 31.491  28.605  154.018 1.00 46.27  ? 625  LYS A CE    1 
ATOM   4591  N  NZ    . LYS A 1 626  ? 31.415  27.154  153.698 1.00 44.98  ? 625  LYS A NZ    1 
ATOM   4592  N  N     . GLY A 1 627  ? 37.508  28.385  153.300 1.00 41.00  ? 626  GLY A N     1 
ATOM   4593  C  CA    . GLY A 1 627  ? 38.111  27.078  153.459 1.00 39.47  ? 626  GLY A CA    1 
ATOM   4594  C  C     . GLY A 1 627  ? 37.106  26.017  153.864 1.00 39.25  ? 626  GLY A C     1 
ATOM   4595  O  O     . GLY A 1 627  ? 35.910  26.096  153.565 1.00 40.10  ? 626  GLY A O     1 
ATOM   4596  N  N     . GLN A 1 628  ? 37.603  25.001  154.570 1.00 44.37  ? 627  GLN A N     1 
ATOM   4597  C  CA    . GLN A 1 628  ? 36.779  23.881  155.023 1.00 43.99  ? 627  GLN A CA    1 
ATOM   4598  C  C     . GLN A 1 628  ? 36.061  24.262  156.319 1.00 45.20  ? 627  GLN A C     1 
ATOM   4599  O  O     . GLN A 1 628  ? 36.282  23.701  157.393 1.00 44.77  ? 627  GLN A O     1 
ATOM   4600  C  CB    . GLN A 1 628  ? 37.642  22.642  155.201 1.00 45.43  ? 627  GLN A CB    1 
ATOM   4601  C  CG    . GLN A 1 628  ? 36.880  21.349  155.443 1.00 48.07  ? 627  GLN A CG    1 
ATOM   4602  C  CD    . GLN A 1 628  ? 37.793  20.249  155.932 1.00 48.41  ? 627  GLN A CD    1 
ATOM   4603  O  OE1   . GLN A 1 628  ? 38.752  20.487  156.663 1.00 49.38  ? 627  GLN A OE1   1 
ATOM   4604  N  NE2   . GLN A 1 628  ? 37.490  19.025  155.532 1.00 49.20  ? 627  GLN A NE2   1 
ATOM   4605  N  N     . ARG A 1 629  ? 35.179  25.248  156.207 1.00 44.39  ? 628  ARG A N     1 
ATOM   4606  C  CA    . ARG A 1 629  ? 34.472  25.755  157.370 1.00 44.57  ? 628  ARG A CA    1 
ATOM   4607  C  C     . ARG A 1 629  ? 33.056  26.125  156.977 1.00 45.11  ? 628  ARG A C     1 
ATOM   4608  O  O     . ARG A 1 629  ? 32.766  26.382  155.810 1.00 46.10  ? 628  ARG A O     1 
ATOM   4609  C  CB    . ARG A 1 629  ? 35.171  26.979  157.979 1.00 43.87  ? 628  ARG A CB    1 
ATOM   4610  C  CG    . ARG A 1 629  ? 36.491  26.668  158.674 1.00 41.89  ? 628  ARG A CG    1 
ATOM   4611  C  CD    . ARG A 1 629  ? 37.128  27.908  159.265 1.00 41.85  ? 628  ARG A CD    1 
ATOM   4612  N  NE    . ARG A 1 629  ? 37.485  28.889  158.252 1.00 42.21  ? 628  ARG A NE    1 
ATOM   4613  C  CZ    . ARG A 1 629  ? 38.061  30.055  158.515 1.00 43.32  ? 628  ARG A CZ    1 
ATOM   4614  N  NH1   . ARG A 1 629  ? 38.351  30.383  159.762 1.00 43.47  ? 628  ARG A NH1   1 
ATOM   4615  N  NH2   . ARG A 1 629  ? 38.346  30.896  157.531 1.00 45.70  ? 628  ARG A NH2   1 
ATOM   4616  N  N     . THR A 1 630  ? 32.176  26.147  157.970 1.00 45.93  ? 629  THR A N     1 
ATOM   4617  C  CA    . THR A 1 630  ? 30.844  26.704  157.811 1.00 46.90  ? 629  THR A CA    1 
ATOM   4618  C  C     . THR A 1 630  ? 30.915  28.223  157.924 1.00 48.56  ? 629  THR A C     1 
ATOM   4619  O  O     . THR A 1 630  ? 31.873  28.763  158.485 1.00 50.07  ? 629  THR A O     1 
ATOM   4620  C  CB    . THR A 1 630  ? 29.911  26.151  158.880 1.00 48.76  ? 629  THR A CB    1 
ATOM   4621  O  OG1   . THR A 1 630  ? 30.241  26.739  160.139 1.00 52.59  ? 629  THR A OG1   1 
ATOM   4622  C  CG2   . THR A 1 630  ? 30.042  24.653  158.984 1.00 48.45  ? 629  THR A CG2   1 
ATOM   4623  N  N     . PRO A 1 631  ? 29.918  28.943  157.402 1.00 48.36  ? 630  PRO A N     1 
ATOM   4624  C  CA    . PRO A 1 631  ? 29.953  30.404  157.545 1.00 51.32  ? 630  PRO A CA    1 
ATOM   4625  C  C     . PRO A 1 631  ? 30.050  30.845  158.992 1.00 52.68  ? 630  PRO A C     1 
ATOM   4626  O  O     . PRO A 1 631  ? 30.814  31.768  159.307 1.00 56.27  ? 630  PRO A O     1 
ATOM   4627  C  CB    . PRO A 1 631  ? 28.644  30.857  156.892 1.00 52.56  ? 630  PRO A CB    1 
ATOM   4628  C  CG    . PRO A 1 631  ? 28.221  29.719  156.049 1.00 50.56  ? 630  PRO A CG    1 
ATOM   4629  C  CD    . PRO A 1 631  ? 28.699  28.491  156.725 1.00 48.99  ? 630  PRO A CD    1 
ATOM   4630  N  N     . TYR A 1 632  ? 29.306  30.192  159.887 1.00 57.45  ? 631  TYR A N     1 
ATOM   4631  C  CA    . TYR A 1 632  ? 29.387  30.524  161.304 1.00 58.39  ? 631  TYR A CA    1 
ATOM   4632  C  C     . TYR A 1 632  ? 30.820  30.433  161.806 1.00 58.99  ? 631  TYR A C     1 
ATOM   4633  O  O     . TYR A 1 632  ? 31.349  31.391  162.380 1.00 59.35  ? 631  TYR A O     1 
ATOM   4634  C  CB    . TYR A 1 632  ? 28.482  29.604  162.115 1.00 60.45  ? 631  TYR A CB    1 
ATOM   4635  C  CG    . TYR A 1 632  ? 28.706  29.739  163.599 1.00 61.54  ? 631  TYR A CG    1 
ATOM   4636  C  CD1   . TYR A 1 632  ? 28.399  30.920  164.261 1.00 63.37  ? 631  TYR A CD1   1 
ATOM   4637  C  CD2   . TYR A 1 632  ? 29.236  28.692  164.339 1.00 59.77  ? 631  TYR A CD2   1 
ATOM   4638  C  CE1   . TYR A 1 632  ? 28.606  31.054  165.624 1.00 63.44  ? 631  TYR A CE1   1 
ATOM   4639  C  CE2   . TYR A 1 632  ? 29.444  28.814  165.698 1.00 59.65  ? 631  TYR A CE2   1 
ATOM   4640  C  CZ    . TYR A 1 632  ? 29.128  29.998  166.335 1.00 62.13  ? 631  TYR A CZ    1 
ATOM   4641  O  OH    . TYR A 1 632  ? 29.332  30.124  167.687 1.00 63.25  ? 631  TYR A OH    1 
ATOM   4642  N  N     . GLN A 1 633  ? 31.469  29.289  161.579 1.00 52.60  ? 632  GLN A N     1 
ATOM   4643  C  CA    . GLN A 1 633  ? 32.845  29.120  162.026 1.00 53.05  ? 632  GLN A CA    1 
ATOM   4644  C  C     . GLN A 1 633  ? 33.792  30.092  161.342 1.00 51.81  ? 632  GLN A C     1 
ATOM   4645  O  O     . GLN A 1 633  ? 34.813  30.465  161.928 1.00 53.38  ? 632  GLN A O     1 
ATOM   4646  C  CB    . GLN A 1 633  ? 33.321  27.691  161.768 1.00 51.99  ? 632  GLN A CB    1 
ATOM   4647  C  CG    . GLN A 1 633  ? 32.481  26.596  162.394 1.00 53.02  ? 632  GLN A CG    1 
ATOM   4648  C  CD    . GLN A 1 633  ? 32.753  25.241  161.767 1.00 54.04  ? 632  GLN A CD    1 
ATOM   4649  O  OE1   . GLN A 1 633  ? 33.257  25.155  160.648 1.00 58.01  ? 632  GLN A OE1   1 
ATOM   4650  N  NE2   . GLN A 1 633  ? 32.426  24.175  162.486 1.00 54.15  ? 632  GLN A NE2   1 
ATOM   4651  N  N     . ALA A 1 634  ? 33.480  30.522  160.118 1.00 62.36  ? 633  ALA A N     1 
ATOM   4652  C  CA    . ALA A 1 634  ? 34.469  31.179  159.270 1.00 62.23  ? 633  ALA A CA    1 
ATOM   4653  C  C     . ALA A 1 634  ? 34.277  32.680  159.081 1.00 63.24  ? 633  ALA A C     1 
ATOM   4654  O  O     . ALA A 1 634  ? 35.276  33.391  158.955 1.00 65.68  ? 633  ALA A O     1 
ATOM   4655  C  CB    . ALA A 1 634  ? 34.498  30.510  157.890 1.00 61.16  ? 633  ALA A CB    1 
ATOM   4656  N  N     . LEU A 1 635  ? 33.038  33.184  159.061 1.00 52.95  ? 634  LEU A N     1 
ATOM   4657  C  CA    . LEU A 1 635  ? 32.801  34.542  158.572 1.00 53.29  ? 634  LEU A CA    1 
ATOM   4658  C  C     . LEU A 1 635  ? 33.541  35.584  159.398 1.00 53.05  ? 634  LEU A C     1 
ATOM   4659  O  O     . LEU A 1 635  ? 34.362  36.341  158.871 1.00 53.22  ? 634  LEU A O     1 
ATOM   4660  C  CB    . LEU A 1 635  ? 31.303  34.845  158.527 1.00 53.90  ? 634  LEU A CB    1 
ATOM   4661  C  CG    . LEU A 1 635  ? 30.712  34.671  157.122 1.00 53.91  ? 634  LEU A CG    1 
ATOM   4662  C  CD1   . LEU A 1 635  ? 29.228  34.999  157.084 1.00 55.80  ? 634  LEU A CD1   1 
ATOM   4663  C  CD2   . LEU A 1 635  ? 31.469  35.489  156.073 1.00 54.02  ? 634  LEU A CD2   1 
ATOM   4664  N  N     . ASP A 1 636  ? 33.245  35.647  160.695 1.00 59.01  ? 635  ASP A N     1 
ATOM   4665  C  CA    . ASP A 1 636  ? 33.835  36.676  161.543 1.00 62.11  ? 635  ASP A CA    1 
ATOM   4666  C  C     . ASP A 1 636  ? 35.358  36.693  161.455 1.00 60.05  ? 635  ASP A C     1 
ATOM   4667  O  O     . ASP A 1 636  ? 35.973  37.763  161.543 1.00 62.68  ? 635  ASP A O     1 
ATOM   4668  C  CB    . ASP A 1 636  ? 33.378  36.481  162.992 1.00 63.95  ? 635  ASP A CB    1 
ATOM   4669  C  CG    . ASP A 1 636  ? 31.886  36.728  163.177 1.00 67.37  ? 635  ASP A CG    1 
ATOM   4670  O  OD1   . ASP A 1 636  ? 31.306  37.529  162.409 1.00 70.03  ? 635  ASP A OD1   1 
ATOM   4671  O  OD2   . ASP A 1 636  ? 31.295  36.135  164.101 1.00 69.00  ? 635  ASP A OD2   1 
ATOM   4672  N  N     . SER A 1 637  ? 35.977  35.530  161.261 1.00 64.02  ? 636  SER A N     1 
ATOM   4673  C  CA    . SER A 1 637  ? 37.426  35.440  161.132 1.00 61.06  ? 636  SER A CA    1 
ATOM   4674  C  C     . SER A 1 637  ? 37.935  35.868  159.761 1.00 62.75  ? 636  SER A C     1 
ATOM   4675  O  O     . SER A 1 637  ? 39.135  36.124  159.617 1.00 59.38  ? 636  SER A O     1 
ATOM   4676  C  CB    . SER A 1 637  ? 37.888  34.009  161.407 1.00 59.64  ? 636  SER A CB    1 
ATOM   4677  O  OG    . SER A 1 637  ? 36.863  33.255  162.033 1.00 61.12  ? 636  SER A OG    1 
ATOM   4678  N  N     . MET A 1 638  ? 37.066  35.940  158.754 1.00 61.23  ? 637  MET A N     1 
ATOM   4679  C  CA    . MET A 1 638  ? 37.496  36.288  157.407 1.00 61.30  ? 637  MET A CA    1 
ATOM   4680  C  C     . MET A 1 638  ? 37.742  37.785  157.291 1.00 60.13  ? 637  MET A C     1 
ATOM   4681  O  O     . MET A 1 638  ? 36.940  38.597  157.754 1.00 65.50  ? 637  MET A O     1 
ATOM   4682  C  CB    . MET A 1 638  ? 36.450  35.860  156.384 1.00 60.56  ? 637  MET A CB    1 
ATOM   4683  C  CG    . MET A 1 638  ? 36.545  34.418  155.964 1.00 55.66  ? 637  MET A CG    1 
ATOM   4684  S  SD    . MET A 1 638  ? 35.295  34.063  154.721 1.00 56.27  ? 637  MET A SD    1 
ATOM   4685  C  CE    . MET A 1 638  ? 34.098  33.165  155.672 1.00 58.15  ? 637  MET A CE    1 
ATOM   4686  N  N     . ASP A 1 639  ? 38.856  38.145  156.653 1.00 54.66  ? 638  ASP A N     1 
ATOM   4687  C  CA    . ASP A 1 639  ? 39.239  39.552  156.569 1.00 56.90  ? 638  ASP A CA    1 
ATOM   4688  C  C     . ASP A 1 639  ? 38.333  40.329  155.622 1.00 59.02  ? 638  ASP A C     1 
ATOM   4689  O  O     . ASP A 1 639  ? 37.919  41.453  155.930 1.00 60.20  ? 638  ASP A O     1 
ATOM   4690  C  CB    . ASP A 1 639  ? 40.693  39.666  156.123 1.00 56.38  ? 638  ASP A CB    1 
ATOM   4691  C  CG    . ASP A 1 639  ? 41.659  39.210  157.179 1.00 54.89  ? 638  ASP A CG    1 
ATOM   4692  O  OD1   . ASP A 1 639  ? 41.302  39.255  158.374 1.00 56.37  ? 638  ASP A OD1   1 
ATOM   4693  O  OD2   . ASP A 1 639  ? 42.778  38.805  156.812 1.00 52.85  ? 638  ASP A OD2   1 
ATOM   4694  N  N     . ASP A 1 640  ? 38.047  39.774  154.469 1.00 61.87  ? 639  ASP A N     1 
ATOM   4695  C  CA    . ASP A 1 640  ? 37.198  40.463  153.572 1.00 63.14  ? 639  ASP A CA    1 
ATOM   4696  C  C     . ASP A 1 640  ? 35.889  39.790  153.664 1.00 62.66  ? 639  ASP A C     1 
ATOM   4697  O  O     . ASP A 1 640  ? 35.626  38.861  152.933 1.00 64.06  ? 639  ASP A O     1 
ATOM   4698  C  CB    . ASP A 1 640  ? 37.749  40.343  152.167 1.00 63.57  ? 639  ASP A CB    1 
ATOM   4699  C  CG    . ASP A 1 640  ? 36.785  40.803  151.117 1.00 65.22  ? 639  ASP A CG    1 
ATOM   4700  O  OD1   . ASP A 1 640  ? 35.709  41.307  151.442 1.00 66.36  ? 639  ASP A OD1   1 
ATOM   4701  O  OD2   . ASP A 1 640  ? 37.115  40.660  149.938 1.00 65.50  ? 639  ASP A OD2   1 
ATOM   4702  N  N     . ALA A 1 641  ? 35.048  40.252  154.565 1.00 59.49  ? 640  ALA A N     1 
ATOM   4703  C  CA    . ALA A 1 641  ? 33.737  39.671  154.682 1.00 60.59  ? 640  ALA A CA    1 
ATOM   4704  C  C     . ALA A 1 641  ? 32.827  40.482  155.563 1.00 61.27  ? 640  ALA A C     1 
ATOM   4705  O  O     . ALA A 1 641  ? 33.296  41.242  156.388 1.00 61.55  ? 640  ALA A O     1 
ATOM   4706  C  CB    . ALA A 1 641  ? 33.864  38.259  155.196 1.00 59.64  ? 640  ALA A CB    1 
ATOM   4707  N  N     . TRP A 1 642  ? 31.526  40.302  155.409 1.00 64.44  ? 641  TRP A N     1 
ATOM   4708  C  CA    . TRP A 1 642  ? 30.609  40.980  156.289 1.00 66.55  ? 641  TRP A CA    1 
ATOM   4709  C  C     . TRP A 1 642  ? 30.508  40.124  157.523 1.00 65.84  ? 641  TRP A C     1 
ATOM   4710  O  O     . TRP A 1 642  ? 30.876  38.980  157.489 1.00 65.21  ? 641  TRP A O     1 
ATOM   4711  C  CB    . TRP A 1 642  ? 29.274  41.381  155.662 1.00 68.19  ? 641  TRP A CB    1 
ATOM   4712  C  CG    . TRP A 1 642  ? 28.342  40.339  155.258 1.00 66.42  ? 641  TRP A CG    1 
ATOM   4713  C  CD1   . TRP A 1 642  ? 28.527  39.022  155.305 1.00 64.13  ? 641  TRP A CD1   1 
ATOM   4714  C  CD2   . TRP A 1 642  ? 27.059  40.548  154.710 1.00 65.76  ? 641  TRP A CD2   1 
ATOM   4715  N  NE1   . TRP A 1 642  ? 27.434  38.372  154.835 1.00 64.02  ? 641  TRP A NE1   1 
ATOM   4716  C  CE2   . TRP A 1 642  ? 26.511  39.295  154.454 1.00 64.34  ? 641  TRP A CE2   1 
ATOM   4717  C  CE3   . TRP A 1 642  ? 26.314  41.684  154.404 1.00 68.69  ? 641  TRP A CE3   1 
ATOM   4718  C  CZ2   . TRP A 1 642  ? 25.249  39.132  153.905 1.00 65.46  ? 641  TRP A CZ2   1 
ATOM   4719  C  CZ3   . TRP A 1 642  ? 25.064  41.527  153.870 1.00 69.78  ? 641  TRP A CZ3   1 
ATOM   4720  C  CH2   . TRP A 1 642  ? 24.540  40.261  153.628 1.00 68.09  ? 641  TRP A CH2   1 
ATOM   4721  N  N     . SER A 1 643  ? 30.053  40.690  158.615 1.00 67.40  ? 642  SER A N     1 
ATOM   4722  C  CA    . SER A 1 643  ? 29.945  39.980  159.855 1.00 66.64  ? 642  SER A CA    1 
ATOM   4723  C  C     . SER A 1 643  ? 28.902  38.904  159.825 1.00 64.75  ? 642  SER A C     1 
ATOM   4724  O  O     . SER A 1 643  ? 27.950  38.988  159.096 1.00 66.30  ? 642  SER A O     1 
ATOM   4725  C  CB    . SER A 1 643  ? 29.559  40.965  160.941 1.00 68.90  ? 642  SER A CB    1 
ATOM   4726  O  OG    . SER A 1 643  ? 28.190  41.297  160.851 1.00 70.19  ? 642  SER A OG    1 
ATOM   4727  N  N     . PHE A 1 644  ? 29.086  37.878  160.636 1.00 62.19  ? 643  PHE A N     1 
ATOM   4728  C  CA    . PHE A 1 644  ? 28.084  36.819  160.689 1.00 62.03  ? 643  PHE A CA    1 
ATOM   4729  C  C     . PHE A 1 644  ? 26.725  37.358  161.120 1.00 65.50  ? 643  PHE A C     1 
ATOM   4730  O  O     . PHE A 1 644  ? 25.688  36.803  160.743 1.00 67.50  ? 643  PHE A O     1 
ATOM   4731  C  CB    . PHE A 1 644  ? 28.549  35.711  161.635 1.00 60.85  ? 643  PHE A CB    1 
ATOM   4732  C  CG    . PHE A 1 644  ? 27.582  34.574  161.759 1.00 58.44  ? 643  PHE A CG    1 
ATOM   4733  C  CD1   . PHE A 1 644  ? 27.441  33.656  160.738 1.00 57.35  ? 643  PHE A CD1   1 
ATOM   4734  C  CD2   . PHE A 1 644  ? 26.808  34.426  162.889 1.00 59.58  ? 643  PHE A CD2   1 
ATOM   4735  C  CE1   . PHE A 1 644  ? 26.544  32.609  160.847 1.00 56.91  ? 643  PHE A CE1   1 
ATOM   4736  C  CE2   . PHE A 1 644  ? 25.916  33.382  163.007 1.00 59.40  ? 643  PHE A CE2   1 
ATOM   4737  C  CZ    . PHE A 1 644  ? 25.785  32.473  161.989 1.00 58.07  ? 643  PHE A CZ    1 
ATOM   4738  N  N     . ARG A 1 645  ? 26.689  38.432  161.882 1.00 67.11  ? 644  ARG A N     1 
ATOM   4739  C  CA    . ARG A 1 645  ? 25.423  39.012  162.276 1.00 70.84  ? 644  ARG A CA    1 
ATOM   4740  C  C     . ARG A 1 645  ? 24.673  39.569  161.083 1.00 72.49  ? 644  ARG A C     1 
ATOM   4741  O  O     . ARG A 1 645  ? 23.498  39.341  160.908 1.00 69.97  ? 644  ARG A O     1 
ATOM   4742  C  CB    . ARG A 1 645  ? 25.660  40.072  163.325 1.00 74.51  ? 644  ARG A CB    1 
ATOM   4743  C  CG    . ARG A 1 645  ? 24.819  41.314  163.207 1.00 78.05  ? 644  ARG A CG    1 
ATOM   4744  C  CD    . ARG A 1 645  ? 25.348  42.333  164.192 1.00 80.03  ? 644  ARG A CD    1 
ATOM   4745  N  NE    . ARG A 1 645  ? 26.531  43.019  163.702 1.00 80.23  ? 644  ARG A NE    1 
ATOM   4746  C  CZ    . ARG A 1 645  ? 26.505  43.886  162.710 1.00 83.06  ? 644  ARG A CZ    1 
ATOM   4747  N  NH1   . ARG A 1 645  ? 25.356  44.152  162.124 1.00 85.97  ? 644  ARG A NH1   1 
ATOM   4748  N  NH2   . ARG A 1 645  ? 27.617  44.483  162.313 1.00 82.34  ? 644  ARG A NH2   1 
ATOM   4749  N  N     . GLU A 1 646  ? 25.392  40.226  160.199 1.00 68.52  ? 645  GLU A N     1 
ATOM   4750  C  CA    . GLU A 1 646  ? 24.789  40.759  159.002 1.00 70.74  ? 645  GLU A CA    1 
ATOM   4751  C  C     . GLU A 1 646  ? 24.218  39.651  158.142 1.00 69.04  ? 645  GLU A C     1 
ATOM   4752  O  O     . GLU A 1 646  ? 23.118  39.764  157.619 1.00 71.45  ? 645  GLU A O     1 
ATOM   4753  C  CB    . GLU A 1 646  ? 25.814  41.523  158.229 1.00 69.82  ? 645  GLU A CB    1 
ATOM   4754  C  CG    . GLU A 1 646  ? 26.676  42.371  159.108 1.00 71.04  ? 645  GLU A CG    1 
ATOM   4755  C  CD    . GLU A 1 646  ? 27.184  43.551  158.365 1.00 72.10  ? 645  GLU A CD    1 
ATOM   4756  O  OE1   . GLU A 1 646  ? 26.458  44.043  157.505 1.00 73.88  ? 645  GLU A OE1   1 
ATOM   4757  O  OE2   . GLU A 1 646  ? 28.306  43.987  158.630 1.00 71.55  ? 645  GLU A OE2   1 
ATOM   4758  N  N     . LEU A 1 647  ? 24.943  38.549  158.027 1.00 71.68  ? 646  LEU A N     1 
ATOM   4759  C  CA    . LEU A 1 647  ? 24.463  37.425  157.271 1.00 71.54  ? 646  LEU A CA    1 
ATOM   4760  C  C     . LEU A 1 647  ? 23.219  36.878  157.896 1.00 74.03  ? 646  LEU A C     1 
ATOM   4761  O  O     . LEU A 1 647  ? 22.277  36.588  157.205 1.00 74.10  ? 646  LEU A O     1 
ATOM   4762  C  CB    . LEU A 1 647  ? 25.492  36.315  157.185 1.00 70.52  ? 646  LEU A CB    1 
ATOM   4763  C  CG    . LEU A 1 647  ? 24.896  35.149  156.415 1.00 70.11  ? 646  LEU A CG    1 
ATOM   4764  C  CD1   . LEU A 1 647  ? 25.188  35.310  154.947 1.00 68.99  ? 646  LEU A CD1   1 
ATOM   4765  C  CD2   . LEU A 1 647  ? 25.360  33.805  156.909 1.00 68.16  ? 646  LEU A CD2   1 
ATOM   4766  N  N     . LYS A 1 648  ? 23.163  36.793  159.216 1.00 66.82  ? 647  LYS A N     1 
ATOM   4767  C  CA    . LYS A 1 648  ? 21.968  36.290  159.867 1.00 68.43  ? 647  LYS A CA    1 
ATOM   4768  C  C     . LYS A 1 648  ? 20.795  37.169  159.557 1.00 69.87  ? 647  LYS A C     1 
ATOM   4769  O  O     . LYS A 1 648  ? 19.722  36.684  159.231 1.00 70.78  ? 647  LYS A O     1 
ATOM   4770  C  CB    . LYS A 1 648  ? 22.106  36.347  161.373 1.00 67.43  ? 647  LYS A CB    1 
ATOM   4771  C  CG    . LYS A 1 648  ? 23.354  35.767  161.974 1.00 65.06  ? 647  LYS A CG    1 
ATOM   4772  C  CD    . LYS A 1 648  ? 23.063  35.445  163.419 1.00 65.86  ? 647  LYS A CD    1 
ATOM   4773  C  CE    . LYS A 1 648  ? 21.689  34.831  163.561 1.00 67.39  ? 647  LYS A CE    1 
ATOM   4774  N  NZ    . LYS A 1 648  ? 21.319  34.687  164.984 1.00 68.06  ? 647  LYS A NZ    1 
ATOM   4775  N  N     . ALA A 1 649  ? 21.011  38.475  159.612 1.00 80.25  ? 648  ALA A N     1 
ATOM   4776  C  CA    . ALA A 1 649  ? 19.942  39.395  159.360 1.00 83.20  ? 648  ALA A CA    1 
ATOM   4777  C  C     . ALA A 1 649  ? 19.414  39.209  157.982 1.00 83.57  ? 648  ALA A C     1 
ATOM   4778  O  O     . ALA A 1 649  ? 18.236  38.977  157.819 1.00 84.84  ? 648  ALA A O     1 
ATOM   4779  C  CB    . ALA A 1 649  ? 20.456  40.806  159.505 1.00 86.84  ? 648  ALA A CB    1 
ATOM   4780  N  N     . PHE A 1 650  ? 20.303  39.126  157.017 1.00 79.08  ? 649  PHE A N     1 
ATOM   4781  C  CA    . PHE A 1 650  ? 19.884  38.989  155.644 1.00 78.80  ? 649  PHE A CA    1 
ATOM   4782  C  C     . PHE A 1 650  ? 19.115  37.723  155.448 1.00 77.97  ? 649  PHE A C     1 
ATOM   4783  O  O     . PHE A 1 650  ? 18.033  37.750  154.913 1.00 77.64  ? 649  PHE A O     1 
ATOM   4784  C  CB    . PHE A 1 650  ? 21.124  38.970  154.773 1.00 76.27  ? 649  PHE A CB    1 
ATOM   4785  C  CG    . PHE A 1 650  ? 20.856  39.024  153.307 1.00 76.11  ? 649  PHE A CG    1 
ATOM   4786  C  CD1   . PHE A 1 650  ? 20.101  38.069  152.692 1.00 78.10  ? 649  PHE A CD1   1 
ATOM   4787  C  CD2   . PHE A 1 650  ? 21.417  40.005  152.542 1.00 74.70  ? 649  PHE A CD2   1 
ATOM   4788  C  CE1   . PHE A 1 650  ? 19.875  38.114  151.342 1.00 77.09  ? 649  PHE A CE1   1 
ATOM   4789  C  CE2   . PHE A 1 650  ? 21.192  40.058  151.189 1.00 74.54  ? 649  PHE A CE2   1 
ATOM   4790  C  CZ    . PHE A 1 650  ? 20.415  39.107  150.587 1.00 75.83  ? 649  PHE A CZ    1 
ATOM   4791  N  N     . VAL A 1 651  ? 19.605  36.637  156.007 1.00 69.84  ? 650  VAL A N     1 
ATOM   4792  C  CA    . VAL A 1 651  ? 18.926  35.383  155.796 1.00 70.17  ? 650  VAL A CA    1 
ATOM   4793  C  C     . VAL A 1 651  ? 17.539  35.366  156.366 1.00 70.96  ? 650  VAL A C     1 
ATOM   4794  O  O     . VAL A 1 651  ? 16.621  34.935  155.675 1.00 71.69  ? 650  VAL A O     1 
ATOM   4795  C  CB    . VAL A 1 651  ? 19.748  34.191  156.295 1.00 66.24  ? 650  VAL A CB    1 
ATOM   4796  C  CG1   . VAL A 1 651  ? 19.005  32.897  156.066 1.00 65.32  ? 650  VAL A CG1   1 
ATOM   4797  C  CG2   . VAL A 1 651  ? 21.038  34.143  155.537 1.00 64.21  ? 650  VAL A CG2   1 
ATOM   4798  N  N     . ARG A 1 652  ? 17.359  35.836  157.599 1.00 74.26  ? 651  ARG A N     1 
ATOM   4799  C  CA    . ARG A 1 652  ? 15.989  35.791  158.132 1.00 80.55  ? 651  ARG A CA    1 
ATOM   4800  C  C     . ARG A 1 652  ? 15.081  36.790  157.495 1.00 85.66  ? 651  ARG A C     1 
ATOM   4801  O  O     . ARG A 1 652  ? 13.893  36.564  157.386 1.00 89.51  ? 651  ARG A O     1 
ATOM   4802  C  CB    . ARG A 1 652  ? 15.817  35.716  159.651 1.00 82.21  ? 651  ARG A CB    1 
ATOM   4803  C  CG    . ARG A 1 652  ? 16.802  36.439  160.534 1.00 84.59  ? 651  ARG A CG    1 
ATOM   4804  C  CD    . ARG A 1 652  ? 16.993  35.659  161.828 1.00 85.43  ? 651  ARG A CD    1 
ATOM   4805  N  NE    . ARG A 1 652  ? 17.741  36.435  162.804 1.00 87.59  ? 651  ARG A NE    1 
ATOM   4806  C  CZ    . ARG A 1 652  ? 17.749  36.184  164.101 1.00 87.51  ? 651  ARG A CZ    1 
ATOM   4807  N  NH1   . ARG A 1 652  ? 17.048  35.172  164.574 1.00 85.24  ? 651  ARG A NH1   1 
ATOM   4808  N  NH2   . ARG A 1 652  ? 18.455  36.949  164.920 1.00 89.82  ? 651  ARG A NH2   1 
ATOM   4809  N  N     . GLU A 1 653  ? 15.648  37.932  157.132 1.00 97.98  ? 652  GLU A N     1 
ATOM   4810  C  CA    . GLU A 1 653  ? 14.892  39.036  156.556 1.00 103.07 ? 652  GLU A CA    1 
ATOM   4811  C  C     . GLU A 1 653  ? 14.213  38.762  155.220 1.00 101.22 ? 652  GLU A C     1 
ATOM   4812  O  O     . GLU A 1 653  ? 13.094  39.221  154.988 1.00 104.54 ? 652  GLU A O     1 
ATOM   4813  C  CB    . GLU A 1 653  ? 15.786  40.275  156.431 1.00 109.97 ? 652  GLU A CB    1 
ATOM   4814  C  CG    . GLU A 1 653  ? 15.108  41.465  155.772 1.00 114.66 ? 652  GLU A CG    1 
ATOM   4815  C  CD    . GLU A 1 653  ? 15.847  42.766  156.016 1.00 119.88 ? 652  GLU A CD    1 
ATOM   4816  O  OE1   . GLU A 1 653  ? 15.306  43.834  155.662 1.00 121.23 ? 652  GLU A OE1   1 
ATOM   4817  O  OE2   . GLU A 1 653  ? 16.970  42.720  156.561 1.00 122.79 ? 652  GLU A OE2   1 
ATOM   4818  N  N     . SER A 1 654  ? 14.876  38.022  154.340 1.00 90.75  ? 653  SER A N     1 
ATOM   4819  C  CA    . SER A 1 654  ? 14.310  37.802  153.006 1.00 92.09  ? 653  SER A CA    1 
ATOM   4820  C  C     . SER A 1 654  ? 13.283  36.676  152.822 1.00 86.21  ? 653  SER A C     1 
ATOM   4821  O  O     . SER A 1 654  ? 12.988  35.904  153.735 1.00 82.91  ? 653  SER A O     1 
ATOM   4822  C  CB    . SER A 1 654  ? 15.440  37.630  151.984 1.00 75.76  ? 653  SER A CB    1 
ATOM   4823  O  OG    . SER A 1 654  ? 16.507  38.523  152.248 1.00 76.02  ? 653  SER A OG    1 
ATOM   4824  N  N     . LYS A 1 655  ? 12.759  36.623  151.600 1.00 99.37  ? 654  LYS A N     1 
ATOM   4825  C  CA    . LYS A 1 655  ? 11.771  35.661  151.130 1.00 101.33 ? 654  LYS A CA    1 
ATOM   4826  C  C     . LYS A 1 655  ? 12.222  35.049  149.811 1.00 98.93  ? 654  LYS A C     1 
ATOM   4827  O  O     . LYS A 1 655  ? 11.436  34.919  148.873 1.00 99.99  ? 654  LYS A O     1 
ATOM   4828  C  CB    . LYS A 1 655  ? 10.407  36.332  150.961 1.00 106.54 ? 654  LYS A CB    1 
ATOM   4829  C  CG    . LYS A 1 655  ? 9.415   36.009  152.067 1.00 111.19 ? 654  LYS A CG    1 
ATOM   4830  C  CD    . LYS A 1 655  ? 8.054   36.624  151.784 1.00 111.67 ? 654  LYS A CD    1 
ATOM   4831  C  CE    . LYS A 1 655  ? 8.132   38.141  151.735 1.00 114.14 ? 654  LYS A CE    1 
ATOM   4832  N  NZ    . LYS A 1 655  ? 6.875   38.745  151.214 1.00 114.17 ? 654  LYS A NZ    1 
ATOM   4833  N  N     . THR A 1 656  ? 13.496  34.674  149.747 1.00 92.58  ? 655  THR A N     1 
ATOM   4834  C  CA    . THR A 1 656  ? 14.057  34.083  148.538 1.00 88.32  ? 655  THR A CA    1 
ATOM   4835  C  C     . THR A 1 656  ? 14.758  32.755  148.809 1.00 83.37  ? 655  THR A C     1 
ATOM   4836  O  O     . THR A 1 656  ? 14.672  31.828  148.003 1.00 79.67  ? 655  THR A O     1 
ATOM   4837  C  CB    . THR A 1 656  ? 15.048  35.042  147.852 1.00 87.52  ? 655  THR A CB    1 
ATOM   4838  O  OG1   . THR A 1 656  ? 15.926  35.608  148.832 1.00 84.10  ? 655  THR A OG1   1 
ATOM   4839  C  CG2   . THR A 1 656  ? 14.302  36.159  147.139 1.00 91.73  ? 655  THR A CG2   1 
ATOM   4840  N  N     . LEU A 1 657  ? 15.451  32.663  149.940 1.00 74.21  ? 656  LEU A N     1 
ATOM   4841  C  CA    . LEU A 1 657  ? 16.162  31.440  150.279 1.00 69.27  ? 656  LEU A CA    1 
ATOM   4842  C  C     . LEU A 1 657  ? 15.196  30.361  150.752 1.00 69.32  ? 656  LEU A C     1 
ATOM   4843  O  O     . LEU A 1 657  ? 14.189  30.642  151.403 1.00 75.87  ? 656  LEU A O     1 
ATOM   4844  C  CB    . LEU A 1 657  ? 17.193  31.715  151.374 1.00 66.65  ? 656  LEU A CB    1 
ATOM   4845  C  CG    . LEU A 1 657  ? 18.319  32.739  151.181 1.00 65.51  ? 656  LEU A CG    1 
ATOM   4846  C  CD1   . LEU A 1 657  ? 18.463  33.667  152.389 1.00 63.96  ? 656  LEU A CD1   1 
ATOM   4847  C  CD2   . LEU A 1 657  ? 19.648  32.081  150.810 1.00 68.00  ? 656  LEU A CD2   1 
ATOM   4848  N  N     . SER A 1 658  ? 15.517  29.110  150.433 1.00 65.71  ? 657  SER A N     1 
ATOM   4849  C  CA    . SER A 1 658  ? 14.658  28.016  150.852 1.00 66.05  ? 657  SER A CA    1 
ATOM   4850  C  C     . SER A 1 658  ? 14.783  27.791  152.358 1.00 65.88  ? 657  SER A C     1 
ATOM   4851  O  O     . SER A 1 658  ? 15.681  28.311  153.024 1.00 66.76  ? 657  SER A O     1 
ATOM   4852  C  CB    . SER A 1 658  ? 14.991  26.741  150.080 1.00 64.23  ? 657  SER A CB    1 
ATOM   4853  O  OG    . SER A 1 658  ? 16.212  26.171  150.508 1.00 61.88  ? 657  SER A OG    1 
ATOM   4854  N  N     . ASN A 1 659  ? 13.847  27.006  152.893 1.00 76.32  ? 658  ASN A N     1 
ATOM   4855  C  CA    . ASN A 1 659  ? 13.844  26.708  154.322 1.00 76.57  ? 658  ASN A CA    1 
ATOM   4856  C  C     . ASN A 1 659  ? 15.113  25.981  154.733 1.00 74.94  ? 658  ASN A C     1 
ATOM   4857  O  O     . ASN A 1 659  ? 15.761  26.341  155.722 1.00 73.30  ? 658  ASN A O     1 
ATOM   4858  C  CB    . ASN A 1 659  ? 12.617  25.871  154.678 1.00 81.05  ? 658  ASN A CB    1 
ATOM   4859  C  CG    . ASN A 1 659  ? 11.568  26.664  155.414 1.00 86.37  ? 658  ASN A CG    1 
ATOM   4860  O  OD1   . ASN A 1 659  ? 11.636  27.890  155.486 1.00 89.01  ? 658  ASN A OD1   1 
ATOM   4861  N  ND2   . ASN A 1 659  ? 10.590  25.966  155.977 1.00 87.66  ? 658  ASN A ND2   1 
ATOM   4862  N  N     . LYS A 1 660  ? 15.482  24.944  153.982 1.00 68.49  ? 659  LYS A N     1 
ATOM   4863  C  CA    . LYS A 1 660  ? 16.666  24.168  154.323 1.00 64.39  ? 659  LYS A CA    1 
ATOM   4864  C  C     . LYS A 1 660  ? 17.947  24.943  154.042 1.00 58.84  ? 659  LYS A C     1 
ATOM   4865  O  O     . LYS A 1 660  ? 18.949  24.757  154.737 1.00 57.38  ? 659  LYS A O     1 
ATOM   4866  C  CB    . LYS A 1 660  ? 16.652  22.841  153.567 1.00 60.56  ? 659  LYS A CB    1 
ATOM   4867  C  CG    . LYS A 1 660  ? 18.024  22.216  153.372 1.00 56.66  ? 659  LYS A CG    1 
ATOM   4868  C  CD    . LYS A 1 660  ? 17.905  20.872  152.681 1.00 57.77  ? 659  LYS A CD    1 
ATOM   4869  C  CE    . LYS A 1 660  ? 19.261  20.176  152.586 1.00 57.23  ? 659  LYS A CE    1 
ATOM   4870  N  NZ    . LYS A 1 660  ? 19.111  18.700  152.530 1.00 58.66  ? 659  LYS A NZ    1 
ATOM   4871  N  N     . LYS A 1 661  ? 17.934  25.828  153.051 1.00 63.42  ? 660  LYS A N     1 
ATOM   4872  C  CA    . LYS A 1 661  ? 19.111  26.652  152.810 1.00 62.47  ? 660  LYS A CA    1 
ATOM   4873  C  C     . LYS A 1 661  ? 19.360  27.615  153.960 1.00 64.35  ? 660  LYS A C     1 
ATOM   4874  O  O     . LYS A 1 661  ? 20.508  27.993  154.215 1.00 62.33  ? 660  LYS A O     1 
ATOM   4875  C  CB    . LYS A 1 661  ? 18.956  27.418  151.495 1.00 64.89  ? 660  LYS A CB    1 
ATOM   4876  C  CG    . LYS A 1 661  ? 19.968  28.526  151.301 1.00 65.01  ? 660  LYS A CG    1 
ATOM   4877  C  CD    . LYS A 1 661  ? 20.316  28.699  149.851 1.00 65.38  ? 660  LYS A CD    1 
ATOM   4878  C  CE    . LYS A 1 661  ? 20.974  27.450  149.317 1.00 63.99  ? 660  LYS A CE    1 
ATOM   4879  N  NZ    . LYS A 1 661  ? 21.327  27.595  147.886 1.00 64.43  ? 660  LYS A NZ    1 
ATOM   4880  N  N     . LYS A 1 662  ? 18.307  28.008  154.678 1.00 67.35  ? 661  LYS A N     1 
ATOM   4881  C  CA    . LYS A 1 662  ? 18.478  28.961  155.768 1.00 69.52  ? 661  LYS A CA    1 
ATOM   4882  C  C     . LYS A 1 662  ? 19.134  28.309  156.982 1.00 67.43  ? 661  LYS A C     1 
ATOM   4883  O  O     . LYS A 1 662  ? 20.001  28.916  157.621 1.00 67.71  ? 661  LYS A O     1 
ATOM   4884  C  CB    . LYS A 1 662  ? 17.133  29.587  156.140 1.00 71.69  ? 661  LYS A CB    1 
ATOM   4885  C  CG    . LYS A 1 662  ? 16.602  30.559  155.094 1.00 70.79  ? 661  LYS A CG    1 
ATOM   4886  C  CD    . LYS A 1 662  ? 15.610  31.555  155.678 1.00 71.51  ? 661  LYS A CD    1 
ATOM   4887  C  CE    . LYS A 1 662  ? 14.224  31.381  155.087 1.00 73.65  ? 661  LYS A CE    1 
ATOM   4888  N  NZ    . LYS A 1 662  ? 13.362  32.576  155.313 1.00 77.55  ? 661  LYS A NZ    1 
ATOM   4889  N  N     . GLU A 1 663  ? 18.743  27.074  157.313 1.00 68.56  ? 662  GLU A N     1 
ATOM   4890  C  CA    . GLU A 1 663  ? 19.382  26.377  158.426 1.00 68.48  ? 662  GLU A CA    1 
ATOM   4891  C  C     . GLU A 1 663  ? 20.871  26.191  158.176 1.00 65.93  ? 662  GLU A C     1 
ATOM   4892  O  O     . GLU A 1 663  ? 21.692  26.427  159.067 1.00 64.00  ? 662  GLU A O     1 
ATOM   4893  C  CB    . GLU A 1 663  ? 18.731  25.016  158.652 1.00 72.83  ? 662  GLU A CB    1 
ATOM   4894  C  CG    . GLU A 1 663  ? 17.238  24.981  158.473 1.00 79.73  ? 662  GLU A CG    1 
ATOM   4895  C  CD    . GLU A 1 663  ? 16.702  23.569  158.548 1.00 83.26  ? 662  GLU A CD    1 
ATOM   4896  O  OE1   . GLU A 1 663  ? 15.777  23.243  157.775 1.00 85.50  ? 662  GLU A OE1   1 
ATOM   4897  O  OE2   . GLU A 1 663  ? 17.216  22.781  159.373 1.00 83.32  ? 662  GLU A OE2   1 
ATOM   4898  N  N     . TYR A 1 664  ? 21.236  25.768  156.967 1.00 62.84  ? 663  TYR A N     1 
ATOM   4899  C  CA    . TYR A 1 664  ? 22.627  25.446  156.679 1.00 53.38  ? 663  TYR A CA    1 
ATOM   4900  C  C     . TYR A 1 664  ? 23.510  26.681  156.691 1.00 53.29  ? 663  TYR A C     1 
ATOM   4901  O  O     . TYR A 1 664  ? 24.703  26.581  156.979 1.00 51.81  ? 663  TYR A O     1 
ATOM   4902  C  CB    . TYR A 1 664  ? 22.736  24.738  155.331 1.00 62.27  ? 663  TYR A CB    1 
ATOM   4903  C  CG    . TYR A 1 664  ? 22.310  23.290  155.353 1.00 61.03  ? 663  TYR A CG    1 
ATOM   4904  C  CD1   . TYR A 1 664  ? 21.075  22.915  155.858 1.00 61.88  ? 663  TYR A CD1   1 
ATOM   4905  C  CD2   . TYR A 1 664  ? 23.139  22.297  154.854 1.00 59.06  ? 663  TYR A CD2   1 
ATOM   4906  C  CE1   . TYR A 1 664  ? 20.681  21.597  155.874 1.00 61.96  ? 663  TYR A CE1   1 
ATOM   4907  C  CE2   . TYR A 1 664  ? 22.756  20.972  154.869 1.00 59.36  ? 663  TYR A CE2   1 
ATOM   4908  C  CZ    . TYR A 1 664  ? 21.524  20.629  155.378 1.00 62.86  ? 663  TYR A CZ    1 
ATOM   4909  O  OH    . TYR A 1 664  ? 21.130  19.313  155.393 1.00 65.61  ? 663  TYR A OH    1 
ATOM   4910  N  N     . LEU A 1 665  ? 22.965  27.845  156.372 1.00 62.57  ? 664  LEU A N     1 
ATOM   4911  C  CA    . LEU A 1 665  ? 23.802  29.033  156.353 1.00 62.97  ? 664  LEU A CA    1 
ATOM   4912  C  C     . LEU A 1 665  ? 24.078  29.579  157.743 1.00 64.06  ? 664  LEU A C     1 
ATOM   4913  O  O     . LEU A 1 665  ? 24.971  30.420  157.889 1.00 67.31  ? 664  LEU A O     1 
ATOM   4914  C  CB    . LEU A 1 665  ? 23.162  30.120  155.486 1.00 65.08  ? 664  LEU A CB    1 
ATOM   4915  C  CG    . LEU A 1 665  ? 23.502  30.055  153.994 1.00 62.93  ? 664  LEU A CG    1 
ATOM   4916  C  CD1   . LEU A 1 665  ? 22.346  30.598  153.178 1.00 64.70  ? 664  LEU A CD1   1 
ATOM   4917  C  CD2   . LEU A 1 665  ? 24.781  30.827  153.681 1.00 60.84  ? 664  LEU A CD2   1 
ATOM   4918  N  N     . LEU A 1 666  ? 23.357  29.110  158.766 1.00 63.05  ? 665  LEU A N     1 
ATOM   4919  C  CA    . LEU A 1 666  ? 23.459  29.693  160.095 1.00 64.16  ? 665  LEU A CA    1 
ATOM   4920  C  C     . LEU A 1 666  ? 23.635  28.668  161.207 1.00 63.85  ? 665  LEU A C     1 
ATOM   4921  O  O     . LEU A 1 666  ? 23.580  29.052  162.379 1.00 65.76  ? 665  LEU A O     1 
ATOM   4922  C  CB    . LEU A 1 666  ? 22.224  30.552  160.401 1.00 66.11  ? 665  LEU A CB    1 
ATOM   4923  C  CG    . LEU A 1 666  ? 21.909  31.735  159.484 1.00 64.43  ? 665  LEU A CG    1 
ATOM   4924  C  CD1   . LEU A 1 666  ? 20.819  32.594  160.084 1.00 67.54  ? 665  LEU A CD1   1 
ATOM   4925  C  CD2   . LEU A 1 666  ? 23.136  32.568  159.224 1.00 61.13  ? 665  LEU A CD2   1 
ATOM   4926  N  N     . THR A 1 667  ? 23.829  27.387  160.893 1.00 61.50  ? 666  THR A N     1 
ATOM   4927  C  CA    . THR A 1 667  ? 24.051  26.411  161.954 1.00 59.96  ? 666  THR A CA    1 
ATOM   4928  C  C     . THR A 1 667  ? 25.283  26.794  162.740 1.00 57.91  ? 666  THR A C     1 
ATOM   4929  O  O     . THR A 1 667  ? 26.384  26.860  162.192 1.00 56.30  ? 666  THR A O     1 
ATOM   4930  C  CB    . THR A 1 667  ? 24.219  25.000  161.402 1.00 58.07  ? 666  THR A CB    1 
ATOM   4931  O  OG1   . THR A 1 667  ? 24.864  25.051  160.122 1.00 57.78  ? 666  THR A OG1   1 
ATOM   4932  C  CG2   . THR A 1 667  ? 22.873  24.293  161.310 1.00 58.87  ? 666  THR A CG2   1 
ATOM   4933  N  N     . GLU A 1 668  ? 25.091  27.064  164.021 1.00 65.88  ? 667  GLU A N     1 
ATOM   4934  C  CA    . GLU A 1 668  ? 26.202  27.273  164.931 1.00 66.57  ? 667  GLU A CA    1 
ATOM   4935  C  C     . GLU A 1 668  ? 26.746  25.968  165.473 1.00 65.76  ? 667  GLU A C     1 
ATOM   4936  O  O     . GLU A 1 668  ? 27.449  25.960  166.487 1.00 65.25  ? 667  GLU A O     1 
ATOM   4937  C  CB    . GLU A 1 668  ? 25.773  28.206  166.058 1.00 71.94  ? 667  GLU A CB    1 
ATOM   4938  C  CG    . GLU A 1 668  ? 25.486  29.599  165.551 1.00 75.60  ? 667  GLU A CG    1 
ATOM   4939  C  CD    . GLU A 1 668  ? 24.358  30.268  166.280 1.00 78.40  ? 667  GLU A CD    1 
ATOM   4940  O  OE1   . GLU A 1 668  ? 23.492  30.863  165.601 1.00 80.35  ? 667  GLU A OE1   1 
ATOM   4941  O  OE2   . GLU A 1 668  ? 24.338  30.199  167.526 1.00 78.69  ? 667  GLU A OE2   1 
ATOM   4942  N  N     . GLU A 1 669  ? 26.418  24.871  164.802 1.00 54.62  ? 668  GLU A N     1 
ATOM   4943  C  CA    . GLU A 1 669  ? 26.904  23.550  165.157 1.00 56.17  ? 668  GLU A CA    1 
ATOM   4944  C  C     . GLU A 1 669  ? 28.325  23.400  164.646 1.00 51.69  ? 668  GLU A C     1 
ATOM   4945  O  O     . GLU A 1 669  ? 28.581  23.580  163.453 1.00 50.94  ? 668  GLU A O     1 
ATOM   4946  C  CB    . GLU A 1 669  ? 25.989  22.497  164.548 1.00 59.40  ? 668  GLU A CB    1 
ATOM   4947  C  CG    . GLU A 1 669  ? 26.261  21.074  164.940 1.00 60.72  ? 668  GLU A CG    1 
ATOM   4948  C  CD    . GLU A 1 669  ? 25.078  20.186  164.609 1.00 65.46  ? 668  GLU A CD    1 
ATOM   4949  O  OE1   . GLU A 1 669  ? 23.931  20.680  164.715 1.00 73.45  ? 668  GLU A OE1   1 
ATOM   4950  O  OE2   . GLU A 1 669  ? 25.287  19.013  164.224 1.00 66.43  ? 668  GLU A OE2   1 
ATOM   4951  N  N     . ASP A 1 670  ? 29.256  23.093  165.546 1.00 61.43  ? 669  ASP A N     1 
ATOM   4952  C  CA    . ASP A 1 670  ? 30.651  22.898  165.158 1.00 65.58  ? 669  ASP A CA    1 
ATOM   4953  C  C     . ASP A 1 670  ? 30.805  21.489  164.590 1.00 66.15  ? 669  ASP A C     1 
ATOM   4954  O  O     . ASP A 1 670  ? 31.382  20.586  165.201 1.00 65.71  ? 669  ASP A O     1 
ATOM   4955  C  CB    . ASP A 1 670  ? 31.588  23.137  166.331 1.00 70.03  ? 669  ASP A CB    1 
ATOM   4956  C  CG    . ASP A 1 670  ? 33.033  23.243  165.900 1.00 73.09  ? 669  ASP A CG    1 
ATOM   4957  O  OD1   . ASP A 1 670  ? 33.626  22.207  165.534 1.00 73.41  ? 669  ASP A OD1   1 
ATOM   4958  O  OD2   . ASP A 1 670  ? 33.578  24.363  165.926 1.00 76.82  ? 669  ASP A OD2   1 
ATOM   4959  N  N     . ILE A 1 671  ? 30.255  21.310  163.388 1.00 61.13  ? 670  ILE A N     1 
ATOM   4960  C  CA    . ILE A 1 671  ? 30.353  20.022  162.728 1.00 59.30  ? 670  ILE A CA    1 
ATOM   4961  C  C     . ILE A 1 671  ? 31.821  19.696  162.487 1.00 58.63  ? 670  ILE A C     1 
ATOM   4962  O  O     . ILE A 1 671  ? 32.675  20.586  162.391 1.00 62.23  ? 670  ILE A O     1 
ATOM   4963  C  CB    . ILE A 1 671  ? 29.551  20.010  161.416 1.00 56.85  ? 670  ILE A CB    1 
ATOM   4964  C  CG1   . ILE A 1 671  ? 29.943  21.188  160.519 1.00 55.80  ? 670  ILE A CG1   1 
ATOM   4965  C  CG2   . ILE A 1 671  ? 28.070  20.042  161.709 1.00 58.18  ? 670  ILE A CG2   1 
ATOM   4966  C  CD1   . ILE A 1 671  ? 30.958  20.847  159.469 1.00 53.49  ? 670  ILE A CD1   1 
ATOM   4967  N  N     . SER A 1 672  ? 32.119  18.406  162.399 1.00 56.08  ? 671  SER A N     1 
ATOM   4968  C  CA    . SER A 1 672  ? 33.490  17.971  162.219 1.00 51.53  ? 671  SER A CA    1 
ATOM   4969  C  C     . SER A 1 672  ? 33.495  16.661  161.456 1.00 47.53  ? 671  SER A C     1 
ATOM   4970  O  O     . SER A 1 672  ? 32.503  15.928  161.431 1.00 46.97  ? 671  SER A O     1 
ATOM   4971  C  CB    . SER A 1 672  ? 34.207  17.811  163.562 1.00 47.93  ? 671  SER A CB    1 
ATOM   4972  O  OG    . SER A 1 672  ? 35.383  17.049  163.404 1.00 44.02  ? 671  SER A OG    1 
ATOM   4973  N  N     . LYS A 1 673  ? 34.617  16.359  160.851 1.00 49.49  ? 672  LYS A N     1 
ATOM   4974  C  CA    . LYS A 1 673  ? 34.758  15.149  160.069 1.00 51.21  ? 672  LYS A CA    1 
ATOM   4975  C  C     . LYS A 1 673  ? 34.741  13.881  160.874 1.00 53.85  ? 672  LYS A C     1 
ATOM   4976  O  O     . LYS A 1 673  ? 34.513  12.824  160.334 1.00 53.16  ? 672  LYS A O     1 
ATOM   4977  C  CB    . LYS A 1 673  ? 36.059  15.223  159.283 1.00 52.26  ? 672  LYS A CB    1 
ATOM   4978  C  CG    . LYS A 1 673  ? 36.311  16.603  158.717 1.00 53.60  ? 672  LYS A CG    1 
ATOM   4979  C  CD    . LYS A 1 673  ? 37.101  17.517  159.639 1.00 53.96  ? 672  LYS A CD    1 
ATOM   4980  C  CE    . LYS A 1 673  ? 38.385  17.959  158.968 1.00 55.21  ? 672  LYS A CE    1 
ATOM   4981  N  NZ    . LYS A 1 673  ? 39.089  18.984  159.752 1.00 57.06  ? 672  LYS A NZ    1 
ATOM   4982  N  N     . PHE A 1 674  ? 34.966  13.991  162.174 1.00 50.43  ? 673  PHE A N     1 
ATOM   4983  C  CA    . PHE A 1 674  ? 35.056  12.819  163.031 1.00 48.01  ? 673  PHE A CA    1 
ATOM   4984  C  C     . PHE A 1 674  ? 33.919  12.736  164.040 1.00 51.19  ? 673  PHE A C     1 
ATOM   4985  O  O     . PHE A 1 674  ? 33.991  11.929  164.969 1.00 50.79  ? 673  PHE A O     1 
ATOM   4986  C  CB    . PHE A 1 674  ? 36.419  12.796  163.731 1.00 40.20  ? 673  PHE A CB    1 
ATOM   4987  C  CG    . PHE A 1 674  ? 37.579  12.815  162.773 1.00 36.46  ? 673  PHE A CG    1 
ATOM   4988  C  CD1   . PHE A 1 674  ? 37.983  11.660  162.132 1.00 34.10  ? 673  PHE A CD1   1 
ATOM   4989  C  CD2   . PHE A 1 674  ? 38.248  13.990  162.496 1.00 34.36  ? 673  PHE A CD2   1 
ATOM   4990  C  CE1   . PHE A 1 674  ? 39.038  11.673  161.232 1.00 33.18  ? 673  PHE A CE1   1 
ATOM   4991  C  CE2   . PHE A 1 674  ? 39.306  14.010  161.602 1.00 33.44  ? 673  PHE A CE2   1 
ATOM   4992  C  CZ    . PHE A 1 674  ? 39.695  12.849  160.968 1.00 32.86  ? 673  PHE A CZ    1 
ATOM   4993  N  N     . ASP A 1 675  ? 32.868  13.535  163.872 1.00 55.89  ? 674  ASP A N     1 
ATOM   4994  C  CA    . ASP A 1 675  ? 31.717  13.447  164.759 1.00 62.74  ? 674  ASP A CA    1 
ATOM   4995  C  C     . ASP A 1 675  ? 31.077  12.070  164.665 1.00 66.06  ? 674  ASP A C     1 
ATOM   4996  O  O     . ASP A 1 675  ? 30.922  11.510  163.578 1.00 67.24  ? 674  ASP A O     1 
ATOM   4997  C  CB    . ASP A 1 675  ? 30.688  14.524  164.411 1.00 64.23  ? 674  ASP A CB    1 
ATOM   4998  C  CG    . ASP A 1 675  ? 31.145  15.916  164.799 1.00 65.03  ? 674  ASP A CG    1 
ATOM   4999  O  OD1   . ASP A 1 675  ? 32.081  16.035  165.624 1.00 64.49  ? 674  ASP A OD1   1 
ATOM   5000  O  OD2   . ASP A 1 675  ? 30.557  16.893  164.285 1.00 66.00  ? 674  ASP A OD2   1 
ATOM   5001  N  N     . VAL A 1 676  ? 30.708  11.523  165.817 1.00 75.19  ? 675  VAL A N     1 
ATOM   5002  C  CA    . VAL A 1 676  ? 30.096  10.206  165.871 1.00 77.91  ? 675  VAL A CA    1 
ATOM   5003  C  C     . VAL A 1 676  ? 28.704  10.260  165.254 1.00 79.38  ? 675  VAL A C     1 
ATOM   5004  O  O     . VAL A 1 676  ? 28.369  9.458   164.383 1.00 80.90  ? 675  VAL A O     1 
ATOM   5005  C  CB    . VAL A 1 676  ? 30.040  9.675   167.318 1.00 79.19  ? 675  VAL A CB    1 
ATOM   5006  N  N     . ILE A 1 681  ? 23.164  10.656  154.798 1.00 51.53  ? 680  ILE A N     1 
ATOM   5007  C  CA    . ILE A 1 681  ? 23.452  11.339  153.539 1.00 50.75  ? 680  ILE A CA    1 
ATOM   5008  C  C     . ILE A 1 681  ? 22.573  10.775  152.429 1.00 52.08  ? 680  ILE A C     1 
ATOM   5009  O  O     . ILE A 1 681  ? 22.107  9.640   152.512 1.00 57.54  ? 680  ILE A O     1 
ATOM   5010  C  CB    . ILE A 1 681  ? 24.931  11.230  153.166 1.00 46.81  ? 680  ILE A CB    1 
ATOM   5011  C  CG1   . ILE A 1 681  ? 25.210  9.880   152.511 1.00 44.63  ? 680  ILE A CG1   1 
ATOM   5012  C  CG2   . ILE A 1 681  ? 25.780  11.382  154.402 1.00 46.67  ? 680  ILE A CG2   1 
ATOM   5013  C  CD1   . ILE A 1 681  ? 26.681  9.588   152.293 1.00 42.65  ? 680  ILE A CD1   1 
ATOM   5014  N  N     . GLU A 1 682  ? 22.358  11.576  151.382 1.00 53.52  ? 681  GLU A N     1 
ATOM   5015  C  CA    . GLU A 1 682  ? 21.393  11.195  150.356 1.00 55.33  ? 681  GLU A CA    1 
ATOM   5016  C  C     . GLU A 1 682  ? 21.931  10.099  149.453 1.00 53.87  ? 681  GLU A C     1 
ATOM   5017  O  O     . GLU A 1 682  ? 21.150  9.317   148.903 1.00 52.92  ? 681  GLU A O     1 
ATOM   5018  C  CB    . GLU A 1 682  ? 20.985  12.416  149.536 1.00 59.51  ? 681  GLU A CB    1 
ATOM   5019  C  CG    . GLU A 1 682  ? 19.993  13.311  150.246 1.00 63.94  ? 681  GLU A CG    1 
ATOM   5020  C  CD    . GLU A 1 682  ? 18.706  12.589  150.588 1.00 68.94  ? 681  GLU A CD    1 
ATOM   5021  O  OE1   . GLU A 1 682  ? 17.798  12.549  149.735 1.00 72.63  ? 681  GLU A OE1   1 
ATOM   5022  O  OE2   . GLU A 1 682  ? 18.603  12.058  151.711 1.00 73.01  ? 681  GLU A OE2   1 
ATOM   5023  N  N     . ARG A 1 683  ? 23.226  9.958   149.363 1.00 49.02  ? 682  ARG A N     1 
ATOM   5024  C  CA    . ARG A 1 683  ? 23.780  8.921   148.557 1.00 49.61  ? 682  ARG A CA    1 
ATOM   5025  C  C     . ARG A 1 683  ? 23.273  7.597   149.088 1.00 51.44  ? 682  ARG A C     1 
ATOM   5026  O  O     . ARG A 1 683  ? 23.071  6.663   148.350 1.00 52.07  ? 682  ARG A O     1 
ATOM   5027  C  CB    . ARG A 1 683  ? 25.294  8.976   148.643 1.00 47.16  ? 682  ARG A CB    1 
ATOM   5028  C  CG    . ARG A 1 683  ? 25.982  8.031   147.710 1.00 47.34  ? 682  ARG A CG    1 
ATOM   5029  C  CD    . ARG A 1 683  ? 27.332  7.601   148.221 1.00 46.36  ? 682  ARG A CD    1 
ATOM   5030  N  NE    . ARG A 1 683  ? 27.848  6.527   147.387 1.00 45.77  ? 682  ARG A NE    1 
ATOM   5031  C  CZ    . ARG A 1 683  ? 29.092  6.427   146.975 1.00 46.07  ? 682  ARG A CZ    1 
ATOM   5032  N  NH1   . ARG A 1 683  ? 29.967  7.328   147.321 1.00 47.87  ? 682  ARG A NH1   1 
ATOM   5033  N  NH2   . ARG A 1 683  ? 29.449  5.426   146.210 1.00 45.29  ? 682  ARG A NH2   1 
ATOM   5034  N  N     . ASN A 1 684  ? 23.091  7.498   150.389 1.00 62.37  ? 683  ASN A N     1 
ATOM   5035  C  CA    . ASN A 1 684  ? 22.632  6.248   150.985 1.00 62.33  ? 683  ASN A CA    1 
ATOM   5036  C  C     . ASN A 1 684  ? 21.257  5.864   150.470 1.00 59.43  ? 683  ASN A C     1 
ATOM   5037  O  O     . ASN A 1 684  ? 20.981  4.680   150.250 1.00 58.25  ? 683  ASN A O     1 
ATOM   5038  C  CB    . ASN A 1 684  ? 22.601  6.365   152.509 1.00 66.84  ? 683  ASN A CB    1 
ATOM   5039  C  CG    . ASN A 1 684  ? 23.974  6.515   153.112 1.00 68.09  ? 683  ASN A CG    1 
ATOM   5040  O  OD1   . ASN A 1 684  ? 24.975  6.563   152.404 1.00 68.13  ? 683  ASN A OD1   1 
ATOM   5041  N  ND2   . ASN A 1 684  ? 24.029  6.592   154.436 1.00 70.09  ? 683  ASN A ND2   1 
ATOM   5042  N  N     . LEU A 1 685  ? 20.377  6.846   150.288 1.00 55.23  ? 684  LEU A N     1 
ATOM   5043  C  CA    . LEU A 1 685  ? 19.022  6.550   149.845 1.00 53.15  ? 684  LEU A CA    1 
ATOM   5044  C  C     . LEU A 1 685  ? 18.980  6.215   148.362 1.00 50.64  ? 684  LEU A C     1 
ATOM   5045  O  O     . LEU A 1 685  ? 18.304  5.263   147.965 1.00 51.71  ? 684  LEU A O     1 
ATOM   5046  C  CB    . LEU A 1 685  ? 18.100  7.726   150.161 1.00 51.82  ? 684  LEU A CB    1 
ATOM   5047  C  CG    . LEU A 1 685  ? 16.627  7.587   149.775 1.00 53.91  ? 684  LEU A CG    1 
ATOM   5048  C  CD1   . LEU A 1 685  ? 16.037  6.299   150.317 1.00 54.99  ? 684  LEU A CD1   1 
ATOM   5049  C  CD2   . LEU A 1 685  ? 15.830  8.782   150.268 1.00 55.09  ? 684  LEU A CD2   1 
ATOM   5050  N  N     . VAL A 1 686  ? 19.701  6.967   147.532 1.00 49.53  ? 685  VAL A N     1 
ATOM   5051  C  CA    . VAL A 1 686  ? 19.729  6.672   146.102 1.00 49.52  ? 685  VAL A CA    1 
ATOM   5052  C  C     . VAL A 1 686  ? 20.240  5.258   145.863 1.00 49.11  ? 685  VAL A C     1 
ATOM   5053  O  O     . VAL A 1 686  ? 19.642  4.478   145.114 1.00 50.86  ? 685  VAL A O     1 
ATOM   5054  C  CB    . VAL A 1 686  ? 20.589  7.706   145.357 1.00 48.32  ? 685  VAL A CB    1 
ATOM   5055  C  CG1   . VAL A 1 686  ? 20.699  7.338   143.893 1.00 48.30  ? 685  VAL A CG1   1 
ATOM   5056  C  CG2   . VAL A 1 686  ? 20.014  9.097   145.521 1.00 48.98  ? 685  VAL A CG2   1 
ATOM   5057  N  N     . ASP A 1 687  ? 21.349  4.904   146.507 1.00 49.54  ? 686  ASP A N     1 
ATOM   5058  C  CA    . ASP A 1 687  ? 22.002  3.630   146.242 1.00 49.77  ? 686  ASP A CA    1 
ATOM   5059  C  C     . ASP A 1 687  ? 21.261  2.449   146.850 1.00 49.85  ? 686  ASP A C     1 
ATOM   5060  O  O     . ASP A 1 687  ? 21.337  1.339   146.313 1.00 49.75  ? 686  ASP A O     1 
ATOM   5061  C  CB    . ASP A 1 687  ? 23.438  3.662   146.757 1.00 50.42  ? 686  ASP A CB    1 
ATOM   5062  C  CG    . ASP A 1 687  ? 24.291  4.680   146.038 1.00 50.90  ? 686  ASP A CG    1 
ATOM   5063  O  OD1   . ASP A 1 687  ? 23.888  5.157   144.955 1.00 52.29  ? 686  ASP A OD1   1 
ATOM   5064  O  OD2   . ASP A 1 687  ? 25.370  5.006   146.563 1.00 49.38  ? 686  ASP A OD2   1 
ATOM   5065  N  N     . THR A 1 688  ? 20.560  2.647   147.963 1.00 49.43  ? 687  THR A N     1 
ATOM   5066  C  CA    . THR A 1 688  ? 19.724  1.571   148.479 1.00 50.93  ? 687  THR A CA    1 
ATOM   5067  C  C     . THR A 1 688  ? 18.584  1.265   147.519 1.00 52.54  ? 687  THR A C     1 
ATOM   5068  O  O     . THR A 1 688  ? 18.292  0.097   147.237 1.00 53.44  ? 687  THR A O     1 
ATOM   5069  C  CB    . THR A 1 688  ? 19.165  1.942   149.851 1.00 51.63  ? 687  THR A CB    1 
ATOM   5070  O  OG1   . THR A 1 688  ? 20.216  2.503   150.661 1.00 50.12  ? 687  THR A OG1   1 
ATOM   5071  C  CG2   . THR A 1 688  ? 18.586  0.711   150.534 1.00 52.99  ? 687  THR A CG2   1 
ATOM   5072  N  N     . ARG A 1 689  ? 17.913  2.312   147.031 1.00 53.05  ? 688  ARG A N     1 
ATOM   5073  C  CA    . ARG A 1 689  ? 16.893  2.137   146.006 1.00 54.53  ? 688  ARG A CA    1 
ATOM   5074  C  C     . ARG A 1 689  ? 17.460  1.428   144.788 1.00 54.03  ? 688  ARG A C     1 
ATOM   5075  O  O     . ARG A 1 689  ? 16.834  0.510   144.251 1.00 55.31  ? 688  ARG A O     1 
ATOM   5076  C  CB    . ARG A 1 689  ? 16.311  3.492   145.613 1.00 54.93  ? 688  ARG A CB    1 
ATOM   5077  C  CG    . ARG A 1 689  ? 15.533  4.145   146.732 1.00 55.91  ? 688  ARG A CG    1 
ATOM   5078  C  CD    . ARG A 1 689  ? 15.251  5.600   146.446 1.00 56.01  ? 688  ARG A CD    1 
ATOM   5079  N  NE    . ARG A 1 689  ? 14.149  6.096   147.260 1.00 57.64  ? 688  ARG A NE    1 
ATOM   5080  C  CZ    . ARG A 1 689  ? 13.793  7.372   147.329 1.00 58.05  ? 688  ARG A CZ    1 
ATOM   5081  N  NH1   . ARG A 1 689  ? 14.457  8.284   146.635 1.00 56.93  ? 688  ARG A NH1   1 
ATOM   5082  N  NH2   . ARG A 1 689  ? 12.775  7.736   148.092 1.00 59.71  ? 688  ARG A NH2   1 
ATOM   5083  N  N     . TYR A 1 690  ? 18.654  1.833   144.352 1.00 52.26  ? 689  TYR A N     1 
ATOM   5084  C  CA    . TYR A 1 690  ? 19.265  1.228   143.175 1.00 51.78  ? 689  TYR A CA    1 
ATOM   5085  C  C     . TYR A 1 690  ? 19.550  -0.248  143.418 1.00 52.06  ? 689  TYR A C     1 
ATOM   5086  O  O     . TYR A 1 690  ? 19.178  -1.106  142.608 1.00 53.05  ? 689  TYR A O     1 
ATOM   5087  C  CB    . TYR A 1 690  ? 20.534  2.007   142.797 1.00 49.89  ? 689  TYR A CB    1 
ATOM   5088  C  CG    . TYR A 1 690  ? 21.195  1.628   141.465 1.00 49.40  ? 689  TYR A CG    1 
ATOM   5089  C  CD1   . TYR A 1 690  ? 20.803  0.512   140.754 1.00 50.46  ? 689  TYR A CD1   1 
ATOM   5090  C  CD2   . TYR A 1 690  ? 22.222  2.392   140.928 1.00 47.98  ? 689  TYR A CD2   1 
ATOM   5091  C  CE1   . TYR A 1 690  ? 21.405  0.163   139.569 1.00 50.12  ? 689  TYR A CE1   1 
ATOM   5092  C  CE2   . TYR A 1 690  ? 22.830  2.039   139.728 1.00 47.64  ? 689  TYR A CE2   1 
ATOM   5093  C  CZ    . TYR A 1 690  ? 22.411  0.920   139.055 1.00 48.72  ? 689  TYR A CZ    1 
ATOM   5094  O  OH    . TYR A 1 690  ? 22.983  0.531   137.861 1.00 48.54  ? 689  TYR A OH    1 
ATOM   5095  N  N     . ALA A 1 691  ? 20.187  -0.565  144.541 1.00 51.32  ? 690  ALA A N     1 
ATOM   5096  C  CA    . ALA A 1 691  ? 20.571  -1.946  144.799 1.00 51.57  ? 690  ALA A CA    1 
ATOM   5097  C  C     . ALA A 1 691  ? 19.351  -2.853  144.909 1.00 53.66  ? 690  ALA A C     1 
ATOM   5098  O  O     . ALA A 1 691  ? 19.293  -3.908  144.270 1.00 54.45  ? 690  ALA A O     1 
ATOM   5099  C  CB    . ALA A 1 691  ? 21.422  -2.020  146.066 1.00 50.51  ? 690  ALA A CB    1 
ATOM   5100  N  N     . SER A 1 692  ? 18.365  -2.458  145.723 1.00 58.94  ? 691  SER A N     1 
ATOM   5101  C  CA    . SER A 1 692  ? 17.177  -3.285  145.928 1.00 60.88  ? 691  SER A CA    1 
ATOM   5102  C  C     . SER A 1 692  ? 16.467  -3.544  144.616 1.00 63.73  ? 691  SER A C     1 
ATOM   5103  O  O     . SER A 1 692  ? 16.022  -4.660  144.334 1.00 66.79  ? 691  SER A O     1 
ATOM   5104  C  CB    . SER A 1 692  ? 16.218  -2.591  146.885 1.00 63.06  ? 691  SER A CB    1 
ATOM   5105  O  OG    . SER A 1 692  ? 16.784  -2.458  148.158 1.00 62.70  ? 691  SER A OG    1 
ATOM   5106  N  N     . ARG A 1 693  ? 16.343  -2.507  143.812 1.00 57.60  ? 692  ARG A N     1 
ATOM   5107  C  CA    . ARG A 1 693  ? 15.689  -2.626  142.526 1.00 58.70  ? 692  ARG A CA    1 
ATOM   5108  C  C     . ARG A 1 693  ? 16.366  -3.663  141.639 1.00 58.48  ? 692  ARG A C     1 
ATOM   5109  O  O     . ARG A 1 693  ? 15.714  -4.581  141.137 1.00 60.09  ? 692  ARG A O     1 
ATOM   5110  C  CB    . ARG A 1 693  ? 15.703  -1.271  141.859 1.00 57.98  ? 692  ARG A CB    1 
ATOM   5111  C  CG    . ARG A 1 693  ? 15.366  -1.352  140.431 1.00 58.69  ? 692  ARG A CG    1 
ATOM   5112  C  CD    . ARG A 1 693  ? 14.168  -0.563  140.175 1.00 60.09  ? 692  ARG A CD    1 
ATOM   5113  N  NE    . ARG A 1 693  ? 13.650  -0.723  138.835 1.00 61.17  ? 692  ARG A NE    1 
ATOM   5114  C  CZ    . ARG A 1 693  ? 13.192  0.302   138.122 1.00 61.52  ? 692  ARG A CZ    1 
ATOM   5115  N  NH1   . ARG A 1 693  ? 12.711  0.093   136.893 1.00 62.62  ? 692  ARG A NH1   1 
ATOM   5116  N  NH2   . ARG A 1 693  ? 13.241  1.558   138.611 1.00 60.84  ? 692  ARG A NH2   1 
ATOM   5117  N  N     . VAL A 1 694  ? 17.680  -3.542  141.439 1.00 56.61  ? 693  VAL A N     1 
ATOM   5118  C  CA    . VAL A 1 694  ? 18.387  -4.449  140.536 1.00 56.41  ? 693  VAL A CA    1 
ATOM   5119  C  C     . VAL A 1 694  ? 18.183  -5.891  140.955 1.00 57.68  ? 693  VAL A C     1 
ATOM   5120  O  O     . VAL A 1 694  ? 17.960  -6.777  140.121 1.00 58.81  ? 693  VAL A O     1 
ATOM   5121  C  CB    . VAL A 1 694  ? 19.876  -4.079  140.486 1.00 54.26  ? 693  VAL A CB    1 
ATOM   5122  C  CG1   . VAL A 1 694  ? 20.687  -5.187  139.842 1.00 54.17  ? 693  VAL A CG1   1 
ATOM   5123  C  CG2   . VAL A 1 694  ? 20.020  -2.830  139.714 1.00 53.41  ? 693  VAL A CG2   1 
ATOM   5124  N  N     . VAL A 1 695  ? 18.240  -6.143  142.258 1.00 62.54  ? 694  VAL A N     1 
ATOM   5125  C  CA    . VAL A 1 695  ? 17.996  -7.482  142.769 1.00 62.81  ? 694  VAL A CA    1 
ATOM   5126  C  C     . VAL A 1 695  ? 16.591  -7.939  142.417 1.00 64.19  ? 694  VAL A C     1 
ATOM   5127  O  O     . VAL A 1 695  ? 16.386  -9.078  141.987 1.00 64.63  ? 694  VAL A O     1 
ATOM   5128  C  CB    . VAL A 1 695  ? 18.246  -7.503  144.284 1.00 62.79  ? 694  VAL A CB    1 
ATOM   5129  C  CG1   . VAL A 1 695  ? 17.985  -8.882  144.848 1.00 64.31  ? 694  VAL A CG1   1 
ATOM   5130  C  CG2   . VAL A 1 695  ? 19.668  -7.057  144.567 1.00 62.06  ? 694  VAL A CG2   1 
ATOM   5131  N  N     . LEU A 1 696  ? 15.604  -7.062  142.593 1.00 61.98  ? 695  LEU A N     1 
ATOM   5132  C  CA    . LEU A 1 696  ? 14.228  -7.426  142.283 1.00 64.33  ? 695  LEU A CA    1 
ATOM   5133  C  C     . LEU A 1 696  ? 14.092  -7.839  140.821 1.00 65.04  ? 695  LEU A C     1 
ATOM   5134  O  O     . LEU A 1 696  ? 13.745  -8.984  140.519 1.00 66.62  ? 695  LEU A O     1 
ATOM   5135  C  CB    . LEU A 1 696  ? 13.295  -6.261  142.619 1.00 64.78  ? 695  LEU A CB    1 
ATOM   5136  C  CG    . LEU A 1 696  ? 11.867  -6.312  142.071 1.00 67.10  ? 695  LEU A CG    1 
ATOM   5137  C  CD1   . LEU A 1 696  ? 11.185  -7.609  142.418 1.00 69.23  ? 695  LEU A CD1   1 
ATOM   5138  C  CD2   . LEU A 1 696  ? 11.069  -5.160  142.619 1.00 67.49  ? 695  LEU A CD2   1 
ATOM   5139  N  N     . ASN A 1 697  ? 14.400  -6.917  139.902 1.00 63.94  ? 696  ASN A N     1 
ATOM   5140  C  CA    . ASN A 1 697  ? 14.310  -7.197  138.471 1.00 64.55  ? 696  ASN A CA    1 
ATOM   5141  C  C     . ASN A 1 697  ? 15.052  -8.468  138.095 1.00 64.64  ? 696  ASN A C     1 
ATOM   5142  O  O     . ASN A 1 697  ? 14.535  -9.297  137.341 1.00 66.31  ? 696  ASN A O     1 
ATOM   5143  C  CB    . ASN A 1 697  ? 14.862  -6.018  137.675 1.00 62.97  ? 696  ASN A CB    1 
ATOM   5144  C  CG    . ASN A 1 697  ? 14.052  -4.764  137.865 1.00 63.19  ? 696  ASN A CG    1 
ATOM   5145  O  OD1   . ASN A 1 697  ? 14.295  -3.752  137.213 1.00 64.41  ? 696  ASN A OD1   1 
ATOM   5146  N  ND2   . ASN A 1 697  ? 13.073  -4.822  138.758 1.00 62.11  ? 696  ASN A ND2   1 
ATOM   5147  N  N     . ALA A 1 698  ? 16.264  -8.644  138.616 1.00 63.48  ? 697  ALA A N     1 
ATOM   5148  C  CA    . ALA A 1 698  ? 17.038  -9.834  138.288 1.00 68.06  ? 697  ALA A CA    1 
ATOM   5149  C  C     . ALA A 1 698  ? 16.350  -11.100 138.772 1.00 68.07  ? 697  ALA A C     1 
ATOM   5150  O  O     . ALA A 1 698  ? 16.486  -12.155 138.145 1.00 68.92  ? 697  ALA A O     1 
ATOM   5151  C  CB    . ALA A 1 698  ? 18.441  -9.732  138.883 1.00 61.54  ? 697  ALA A CB    1 
ATOM   5152  N  N     . LEU A 1 699  ? 15.599  -11.016 139.867 1.00 65.99  ? 698  LEU A N     1 
ATOM   5153  C  CA    . LEU A 1 699  ? 14.914  -12.200 140.368 1.00 68.14  ? 698  LEU A CA    1 
ATOM   5154  C  C     . LEU A 1 699  ? 13.711  -12.550 139.501 1.00 72.76  ? 698  LEU A C     1 
ATOM   5155  O  O     . LEU A 1 699  ? 13.533  -13.711 139.117 1.00 75.00  ? 698  LEU A O     1 
ATOM   5156  C  CB    . LEU A 1 699  ? 14.490  -11.987 141.820 1.00 68.78  ? 698  LEU A CB    1 
ATOM   5157  C  CG    . LEU A 1 699  ? 15.607  -11.953 142.867 1.00 68.28  ? 698  LEU A CG    1 
ATOM   5158  C  CD1   . LEU A 1 699  ? 15.053  -11.617 144.237 1.00 66.97  ? 698  LEU A CD1   1 
ATOM   5159  C  CD2   . LEU A 1 699  ? 16.381  -13.263 142.911 1.00 66.96  ? 698  LEU A CD2   1 
ATOM   5160  N  N     . GLN A 1 700  ? 12.873  -11.559 139.189 1.00 70.67  ? 699  GLN A N     1 
ATOM   5161  C  CA    . GLN A 1 700  ? 11.708  -11.813 138.352 1.00 72.88  ? 699  GLN A CA    1 
ATOM   5162  C  C     . GLN A 1 700  ? 12.123  -12.438 137.028 1.00 73.17  ? 699  GLN A C     1 
ATOM   5163  O  O     . GLN A 1 700  ? 11.655  -13.523 136.664 1.00 75.19  ? 699  GLN A O     1 
ATOM   5164  C  CB    . GLN A 1 700  ? 10.942  -10.512 138.114 1.00 72.81  ? 699  GLN A CB    1 
ATOM   5165  C  CG    . GLN A 1 700  ? 11.083  -9.513  139.230 1.00 71.43  ? 699  GLN A CG    1 
ATOM   5166  C  CD    . GLN A 1 700  ? 10.024  -8.452  139.214 1.00 72.20  ? 699  GLN A CD    1 
ATOM   5167  O  OE1   . GLN A 1 700  ? 8.976   -8.592  139.848 1.00 74.00  ? 699  GLN A OE1   1 
ATOM   5168  N  NE2   . GLN A 1 700  ? 10.294  -7.364  138.511 1.00 70.93  ? 699  GLN A NE2   1 
ATOM   5169  N  N     . GLU A 1 701  ? 13.040  -11.778 136.316 1.00 71.35  ? 700  GLU A N     1 
ATOM   5170  C  CA    . GLU A 1 701  ? 13.476  -12.246 135.007 1.00 71.55  ? 700  GLU A CA    1 
ATOM   5171  C  C     . GLU A 1 701  ? 14.141  -13.612 135.089 1.00 74.95  ? 700  GLU A C     1 
ATOM   5172  O  O     . GLU A 1 701  ? 14.082  -14.388 134.130 1.00 77.35  ? 700  GLU A O     1 
ATOM   5173  C  CB    . GLU A 1 701  ? 14.414  -11.217 134.378 1.00 77.05  ? 700  GLU A CB    1 
ATOM   5174  C  CG    . GLU A 1 701  ? 15.514  -11.801 133.521 1.00 77.09  ? 700  GLU A CG    1 
ATOM   5175  C  CD    . GLU A 1 701  ? 16.176  -10.724 132.686 1.00 75.67  ? 700  GLU A CD    1 
ATOM   5176  O  OE1   . GLU A 1 701  ? 15.738  -9.563  132.776 1.00 74.10  ? 700  GLU A OE1   1 
ATOM   5177  O  OE2   . GLU A 1 701  ? 17.126  -11.026 131.940 1.00 77.15  ? 700  GLU A OE2   1 
ATOM   5178  N  N     . HIS A 1 702  ? 14.774  -13.929 136.217 1.00 74.02  ? 701  HIS A N     1 
ATOM   5179  C  CA    . HIS A 1 702  ? 15.380  -15.248 136.354 1.00 75.98  ? 701  HIS A CA    1 
ATOM   5180  C  C     . HIS A 1 702  ? 14.331  -16.337 136.536 1.00 80.53  ? 701  HIS A C     1 
ATOM   5181  O  O     . HIS A 1 702  ? 14.536  -17.467 136.080 1.00 85.12  ? 701  HIS A O     1 
ATOM   5182  C  CB    . HIS A 1 702  ? 16.366  -15.280 137.526 1.00 75.74  ? 701  HIS A CB    1 
ATOM   5183  C  CG    . HIS A 1 702  ? 17.107  -16.572 137.649 1.00 75.34  ? 701  HIS A CG    1 
ATOM   5184  N  ND1   . HIS A 1 702  ? 16.798  -17.522 138.598 1.00 75.07  ? 701  HIS A ND1   1 
ATOM   5185  C  CD2   . HIS A 1 702  ? 18.134  -17.080 136.928 1.00 73.13  ? 701  HIS A CD2   1 
ATOM   5186  C  CE1   . HIS A 1 702  ? 17.606  -18.557 138.461 1.00 74.42  ? 701  HIS A CE1   1 
ATOM   5187  N  NE2   . HIS A 1 702  ? 18.426  -18.314 137.455 1.00 73.79  ? 701  HIS A NE2   1 
ATOM   5188  N  N     . PHE A 1 703  ? 13.208  -16.020 137.177 1.00 82.13  ? 702  PHE A N     1 
ATOM   5189  C  CA    . PHE A 1 703  ? 12.175  -17.011 137.457 1.00 84.97  ? 702  PHE A CA    1 
ATOM   5190  C  C     . PHE A 1 703  ? 11.205  -17.210 136.301 1.00 85.20  ? 702  PHE A C     1 
ATOM   5191  O  O     . PHE A 1 703  ? 10.344  -18.094 136.380 1.00 86.70  ? 702  PHE A O     1 
ATOM   5192  C  CB    . PHE A 1 703  ? 11.403  -16.623 138.718 1.00 86.63  ? 702  PHE A CB    1 
ATOM   5193  C  CG    . PHE A 1 703  ? 12.215  -16.728 139.969 1.00 85.18  ? 702  PHE A CG    1 
ATOM   5194  C  CD1   . PHE A 1 703  ? 13.134  -17.752 140.128 1.00 85.07  ? 702  PHE A CD1   1 
ATOM   5195  C  CD2   . PHE A 1 703  ? 12.083  -15.791 140.979 1.00 83.68  ? 702  PHE A CD2   1 
ATOM   5196  C  CE1   . PHE A 1 703  ? 13.895  -17.850 141.278 1.00 83.93  ? 702  PHE A CE1   1 
ATOM   5197  C  CE2   . PHE A 1 703  ? 12.842  -15.880 142.130 1.00 82.41  ? 702  PHE A CE2   1 
ATOM   5198  C  CZ    . PHE A 1 703  ? 13.748  -16.913 142.280 1.00 82.69  ? 702  PHE A CZ    1 
ATOM   5199  N  N     . ARG A 1 704  ? 11.309  -16.415 135.240 1.00 81.31  ? 703  ARG A N     1 
ATOM   5200  C  CA    . ARG A 1 704  ? 10.538  -16.655 134.031 1.00 82.61  ? 703  ARG A CA    1 
ATOM   5201  C  C     . ARG A 1 704  ? 11.353  -17.372 132.969 1.00 82.42  ? 703  ARG A C     1 
ATOM   5202  O  O     . ARG A 1 704  ? 10.921  -18.402 132.443 1.00 83.71  ? 703  ARG A O     1 
ATOM   5203  C  CB    . ARG A 1 704  ? 10.022  -15.347 133.446 1.00 81.91  ? 703  ARG A CB    1 
ATOM   5204  C  CG    . ARG A 1 704  ? 9.238   -14.469 134.379 1.00 81.99  ? 703  ARG A CG    1 
ATOM   5205  C  CD    . ARG A 1 704  ? 8.563   -13.351 133.591 1.00 82.34  ? 703  ARG A CD    1 
ATOM   5206  N  NE    . ARG A 1 704  ? 9.514   -12.537 132.836 1.00 80.08  ? 703  ARG A NE    1 
ATOM   5207  C  CZ    . ARG A 1 704  ? 9.892   -12.775 131.585 1.00 80.27  ? 703  ARG A CZ    1 
ATOM   5208  N  NH1   . ARG A 1 704  ? 9.407   -13.815 130.927 1.00 83.94  ? 703  ARG A NH1   1 
ATOM   5209  N  NH2   . ARG A 1 704  ? 10.765  -11.976 130.991 1.00 78.42  ? 703  ARG A NH2   1 
ATOM   5210  N  N     . ALA A 1 705  ? 12.524  -16.830 132.638 1.00 79.07  ? 704  ALA A N     1 
ATOM   5211  C  CA    . ALA A 1 705  ? 13.406  -17.482 131.683 1.00 78.99  ? 704  ALA A CA    1 
ATOM   5212  C  C     . ALA A 1 705  ? 13.766  -18.894 132.116 1.00 80.27  ? 704  ALA A C     1 
ATOM   5213  O  O     . ALA A 1 705  ? 14.211  -19.692 131.284 1.00 81.10  ? 704  ALA A O     1 
ATOM   5214  C  CB    . ALA A 1 705  ? 14.672  -16.652 131.483 1.00 76.17  ? 704  ALA A CB    1 
ATOM   5215  N  N     . HIS A 1 706  ? 13.579  -19.224 133.393 1.00 83.43  ? 705  HIS A N     1 
ATOM   5216  C  CA    . HIS A 1 706  ? 13.760  -20.581 133.872 1.00 82.60  ? 705  HIS A CA    1 
ATOM   5217  C  C     . HIS A 1 706  ? 12.476  -21.219 134.374 1.00 86.87  ? 705  HIS A C     1 
ATOM   5218  O  O     . HIS A 1 706  ? 12.480  -22.422 134.657 1.00 88.37  ? 705  HIS A O     1 
ATOM   5219  C  CB    . HIS A 1 706  ? 14.822  -20.618 134.980 1.00 80.82  ? 705  HIS A CB    1 
ATOM   5220  C  CG    . HIS A 1 706  ? 16.195  -20.258 134.502 1.00 79.08  ? 705  HIS A CG    1 
ATOM   5221  N  ND1   . HIS A 1 706  ? 17.154  -21.204 134.213 1.00 79.00  ? 705  HIS A ND1   1 
ATOM   5222  C  CD2   . HIS A 1 706  ? 16.760  -19.057 134.240 1.00 76.15  ? 705  HIS A CD2   1 
ATOM   5223  C  CE1   . HIS A 1 706  ? 18.255  -20.601 133.804 1.00 76.64  ? 705  HIS A CE1   1 
ATOM   5224  N  NE2   . HIS A 1 706  ? 18.043  -19.297 133.811 1.00 74.96  ? 705  HIS A NE2   1 
ATOM   5225  N  N     . LYS A 1 707  ? 11.384  -20.463 134.473 1.00 85.34  ? 706  LYS A N     1 
ATOM   5226  C  CA    . LYS A 1 707  ? 10.073  -20.987 134.853 1.00 88.08  ? 706  LYS A CA    1 
ATOM   5227  C  C     . LYS A 1 707  ? 10.147  -21.751 136.173 1.00 88.81  ? 706  LYS A C     1 
ATOM   5228  O  O     . LYS A 1 707  ? 9.823   -22.935 136.263 1.00 91.20  ? 706  LYS A O     1 
ATOM   5229  C  CB    . LYS A 1 707  ? 9.494   -21.864 133.741 1.00 90.68  ? 706  LYS A CB    1 
ATOM   5230  N  N     . ILE A 1 708  ? 10.603  -21.043 137.207 1.00 95.01  ? 707  ILE A N     1 
ATOM   5231  C  CA    . ILE A 1 708  ? 10.642  -21.609 138.550 1.00 97.29  ? 707  ILE A CA    1 
ATOM   5232  C  C     . ILE A 1 708  ? 9.351   -21.346 139.318 1.00 100.93 ? 707  ILE A C     1 
ATOM   5233  O  O     . ILE A 1 708  ? 9.025   -22.102 140.245 1.00 104.06 ? 707  ILE A O     1 
ATOM   5234  C  CB    . ILE A 1 708  ? 11.847  -21.056 139.332 1.00 93.78  ? 707  ILE A CB    1 
ATOM   5235  C  CG1   . ILE A 1 708  ? 13.127  -21.186 138.503 1.00 91.84  ? 707  ILE A CG1   1 
ATOM   5236  C  CG2   . ILE A 1 708  ? 12.015  -21.782 140.658 1.00 94.02  ? 707  ILE A CG2   1 
ATOM   5237  C  CD1   . ILE A 1 708  ? 13.509  -22.615 138.186 1.00 93.76  ? 707  ILE A CD1   1 
ATOM   5238  N  N     . ASP A 1 709  ? 8.602   -20.308 138.947 1.00 108.18 ? 708  ASP A N     1 
ATOM   5239  C  CA    . ASP A 1 709  ? 7.342   -19.955 139.598 1.00 111.15 ? 708  ASP A CA    1 
ATOM   5240  C  C     . ASP A 1 709  ? 7.533   -19.693 141.087 1.00 107.35 ? 708  ASP A C     1 
ATOM   5241  O  O     . ASP A 1 709  ? 6.637   -19.942 141.896 1.00 109.44 ? 708  ASP A O     1 
ATOM   5242  C  CB    . ASP A 1 709  ? 6.268   -21.021 139.363 1.00 120.27 ? 708  ASP A CB    1 
ATOM   5243  C  CG    . ASP A 1 709  ? 5.711   -20.984 137.945 1.00 126.26 ? 708  ASP A CG    1 
ATOM   5244  O  OD1   . ASP A 1 709  ? 6.460   -20.603 137.017 1.00 125.39 ? 708  ASP A OD1   1 
ATOM   5245  O  OD2   . ASP A 1 709  ? 4.523   -21.328 137.758 1.00 130.42 ? 708  ASP A OD2   1 
ATOM   5246  N  N     . THR A 1 710  ? 8.718   -19.210 141.449 1.00 92.80  ? 709  THR A N     1 
ATOM   5247  C  CA    . THR A 1 710  ? 8.928   -18.556 142.732 1.00 88.36  ? 709  THR A CA    1 
ATOM   5248  C  C     . THR A 1 710  ? 8.383   -17.142 142.609 1.00 84.23  ? 709  THR A C     1 
ATOM   5249  O  O     . THR A 1 710  ? 8.913   -16.333 141.844 1.00 82.31  ? 709  THR A O     1 
ATOM   5250  C  CB    . THR A 1 710  ? 10.410  -18.545 143.100 1.00 82.71  ? 709  THR A CB    1 
ATOM   5251  O  OG1   . THR A 1 710  ? 10.828  -19.866 143.469 1.00 83.91  ? 709  THR A OG1   1 
ATOM   5252  C  CG2   . THR A 1 710  ? 10.672  -17.591 144.261 1.00 80.94  ? 709  THR A CG2   1 
ATOM   5253  N  N     . LYS A 1 711  ? 7.305   -16.849 143.327 1.00 85.72  ? 710  LYS A N     1 
ATOM   5254  C  CA    . LYS A 1 711  ? 6.763   -15.500 143.303 1.00 84.98  ? 710  LYS A CA    1 
ATOM   5255  C  C     . LYS A 1 711  ? 7.778   -14.524 143.883 1.00 81.98  ? 710  LYS A C     1 
ATOM   5256  O  O     . LYS A 1 711  ? 8.666   -14.899 144.652 1.00 80.88  ? 710  LYS A O     1 
ATOM   5257  C  CB    . LYS A 1 711  ? 5.454   -15.431 144.085 1.00 87.29  ? 710  LYS A CB    1 
ATOM   5258  N  N     . VAL A 1 712  ? 7.660   -13.260 143.482 1.00 80.73  ? 711  VAL A N     1 
ATOM   5259  C  CA    . VAL A 1 712  ? 8.570   -12.205 143.915 1.00 77.97  ? 711  VAL A CA    1 
ATOM   5260  C  C     . VAL A 1 712  ? 7.723   -10.975 144.209 1.00 78.18  ? 711  VAL A C     1 
ATOM   5261  O  O     . VAL A 1 712  ? 7.257   -10.307 143.282 1.00 78.36  ? 711  VAL A O     1 
ATOM   5262  C  CB    . VAL A 1 712  ? 9.645   -11.878 142.866 1.00 75.81  ? 711  VAL A CB    1 
ATOM   5263  C  CG1   . VAL A 1 712  ? 10.633  -10.883 143.425 1.00 73.11  ? 711  VAL A CG1   1 
ATOM   5264  C  CG2   . VAL A 1 712  ? 10.378  -13.131 142.425 1.00 75.97  ? 711  VAL A CG2   1 
ATOM   5265  N  N     . SER A 1 713  ? 7.534   -10.666 145.486 1.00 78.86  ? 712  SER A N     1 
ATOM   5266  C  CA    . SER A 1 713  ? 6.654   -9.584  145.899 1.00 79.57  ? 712  SER A CA    1 
ATOM   5267  C  C     . SER A 1 713  ? 7.454   -8.441  146.513 1.00 76.36  ? 712  SER A C     1 
ATOM   5268  O  O     . SER A 1 713  ? 8.650   -8.554  146.784 1.00 75.48  ? 712  SER A O     1 
ATOM   5269  C  CB    . SER A 1 713  ? 5.595   -10.102 146.877 1.00 83.03  ? 712  SER A CB    1 
ATOM   5270  O  OG    . SER A 1 713  ? 6.191   -10.923 147.861 1.00 83.22  ? 712  SER A OG    1 
ATOM   5271  N  N     . VAL A 1 714  ? 6.766   -7.325  146.732 1.00 77.14  ? 713  VAL A N     1 
ATOM   5272  C  CA    . VAL A 1 714  ? 7.385   -6.065  147.117 1.00 75.73  ? 713  VAL A CA    1 
ATOM   5273  C  C     . VAL A 1 714  ? 6.632   -5.477  148.302 1.00 78.59  ? 713  VAL A C     1 
ATOM   5274  O  O     . VAL A 1 714  ? 5.396   -5.481  148.331 1.00 83.73  ? 713  VAL A O     1 
ATOM   5275  C  CB    . VAL A 1 714  ? 7.402   -5.080  145.930 1.00 74.01  ? 713  VAL A CB    1 
ATOM   5276  C  CG1   . VAL A 1 714  ? 7.402   -3.664  146.372 1.00 72.84  ? 713  VAL A CG1   1 
ATOM   5277  C  CG2   . VAL A 1 714  ? 8.564   -5.331  145.076 1.00 73.02  ? 713  VAL A CG2   1 
ATOM   5278  N  N     . VAL A 1 715  ? 7.384   -4.971  149.276 1.00 80.49  ? 714  VAL A N     1 
ATOM   5279  C  CA    . VAL A 1 715  ? 6.845   -4.286  150.442 1.00 81.74  ? 714  VAL A CA    1 
ATOM   5280  C  C     . VAL A 1 715  ? 7.543   -2.940  150.563 1.00 80.39  ? 714  VAL A C     1 
ATOM   5281  O  O     . VAL A 1 715  ? 8.727   -2.819  150.235 1.00 77.44  ? 714  VAL A O     1 
ATOM   5282  C  CB    . VAL A 1 715  ? 7.044   -5.121  151.720 1.00 84.90  ? 714  VAL A CB    1 
ATOM   5283  C  CG1   . VAL A 1 715  ? 6.409   -4.433  152.922 1.00 87.72  ? 714  VAL A CG1   1 
ATOM   5284  C  CG2   . VAL A 1 715  ? 6.468   -6.508  151.519 1.00 87.57  ? 714  VAL A CG2   1 
ATOM   5285  N  N     . ARG A 1 716  ? 6.812   -1.930  151.024 1.00 77.24  ? 715  ARG A N     1 
ATOM   5286  C  CA    . ARG A 1 716  ? 7.373   -0.600  151.190 1.00 77.03  ? 715  ARG A CA    1 
ATOM   5287  C  C     . ARG A 1 716  ? 7.742   -0.340  152.637 1.00 78.84  ? 715  ARG A C     1 
ATOM   5288  O  O     . ARG A 1 716  ? 7.112   -0.853  153.566 1.00 80.74  ? 715  ARG A O     1 
ATOM   5289  C  CB    . ARG A 1 716  ? 6.401   0.470   150.708 1.00 75.83  ? 715  ARG A CB    1 
ATOM   5290  C  CG    . ARG A 1 716  ? 6.322   0.527   149.186 1.00 73.82  ? 715  ARG A CG    1 
ATOM   5291  C  CD    . ARG A 1 716  ? 4.963   0.974   148.706 1.00 75.55  ? 715  ARG A CD    1 
ATOM   5292  N  NE    . ARG A 1 716  ? 5.045   1.751   147.480 1.00 74.71  ? 715  ARG A NE    1 
ATOM   5293  C  CZ    . ARG A 1 716  ? 5.383   1.228   146.305 1.00 74.14  ? 715  ARG A CZ    1 
ATOM   5294  N  NH1   . ARG A 1 716  ? 5.686   -0.080  146.198 1.00 74.34  ? 715  ARG A NH1   1 
ATOM   5295  N  NH2   . ARG A 1 716  ? 5.414   2.008   145.218 1.00 73.73  ? 715  ARG A NH2   1 
ATOM   5296  N  N     . GLY A 1 717  ? 8.754   0.510   152.813 1.00 88.44  ? 716  GLY A N     1 
ATOM   5297  C  CA    . GLY A 1 717  ? 9.346   0.690   154.126 1.00 89.42  ? 716  GLY A CA    1 
ATOM   5298  C  C     . GLY A 1 717  ? 8.407   1.335   155.125 1.00 93.14  ? 716  GLY A C     1 
ATOM   5299  O  O     . GLY A 1 717  ? 8.395   0.964   156.301 1.00 95.00  ? 716  GLY A O     1 
ATOM   5300  N  N     . GLN A 1 718  ? 7.614   2.310   154.678 1.00 96.24  ? 717  GLN A N     1 
ATOM   5301  C  CA    . GLN A 1 718  ? 6.721   2.995   155.606 1.00 97.66  ? 717  GLN A CA    1 
ATOM   5302  C  C     . GLN A 1 718  ? 5.673   2.048   156.170 1.00 96.78  ? 717  GLN A C     1 
ATOM   5303  O  O     . GLN A 1 718  ? 5.195   2.250   157.291 1.00 96.40  ? 717  GLN A O     1 
ATOM   5304  C  CB    . GLN A 1 718  ? 6.053   4.183   154.919 1.00 101.90 ? 717  GLN A CB    1 
ATOM   5305  C  CG    . GLN A 1 718  ? 7.032   5.148   154.280 1.00 102.86 ? 717  GLN A CG    1 
ATOM   5306  C  CD    . GLN A 1 718  ? 6.717   5.403   152.823 1.00 105.82 ? 717  GLN A CD    1 
ATOM   5307  O  OE1   . GLN A 1 718  ? 5.580   5.228   152.384 1.00 109.77 ? 717  GLN A OE1   1 
ATOM   5308  N  NE2   . GLN A 1 718  ? 7.726   5.813   152.062 1.00 103.23 ? 717  GLN A NE2   1 
ATOM   5309  N  N     . PHE A 1 719  ? 5.315   1.007   155.419 1.00 85.10  ? 718  PHE A N     1 
ATOM   5310  C  CA    . PHE A 1 719  ? 4.374   0.025   155.940 1.00 83.52  ? 718  PHE A CA    1 
ATOM   5311  C  C     . PHE A 1 719  ? 5.040   -0.881  156.965 1.00 81.32  ? 718  PHE A C     1 
ATOM   5312  O  O     . PHE A 1 719  ? 4.442   -1.207  157.997 1.00 80.58  ? 718  PHE A O     1 
ATOM   5313  C  CB    . PHE A 1 719  ? 3.782   -0.796  154.796 1.00 82.65  ? 718  PHE A CB    1 
ATOM   5314  C  CG    . PHE A 1 719  ? 2.822   -1.850  155.251 1.00 84.02  ? 718  PHE A CG    1 
ATOM   5315  C  CD1   . PHE A 1 719  ? 1.545   -1.509  155.667 1.00 87.66  ? 718  PHE A CD1   1 
ATOM   5316  C  CD2   . PHE A 1 719  ? 3.195   -3.182  155.267 1.00 82.49  ? 718  PHE A CD2   1 
ATOM   5317  C  CE1   . PHE A 1 719  ? 0.658   -2.479  156.093 1.00 90.40  ? 718  PHE A CE1   1 
ATOM   5318  C  CE2   . PHE A 1 719  ? 2.311   -4.159  155.693 1.00 85.30  ? 718  PHE A CE2   1 
ATOM   5319  C  CZ    . PHE A 1 719  ? 1.041   -3.806  156.105 1.00 89.11  ? 718  PHE A CZ    1 
ATOM   5320  N  N     . THR A 1 720  ? 6.280   -1.296  156.702 1.00 77.27  ? 719  THR A N     1 
ATOM   5321  C  CA    . THR A 1 720  ? 7.002   -2.108  157.675 1.00 77.04  ? 719  THR A CA    1 
ATOM   5322  C  C     . THR A 1 720  ? 7.277   -1.334  158.959 1.00 76.88  ? 719  THR A C     1 
ATOM   5323  O  O     . THR A 1 720  ? 7.313   -1.926  160.044 1.00 77.95  ? 719  THR A O     1 
ATOM   5324  C  CB    . THR A 1 720  ? 8.310   -2.610  157.067 1.00 72.78  ? 719  THR A CB    1 
ATOM   5325  O  OG1   . THR A 1 720  ? 8.917   -1.561  156.303 1.00 70.82  ? 719  THR A OG1   1 
ATOM   5326  C  CG2   . THR A 1 720  ? 8.058   -3.794  156.164 1.00 73.67  ? 719  THR A CG2   1 
ATOM   5327  N  N     . SER A 1 721  ? 7.454   -0.016  158.859 1.00 82.55  ? 720  SER A N     1 
ATOM   5328  C  CA    . SER A 1 721  ? 7.739   0.782   160.045 1.00 81.99  ? 720  SER A CA    1 
ATOM   5329  C  C     . SER A 1 721  ? 6.546   0.829   160.991 1.00 86.57  ? 720  SER A C     1 
ATOM   5330  O  O     . SER A 1 721  ? 6.713   0.698   162.209 1.00 86.34  ? 720  SER A O     1 
ATOM   5331  C  CB    . SER A 1 721  ? 8.164   2.190   159.635 1.00 82.01  ? 720  SER A CB    1 
ATOM   5332  O  OG    . SER A 1 721  ? 9.406   2.156   158.949 1.00 80.91  ? 720  SER A OG    1 
ATOM   5333  N  N     . GLN A 1 722  ? 5.334   1.013   160.457 1.00 92.93  ? 721  GLN A N     1 
ATOM   5334  C  CA    . GLN A 1 722  ? 4.161   1.037   161.324 1.00 95.16  ? 721  GLN A CA    1 
ATOM   5335  C  C     . GLN A 1 722  ? 3.777   -0.364  161.772 1.00 93.46  ? 721  GLN A C     1 
ATOM   5336  O  O     . GLN A 1 722  ? 3.258   -0.538  162.879 1.00 91.37  ? 721  GLN A O     1 
ATOM   5337  C  CB    . GLN A 1 722  ? 2.977   1.712   160.630 1.00 97.93  ? 721  GLN A CB    1 
ATOM   5338  C  CG    . GLN A 1 722  ? 1.658   1.542   161.391 1.00 102.03 ? 721  GLN A CG    1 
ATOM   5339  C  CD    . GLN A 1 722  ? 0.457   1.914   160.569 1.00 106.32 ? 721  GLN A CD    1 
ATOM   5340  O  OE1   . GLN A 1 722  ? -0.567  1.215   160.583 1.00 109.77 ? 721  GLN A OE1   1 
ATOM   5341  N  NE2   . GLN A 1 722  ? 0.554   3.034   159.860 1.00 107.63 ? 721  GLN A NE2   1 
ATOM   5342  N  N     . LEU A 1 723  ? 4.005   -1.370  160.927 1.00 89.43  ? 722  LEU A N     1 
ATOM   5343  C  CA    . LEU A 1 723  ? 3.789   -2.745  161.363 1.00 88.65  ? 722  LEU A CA    1 
ATOM   5344  C  C     . LEU A 1 723  ? 4.666   -3.060  162.564 1.00 87.83  ? 722  LEU A C     1 
ATOM   5345  O  O     . LEU A 1 723  ? 4.194   -3.613  163.565 1.00 89.61  ? 722  LEU A O     1 
ATOM   5346  C  CB    . LEU A 1 723  ? 4.064   -3.719  160.211 1.00 86.02  ? 722  LEU A CB    1 
ATOM   5347  C  CG    . LEU A 1 723  ? 3.557   -5.172  160.305 1.00 87.33  ? 722  LEU A CG    1 
ATOM   5348  C  CD1   . LEU A 1 723  ? 3.861   -5.938  159.014 1.00 86.04  ? 722  LEU A CD1   1 
ATOM   5349  C  CD2   . LEU A 1 723  ? 4.052   -5.995  161.526 1.00 87.31  ? 722  LEU A CD2   1 
ATOM   5350  N  N     . ARG A 1 724  ? 5.954   -2.715  162.479 1.00 83.58  ? 723  ARG A N     1 
ATOM   5351  C  CA    . ARG A 1 724  ? 6.856   -2.945  163.603 1.00 85.38  ? 723  ARG A CA    1 
ATOM   5352  C  C     . ARG A 1 724  ? 6.362   -2.232  164.852 1.00 87.45  ? 723  ARG A C     1 
ATOM   5353  O  O     . ARG A 1 724  ? 6.466   -2.764  165.962 1.00 90.10  ? 723  ARG A O     1 
ATOM   5354  C  CB    . ARG A 1 724  ? 8.270   -2.484  163.252 1.00 82.45  ? 723  ARG A CB    1 
ATOM   5355  N  N     . ARG A 1 725  ? 5.817   -1.025  164.687 1.00 89.43  ? 724  ARG A N     1 
ATOM   5356  C  CA    . ARG A 1 725  ? 5.219   -0.322  165.815 1.00 90.49  ? 724  ARG A CA    1 
ATOM   5357  C  C     . ARG A 1 725  ? 3.949   -1.018  166.286 1.00 92.46  ? 724  ARG A C     1 
ATOM   5358  O  O     . ARG A 1 725  ? 3.720   -1.150  167.495 1.00 94.71  ? 724  ARG A O     1 
ATOM   5359  C  CB    . ARG A 1 725  ? 4.926   1.128   165.433 1.00 92.38  ? 724  ARG A CB    1 
ATOM   5360  N  N     . HIS A 1 726  ? 3.113   -1.469  165.348 1.00 94.51  ? 725  HIS A N     1 
ATOM   5361  C  CA    . HIS A 1 726  ? 1.880   -2.157  165.718 1.00 97.88  ? 725  HIS A CA    1 
ATOM   5362  C  C     . HIS A 1 726  ? 2.181   -3.439  166.482 1.00 96.41  ? 725  HIS A C     1 
ATOM   5363  O  O     . HIS A 1 726  ? 1.614   -3.685  167.552 1.00 98.21  ? 725  HIS A O     1 
ATOM   5364  C  CB    . HIS A 1 726  ? 1.045   -2.455  164.473 1.00 95.42  ? 725  HIS A CB    1 
ATOM   5365  N  N     . TRP A 1 727  ? 3.071   -4.269  165.949 1.00 98.30  ? 726  TRP A N     1 
ATOM   5366  C  CA    . TRP A 1 727  ? 3.521   -5.430  166.694 1.00 98.66  ? 726  TRP A CA    1 
ATOM   5367  C  C     . TRP A 1 727  ? 4.418   -4.991  167.857 1.00 97.30  ? 726  TRP A C     1 
ATOM   5368  O  O     . TRP A 1 727  ? 4.797   -3.823  167.985 1.00 95.82  ? 726  TRP A O     1 
ATOM   5369  C  CB    . TRP A 1 727  ? 4.252   -6.404  165.771 1.00 97.84  ? 726  TRP A CB    1 
ATOM   5370  N  N     . GLY A 1 728  ? 4.748   -5.946  168.721 1.00 101.78 ? 727  GLY A N     1 
ATOM   5371  C  CA    . GLY A 1 728  ? 5.581   -5.653  169.873 1.00 99.30  ? 727  GLY A CA    1 
ATOM   5372  C  C     . GLY A 1 728  ? 7.059   -5.766  169.568 1.00 97.12  ? 727  GLY A C     1 
ATOM   5373  O  O     . GLY A 1 728  ? 7.765   -6.576  170.175 1.00 93.35  ? 727  GLY A O     1 
ATOM   5374  N  N     . ILE A 1 729  ? 7.540   -4.956  168.629 1.00 83.86  ? 728  ILE A N     1 
ATOM   5375  C  CA    . ILE A 1 729  ? 8.914   -5.027  168.151 1.00 78.84  ? 728  ILE A CA    1 
ATOM   5376  C  C     . ILE A 1 729  ? 9.726   -3.925  168.814 1.00 78.08  ? 728  ILE A C     1 
ATOM   5377  O  O     . ILE A 1 729  ? 9.349   -2.747  168.768 1.00 77.16  ? 728  ILE A O     1 
ATOM   5378  C  CB    . ILE A 1 729  ? 8.974   -4.910  166.620 1.00 77.67  ? 728  ILE A CB    1 
ATOM   5379  N  N     . GLU A 1 730  ? 10.838  -4.308  169.432 1.00 84.48  ? 729  GLU A N     1 
ATOM   5380  C  CA    . GLU A 1 730  ? 11.757  -3.384  170.077 1.00 86.40  ? 729  GLU A CA    1 
ATOM   5381  C  C     . GLU A 1 730  ? 13.127  -3.507  169.424 1.00 85.38  ? 729  GLU A C     1 
ATOM   5382  O  O     . GLU A 1 730  ? 13.601  -4.618  169.166 1.00 88.44  ? 729  GLU A O     1 
ATOM   5383  C  CB    . GLU A 1 730  ? 11.858  -3.666  171.580 1.00 89.20  ? 729  GLU A CB    1 
ATOM   5384  N  N     . LYS A 1 731  ? 13.757  -2.367  169.151 1.00 81.62  ? 730  LYS A N     1 
ATOM   5385  C  CA    . LYS A 1 731  ? 15.071  -2.331  168.521 1.00 81.03  ? 730  LYS A CA    1 
ATOM   5386  C  C     . LYS A 1 731  ? 16.137  -2.147  169.592 1.00 79.77  ? 730  LYS A C     1 
ATOM   5387  O  O     . LYS A 1 731  ? 16.105  -1.168  170.346 1.00 83.72  ? 730  LYS A O     1 
ATOM   5388  C  CB    . LYS A 1 731  ? 15.152  -1.207  167.490 1.00 82.64  ? 730  LYS A CB    1 
ATOM   5389  N  N     . THR A 1 732  ? 17.074  -3.086  169.661 1.00 80.71  ? 731  THR A N     1 
ATOM   5390  C  CA    . THR A 1 732  ? 18.202  -2.931  170.565 1.00 79.19  ? 731  THR A CA    1 
ATOM   5391  C  C     . THR A 1 732  ? 19.110  -1.809  170.080 1.00 76.25  ? 731  THR A C     1 
ATOM   5392  O  O     . THR A 1 732  ? 19.400  -1.692  168.888 1.00 74.53  ? 731  THR A O     1 
ATOM   5393  C  CB    . THR A 1 732  ? 18.984  -4.238  170.680 1.00 76.69  ? 731  THR A CB    1 
ATOM   5394  O  OG1   . THR A 1 732  ? 19.065  -4.863  169.395 1.00 74.21  ? 731  THR A OG1   1 
ATOM   5395  C  CG2   . THR A 1 732  ? 18.296  -5.175  171.647 1.00 80.75  ? 731  THR A CG2   1 
ATOM   5396  N  N     . ARG A 1 733  ? 19.551  -0.981  171.019 1.00 79.93  ? 732  ARG A N     1 
ATOM   5397  C  CA    . ARG A 1 733  ? 20.351  0.195   170.704 1.00 79.77  ? 732  ARG A CA    1 
ATOM   5398  C  C     . ARG A 1 733  ? 21.672  -0.191  170.051 1.00 77.21  ? 732  ARG A C     1 
ATOM   5399  O  O     . ARG A 1 733  ? 22.465  -0.939  170.629 1.00 77.35  ? 732  ARG A O     1 
ATOM   5400  C  CB    . ARG A 1 733  ? 20.591  0.989   171.989 1.00 83.92  ? 732  ARG A CB    1 
ATOM   5401  C  CG    . ARG A 1 733  ? 21.768  1.948   171.967 1.00 85.91  ? 732  ARG A CG    1 
ATOM   5402  C  CD    . ARG A 1 733  ? 21.693  2.910   173.140 1.00 89.36  ? 732  ARG A CD    1 
ATOM   5403  N  NE    . ARG A 1 733  ? 20.592  3.855   172.984 1.00 92.64  ? 732  ARG A NE    1 
ATOM   5404  C  CZ    . ARG A 1 733  ? 20.746  5.111   172.585 1.00 93.96  ? 732  ARG A CZ    1 
ATOM   5405  N  NH1   . ARG A 1 733  ? 21.957  5.578   172.313 1.00 93.25  ? 732  ARG A NH1   1 
ATOM   5406  N  NH2   . ARG A 1 733  ? 19.691  5.902   172.459 1.00 95.58  ? 732  ARG A NH2   1 
ATOM   5407  N  N     . ASP A 1 734  ? 21.896  0.309   168.834 1.00 73.11  ? 733  ASP A N     1 
ATOM   5408  C  CA    . ASP A 1 734  ? 23.188  0.212   168.150 1.00 68.68  ? 733  ASP A CA    1 
ATOM   5409  C  C     . ASP A 1 734  ? 23.626  -1.239  167.946 1.00 65.99  ? 733  ASP A C     1 
ATOM   5410  O  O     . ASP A 1 734  ? 24.753  -1.620  168.259 1.00 63.11  ? 733  ASP A O     1 
ATOM   5411  C  CB    . ASP A 1 734  ? 24.259  0.998   168.912 1.00 67.54  ? 733  ASP A CB    1 
ATOM   5412  C  CG    . ASP A 1 734  ? 23.862  2.436   169.161 1.00 69.71  ? 733  ASP A CG    1 
ATOM   5413  O  OD1   . ASP A 1 734  ? 22.649  2.729   169.112 1.00 72.76  ? 733  ASP A OD1   1 
ATOM   5414  O  OD2   . ASP A 1 734  ? 24.760  3.270   169.404 1.00 70.14  ? 733  ASP A OD2   1 
ATOM   5415  N  N     . THR A 1 735  ? 22.737  -2.054  167.399 1.00 63.78  ? 734  THR A N     1 
ATOM   5416  C  CA    . THR A 1 735  ? 23.047  -3.461  167.214 1.00 61.17  ? 734  THR A CA    1 
ATOM   5417  C  C     . THR A 1 735  ? 22.579  -3.925  165.844 1.00 61.87  ? 734  THR A C     1 
ATOM   5418  O  O     . THR A 1 735  ? 21.572  -3.446  165.314 1.00 67.65  ? 734  THR A O     1 
ATOM   5419  C  CB    . THR A 1 735  ? 22.403  -4.308  168.305 1.00 61.45  ? 734  THR A CB    1 
ATOM   5420  O  OG1   . THR A 1 735  ? 22.920  -3.893  169.578 1.00 58.63  ? 734  THR A OG1   1 
ATOM   5421  C  CG2   . THR A 1 735  ? 22.724  -5.769  168.113 1.00 63.01  ? 734  THR A CG2   1 
ATOM   5422  N  N     . TYR A 1 736  ? 23.332  -4.872  165.281 1.00 54.56  ? 735  TYR A N     1 
ATOM   5423  C  CA    . TYR A 1 736  ? 23.070  -5.496  163.990 1.00 54.73  ? 735  TYR A CA    1 
ATOM   5424  C  C     . TYR A 1 736  ? 21.892  -6.452  164.013 1.00 56.99  ? 735  TYR A C     1 
ATOM   5425  O  O     . TYR A 1 736  ? 21.622  -7.082  162.988 1.00 57.39  ? 735  TYR A O     1 
ATOM   5426  C  CB    . TYR A 1 736  ? 24.315  -6.249  163.535 1.00 53.61  ? 735  TYR A CB    1 
ATOM   5427  C  CG    . TYR A 1 736  ? 25.433  -5.355  163.067 1.00 51.40  ? 735  TYR A CG    1 
ATOM   5428  C  CD1   . TYR A 1 736  ? 25.173  -4.150  162.453 1.00 50.56  ? 735  TYR A CD1   1 
ATOM   5429  C  CD2   . TYR A 1 736  ? 26.754  -5.733  163.214 1.00 50.29  ? 735  TYR A CD2   1 
ATOM   5430  C  CE1   . TYR A 1 736  ? 26.204  -3.334  162.012 1.00 48.67  ? 735  TYR A CE1   1 
ATOM   5431  C  CE2   . TYR A 1 736  ? 27.783  -4.930  162.762 1.00 48.40  ? 735  TYR A CE2   1 
ATOM   5432  C  CZ    . TYR A 1 736  ? 27.508  -3.731  162.167 1.00 47.60  ? 735  TYR A CZ    1 
ATOM   5433  O  OH    . TYR A 1 736  ? 28.552  -2.943  161.729 1.00 45.84  ? 735  TYR A OH    1 
ATOM   5434  N  N     . HIS A 1 737  ? 21.200  -6.596  165.142 1.00 62.65  ? 736  HIS A N     1 
ATOM   5435  C  CA    . HIS A 1 737  ? 20.078  -7.523  165.191 1.00 66.14  ? 736  HIS A CA    1 
ATOM   5436  C  C     . HIS A 1 737  ? 18.922  -7.060  164.316 1.00 66.27  ? 736  HIS A C     1 
ATOM   5437  O  O     . HIS A 1 737  ? 18.216  -7.891  163.736 1.00 65.05  ? 736  HIS A O     1 
ATOM   5438  C  CB    . HIS A 1 737  ? 19.610  -7.701  166.635 1.00 71.69  ? 736  HIS A CB    1 
ATOM   5439  C  CG    . HIS A 1 737  ? 20.511  -8.564  167.460 1.00 75.03  ? 736  HIS A CG    1 
ATOM   5440  N  ND1   . HIS A 1 737  ? 20.961  -9.792  167.029 1.00 76.41  ? 736  HIS A ND1   1 
ATOM   5441  C  CD2   . HIS A 1 737  ? 21.036  -8.385  168.695 1.00 75.99  ? 736  HIS A CD2   1 
ATOM   5442  C  CE1   . HIS A 1 737  ? 21.733  -10.328 167.958 1.00 76.74  ? 736  HIS A CE1   1 
ATOM   5443  N  NE2   . HIS A 1 737  ? 21.801  -9.490  168.976 1.00 76.36  ? 736  HIS A NE2   1 
ATOM   5444  N  N     . HIS A 1 738  ? 18.727  -5.748  164.194 1.00 66.69  ? 737  HIS A N     1 
ATOM   5445  C  CA    . HIS A 1 738  ? 17.509  -5.235  163.584 1.00 68.73  ? 737  HIS A CA    1 
ATOM   5446  C  C     . HIS A 1 738  ? 17.465  -5.459  162.080 1.00 64.97  ? 737  HIS A C     1 
ATOM   5447  O  O     . HIS A 1 738  ? 16.380  -5.422  161.498 1.00 66.06  ? 737  HIS A O     1 
ATOM   5448  C  CB    . HIS A 1 738  ? 17.348  -3.750  163.906 1.00 69.84  ? 737  HIS A CB    1 
ATOM   5449  C  CG    . HIS A 1 738  ? 18.299  -2.864  163.169 1.00 67.79  ? 737  HIS A CG    1 
ATOM   5450  N  ND1   . HIS A 1 738  ? 19.645  -3.137  163.069 1.00 65.30  ? 737  HIS A ND1   1 
ATOM   5451  C  CD2   . HIS A 1 738  ? 18.099  -1.703  162.502 1.00 68.57  ? 737  HIS A CD2   1 
ATOM   5452  C  CE1   . HIS A 1 738  ? 20.233  -2.184  162.367 1.00 65.70  ? 737  HIS A CE1   1 
ATOM   5453  N  NE2   . HIS A 1 738  ? 19.317  -1.303  162.010 1.00 65.90  ? 737  HIS A NE2   1 
ATOM   5454  N  N     . HIS A 1 739  ? 18.608  -5.688  161.435 1.00 60.71  ? 738  HIS A N     1 
ATOM   5455  C  CA    . HIS A 1 739  ? 18.580  -6.045  160.021 1.00 60.96  ? 738  HIS A CA    1 
ATOM   5456  C  C     . HIS A 1 739  ? 17.917  -7.403  159.814 1.00 62.81  ? 738  HIS A C     1 
ATOM   5457  O  O     . HIS A 1 739  ? 17.183  -7.604  158.841 1.00 63.24  ? 738  HIS A O     1 
ATOM   5458  C  CB    . HIS A 1 739  ? 19.994  -6.040  159.444 1.00 61.14  ? 738  HIS A CB    1 
ATOM   5459  C  CG    . HIS A 1 739  ? 20.649  -4.696  159.455 1.00 59.74  ? 738  HIS A CG    1 
ATOM   5460  N  ND1   . HIS A 1 739  ? 21.917  -4.492  159.948 1.00 57.52  ? 738  HIS A ND1   1 
ATOM   5461  C  CD2   . HIS A 1 739  ? 20.215  -3.488  159.026 1.00 59.49  ? 738  HIS A CD2   1 
ATOM   5462  C  CE1   . HIS A 1 739  ? 22.237  -3.217  159.826 1.00 56.96  ? 738  HIS A CE1   1 
ATOM   5463  N  NE2   . HIS A 1 739  ? 21.221  -2.586  159.267 1.00 56.54  ? 738  HIS A NE2   1 
ATOM   5464  N  N     . ALA A 1 740  ? 18.147  -8.340  160.729 1.00 62.28  ? 739  ALA A N     1 
ATOM   5465  C  CA    . ALA A 1 740  ? 17.578  -9.674  160.583 1.00 64.29  ? 739  ALA A CA    1 
ATOM   5466  C  C     . ALA A 1 740  ? 16.073  -9.658  160.788 1.00 68.77  ? 739  ALA A C     1 
ATOM   5467  O  O     . ALA A 1 740  ? 15.320  -10.176 159.959 1.00 71.94  ? 739  ALA A O     1 
ATOM   5468  C  CB    . ALA A 1 740  ? 18.231  -10.632 161.574 1.00 64.70  ? 739  ALA A CB    1 
ATOM   5469  N  N     . VAL A 1 741  ? 15.612  -9.077  161.898 1.00 80.58  ? 740  VAL A N     1 
ATOM   5470  C  CA    . VAL A 1 741  ? 14.188  -9.147  162.203 1.00 84.23  ? 740  VAL A CA    1 
ATOM   5471  C  C     . VAL A 1 741  ? 13.390  -8.279  161.245 1.00 84.97  ? 740  VAL A C     1 
ATOM   5472  O  O     . VAL A 1 741  ? 12.212  -8.556  160.987 1.00 88.61  ? 740  VAL A O     1 
ATOM   5473  C  CB    . VAL A 1 741  ? 13.915  -8.775  163.675 1.00 86.03  ? 740  VAL A CB    1 
ATOM   5474  C  CG1   . VAL A 1 741  ? 14.865  -9.530  164.594 1.00 86.84  ? 740  VAL A CG1   1 
ATOM   5475  C  CG2   . VAL A 1 741  ? 14.005  -7.268  163.892 1.00 86.79  ? 740  VAL A CG2   1 
ATOM   5476  N  N     . ASP A 1 742  ? 14.000  -7.224  160.697 1.00 87.84  ? 741  ASP A N     1 
ATOM   5477  C  CA    . ASP A 1 742  ? 13.326  -6.471  159.649 1.00 67.67  ? 741  ASP A CA    1 
ATOM   5478  C  C     . ASP A 1 742  ? 13.000  -7.377  158.476 1.00 68.49  ? 741  ASP A C     1 
ATOM   5479  O  O     . ASP A 1 742  ? 11.892  -7.328  157.938 1.00 70.10  ? 741  ASP A O     1 
ATOM   5480  C  CB    . ASP A 1 742  ? 14.181  -5.284  159.209 1.00 65.21  ? 741  ASP A CB    1 
ATOM   5481  C  CG    . ASP A 1 742  ? 13.878  -4.029  160.004 1.00 65.13  ? 741  ASP A CG    1 
ATOM   5482  O  OD1   . ASP A 1 742  ? 12.729  -3.895  160.476 1.00 67.13  ? 741  ASP A OD1   1 
ATOM   5483  O  OD2   . ASP A 1 742  ? 14.772  -3.165  160.138 1.00 63.19  ? 741  ASP A OD2   1 
ATOM   5484  N  N     . ALA A 1 743  ? 13.942  -8.246  158.103 1.00 67.58  ? 742  ALA A N     1 
ATOM   5485  C  CA    . ALA A 1 743  ? 13.720  -9.187  157.013 1.00 68.42  ? 742  ALA A CA    1 
ATOM   5486  C  C     . ALA A 1 743  ? 12.598  -10.163 157.326 1.00 71.28  ? 742  ALA A C     1 
ATOM   5487  O  O     . ALA A 1 743  ? 11.879  -10.592 156.418 1.00 72.59  ? 742  ALA A O     1 
ATOM   5488  C  CB    . ALA A 1 743  ? 15.006  -9.953  156.708 1.00 67.03  ? 742  ALA A CB    1 
ATOM   5489  N  N     . LEU A 1 744  ? 12.435  -10.536 158.594 1.00 72.37  ? 743  LEU A N     1 
ATOM   5490  C  CA    . LEU A 1 744  ? 11.342  -11.431 158.940 1.00 75.25  ? 743  LEU A CA    1 
ATOM   5491  C  C     . LEU A 1 744  ? 10.013  -10.699 158.963 1.00 76.82  ? 743  LEU A C     1 
ATOM   5492  O  O     . LEU A 1 744  ? 8.972   -11.298 158.672 1.00 79.17  ? 743  LEU A O     1 
ATOM   5493  C  CB    . LEU A 1 744  ? 11.623  -12.103 160.277 1.00 76.03  ? 743  LEU A CB    1 
ATOM   5494  C  CG    . LEU A 1 744  ? 12.641  -13.224 160.110 1.00 75.49  ? 743  LEU A CG    1 
ATOM   5495  C  CD1   . LEU A 1 744  ? 12.804  -13.988 161.397 1.00 76.66  ? 743  LEU A CD1   1 
ATOM   5496  C  CD2   . LEU A 1 744  ? 12.196  -14.151 159.001 1.00 76.85  ? 743  LEU A CD2   1 
ATOM   5497  N  N     . ILE A 1 745  ? 10.023  -9.411  159.302 1.00 75.70  ? 744  ILE A N     1 
ATOM   5498  C  CA    . ILE A 1 745  ? 8.829   -8.603  159.102 1.00 77.02  ? 744  ILE A CA    1 
ATOM   5499  C  C     . ILE A 1 745  ? 8.506   -8.516  157.618 1.00 76.96  ? 744  ILE A C     1 
ATOM   5500  O  O     . ILE A 1 745  ? 7.332   -8.479  157.228 1.00 78.96  ? 744  ILE A O     1 
ATOM   5501  C  CB    . ILE A 1 745  ? 9.027   -7.217  159.745 1.00 75.75  ? 744  ILE A CB    1 
ATOM   5502  C  CG1   . ILE A 1 745  ? 9.044   -7.354  161.267 1.00 76.51  ? 744  ILE A CG1   1 
ATOM   5503  C  CG2   . ILE A 1 745  ? 7.951   -6.244  159.306 1.00 76.77  ? 744  ILE A CG2   1 
ATOM   5504  C  CD1   . ILE A 1 745  ? 9.106   -6.039  162.000 1.00 75.70  ? 744  ILE A CD1   1 
ATOM   5505  N  N     . ILE A 1 746  ? 9.535   -8.529  156.767 1.00 74.81  ? 745  ILE A N     1 
ATOM   5506  C  CA    . ILE A 1 746  ? 9.326   -8.501  155.322 1.00 74.77  ? 745  ILE A CA    1 
ATOM   5507  C  C     . ILE A 1 746  ? 8.701   -9.806  154.847 1.00 78.11  ? 745  ILE A C     1 
ATOM   5508  O  O     . ILE A 1 746  ? 7.705   -9.806  154.114 1.00 82.00  ? 745  ILE A O     1 
ATOM   5509  C  CB    . ILE A 1 746  ? 10.652  -8.226  154.595 1.00 72.03  ? 745  ILE A CB    1 
ATOM   5510  C  CG1   . ILE A 1 746  ? 11.220  -6.873  154.998 1.00 69.92  ? 745  ILE A CG1   1 
ATOM   5511  C  CG2   . ILE A 1 746  ? 10.447  -8.255  153.103 1.00 71.95  ? 745  ILE A CG2   1 
ATOM   5512  C  CD1   . ILE A 1 746  ? 12.606  -6.665  154.498 1.00 67.31  ? 745  ILE A CD1   1 
ATOM   5513  N  N     . ALA A 1 747  ? 9.242   -10.931 155.257 1.00 83.39  ? 746  ALA A N     1 
ATOM   5514  C  CA    . ALA A 1 747  ? 8.655   -12.179 154.832 1.00 85.57  ? 746  ALA A CA    1 
ATOM   5515  C  C     . ALA A 1 747  ? 7.234   -12.280 155.338 1.00 89.94  ? 746  ALA A C     1 
ATOM   5516  O  O     . ALA A 1 747  ? 6.343   -12.699 154.645 1.00 90.91  ? 746  ALA A O     1 
ATOM   5517  C  CB    . ALA A 1 747  ? 9.464   -13.343 155.336 1.00 87.17  ? 746  ALA A CB    1 
ATOM   5518  N  N     . ALA A 1 748  ? 7.030   -11.891 156.570 1.00 84.80  ? 747  ALA A N     1 
ATOM   5519  C  CA    . ALA A 1 748  ? 5.712   -11.938 157.162 1.00 87.37  ? 747  ALA A CA    1 
ATOM   5520  C  C     . ALA A 1 748  ? 4.710   -11.017 156.489 1.00 87.34  ? 747  ALA A C     1 
ATOM   5521  O  O     . ALA A 1 748  ? 3.535   -11.309 156.468 1.00 89.87  ? 747  ALA A O     1 
ATOM   5522  C  CB    . ALA A 1 748  ? 5.769   -11.666 158.652 1.00 87.08  ? 747  ALA A CB    1 
ATOM   5523  N  N     . SER A 1 749  ? 5.155   -9.893  155.965 1.00 83.83  ? 748  SER A N     1 
ATOM   5524  C  CA    . SER A 1 749  ? 4.237   -8.962  155.338 1.00 84.53  ? 748  SER A CA    1 
ATOM   5525  C  C     . SER A 1 749  ? 3.547   -9.651  154.185 1.00 86.20  ? 748  SER A C     1 
ATOM   5526  O  O     . SER A 1 749  ? 2.376   -9.465  153.945 1.00 88.50  ? 748  SER A O     1 
ATOM   5527  C  CB    . SER A 1 749  ? 5.016   -7.787  154.797 1.00 81.79  ? 748  SER A CB    1 
ATOM   5528  O  OG    . SER A 1 749  ? 6.071   -8.264  153.998 1.00 79.67  ? 748  SER A OG    1 
ATOM   5529  N  N     . SER A 1 750  ? 4.296   -10.441 153.460 1.00 85.15  ? 749  SER A N     1 
ATOM   5530  C  CA    . SER A 1 750  ? 3.759   -11.128 152.328 1.00 86.97  ? 749  SER A CA    1 
ATOM   5531  C  C     . SER A 1 750  ? 2.682   -12.141 152.649 1.00 90.00  ? 749  SER A C     1 
ATOM   5532  O  O     . SER A 1 750  ? 1.742   -12.288 151.894 1.00 92.29  ? 749  SER A O     1 
ATOM   5533  C  CB    . SER A 1 750  ? 4.877   -11.723 151.487 1.00 85.36  ? 749  SER A CB    1 
ATOM   5534  O  OG    . SER A 1 750  ? 4.995   -13.112 151.654 1.00 85.51  ? 749  SER A OG    1 
ATOM   5535  N  N     . GLN A 1 751  ? 2.774   -12.851 153.764 1.00 90.16  ? 750  GLN A N     1 
ATOM   5536  C  CA    . GLN A 1 751  ? 1.736   -13.848 154.056 1.00 93.06  ? 750  GLN A CA    1 
ATOM   5537  C  C     . GLN A 1 751  ? 0.601   -13.362 154.944 1.00 95.75  ? 750  GLN A C     1 
ATOM   5538  O  O     . GLN A 1 751  ? -0.074  -14.141 155.596 1.00 98.57  ? 750  GLN A O     1 
ATOM   5539  C  CB    . GLN A 1 751  ? 2.333   -15.145 154.603 1.00 92.53  ? 750  GLN A CB    1 
ATOM   5540  N  N     . LEU A 1 752  ? 0.414   -12.059 154.967 1.00 95.07  ? 751  LEU A N     1 
ATOM   5541  C  CA    . LEU A 1 752  ? -0.635  -11.418 155.736 1.00 97.23  ? 751  LEU A CA    1 
ATOM   5542  C  C     . LEU A 1 752  ? -2.061  -11.688 155.280 1.00 100.25 ? 751  LEU A C     1 
ATOM   5543  O  O     . LEU A 1 752  ? -2.971  -11.734 156.085 1.00 102.69 ? 751  LEU A O     1 
ATOM   5544  C  CB    . LEU A 1 752  ? -0.382  -9.930  155.849 1.00 95.40  ? 751  LEU A CB    1 
ATOM   5545  C  CG    . LEU A 1 752  ? -0.286  -9.399  157.267 1.00 96.31  ? 751  LEU A CG    1 
ATOM   5546  C  CD1   . LEU A 1 752  ? 0.468   -10.366 158.143 1.00 96.61  ? 751  LEU A CD1   1 
ATOM   5547  C  CD2   . LEU A 1 752  ? 0.358   -8.030  157.274 1.00 93.85  ? 751  LEU A CD2   1 
ATOM   5548  N  N     . ASN A 1 753  ? -2.275  -11.797 153.977 1.00 100.26 ? 752  ASN A N     1 
ATOM   5549  C  CA    . ASN A 1 753  ? -3.611  -12.077 153.478 1.00 103.29 ? 752  ASN A CA    1 
ATOM   5550  C  C     . ASN A 1 753  ? -4.003  -13.441 153.978 1.00 106.34 ? 752  ASN A C     1 
ATOM   5551  O  O     . ASN A 1 753  ? -5.112  -13.654 154.405 1.00 109.36 ? 752  ASN A O     1 
ATOM   5552  C  CB    . ASN A 1 753  ? -3.644  -12.063 151.962 1.00 102.62 ? 752  ASN A CB    1 
ATOM   5553  N  N     . LEU A 1 754  ? -3.070  -14.373 153.929 1.00 108.67 ? 753  LEU A N     1 
ATOM   5554  C  CA    . LEU A 1 754  ? -3.340  -15.697 154.411 1.00 113.82 ? 753  LEU A CA    1 
ATOM   5555  C  C     . LEU A 1 754  ? -3.610  -15.606 155.891 1.00 113.47 ? 753  LEU A C     1 
ATOM   5556  O  O     . LEU A 1 754  ? -4.523  -16.218 156.413 1.00 111.79 ? 753  LEU A O     1 
ATOM   5557  C  CB    . LEU A 1 754  ? -2.127  -16.569 154.188 1.00 112.38 ? 753  LEU A CB    1 
ATOM   5558  C  CG    . LEU A 1 754  ? -1.911  -17.190 152.815 1.00 110.93 ? 753  LEU A CG    1 
ATOM   5559  C  CD1   . LEU A 1 754  ? -1.702  -18.684 152.970 1.00 109.15 ? 753  LEU A CD1   1 
ATOM   5560  C  CD2   . LEU A 1 754  ? -3.037  -16.895 151.849 1.00 113.72 ? 753  LEU A CD2   1 
ATOM   5561  N  N     . PRO A 1 792  ? -1.187  -19.578 163.733 1.00 117.40 ? 791  PRO A N     1 
ATOM   5562  C  CA    . PRO A 1 792  ? 0.155   -19.549 163.140 1.00 113.39 ? 791  PRO A CA    1 
ATOM   5563  C  C     . PRO A 1 792  ? 0.685   -18.127 162.983 1.00 110.19 ? 791  PRO A C     1 
ATOM   5564  O  O     . PRO A 1 792  ? 1.892   -17.906 163.049 1.00 107.24 ? 791  PRO A O     1 
ATOM   5565  C  CB    . PRO A 1 792  ? -0.045  -20.218 161.776 1.00 113.61 ? 791  PRO A CB    1 
ATOM   5566  C  CG    . PRO A 1 792  ? -1.500  -20.080 161.490 1.00 116.70 ? 791  PRO A CG    1 
ATOM   5567  C  CD    . PRO A 1 792  ? -2.181  -20.163 162.820 1.00 119.90 ? 791  PRO A CD    1 
ATOM   5568  N  N     . TYR A 1 793  ? -0.224  -17.175 162.773 1.00 111.28 ? 792  TYR A N     1 
ATOM   5569  C  CA    . TYR A 1 793  ? 0.164   -15.769 162.744 1.00 108.70 ? 792  TYR A CA    1 
ATOM   5570  C  C     . TYR A 1 793  ? 0.619   -15.301 164.121 1.00 108.16 ? 792  TYR A C     1 
ATOM   5571  O  O     . TYR A 1 793  ? 1.643   -14.621 164.247 1.00 105.66 ? 792  TYR A O     1 
ATOM   5572  C  CB    . TYR A 1 793  ? -1.006  -14.928 162.228 1.00 109.56 ? 792  TYR A CB    1 
ATOM   5573  C  CG    . TYR A 1 793  ? -1.007  -13.473 162.649 1.00 108.71 ? 792  TYR A CG    1 
ATOM   5574  C  CD1   . TYR A 1 793  ? -1.645  -13.070 163.816 1.00 110.78 ? 792  TYR A CD1   1 
ATOM   5575  C  CD2   . TYR A 1 793  ? -0.401  -12.500 161.867 1.00 106.58 ? 792  TYR A CD2   1 
ATOM   5576  C  CE1   . TYR A 1 793  ? -1.659  -11.746 164.204 1.00 110.32 ? 792  TYR A CE1   1 
ATOM   5577  C  CE2   . TYR A 1 793  ? -0.414  -11.169 162.248 1.00 106.17 ? 792  TYR A CE2   1 
ATOM   5578  C  CZ    . TYR A 1 793  ? -1.045  -10.800 163.417 1.00 108.17 ? 792  TYR A CZ    1 
ATOM   5579  O  OH    . TYR A 1 793  ? -1.065  -9.481  163.807 1.00 107.70 ? 792  TYR A OH    1 
ATOM   5580  N  N     . GLN A 1 794  ? -0.146  -15.585 165.148 1.00 114.50 ? 793  GLN A N     1 
ATOM   5581  C  CA    . GLN A 1 794  ? 0.260   -15.161 166.469 1.00 114.34 ? 793  GLN A CA    1 
ATOM   5582  C  C     . GLN A 1 794  ? 1.515   -15.935 166.869 1.00 112.99 ? 793  GLN A C     1 
ATOM   5583  O  O     . GLN A 1 794  ? 2.331   -15.449 167.629 1.00 112.75 ? 793  GLN A O     1 
ATOM   5584  C  CB    . GLN A 1 794  ? -0.863  -15.335 167.486 1.00 118.90 ? 793  GLN A CB    1 
ATOM   5585  N  N     . HIS A 1 795  ? 1.655   -17.160 166.380 1.00 110.25 ? 794  HIS A N     1 
ATOM   5586  C  CA    . HIS A 1 795  ? 2.805   -17.959 166.744 1.00 108.05 ? 794  HIS A CA    1 
ATOM   5587  C  C     . HIS A 1 795  ? 4.078   -17.313 166.309 1.00 100.21 ? 794  HIS A C     1 
ATOM   5588  O  O     . HIS A 1 795  ? 5.036   -17.201 167.071 1.00 98.80  ? 794  HIS A O     1 
ATOM   5589  C  CB    . HIS A 1 795  ? 2.739   -19.271 166.002 1.00 107.17 ? 794  HIS A CB    1 
ATOM   5590  C  CG    . HIS A 1 795  ? 3.916   -20.156 166.241 1.00 104.49 ? 794  HIS A CG    1 
ATOM   5591  N  ND1   . HIS A 1 795  ? 4.317   -21.120 165.344 1.00 103.28 ? 794  HIS A ND1   1 
ATOM   5592  C  CD2   . HIS A 1 795  ? 4.767   -20.238 167.284 1.00 104.36 ? 794  HIS A CD2   1 
ATOM   5593  C  CE1   . HIS A 1 795  ? 5.363   -21.761 165.825 1.00 102.50 ? 794  HIS A CE1   1 
ATOM   5594  N  NE2   . HIS A 1 795  ? 5.656   -21.243 167.000 1.00 103.14 ? 794  HIS A NE2   1 
ATOM   5595  N  N     . PHE A 1 796  ? 4.080   -16.851 165.075 1.00 99.29  ? 795  PHE A N     1 
ATOM   5596  C  CA    . PHE A 1 796  ? 5.270   -16.269 164.548 1.00 95.79  ? 795  PHE A CA    1 
ATOM   5597  C  C     . PHE A 1 796  ? 5.603   -15.077 165.396 1.00 93.86  ? 795  PHE A C     1 
ATOM   5598  O  O     . PHE A 1 796  ? 6.731   -14.928 165.822 1.00 90.77  ? 795  PHE A O     1 
ATOM   5599  C  CB    . PHE A 1 796  ? 5.041   -15.893 163.096 1.00 94.07  ? 795  PHE A CB    1 
ATOM   5600  C  CG    . PHE A 1 796  ? 5.987   -14.870 162.578 1.00 90.70  ? 795  PHE A CG    1 
ATOM   5601  C  CD1   . PHE A 1 796  ? 7.282   -15.200 162.292 1.00 88.25  ? 795  PHE A CD1   1 
ATOM   5602  C  CD2   . PHE A 1 796  ? 5.578   -13.572 162.380 1.00 90.13  ? 795  PHE A CD2   1 
ATOM   5603  C  CE1   . PHE A 1 796  ? 8.158   -14.252 161.813 1.00 85.32  ? 795  PHE A CE1   1 
ATOM   5604  C  CE2   . PHE A 1 796  ? 6.448   -12.617 161.900 1.00 87.17  ? 795  PHE A CE2   1 
ATOM   5605  C  CZ    . PHE A 1 796  ? 7.738   -12.960 161.616 1.00 84.79  ? 795  PHE A CZ    1 
ATOM   5606  N  N     . VAL A 1 797  ? 4.614   -14.258 165.701 1.00 94.33  ? 796  VAL A N     1 
ATOM   5607  C  CA    . VAL A 1 797  ? 4.882   -13.083 166.498 1.00 92.77  ? 796  VAL A CA    1 
ATOM   5608  C  C     . VAL A 1 797  ? 5.381   -13.350 167.900 1.00 95.10  ? 796  VAL A C     1 
ATOM   5609  O  O     . VAL A 1 797  ? 6.225   -12.631 168.403 1.00 90.89  ? 796  VAL A O     1 
ATOM   5610  C  CB    . VAL A 1 797  ? 3.696   -12.144 166.538 1.00 94.21  ? 796  VAL A CB    1 
ATOM   5611  C  CG1   . VAL A 1 797  ? 4.049   -10.897 167.318 1.00 93.62  ? 796  VAL A CG1   1 
ATOM   5612  C  CG2   . VAL A 1 797  ? 3.340   -11.756 165.135 1.00 92.89  ? 796  VAL A CG2   1 
ATOM   5613  N  N     . ASP A 1 798  ? 4.829   -14.353 168.548 1.00 109.91 ? 797  ASP A N     1 
ATOM   5614  C  CA    . ASP A 1 798  ? 5.242   -14.656 169.895 1.00 109.41 ? 797  ASP A CA    1 
ATOM   5615  C  C     . ASP A 1 798  ? 6.689   -15.106 169.858 1.00 108.08 ? 797  ASP A C     1 
ATOM   5616  O  O     . ASP A 1 798  ? 7.544   -14.709 170.681 1.00 107.65 ? 797  ASP A O     1 
ATOM   5617  C  CB    . ASP A 1 798  ? 4.310   -15.707 170.498 1.00 116.26 ? 797  ASP A CB    1 
ATOM   5618  C  CG    . ASP A 1 798  ? 3.100   -15.082 171.193 1.00 120.90 ? 797  ASP A CG    1 
ATOM   5619  O  OD1   . ASP A 1 798  ? 2.917   -13.857 171.082 1.00 120.04 ? 797  ASP A OD1   1 
ATOM   5620  O  OD2   . ASP A 1 798  ? 2.332   -15.810 171.854 1.00 124.75 ? 797  ASP A OD2   1 
ATOM   5621  N  N     . THR A 1 799  ? 6.977   -15.911 168.851 1.00 97.51  ? 798  THR A N     1 
ATOM   5622  C  CA    . THR A 1 799  ? 8.305   -16.432 168.708 1.00 94.22  ? 798  THR A CA    1 
ATOM   5623  C  C     . THR A 1 799  ? 9.221   -15.226 168.556 1.00 88.73  ? 798  THR A C     1 
ATOM   5624  O  O     . THR A 1 799  ? 10.255  -15.136 169.178 1.00 86.91  ? 798  THR A O     1 
ATOM   5625  C  CB    . THR A 1 799  ? 8.348   -17.349 167.475 1.00 92.55  ? 798  THR A CB    1 
ATOM   5626  O  OG1   . THR A 1 799  ? 7.869   -18.644 167.832 1.00 92.84  ? 798  THR A OG1   1 
ATOM   5627  C  CG2   . THR A 1 799  ? 9.756   -17.503 166.927 1.00 95.60  ? 798  THR A CG2   1 
ATOM   5628  N  N     . LEU A 1 800  ? 8.786   -14.276 167.757 1.00 95.03  ? 799  LEU A N     1 
ATOM   5629  C  CA    . LEU A 1 800  ? 9.539   -13.066 167.500 1.00 90.77  ? 799  LEU A CA    1 
ATOM   5630  C  C     . LEU A 1 800  ? 9.811   -12.174 168.709 1.00 90.87  ? 799  LEU A C     1 
ATOM   5631  O  O     . LEU A 1 800  ? 10.895  -11.628 168.833 1.00 88.15  ? 799  LEU A O     1 
ATOM   5632  C  CB    . LEU A 1 800  ? 8.826   -12.245 166.433 1.00 90.49  ? 799  LEU A CB    1 
ATOM   5633  C  CG    . LEU A 1 800  ? 9.605   -11.137 165.734 1.00 87.72  ? 799  LEU A CG    1 
ATOM   5634  C  CD1   . LEU A 1 800  ? 10.106  -11.637 164.395 1.00 85.95  ? 799  LEU A CD1   1 
ATOM   5635  C  CD2   . LEU A 1 800  ? 8.730   -9.914  165.547 1.00 88.65  ? 799  LEU A CD2   1 
ATOM   5636  N  N     . LYS A 1 801  ? 8.760   -11.996 169.506 1.00 91.83  ? 800  LYS A N     1 
ATOM   5637  C  CA    . LYS A 1 801  ? 8.745   -11.207 170.733 1.00 92.67  ? 800  LYS A CA    1 
ATOM   5638  C  C     . LYS A 1 801  ? 9.593   -11.817 171.840 1.00 93.58  ? 800  LYS A C     1 
ATOM   5639  O  O     . LYS A 1 801  ? 10.226  -11.106 172.620 1.00 91.24  ? 800  LYS A O     1 
ATOM   5640  C  CB    . LYS A 1 801  ? 7.308   -11.014 171.223 1.00 95.86  ? 800  LYS A CB    1 
ATOM   5641  N  N     . SER A 1 802  ? 9.790   -13.111 171.744 1.00 95.38  ? 801  SER A N     1 
ATOM   5642  C  CA    . SER A 1 802  ? 10.532  -13.787 172.746 1.00 99.27  ? 801  SER A CA    1 
ATOM   5643  C  C     . SER A 1 802  ? 11.795  -13.017 173.018 1.00 98.76  ? 801  SER A C     1 
ATOM   5644  O  O     . SER A 1 802  ? 12.488  -12.593 172.122 1.00 97.79  ? 801  SER A O     1 
ATOM   5645  C  CB    . SER A 1 802  ? 10.886  -15.170 172.220 1.00 99.03  ? 801  SER A CB    1 
ATOM   5646  O  OG    . SER A 1 802  ? 12.033  -15.699 172.844 1.00 95.53  ? 801  SER A OG    1 
ATOM   5647  N  N     . LYS A 1 803  ? 12.061  -12.823 174.299 1.00 104.07 ? 802  LYS A N     1 
ATOM   5648  C  CA    . LYS A 1 803  ? 13.249  -12.143 174.775 1.00 104.23 ? 802  LYS A CA    1 
ATOM   5649  C  C     . LYS A 1 803  ? 14.410  -12.988 174.353 1.00 103.76 ? 802  LYS A C     1 
ATOM   5650  O  O     . LYS A 1 803  ? 15.469  -12.480 174.043 1.00 104.00 ? 802  LYS A O     1 
ATOM   5651  C  CB    . LYS A 1 803  ? 13.241  -11.995 176.296 1.00 106.97 ? 802  LYS A CB    1 
ATOM   5652  N  N     . GLU A 1 804  ? 14.196  -14.291 174.371 1.00 108.66 ? 803  GLU A N     1 
ATOM   5653  C  CA    . GLU A 1 804  ? 15.188  -15.271 174.005 1.00 105.51 ? 803  GLU A CA    1 
ATOM   5654  C  C     . GLU A 1 804  ? 15.541  -15.323 172.514 1.00 103.87 ? 803  GLU A C     1 
ATOM   5655  O  O     . GLU A 1 804  ? 16.475  -16.004 172.134 1.00 101.19 ? 803  GLU A O     1 
ATOM   5656  C  CB    . GLU A 1 804  ? 14.703  -16.641 174.446 1.00 109.53 ? 803  GLU A CB    1 
ATOM   5657  N  N     . PHE A 1 805  ? 14.763  -14.668 171.668 1.00 95.15  ? 804  PHE A N     1 
ATOM   5658  C  CA    . PHE A 1 805  ? 15.005  -14.707 170.235 1.00 92.68  ? 804  PHE A CA    1 
ATOM   5659  C  C     . PHE A 1 805  ? 16.301  -14.107 169.671 1.00 86.45  ? 804  PHE A C     1 
ATOM   5660  O  O     . PHE A 1 805  ? 16.977  -14.733 168.879 1.00 84.55  ? 804  PHE A O     1 
ATOM   5661  C  CB    . PHE A 1 805  ? 13.807  -14.059 169.545 1.00 91.80  ? 804  PHE A CB    1 
ATOM   5662  C  CG    . PHE A 1 805  ? 13.873  -14.093 168.059 1.00 89.34  ? 804  PHE A CG    1 
ATOM   5663  C  CD1   . PHE A 1 805  ? 14.229  -15.240 167.402 1.00 89.94  ? 804  PHE A CD1   1 
ATOM   5664  C  CD2   . PHE A 1 805  ? 13.586  -12.979 167.326 1.00 87.35  ? 804  PHE A CD2   1 
ATOM   5665  C  CE1   . PHE A 1 805  ? 14.318  -15.276 166.030 1.00 89.69  ? 804  PHE A CE1   1 
ATOM   5666  C  CE2   . PHE A 1 805  ? 13.670  -13.002 165.958 1.00 87.28  ? 804  PHE A CE2   1 
ATOM   5667  C  CZ    . PHE A 1 805  ? 14.030  -14.153 165.307 1.00 88.46  ? 804  PHE A CZ    1 
ATOM   5668  N  N     . GLU A 1 806  ? 16.671  -12.915 170.093 1.00 89.63  ? 805  GLU A N     1 
ATOM   5669  C  CA    . GLU A 1 806  ? 17.868  -12.279 169.574 1.00 88.50  ? 805  GLU A CA    1 
ATOM   5670  C  C     . GLU A 1 806  ? 19.184  -12.980 169.863 1.00 90.16  ? 805  GLU A C     1 
ATOM   5671  O  O     . GLU A 1 806  ? 20.028  -13.051 169.002 1.00 88.96  ? 805  GLU A O     1 
ATOM   5672  C  CB    . GLU A 1 806  ? 17.935  -10.819 170.005 1.00 89.21  ? 805  GLU A CB    1 
ATOM   5673  C  CG    . GLU A 1 806  ? 17.240  -9.870  169.046 1.00 89.59  ? 805  GLU A CG    1 
ATOM   5674  C  CD    . GLU A 1 806  ? 17.217  -8.433  169.519 1.00 89.67  ? 805  GLU A CD    1 
ATOM   5675  O  OE1   . GLU A 1 806  ? 18.126  -8.012  170.247 1.00 87.18  ? 805  GLU A OE1   1 
ATOM   5676  O  OE2   . GLU A 1 806  ? 16.285  -7.714  169.150 1.00 91.96  ? 805  GLU A OE2   1 
ATOM   5677  N  N     . ASP A 1 807  ? 19.349  -13.489 171.069 1.00 94.00  ? 806  ASP A N     1 
ATOM   5678  C  CA    . ASP A 1 807  ? 20.561  -14.169 171.510 1.00 92.47  ? 806  ASP A CA    1 
ATOM   5679  C  C     . ASP A 1 807  ? 20.928  -15.363 170.634 1.00 89.39  ? 806  ASP A C     1 
ATOM   5680  O  O     . ASP A 1 807  ? 21.964  -15.991 170.880 1.00 91.94  ? 806  ASP A O     1 
ATOM   5681  C  CB    . ASP A 1 807  ? 20.414  -14.618 172.965 1.00 94.73  ? 806  ASP A CB    1 
ATOM   5682  C  CG    . ASP A 1 807  ? 21.364  -13.899 173.892 1.00 97.65  ? 806  ASP A CG    1 
ATOM   5683  O  OD1   . ASP A 1 807  ? 22.486  -13.566 173.451 1.00 98.74  ? 806  ASP A OD1   1 
ATOM   5684  O  OD2   . ASP A 1 807  ? 20.986  -13.662 175.059 1.00 98.46  ? 806  ASP A OD2   1 
ATOM   5685  N  N     . SER A 1 808  ? 20.121  -15.698 169.626 1.00 80.99  ? 807  SER A N     1 
ATOM   5686  C  CA    . SER A 1 808  ? 20.442  -16.803 168.731 1.00 78.27  ? 807  SER A CA    1 
ATOM   5687  C  C     . SER A 1 808  ? 20.313  -16.411 167.262 1.00 75.35  ? 807  SER A C     1 
ATOM   5688  O  O     . SER A 1 808  ? 20.149  -17.285 166.410 1.00 74.08  ? 807  SER A O     1 
ATOM   5689  C  CB    . SER A 1 808  ? 19.562  -18.017 169.028 1.00 81.71  ? 807  SER A CB    1 
ATOM   5690  O  OG    . SER A 1 808  ? 19.960  -19.127 168.243 1.00 82.42  ? 807  SER A OG    1 
ATOM   5691  N  N     . ILE A 1 809  ? 20.382  -15.118 166.951 1.00 69.76  ? 808  ILE A N     1 
ATOM   5692  C  CA    . ILE A 1 809  ? 20.439  -14.654 165.570 1.00 68.03  ? 808  ILE A CA    1 
ATOM   5693  C  C     . ILE A 1 809  ? 21.871  -14.759 165.070 1.00 66.03  ? 808  ILE A C     1 
ATOM   5694  O  O     . ILE A 1 809  ? 22.816  -14.389 165.773 1.00 64.74  ? 808  ILE A O     1 
ATOM   5695  C  CB    . ILE A 1 809  ? 19.924  -13.209 165.461 1.00 66.96  ? 808  ILE A CB    1 
ATOM   5696  C  CG1   . ILE A 1 809  ? 18.477  -13.118 165.935 1.00 69.14  ? 808  ILE A CG1   1 
ATOM   5697  C  CG2   . ILE A 1 809  ? 20.057  -12.699 164.036 1.00 65.48  ? 808  ILE A CG2   1 
ATOM   5698  C  CD1   . ILE A 1 809  ? 17.903  -11.730 165.852 1.00 68.39  ? 808  ILE A CD1   1 
ATOM   5699  N  N     . LEU A 1 810  ? 22.038  -15.252 163.851 1.00 65.84  ? 809  LEU A N     1 
ATOM   5700  C  CA    . LEU A 1 810  ? 23.364  -15.485 163.309 1.00 64.25  ? 809  LEU A CA    1 
ATOM   5701  C  C     . LEU A 1 810  ? 23.881  -14.245 162.583 1.00 61.79  ? 809  LEU A C     1 
ATOM   5702  O  O     . LEU A 1 810  ? 23.117  -13.394 162.124 1.00 61.50  ? 809  LEU A O     1 
ATOM   5703  C  CB    . LEU A 1 810  ? 23.350  -16.685 162.367 1.00 65.44  ? 809  LEU A CB    1 
ATOM   5704  C  CG    . LEU A 1 810  ? 22.736  -17.945 162.967 1.00 68.16  ? 809  LEU A CG    1 
ATOM   5705  C  CD1   . LEU A 1 810  ? 22.849  -19.095 161.997 1.00 69.25  ? 809  LEU A CD1   1 
ATOM   5706  C  CD2   . LEU A 1 810  ? 23.411  -18.281 164.283 1.00 68.41  ? 809  LEU A CD2   1 
ATOM   5707  N  N     . PHE A 1 811  ? 25.203  -14.150 162.495 1.00 60.11  ? 810  PHE A N     1 
ATOM   5708  C  CA    . PHE A 1 811  ? 25.860  -13.028 161.848 1.00 57.80  ? 810  PHE A CA    1 
ATOM   5709  C  C     . PHE A 1 811  ? 26.954  -13.541 160.930 1.00 56.89  ? 810  PHE A C     1 
ATOM   5710  O  O     . PHE A 1 811  ? 27.650  -14.507 161.251 1.00 57.46  ? 810  PHE A O     1 
ATOM   5711  C  CB    . PHE A 1 811  ? 26.443  -12.052 162.876 1.00 56.47  ? 810  PHE A CB    1 
ATOM   5712  C  CG    . PHE A 1 811  ? 25.400  -11.366 163.698 1.00 57.22  ? 810  PHE A CG    1 
ATOM   5713  C  CD1   . PHE A 1 811  ? 24.849  -10.173 163.278 1.00 56.43  ? 810  PHE A CD1   1 
ATOM   5714  C  CD2   . PHE A 1 811  ? 24.950  -11.927 164.877 1.00 58.88  ? 810  PHE A CD2   1 
ATOM   5715  C  CE1   . PHE A 1 811  ? 23.878  -9.551  164.022 1.00 57.29  ? 810  PHE A CE1   1 
ATOM   5716  C  CE2   . PHE A 1 811  ? 23.980  -11.304 165.623 1.00 59.72  ? 810  PHE A CE2   1 
ATOM   5717  C  CZ    . PHE A 1 811  ? 23.447  -10.112 165.195 1.00 58.92  ? 810  PHE A CZ    1 
ATOM   5718  N  N     . SER A 1 812  ? 27.081  -12.905 159.776 1.00 56.44  ? 811  SER A N     1 
ATOM   5719  C  CA    . SER A 1 812  ? 28.147  -13.210 158.840 1.00 57.93  ? 811  SER A CA    1 
ATOM   5720  C  C     . SER A 1 812  ? 28.710  -11.894 158.344 1.00 60.84  ? 811  SER A C     1 
ATOM   5721  O  O     . SER A 1 812  ? 27.958  -10.963 158.044 1.00 65.40  ? 811  SER A O     1 
ATOM   5722  C  CB    . SER A 1 812  ? 27.652  -14.046 157.659 1.00 57.59  ? 811  SER A CB    1 
ATOM   5723  O  OG    . SER A 1 812  ? 26.668  -13.334 156.949 1.00 57.14  ? 811  SER A OG    1 
ATOM   5724  N  N     . TYR A 1 813  ? 30.029  -11.814 158.272 1.00 51.12  ? 812  TYR A N     1 
ATOM   5725  C  CA    . TYR A 1 813  ? 30.701  -10.592 157.875 1.00 49.11  ? 812  TYR A CA    1 
ATOM   5726  C  C     . TYR A 1 813  ? 31.530  -10.857 156.630 1.00 48.41  ? 812  TYR A C     1 
ATOM   5727  O  O     . TYR A 1 813  ? 32.061  -11.956 156.452 1.00 49.14  ? 812  TYR A O     1 
ATOM   5728  C  CB    . TYR A 1 813  ? 31.568  -10.059 159.022 1.00 48.13  ? 812  TYR A CB    1 
ATOM   5729  C  CG    . TYR A 1 813  ? 30.747  -9.598  160.207 1.00 48.72  ? 812  TYR A CG    1 
ATOM   5730  C  CD1   . TYR A 1 813  ? 30.243  -10.507 161.125 1.00 50.39  ? 812  TYR A CD1   1 
ATOM   5731  C  CD2   . TYR A 1 813  ? 30.465  -8.254  160.396 1.00 47.74  ? 812  TYR A CD2   1 
ATOM   5732  C  CE1   . TYR A 1 813  ? 29.482  -10.094 162.193 1.00 51.05  ? 812  TYR A CE1   1 
ATOM   5733  C  CE2   . TYR A 1 813  ? 29.709  -7.829  161.466 1.00 48.41  ? 812  TYR A CE2   1 
ATOM   5734  C  CZ    . TYR A 1 813  ? 29.219  -8.752  162.362 1.00 50.05  ? 812  TYR A CZ    1 
ATOM   5735  O  OH    . TYR A 1 813  ? 28.464  -8.324  163.426 1.00 50.82  ? 812  TYR A OH    1 
ATOM   5736  N  N     . GLN A 1 814  ? 31.607  -9.856  155.758 1.00 49.14  ? 813  GLN A N     1 
ATOM   5737  C  CA    . GLN A 1 814  ? 32.430  -9.942  154.559 1.00 49.43  ? 813  GLN A CA    1 
ATOM   5738  C  C     . GLN A 1 814  ? 33.863  -9.602  154.935 1.00 48.40  ? 813  GLN A C     1 
ATOM   5739  O  O     . GLN A 1 814  ? 34.165  -8.462  155.296 1.00 47.04  ? 813  GLN A O     1 
ATOM   5740  C  CB    . GLN A 1 814  ? 31.905  -9.002  153.478 1.00 53.09  ? 813  GLN A CB    1 
ATOM   5741  C  CG    . GLN A 1 814  ? 32.770  -8.931  152.231 1.00 54.69  ? 813  GLN A CG    1 
ATOM   5742  C  CD    . GLN A 1 814  ? 32.622  -10.144 151.348 1.00 56.74  ? 813  GLN A CD    1 
ATOM   5743  O  OE1   . GLN A 1 814  ? 31.562  -10.375 150.754 1.00 59.61  ? 813  GLN A OE1   1 
ATOM   5744  N  NE2   . GLN A 1 814  ? 33.685  -10.929 151.249 1.00 57.72  ? 813  GLN A NE2   1 
ATOM   5745  N  N     . VAL A 1 815  ? 34.748  -10.592 154.860 1.00 45.41  ? 814  VAL A N     1 
ATOM   5746  C  CA    . VAL A 1 815  ? 36.148  -10.365 155.175 1.00 44.31  ? 814  VAL A CA    1 
ATOM   5747  C  C     . VAL A 1 815  ? 36.767  -9.466  154.114 1.00 42.89  ? 814  VAL A C     1 
ATOM   5748  O  O     . VAL A 1 815  ? 36.391  -9.510  152.941 1.00 43.05  ? 814  VAL A O     1 
ATOM   5749  C  CB    . VAL A 1 815  ? 36.877  -11.716 155.274 1.00 45.35  ? 814  VAL A CB    1 
ATOM   5750  C  CG1   . VAL A 1 815  ? 38.299  -11.533 155.728 1.00 44.42  ? 814  VAL A CG1   1 
ATOM   5751  C  CG2   . VAL A 1 815  ? 36.133  -12.634 156.217 1.00 46.98  ? 814  VAL A CG2   1 
ATOM   5752  N  N     . ASP A 1 816  ? 37.710  -8.619  154.530 1.00 41.57  ? 815  ASP A N     1 
ATOM   5753  C  CA    . ASP A 1 816  ? 38.467  -7.771  153.611 1.00 40.28  ? 815  ASP A CA    1 
ATOM   5754  C  C     . ASP A 1 816  ? 39.916  -8.237  153.580 1.00 40.02  ? 815  ASP A C     1 
ATOM   5755  O  O     . ASP A 1 816  ? 40.663  -8.013  154.537 1.00 39.57  ? 815  ASP A O     1 
ATOM   5756  C  CB    . ASP A 1 816  ? 38.386  -6.304  154.012 1.00 40.37  ? 815  ASP A CB    1 
ATOM   5757  C  CG    . ASP A 1 816  ? 39.222  -5.420  153.116 1.00 41.03  ? 815  ASP A CG    1 
ATOM   5758  O  OD1   . ASP A 1 816  ? 39.506  -5.832  151.975 1.00 41.82  ? 815  ASP A OD1   1 
ATOM   5759  O  OD2   . ASP A 1 816  ? 39.604  -4.317  153.546 1.00 43.02  ? 815  ASP A OD2   1 
ATOM   5760  N  N     . SER A 1 817  ? 40.305  -8.883  152.479 1.00 40.40  ? 816  SER A N     1 
ATOM   5761  C  CA    . SER A 1 817  ? 41.661  -9.370  152.264 1.00 40.34  ? 816  SER A CA    1 
ATOM   5762  C  C     . SER A 1 817  ? 42.489  -8.428  151.416 1.00 39.12  ? 816  SER A C     1 
ATOM   5763  O  O     . SER A 1 817  ? 43.663  -8.707  151.170 1.00 39.04  ? 816  SER A O     1 
ATOM   5764  C  CB    . SER A 1 817  ? 41.646  -10.736 151.575 1.00 41.76  ? 816  SER A CB    1 
ATOM   5765  O  OG    . SER A 1 817  ? 40.600  -11.545 152.049 1.00 43.05  ? 816  SER A OG    1 
ATOM   5766  N  N     . LYS A 1 818  ? 41.911  -7.336  150.953 1.00 38.30  ? 817  LYS A N     1 
ATOM   5767  C  CA    . LYS A 1 818  ? 42.556  -6.551  149.918 1.00 37.42  ? 817  LYS A CA    1 
ATOM   5768  C  C     . LYS A 1 818  ? 43.771  -5.817  150.474 1.00 36.42  ? 817  LYS A C     1 
ATOM   5769  O  O     . LYS A 1 818  ? 43.690  -5.163  151.513 1.00 35.89  ? 817  LYS A O     1 
ATOM   5770  C  CB    . LYS A 1 818  ? 41.553  -5.566  149.320 1.00 36.96  ? 817  LYS A CB    1 
ATOM   5771  C  CG    . LYS A 1 818  ? 42.211  -4.396  148.617 1.00 35.86  ? 817  LYS A CG    1 
ATOM   5772  C  CD    . LYS A 1 818  ? 41.238  -3.545  147.856 1.00 35.65  ? 817  LYS A CD    1 
ATOM   5773  C  CE    . LYS A 1 818  ? 41.968  -2.823  146.757 1.00 35.01  ? 817  LYS A CE    1 
ATOM   5774  N  NZ    . LYS A 1 818  ? 43.029  -1.955  147.252 1.00 34.05  ? 817  LYS A NZ    1 
ATOM   5775  N  N     . PHE A 1 819  ? 44.906  -5.936  149.793 1.00 36.27  ? 818  PHE A N     1 
ATOM   5776  C  CA    . PHE A 1 819  ? 46.056  -5.128  150.148 1.00 35.37  ? 818  PHE A CA    1 
ATOM   5777  C  C     . PHE A 1 819  ? 46.029  -3.825  149.352 1.00 34.43  ? 818  PHE A C     1 
ATOM   5778  O  O     . PHE A 1 819  ? 45.141  -3.580  148.540 1.00 34.49  ? 818  PHE A O     1 
ATOM   5779  C  CB    . PHE A 1 819  ? 47.358  -5.903  149.939 1.00 35.83  ? 818  PHE A CB    1 
ATOM   5780  C  CG    . PHE A 1 819  ? 47.477  -6.561  148.599 1.00 36.50  ? 818  PHE A CG    1 
ATOM   5781  C  CD1   . PHE A 1 819  ? 47.592  -5.812  147.439 1.00 35.99  ? 818  PHE A CD1   1 
ATOM   5782  C  CD2   . PHE A 1 819  ? 47.510  -7.932  148.498 1.00 37.76  ? 818  PHE A CD2   1 
ATOM   5783  C  CE1   . PHE A 1 819  ? 47.705  -6.417  146.222 1.00 36.69  ? 818  PHE A CE1   1 
ATOM   5784  C  CE2   . PHE A 1 819  ? 47.628  -8.536  147.281 1.00 38.48  ? 818  PHE A CE2   1 
ATOM   5785  C  CZ    . PHE A 1 819  ? 47.726  -7.777  146.143 1.00 37.93  ? 818  PHE A CZ    1 
ATOM   5786  N  N     . ASN A 1 820  ? 47.011  -2.970  149.607 1.00 34.07  ? 819  ASN A N     1 
ATOM   5787  C  CA    . ASN A 1 820  ? 47.164  -1.693  148.911 1.00 32.85  ? 819  ASN A CA    1 
ATOM   5788  C  C     . ASN A 1 820  ? 45.969  -0.772  149.115 1.00 32.46  ? 819  ASN A C     1 
ATOM   5789  O  O     . ASN A 1 820  ? 45.557  -0.058  148.206 1.00 32.22  ? 819  ASN A O     1 
ATOM   5790  C  CB    . ASN A 1 820  ? 47.430  -1.880  147.421 1.00 33.11  ? 819  ASN A CB    1 
ATOM   5791  C  CG    . ASN A 1 820  ? 47.991  -0.638  146.791 1.00 32.40  ? 819  ASN A CG    1 
ATOM   5792  O  OD1   . ASN A 1 820  ? 48.702  0.116   147.443 1.00 31.84  ? 819  ASN A OD1   1 
ATOM   5793  N  ND2   . ASN A 1 820  ? 47.662  -0.396  145.536 1.00 32.51  ? 819  ASN A ND2   1 
ATOM   5794  N  N     . ARG A 1 821  ? 45.423  -0.759  150.317 1.00 32.48  ? 820  ARG A N     1 
ATOM   5795  C  CA    . ARG A 1 821  ? 44.524  0.317   150.687 1.00 32.08  ? 820  ARG A CA    1 
ATOM   5796  C  C     . ARG A 1 821  ? 45.368  1.501   151.143 1.00 31.29  ? 820  ARG A C     1 
ATOM   5797  O  O     . ARG A 1 821  ? 46.594  1.489   151.047 1.00 31.06  ? 820  ARG A O     1 
ATOM   5798  C  CB    . ARG A 1 821  ? 43.544  -0.138  151.753 1.00 32.58  ? 820  ARG A CB    1 
ATOM   5799  C  CG    . ARG A 1 821  ? 42.705  -1.322  151.373 1.00 33.52  ? 820  ARG A CG    1 
ATOM   5800  C  CD    . ARG A 1 821  ? 41.433  -1.309  152.173 1.00 33.98  ? 820  ARG A CD    1 
ATOM   5801  N  NE    . ARG A 1 821  ? 40.542  -2.404  151.815 1.00 35.02  ? 820  ARG A NE    1 
ATOM   5802  C  CZ    . ARG A 1 821  ? 39.620  -2.342  150.854 1.00 35.37  ? 820  ARG A CZ    1 
ATOM   5803  N  NH1   . ARG A 1 821  ? 39.460  -1.237  150.148 1.00 34.77  ? 820  ARG A NH1   1 
ATOM   5804  N  NH2   . ARG A 1 821  ? 38.856  -3.388  150.605 1.00 36.43  ? 820  ARG A NH2   1 
ATOM   5805  N  N     . LYS A 1 822  ? 44.715  2.553   151.618 1.00 30.98  ? 821  LYS A N     1 
ATOM   5806  C  CA    . LYS A 1 822  ? 45.410  3.735   152.108 1.00 30.37  ? 821  LYS A CA    1 
ATOM   5807  C  C     . LYS A 1 822  ? 46.390  3.369   153.222 1.00 32.73  ? 821  LYS A C     1 
ATOM   5808  O  O     . LYS A 1 822  ? 46.005  2.775   154.233 1.00 36.79  ? 821  LYS A O     1 
ATOM   5809  C  CB    . LYS A 1 822  ? 44.377  4.752   152.591 1.00 30.31  ? 821  LYS A CB    1 
ATOM   5810  C  CG    . LYS A 1 822  ? 44.865  5.684   153.685 1.00 29.97  ? 821  LYS A CG    1 
ATOM   5811  C  CD    . LYS A 1 822  ? 44.186  7.021   153.645 1.00 29.87  ? 821  LYS A CD    1 
ATOM   5812  C  CE    . LYS A 1 822  ? 43.560  7.340   154.971 1.00 30.37  ? 821  LYS A CE    1 
ATOM   5813  N  NZ    . LYS A 1 822  ? 43.305  8.791   155.121 1.00 30.04  ? 821  LYS A NZ    1 
ATOM   5814  N  N     . ILE A 1 823  ? 47.665  3.724   153.034 1.00 29.96  ? 822  ILE A N     1 
ATOM   5815  C  CA    . ILE A 1 823  ? 48.727  3.123   153.840 1.00 30.08  ? 822  ILE A CA    1 
ATOM   5816  C  C     . ILE A 1 823  ? 48.940  3.853   155.168 1.00 29.85  ? 822  ILE A C     1 
ATOM   5817  O  O     . ILE A 1 823  ? 49.367  3.242   156.149 1.00 30.11  ? 822  ILE A O     1 
ATOM   5818  C  CB    . ILE A 1 823  ? 50.034  3.060   153.033 1.00 30.00  ? 822  ILE A CB    1 
ATOM   5819  C  CG1   . ILE A 1 823  ? 50.492  4.462   152.652 1.00 29.49  ? 822  ILE A CG1   1 
ATOM   5820  C  CG2   . ILE A 1 823  ? 49.856  2.218   151.794 1.00 30.38  ? 822  ILE A CG2   1 
ATOM   5821  C  CD1   . ILE A 1 823  ? 51.853  4.504   152.019 1.00 29.52  ? 822  ILE A CD1   1 
ATOM   5822  N  N     . SER A 1 824  ? 48.636  5.141   155.238 1.00 30.25  ? 823  SER A N     1 
ATOM   5823  C  CA    . SER A 1 824  ? 48.958  5.930   156.409 1.00 29.34  ? 823  SER A CA    1 
ATOM   5824  C  C     . SER A 1 824  ? 48.122  7.195   156.380 1.00 30.82  ? 823  SER A C     1 
ATOM   5825  O  O     . SER A 1 824  ? 47.388  7.456   155.429 1.00 36.09  ? 823  SER A O     1 
ATOM   5826  C  CB    . SER A 1 824  ? 50.435  6.282   156.431 1.00 29.14  ? 823  SER A CB    1 
ATOM   5827  O  OG    . SER A 1 824  ? 50.644  7.439   155.659 1.00 28.84  ? 823  SER A OG    1 
ATOM   5828  N  N     . ASP A 1 825  ? 48.238  7.982   157.433 1.00 29.16  ? 824  ASP A N     1 
ATOM   5829  C  CA    . ASP A 1 825  ? 47.776  9.347   157.374 1.00 29.08  ? 824  ASP A CA    1 
ATOM   5830  C  C     . ASP A 1 825  ? 48.628  10.124  156.386 1.00 28.80  ? 824  ASP A C     1 
ATOM   5831  O  O     . ASP A 1 825  ? 49.733  9.717   156.030 1.00 28.67  ? 824  ASP A O     1 
ATOM   5832  C  CB    . ASP A 1 825  ? 47.831  9.987   158.759 1.00 29.25  ? 824  ASP A CB    1 
ATOM   5833  C  CG    . ASP A 1 825  ? 46.752  9.472   159.668 1.00 32.08  ? 824  ASP A CG    1 
ATOM   5834  O  OD1   . ASP A 1 825  ? 45.995  8.584   159.241 1.00 40.15  ? 824  ASP A OD1   1 
ATOM   5835  O  OD2   . ASP A 1 825  ? 46.657  9.945   160.811 1.00 32.10  ? 824  ASP A OD2   1 
ATOM   5836  N  N     . ALA A 1 826  ? 48.101  11.257  155.943 1.00 28.83  ? 825  ALA A N     1 
ATOM   5837  C  CA    . ALA A 1 826  ? 48.755  12.039  154.904 1.00 28.70  ? 825  ALA A CA    1 
ATOM   5838  C  C     . ALA A 1 826  ? 49.720  13.084  155.438 1.00 28.74  ? 825  ALA A C     1 
ATOM   5839  O  O     . ALA A 1 826  ? 50.583  13.538  154.683 1.00 28.70  ? 825  ALA A O     1 
ATOM   5840  C  CB    . ALA A 1 826  ? 47.707  12.738  154.034 1.00 28.87  ? 825  ALA A CB    1 
ATOM   5841  N  N     . THR A 1 827  ? 49.584  13.496  156.699 1.00 28.91  ? 826  THR A N     1 
ATOM   5842  C  CA    . THR A 1 827  ? 50.475  14.510  157.242 1.00 29.06  ? 826  THR A CA    1 
ATOM   5843  C  C     . THR A 1 827  ? 51.921  14.056  157.117 1.00 28.92  ? 826  THR A C     1 
ATOM   5844  O  O     . THR A 1 827  ? 52.254  12.896  157.362 1.00 28.79  ? 826  THR A O     1 
ATOM   5845  C  CB    . THR A 1 827  ? 50.144  14.809  158.700 1.00 29.34  ? 826  THR A CB    1 
ATOM   5846  O  OG1   . THR A 1 827  ? 48.763  15.136  158.826 1.00 29.60  ? 826  THR A OG1   1 
ATOM   5847  C  CG2   . THR A 1 827  ? 50.937  15.985  159.179 1.00 29.63  ? 826  THR A CG2   1 
ATOM   5848  N  N     . ILE A 1 828  ? 52.772  14.971  156.689 1.00 29.06  ? 827  ILE A N     1 
ATOM   5849  C  CA    . ILE A 1 828  ? 54.184  14.706  156.484 1.00 29.08  ? 827  ILE A CA    1 
ATOM   5850  C  C     . ILE A 1 828  ? 54.925  15.399  157.626 1.00 29.72  ? 827  ILE A C     1 
ATOM   5851  O  O     . ILE A 1 828  ? 54.905  16.629  157.744 1.00 31.25  ? 827  ILE A O     1 
ATOM   5852  C  CB    . ILE A 1 828  ? 54.633  15.175  155.096 1.00 29.16  ? 827  ILE A CB    1 
ATOM   5853  C  CG1   . ILE A 1 828  ? 54.026  14.249  154.038 1.00 28.89  ? 827  ILE A CG1   1 
ATOM   5854  C  CG2   . ILE A 1 828  ? 56.122  15.172  154.959 1.00 29.39  ? 827  ILE A CG2   1 
ATOM   5855  C  CD1   . ILE A 1 828  ? 54.297  14.650  152.595 1.00 29.02  ? 827  ILE A CD1   1 
ATOM   5856  N  N     . TYR A 1 829  ? 55.538  14.602  158.498 1.00 29.42  ? 828  TYR A N     1 
ATOM   5857  C  CA    . TYR A 1 829  ? 55.970  15.053  159.815 1.00 29.74  ? 828  TYR A CA    1 
ATOM   5858  C  C     . TYR A 1 829  ? 57.471  15.264  159.855 1.00 30.07  ? 828  TYR A C     1 
ATOM   5859  O  O     . TYR A 1 829  ? 58.241  14.401  159.429 1.00 30.03  ? 828  TYR A O     1 
ATOM   5860  C  CB    . TYR A 1 829  ? 55.585  14.044  160.892 1.00 29.69  ? 828  TYR A CB    1 
ATOM   5861  C  CG    . TYR A 1 829  ? 54.113  13.941  161.202 1.00 29.58  ? 828  TYR A CG    1 
ATOM   5862  C  CD1   . TYR A 1 829  ? 53.516  14.814  162.086 1.00 29.90  ? 828  TYR A CD1   1 
ATOM   5863  C  CD2   . TYR A 1 829  ? 53.329  12.938  160.639 1.00 29.31  ? 828  TYR A CD2   1 
ATOM   5864  C  CE1   . TYR A 1 829  ? 52.183  14.715  162.384 1.00 29.94  ? 828  TYR A CE1   1 
ATOM   5865  C  CE2   . TYR A 1 829  ? 51.984  12.835  160.939 1.00 29.34  ? 828  TYR A CE2   1 
ATOM   5866  C  CZ    . TYR A 1 829  ? 51.419  13.726  161.814 1.00 29.66  ? 828  TYR A CZ    1 
ATOM   5867  O  OH    . TYR A 1 829  ? 50.090  13.644  162.130 1.00 29.84  ? 828  TYR A OH    1 
ATOM   5868  N  N     . ALA A 1 830  ? 57.880  16.406  160.383 1.00 30.52  ? 829  ALA A N     1 
ATOM   5869  C  CA    . ALA A 1 830  ? 59.272  16.604  160.728 1.00 30.99  ? 829  ALA A CA    1 
ATOM   5870  C  C     . ALA A 1 830  ? 59.569  15.974  162.088 1.00 31.15  ? 829  ALA A C     1 
ATOM   5871  O  O     . ALA A 1 830  ? 58.672  15.731  162.900 1.00 31.01  ? 829  ALA A O     1 
ATOM   5872  C  CB    . ALA A 1 830  ? 59.603  18.092  160.737 1.00 31.55  ? 829  ALA A CB    1 
ATOM   5873  N  N     . THR A 1 831  ? 60.845  15.669  162.310 1.00 31.53  ? 830  THR A N     1 
ATOM   5874  C  CA    . THR A 1 831  ? 61.340  15.229  163.608 1.00 31.88  ? 830  THR A CA    1 
ATOM   5875  C  C     . THR A 1 831  ? 62.560  16.058  163.971 1.00 32.62  ? 830  THR A C     1 
ATOM   5876  O  O     . THR A 1 831  ? 63.200  16.656  163.107 1.00 32.86  ? 830  THR A O     1 
ATOM   5877  C  CB    . THR A 1 831  ? 61.721  13.742  163.629 1.00 31.79  ? 830  THR A CB    1 
ATOM   5878  O  OG1   . THR A 1 831  ? 62.880  13.545  162.822 1.00 32.07  ? 830  THR A OG1   1 
ATOM   5879  C  CG2   . THR A 1 831  ? 60.598  12.876  163.093 1.00 31.18  ? 830  THR A CG2   1 
ATOM   5880  N  N     . ARG A 1 832  ? 62.854  16.109  165.272 1.00 33.07  ? 831  ARG A N     1 
ATOM   5881  C  CA    . ARG A 1 832  ? 64.069  16.716  165.804 1.00 33.90  ? 831  ARG A CA    1 
ATOM   5882  C  C     . ARG A 1 832  ? 64.565  15.932  167.010 1.00 34.29  ? 831  ARG A C     1 
ATOM   5883  O  O     . ARG A 1 832  ? 63.836  15.148  167.615 1.00 33.97  ? 831  ARG A O     1 
ATOM   5884  C  CB    . ARG A 1 832  ? 63.877  18.180  166.217 1.00 34.38  ? 831  ARG A CB    1 
ATOM   5885  C  CG    . ARG A 1 832  ? 63.288  19.081  165.120 1.00 34.16  ? 831  ARG A CG    1 
ATOM   5886  C  CD    . ARG A 1 832  ? 64.313  19.495  164.042 1.00 34.53  ? 831  ARG A CD    1 
ATOM   5887  N  NE    . ARG A 1 832  ? 63.817  20.656  163.307 1.00 34.66  ? 831  ARG A NE    1 
ATOM   5888  C  CZ    . ARG A 1 832  ? 62.956  20.590  162.284 1.00 34.05  ? 831  ARG A CZ    1 
ATOM   5889  N  NH1   . ARG A 1 832  ? 62.555  21.718  161.688 1.00 34.34  ? 831  ARG A NH1   1 
ATOM   5890  N  NH2   . ARG A 1 832  ? 62.485  19.407  161.856 1.00 33.26  ? 831  ARG A NH2   1 
ATOM   5891  N  N     . GLN A 1 833  ? 65.826  16.167  167.344 1.00 35.08  ? 832  GLN A N     1 
ATOM   5892  C  CA    . GLN A 1 833  ? 66.439  15.639  168.551 1.00 35.68  ? 832  GLN A CA    1 
ATOM   5893  C  C     . GLN A 1 833  ? 66.261  16.646  169.680 1.00 36.21  ? 832  GLN A C     1 
ATOM   5894  O  O     . GLN A 1 833  ? 66.721  17.787  169.572 1.00 36.75  ? 832  GLN A O     1 
ATOM   5895  C  CB    . GLN A 1 833  ? 67.917  15.372  168.304 1.00 36.42  ? 832  GLN A CB    1 
ATOM   5896  C  CG    . GLN A 1 833  ? 68.192  14.571  167.056 1.00 36.08  ? 832  GLN A CG    1 
ATOM   5897  C  CD    . GLN A 1 833  ? 67.648  13.171  167.159 1.00 35.60  ? 832  GLN A CD    1 
ATOM   5898  O  OE1   . GLN A 1 833  ? 67.046  12.651  166.218 1.00 36.11  ? 832  GLN A OE1   1 
ATOM   5899  N  NE2   . GLN A 1 833  ? 67.849  12.548  168.309 1.00 36.04  ? 832  GLN A NE2   1 
ATOM   5900  N  N     . ALA A 1 834  ? 65.598  16.236  170.759 1.00 37.80  ? 833  ALA A N     1 
ATOM   5901  C  CA    . ALA A 1 834  ? 65.443  17.128  171.902 1.00 39.34  ? 833  ALA A CA    1 
ATOM   5902  C  C     . ALA A 1 834  ? 65.265  16.318  173.176 1.00 40.63  ? 833  ALA A C     1 
ATOM   5903  O  O     . ALA A 1 834  ? 64.951  15.125  173.143 1.00 40.15  ? 833  ALA A O     1 
ATOM   5904  C  CB    . ALA A 1 834  ? 64.258  18.078  171.720 1.00 39.15  ? 833  ALA A CB    1 
ATOM   5905  N  N     . LYS A 1 835  ? 65.477  16.992  174.305 1.00 47.94  ? 834  LYS A N     1 
ATOM   5906  C  CA    . LYS A 1 835  ? 65.131  16.477  175.623 1.00 46.87  ? 834  LYS A CA    1 
ATOM   5907  C  C     . LYS A 1 835  ? 63.882  17.207  176.092 1.00 44.52  ? 834  LYS A C     1 
ATOM   5908  O  O     . LYS A 1 835  ? 63.887  18.434  176.214 1.00 42.98  ? 834  LYS A O     1 
ATOM   5909  C  CB    . LYS A 1 835  ? 66.273  16.672  176.613 1.00 52.91  ? 834  LYS A CB    1 
ATOM   5910  C  CG    . LYS A 1 835  ? 67.605  16.100  176.172 1.00 56.67  ? 834  LYS A CG    1 
ATOM   5911  C  CD    . LYS A 1 835  ? 68.674  16.384  177.229 1.00 59.31  ? 834  LYS A CD    1 
ATOM   5912  C  CE    . LYS A 1 835  ? 70.065  16.013  176.744 1.00 60.57  ? 834  LYS A CE    1 
ATOM   5913  N  NZ    . LYS A 1 835  ? 70.877  17.209  176.387 1.00 63.88  ? 834  LYS A NZ    1 
ATOM   5914  N  N     . VAL A 1 836  ? 62.814  16.457  176.331 1.00 39.37  ? 835  VAL A N     1 
ATOM   5915  C  CA    . VAL A 1 836  ? 61.526  17.008  176.731 1.00 38.90  ? 835  VAL A CA    1 
ATOM   5916  C  C     . VAL A 1 836  ? 61.050  16.246  177.958 1.00 43.57  ? 835  VAL A C     1 
ATOM   5917  O  O     . VAL A 1 836  ? 61.220  15.025  178.042 1.00 48.13  ? 835  VAL A O     1 
ATOM   5918  C  CB    . VAL A 1 836  ? 60.481  16.909  175.590 1.00 36.73  ? 835  VAL A CB    1 
ATOM   5919  C  CG1   . VAL A 1 836  ? 59.152  17.523  176.008 1.00 36.86  ? 835  VAL A CG1   1 
ATOM   5920  C  CG2   . VAL A 1 836  ? 61.009  17.553  174.300 1.00 36.37  ? 835  VAL A CG2   1 
ATOM   5921  N  N     . GLY A 1 837  ? 60.457  16.959  178.908 1.00 41.30  ? 836  GLY A N     1 
ATOM   5922  C  CA    . GLY A 1 837  ? 59.885  16.311  180.072 1.00 46.96  ? 836  GLY A CA    1 
ATOM   5923  C  C     . GLY A 1 837  ? 60.894  15.651  180.992 1.00 49.14  ? 836  GLY A C     1 
ATOM   5924  O  O     . GLY A 1 837  ? 61.706  16.334  181.615 1.00 50.04  ? 836  GLY A O     1 
ATOM   5925  N  N     . LYS A 1 838  ? 60.826  14.332  181.092 1.00 65.97  ? 837  LYS A N     1 
ATOM   5926  C  CA    . LYS A 1 838  ? 61.660  13.540  181.987 1.00 73.42  ? 837  LYS A CA    1 
ATOM   5927  C  C     . LYS A 1 838  ? 62.893  12.857  181.433 1.00 76.55  ? 837  LYS A C     1 
ATOM   5928  O  O     . LYS A 1 838  ? 63.429  11.991  182.091 1.00 79.62  ? 837  LYS A O     1 
ATOM   5929  C  CB    . LYS A 1 838  ? 60.810  12.456  182.647 1.00 77.53  ? 837  LYS A CB    1 
ATOM   5930  C  CG    . LYS A 1 838  ? 59.997  12.877  183.869 1.00 80.20  ? 837  LYS A CG    1 
ATOM   5931  C  CD    . LYS A 1 838  ? 58.726  12.046  183.995 1.00 81.74  ? 837  LYS A CD    1 
ATOM   5932  C  CE    . LYS A 1 838  ? 58.652  11.230  185.283 1.00 84.66  ? 837  LYS A CE    1 
ATOM   5933  N  NZ    . LYS A 1 838  ? 57.838  9.983   185.136 1.00 85.63  ? 837  LYS A NZ    1 
ATOM   5934  N  N     . ASP A 1 839  ? 63.334  13.196  180.236 1.00 69.04  ? 838  ASP A N     1 
ATOM   5935  C  CA    . ASP A 1 839  ? 64.496  12.533  179.675 1.00 67.05  ? 838  ASP A CA    1 
ATOM   5936  C  C     . ASP A 1 839  ? 65.744  13.384  179.751 1.00 64.47  ? 838  ASP A C     1 
ATOM   5937  O  O     . ASP A 1 839  ? 65.666  14.588  179.634 1.00 62.67  ? 838  ASP A O     1 
ATOM   5938  C  CB    . ASP A 1 839  ? 64.275  12.108  178.206 1.00 65.58  ? 838  ASP A CB    1 
ATOM   5939  C  CG    . ASP A 1 839  ? 62.849  12.283  177.714 1.00 66.19  ? 838  ASP A CG    1 
ATOM   5940  O  OD1   . ASP A 1 839  ? 61.970  11.541  178.144 1.00 69.73  ? 838  ASP A OD1   1 
ATOM   5941  O  OD2   . ASP A 1 839  ? 62.616  13.133  176.853 1.00 66.77  ? 838  ASP A OD2   1 
ATOM   5942  N  N     . LYS A 1 840  ? 66.898  12.765  179.978 1.00 65.07  ? 839  LYS A N     1 
ATOM   5943  C  CA    . LYS A 1 840  ? 68.157  13.516  179.997 1.00 66.73  ? 839  LYS A CA    1 
ATOM   5944  C  C     . LYS A 1 840  ? 69.144  13.039  178.947 1.00 67.83  ? 839  LYS A C     1 
ATOM   5945  O  O     . LYS A 1 840  ? 70.326  13.310  178.989 1.00 70.61  ? 839  LYS A O     1 
ATOM   5946  C  CB    . LYS A 1 840  ? 68.781  13.681  181.380 1.00 65.71  ? 839  LYS A CB    1 
ATOM   5947  C  CG    . LYS A 1 840  ? 69.394  15.067  181.577 1.00 64.41  ? 839  LYS A CG    1 
ATOM   5948  C  CD    . LYS A 1 840  ? 69.121  15.629  182.972 1.00 65.30  ? 839  LYS A CD    1 
ATOM   5949  C  CE    . LYS A 1 840  ? 69.184  17.157  183.015 1.00 65.88  ? 839  LYS A CE    1 
ATOM   5950  N  NZ    . LYS A 1 840  ? 70.544  17.772  182.980 1.00 66.98  ? 839  LYS A NZ    1 
ATOM   5951  N  N     . ALA A 1 841  ? 68.601  12.318  177.999 1.00 74.59  ? 840  ALA A N     1 
ATOM   5952  C  CA    . ALA A 1 841  ? 69.312  11.821  176.872 1.00 74.71  ? 840  ALA A CA    1 
ATOM   5953  C  C     . ALA A 1 841  ? 68.486  12.398  175.735 1.00 74.06  ? 840  ALA A C     1 
ATOM   5954  O  O     . ALA A 1 841  ? 67.278  12.459  175.836 1.00 74.85  ? 840  ALA A O     1 
ATOM   5955  C  CB    . ALA A 1 841  ? 69.229  10.327  176.870 1.00 75.99  ? 840  ALA A CB    1 
ATOM   5956  N  N     . ASP A 1 842  ? 69.120  12.838  174.666 1.00 66.19  ? 841  ASP A N     1 
ATOM   5957  C  CA    . ASP A 1 842  ? 68.386  13.395  173.557 1.00 57.72  ? 841  ASP A CA    1 
ATOM   5958  C  C     . ASP A 1 842  ? 67.549  12.304  172.998 1.00 50.91  ? 841  ASP A C     1 
ATOM   5959  O  O     . ASP A 1 842  ? 67.955  11.185  172.992 1.00 49.83  ? 841  ASP A O     1 
ATOM   5960  C  CB    . ASP A 1 842  ? 69.344  13.850  172.489 1.00 55.00  ? 841  ASP A CB    1 
ATOM   5961  C  CG    . ASP A 1 842  ? 69.426  15.325  172.378 1.00 53.05  ? 841  ASP A CG    1 
ATOM   5962  O  OD1   . ASP A 1 842  ? 68.928  16.021  173.254 1.00 52.20  ? 841  ASP A OD1   1 
ATOM   5963  O  OD2   . ASP A 1 842  ? 70.013  15.798  171.404 1.00 53.03  ? 841  ASP A OD2   1 
ATOM   5964  N  N     . GLU A 1 843  ? 66.371  12.646  172.534 1.00 46.26  ? 842  GLU A N     1 
ATOM   5965  C  CA    . GLU A 1 843  ? 65.413  11.726  171.940 1.00 45.06  ? 842  GLU A CA    1 
ATOM   5966  C  C     . GLU A 1 843  ? 64.921  12.293  170.614 1.00 38.00  ? 842  GLU A C     1 
ATOM   5967  O  O     . GLU A 1 843  ? 65.048  13.488  170.345 1.00 36.37  ? 842  GLU A O     1 
ATOM   5968  C  CB    . GLU A 1 843  ? 64.227  11.481  172.886 1.00 48.79  ? 842  GLU A CB    1 
ATOM   5969  C  CG    . GLU A 1 843  ? 63.661  10.080  172.847 1.00 51.42  ? 842  GLU A CG    1 
ATOM   5970  C  CD    . GLU A 1 843  ? 64.300  9.167   173.873 1.00 53.99  ? 842  GLU A CD    1 
ATOM   5971  O  OE1   . GLU A 1 843  ? 64.297  9.512   175.071 1.00 54.74  ? 842  GLU A OE1   1 
ATOM   5972  O  OE2   . GLU A 1 843  ? 64.812  8.102   173.482 1.00 57.33  ? 842  GLU A OE2   1 
ATOM   5973  N  N     . THR A 1 844  ? 64.350  11.424  169.783 1.00 37.37  ? 843  THR A N     1 
ATOM   5974  C  CA    . THR A 1 844  ? 63.736  11.833  168.523 1.00 34.17  ? 843  THR A CA    1 
ATOM   5975  C  C     . THR A 1 844  ? 62.266  12.151  168.765 1.00 33.37  ? 843  THR A C     1 
ATOM   5976  O  O     . THR A 1 844  ? 61.467  11.254  169.040 1.00 33.17  ? 843  THR A O     1 
ATOM   5977  C  CB    . THR A 1 844  ? 63.876  10.744  167.467 1.00 35.17  ? 843  THR A CB    1 
ATOM   5978  O  OG1   . THR A 1 844  ? 65.264  10.468  167.249 1.00 37.61  ? 843  THR A OG1   1 
ATOM   5979  C  CG2   . THR A 1 844  ? 63.246  11.202  166.157 1.00 34.84  ? 843  THR A CG2   1 
ATOM   5980  N  N     . TYR A 1 845  ? 61.906  13.420  168.651 1.00 33.30  ? 844  TYR A N     1 
ATOM   5981  C  CA    . TYR A 1 845  ? 60.531  13.863  168.836 1.00 34.60  ? 844  TYR A CA    1 
ATOM   5982  C  C     . TYR A 1 845  ? 59.915  14.231  167.493 1.00 32.95  ? 844  TYR A C     1 
ATOM   5983  O  O     . TYR A 1 845  ? 60.538  14.930  166.690 1.00 37.01  ? 844  TYR A O     1 
ATOM   5984  C  CB    . TYR A 1 845  ? 60.467  15.055  169.789 1.00 37.45  ? 844  TYR A CB    1 
ATOM   5985  C  CG    . TYR A 1 845  ? 60.343  14.652  171.231 1.00 37.53  ? 844  TYR A CG    1 
ATOM   5986  C  CD1   . TYR A 1 845  ? 61.456  14.263  171.968 1.00 38.42  ? 844  TYR A CD1   1 
ATOM   5987  C  CD2   . TYR A 1 845  ? 59.111  14.644  171.859 1.00 36.58  ? 844  TYR A CD2   1 
ATOM   5988  C  CE1   . TYR A 1 845  ? 61.338  13.887  173.287 1.00 37.62  ? 844  TYR A CE1   1 
ATOM   5989  C  CE2   . TYR A 1 845  ? 58.986  14.265  173.177 1.00 39.83  ? 844  TYR A CE2   1 
ATOM   5990  C  CZ    . TYR A 1 845  ? 60.101  13.888  173.887 1.00 38.02  ? 844  TYR A CZ    1 
ATOM   5991  O  OH    . TYR A 1 845  ? 59.961  13.512  175.204 1.00 39.33  ? 844  TYR A OH    1 
ATOM   5992  N  N     . VAL A 1 846  ? 58.703  13.750  167.248 1.00 31.88  ? 845  VAL A N     1 
ATOM   5993  C  CA    . VAL A 1 846  ? 57.923  14.197  166.105 1.00 31.40  ? 845  VAL A CA    1 
ATOM   5994  C  C     . VAL A 1 846  ? 57.382  15.584  166.415 1.00 31.67  ? 845  VAL A C     1 
ATOM   5995  O  O     . VAL A 1 846  ? 56.834  15.823  167.495 1.00 32.00  ? 845  VAL A O     1 
ATOM   5996  C  CB    . VAL A 1 846  ? 56.786  13.206  165.796 1.00 30.97  ? 845  VAL A CB    1 
ATOM   5997  C  CG1   . VAL A 1 846  ? 55.850  13.765  164.745 1.00 30.59  ? 845  VAL A CG1   1 
ATOM   5998  C  CG2   . VAL A 1 846  ? 57.341  11.883  165.333 1.00 30.83  ? 845  VAL A CG2   1 
ATOM   5999  N  N     . LEU A 1 847  ? 57.541  16.504  165.473 1.00 31.63  ? 846  LEU A N     1 
ATOM   6000  C  CA    . LEU A 1 847  ? 57.002  17.839  165.652 1.00 32.00  ? 846  LEU A CA    1 
ATOM   6001  C  C     . LEU A 1 847  ? 55.543  17.904  165.230 1.00 33.79  ? 846  LEU A C     1 
ATOM   6002  O  O     . LEU A 1 847  ? 55.060  17.102  164.429 1.00 34.35  ? 846  LEU A O     1 
ATOM   6003  C  CB    . LEU A 1 847  ? 57.791  18.864  164.850 1.00 33.39  ? 846  LEU A CB    1 
ATOM   6004  C  CG    . LEU A 1 847  ? 59.297  18.944  165.042 1.00 34.24  ? 846  LEU A CG    1 
ATOM   6005  C  CD1   . LEU A 1 847  ? 59.777  20.213  164.386 1.00 35.18  ? 846  LEU A CD1   1 
ATOM   6006  C  CD2   . LEU A 1 847  ? 59.664  18.932  166.507 1.00 33.97  ? 846  LEU A CD2   1 
ATOM   6007  N  N     . GLY A 1 848  ? 54.892  18.925  165.731 1.00 32.20  ? 847  GLY A N     1 
ATOM   6008  C  CA    . GLY A 1 848  ? 53.524  19.245  165.452 1.00 32.18  ? 847  GLY A CA    1 
ATOM   6009  C  C     . GLY A 1 848  ? 53.546  20.730  165.287 1.00 32.85  ? 847  GLY A C     1 
ATOM   6010  O  O     . GLY A 1 848  ? 54.491  21.336  165.653 1.00 33.29  ? 847  GLY A O     1 
ATOM   6011  N  N     . LYS A 1 849  ? 52.537  21.306  164.688 1.00 33.54  ? 848  LYS A N     1 
ATOM   6012  C  CA    . LYS A 1 849  ? 52.495  22.744  164.535 1.00 38.93  ? 848  LYS A CA    1 
ATOM   6013  C  C     . LYS A 1 849  ? 51.096  23.318  164.600 1.00 41.24  ? 848  LYS A C     1 
ATOM   6014  O  O     . LYS A 1 849  ? 50.171  22.706  164.137 1.00 46.85  ? 848  LYS A O     1 
ATOM   6015  C  CB    . LYS A 1 849  ? 53.298  23.171  163.307 1.00 40.63  ? 848  LYS A CB    1 
ATOM   6016  C  CG    . LYS A 1 849  ? 52.543  23.760  162.153 1.00 38.72  ? 848  LYS A CG    1 
ATOM   6017  C  CD    . LYS A 1 849  ? 53.212  25.021  161.677 1.00 39.70  ? 848  LYS A CD    1 
ATOM   6018  C  CE    . LYS A 1 849  ? 53.822  24.898  160.302 1.00 39.40  ? 848  LYS A CE    1 
ATOM   6019  N  NZ    . LYS A 1 849  ? 52.890  24.537  159.225 1.00 38.07  ? 848  LYS A NZ    1 
ATOM   6020  N  N     . ILE A 1 850  ? 50.958  24.498  165.176 1.00 38.99  ? 849  ILE A N     1 
ATOM   6021  C  CA    . ILE A 1 850  ? 49.676  25.166  165.255 1.00 39.59  ? 849  ILE A CA    1 
ATOM   6022  C  C     . ILE A 1 850  ? 49.702  25.992  164.014 1.00 36.36  ? 849  ILE A C     1 
ATOM   6023  O  O     . ILE A 1 850  ? 50.556  26.778  163.846 1.00 36.66  ? 849  ILE A O     1 
ATOM   6024  C  CB    . ILE A 1 850  ? 49.589  26.052  166.476 1.00 37.09  ? 849  ILE A CB    1 
ATOM   6025  C  CG1   . ILE A 1 850  ? 49.774  25.211  167.715 1.00 36.97  ? 849  ILE A CG1   1 
ATOM   6026  C  CG2   . ILE A 1 850  ? 48.264  26.742  166.532 1.00 38.01  ? 849  ILE A CG2   1 
ATOM   6027  C  CD1   . ILE A 1 850  ? 49.877  26.005  168.969 1.00 37.95  ? 849  ILE A CD1   1 
ATOM   6028  N  N     . LYS A 1 851  ? 48.750  25.790  163.138 1.00 38.46  ? 850  LYS A N     1 
ATOM   6029  C  CA    . LYS A 1 851  ? 48.789  26.429  161.825 1.00 39.91  ? 850  LYS A CA    1 
ATOM   6030  C  C     . LYS A 1 851  ? 48.528  27.925  161.926 1.00 44.30  ? 850  LYS A C     1 
ATOM   6031  O  O     . LYS A 1 851  ? 49.170  28.713  161.229 1.00 43.09  ? 850  LYS A O     1 
ATOM   6032  C  CB    . LYS A 1 851  ? 47.786  25.760  160.881 1.00 40.25  ? 850  LYS A CB    1 
ATOM   6033  N  N     . ASP A 1 852  ? 47.599  28.336  162.784 1.00 46.40  ? 851  ASP A N     1 
ATOM   6034  C  CA    . ASP A 1 852  ? 47.312  29.754  162.956 1.00 49.54  ? 851  ASP A CA    1 
ATOM   6035  C  C     . ASP A 1 852  ? 46.872  30.007  164.390 1.00 44.68  ? 851  ASP A C     1 
ATOM   6036  O  O     . ASP A 1 852  ? 45.864  29.453  164.836 1.00 41.42  ? 851  ASP A O     1 
ATOM   6037  C  CB    . ASP A 1 852  ? 46.243  30.202  161.969 1.00 55.87  ? 851  ASP A CB    1 
ATOM   6038  C  CG    . ASP A 1 852  ? 45.960  31.693  162.048 1.00 65.19  ? 851  ASP A CG    1 
ATOM   6039  O  OD1   . ASP A 1 852  ? 46.875  32.500  161.807 1.00 74.12  ? 851  ASP A OD1   1 
ATOM   6040  O  OD2   . ASP A 1 852  ? 44.818  32.067  162.361 1.00 67.10  ? 851  ASP A OD2   1 
ATOM   6041  N  N     . ILE A 1 853  ? 47.633  30.845  165.104 1.00 42.59  ? 852  ILE A N     1 
ATOM   6042  C  CA    . ILE A 1 853  ? 47.368  31.119  166.513 1.00 42.40  ? 852  ILE A CA    1 
ATOM   6043  C  C     . ILE A 1 853  ? 46.271  32.143  166.728 1.00 43.68  ? 852  ILE A C     1 
ATOM   6044  O  O     . ILE A 1 853  ? 45.916  32.421  167.880 1.00 44.59  ? 852  ILE A O     1 
ATOM   6045  C  CB    . ILE A 1 853  ? 48.651  31.604  167.215 1.00 42.59  ? 852  ILE A CB    1 
ATOM   6046  C  CG1   . ILE A 1 853  ? 49.116  32.921  166.608 1.00 43.69  ? 852  ILE A CG1   1 
ATOM   6047  C  CG2   . ILE A 1 853  ? 49.743  30.581  167.068 1.00 41.23  ? 852  ILE A CG2   1 
ATOM   6048  C  CD1   . ILE A 1 853  ? 50.422  33.417  167.150 1.00 44.20  ? 852  ILE A CD1   1 
ATOM   6049  N  N     . TYR A 1 854  ? 45.715  32.710  165.667 1.00 44.10  ? 853  TYR A N     1 
ATOM   6050  C  CA    . TYR A 1 854  ? 44.712  33.753  165.800 1.00 45.74  ? 853  TYR A CA    1 
ATOM   6051  C  C     . TYR A 1 854  ? 43.282  33.231  165.731 1.00 45.74  ? 853  TYR A C     1 
ATOM   6052  O  O     . TYR A 1 854  ? 42.348  34.011  165.929 1.00 51.40  ? 853  TYR A O     1 
ATOM   6053  C  CB    . TYR A 1 854  ? 44.930  34.823  164.736 1.00 46.56  ? 853  TYR A CB    1 
ATOM   6054  C  CG    . TYR A 1 854  ? 46.335  35.370  164.714 1.00 46.72  ? 853  TYR A CG    1 
ATOM   6055  C  CD1   . TYR A 1 854  ? 46.791  36.208  165.719 1.00 48.00  ? 853  TYR A CD1   1 
ATOM   6056  C  CD2   . TYR A 1 854  ? 47.203  35.053  163.684 1.00 45.71  ? 853  TYR A CD2   1 
ATOM   6057  C  CE1   . TYR A 1 854  ? 48.065  36.714  165.697 1.00 48.27  ? 853  TYR A CE1   1 
ATOM   6058  C  CE2   . TYR A 1 854  ? 48.484  35.550  163.656 1.00 45.99  ? 853  TYR A CE2   1 
ATOM   6059  C  CZ    . TYR A 1 854  ? 48.909  36.381  164.671 1.00 47.27  ? 853  TYR A CZ    1 
ATOM   6060  O  OH    . TYR A 1 854  ? 50.180  36.897  164.670 1.00 47.69  ? 853  TYR A OH    1 
ATOM   6061  N  N     . THR A 1 855  ? 43.086  31.946  165.468 1.00 44.28  ? 854  THR A N     1 
ATOM   6062  C  CA    . THR A 1 855  ? 41.791  31.314  165.663 1.00 44.33  ? 854  THR A CA    1 
ATOM   6063  C  C     . THR A 1 855  ? 41.658  30.879  167.118 1.00 44.55  ? 854  THR A C     1 
ATOM   6064  O  O     . THR A 1 855  ? 42.649  30.752  167.838 1.00 44.21  ? 854  THR A O     1 
ATOM   6065  C  CB    . THR A 1 855  ? 41.633  30.105  164.740 1.00 42.81  ? 854  THR A CB    1 
ATOM   6066  O  OG1   . THR A 1 855  ? 42.627  29.133  165.067 1.00 42.08  ? 854  THR A OG1   1 
ATOM   6067  C  CG2   . THR A 1 855  ? 41.798  30.509  163.269 1.00 43.11  ? 854  THR A CG2   1 
ATOM   6068  N  N     . GLN A 1 856  ? 40.418  30.662  167.562 1.00 50.34  ? 855  GLN A N     1 
ATOM   6069  C  CA    . GLN A 1 856  ? 40.239  30.137  168.912 1.00 52.46  ? 855  GLN A CA    1 
ATOM   6070  C  C     . GLN A 1 856  ? 40.830  28.739  169.023 1.00 54.03  ? 855  GLN A C     1 
ATOM   6071  O  O     . GLN A 1 856  ? 41.562  28.442  169.970 1.00 58.21  ? 855  GLN A O     1 
ATOM   6072  C  CB    . GLN A 1 856  ? 38.767  30.140  169.327 1.00 56.08  ? 855  GLN A CB    1 
ATOM   6073  C  CG    . GLN A 1 856  ? 38.422  31.235  170.335 1.00 58.22  ? 855  GLN A CG    1 
ATOM   6074  C  CD    . GLN A 1 856  ? 38.943  30.946  171.738 1.00 58.51  ? 855  GLN A CD    1 
ATOM   6075  O  OE1   . GLN A 1 856  ? 39.271  29.819  172.071 1.00 57.98  ? 855  GLN A OE1   1 
ATOM   6076  N  NE2   . GLN A 1 856  ? 39.033  31.974  172.558 1.00 60.63  ? 855  GLN A NE2   1 
ATOM   6077  N  N     . ASP A 1 857  ? 40.546  27.873  168.048 1.00 44.39  ? 856  ASP A N     1 
ATOM   6078  C  CA    . ASP A 1 857  ? 41.204  26.573  168.018 1.00 42.72  ? 856  ASP A CA    1 
ATOM   6079  C  C     . ASP A 1 857  ? 42.716  26.711  168.042 1.00 40.51  ? 856  ASP A C     1 
ATOM   6080  O  O     . ASP A 1 857  ? 43.405  25.893  168.659 1.00 39.80  ? 856  ASP A O     1 
ATOM   6081  C  CB    . ASP A 1 857  ? 40.789  25.779  166.783 1.00 42.28  ? 856  ASP A CB    1 
ATOM   6082  C  CG    . ASP A 1 857  ? 39.390  25.239  166.883 1.00 44.00  ? 856  ASP A CG    1 
ATOM   6083  O  OD1   . ASP A 1 857  ? 38.798  25.297  167.980 1.00 43.66  ? 856  ASP A OD1   1 
ATOM   6084  O  OD2   . ASP A 1 857  ? 38.887  24.731  165.860 1.00 48.45  ? 856  ASP A OD2   1 
ATOM   6085  N  N     . GLY A 1 858  ? 43.251  27.737  167.385 1.00 40.83  ? 857  GLY A N     1 
ATOM   6086  C  CA    . GLY A 1 858  ? 44.688  27.935  167.408 1.00 40.39  ? 857  GLY A CA    1 
ATOM   6087  C  C     . GLY A 1 858  ? 45.192  28.335  168.779 1.00 41.15  ? 857  GLY A C     1 
ATOM   6088  O  O     . GLY A 1 858  ? 46.247  27.874  169.223 1.00 40.55  ? 857  GLY A O     1 
ATOM   6089  N  N     . TYR A 1 859  ? 44.441  29.187  169.476 1.00 42.58  ? 858  TYR A N     1 
ATOM   6090  C  CA    . TYR A 1 859  ? 44.874  29.644  170.789 1.00 43.49  ? 858  TYR A CA    1 
ATOM   6091  C  C     . TYR A 1 859  ? 44.623  28.592  171.860 1.00 43.18  ? 858  TYR A C     1 
ATOM   6092  O  O     . TYR A 1 859  ? 45.493  28.357  172.700 1.00 43.06  ? 858  TYR A O     1 
ATOM   6093  C  CB    . TYR A 1 859  ? 44.193  30.965  171.147 1.00 45.31  ? 858  TYR A CB    1 
ATOM   6094  C  CG    . TYR A 1 859  ? 44.317  31.341  172.612 1.00 46.45  ? 858  TYR A CG    1 
ATOM   6095  C  CD1   . TYR A 1 859  ? 45.446  31.985  173.102 1.00 46.93  ? 858  TYR A CD1   1 
ATOM   6096  C  CD2   . TYR A 1 859  ? 43.293  31.078  173.501 1.00 47.20  ? 858  TYR A CD2   1 
ATOM   6097  C  CE1   . TYR A 1 859  ? 45.550  32.326  174.442 1.00 48.06  ? 858  TYR A CE1   1 
ATOM   6098  C  CE2   . TYR A 1 859  ? 43.393  31.421  174.828 1.00 48.33  ? 858  TYR A CE2   1 
ATOM   6099  C  CZ    . TYR A 1 859  ? 44.511  32.039  175.294 1.00 48.74  ? 858  TYR A CZ    1 
ATOM   6100  O  OH    . TYR A 1 859  ? 44.552  32.352  176.630 1.00 49.95  ? 858  TYR A OH    1 
ATOM   6101  N  N     . ASP A 1 860  ? 43.458  27.936  171.846 1.00 46.31  ? 859  ASP A N     1 
ATOM   6102  C  CA    . ASP A 1 860  ? 43.220  26.865  172.812 1.00 49.10  ? 859  ASP A CA    1 
ATOM   6103  C  C     . ASP A 1 860  ? 44.285  25.788  172.715 1.00 47.64  ? 859  ASP A C     1 
ATOM   6104  O  O     . ASP A 1 860  ? 44.715  25.244  173.735 1.00 48.27  ? 859  ASP A O     1 
ATOM   6105  C  CB    . ASP A 1 860  ? 41.847  26.221  172.627 1.00 54.05  ? 859  ASP A CB    1 
ATOM   6106  C  CG    . ASP A 1 860  ? 40.718  27.197  172.750 1.00 59.35  ? 859  ASP A CG    1 
ATOM   6107  O  OD1   . ASP A 1 860  ? 40.518  27.754  173.843 1.00 65.47  ? 859  ASP A OD1   1 
ATOM   6108  O  OD2   . ASP A 1 860  ? 40.023  27.398  171.745 1.00 62.36  ? 859  ASP A OD2   1 
ATOM   6109  N  N     . ALA A 1 861  ? 44.704  25.440  171.502 1.00 43.45  ? 860  ALA A N     1 
ATOM   6110  C  CA    . ALA A 1 861  ? 45.806  24.499  171.376 1.00 39.11  ? 860  ALA A CA    1 
ATOM   6111  C  C     . ALA A 1 861  ? 47.069  25.063  172.008 1.00 39.41  ? 860  ALA A C     1 
ATOM   6112  O  O     . ALA A 1 861  ? 47.847  24.331  172.632 1.00 38.99  ? 860  ALA A O     1 
ATOM   6113  C  CB    . ALA A 1 861  ? 46.047  24.154  169.910 1.00 38.03  ? 860  ALA A CB    1 
ATOM   6114  N  N     . PHE A 1 862  ? 47.273  26.371  171.878 1.00 40.28  ? 861  PHE A N     1 
ATOM   6115  C  CA    . PHE A 1 862  ? 48.470  26.988  172.421 1.00 40.72  ? 861  PHE A CA    1 
ATOM   6116  C  C     . PHE A 1 862  ? 48.523  26.832  173.935 1.00 41.42  ? 861  PHE A C     1 
ATOM   6117  O  O     . PHE A 1 862  ? 49.569  26.501  174.498 1.00 41.22  ? 861  PHE A O     1 
ATOM   6118  C  CB    . PHE A 1 862  ? 48.520  28.462  172.023 1.00 41.76  ? 861  PHE A CB    1 
ATOM   6119  C  CG    . PHE A 1 862  ? 49.635  29.217  172.667 1.00 42.53  ? 861  PHE A CG    1 
ATOM   6120  C  CD1   . PHE A 1 862  ? 49.468  29.804  173.913 1.00 43.82  ? 861  PHE A CD1   1 
ATOM   6121  C  CD2   . PHE A 1 862  ? 50.851  29.338  172.038 1.00 42.06  ? 861  PHE A CD2   1 
ATOM   6122  C  CE1   . PHE A 1 862  ? 50.489  30.490  174.507 1.00 44.61  ? 861  PHE A CE1   1 
ATOM   6123  C  CE2   . PHE A 1 862  ? 51.877  30.034  172.632 1.00 42.89  ? 861  PHE A CE2   1 
ATOM   6124  C  CZ    . PHE A 1 862  ? 51.694  30.608  173.865 1.00 44.15  ? 861  PHE A CZ    1 
ATOM   6125  N  N     . MET A 1 863  ? 47.396  27.060  174.611 1.00 43.85  ? 862  MET A N     1 
ATOM   6126  C  CA    . MET A 1 863  ? 47.390  27.026  176.066 1.00 44.80  ? 862  MET A CA    1 
ATOM   6127  C  C     . MET A 1 863  ? 47.526  25.605  176.599 1.00 42.42  ? 862  MET A C     1 
ATOM   6128  O  O     . MET A 1 863  ? 48.174  25.391  177.625 1.00 42.81  ? 862  MET A O     1 
ATOM   6129  C  CB    . MET A 1 863  ? 46.124  27.682  176.602 1.00 47.58  ? 862  MET A CB    1 
ATOM   6130  C  CG    . MET A 1 863  ? 45.998  29.159  176.273 1.00 54.66  ? 862  MET A CG    1 
ATOM   6131  S  SD    . MET A 1 863  ? 47.343  30.190  176.901 1.00 55.48  ? 862  MET A SD    1 
ATOM   6132  C  CE    . MET A 1 863  ? 47.338  29.751  178.629 1.00 56.53  ? 862  MET A CE    1 
ATOM   6133  N  N     . LYS A 1 864  ? 46.913  24.625  175.932 1.00 41.47  ? 863  LYS A N     1 
ATOM   6134  C  CA    . LYS A 1 864  ? 47.101  23.235  176.331 1.00 40.87  ? 863  LYS A CA    1 
ATOM   6135  C  C     . LYS A 1 864  ? 48.580  22.891  176.415 1.00 40.11  ? 863  LYS A C     1 
ATOM   6136  O  O     . LYS A 1 864  ? 49.031  22.273  177.382 1.00 40.25  ? 863  LYS A O     1 
ATOM   6137  C  CB    . LYS A 1 864  ? 46.399  22.298  175.349 1.00 42.64  ? 863  LYS A CB    1 
ATOM   6138  C  CG    . LYS A 1 864  ? 44.923  22.103  175.594 1.00 45.42  ? 863  LYS A CG    1 
ATOM   6139  C  CD    . LYS A 1 864  ? 44.416  20.846  174.892 1.00 47.66  ? 863  LYS A CD    1 
ATOM   6140  C  CE    . LYS A 1 864  ? 44.980  19.593  175.557 1.00 52.72  ? 863  LYS A CE    1 
ATOM   6141  N  NZ    . LYS A 1 864  ? 44.632  18.324  174.869 1.00 52.80  ? 863  LYS A NZ    1 
ATOM   6142  N  N     . ILE A 1 865  ? 49.352  23.290  175.403 1.00 42.00  ? 864  ILE A N     1 
ATOM   6143  C  CA    . ILE A 1 865  ? 50.790  23.046  175.400 1.00 40.59  ? 864  ILE A CA    1 
ATOM   6144  C  C     . ILE A 1 865  ? 51.489  23.978  176.376 1.00 43.23  ? 864  ILE A C     1 
ATOM   6145  O  O     . ILE A 1 865  ? 52.526  23.631  176.949 1.00 44.42  ? 864  ILE A O     1 
ATOM   6146  C  CB    . ILE A 1 865  ? 51.350  23.212  173.975 1.00 40.87  ? 864  ILE A CB    1 
ATOM   6147  C  CG1   . ILE A 1 865  ? 50.558  22.368  172.976 1.00 40.42  ? 864  ILE A CG1   1 
ATOM   6148  C  CG2   . ILE A 1 865  ? 52.814  22.835  173.927 1.00 40.57  ? 864  ILE A CG2   1 
ATOM   6149  C  CD1   . ILE A 1 865  ? 50.860  22.707  171.532 1.00 39.90  ? 864  ILE A CD1   1 
ATOM   6150  N  N     . TYR A 1 866  ? 50.933  25.167  176.584 1.00 41.20  ? 865  TYR A N     1 
ATOM   6151  C  CA    . TYR A 1 866  ? 51.584  26.173  177.408 1.00 42.38  ? 865  TYR A CA    1 
ATOM   6152  C  C     . TYR A 1 866  ? 51.491  25.810  178.879 1.00 43.12  ? 865  TYR A C     1 
ATOM   6153  O  O     . TYR A 1 866  ? 52.491  25.837  179.603 1.00 43.50  ? 865  TYR A O     1 
ATOM   6154  C  CB    . TYR A 1 866  ? 50.937  27.528  177.143 1.00 43.43  ? 865  TYR A CB    1 
ATOM   6155  C  CG    . TYR A 1 866  ? 51.475  28.671  177.947 1.00 44.87  ? 865  TYR A CG    1 
ATOM   6156  C  CD1   . TYR A 1 866  ? 52.605  29.358  177.541 1.00 45.06  ? 865  TYR A CD1   1 
ATOM   6157  C  CD2   . TYR A 1 866  ? 50.835  29.086  179.098 1.00 46.17  ? 865  TYR A CD2   1 
ATOM   6158  C  CE1   . TYR A 1 866  ? 53.092  30.412  178.266 1.00 46.50  ? 865  TYR A CE1   1 
ATOM   6159  C  CE2   . TYR A 1 866  ? 51.312  30.137  179.829 1.00 47.60  ? 865  TYR A CE2   1 
ATOM   6160  C  CZ    . TYR A 1 866  ? 52.441  30.798  179.412 1.00 47.76  ? 865  TYR A CZ    1 
ATOM   6161  O  OH    . TYR A 1 866  ? 52.920  31.849  180.153 1.00 49.32  ? 865  TYR A OH    1 
ATOM   6162  N  N     . LYS A 1 867  ? 50.290  25.473  179.339 1.00 45.75  ? 866  LYS A N     1 
ATOM   6163  C  CA    . LYS A 1 867  ? 50.117  25.112  180.733 1.00 45.58  ? 866  LYS A CA    1 
ATOM   6164  C  C     . LYS A 1 867  ? 50.849  23.826  181.069 1.00 44.81  ? 866  LYS A C     1 
ATOM   6165  O  O     . LYS A 1 867  ? 51.262  23.631  182.213 1.00 44.56  ? 866  LYS A O     1 
ATOM   6166  C  CB    . LYS A 1 867  ? 48.633  24.988  181.048 1.00 48.84  ? 866  LYS A CB    1 
ATOM   6167  C  CG    . LYS A 1 867  ? 47.894  26.287  180.857 1.00 54.13  ? 866  LYS A CG    1 
ATOM   6168  C  CD    . LYS A 1 867  ? 46.637  26.330  181.699 1.00 58.16  ? 866  LYS A CD    1 
ATOM   6169  C  CE    . LYS A 1 867  ? 45.499  25.582  181.025 1.00 59.61  ? 866  LYS A CE    1 
ATOM   6170  N  NZ    . LYS A 1 867  ? 44.971  26.306  179.832 1.00 62.57  ? 866  LYS A NZ    1 
ATOM   6171  N  N     . LYS A 1 868  ? 51.047  22.957  180.092 1.00 45.32  ? 867  LYS A N     1 
ATOM   6172  C  CA    . LYS A 1 868  ? 51.672  21.673  180.351 1.00 45.71  ? 867  LYS A CA    1 
ATOM   6173  C  C     . LYS A 1 868  ? 53.197  21.757  180.338 1.00 45.35  ? 867  LYS A C     1 
ATOM   6174  O  O     . LYS A 1 868  ? 53.852  21.222  181.234 1.00 48.29  ? 867  LYS A O     1 
ATOM   6175  C  CB    . LYS A 1 868  ? 51.183  20.648  179.327 1.00 46.47  ? 867  LYS A CB    1 
ATOM   6176  C  CG    . LYS A 1 868  ? 52.002  19.377  179.314 1.00 47.80  ? 867  LYS A CG    1 
ATOM   6177  C  CD    . LYS A 1 868  ? 51.459  18.413  178.300 1.00 48.40  ? 867  LYS A CD    1 
ATOM   6178  C  CE    . LYS A 1 868  ? 52.191  17.072  178.353 1.00 49.03  ? 867  LYS A CE    1 
ATOM   6179  N  NZ    . LYS A 1 868  ? 51.724  16.167  177.258 1.00 50.82  ? 867  LYS A NZ    1 
ATOM   6180  N  N     . ASP A 1 869  ? 53.769  22.440  179.345 1.00 40.90  ? 868  ASP A N     1 
ATOM   6181  C  CA    . ASP A 1 869  ? 55.215  22.510  179.169 1.00 40.76  ? 868  ASP A CA    1 
ATOM   6182  C  C     . ASP A 1 869  ? 55.556  23.518  178.076 1.00 40.64  ? 868  ASP A C     1 
ATOM   6183  O  O     . ASP A 1 869  ? 55.629  23.167  176.897 1.00 39.67  ? 868  ASP A O     1 
ATOM   6184  C  CB    . ASP A 1 869  ? 55.777  21.124  178.834 1.00 39.78  ? 868  ASP A CB    1 
ATOM   6185  C  CG    . ASP A 1 869  ? 57.296  21.079  178.834 1.00 39.84  ? 868  ASP A CG    1 
ATOM   6186  O  OD1   . ASP A 1 869  ? 57.935  22.140  178.969 1.00 40.56  ? 868  ASP A OD1   1 
ATOM   6187  O  OD2   . ASP A 1 869  ? 57.855  19.974  178.677 1.00 39.26  ? 868  ASP A OD2   1 
ATOM   6188  N  N     . LYS A 1 870  ? 55.778  24.772  178.469 1.00 41.74  ? 869  LYS A N     1 
ATOM   6189  C  CA    . LYS A 1 870  ? 56.142  25.814  177.518 1.00 44.20  ? 869  LYS A CA    1 
ATOM   6190  C  C     . LYS A 1 870  ? 57.364  25.436  176.707 1.00 41.17  ? 869  LYS A C     1 
ATOM   6191  O  O     . LYS A 1 870  ? 57.512  25.895  175.571 1.00 40.85  ? 869  LYS A O     1 
ATOM   6192  C  CB    . LYS A 1 870  ? 56.422  27.132  178.245 1.00 48.32  ? 869  LYS A CB    1 
ATOM   6193  C  CG    . LYS A 1 870  ? 55.377  27.539  179.262 1.00 52.05  ? 869  LYS A CG    1 
ATOM   6194  C  CD    . LYS A 1 870  ? 55.756  28.792  180.041 1.00 55.03  ? 869  LYS A CD    1 
ATOM   6195  C  CE    . LYS A 1 870  ? 57.262  28.976  180.139 1.00 59.57  ? 869  LYS A CE    1 
ATOM   6196  N  NZ    . LYS A 1 870  ? 57.655  30.280  180.746 1.00 66.17  ? 869  LYS A NZ    1 
ATOM   6197  N  N     . SER A 1 871  ? 58.263  24.631  177.273 1.00 41.05  ? 870  SER A N     1 
ATOM   6198  C  CA    . SER A 1 871  ? 59.477  24.257  176.561 1.00 40.56  ? 870  SER A CA    1 
ATOM   6199  C  C     . SER A 1 871  ? 59.197  23.376  175.351 1.00 39.24  ? 870  SER A C     1 
ATOM   6200  O  O     . SER A 1 871  ? 60.114  23.141  174.559 1.00 38.86  ? 870  SER A O     1 
ATOM   6201  C  CB    . SER A 1 871  ? 60.456  23.549  177.504 1.00 40.87  ? 870  SER A CB    1 
ATOM   6202  O  OG    . SER A 1 871  ? 60.019  22.248  177.853 1.00 40.22  ? 870  SER A OG    1 
ATOM   6203  N  N     . LYS A 1 872  ? 57.970  22.872  175.206 1.00 38.66  ? 871  LYS A N     1 
ATOM   6204  C  CA    . LYS A 1 872  ? 57.612  22.124  174.002 1.00 37.53  ? 871  LYS A CA    1 
ATOM   6205  C  C     . LYS A 1 872  ? 57.669  23.011  172.768 1.00 37.41  ? 871  LYS A C     1 
ATOM   6206  O  O     . LYS A 1 872  ? 58.109  22.569  171.707 1.00 36.70  ? 871  LYS A O     1 
ATOM   6207  C  CB    . LYS A 1 872  ? 56.228  21.500  174.153 1.00 37.13  ? 871  LYS A CB    1 
ATOM   6208  C  CG    . LYS A 1 872  ? 56.215  20.249  175.003 1.00 36.98  ? 871  LYS A CG    1 
ATOM   6209  C  CD    . LYS A 1 872  ? 54.813  19.895  175.461 1.00 37.04  ? 871  LYS A CD    1 
ATOM   6210  C  CE    . LYS A 1 872  ? 53.947  19.392  174.325 1.00 36.18  ? 871  LYS A CE    1 
ATOM   6211  N  NZ    . LYS A 1 872  ? 54.409  18.066  173.889 1.00 35.40  ? 871  LYS A NZ    1 
ATOM   6212  N  N     . PHE A 1 873  ? 57.254  24.269  172.889 1.00 38.22  ? 872  PHE A N     1 
ATOM   6213  C  CA    . PHE A 1 873  ? 57.356  25.190  171.765 1.00 38.32  ? 872  PHE A CA    1 
ATOM   6214  C  C     . PHE A 1 873  ? 58.804  25.360  171.343 1.00 38.47  ? 872  PHE A C     1 
ATOM   6215  O  O     . PHE A 1 873  ? 59.687  25.588  172.171 1.00 39.20  ? 872  PHE A O     1 
ATOM   6216  C  CB    . PHE A 1 873  ? 56.759  26.546  172.120 1.00 39.45  ? 872  PHE A CB    1 
ATOM   6217  C  CG    . PHE A 1 873  ? 55.281  26.518  172.311 1.00 39.44  ? 872  PHE A CG    1 
ATOM   6218  C  CD1   . PHE A 1 873  ? 54.449  26.149  171.275 1.00 38.64  ? 872  PHE A CD1   1 
ATOM   6219  C  CD2   . PHE A 1 873  ? 54.722  26.868  173.519 1.00 40.34  ? 872  PHE A CD2   1 
ATOM   6220  C  CE1   . PHE A 1 873  ? 53.090  26.121  171.447 1.00 38.74  ? 872  PHE A CE1   1 
ATOM   6221  C  CE2   . PHE A 1 873  ? 53.370  26.843  173.696 1.00 40.46  ? 872  PHE A CE2   1 
ATOM   6222  C  CZ    . PHE A 1 873  ? 52.547  26.466  172.654 1.00 39.67  ? 872  PHE A CZ    1 
ATOM   6223  N  N     . LEU A 1 874  ? 59.050  25.245  170.045 1.00 37.87  ? 873  LEU A N     1 
ATOM   6224  C  CA    . LEU A 1 874  ? 60.407  25.381  169.542 1.00 38.08  ? 873  LEU A CA    1 
ATOM   6225  C  C     . LEU A 1 874  ? 60.921  26.803  169.661 1.00 39.34  ? 873  LEU A C     1 
ATOM   6226  O  O     . LEU A 1 874  ? 62.140  27.001  169.700 1.00 39.89  ? 873  LEU A O     1 
ATOM   6227  C  CB    . LEU A 1 874  ? 60.479  24.918  168.089 1.00 37.24  ? 873  LEU A CB    1 
ATOM   6228  C  CG    . LEU A 1 874  ? 60.830  23.450  167.878 1.00 36.30  ? 873  LEU A CG    1 
ATOM   6229  C  CD1   . LEU A 1 874  ? 59.895  22.564  168.647 1.00 35.79  ? 873  LEU A CD1   1 
ATOM   6230  C  CD2   . LEU A 1 874  ? 60.767  23.114  166.417 1.00 35.60  ? 873  LEU A CD2   1 
ATOM   6231  N  N     . MET A 1 875  ? 60.024  27.788  169.725 1.00 39.94  ? 874  MET A N     1 
ATOM   6232  C  CA    . MET A 1 875  ? 60.458  29.170  169.847 1.00 41.31  ? 874  MET A CA    1 
ATOM   6233  C  C     . MET A 1 875  ? 60.929  29.455  171.256 1.00 42.28  ? 874  MET A C     1 
ATOM   6234  O  O     . MET A 1 875  ? 61.880  30.215  171.459 1.00 44.97  ? 874  MET A O     1 
ATOM   6235  C  CB    . MET A 1 875  ? 59.337  30.131  169.471 1.00 41.80  ? 874  MET A CB    1 
ATOM   6236  C  CG    . MET A 1 875  ? 59.559  31.510  170.005 1.00 45.10  ? 874  MET A CG    1 
ATOM   6237  S  SD    . MET A 1 875  ? 58.420  32.633  169.254 1.00 45.56  ? 874  MET A SD    1 
ATOM   6238  C  CE    . MET A 1 875  ? 56.993  32.305  170.256 1.00 46.93  ? 874  MET A CE    1 
ATOM   6239  N  N     . TYR A 1 876  ? 60.253  28.868  172.240 1.00 45.81  ? 875  TYR A N     1 
ATOM   6240  C  CA    . TYR A 1 876  ? 60.722  28.971  173.610 1.00 45.96  ? 875  TYR A CA    1 
ATOM   6241  C  C     . TYR A 1 876  ? 62.192  28.602  173.704 1.00 43.76  ? 875  TYR A C     1 
ATOM   6242  O  O     . TYR A 1 876  ? 62.959  29.253  174.416 1.00 45.65  ? 875  TYR A O     1 
ATOM   6243  C  CB    . TYR A 1 876  ? 59.883  28.078  174.524 1.00 45.74  ? 875  TYR A CB    1 
ATOM   6244  C  CG    . TYR A 1 876  ? 60.205  28.273  175.976 1.00 46.02  ? 875  TYR A CG    1 
ATOM   6245  C  CD1   . TYR A 1 876  ? 61.192  27.528  176.596 1.00 46.71  ? 875  TYR A CD1   1 
ATOM   6246  C  CD2   . TYR A 1 876  ? 59.533  29.218  176.725 1.00 47.43  ? 875  TYR A CD2   1 
ATOM   6247  C  CE1   . TYR A 1 876  ? 61.500  27.723  177.935 1.00 46.99  ? 875  TYR A CE1   1 
ATOM   6248  C  CE2   . TYR A 1 876  ? 59.832  29.414  178.057 1.00 47.98  ? 875  TYR A CE2   1 
ATOM   6249  C  CZ    . TYR A 1 876  ? 60.810  28.666  178.656 1.00 47.49  ? 875  TYR A CZ    1 
ATOM   6250  O  OH    . TYR A 1 876  ? 61.087  28.869  179.984 1.00 49.44  ? 875  TYR A OH    1 
ATOM   6251  N  N     . ARG A 1 877  ? 62.608  27.588  172.960 1.00 41.93  ? 876  ARG A N     1 
ATOM   6252  C  CA    . ARG A 1 877  ? 63.982  27.128  173.033 1.00 42.09  ? 876  ARG A CA    1 
ATOM   6253  C  C     . ARG A 1 877  ? 64.908  27.844  172.066 1.00 42.63  ? 876  ARG A C     1 
ATOM   6254  O  O     . ARG A 1 877  ? 66.076  28.062  172.400 1.00 43.49  ? 876  ARG A O     1 
ATOM   6255  C  CB    . ARG A 1 877  ? 64.041  25.623  172.780 1.00 40.86  ? 876  ARG A CB    1 
ATOM   6256  C  CG    . ARG A 1 877  ? 63.372  24.835  173.879 1.00 40.57  ? 876  ARG A CG    1 
ATOM   6257  C  CD    . ARG A 1 877  ? 63.582  23.350  173.729 1.00 39.62  ? 876  ARG A CD    1 
ATOM   6258  N  NE    . ARG A 1 877  ? 62.708  22.611  174.631 1.00 39.32  ? 876  ARG A NE    1 
ATOM   6259  C  CZ    . ARG A 1 877  ? 62.936  21.370  175.042 1.00 38.95  ? 876  ARG A CZ    1 
ATOM   6260  N  NH1   . ARG A 1 877  ? 64.014  20.723  174.636 1.00 38.82  ? 876  ARG A NH1   1 
ATOM   6261  N  NH2   . ARG A 1 877  ? 62.084  20.778  175.862 1.00 38.82  ? 876  ARG A NH2   1 
ATOM   6262  N  N     . HIS A 1 878  ? 64.430  28.217  170.878 1.00 42.23  ? 877  HIS A N     1 
ATOM   6263  C  CA    . HIS A 1 878  ? 65.291  28.806  169.862 1.00 42.73  ? 877  HIS A CA    1 
ATOM   6264  C  C     . HIS A 1 878  ? 65.055  30.291  169.668 1.00 43.92  ? 877  HIS A C     1 
ATOM   6265  O  O     . HIS A 1 878  ? 65.776  30.922  168.890 1.00 44.59  ? 877  HIS A O     1 
ATOM   6266  C  CB    . HIS A 1 878  ? 65.121  28.070  168.534 1.00 41.55  ? 877  HIS A CB    1 
ATOM   6267  C  CG    . HIS A 1 878  ? 65.458  26.617  168.611 1.00 40.56  ? 877  HIS A CG    1 
ATOM   6268  N  ND1   . HIS A 1 878  ? 66.538  26.139  169.316 1.00 40.99  ? 877  HIS A ND1   1 
ATOM   6269  C  CD2   . HIS A 1 878  ? 64.831  25.532  168.106 1.00 39.29  ? 877  HIS A CD2   1 
ATOM   6270  C  CE1   . HIS A 1 878  ? 66.574  24.822  169.229 1.00 40.04  ? 877  HIS A CE1   1 
ATOM   6271  N  NE2   . HIS A 1 878  ? 65.547  24.429  168.501 1.00 39.00  ? 877  HIS A NE2   1 
ATOM   6272  N  N     . ASP A 1 879  ? 64.091  30.870  170.365 1.00 44.39  ? 878  ASP A N     1 
ATOM   6273  C  CA    . ASP A 1 879  ? 63.916  32.314  170.322 1.00 46.08  ? 878  ASP A CA    1 
ATOM   6274  C  C     . ASP A 1 879  ? 63.306  32.807  171.629 1.00 46.57  ? 878  ASP A C     1 
ATOM   6275  O  O     . ASP A 1 879  ? 62.215  33.388  171.626 1.00 46.84  ? 878  ASP A O     1 
ATOM   6276  C  CB    . ASP A 1 879  ? 63.022  32.684  169.156 1.00 47.45  ? 878  ASP A CB    1 
ATOM   6277  C  CG    . ASP A 1 879  ? 63.050  34.158  168.831 1.00 50.11  ? 878  ASP A CG    1 
ATOM   6278  O  OD1   . ASP A 1 879  ? 63.911  34.858  169.390 1.00 55.85  ? 878  ASP A OD1   1 
ATOM   6279  O  OD2   . ASP A 1 879  ? 62.230  34.615  167.994 1.00 49.90  ? 878  ASP A OD2   1 
ATOM   6280  N  N     . PRO A 1 880  ? 63.971  32.598  172.777 1.00 47.10  ? 879  PRO A N     1 
ATOM   6281  C  CA    . PRO A 1 880  ? 63.329  32.985  174.059 1.00 47.90  ? 879  PRO A CA    1 
ATOM   6282  C  C     . PRO A 1 880  ? 62.999  34.459  174.148 1.00 49.51  ? 879  PRO A C     1 
ATOM   6283  O  O     . PRO A 1 880  ? 62.079  34.816  174.884 1.00 51.04  ? 879  PRO A O     1 
ATOM   6284  C  CB    . PRO A 1 880  ? 64.370  32.591  175.116 1.00 48.40  ? 879  PRO A CB    1 
ATOM   6285  C  CG    . PRO A 1 880  ? 65.646  32.447  174.367 1.00 48.39  ? 879  PRO A CG    1 
ATOM   6286  C  CD    . PRO A 1 880  ? 65.309  31.968  173.007 1.00 47.09  ? 879  PRO A CD    1 
ATOM   6287  N  N     . GLN A 1 881  ? 63.687  35.317  173.388 1.00 55.54  ? 880  GLN A N     1 
ATOM   6288  C  CA    . GLN A 1 881  ? 63.365  36.739  173.402 1.00 58.02  ? 880  GLN A CA    1 
ATOM   6289  C  C     . GLN A 1 881  ? 61.940  36.977  172.914 1.00 56.42  ? 880  GLN A C     1 
ATOM   6290  O  O     . GLN A 1 881  ? 61.145  37.644  173.584 1.00 59.09  ? 880  GLN A O     1 
ATOM   6291  C  CB    . GLN A 1 881  ? 64.365  37.519  172.556 1.00 60.12  ? 880  GLN A CB    1 
ATOM   6292  C  CG    . GLN A 1 881  ? 65.813  37.256  172.930 1.00 59.05  ? 880  GLN A CG    1 
ATOM   6293  C  CD    . GLN A 1 881  ? 66.805  38.054  172.109 1.00 59.42  ? 880  GLN A CD    1 
ATOM   6294  O  OE1   . GLN A 1 881  ? 66.683  39.266  171.977 1.00 62.34  ? 880  GLN A OE1   1 
ATOM   6295  N  NE2   . GLN A 1 881  ? 67.801  37.372  171.560 1.00 57.66  ? 880  GLN A NE2   1 
ATOM   6296  N  N     . THR A 1 882  ? 61.595  36.431  171.748 1.00 57.39  ? 881  THR A N     1 
ATOM   6297  C  CA    . THR A 1 882  ? 60.231  36.576  171.254 1.00 54.27  ? 881  THR A CA    1 
ATOM   6298  C  C     . THR A 1 882  ? 59.233  35.983  172.234 1.00 50.41  ? 881  THR A C     1 
ATOM   6299  O  O     . THR A 1 882  ? 58.199  36.592  172.529 1.00 50.25  ? 881  THR A O     1 
ATOM   6300  C  CB    . THR A 1 882  ? 60.076  35.903  169.893 1.00 54.41  ? 881  THR A CB    1 
ATOM   6301  O  OG1   . THR A 1 882  ? 61.119  36.334  169.017 1.00 57.50  ? 881  THR A OG1   1 
ATOM   6302  C  CG2   . THR A 1 882  ? 58.760  36.279  169.288 1.00 55.97  ? 881  THR A CG2   1 
ATOM   6303  N  N     . PHE A 1 883  ? 59.527  34.796  172.752 1.00 48.33  ? 882  PHE A N     1 
ATOM   6304  C  CA    . PHE A 1 883  ? 58.566  34.141  173.622 1.00 47.83  ? 882  PHE A CA    1 
ATOM   6305  C  C     . PHE A 1 883  ? 58.365  34.936  174.903 1.00 49.43  ? 882  PHE A C     1 
ATOM   6306  O  O     . PHE A 1 883  ? 57.227  35.214  175.299 1.00 49.88  ? 882  PHE A O     1 
ATOM   6307  C  CB    . PHE A 1 883  ? 59.017  32.717  173.926 1.00 46.44  ? 882  PHE A CB    1 
ATOM   6308  C  CG    . PHE A 1 883  ? 57.924  31.850  174.455 1.00 45.64  ? 882  PHE A CG    1 
ATOM   6309  C  CD1   . PHE A 1 883  ? 57.574  31.894  175.792 1.00 46.41  ? 882  PHE A CD1   1 
ATOM   6310  C  CD2   . PHE A 1 883  ? 57.230  30.996  173.611 1.00 44.24  ? 882  PHE A CD2   1 
ATOM   6311  C  CE1   . PHE A 1 883  ? 56.558  31.104  176.277 1.00 45.80  ? 882  PHE A CE1   1 
ATOM   6312  C  CE2   . PHE A 1 883  ? 56.216  30.204  174.093 1.00 43.64  ? 882  PHE A CE2   1 
ATOM   6313  C  CZ    . PHE A 1 883  ? 55.881  30.256  175.432 1.00 44.44  ? 882  PHE A CZ    1 
ATOM   6314  N  N     . GLU A 1 884  ? 59.463  35.344  175.543 1.00 50.45  ? 883  GLU A N     1 
ATOM   6315  C  CA    . GLU A 1 884  ? 59.389  35.981  176.849 1.00 62.63  ? 883  GLU A CA    1 
ATOM   6316  C  C     . GLU A 1 884  ? 59.039  37.459  176.757 1.00 53.80  ? 883  GLU A C     1 
ATOM   6317  O  O     . GLU A 1 884  ? 58.382  37.987  177.658 1.00 54.98  ? 883  GLU A O     1 
ATOM   6318  C  CB    . GLU A 1 884  ? 60.716  35.791  177.588 1.00 64.24  ? 883  GLU A CB    1 
ATOM   6319  C  CG    . GLU A 1 884  ? 60.735  36.346  179.000 1.00 67.42  ? 883  GLU A CG    1 
ATOM   6320  C  CD    . GLU A 1 884  ? 59.947  35.497  179.982 1.00 68.56  ? 883  GLU A CD    1 
ATOM   6321  O  OE1   . GLU A 1 884  ? 59.387  34.457  179.568 1.00 70.76  ? 883  GLU A OE1   1 
ATOM   6322  O  OE2   . GLU A 1 884  ? 59.891  35.873  181.172 1.00 71.36  ? 883  GLU A OE2   1 
ATOM   6323  N  N     . LYS A 1 885  ? 59.448  38.140  175.690 1.00 54.23  ? 884  LYS A N     1 
ATOM   6324  C  CA    . LYS A 1 885  ? 59.282  39.584  175.602 1.00 56.19  ? 884  LYS A CA    1 
ATOM   6325  C  C     . LYS A 1 885  ? 58.228  40.027  174.600 1.00 56.14  ? 884  LYS A C     1 
ATOM   6326  O  O     . LYS A 1 885  ? 58.026  41.230  174.438 1.00 57.84  ? 884  LYS A O     1 
ATOM   6327  C  CB    . LYS A 1 885  ? 60.621  40.259  175.273 1.00 59.10  ? 884  LYS A CB    1 
ATOM   6328  C  CG    . LYS A 1 885  ? 61.820  39.545  175.865 1.00 59.04  ? 884  LYS A CG    1 
ATOM   6329  C  CD    . LYS A 1 885  ? 63.022  40.456  175.938 1.00 60.95  ? 884  LYS A CD    1 
ATOM   6330  C  CE    . LYS A 1 885  ? 63.609  40.726  174.571 1.00 61.01  ? 884  LYS A CE    1 
ATOM   6331  N  NZ    . LYS A 1 885  ? 65.061  41.033  174.689 1.00 62.54  ? 884  LYS A NZ    1 
ATOM   6332  N  N     . VAL A 1 886  ? 57.545  39.101  173.931 1.00 55.53  ? 885  VAL A N     1 
ATOM   6333  C  CA    . VAL A 1 886  ? 56.467  39.479  173.025 1.00 54.31  ? 885  VAL A CA    1 
ATOM   6334  C  C     . VAL A 1 886  ? 55.196  38.729  173.393 1.00 53.41  ? 885  VAL A C     1 
ATOM   6335  O  O     . VAL A 1 886  ? 54.151  39.338  173.640 1.00 54.45  ? 885  VAL A O     1 
ATOM   6336  C  CB    . VAL A 1 886  ? 56.844  39.215  171.559 1.00 53.23  ? 885  VAL A CB    1 
ATOM   6337  C  CG1   . VAL A 1 886  ? 55.677  39.529  170.673 1.00 53.23  ? 885  VAL A CG1   1 
ATOM   6338  C  CG2   . VAL A 1 886  ? 58.049  40.037  171.158 1.00 54.35  ? 885  VAL A CG2   1 
ATOM   6339  N  N     . ILE A 1 887  ? 55.282  37.403  173.464 1.00 51.62  ? 886  ILE A N     1 
ATOM   6340  C  CA    . ILE A 1 887  ? 54.073  36.602  173.596 1.00 50.67  ? 886  ILE A CA    1 
ATOM   6341  C  C     . ILE A 1 887  ? 53.589  36.532  175.042 1.00 51.43  ? 886  ILE A C     1 
ATOM   6342  O  O     . ILE A 1 887  ? 52.381  36.586  175.297 1.00 51.79  ? 886  ILE A O     1 
ATOM   6343  C  CB    . ILE A 1 887  ? 54.318  35.217  172.987 1.00 48.58  ? 886  ILE A CB    1 
ATOM   6344  C  CG1   . ILE A 1 887  ? 54.446  35.384  171.477 1.00 48.03  ? 886  ILE A CG1   1 
ATOM   6345  C  CG2   . ILE A 1 887  ? 53.212  34.251  173.358 1.00 47.68  ? 886  ILE A CG2   1 
ATOM   6346  C  CD1   . ILE A 1 887  ? 54.198  34.157  170.704 1.00 46.18  ? 886  ILE A CD1   1 
ATOM   6347  N  N     . GLU A 1 888  ? 54.500  36.422  176.014 1.00 51.80  ? 887  GLU A N     1 
ATOM   6348  C  CA    . GLU A 1 888  ? 54.077  36.416  177.415 1.00 52.70  ? 887  GLU A CA    1 
ATOM   6349  C  C     . GLU A 1 888  ? 53.390  37.715  177.824 1.00 54.76  ? 887  GLU A C     1 
ATOM   6350  O  O     . GLU A 1 888  ? 52.301  37.646  178.419 1.00 55.22  ? 887  GLU A O     1 
ATOM   6351  C  CB    . GLU A 1 888  ? 55.270  36.103  178.325 1.00 53.31  ? 887  GLU A CB    1 
ATOM   6352  C  CG    . GLU A 1 888  ? 55.966  34.786  178.063 1.00 53.03  ? 887  GLU A CG    1 
ATOM   6353  C  CD    . GLU A 1 888  ? 55.412  33.653  178.895 1.00 56.44  ? 887  GLU A CD    1 
ATOM   6354  O  OE1   . GLU A 1 888  ? 56.088  32.610  179.009 1.00 55.08  ? 887  GLU A OE1   1 
ATOM   6355  O  OE2   . GLU A 1 888  ? 54.301  33.809  179.438 1.00 63.92  ? 887  GLU A OE2   1 
ATOM   6356  N  N     . PRO A 1 889  ? 53.945  38.908  177.560 1.00 56.19  ? 888  PRO A N     1 
ATOM   6357  C  CA    . PRO A 1 889  ? 53.158  40.137  177.770 1.00 58.20  ? 888  PRO A CA    1 
ATOM   6358  C  C     . PRO A 1 889  ? 51.791  40.135  177.098 1.00 57.97  ? 888  PRO A C     1 
ATOM   6359  O  O     . PRO A 1 889  ? 50.825  40.638  177.683 1.00 59.32  ? 888  PRO A O     1 
ATOM   6360  C  CB    . PRO A 1 889  ? 54.053  41.230  177.174 1.00 59.37  ? 888  PRO A CB    1 
ATOM   6361  C  CG    . PRO A 1 889  ? 55.402  40.687  177.167 1.00 58.45  ? 888  PRO A CG    1 
ATOM   6362  C  CD    . PRO A 1 889  ? 55.334  39.207  177.165 1.00 56.27  ? 888  PRO A CD    1 
ATOM   6363  N  N     . ILE A 1 890  ? 51.684  39.614  175.876 1.00 56.45  ? 889  ILE A N     1 
ATOM   6364  C  CA    . ILE A 1 890  ? 50.398  39.612  175.181 1.00 56.29  ? 889  ILE A CA    1 
ATOM   6365  C  C     . ILE A 1 890  ? 49.374  38.804  175.964 1.00 55.87  ? 889  ILE A C     1 
ATOM   6366  O  O     . ILE A 1 890  ? 48.254  39.262  176.209 1.00 57.03  ? 889  ILE A O     1 
ATOM   6367  C  CB    . ILE A 1 890  ? 50.557  39.080  173.746 1.00 54.64  ? 889  ILE A CB    1 
ATOM   6368  C  CG1   . ILE A 1 890  ? 51.197  40.142  172.855 1.00 55.58  ? 889  ILE A CG1   1 
ATOM   6369  C  CG2   . ILE A 1 890  ? 49.214  38.661  173.178 1.00 54.05  ? 889  ILE A CG2   1 
ATOM   6370  C  CD1   . ILE A 1 890  ? 51.553  39.633  171.482 1.00 54.05  ? 889  ILE A CD1   1 
ATOM   6371  N  N     . LEU A 1 891  ? 49.741  37.585  176.367 1.00 58.20  ? 890  LEU A N     1 
ATOM   6372  C  CA    . LEU A 1 891  ? 48.843  36.794  177.200 1.00 56.51  ? 890  LEU A CA    1 
ATOM   6373  C  C     . LEU A 1 891  ? 48.490  37.528  178.481 1.00 59.94  ? 890  LEU A C     1 
ATOM   6374  O  O     . LEU A 1 891  ? 47.386  37.359  179.003 1.00 60.94  ? 890  LEU A O     1 
ATOM   6375  C  CB    . LEU A 1 891  ? 49.468  35.439  177.533 1.00 55.89  ? 890  LEU A CB    1 
ATOM   6376  C  CG    . LEU A 1 891  ? 49.731  34.445  176.406 1.00 52.44  ? 890  LEU A CG    1 
ATOM   6377  C  CD1   . LEU A 1 891  ? 50.423  33.227  176.953 1.00 50.59  ? 890  LEU A CD1   1 
ATOM   6378  C  CD2   . LEU A 1 891  ? 48.438  34.049  175.727 1.00 51.67  ? 890  LEU A CD2   1 
ATOM   6379  N  N     . GLU A 1 892  ? 49.405  38.357  178.992 1.00 58.99  ? 891  GLU A N     1 
ATOM   6380  C  CA    . GLU A 1 892  ? 49.184  39.053  180.256 1.00 62.45  ? 891  GLU A CA    1 
ATOM   6381  C  C     . GLU A 1 892  ? 48.258  40.254  180.115 1.00 61.23  ? 891  GLU A C     1 
ATOM   6382  O  O     . GLU A 1 892  ? 47.522  40.572  181.053 1.00 62.71  ? 891  GLU A O     1 
ATOM   6383  C  CB    . GLU A 1 892  ? 50.516  39.516  180.847 1.00 65.36  ? 891  GLU A CB    1 
ATOM   6384  C  CG    . GLU A 1 892  ? 51.383  38.403  181.408 1.00 65.51  ? 891  GLU A CG    1 
ATOM   6385  C  CD    . GLU A 1 892  ? 52.768  38.883  181.810 1.00 65.99  ? 891  GLU A CD    1 
ATOM   6386  O  OE1   . GLU A 1 892  ? 53.644  38.025  182.058 1.00 66.47  ? 891  GLU A OE1   1 
ATOM   6387  O  OE2   . GLU A 1 892  ? 52.983  40.114  181.871 1.00 68.73  ? 891  GLU A OE2   1 
ATOM   6388  N  N     . ASN A 1 893  ? 48.268  40.926  178.965 1.00 67.34  ? 892  ASN A N     1 
ATOM   6389  C  CA    . ASN A 1 893  ? 47.635  42.231  178.836 1.00 70.89  ? 892  ASN A CA    1 
ATOM   6390  C  C     . ASN A 1 893  ? 46.424  42.242  177.903 1.00 73.16  ? 892  ASN A C     1 
ATOM   6391  O  O     . ASN A 1 893  ? 45.906  43.321  177.599 1.00 73.35  ? 892  ASN A O     1 
ATOM   6392  C  CB    . ASN A 1 893  ? 48.673  43.256  178.376 1.00 73.96  ? 892  ASN A CB    1 
ATOM   6393  C  CG    . ASN A 1 893  ? 49.897  43.294  179.282 1.00 76.12  ? 892  ASN A CG    1 
ATOM   6394  O  OD1   . ASN A 1 893  ? 51.032  43.303  178.809 1.00 76.07  ? 892  ASN A OD1   1 
ATOM   6395  N  ND2   . ASN A 1 893  ? 49.668  43.314  180.590 1.00 77.55  ? 892  ASN A ND2   1 
ATOM   6396  N  N     . TYR A 1 894  ? 45.945  41.085  177.460 1.00 67.95  ? 893  TYR A N     1 
ATOM   6397  C  CA    . TYR A 1 894  ? 44.772  41.036  176.601 1.00 67.93  ? 893  TYR A CA    1 
ATOM   6398  C  C     . TYR A 1 894  ? 43.774  40.014  177.120 1.00 68.14  ? 893  TYR A C     1 
ATOM   6399  O  O     . TYR A 1 894  ? 44.167  38.968  177.642 1.00 69.51  ? 893  TYR A O     1 
ATOM   6400  C  CB    . TYR A 1 894  ? 45.149  40.691  175.156 1.00 62.45  ? 893  TYR A CB    1 
ATOM   6401  C  CG    . TYR A 1 894  ? 45.777  41.841  174.415 1.00 60.77  ? 893  TYR A CG    1 
ATOM   6402  C  CD1   . TYR A 1 894  ? 44.996  42.778  173.760 1.00 62.24  ? 893  TYR A CD1   1 
ATOM   6403  C  CD2   . TYR A 1 894  ? 47.149  42.000  174.384 1.00 60.45  ? 893  TYR A CD2   1 
ATOM   6404  C  CE1   . TYR A 1 894  ? 45.570  43.838  173.087 1.00 63.35  ? 893  TYR A CE1   1 
ATOM   6405  C  CE2   . TYR A 1 894  ? 47.730  43.054  173.713 1.00 61.95  ? 893  TYR A CE2   1 
ATOM   6406  C  CZ    . TYR A 1 894  ? 46.939  43.969  173.068 1.00 63.88  ? 893  TYR A CZ    1 
ATOM   6407  O  OH    . TYR A 1 894  ? 47.524  45.019  172.403 1.00 64.23  ? 893  TYR A OH    1 
ATOM   6408  N  N     . PRO A 1 895  ? 42.479  40.286  176.984 1.00 68.74  ? 894  PRO A N     1 
ATOM   6409  C  CA    . PRO A 1 895  ? 41.480  39.384  177.560 1.00 70.47  ? 894  PRO A CA    1 
ATOM   6410  C  C     . PRO A 1 895  ? 41.432  38.063  176.816 1.00 71.33  ? 894  PRO A C     1 
ATOM   6411  O  O     . PRO A 1 895  ? 41.705  37.984  175.616 1.00 71.46  ? 894  PRO A O     1 
ATOM   6412  C  CB    . PRO A 1 895  ? 40.169  40.159  177.401 1.00 73.12  ? 894  PRO A CB    1 
ATOM   6413  C  CG    . PRO A 1 895  ? 40.402  41.026  176.229 1.00 72.72  ? 894  PRO A CG    1 
ATOM   6414  C  CD    . PRO A 1 895  ? 41.854  41.411  176.269 1.00 70.13  ? 894  PRO A CD    1 
ATOM   6415  N  N     . ASN A 1 896  ? 41.100  37.009  177.554 1.00 74.57  ? 895  ASN A N     1 
ATOM   6416  C  CA    . ASN A 1 896  ? 40.824  35.708  176.967 1.00 75.89  ? 895  ASN A CA    1 
ATOM   6417  C  C     . ASN A 1 896  ? 39.335  35.399  176.965 1.00 79.25  ? 895  ASN A C     1 
ATOM   6418  O  O     . ASN A 1 896  ? 38.941  34.277  176.637 1.00 79.88  ? 895  ASN A O     1 
ATOM   6419  C  CB    . ASN A 1 896  ? 41.601  34.614  177.705 1.00 73.95  ? 895  ASN A CB    1 
ATOM   6420  C  CG    . ASN A 1 896  ? 40.989  34.265  179.043 1.00 74.83  ? 895  ASN A CG    1 
ATOM   6421  O  OD1   . ASN A 1 896  ? 40.267  33.279  179.164 1.00 72.85  ? 895  ASN A OD1   1 
ATOM   6422  N  ND2   . ASN A 1 896  ? 41.277  35.070  180.058 1.00 78.87  ? 895  ASN A ND2   1 
ATOM   6423  N  N     . LYS A 1 897  ? 38.504  36.377  177.318 1.00 88.88  ? 896  LYS A N     1 
ATOM   6424  C  CA    . LYS A 1 897  ? 37.057  36.231  177.282 1.00 92.53  ? 896  LYS A CA    1 
ATOM   6425  C  C     . LYS A 1 897  ? 36.448  37.597  176.996 1.00 95.64  ? 896  LYS A C     1 
ATOM   6426  O  O     . LYS A 1 897  ? 37.139  38.619  177.021 1.00 97.17  ? 896  LYS A O     1 
ATOM   6427  C  CB    . LYS A 1 897  ? 36.525  35.644  178.593 1.00 94.89  ? 896  LYS A CB    1 
ATOM   6428  N  N     . GLN A 1 898  ? 35.137  37.610  176.727 1.00 100.02 ? 897  GLN A N     1 
ATOM   6429  C  CA    . GLN A 1 898  ? 34.442  38.855  176.409 1.00 104.32 ? 897  GLN A CA    1 
ATOM   6430  C  C     . GLN A 1 898  ? 32.927  38.652  176.346 1.00 101.69 ? 897  GLN A C     1 
ATOM   6431  O  O     . GLN A 1 898  ? 32.461  37.555  176.026 1.00 102.76 ? 897  GLN A O     1 
ATOM   6432  C  CB    . GLN A 1 898  ? 34.987  39.416  175.090 1.00 107.52 ? 897  GLN A CB    1 
ATOM   6433  C  CG    . GLN A 1 898  ? 35.450  40.861  175.135 1.00 113.32 ? 897  GLN A CG    1 
ATOM   6434  C  CD    . GLN A 1 898  ? 36.184  41.275  173.884 1.00 116.67 ? 897  GLN A CD    1 
ATOM   6435  O  OE1   . GLN A 1 898  ? 36.976  40.509  173.341 1.00 116.76 ? 897  GLN A OE1   1 
ATOM   6436  N  NE2   . GLN A 1 898  ? 35.913  42.487  173.407 1.00 120.54 ? 897  GLN A NE2   1 
ATOM   6437  N  N     . ILE A 1 899  ? 32.213  39.753  176.560 1.00 99.98  ? 898  ILE A N     1 
ATOM   6438  C  CA    . ILE A 1 899  ? 30.773  39.791  176.468 1.00 95.98  ? 898  ILE A CA    1 
ATOM   6439  C  C     . ILE A 1 899  ? 30.486  39.866  174.978 1.00 89.58  ? 898  ILE A C     1 
ATOM   6440  O  O     . ILE A 1 899  ? 30.979  40.737  174.272 1.00 87.80  ? 898  ILE A O     1 
ATOM   6441  C  CB    . ILE A 1 899  ? 30.224  41.042  177.153 1.00 95.02  ? 898  ILE A CB    1 
ATOM   6442  N  N     . ASN A 1 900  ? 29.673  38.937  174.514 1.00 90.82  ? 899  ASN A N     1 
ATOM   6443  C  CA    . ASN A 1 900  ? 29.323  38.820  173.110 1.00 90.14  ? 899  ASN A CA    1 
ATOM   6444  C  C     . ASN A 1 900  ? 28.121  39.633  172.700 1.00 90.98  ? 899  ASN A C     1 
ATOM   6445  O  O     . ASN A 1 900  ? 27.731  40.580  173.356 1.00 93.67  ? 899  ASN A O     1 
ATOM   6446  C  CB    . ASN A 1 900  ? 29.106  37.357  172.748 1.00 89.48  ? 899  ASN A CB    1 
ATOM   6447  N  N     . GLU A 1 901  ? 27.559  39.266  171.571 1.00 86.64  ? 900  GLU A N     1 
ATOM   6448  C  CA    . GLU A 1 901  ? 26.393  39.924  171.044 1.00 89.65  ? 900  GLU A CA    1 
ATOM   6449  C  C     . GLU A 1 901  ? 25.199  39.771  171.962 1.00 92.65  ? 900  GLU A C     1 
ATOM   6450  O  O     . GLU A 1 901  ? 24.432  40.704  172.169 1.00 96.92  ? 900  GLU A O     1 
ATOM   6451  C  CB    . GLU A 1 901  ? 26.047  39.284  169.708 1.00 88.07  ? 900  GLU A CB    1 
ATOM   6452  N  N     . LYS A 1 902  ? 25.064  38.580  172.517 1.00 99.37  ? 901  LYS A N     1 
ATOM   6453  C  CA    . LYS A 1 902  ? 23.928  38.217  173.341 1.00 106.20 ? 901  LYS A CA    1 
ATOM   6454  C  C     . LYS A 1 902  ? 24.105  38.465  174.819 1.00 110.28 ? 901  LYS A C     1 
ATOM   6455  O  O     . LYS A 1 902  ? 23.328  37.954  175.632 1.00 114.67 ? 901  LYS A O     1 
ATOM   6456  C  CB    . LYS A 1 902  ? 23.561  36.756  173.115 1.00 106.72 ? 901  LYS A CB    1 
ATOM   6457  N  N     . GLY A 1 903  ? 25.123  39.246  175.165 1.00 113.41 ? 902  GLY A N     1 
ATOM   6458  C  CA    . GLY A 1 903  ? 25.411  39.512  176.551 1.00 113.82 ? 902  GLY A CA    1 
ATOM   6459  C  C     . GLY A 1 903  ? 25.803  38.236  177.258 1.00 113.46 ? 902  GLY A C     1 
ATOM   6460  O  O     . GLY A 1 903  ? 25.403  37.977  178.387 1.00 117.38 ? 902  GLY A O     1 
ATOM   6461  N  N     . LYS A 1 904  ? 26.582  37.412  176.576 1.00 102.57 ? 903  LYS A N     1 
ATOM   6462  C  CA    . LYS A 1 904  ? 27.052  36.181  177.192 1.00 96.76  ? 903  LYS A CA    1 
ATOM   6463  C  C     . LYS A 1 904  ? 28.569  36.131  177.097 1.00 93.14  ? 903  LYS A C     1 
ATOM   6464  O  O     . LYS A 1 904  ? 29.133  36.350  176.020 1.00 89.61  ? 903  LYS A O     1 
ATOM   6465  C  CB    . LYS A 1 904  ? 26.437  34.957  176.513 1.00 86.15  ? 903  LYS A CB    1 
ATOM   6466  N  N     . GLU A 1 905  ? 29.224  35.828  178.204 1.00 105.38 ? 904  GLU A N     1 
ATOM   6467  C  CA    . GLU A 1 905  ? 30.660  35.766  178.192 1.00 109.54 ? 904  GLU A CA    1 
ATOM   6468  C  C     . GLU A 1 905  ? 31.068  34.658  177.270 1.00 108.22 ? 904  GLU A C     1 
ATOM   6469  O  O     . GLU A 1 905  ? 30.677  33.517  177.437 1.00 108.35 ? 904  GLU A O     1 
ATOM   6470  C  CB    . GLU A 1 905  ? 31.178  35.461  179.612 1.00 111.39 ? 904  GLU A CB    1 
ATOM   6471  C  CG    . GLU A 1 905  ? 32.472  34.650  179.737 1.00 114.94 ? 904  GLU A CG    1 
ATOM   6472  C  CD    . GLU A 1 905  ? 32.476  33.671  180.906 1.00 114.35 ? 904  GLU A CD    1 
ATOM   6473  O  OE1   . GLU A 1 905  ? 33.543  33.449  181.498 1.00 111.83 ? 904  GLU A OE1   1 
ATOM   6474  O  OE2   . GLU A 1 905  ? 31.424  33.102  181.230 1.00 116.10 ? 904  GLU A OE2   1 
ATOM   6475  N  N     . VAL A 1 906  ? 31.916  35.002  176.325 1.00 107.07 ? 905  VAL A N     1 
ATOM   6476  C  CA    . VAL A 1 906  ? 32.481  34.007  175.420 1.00 104.96 ? 905  VAL A CA    1 
ATOM   6477  C  C     . VAL A 1 906  ? 33.996  34.016  175.581 1.00 101.33 ? 905  VAL A C     1 
ATOM   6478  O  O     . VAL A 1 906  ? 34.597  35.088  175.743 1.00 101.89 ? 905  VAL A O     1 
ATOM   6479  C  CB    . VAL A 1 906  ? 32.055  34.273  173.965 1.00 107.60 ? 905  VAL A CB    1 
ATOM   6480  C  CG1   . VAL A 1 906  ? 32.691  35.550  173.425 1.00 108.93 ? 905  VAL A CG1   1 
ATOM   6481  C  CG2   . VAL A 1 906  ? 32.391  33.084  173.076 1.00 106.83 ? 905  VAL A CG2   1 
ATOM   6482  N  N     . PRO A 1 907  ? 34.649  32.855  175.593 1.00 88.90  ? 906  PRO A N     1 
ATOM   6483  C  CA    . PRO A 1 907  ? 36.119  32.833  175.572 1.00 83.88  ? 906  PRO A CA    1 
ATOM   6484  C  C     . PRO A 1 907  ? 36.631  33.388  174.251 1.00 78.92  ? 906  PRO A C     1 
ATOM   6485  O  O     . PRO A 1 907  ? 36.277  32.891  173.181 1.00 75.04  ? 906  PRO A O     1 
ATOM   6486  C  CB    . PRO A 1 907  ? 36.457  31.346  175.734 1.00 81.70  ? 906  PRO A CB    1 
ATOM   6487  C  CG    . PRO A 1 907  ? 35.246  30.747  176.358 1.00 83.68  ? 906  PRO A CG    1 
ATOM   6488  C  CD    . PRO A 1 907  ? 34.081  31.517  175.815 1.00 87.45  ? 906  PRO A CD    1 
ATOM   6489  N  N     . CYS A 1 908  ? 37.448  34.429  174.327 1.00 82.23  ? 907  CYS A N     1 
ATOM   6490  C  CA    . CYS A 1 908  ? 38.041  35.051  173.154 1.00 78.33  ? 907  CYS A CA    1 
ATOM   6491  C  C     . CYS A 1 908  ? 39.534  34.734  173.117 1.00 71.49  ? 907  CYS A C     1 
ATOM   6492  O  O     . CYS A 1 908  ? 40.054  34.002  173.964 1.00 71.59  ? 907  CYS A O     1 
ATOM   6493  C  CB    . CYS A 1 908  ? 37.785  36.556  173.160 1.00 80.09  ? 907  CYS A CB    1 
ATOM   6494  S  SG    . CYS A 1 908  ? 38.824  37.415  174.327 1.00 83.30  ? 907  CYS A SG    1 
ATOM   6495  N  N     . ASN A 1 909  ? 40.222  35.278  172.116 1.00 64.39  ? 908  ASN A N     1 
ATOM   6496  C  CA    . ASN A 1 909  ? 41.603  34.899  171.802 1.00 59.57  ? 908  ASN A CA    1 
ATOM   6497  C  C     . ASN A 1 909  ? 42.530  36.097  171.955 1.00 59.84  ? 908  ASN A C     1 
ATOM   6498  O  O     . ASN A 1 909  ? 42.483  37.024  171.126 1.00 63.89  ? 908  ASN A O     1 
ATOM   6499  C  CB    . ASN A 1 909  ? 41.687  34.319  170.388 1.00 57.47  ? 908  ASN A CB    1 
ATOM   6500  C  CG    . ASN A 1 909  ? 43.123  34.110  169.903 1.00 55.65  ? 908  ASN A CG    1 
ATOM   6501  O  OD1   . ASN A 1 909  ? 44.095  34.291  170.640 1.00 52.39  ? 908  ASN A OD1   1 
ATOM   6502  N  ND2   . ASN A 1 909  ? 43.250  33.660  168.660 1.00 57.38  ? 908  ASN A ND2   1 
ATOM   6503  N  N     . PRO A 1 910  ? 43.403  36.105  172.967 1.00 59.37  ? 909  PRO A N     1 
ATOM   6504  C  CA    . PRO A 1 910  ? 44.299  37.254  173.178 1.00 58.82  ? 909  PRO A CA    1 
ATOM   6505  C  C     . PRO A 1 910  ? 45.163  37.580  171.981 1.00 58.15  ? 909  PRO A C     1 
ATOM   6506  O  O     . PRO A 1 910  ? 45.417  38.761  171.717 1.00 57.81  ? 909  PRO A O     1 
ATOM   6507  C  CB    . PRO A 1 910  ? 45.149  36.800  174.372 1.00 58.73  ? 909  PRO A CB    1 
ATOM   6508  C  CG    . PRO A 1 910  ? 44.298  35.800  175.083 1.00 58.89  ? 909  PRO A CG    1 
ATOM   6509  C  CD    . PRO A 1 910  ? 43.562  35.077  174.001 1.00 58.08  ? 909  PRO A CD    1 
ATOM   6510  N  N     . PHE A 1 911  ? 45.640  36.565  171.257 1.00 53.61  ? 910  PHE A N     1 
ATOM   6511  C  CA    . PHE A 1 911  ? 46.404  36.822  170.044 1.00 50.78  ? 910  PHE A CA    1 
ATOM   6512  C  C     . PHE A 1 911  ? 45.539  37.511  169.001 1.00 53.21  ? 910  PHE A C     1 
ATOM   6513  O  O     . PHE A 1 911  ? 45.982  38.457  168.339 1.00 54.49  ? 910  PHE A O     1 
ATOM   6514  C  CB    . PHE A 1 911  ? 46.957  35.512  169.485 1.00 48.62  ? 910  PHE A CB    1 
ATOM   6515  C  CG    . PHE A 1 911  ? 47.861  34.768  170.434 1.00 47.85  ? 910  PHE A CG    1 
ATOM   6516  C  CD1   . PHE A 1 911  ? 48.802  35.441  171.189 1.00 48.79  ? 910  PHE A CD1   1 
ATOM   6517  C  CD2   . PHE A 1 911  ? 47.777  33.388  170.552 1.00 46.30  ? 910  PHE A CD2   1 
ATOM   6518  C  CE1   . PHE A 1 911  ? 49.634  34.752  172.038 1.00 48.17  ? 910  PHE A CE1   1 
ATOM   6519  C  CE2   . PHE A 1 911  ? 48.605  32.696  171.400 1.00 45.69  ? 910  PHE A CE2   1 
ATOM   6520  C  CZ    . PHE A 1 911  ? 49.531  33.372  172.142 1.00 46.61  ? 910  PHE A CZ    1 
ATOM   6521  N  N     . LEU A 1 912  ? 44.300  37.045  168.842 1.00 56.87  ? 911  LEU A N     1 
ATOM   6522  C  CA    . LEU A 1 912  ? 43.393  37.653  167.877 1.00 56.16  ? 911  LEU A CA    1 
ATOM   6523  C  C     . LEU A 1 912  ? 43.077  39.095  168.252 1.00 61.19  ? 911  LEU A C     1 
ATOM   6524  O  O     . LEU A 1 912  ? 43.084  39.979  167.390 1.00 59.32  ? 911  LEU A O     1 
ATOM   6525  C  CB    . LEU A 1 912  ? 42.121  36.808  167.776 1.00 55.62  ? 911  LEU A CB    1 
ATOM   6526  C  CG    . LEU A 1 912  ? 40.989  37.105  166.828 1.00 55.58  ? 911  LEU A CG    1 
ATOM   6527  C  CD1   . LEU A 1 912  ? 39.983  37.987  167.461 1.00 56.67  ? 911  LEU A CD1   1 
ATOM   6528  C  CD2   . LEU A 1 912  ? 41.460  37.686  165.502 1.00 56.40  ? 911  LEU A CD2   1 
ATOM   6529  N  N     . LYS A 1 913  ? 42.822  39.362  169.532 1.00 62.08  ? 912  LYS A N     1 
ATOM   6530  C  CA    . LYS A 1 913  ? 42.493  40.726  169.942 1.00 63.19  ? 912  LYS A CA    1 
ATOM   6531  C  C     . LYS A 1 913  ? 43.679  41.674  169.805 1.00 61.95  ? 912  LYS A C     1 
ATOM   6532  O  O     . LYS A 1 913  ? 43.485  42.867  169.561 1.00 64.52  ? 912  LYS A O     1 
ATOM   6533  C  CB    . LYS A 1 913  ? 41.957  40.735  171.371 1.00 65.37  ? 912  LYS A CB    1 
ATOM   6534  C  CG    . LYS A 1 913  ? 40.523  40.233  171.464 1.00 68.72  ? 912  LYS A CG    1 
ATOM   6535  C  CD    . LYS A 1 913  ? 39.667  40.847  170.350 1.00 71.93  ? 912  LYS A CD    1 
ATOM   6536  C  CE    . LYS A 1 913  ? 38.178  40.559  170.516 1.00 74.09  ? 912  LYS A CE    1 
ATOM   6537  N  NZ    . LYS A 1 913  ? 37.375  41.305  169.502 1.00 76.10  ? 912  LYS A NZ    1 
ATOM   6538  N  N     . TYR A 1 914  ? 44.905  41.178  169.956 1.00 57.65  ? 913  TYR A N     1 
ATOM   6539  C  CA    . TYR A 1 914  ? 46.060  41.988  169.590 1.00 58.27  ? 913  TYR A CA    1 
ATOM   6540  C  C     . TYR A 1 914  ? 46.099  42.234  168.088 1.00 57.96  ? 913  TYR A C     1 
ATOM   6541  O  O     . TYR A 1 914  ? 46.477  43.324  167.647 1.00 59.42  ? 913  TYR A O     1 
ATOM   6542  C  CB    . TYR A 1 914  ? 47.347  41.307  170.056 1.00 56.94  ? 913  TYR A CB    1 
ATOM   6543  C  CG    . TYR A 1 914  ? 48.631  42.036  169.709 1.00 57.53  ? 913  TYR A CG    1 
ATOM   6544  C  CD1   . TYR A 1 914  ? 49.179  41.951  168.448 1.00 56.68  ? 913  TYR A CD1   1 
ATOM   6545  C  CD2   . TYR A 1 914  ? 49.308  42.786  170.658 1.00 59.00  ? 913  TYR A CD2   1 
ATOM   6546  C  CE1   . TYR A 1 914  ? 50.341  42.604  168.128 1.00 57.33  ? 913  TYR A CE1   1 
ATOM   6547  C  CE2   . TYR A 1 914  ? 50.480  43.441  170.343 1.00 59.65  ? 913  TYR A CE2   1 
ATOM   6548  C  CZ    . TYR A 1 914  ? 50.990  43.341  169.073 1.00 58.81  ? 913  TYR A CZ    1 
ATOM   6549  O  OH    . TYR A 1 914  ? 52.151  43.982  168.731 1.00 59.56  ? 913  TYR A OH    1 
ATOM   6550  N  N     . LYS A 1 915  ? 45.724  41.229  167.288 1.00 56.18  ? 914  LYS A N     1 
ATOM   6551  C  CA    . LYS A 1 915  ? 45.809  41.346  165.834 1.00 55.75  ? 914  LYS A CA    1 
ATOM   6552  C  C     . LYS A 1 915  ? 44.962  42.500  165.324 1.00 57.75  ? 914  LYS A C     1 
ATOM   6553  O  O     . LYS A 1 915  ? 45.440  43.352  164.567 1.00 58.69  ? 914  LYS A O     1 
ATOM   6554  C  CB    . LYS A 1 915  ? 45.371  40.036  165.177 1.00 53.67  ? 914  LYS A CB    1 
ATOM   6555  C  CG    . LYS A 1 915  ? 45.731  39.898  163.701 1.00 52.83  ? 914  LYS A CG    1 
ATOM   6556  C  CD    . LYS A 1 915  ? 44.831  38.868  163.019 1.00 51.46  ? 914  LYS A CD    1 
ATOM   6557  C  CE    . LYS A 1 915  ? 45.074  38.797  161.508 1.00 50.84  ? 914  LYS A CE    1 
ATOM   6558  N  NZ    . LYS A 1 915  ? 43.944  39.393  160.745 1.00 51.97  ? 914  LYS A NZ    1 
ATOM   6559  N  N     . GLU A 1 916  ? 43.695  42.539  165.730 1.00 66.81  ? 915  GLU A N     1 
ATOM   6560  C  CA    . GLU A 1 916  ? 42.809  43.615  165.316 1.00 69.02  ? 915  GLU A CA    1 
ATOM   6561  C  C     . GLU A 1 916  ? 43.362  44.987  165.668 1.00 70.45  ? 915  GLU A C     1 
ATOM   6562  O  O     . GLU A 1 916  ? 43.004  45.971  165.015 1.00 73.01  ? 915  GLU A O     1 
ATOM   6563  C  CB    . GLU A 1 916  ? 41.434  43.425  165.955 1.00 69.96  ? 915  GLU A CB    1 
ATOM   6564  C  CG    . GLU A 1 916  ? 40.804  42.084  165.645 1.00 70.02  ? 915  GLU A CG    1 
ATOM   6565  C  CD    . GLU A 1 916  ? 39.615  41.770  166.535 1.00 74.05  ? 915  GLU A CD    1 
ATOM   6566  O  OE1   . GLU A 1 916  ? 39.436  42.460  167.565 1.00 76.91  ? 915  GLU A OE1   1 
ATOM   6567  O  OE2   . GLU A 1 916  ? 38.865  40.824  166.209 1.00 73.99  ? 915  GLU A OE2   1 
ATOM   6568  N  N     . GLU A 1 917  ? 44.240  45.079  166.667 1.00 76.66  ? 916  GLU A N     1 
ATOM   6569  C  CA    . GLU A 1 917  ? 44.704  46.381  167.132 1.00 79.82  ? 916  GLU A CA    1 
ATOM   6570  C  C     . GLU A 1 917  ? 46.004  46.821  166.462 1.00 79.02  ? 916  GLU A C     1 
ATOM   6571  O  O     . GLU A 1 917  ? 46.044  47.882  165.831 1.00 82.98  ? 916  GLU A O     1 
ATOM   6572  C  CB    . GLU A 1 917  ? 44.858  46.362  168.649 1.00 85.44  ? 916  GLU A CB    1 
ATOM   6573  C  CG    . GLU A 1 917  ? 45.213  47.701  169.231 1.00 90.93  ? 916  GLU A CG    1 
ATOM   6574  C  CD    . GLU A 1 917  ? 44.076  48.362  169.956 1.00 93.40  ? 916  GLU A CD    1 
ATOM   6575  O  OE1   . GLU A 1 917  ? 42.924  47.912  169.792 1.00 93.44  ? 916  GLU A OE1   1 
ATOM   6576  O  OE2   . GLU A 1 917  ? 44.344  49.322  170.710 1.00 96.22  ? 916  GLU A OE2   1 
ATOM   6577  N  N     . HIS A 1 918  ? 47.073  46.034  166.601 1.00 65.36  ? 917  HIS A N     1 
ATOM   6578  C  CA    . HIS A 1 918  ? 48.374  46.391  166.038 1.00 64.09  ? 917  HIS A CA    1 
ATOM   6579  C  C     . HIS A 1 918  ? 48.738  45.589  164.795 1.00 61.54  ? 917  HIS A C     1 
ATOM   6580  O  O     . HIS A 1 918  ? 49.838  45.766  164.261 1.00 61.43  ? 917  HIS A O     1 
ATOM   6581  C  CB    . HIS A 1 918  ? 49.499  46.219  167.066 1.00 63.29  ? 917  HIS A CB    1 
ATOM   6582  C  CG    . HIS A 1 918  ? 49.282  46.951  168.374 1.00 65.21  ? 917  HIS A CG    1 
ATOM   6583  N  ND1   . HIS A 1 918  ? 48.151  46.775  169.155 1.00 65.55  ? 917  HIS A ND1   1 
ATOM   6584  C  CD2   . HIS A 1 918  ? 50.068  47.843  169.035 1.00 66.96  ? 917  HIS A CD2   1 
ATOM   6585  C  CE1   . HIS A 1 918  ? 48.254  47.527  170.234 1.00 67.41  ? 917  HIS A CE1   1 
ATOM   6586  N  NE2   . HIS A 1 918  ? 49.397  48.192  170.178 1.00 68.31  ? 917  HIS A NE2   1 
ATOM   6587  N  N     . GLY A 1 919  ? 47.851  44.730  164.313 1.00 60.12  ? 918  GLY A N     1 
ATOM   6588  C  CA    . GLY A 1 919  ? 48.209  43.811  163.265 1.00 58.13  ? 918  GLY A CA    1 
ATOM   6589  C  C     . GLY A 1 919  ? 48.839  42.552  163.820 1.00 56.05  ? 918  GLY A C     1 
ATOM   6590  O  O     . GLY A 1 919  ? 48.714  42.213  164.999 1.00 55.91  ? 918  GLY A O     1 
ATOM   6591  N  N     . TYR A 1 920  ? 49.536  41.847  162.937 1.00 54.51  ? 919  TYR A N     1 
ATOM   6592  C  CA    . TYR A 1 920  ? 50.129  40.574  163.314 1.00 52.53  ? 919  TYR A CA    1 
ATOM   6593  C  C     . TYR A 1 920  ? 51.165  40.767  164.410 1.00 52.98  ? 919  TYR A C     1 
ATOM   6594  O  O     . TYR A 1 920  ? 51.940  41.724  164.390 1.00 54.35  ? 919  TYR A O     1 
ATOM   6595  C  CB    . TYR A 1 920  ? 50.778  39.904  162.105 1.00 54.96  ? 919  TYR A CB    1 
ATOM   6596  C  CG    . TYR A 1 920  ? 49.809  39.235  161.157 1.00 54.47  ? 919  TYR A CG    1 
ATOM   6597  C  CD1   . TYR A 1 920  ? 49.409  37.925  161.355 1.00 56.71  ? 919  TYR A CD1   1 
ATOM   6598  C  CD2   . TYR A 1 920  ? 49.304  39.913  160.064 1.00 55.48  ? 919  TYR A CD2   1 
ATOM   6599  C  CE1   . TYR A 1 920  ? 48.531  37.305  160.491 1.00 56.91  ? 919  TYR A CE1   1 
ATOM   6600  C  CE2   . TYR A 1 920  ? 48.421  39.303  159.188 1.00 58.37  ? 919  TYR A CE2   1 
ATOM   6601  C  CZ    . TYR A 1 920  ? 48.038  37.999  159.404 1.00 57.68  ? 919  TYR A CZ    1 
ATOM   6602  O  OH    . TYR A 1 920  ? 47.162  37.394  158.530 1.00 61.99  ? 919  TYR A OH    1 
ATOM   6603  N  N     . ILE A 1 921  ? 51.143  39.864  165.390 1.00 51.93  ? 920  ILE A N     1 
ATOM   6604  C  CA    . ILE A 1 921  ? 52.257  39.734  166.315 1.00 51.92  ? 920  ILE A CA    1 
ATOM   6605  C  C     . ILE A 1 921  ? 53.522  39.491  165.516 1.00 51.21  ? 920  ILE A C     1 
ATOM   6606  O  O     . ILE A 1 921  ? 53.562  38.627  164.634 1.00 49.70  ? 920  ILE A O     1 
ATOM   6607  C  CB    . ILE A 1 921  ? 52.000  38.586  167.301 1.00 50.65  ? 920  ILE A CB    1 
ATOM   6608  C  CG1   . ILE A 1 921  ? 50.652  38.765  167.995 1.00 51.38  ? 920  ILE A CG1   1 
ATOM   6609  C  CG2   . ILE A 1 921  ? 53.122  38.489  168.315 1.00 50.81  ? 920  ILE A CG2   1 
ATOM   6610  C  CD1   . ILE A 1 921  ? 50.213  37.553  168.783 1.00 50.11  ? 920  ILE A CD1   1 
ATOM   6611  N  N     . ARG A 1 922  ? 54.569  40.240  165.824 1.00 52.38  ? 921  ARG A N     1 
ATOM   6612  C  CA    . ARG A 1 922  ? 55.802  40.151  165.063 1.00 52.05  ? 921  ARG A CA    1 
ATOM   6613  C  C     . ARG A 1 922  ? 56.942  39.685  165.950 1.00 51.73  ? 921  ARG A C     1 
ATOM   6614  O  O     . ARG A 1 922  ? 56.930  39.893  167.165 1.00 52.43  ? 921  ARG A O     1 
ATOM   6615  C  CB    . ARG A 1 922  ? 56.159  41.488  164.422 1.00 53.92  ? 921  ARG A CB    1 
ATOM   6616  C  CG    . ARG A 1 922  ? 54.945  42.186  163.852 1.00 54.80  ? 921  ARG A CG    1 
ATOM   6617  C  CD    . ARG A 1 922  ? 55.308  43.446  163.123 1.00 56.67  ? 921  ARG A CD    1 
ATOM   6618  N  NE    . ARG A 1 922  ? 56.269  43.172  162.073 1.00 56.04  ? 921  ARG A NE    1 
ATOM   6619  C  CZ    . ARG A 1 922  ? 55.980  43.220  160.777 1.00 56.27  ? 921  ARG A CZ    1 
ATOM   6620  N  NH1   . ARG A 1 922  ? 56.925  42.944  159.884 1.00 58.15  ? 921  ARG A NH1   1 
ATOM   6621  N  NH2   . ARG A 1 922  ? 54.752  43.552  160.364 1.00 57.37  ? 921  ARG A NH2   1 
ATOM   6622  N  N     . LYS A 1 923  ? 57.919  39.041  165.322 1.00 50.74  ? 922  LYS A N     1 
ATOM   6623  C  CA    . LYS A 1 923  ? 59.075  38.551  166.053 1.00 52.46  ? 922  LYS A CA    1 
ATOM   6624  C  C     . LYS A 1 923  ? 59.820  39.719  166.678 1.00 55.95  ? 922  LYS A C     1 
ATOM   6625  O  O     . LYS A 1 923  ? 59.799  40.839  166.165 1.00 60.77  ? 922  LYS A O     1 
ATOM   6626  C  CB    . LYS A 1 923  ? 59.998  37.764  165.123 1.00 50.80  ? 922  LYS A CB    1 
ATOM   6627  C  CG    . LYS A 1 923  ? 60.905  36.801  165.841 1.00 49.62  ? 922  LYS A CG    1 
ATOM   6628  C  CD    . LYS A 1 923  ? 61.213  35.623  164.964 1.00 47.38  ? 922  LYS A CD    1 
ATOM   6629  C  CE    . LYS A 1 923  ? 62.621  35.670  164.435 1.00 47.73  ? 922  LYS A CE    1 
ATOM   6630  N  NZ    . LYS A 1 923  ? 63.619  35.425  165.503 1.00 48.32  ? 922  LYS A NZ    1 
ATOM   6631  N  N     . TYR A 1 924  ? 60.467  39.457  167.808 1.00 58.03  ? 923  TYR A N     1 
ATOM   6632  C  CA    . TYR A 1 924  ? 61.163  40.519  168.520 1.00 58.53  ? 923  TYR A CA    1 
ATOM   6633  C  C     . TYR A 1 924  ? 62.307  41.058  167.669 1.00 57.38  ? 923  TYR A C     1 
ATOM   6634  O  O     . TYR A 1 924  ? 63.031  40.295  167.025 1.00 57.85  ? 923  TYR A O     1 
ATOM   6635  C  CB    . TYR A 1 924  ? 61.691  40.017  169.863 1.00 56.00  ? 923  TYR A CB    1 
ATOM   6636  C  CG    . TYR A 1 924  ? 62.867  40.839  170.349 1.00 57.70  ? 923  TYR A CG    1 
ATOM   6637  C  CD1   . TYR A 1 924  ? 64.167  40.511  169.995 1.00 56.12  ? 923  TYR A CD1   1 
ATOM   6638  C  CD2   . TYR A 1 924  ? 62.677  41.975  171.119 1.00 58.27  ? 923  TYR A CD2   1 
ATOM   6639  C  CE1   . TYR A 1 924  ? 65.235  41.281  170.402 1.00 59.06  ? 923  TYR A CE1   1 
ATOM   6640  C  CE2   . TYR A 1 924  ? 63.751  42.747  171.531 1.00 60.02  ? 923  TYR A CE2   1 
ATOM   6641  C  CZ    . TYR A 1 924  ? 65.028  42.392  171.170 1.00 60.79  ? 923  TYR A CZ    1 
ATOM   6642  O  OH    . TYR A 1 924  ? 66.108  43.149  171.580 1.00 63.87  ? 923  TYR A OH    1 
ATOM   6643  N  N     . SER A 1 925  ? 62.468  42.381  167.671 1.00 57.55  ? 924  SER A N     1 
ATOM   6644  C  CA    . SER A 1 925  ? 63.490  43.052  166.879 1.00 58.73  ? 924  SER A CA    1 
ATOM   6645  C  C     . SER A 1 925  ? 63.784  44.396  167.516 1.00 61.25  ? 924  SER A C     1 
ATOM   6646  O  O     . SER A 1 925  ? 62.967  44.937  168.261 1.00 62.11  ? 924  SER A O     1 
ATOM   6647  C  CB    . SER A 1 925  ? 63.037  43.243  165.429 1.00 58.46  ? 924  SER A CB    1 
ATOM   6648  O  OG    . SER A 1 925  ? 62.360  44.475  165.312 1.00 60.24  ? 924  SER A OG    1 
ATOM   6649  N  N     . LYS A 1 926  ? 64.946  44.951  167.182 1.00 66.71  ? 925  LYS A N     1 
ATOM   6650  C  CA    . LYS A 1 926  ? 65.315  46.243  167.751 1.00 69.41  ? 925  LYS A CA    1 
ATOM   6651  C  C     . LYS A 1 926  ? 64.540  47.373  167.090 1.00 70.15  ? 925  LYS A C     1 
ATOM   6652  O  O     . LYS A 1 926  ? 63.993  48.246  167.772 1.00 72.78  ? 925  LYS A O     1 
ATOM   6653  C  CB    . LYS A 1 926  ? 66.818  46.482  167.614 1.00 71.72  ? 925  LYS A CB    1 
ATOM   6654  C  CG    . LYS A 1 926  ? 67.664  45.241  167.758 1.00 71.32  ? 925  LYS A CG    1 
ATOM   6655  C  CD    . LYS A 1 926  ? 69.066  45.501  167.249 1.00 73.71  ? 925  LYS A CD    1 
ATOM   6656  C  CE    . LYS A 1 926  ? 69.844  44.209  167.167 1.00 72.26  ? 925  LYS A CE    1 
ATOM   6657  N  NZ    . LYS A 1 926  ? 71.236  44.416  166.688 1.00 73.64  ? 925  LYS A NZ    1 
ATOM   6658  N  N     . LYS A 1 927  ? 64.499  47.385  165.758 1.00 68.33  ? 926  LYS A N     1 
ATOM   6659  C  CA    . LYS A 1 927  ? 63.875  48.460  164.998 1.00 70.10  ? 926  LYS A CA    1 
ATOM   6660  C  C     . LYS A 1 927  ? 62.459  48.112  164.554 1.00 70.35  ? 926  LYS A C     1 
ATOM   6661  O  O     . LYS A 1 927  ? 61.996  48.615  163.525 1.00 69.38  ? 926  LYS A O     1 
ATOM   6662  C  CB    . LYS A 1 927  ? 64.736  48.812  163.786 1.00 69.26  ? 926  LYS A CB    1 
ATOM   6663  N  N     . GLY A 1 928  ? 61.764  47.267  165.310 1.00 64.96  ? 927  GLY A N     1 
ATOM   6664  C  CA    . GLY A 1 928  ? 60.423  46.848  164.924 1.00 65.88  ? 927  GLY A CA    1 
ATOM   6665  C  C     . GLY A 1 928  ? 60.391  46.127  163.596 1.00 64.22  ? 927  GLY A C     1 
ATOM   6666  O  O     . GLY A 1 928  ? 59.410  46.239  162.851 1.00 63.21  ? 927  GLY A O     1 
ATOM   6667  N  N     . ASN A 1 929  ? 61.446  45.377  163.289 1.00 81.28  ? 928  ASN A N     1 
ATOM   6668  C  CA    . ASN A 1 929  ? 61.676  44.843  161.958 1.00 82.63  ? 928  ASN A CA    1 
ATOM   6669  C  C     . ASN A 1 929  ? 61.402  43.349  161.847 1.00 79.19  ? 928  ASN A C     1 
ATOM   6670  O  O     . ASN A 1 929  ? 61.631  42.776  160.782 1.00 72.96  ? 928  ASN A O     1 
ATOM   6671  C  CB    . ASN A 1 929  ? 63.118  45.144  161.525 1.00 90.20  ? 928  ASN A CB    1 
ATOM   6672  C  CG    . ASN A 1 929  ? 63.272  45.166  160.027 1.00 96.94  ? 928  ASN A CG    1 
ATOM   6673  O  OD1   . ASN A 1 929  ? 62.282  45.116  159.287 1.00 99.94  ? 928  ASN A OD1   1 
ATOM   6674  N  ND2   . ASN A 1 929  ? 64.517  45.256  159.560 1.00 100.66 ? 928  ASN A ND2   1 
ATOM   6675  N  N     . GLY A 1 930  ? 60.923  42.707  162.907 1.00 69.28  ? 929  GLY A N     1 
ATOM   6676  C  CA    . GLY A 1 930  ? 60.766  41.275  162.917 1.00 54.05  ? 929  GLY A CA    1 
ATOM   6677  C  C     . GLY A 1 930  ? 59.660  40.790  161.997 1.00 52.84  ? 929  GLY A C     1 
ATOM   6678  O  O     . GLY A 1 930  ? 58.675  41.486  161.742 1.00 53.64  ? 929  GLY A O     1 
ATOM   6679  N  N     . PRO A 1 931  ? 59.822  39.584  161.452 1.00 51.00  ? 930  PRO A N     1 
ATOM   6680  C  CA    . PRO A 1 931  ? 58.742  38.996  160.647 1.00 49.78  ? 930  PRO A CA    1 
ATOM   6681  C  C     . PRO A 1 931  ? 57.526  38.691  161.501 1.00 49.27  ? 930  PRO A C     1 
ATOM   6682  O  O     . PRO A 1 931  ? 57.592  38.640  162.725 1.00 49.46  ? 930  PRO A O     1 
ATOM   6683  C  CB    . PRO A 1 931  ? 59.359  37.703  160.098 1.00 48.05  ? 930  PRO A CB    1 
ATOM   6684  C  CG    . PRO A 1 931  ? 60.660  37.550  160.831 1.00 48.31  ? 930  PRO A CG    1 
ATOM   6685  C  CD    . PRO A 1 931  ? 61.109  38.887  161.224 1.00 50.34  ? 930  PRO A CD    1 
ATOM   6686  N  N     . GLU A 1 932  ? 56.398  38.506  160.838 1.00 53.03  ? 931  GLU A N     1 
ATOM   6687  C  CA    . GLU A 1 932  ? 55.171  38.209  161.553 1.00 53.16  ? 931  GLU A CA    1 
ATOM   6688  C  C     . GLU A 1 932  ? 55.179  36.767  162.053 1.00 48.34  ? 931  GLU A C     1 
ATOM   6689  O  O     . GLU A 1 932  ? 55.997  35.945  161.646 1.00 45.63  ? 931  GLU A O     1 
ATOM   6690  C  CB    . GLU A 1 932  ? 53.950  38.469  160.666 1.00 58.68  ? 931  GLU A CB    1 
ATOM   6691  C  CG    . GLU A 1 932  ? 53.807  39.921  160.274 1.00 66.28  ? 931  GLU A CG    1 
ATOM   6692  C  CD    . GLU A 1 932  ? 53.786  40.112  158.777 1.00 69.94  ? 931  GLU A CD    1 
ATOM   6693  O  OE1   . GLU A 1 932  ? 52.927  40.875  158.287 1.00 72.22  ? 931  GLU A OE1   1 
ATOM   6694  O  OE2   . GLU A 1 932  ? 54.621  39.483  158.088 1.00 70.73  ? 931  GLU A OE2   1 
ATOM   6695  N  N     . ILE A 1 933  ? 54.252  36.470  162.960 1.00 46.31  ? 932  ILE A N     1 
ATOM   6696  C  CA    . ILE A 1 933  ? 54.150  35.159  163.581 1.00 44.81  ? 932  ILE A CA    1 
ATOM   6697  C  C     . ILE A 1 933  ? 52.748  34.632  163.329 1.00 44.14  ? 932  ILE A C     1 
ATOM   6698  O  O     . ILE A 1 933  ? 51.761  35.248  163.750 1.00 45.08  ? 932  ILE A O     1 
ATOM   6699  C  CB    . ILE A 1 933  ? 54.462  35.219  165.086 1.00 45.32  ? 932  ILE A CB    1 
ATOM   6700  C  CG1   . ILE A 1 933  ? 55.871  35.761  165.306 1.00 46.12  ? 932  ILE A CG1   1 
ATOM   6701  C  CG2   . ILE A 1 933  ? 54.329  33.834  165.725 1.00 43.86  ? 932  ILE A CG2   1 
ATOM   6702  C  CD1   . ILE A 1 933  ? 56.266  35.870  166.743 1.00 46.74  ? 932  ILE A CD1   1 
ATOM   6703  N  N     . LYS A 1 934  ? 52.683  33.481  162.686 1.00 44.15  ? 933  LYS A N     1 
ATOM   6704  C  CA    . LYS A 1 934  ? 51.431  32.836  162.389 1.00 45.41  ? 933  LYS A CA    1 
ATOM   6705  C  C     . LYS A 1 934  ? 51.355  31.413  162.909 1.00 46.34  ? 933  LYS A C     1 
ATOM   6706  O  O     . LYS A 1 934  ? 50.376  31.038  163.486 1.00 50.79  ? 933  LYS A O     1 
ATOM   6707  C  CB    . LYS A 1 934  ? 51.156  32.884  160.893 1.00 47.89  ? 933  LYS A CB    1 
ATOM   6708  C  CG    . LYS A 1 934  ? 51.150  34.290  160.326 1.00 50.65  ? 933  LYS A CG    1 
ATOM   6709  C  CD    . LYS A 1 934  ? 52.108  34.474  159.169 1.00 51.50  ? 933  LYS A CD    1 
ATOM   6710  C  CE    . LYS A 1 934  ? 51.357  34.699  157.870 1.00 54.72  ? 933  LYS A CE    1 
ATOM   6711  N  NZ    . LYS A 1 934  ? 51.818  35.929  157.182 1.00 57.15  ? 933  LYS A NZ    1 
ATOM   6712  N  N     . SER A 1 935  ? 52.399  30.636  162.689 1.00 44.91  ? 934  SER A N     1 
ATOM   6713  C  CA    . SER A 1 935  ? 52.480  29.252  163.110 1.00 42.80  ? 934  SER A CA    1 
ATOM   6714  C  C     . SER A 1 935  ? 53.518  29.090  164.210 1.00 43.63  ? 934  SER A C     1 
ATOM   6715  O  O     . SER A 1 935  ? 54.498  29.836  164.278 1.00 50.04  ? 934  SER A O     1 
ATOM   6716  C  CB    . SER A 1 935  ? 52.848  28.355  161.935 1.00 39.98  ? 934  SER A CB    1 
ATOM   6717  O  OG    . SER A 1 935  ? 51.953  28.531  160.861 1.00 38.07  ? 934  SER A OG    1 
ATOM   6718  N  N     . LEU A 1 936  ? 53.293  28.097  165.067 1.00 37.81  ? 935  LEU A N     1 
ATOM   6719  C  CA    . LEU A 1 936  ? 54.236  27.711  166.103 1.00 37.81  ? 935  LEU A CA    1 
ATOM   6720  C  C     . LEU A 1 936  ? 54.419  26.204  166.063 1.00 36.57  ? 935  LEU A C     1 
ATOM   6721  O  O     . LEU A 1 936  ? 53.475  25.457  166.327 1.00 36.09  ? 935  LEU A O     1 
ATOM   6722  C  CB    . LEU A 1 936  ? 53.748  28.157  167.479 1.00 38.68  ? 935  LEU A CB    1 
ATOM   6723  C  CG    . LEU A 1 936  ? 53.716  29.665  167.687 1.00 40.14  ? 935  LEU A CG    1 
ATOM   6724  C  CD1   . LEU A 1 936  ? 52.999  29.993  168.963 1.00 41.00  ? 935  LEU A CD1   1 
ATOM   6725  C  CD2   . LEU A 1 936  ? 55.120  30.235  167.671 1.00 40.69  ? 935  LEU A CD2   1 
ATOM   6726  N  N     . LYS A 1 937  ? 55.621  25.762  165.720 1.00 36.19  ? 936  LYS A N     1 
ATOM   6727  C  CA    . LYS A 1 937  ? 55.991  24.364  165.869 1.00 35.27  ? 936  LYS A CA    1 
ATOM   6728  C  C     . LYS A 1 937  ? 56.283  24.035  167.331 1.00 35.57  ? 936  LYS A C     1 
ATOM   6729  O  O     . LYS A 1 937  ? 56.663  24.901  168.123 1.00 36.49  ? 936  LYS A O     1 
ATOM   6730  C  CB    . LYS A 1 937  ? 57.210  24.043  165.004 1.00 34.95  ? 936  LYS A CB    1 
ATOM   6731  C  CG    . LYS A 1 937  ? 56.980  24.283  163.513 1.00 34.68  ? 936  LYS A CG    1 
ATOM   6732  C  CD    . LYS A 1 937  ? 58.220  24.090  162.673 1.00 34.58  ? 936  LYS A CD    1 
ATOM   6733  C  CE    . LYS A 1 937  ? 57.895  24.395  161.211 1.00 34.43  ? 936  LYS A CE    1 
ATOM   6734  N  NZ    . LYS A 1 937  ? 59.034  24.187  160.265 1.00 34.40  ? 936  LYS A NZ    1 
ATOM   6735  N  N     . TYR A 1 938  ? 56.088  22.769  167.690 1.00 34.89  ? 937  TYR A N     1 
ATOM   6736  C  CA    . TYR A 1 938  ? 56.340  22.317  169.050 1.00 35.17  ? 937  TYR A CA    1 
ATOM   6737  C  C     . TYR A 1 938  ? 56.705  20.843  169.039 1.00 34.42  ? 937  TYR A C     1 
ATOM   6738  O  O     . TYR A 1 938  ? 56.310  20.102  168.137 1.00 33.67  ? 937  TYR A O     1 
ATOM   6739  C  CB    . TYR A 1 938  ? 55.127  22.532  169.956 1.00 35.59  ? 937  TYR A CB    1 
ATOM   6740  C  CG    . TYR A 1 938  ? 53.884  21.829  169.476 1.00 34.96  ? 937  TYR A CG    1 
ATOM   6741  C  CD1   . TYR A 1 938  ? 53.598  20.536  169.873 1.00 34.47  ? 937  TYR A CD1   1 
ATOM   6742  C  CD2   . TYR A 1 938  ? 52.990  22.466  168.640 1.00 35.00  ? 937  TYR A CD2   1 
ATOM   6743  C  CE1   . TYR A 1 938  ? 52.470  19.899  169.449 1.00 35.72  ? 937  TYR A CE1   1 
ATOM   6744  C  CE2   . TYR A 1 938  ? 51.852  21.831  168.203 1.00 34.53  ? 937  TYR A CE2   1 
ATOM   6745  C  CZ    . TYR A 1 938  ? 51.598  20.550  168.612 1.00 34.05  ? 937  TYR A CZ    1 
ATOM   6746  O  OH    . TYR A 1 938  ? 50.467  19.909  168.189 1.00 37.21  ? 937  TYR A OH    1 
ATOM   6747  N  N     . TYR A 1 939  ? 57.443  20.415  170.062 1.00 34.73  ? 938  TYR A N     1 
ATOM   6748  C  CA    . TYR A 1 939  ? 57.729  18.997  170.223 1.00 34.23  ? 938  TYR A CA    1 
ATOM   6749  C  C     . TYR A 1 939  ? 56.464  18.289  170.679 1.00 33.99  ? 938  TYR A C     1 
ATOM   6750  O  O     . TYR A 1 939  ? 55.860  18.670  171.679 1.00 34.54  ? 938  TYR A O     1 
ATOM   6751  C  CB    . TYR A 1 939  ? 58.861  18.781  171.216 1.00 34.78  ? 938  TYR A CB    1 
ATOM   6752  C  CG    . TYR A 1 939  ? 60.130  19.518  170.884 1.00 35.23  ? 938  TYR A CG    1 
ATOM   6753  C  CD1   . TYR A 1 939  ? 60.906  19.141  169.807 1.00 34.84  ? 938  TYR A CD1   1 
ATOM   6754  C  CD2   . TYR A 1 939  ? 60.564  20.579  171.664 1.00 36.16  ? 938  TYR A CD2   1 
ATOM   6755  C  CE1   . TYR A 1 939  ? 62.064  19.803  169.495 1.00 35.37  ? 938  TYR A CE1   1 
ATOM   6756  C  CE2   . TYR A 1 939  ? 61.733  21.250  171.368 1.00 36.70  ? 938  TYR A CE2   1 
ATOM   6757  C  CZ    . TYR A 1 939  ? 62.479  20.855  170.279 1.00 36.31  ? 938  TYR A CZ    1 
ATOM   6758  O  OH    . TYR A 1 939  ? 63.641  21.514  169.964 1.00 36.96  ? 938  TYR A OH    1 
ATOM   6759  N  N     . ASP A 1 940  ? 56.047  17.278  169.928 1.00 33.27  ? 939  ASP A N     1 
ATOM   6760  C  CA    . ASP A 1 940  ? 54.756  16.643  170.158 1.00 35.34  ? 939  ASP A CA    1 
ATOM   6761  C  C     . ASP A 1 940  ? 54.943  15.337  170.910 1.00 35.46  ? 939  ASP A C     1 
ATOM   6762  O  O     . ASP A 1 940  ? 54.732  15.282  172.122 1.00 34.42  ? 939  ASP A O     1 
ATOM   6763  C  CB    . ASP A 1 940  ? 54.036  16.394  168.826 1.00 33.76  ? 939  ASP A CB    1 
ATOM   6764  C  CG    . ASP A 1 940  ? 52.611  15.899  169.000 1.00 33.84  ? 939  ASP A CG    1 
ATOM   6765  O  OD1   . ASP A 1 940  ? 52.272  15.295  170.028 1.00 36.11  ? 939  ASP A OD1   1 
ATOM   6766  O  OD2   . ASP A 1 940  ? 51.801  16.120  168.093 1.00 35.17  ? 939  ASP A OD2   1 
ATOM   6767  N  N     . SER A 1 941  ? 55.331  14.287  170.193 1.00 32.61  ? 940  SER A N     1 
ATOM   6768  C  CA    . SER A 1 941  ? 55.421  12.945  170.736 1.00 32.69  ? 940  SER A CA    1 
ATOM   6769  C  C     . SER A 1 941  ? 56.700  12.296  170.251 1.00 32.55  ? 940  SER A C     1 
ATOM   6770  O  O     . SER A 1 941  ? 57.306  12.729  169.273 1.00 32.26  ? 940  SER A O     1 
ATOM   6771  C  CB    . SER A 1 941  ? 54.229  12.090  170.326 1.00 32.84  ? 940  SER A CB    1 
ATOM   6772  O  OG    . SER A 1 941  ? 53.026  12.748  170.639 1.00 40.01  ? 940  SER A OG    1 
ATOM   6773  N  N     . LYS A 1 942  ? 57.106  11.251  170.959 1.00 33.50  ? 941  LYS A N     1 
ATOM   6774  C  CA    . LYS A 1 942  ? 58.301  10.521  170.575 1.00 33.81  ? 941  LYS A CA    1 
ATOM   6775  C  C     . LYS A 1 942  ? 58.028  9.738   169.308 1.00 32.88  ? 941  LYS A C     1 
ATOM   6776  O  O     . LYS A 1 942  ? 56.949  9.168   169.128 1.00 34.07  ? 941  LYS A O     1 
ATOM   6777  C  CB    . LYS A 1 942  ? 58.749  9.570   171.687 1.00 37.05  ? 941  LYS A CB    1 
ATOM   6778  C  CG    . LYS A 1 942  ? 59.236  10.229  172.949 1.00 39.71  ? 941  LYS A CG    1 
ATOM   6779  C  CD    . LYS A 1 942  ? 59.921  9.206   173.834 1.00 42.14  ? 941  LYS A CD    1 
ATOM   6780  C  CE    . LYS A 1 942  ? 60.581  9.847   175.045 1.00 44.17  ? 941  LYS A CE    1 
ATOM   6781  N  NZ    . LYS A 1 942  ? 59.581  10.343  176.025 1.00 47.65  ? 941  LYS A NZ    1 
ATOM   6782  N  N     . LEU A 1 943  ? 59.009  9.721   168.420 1.00 32.26  ? 942  LEU A N     1 
ATOM   6783  C  CA    . LEU A 1 943  ? 58.874  8.950   167.200 1.00 31.87  ? 942  LEU A CA    1 
ATOM   6784  C  C     . LEU A 1 943  ? 58.831  7.472   167.545 1.00 32.20  ? 942  LEU A C     1 
ATOM   6785  O  O     . LEU A 1 943  ? 59.674  6.973   168.296 1.00 32.80  ? 942  LEU A O     1 
ATOM   6786  C  CB    . LEU A 1 943  ? 60.027  9.252   166.244 1.00 31.85  ? 942  LEU A CB    1 
ATOM   6787  C  CG    . LEU A 1 943  ? 60.072  8.412   164.971 1.00 31.60  ? 942  LEU A CG    1 
ATOM   6788  C  CD1   . LEU A 1 943  ? 58.887  8.753   164.021 1.00 30.96  ? 942  LEU A CD1   1 
ATOM   6789  C  CD2   . LEU A 1 943  ? 61.405  8.580   164.263 1.00 31.86  ? 942  LEU A CD2   1 
ATOM   6790  N  N     . GLY A 1 944  ? 57.829  6.779   167.026 1.00 33.68  ? 943  GLY A N     1 
ATOM   6791  C  CA    . GLY A 1 944  ? 57.773  5.339   167.139 1.00 32.34  ? 943  GLY A CA    1 
ATOM   6792  C  C     . GLY A 1 944  ? 57.604  4.715   165.776 1.00 32.05  ? 943  GLY A C     1 
ATOM   6793  O  O     . GLY A 1 944  ? 58.449  4.890   164.895 1.00 31.93  ? 943  GLY A O     1 
ATOM   6794  N  N     . ASN A 1 945  ? 56.496  4.004   165.594 1.00 32.02  ? 944  ASN A N     1 
ATOM   6795  C  CA    . ASN A 1 945  ? 56.196  3.333   164.335 1.00 31.86  ? 944  ASN A CA    1 
ATOM   6796  C  C     . ASN A 1 945  ? 55.899  4.344   163.229 1.00 31.15  ? 944  ASN A C     1 
ATOM   6797  O  O     . ASN A 1 945  ? 55.178  5.320   163.434 1.00 30.79  ? 944  ASN A O     1 
ATOM   6798  C  CB    . ASN A 1 945  ? 55.004  2.404   164.534 1.00 32.14  ? 944  ASN A CB    1 
ATOM   6799  C  CG    . ASN A 1 945  ? 54.931  1.339   163.501 1.00 32.34  ? 944  ASN A CG    1 
ATOM   6800  O  OD1   . ASN A 1 945  ? 54.118  1.402   162.599 1.00 32.00  ? 944  ASN A OD1   1 
ATOM   6801  N  ND2   . ASN A 1 945  ? 55.792  0.354   163.611 1.00 33.00  ? 944  ASN A ND2   1 
ATOM   6802  N  N     . HIS A 1 946  ? 56.429  4.098   162.034 1.00 31.12  ? 945  HIS A N     1 
ATOM   6803  C  CA    . HIS A 1 946  ? 56.362  5.141   161.025 1.00 30.50  ? 945  HIS A CA    1 
ATOM   6804  C  C     . HIS A 1 946  ? 56.747  4.574   159.666 1.00 31.97  ? 945  HIS A C     1 
ATOM   6805  O  O     . HIS A 1 946  ? 57.184  3.428   159.547 1.00 35.77  ? 945  HIS A O     1 
ATOM   6806  C  CB    . HIS A 1 946  ? 57.278  6.301   161.404 1.00 30.44  ? 945  HIS A CB    1 
ATOM   6807  C  CG    . HIS A 1 946  ? 58.727  5.942   161.373 1.00 30.89  ? 945  HIS A CG    1 
ATOM   6808  N  ND1   . HIS A 1 946  ? 59.316  5.165   162.343 1.00 31.48  ? 945  HIS A ND1   1 
ATOM   6809  C  CD2   . HIS A 1 946  ? 59.702  6.239   160.485 1.00 30.97  ? 945  HIS A CD2   1 
ATOM   6810  C  CE1   . HIS A 1 946  ? 60.592  4.994   162.053 1.00 31.90  ? 945  HIS A CE1   1 
ATOM   6811  N  NE2   . HIS A 1 946  ? 60.854  5.641   160.935 1.00 31.61  ? 945  HIS A NE2   1 
ATOM   6812  N  N     . ILE A 1 947  ? 56.560  5.400   158.637 1.00 30.10  ? 946  ILE A N     1 
ATOM   6813  C  CA    . ILE A 1 947  ? 57.124  5.177   157.312 1.00 30.17  ? 946  ILE A CA    1 
ATOM   6814  C  C     . ILE A 1 947  ? 58.129  6.287   157.059 1.00 30.11  ? 946  ILE A C     1 
ATOM   6815  O  O     . ILE A 1 947  ? 57.812  7.464   157.241 1.00 29.78  ? 946  ILE A O     1 
ATOM   6816  C  CB    . ILE A 1 947  ? 56.038  5.157   156.219 1.00 29.86  ? 946  ILE A CB    1 
ATOM   6817  C  CG1   . ILE A 1 947  ? 54.957  4.126   156.531 1.00 30.02  ? 946  ILE A CG1   1 
ATOM   6818  C  CG2   . ILE A 1 947  ? 56.646  4.866   154.862 1.00 30.04  ? 946  ILE A CG2   1 
ATOM   6819  C  CD1   . ILE A 1 947  ? 53.790  4.192   155.582 1.00 29.79  ? 946  ILE A CD1   1 
ATOM   6820  N  N     . ASP A 1 948  ? 59.329  5.921   156.641 1.00 30.55  ? 947  ASP A N     1 
ATOM   6821  C  CA    . ASP A 1 948  ? 60.405  6.877   156.431 1.00 32.08  ? 947  ASP A CA    1 
ATOM   6822  C  C     . ASP A 1 948  ? 60.348  7.448   155.013 1.00 30.54  ? 947  ASP A C     1 
ATOM   6823  O  O     . ASP A 1 948  ? 60.518  6.712   154.036 1.00 35.28  ? 947  ASP A O     1 
ATOM   6824  C  CB    . ASP A 1 948  ? 61.747  6.199   156.690 1.00 39.12  ? 947  ASP A CB    1 
ATOM   6825  C  CG    . ASP A 1 948  ? 62.910  7.130   156.506 1.00 44.78  ? 947  ASP A CG    1 
ATOM   6826  O  OD1   . ASP A 1 948  ? 63.044  8.085   157.288 1.00 44.24  ? 947  ASP A OD1   1 
ATOM   6827  O  OD2   . ASP A 1 948  ? 63.702  6.905   155.580 1.00 52.19  ? 947  ASP A OD2   1 
ATOM   6828  N  N     . ILE A 1 949  ? 60.112  8.756   154.905 1.00 30.24  ? 948  ILE A N     1 
ATOM   6829  C  CA    . ILE A 1 949  ? 60.153  9.472   153.634 1.00 30.21  ? 948  ILE A CA    1 
ATOM   6830  C  C     . ILE A 1 949  ? 61.182  10.593  153.722 1.00 30.55  ? 948  ILE A C     1 
ATOM   6831  O  O     . ILE A 1 949  ? 60.901  11.745  153.370 1.00 30.45  ? 948  ILE A O     1 
ATOM   6832  C  CB    . ILE A 1 949  ? 58.764  10.019  153.254 1.00 29.70  ? 948  ILE A CB    1 
ATOM   6833  C  CG1   . ILE A 1 949  ? 58.139  10.750  154.435 1.00 29.44  ? 948  ILE A CG1   1 
ATOM   6834  C  CG2   . ILE A 1 949  ? 57.859  8.889   152.818 1.00 29.54  ? 948  ILE A CG2   1 
ATOM   6835  C  CD1   . ILE A 1 949  ? 56.882  11.462  154.127 1.00 29.12  ? 948  ILE A CD1   1 
ATOM   6836  N  N     . THR A 1 950  ? 62.382  10.258  154.165 1.00 31.09  ? 949  THR A N     1 
ATOM   6837  C  CA    . THR A 1 950  ? 63.365  11.273  154.506 1.00 31.53  ? 949  THR A CA    1 
ATOM   6838  C  C     . THR A 1 950  ? 64.136  11.677  153.268 1.00 32.01  ? 949  THR A C     1 
ATOM   6839  O  O     . THR A 1 950  ? 64.810  10.831  152.676 1.00 32.46  ? 949  THR A O     1 
ATOM   6840  C  CB    . THR A 1 950  ? 64.350  10.772  155.571 1.00 32.04  ? 949  THR A CB    1 
ATOM   6841  O  OG1   . THR A 1 950  ? 63.631  10.314  156.724 1.00 31.68  ? 949  THR A OG1   1 
ATOM   6842  C  CG2   . THR A 1 950  ? 65.293  11.878  155.987 1.00 32.56  ? 949  THR A CG2   1 
ATOM   6843  N  N     . PRO A 1 951  ? 64.169  12.948  152.950 1.00 32.08  ? 950  PRO A N     1 
ATOM   6844  C  CA    . PRO A 1 951  ? 64.955  13.407  151.830 1.00 32.75  ? 950  PRO A CA    1 
ATOM   6845  C  C     . PRO A 1 951  ? 66.418  13.204  152.123 1.00 33.58  ? 950  PRO A C     1 
ATOM   6846  O  O     . PRO A 1 951  ? 66.790  13.315  153.256 1.00 33.75  ? 950  PRO A O     1 
ATOM   6847  C  CB    . PRO A 1 951  ? 64.676  14.885  151.812 1.00 32.80  ? 950  PRO A CB    1 
ATOM   6848  C  CG    . PRO A 1 951  ? 63.384  15.039  152.434 1.00 32.06  ? 950  PRO A CG    1 
ATOM   6849  C  CD    . PRO A 1 951  ? 63.250  13.971  153.426 1.00 31.71  ? 950  PRO A CD    1 
ATOM   6850  N  N     . LYS A 1 952  ? 67.231  12.921  151.123 1.00 43.01  ? 951  LYS A N     1 
ATOM   6851  C  CA    . LYS A 1 952  ? 68.654  12.739  151.339 1.00 48.84  ? 951  LYS A CA    1 
ATOM   6852  C  C     . LYS A 1 952  ? 69.237  14.001  151.839 1.00 49.42  ? 951  LYS A C     1 
ATOM   6853  O  O     . LYS A 1 952  ? 70.211  14.008  152.491 1.00 51.31  ? 951  LYS A O     1 
ATOM   6854  C  CB    . LYS A 1 952  ? 69.358  12.348  150.078 1.00 56.17  ? 951  LYS A CB    1 
ATOM   6855  C  CG    . LYS A 1 952  ? 68.788  11.102  149.442 1.00 62.92  ? 951  LYS A CG    1 
ATOM   6856  C  CD    . LYS A 1 952  ? 69.561  9.855   149.826 1.00 65.54  ? 951  LYS A CD    1 
ATOM   6857  C  CE    . LYS A 1 952  ? 68.754  8.596   149.560 1.00 70.74  ? 951  LYS A CE    1 
ATOM   6858  N  NZ    . LYS A 1 952  ? 69.471  7.627   148.682 1.00 72.76  ? 951  LYS A NZ    1 
ATOM   6859  N  N     . ASP A 1 953  ? 68.616  15.081  151.477 1.00 46.05  ? 952  ASP A N     1 
ATOM   6860  C  CA    . ASP A 1 953  ? 68.977  16.399  151.882 1.00 46.39  ? 952  ASP A CA    1 
ATOM   6861  C  C     . ASP A 1 953  ? 68.878  16.676  153.367 1.00 41.43  ? 952  ASP A C     1 
ATOM   6862  O  O     . ASP A 1 953  ? 69.666  17.378  153.918 1.00 43.06  ? 952  ASP A O     1 
ATOM   6863  C  CB    . ASP A 1 953  ? 67.908  17.303  151.286 1.00 48.55  ? 952  ASP A CB    1 
ATOM   6864  C  CG    . ASP A 1 953  ? 68.391  18.122  150.168 1.00 51.73  ? 952  ASP A CG    1 
ATOM   6865  O  OD1   . ASP A 1 953  ? 69.521  17.924  149.723 1.00 54.86  ? 952  ASP A OD1   1 
ATOM   6866  O  OD2   . ASP A 1 953  ? 67.626  18.972  149.721 1.00 53.45  ? 952  ASP A OD2   1 
ATOM   6867  N  N     . SER A 1 954  ? 67.844  16.153  153.988 1.00 40.24  ? 953  SER A N     1 
ATOM   6868  C  CA    . SER A 1 954  ? 67.486  16.423  155.367 1.00 37.63  ? 953  SER A CA    1 
ATOM   6869  C  C     . SER A 1 954  ? 68.394  16.072  156.516 1.00 39.57  ? 953  SER A C     1 
ATOM   6870  O  O     . SER A 1 954  ? 68.928  14.992  156.600 1.00 39.37  ? 953  SER A O     1 
ATOM   6871  C  CB    . SER A 1 954  ? 66.091  15.825  155.613 1.00 34.63  ? 953  SER A CB    1 
ATOM   6872  O  OG    . SER A 1 954  ? 65.451  16.278  156.779 1.00 33.21  ? 953  SER A OG    1 
ATOM   6873  N  N     . ASN A 1 955  ? 68.456  17.000  157.447 1.00 40.56  ? 954  ASN A N     1 
ATOM   6874  C  CA    . ASN A 1 955  ? 69.212  16.834  158.645 1.00 41.27  ? 954  ASN A CA    1 
ATOM   6875  C  C     . ASN A 1 955  ? 68.476  16.059  159.689 1.00 37.88  ? 954  ASN A C     1 
ATOM   6876  O  O     . ASN A 1 955  ? 69.065  15.655  160.642 1.00 40.41  ? 954  ASN A O     1 
ATOM   6877  C  CB    . ASN A 1 955  ? 69.682  18.174  159.181 1.00 40.86  ? 954  ASN A CB    1 
ATOM   6878  C  CG    . ASN A 1 955  ? 70.772  18.776  158.340 1.00 39.58  ? 954  ASN A CG    1 
ATOM   6879  O  OD1   . ASN A 1 955  ? 71.851  18.267  158.288 1.00 41.51  ? 954  ASN A OD1   1 
ATOM   6880  N  ND2   . ASN A 1 955  ? 70.488  19.870  157.702 1.00 39.01  ? 954  ASN A ND2   1 
ATOM   6881  N  N     . ASN A 1 956  ? 67.187  15.848  159.501 1.00 36.79  ? 955  ASN A N     1 
ATOM   6882  C  CA    . ASN A 1 956  ? 66.373  15.064  160.414 1.00 35.10  ? 955  ASN A CA    1 
ATOM   6883  C  C     . ASN A 1 956  ? 65.459  14.195  159.586 1.00 34.21  ? 955  ASN A C     1 
ATOM   6884  O  O     . ASN A 1 956  ? 65.188  14.536  158.469 1.00 33.65  ? 955  ASN A O     1 
ATOM   6885  C  CB    . ASN A 1 956  ? 65.525  15.951  161.318 1.00 35.42  ? 955  ASN A CB    1 
ATOM   6886  C  CG    . ASN A 1 956  ? 66.344  16.894  162.170 1.00 36.30  ? 955  ASN A CG    1 
ATOM   6887  O  OD1   . ASN A 1 956  ? 66.346  18.076  161.950 1.00 37.56  ? 955  ASN A OD1   1 
ATOM   6888  N  ND2   . ASN A 1 956  ? 67.003  16.371  163.162 1.00 37.55  ? 955  ASN A ND2   1 
ATOM   6889  N  N     . LYS A 1 957  ? 64.993  13.084  160.134 1.00 33.28  ? 956  LYS A N     1 
ATOM   6890  C  CA    . LYS A 1 957  ? 64.077  12.180  159.455 1.00 33.66  ? 956  LYS A CA    1 
ATOM   6891  C  C     . LYS A 1 957  ? 62.726  12.842  159.243 1.00 31.42  ? 956  LYS A C     1 
ATOM   6892  O  O     . LYS A 1 957  ? 62.260  13.625  160.068 1.00 31.38  ? 956  LYS A O     1 
ATOM   6893  C  CB    . LYS A 1 957  ? 63.904  10.888  160.250 1.00 37.22  ? 956  LYS A CB    1 
ATOM   6894  C  CG    . LYS A 1 957  ? 65.097  9.963   160.159 1.00 41.65  ? 956  LYS A CG    1 
ATOM   6895  C  CD    . LYS A 1 957  ? 64.949  8.744   161.047 1.00 45.57  ? 956  LYS A CD    1 
ATOM   6896  C  CE    . LYS A 1 957  ? 63.624  8.054   160.829 1.00 50.70  ? 956  LYS A CE    1 
ATOM   6897  N  NZ    . LYS A 1 957  ? 63.779  6.731   160.140 1.00 54.76  ? 956  LYS A NZ    1 
ATOM   6898  N  N     . VAL A 1 958  ? 62.123  12.548  158.097 1.00 31.03  ? 957  VAL A N     1 
ATOM   6899  C  CA    . VAL A 1 958  ? 60.757  12.927  157.766 1.00 30.48  ? 957  VAL A CA    1 
ATOM   6900  C  C     . VAL A 1 958  ? 59.973  11.629  157.671 1.00 30.13  ? 957  VAL A C     1 
ATOM   6901  O  O     . VAL A 1 958  ? 60.480  10.637  157.142 1.00 30.28  ? 957  VAL A O     1 
ATOM   6902  C  CB    . VAL A 1 958  ? 60.709  13.729  156.445 1.00 30.49  ? 957  VAL A CB    1 
ATOM   6903  C  CG1   . VAL A 1 958  ? 59.303  14.188  156.126 1.00 30.05  ? 957  VAL A CG1   1 
ATOM   6904  C  CG2   . VAL A 1 958  ? 61.658  14.924  156.502 1.00 31.05  ? 957  VAL A CG2   1 
ATOM   6905  N  N     . VAL A 1 959  ? 58.770  11.607  158.236 1.00 29.79  ? 958  VAL A N     1 
ATOM   6906  C  CA    . VAL A 1 959  ? 58.045  10.357  158.415 1.00 29.61  ? 958  VAL A CA    1 
ATOM   6907  C  C     . VAL A 1 959  ? 56.564  10.564  158.138 1.00 29.24  ? 958  VAL A C     1 
ATOM   6908  O  O     . VAL A 1 959  ? 56.061  11.688  158.120 1.00 29.14  ? 958  VAL A O     1 
ATOM   6909  C  CB    . VAL A 1 959  ? 58.214  9.755   159.839 1.00 29.86  ? 958  VAL A CB    1 
ATOM   6910  C  CG1   . VAL A 1 959  ? 59.669  9.653   160.221 1.00 30.35  ? 958  VAL A CG1   1 
ATOM   6911  C  CG2   . VAL A 1 959  ? 57.434  10.557  160.872 1.00 29.80  ? 958  VAL A CG2   1 
ATOM   6912  N  N     . LEU A 1 960  ? 55.875  9.440   157.932 1.00 29.15  ? 959  LEU A N     1 
ATOM   6913  C  CA    . LEU A 1 960  ? 54.424  9.334   157.915 1.00 28.95  ? 959  LEU A CA    1 
ATOM   6914  C  C     . LEU A 1 960  ? 53.970  8.483   159.096 1.00 29.14  ? 959  LEU A C     1 
ATOM   6915  O  O     . LEU A 1 960  ? 54.637  7.522   159.479 1.00 29.41  ? 959  LEU A O     1 
ATOM   6916  C  CB    . LEU A 1 960  ? 53.920  8.692   156.614 1.00 28.84  ? 959  LEU A CB    1 
ATOM   6917  C  CG    . LEU A 1 960  ? 54.229  9.352   155.271 1.00 28.73  ? 959  LEU A CG    1 
ATOM   6918  C  CD1   . LEU A 1 960  ? 54.094  8.346   154.123 1.00 28.80  ? 959  LEU A CD1   1 
ATOM   6919  C  CD2   . LEU A 1 960  ? 53.337  10.563  155.052 1.00 28.57  ? 959  LEU A CD2   1 
ATOM   6920  N  N     . GLN A 1 961  ? 52.813  8.808   159.656 1.00 29.12  ? 960  GLN A N     1 
ATOM   6921  C  CA    . GLN A 1 961  ? 52.377  8.152   160.878 1.00 29.42  ? 960  GLN A CA    1 
ATOM   6922  C  C     . GLN A 1 961  ? 51.003  7.532   160.689 1.00 29.50  ? 960  GLN A C     1 
ATOM   6923  O  O     . GLN A 1 961  ? 50.331  7.750   159.678 1.00 29.31  ? 960  GLN A O     1 
ATOM   6924  C  CB    . GLN A 1 961  ? 52.364  9.125   162.060 1.00 29.56  ? 960  GLN A CB    1 
ATOM   6925  C  CG    . GLN A 1 961  ? 53.727  9.705   162.363 1.00 29.63  ? 960  GLN A CG    1 
ATOM   6926  C  CD    . GLN A 1 961  ? 53.866  10.128  163.798 1.00 29.98  ? 960  GLN A CD    1 
ATOM   6927  O  OE1   . GLN A 1 961  ? 53.303  11.132  164.216 1.00 30.06  ? 960  GLN A OE1   1 
ATOM   6928  N  NE2   . GLN A 1 961  ? 54.613  9.351   164.569 1.00 30.30  ? 960  GLN A NE2   1 
ATOM   6929  N  N     . SER A 1 962  ? 50.603  6.746   161.691 1.00 29.89  ? 961  SER A N     1 
ATOM   6930  C  CA    . SER A 1 962  ? 49.328  6.036   161.707 1.00 30.18  ? 961  SER A CA    1 
ATOM   6931  C  C     . SER A 1 962  ? 49.263  5.026   160.559 1.00 30.19  ? 961  SER A C     1 
ATOM   6932  O  O     . SER A 1 962  ? 48.452  5.126   159.638 1.00 30.08  ? 961  SER A O     1 
ATOM   6933  C  CB    . SER A 1 962  ? 48.165  7.022   161.659 1.00 30.34  ? 961  SER A CB    1 
ATOM   6934  O  OG    . SER A 1 962  ? 47.065  6.521   162.364 1.00 35.64  ? 961  SER A OG    1 
ATOM   6935  N  N     . VAL A 1 963  ? 50.160  4.052   160.630 1.00 30.43  ? 962  VAL A N     1 
ATOM   6936  C  CA    . VAL A 1 963  ? 50.358  3.093   159.554 1.00 30.56  ? 962  VAL A CA    1 
ATOM   6937  C  C     . VAL A 1 963  ? 49.242  2.060   159.612 1.00 31.09  ? 962  VAL A C     1 
ATOM   6938  O  O     . VAL A 1 963  ? 49.028  1.419   160.642 1.00 31.62  ? 962  VAL A O     1 
ATOM   6939  C  CB    . VAL A 1 963  ? 51.742  2.443   159.665 1.00 30.80  ? 962  VAL A CB    1 
ATOM   6940  C  CG1   . VAL A 1 963  ? 52.080  1.674   158.431 1.00 30.96  ? 962  VAL A CG1   1 
ATOM   6941  C  CG2   . VAL A 1 963  ? 52.781  3.519   159.914 1.00 30.44  ? 962  VAL A CG2   1 
ATOM   6942  N  N     . SER A 1 964  ? 48.520  1.900   158.503 1.00 31.05  ? 963  SER A N     1 
ATOM   6943  C  CA    . SER A 1 964  ? 47.346  1.054   158.552 1.00 31.64  ? 963  SER A CA    1 
ATOM   6944  C  C     . SER A 1 964  ? 47.729  -0.405  158.350 1.00 32.31  ? 963  SER A C     1 
ATOM   6945  O  O     . SER A 1 964  ? 48.668  -0.712  157.619 1.00 32.25  ? 963  SER A O     1 
ATOM   6946  C  CB    . SER A 1 964  ? 46.337  1.482   157.496 1.00 31.47  ? 963  SER A CB    1 
ATOM   6947  O  OG    . SER A 1 964  ? 45.762  2.732   157.823 1.00 31.11  ? 963  SER A OG    1 
ATOM   6948  N  N     . PRO A 1 965  ? 47.021  -1.315  159.006 1.00 33.08  ? 964  PRO A N     1 
ATOM   6949  C  CA    . PRO A 1 965  ? 47.339  -2.739  158.918 1.00 33.92  ? 964  PRO A CA    1 
ATOM   6950  C  C     . PRO A 1 965  ? 46.597  -3.474  157.811 1.00 34.39  ? 964  PRO A C     1 
ATOM   6951  O  O     . PRO A 1 965  ? 45.483  -3.123  157.419 1.00 34.33  ? 964  PRO A O     1 
ATOM   6952  C  CB    . PRO A 1 965  ? 46.876  -3.250  160.284 1.00 34.64  ? 964  PRO A CB    1 
ATOM   6953  C  CG    . PRO A 1 965  ? 45.705  -2.424  160.547 1.00 34.40  ? 964  PRO A CG    1 
ATOM   6954  C  CD    . PRO A 1 965  ? 46.036  -1.056  160.063 1.00 33.35  ? 964  PRO A CD    1 
ATOM   6955  N  N     . TRP A 1 966  ? 47.233  -4.544  157.334 1.00 35.00  ? 965  TRP A N     1 
ATOM   6956  C  CA    . TRP A 1 966  ? 46.650  -5.440  156.343 1.00 35.69  ? 965  TRP A CA    1 
ATOM   6957  C  C     . TRP A 1 966  ? 46.112  -6.712  156.985 1.00 36.96  ? 965  TRP A C     1 
ATOM   6958  O  O     . TRP A 1 966  ? 44.910  -6.983  156.921 1.00 37.46  ? 965  TRP A O     1 
ATOM   6959  C  CB    . TRP A 1 966  ? 47.688  -5.786  155.267 1.00 35.72  ? 965  TRP A CB    1 
ATOM   6960  C  CG    . TRP A 1 966  ? 47.192  -6.763  154.239 1.00 36.56  ? 965  TRP A CG    1 
ATOM   6961  C  CD1   . TRP A 1 966  ? 45.919  -6.883  153.770 1.00 36.86  ? 965  TRP A CD1   1 
ATOM   6962  C  CD2   . TRP A 1 966  ? 47.962  -7.760  153.560 1.00 37.35  ? 965  TRP A CD2   1 
ATOM   6963  N  NE1   . TRP A 1 966  ? 45.849  -7.889  152.840 1.00 37.76  ? 965  TRP A NE1   1 
ATOM   6964  C  CE2   . TRP A 1 966  ? 47.091  -8.445  152.699 1.00 38.09  ? 965  TRP A CE2   1 
ATOM   6965  C  CE3   . TRP A 1 966  ? 49.302  -8.141  153.601 1.00 37.61  ? 965  TRP A CE3   1 
ATOM   6966  C  CZ2   . TRP A 1 966  ? 47.518  -9.487  151.887 1.00 39.08  ? 965  TRP A CZ2   1 
ATOM   6967  C  CZ3   . TRP A 1 966  ? 49.722  -9.171  152.799 1.00 38.61  ? 965  TRP A CZ3   1 
ATOM   6968  C  CH2   . TRP A 1 966  ? 48.835  -9.836  151.953 1.00 39.34  ? 965  TRP A CH2   1 
ATOM   6969  N  N     . ARG A 1 967  ? 46.983  -7.503  157.607 1.00 37.59  ? 966  ARG A N     1 
ATOM   6970  C  CA    . ARG A 1 967  ? 46.571  -8.792  158.140 1.00 38.98  ? 966  ARG A CA    1 
ATOM   6971  C  C     . ARG A 1 967  ? 47.490  -9.168  159.291 1.00 39.40  ? 966  ARG A C     1 
ATOM   6972  O  O     . ARG A 1 967  ? 48.552  -8.578  159.483 1.00 38.71  ? 966  ARG A O     1 
ATOM   6973  C  CB    . ARG A 1 967  ? 46.596  -9.873  157.057 1.00 39.91  ? 966  ARG A CB    1 
ATOM   6974  C  CG    . ARG A 1 967  ? 47.988  -10.350 156.730 1.00 40.18  ? 966  ARG A CG    1 
ATOM   6975  C  CD    . ARG A 1 967  ? 48.002  -11.298 155.562 1.00 41.10  ? 966  ARG A CD    1 
ATOM   6976  N  NE    . ARG A 1 967  ? 49.057  -12.295 155.685 1.00 42.16  ? 966  ARG A NE    1 
ATOM   6977  C  CZ    . ARG A 1 967  ? 49.330  -13.206 154.759 1.00 43.18  ? 966  ARG A CZ    1 
ATOM   6978  N  NH1   . ARG A 1 967  ? 50.304  -14.086 154.955 1.00 44.26  ? 966  ARG A NH1   1 
ATOM   6979  N  NH2   . ARG A 1 967  ? 48.632  -13.230 153.632 1.00 43.19  ? 966  ARG A NH2   1 
ATOM   6980  N  N     . ALA A 1 968  ? 47.069  -10.174 160.049 1.00 40.67  ? 967  ALA A N     1 
ATOM   6981  C  CA    . ALA A 1 968  ? 47.875  -10.750 161.115 1.00 41.40  ? 967  ALA A CA    1 
ATOM   6982  C  C     . ALA A 1 968  ? 48.032  -12.244 160.884 1.00 43.01  ? 967  ALA A C     1 
ATOM   6983  O  O     . ALA A 1 968  ? 47.048  -12.944 160.629 1.00 43.93  ? 967  ALA A O     1 
ATOM   6984  C  CB    . ALA A 1 968  ? 47.251  -10.495 162.487 1.00 41.58  ? 967  ALA A CB    1 
ATOM   6985  N  N     . ASP A 1 969  ? 49.266  -12.728 160.965 1.00 43.47  ? 968  ASP A N     1 
ATOM   6986  C  CA    . ASP A 1 969  ? 49.562  -14.147 160.837 1.00 45.17  ? 968  ASP A CA    1 
ATOM   6987  C  C     . ASP A 1 969  ? 49.711  -14.737 162.231 1.00 46.25  ? 968  ASP A C     1 
ATOM   6988  O  O     . ASP A 1 969  ? 50.525  -14.260 163.025 1.00 45.81  ? 968  ASP A O     1 
ATOM   6989  C  CB    . ASP A 1 969  ? 50.830  -14.376 160.019 1.00 45.25  ? 968  ASP A CB    1 
ATOM   6990  C  CG    . ASP A 1 969  ? 50.664  -13.983 158.568 1.00 44.51  ? 968  ASP A CG    1 
ATOM   6991  O  OD1   . ASP A 1 969  ? 49.514  -13.773 158.142 1.00 44.21  ? 968  ASP A OD1   1 
ATOM   6992  O  OD2   . ASP A 1 969  ? 51.680  -13.891 157.856 1.00 44.31  ? 968  ASP A OD2   1 
ATOM   6993  N  N     . VAL A 1 970  ? 48.928  -15.770 162.519 1.00 47.75  ? 969  VAL A N     1 
ATOM   6994  C  CA    . VAL A 1 970  ? 48.895  -16.402 163.830 1.00 49.00  ? 969  VAL A CA    1 
ATOM   6995  C  C     . VAL A 1 970  ? 49.808  -17.617 163.824 1.00 50.64  ? 969  VAL A C     1 
ATOM   6996  O  O     . VAL A 1 970  ? 49.726  -18.463 162.927 1.00 51.63  ? 969  VAL A O     1 
ATOM   6997  C  CB    . VAL A 1 970  ? 47.462  -16.798 164.208 1.00 49.86  ? 969  VAL A CB    1 
ATOM   6998  C  CG1   . VAL A 1 970  ? 47.452  -17.559 165.501 1.00 51.39  ? 969  VAL A CG1   1 
ATOM   6999  C  CG2   . VAL A 1 970  ? 46.610  -15.571 164.317 1.00 48.38  ? 969  VAL A CG2   1 
ATOM   7000  N  N     . TYR A 1 971  ? 50.668  -17.712 164.827 1.00 51.06  ? 970  TYR A N     1 
ATOM   7001  C  CA    . TYR A 1 971  ? 51.558  -18.845 165.021 1.00 52.79  ? 970  TYR A CA    1 
ATOM   7002  C  C     . TYR A 1 971  ? 51.305  -19.444 166.396 1.00 55.23  ? 970  TYR A C     1 
ATOM   7003  O  O     . TYR A 1 971  ? 50.415  -19.013 167.129 1.00 54.09  ? 970  TYR A O     1 
ATOM   7004  C  CB    . TYR A 1 971  ? 53.021  -18.425 164.882 1.00 52.18  ? 970  TYR A CB    1 
ATOM   7005  C  CG    . TYR A 1 971  ? 53.432  -17.996 163.494 1.00 51.17  ? 970  TYR A CG    1 
ATOM   7006  C  CD1   . TYR A 1 971  ? 53.017  -16.780 162.965 1.00 49.24  ? 970  TYR A CD1   1 
ATOM   7007  C  CD2   . TYR A 1 971  ? 54.262  -18.793 162.724 1.00 52.27  ? 970  TYR A CD2   1 
ATOM   7008  C  CE1   . TYR A 1 971  ? 53.403  -16.381 161.712 1.00 48.42  ? 970  TYR A CE1   1 
ATOM   7009  C  CE2   . TYR A 1 971  ? 54.651  -18.399 161.464 1.00 51.45  ? 970  TYR A CE2   1 
ATOM   7010  C  CZ    . TYR A 1 971  ? 54.218  -17.193 160.963 1.00 49.51  ? 970  TYR A CZ    1 
ATOM   7011  O  OH    . TYR A 1 971  ? 54.615  -16.806 159.707 1.00 48.80  ? 970  TYR A OH    1 
ATOM   7012  N  N     . PHE A 1 972  ? 52.108  -20.445 166.747 1.00 55.89  ? 971  PHE A N     1 
ATOM   7013  C  CA    . PHE A 1 972  ? 52.051  -21.048 168.071 1.00 57.37  ? 971  PHE A CA    1 
ATOM   7014  C  C     . PHE A 1 972  ? 53.431  -21.578 168.417 1.00 58.45  ? 971  PHE A C     1 
ATOM   7015  O  O     . PHE A 1 972  ? 54.075  -22.216 167.581 1.00 59.25  ? 971  PHE A O     1 
ATOM   7016  C  CB    . PHE A 1 972  ? 51.018  -22.172 168.122 1.00 59.25  ? 971  PHE A CB    1 
ATOM   7017  C  CG    . PHE A 1 972  ? 50.796  -22.729 169.494 1.00 60.80  ? 971  PHE A CG    1 
ATOM   7018  C  CD1   . PHE A 1 972  ? 49.979  -22.075 170.396 1.00 60.16  ? 971  PHE A CD1   1 
ATOM   7019  C  CD2   . PHE A 1 972  ? 51.397  -23.913 169.884 1.00 63.02  ? 971  PHE A CD2   1 
ATOM   7020  C  CE1   . PHE A 1 972  ? 49.769  -22.594 171.661 1.00 61.69  ? 971  PHE A CE1   1 
ATOM   7021  C  CE2   . PHE A 1 972  ? 51.191  -24.429 171.145 1.00 64.55  ? 971  PHE A CE2   1 
ATOM   7022  C  CZ    . PHE A 1 972  ? 50.378  -23.768 172.034 1.00 63.86  ? 971  PHE A CZ    1 
ATOM   7023  N  N     . ASN A 1 973  ? 53.882  -21.304 169.637 1.00 64.43  ? 972  ASN A N     1 
ATOM   7024  C  CA    . ASN A 1 973  ? 55.196  -21.717 170.109 1.00 66.53  ? 972  ASN A CA    1 
ATOM   7025  C  C     . ASN A 1 973  ? 55.015  -22.876 171.075 1.00 70.94  ? 972  ASN A C     1 
ATOM   7026  O  O     . ASN A 1 973  ? 54.332  -22.736 172.093 1.00 72.95  ? 972  ASN A O     1 
ATOM   7027  C  CB    . ASN A 1 973  ? 55.925  -20.556 170.784 1.00 64.70  ? 972  ASN A CB    1 
ATOM   7028  C  CG    . ASN A 1 973  ? 57.418  -20.769 170.851 1.00 64.56  ? 972  ASN A CG    1 
ATOM   7029  O  OD1   . ASN A 1 973  ? 57.895  -21.902 170.843 1.00 65.51  ? 972  ASN A OD1   1 
ATOM   7030  N  ND2   . ASN A 1 973  ? 58.168  -19.676 170.906 1.00 63.52  ? 972  ASN A ND2   1 
ATOM   7031  N  N     . LYS A 1 974  ? 55.625  -24.019 170.755 1.00 75.47  ? 973  LYS A N     1 
ATOM   7032  C  CA    . LYS A 1 974  ? 55.415  -25.216 171.562 1.00 74.06  ? 973  LYS A CA    1 
ATOM   7033  C  C     . LYS A 1 974  ? 56.150  -25.160 172.891 1.00 74.08  ? 973  LYS A C     1 
ATOM   7034  O  O     . LYS A 1 974  ? 55.654  -25.703 173.884 1.00 73.20  ? 973  LYS A O     1 
ATOM   7035  C  CB    . LYS A 1 974  ? 55.840  -26.463 170.788 1.00 75.24  ? 973  LYS A CB    1 
ATOM   7036  C  CG    . LYS A 1 974  ? 55.071  -26.680 169.501 1.00 74.40  ? 973  LYS A CG    1 
ATOM   7037  C  CD    . LYS A 1 974  ? 55.076  -28.141 169.106 1.00 76.62  ? 973  LYS A CD    1 
ATOM   7038  C  CE    . LYS A 1 974  ? 54.479  -28.341 167.723 1.00 76.12  ? 973  LYS A CE    1 
ATOM   7039  N  NZ    . LYS A 1 974  ? 53.007  -28.118 167.696 1.00 75.92  ? 973  LYS A NZ    1 
ATOM   7040  N  N     . THR A 1 975  ? 57.317  -24.513 172.929 1.00 72.09  ? 974  THR A N     1 
ATOM   7041  C  CA    . THR A 1 975  ? 58.092  -24.452 174.164 1.00 70.66  ? 974  THR A CA    1 
ATOM   7042  C  C     . THR A 1 975  ? 57.363  -23.655 175.235 1.00 67.21  ? 974  THR A C     1 
ATOM   7043  O  O     . THR A 1 975  ? 57.352  -24.043 176.406 1.00 68.71  ? 974  THR A O     1 
ATOM   7044  C  CB    . THR A 1 975  ? 59.465  -23.839 173.891 1.00 67.50  ? 974  THR A CB    1 
ATOM   7045  O  OG1   . THR A 1 975  ? 60.090  -24.533 172.798 1.00 68.29  ? 974  THR A OG1   1 
ATOM   7046  C  CG2   . THR A 1 975  ? 60.357  -23.945 175.124 1.00 67.23  ? 974  THR A CG2   1 
ATOM   7047  N  N     . THR A 1 976  ? 56.752  -22.538 174.856 1.00 64.93  ? 975  THR A N     1 
ATOM   7048  C  CA    . THR A 1 976  ? 56.030  -21.702 175.803 1.00 65.79  ? 975  THR A CA    1 
ATOM   7049  C  C     . THR A 1 976  ? 54.548  -22.032 175.888 1.00 66.64  ? 975  THR A C     1 
ATOM   7050  O  O     . THR A 1 976  ? 53.899  -21.634 176.859 1.00 62.99  ? 975  THR A O     1 
ATOM   7051  C  CB    . THR A 1 976  ? 56.186  -20.224 175.432 1.00 64.60  ? 975  THR A CB    1 
ATOM   7052  O  OG1   . THR A 1 976  ? 55.691  -20.009 174.104 1.00 63.96  ? 975  THR A OG1   1 
ATOM   7053  C  CG2   . THR A 1 976  ? 57.645  -19.819 175.479 1.00 65.91  ? 975  THR A CG2   1 
ATOM   7054  N  N     . GLY A 1 977  ? 54.004  -22.744 174.903 1.00 70.76  ? 976  GLY A N     1 
ATOM   7055  C  CA    . GLY A 1 977  ? 52.584  -23.024 174.884 1.00 68.99  ? 976  GLY A CA    1 
ATOM   7056  C  C     . GLY A 1 977  ? 51.715  -21.822 174.612 1.00 69.45  ? 976  GLY A C     1 
ATOM   7057  O  O     . GLY A 1 977  ? 50.508  -21.873 174.862 1.00 68.96  ? 976  GLY A O     1 
ATOM   7058  N  N     . LYS A 1 978  ? 52.295  -20.740 174.100 1.00 64.54  ? 977  LYS A N     1 
ATOM   7059  C  CA    . LYS A 1 978  ? 51.600  -19.487 173.865 1.00 62.02  ? 977  LYS A CA    1 
ATOM   7060  C  C     . LYS A 1 978  ? 51.544  -19.187 172.375 1.00 60.76  ? 977  LYS A C     1 
ATOM   7061  O  O     . LYS A 1 978  ? 52.354  -19.682 171.586 1.00 60.77  ? 977  LYS A O     1 
ATOM   7062  C  CB    . LYS A 1 978  ? 52.297  -18.335 174.594 1.00 58.93  ? 977  LYS A CB    1 
ATOM   7063  C  CG    . LYS A 1 978  ? 52.463  -18.561 176.071 1.00 59.10  ? 977  LYS A CG    1 
ATOM   7064  C  CD    . LYS A 1 978  ? 53.459  -17.591 176.695 1.00 57.12  ? 977  LYS A CD    1 
ATOM   7065  C  CE    . LYS A 1 978  ? 53.686  -17.945 178.162 1.00 59.33  ? 977  LYS A CE    1 
ATOM   7066  N  NZ    . LYS A 1 978  ? 54.803  -17.172 178.756 1.00 59.92  ? 977  LYS A NZ    1 
ATOM   7067  N  N     . TYR A 1 979  ? 50.578  -18.353 172.002 1.00 60.62  ? 978  TYR A N     1 
ATOM   7068  C  CA    . TYR A 1 979  ? 50.431  -17.907 170.627 1.00 60.64  ? 978  TYR A CA    1 
ATOM   7069  C  C     . TYR A 1 979  ? 51.300  -16.682 170.360 1.00 61.12  ? 978  TYR A C     1 
ATOM   7070  O  O     . TYR A 1 979  ? 51.535  -15.855 171.245 1.00 65.24  ? 978  TYR A O     1 
ATOM   7071  C  CB    . TYR A 1 979  ? 48.969  -17.588 170.317 1.00 60.84  ? 978  TYR A CB    1 
ATOM   7072  C  CG    . TYR A 1 979  ? 48.078  -18.803 170.265 1.00 62.13  ? 978  TYR A CG    1 
ATOM   7073  C  CD1   . TYR A 1 979  ? 47.488  -19.301 171.414 1.00 64.24  ? 978  TYR A CD1   1 
ATOM   7074  C  CD2   . TYR A 1 979  ? 47.825  -19.454 169.065 1.00 60.95  ? 978  TYR A CD2   1 
ATOM   7075  C  CE1   . TYR A 1 979  ? 46.672  -20.412 171.373 1.00 65.54  ? 978  TYR A CE1   1 
ATOM   7076  C  CE2   . TYR A 1 979  ? 47.009  -20.566 169.015 1.00 62.30  ? 978  TYR A CE2   1 
ATOM   7077  C  CZ    . TYR A 1 979  ? 46.436  -21.037 170.174 1.00 64.94  ? 978  TYR A CZ    1 
ATOM   7078  O  OH    . TYR A 1 979  ? 45.623  -22.140 170.137 1.00 66.95  ? 978  TYR A OH    1 
ATOM   7079  N  N     . GLU A 1 980  ? 51.781  -16.581 169.121 1.00 61.93  ? 979  GLU A N     1 
ATOM   7080  C  CA    . GLU A 1 980  ? 52.611  -15.471 168.668 1.00 59.59  ? 979  GLU A CA    1 
ATOM   7081  C  C     . GLU A 1 980  ? 52.015  -14.920 167.378 1.00 55.22  ? 979  GLU A C     1 
ATOM   7082  O  O     . GLU A 1 980  ? 51.874  -15.656 166.396 1.00 58.99  ? 979  GLU A O     1 
ATOM   7083  C  CB    . GLU A 1 980  ? 54.057  -15.930 168.463 1.00 60.73  ? 979  GLU A CB    1 
ATOM   7084  C  CG    . GLU A 1 980  ? 54.683  -16.502 169.726 1.00 61.14  ? 979  GLU A CG    1 
ATOM   7085  C  CD    . GLU A 1 980  ? 56.081  -17.058 169.518 1.00 61.38  ? 979  GLU A CD    1 
ATOM   7086  O  OE1   . GLU A 1 980  ? 56.351  -17.651 168.452 1.00 63.56  ? 979  GLU A OE1   1 
ATOM   7087  O  OE2   . GLU A 1 980  ? 56.916  -16.906 170.435 1.00 61.77  ? 979  GLU A OE2   1 
ATOM   7088  N  N     . ILE A 1 981  ? 51.656  -13.637 167.375 1.00 46.45  ? 980  ILE A N     1 
ATOM   7089  C  CA    . ILE A 1 981  ? 50.876  -13.050 166.291 1.00 45.33  ? 980  ILE A CA    1 
ATOM   7090  C  C     . ILE A 1 981  ? 51.732  -12.020 165.570 1.00 43.84  ? 980  ILE A C     1 
ATOM   7091  O  O     . ILE A 1 981  ? 52.169  -11.032 166.169 1.00 42.92  ? 980  ILE A O     1 
ATOM   7092  C  CB    . ILE A 1 981  ? 49.570  -12.421 166.797 1.00 44.86  ? 980  ILE A CB    1 
ATOM   7093  C  CG1   . ILE A 1 981  ? 48.826  -13.410 167.702 1.00 46.50  ? 980  ILE A CG1   1 
ATOM   7094  C  CG2   . ILE A 1 981  ? 48.711  -11.979 165.604 1.00 44.00  ? 980  ILE A CG2   1 
ATOM   7095  C  CD1   . ILE A 1 981  ? 47.370  -13.094 167.951 1.00 46.46  ? 980  ILE A CD1   1 
ATOM   7096  N  N     . LEU A 1 982  ? 51.949  -12.249 164.280 1.00 43.70  ? 981  LEU A N     1 
ATOM   7097  C  CA    . LEU A 1 982  ? 52.704  -11.362 163.411 1.00 42.45  ? 981  LEU A CA    1 
ATOM   7098  C  C     . LEU A 1 982  ? 51.731  -10.422 162.708 1.00 41.19  ? 981  LEU A C     1 
ATOM   7099  O  O     . LEU A 1 982  ? 50.687  -10.855 162.221 1.00 41.54  ? 981  LEU A O     1 
ATOM   7100  C  CB    . LEU A 1 982  ? 53.485  -12.206 162.401 1.00 43.22  ? 981  LEU A CB    1 
ATOM   7101  C  CG    . LEU A 1 982  ? 54.466  -11.681 161.355 1.00 42.49  ? 981  LEU A CG    1 
ATOM   7102  C  CD1   . LEU A 1 982  ? 55.224  -12.869 160.811 1.00 43.92  ? 981  LEU A CD1   1 
ATOM   7103  C  CD2   . LEU A 1 982  ? 53.762  -10.971 160.216 1.00 42.81  ? 981  LEU A CD2   1 
ATOM   7104  N  N     . GLY A 1 983  ? 52.077  -9.140  162.643 1.00 45.23  ? 982  GLY A N     1 
ATOM   7105  C  CA    . GLY A 1 983  ? 51.219  -8.131  162.048 1.00 45.57  ? 982  GLY A CA    1 
ATOM   7106  C  C     . GLY A 1 983  ? 51.845  -7.566  160.774 1.00 48.92  ? 982  GLY A C     1 
ATOM   7107  O  O     . GLY A 1 983  ? 52.969  -7.071  160.798 1.00 52.65  ? 982  GLY A O     1 
ATOM   7108  N  N     . LEU A 1 984  ? 51.079  -7.626  159.691 1.00 42.17  ? 983  LEU A N     1 
ATOM   7109  C  CA    . LEU A 1 984  ? 51.489  -7.064  158.408 1.00 39.05  ? 983  LEU A CA    1 
ATOM   7110  C  C     . LEU A 1 984  ? 50.675  -5.816  158.104 1.00 38.66  ? 983  LEU A C     1 
ATOM   7111  O  O     . LEU A 1 984  ? 49.462  -5.788  158.321 1.00 45.26  ? 983  LEU A O     1 
ATOM   7112  C  CB    . LEU A 1 984  ? 51.320  -8.067  157.262 1.00 37.76  ? 983  LEU A CB    1 
ATOM   7113  C  CG    . LEU A 1 984  ? 52.358  -9.180  157.097 1.00 38.90  ? 983  LEU A CG    1 
ATOM   7114  C  CD1   . LEU A 1 984  ? 51.975  -10.063 155.919 1.00 39.69  ? 983  LEU A CD1   1 
ATOM   7115  C  CD2   . LEU A 1 984  ? 53.766  -8.612  156.928 1.00 38.45  ? 983  LEU A CD2   1 
ATOM   7116  N  N     . LYS A 1 985  ? 51.349  -4.790  157.600 1.00 34.92  ? 984  LYS A N     1 
ATOM   7117  C  CA    . LYS A 1 985  ? 50.729  -3.528  157.236 1.00 33.92  ? 984  LYS A CA    1 
ATOM   7118  C  C     . LYS A 1 985  ? 50.816  -3.338  155.732 1.00 33.64  ? 984  LYS A C     1 
ATOM   7119  O  O     . LYS A 1 985  ? 51.680  -3.916  155.068 1.00 34.04  ? 984  LYS A O     1 
ATOM   7120  C  CB    . LYS A 1 985  ? 51.400  -2.356  157.967 1.00 33.18  ? 984  LYS A CB    1 
ATOM   7121  C  CG    . LYS A 1 985  ? 51.320  -2.499  159.510 1.00 33.51  ? 984  LYS A CG    1 
ATOM   7122  C  CD    . LYS A 1 985  ? 51.706  -1.243  160.236 1.00 32.83  ? 984  LYS A CD    1 
ATOM   7123  C  CE    . LYS A 1 985  ? 51.172  -1.245  161.668 1.00 33.14  ? 984  LYS A CE    1 
ATOM   7124  N  NZ    . LYS A 1 985  ? 49.800  -0.741  161.825 1.00 32.95  ? 984  LYS A NZ    1 
ATOM   7125  N  N     . TYR A 1 986  ? 49.893  -2.533  155.192 1.00 33.06  ? 985  TYR A N     1 
ATOM   7126  C  CA    . TYR A 1 986  ? 49.923  -2.259  153.762 1.00 32.82  ? 985  TYR A CA    1 
ATOM   7127  C  C     . TYR A 1 986  ? 51.306  -1.799  153.338 1.00 32.51  ? 985  TYR A C     1 
ATOM   7128  O  O     . TYR A 1 986  ? 51.828  -2.245  152.313 1.00 32.84  ? 985  TYR A O     1 
ATOM   7129  C  CB    . TYR A 1 986  ? 48.870  -1.213  153.388 1.00 32.21  ? 985  TYR A CB    1 
ATOM   7130  C  CG    . TYR A 1 986  ? 47.447  -1.605  153.706 1.00 32.61  ? 985  TYR A CG    1 
ATOM   7131  C  CD1   . TYR A 1 986  ? 46.865  -2.735  153.142 1.00 33.42  ? 985  TYR A CD1   1 
ATOM   7132  C  CD2   . TYR A 1 986  ? 46.675  -0.839  154.553 1.00 32.31  ? 985  TYR A CD2   1 
ATOM   7133  C  CE1   . TYR A 1 986  ? 45.561  -3.092  153.436 1.00 33.92  ? 985  TYR A CE1   1 
ATOM   7134  C  CE2   . TYR A 1 986  ? 45.370  -1.189  154.842 1.00 32.81  ? 985  TYR A CE2   1 
ATOM   7135  C  CZ    . TYR A 1 986  ? 44.823  -2.310  154.283 1.00 33.61  ? 985  TYR A CZ    1 
ATOM   7136  O  OH    . TYR A 1 986  ? 43.532  -2.647  154.585 1.00 34.22  ? 985  TYR A OH    1 
ATOM   7137  N  N     . ALA A 1 987  ? 51.943  -0.962  154.151 1.00 32.03  ? 986  ALA A N     1 
ATOM   7138  C  CA    . ALA A 1 987  ? 53.226  -0.379  153.788 1.00 31.78  ? 986  ALA A CA    1 
ATOM   7139  C  C     . ALA A 1 987  ? 54.377  -1.368  153.849 1.00 32.53  ? 986  ALA A C     1 
ATOM   7140  O  O     . ALA A 1 987  ? 55.490  -1.000  153.475 1.00 32.51  ? 986  ALA A O     1 
ATOM   7141  C  CB    . ALA A 1 987  ? 53.521  0.821   154.677 1.00 31.17  ? 986  ALA A CB    1 
ATOM   7142  N  N     . ASP A 1 988  ? 54.148  -2.603  154.287 1.00 33.31  ? 987  ASP A N     1 
ATOM   7143  C  CA    . ASP A 1 988  ? 55.171  -3.634  154.170 1.00 34.22  ? 987  ASP A CA    1 
ATOM   7144  C  C     . ASP A 1 988  ? 55.240  -4.226  152.769 1.00 34.71  ? 987  ASP A C     1 
ATOM   7145  O  O     . ASP A 1 988  ? 56.271  -4.791  152.400 1.00 35.41  ? 987  ASP A O     1 
ATOM   7146  C  CB    . ASP A 1 988  ? 54.918  -4.742  155.188 1.00 35.05  ? 987  ASP A CB    1 
ATOM   7147  C  CG    . ASP A 1 988  ? 55.082  -4.266  156.621 1.00 34.78  ? 987  ASP A CG    1 
ATOM   7148  O  OD1   . ASP A 1 988  ? 55.981  -3.448  156.883 1.00 34.35  ? 987  ASP A OD1   1 
ATOM   7149  O  OD2   . ASP A 1 988  ? 54.305  -4.704  157.487 1.00 36.71  ? 987  ASP A OD2   1 
ATOM   7150  N  N     . LEU A 1 989  ? 54.179  -4.099  151.977 1.00 34.45  ? 988  LEU A N     1 
ATOM   7151  C  CA    . LEU A 1 989  ? 54.176  -4.566  150.600 1.00 34.91  ? 988  LEU A CA    1 
ATOM   7152  C  C     . LEU A 1 989  ? 54.515  -3.410  149.674 1.00 34.19  ? 988  LEU A C     1 
ATOM   7153  O  O     . LEU A 1 989  ? 54.203  -2.256  149.958 1.00 33.29  ? 988  LEU A O     1 
ATOM   7154  C  CB    . LEU A 1 989  ? 52.823  -5.163  150.210 1.00 35.22  ? 988  LEU A CB    1 
ATOM   7155  C  CG    . LEU A 1 989  ? 52.499  -6.582  150.668 1.00 36.36  ? 988  LEU A CG    1 
ATOM   7156  C  CD1   . LEU A 1 989  ? 52.354  -6.670  152.176 1.00 36.34  ? 988  LEU A CD1   1 
ATOM   7157  C  CD2   . LEU A 1 989  ? 51.251  -7.089  149.984 1.00 36.77  ? 988  LEU A CD2   1 
ATOM   7158  N  N     . GLN A 1 990  ? 55.165  -3.729  148.565 1.00 37.90  ? 989  GLN A N     1 
ATOM   7159  C  CA    . GLN A 1 990  ? 55.621  -2.709  147.638 1.00 42.01  ? 989  GLN A CA    1 
ATOM   7160  C  C     . GLN A 1 990  ? 55.757  -3.322  146.257 1.00 40.10  ? 989  GLN A C     1 
ATOM   7161  O  O     . GLN A 1 990  ? 55.709  -4.543  146.090 1.00 38.83  ? 989  GLN A O     1 
ATOM   7162  C  CB    . GLN A 1 990  ? 56.950  -2.102  148.084 1.00 50.26  ? 989  GLN A CB    1 
ATOM   7163  C  CG    . GLN A 1 990  ? 56.794  -0.944  149.029 1.00 54.55  ? 989  GLN A CG    1 
ATOM   7164  C  CD    . GLN A 1 990  ? 58.101  -0.513  149.612 1.00 58.60  ? 989  GLN A CD    1 
ATOM   7165  O  OE1   . GLN A 1 990  ? 59.113  -0.451  148.912 1.00 64.49  ? 989  GLN A OE1   1 
ATOM   7166  N  NE2   . GLN A 1 990  ? 58.102  -0.221  150.904 1.00 60.88  ? 989  GLN A NE2   1 
ATOM   7167  N  N     . PHE A 1 991  ? 55.934  -2.452  145.264 1.00 35.33  ? 990  PHE A N     1 
ATOM   7168  C  CA    . PHE A 1 991  ? 56.237  -2.890  143.908 1.00 35.92  ? 990  PHE A CA    1 
ATOM   7169  C  C     . PHE A 1 991  ? 57.717  -3.236  143.814 1.00 38.95  ? 990  PHE A C     1 
ATOM   7170  O  O     . PHE A 1 991  ? 58.578  -2.445  144.213 1.00 38.84  ? 990  PHE A O     1 
ATOM   7171  C  CB    . PHE A 1 991  ? 55.875  -1.804  142.893 1.00 34.87  ? 990  PHE A CB    1 
ATOM   7172  C  CG    . PHE A 1 991  ? 54.422  -1.417  142.907 1.00 34.24  ? 990  PHE A CG    1 
ATOM   7173  C  CD1   . PHE A 1 991  ? 53.953  -0.464  143.799 1.00 33.31  ? 990  PHE A CD1   1 
ATOM   7174  C  CD2   . PHE A 1 991  ? 53.524  -1.998  142.021 1.00 34.71  ? 990  PHE A CD2   1 
ATOM   7175  C  CE1   . PHE A 1 991  ? 52.619  -0.107  143.815 1.00 32.88  ? 990  PHE A CE1   1 
ATOM   7176  C  CE2   . PHE A 1 991  ? 52.190  -1.649  142.030 1.00 34.26  ? 990  PHE A CE2   1 
ATOM   7177  C  CZ    . PHE A 1 991  ? 51.733  -0.703  142.929 1.00 33.36  ? 990  PHE A CZ    1 
ATOM   7178  N  N     . GLU A 1 992  ? 58.012  -4.425  143.304 1.00 45.54  ? 991  GLU A N     1 
ATOM   7179  C  CA    . GLU A 1 992  ? 59.392  -4.883  143.251 1.00 50.94  ? 991  GLU A CA    1 
ATOM   7180  C  C     . GLU A 1 992  ? 60.135  -4.190  142.117 1.00 52.60  ? 991  GLU A C     1 
ATOM   7181  O  O     . GLU A 1 992  ? 59.584  -3.966  141.041 1.00 54.75  ? 991  GLU A O     1 
ATOM   7182  C  CB    . GLU A 1 992  ? 59.423  -6.397  143.068 1.00 53.93  ? 991  GLU A CB    1 
ATOM   7183  C  CG    . GLU A 1 992  ? 60.764  -7.054  143.288 1.00 53.99  ? 991  GLU A CG    1 
ATOM   7184  C  CD    . GLU A 1 992  ? 60.636  -8.562  143.419 1.00 54.29  ? 991  GLU A CD    1 
ATOM   7185  O  OE1   . GLU A 1 992  ? 61.430  -9.168  144.177 1.00 55.62  ? 991  GLU A OE1   1 
ATOM   7186  O  OE2   . GLU A 1 992  ? 59.731  -9.139  142.777 1.00 53.92  ? 991  GLU A OE2   1 
ATOM   7187  N  N     . LYS A 1 993  ? 61.345  -3.759  142.364 1.00 55.96  ? 992  LYS A N     1 
ATOM   7188  C  CA    . LYS A 1 993  ? 62.072  -3.098  141.330 1.00 56.75  ? 992  LYS A CA    1 
ATOM   7189  C  C     . LYS A 1 993  ? 62.310  -4.200  140.335 1.00 59.97  ? 992  LYS A C     1 
ATOM   7190  O  O     . LYS A 1 993  ? 62.463  -5.328  140.725 1.00 58.63  ? 992  LYS A O     1 
ATOM   7191  C  CB    . LYS A 1 993  ? 63.372  -2.571  141.893 1.00 60.28  ? 992  LYS A CB    1 
ATOM   7192  C  CG    . LYS A 1 993  ? 64.195  -1.751  140.940 1.00 62.49  ? 992  LYS A CG    1 
ATOM   7193  C  CD    . LYS A 1 993  ? 64.128  -0.291  141.294 1.00 62.15  ? 992  LYS A CD    1 
ATOM   7194  C  CE    . LYS A 1 993  ? 64.142  0.590   140.058 1.00 64.00  ? 992  LYS A CE    1 
ATOM   7195  N  NZ    . LYS A 1 993  ? 63.373  1.848   140.275 1.00 63.85  ? 992  LYS A NZ    1 
ATOM   7196  N  N     . GLY A 1 994  ? 62.322  -3.900  139.052 1.00 53.00  ? 993  GLY A N     1 
ATOM   7197  C  CA    . GLY A 1 994  ? 62.545  -4.925  138.059 1.00 58.10  ? 993  GLY A CA    1 
ATOM   7198  C  C     . GLY A 1 994  ? 61.325  -5.731  137.695 1.00 56.38  ? 993  GLY A C     1 
ATOM   7199  O  O     . GLY A 1 994  ? 60.928  -5.738  136.563 1.00 56.06  ? 993  GLY A O     1 
ATOM   7200  N  N     . THR A 1 995  ? 60.722  -6.409  138.652 1.00 73.26  ? 994  THR A N     1 
ATOM   7201  C  CA    . THR A 1 995  ? 59.527  -7.198  138.376 1.00 77.00  ? 994  THR A CA    1 
ATOM   7202  C  C     . THR A 1 995  ? 58.273  -6.354  138.165 1.00 75.13  ? 994  THR A C     1 
ATOM   7203  O  O     . THR A 1 995  ? 57.552  -6.544  137.214 1.00 79.87  ? 994  THR A O     1 
ATOM   7204  C  CB    . THR A 1 995  ? 59.277  -8.266  139.471 1.00 79.31  ? 994  THR A CB    1 
ATOM   7205  O  OG1   . THR A 1 995  ? 60.503  -8.743  140.055 1.00 81.99  ? 994  THR A OG1   1 
ATOM   7206  C  CG2   . THR A 1 995  ? 58.515  -9.450  138.928 1.00 82.65  ? 994  THR A CG2   1 
ATOM   7207  N  N     . GLY A 1 996  ? 58.002  -5.448  139.083 1.00 64.72  ? 995  GLY A N     1 
ATOM   7208  C  CA    . GLY A 1 996  ? 56.819  -4.638  139.003 1.00 55.21  ? 995  GLY A CA    1 
ATOM   7209  C  C     . GLY A 1 996  ? 55.706  -5.280  139.778 1.00 39.45  ? 995  GLY A C     1 
ATOM   7210  O  O     . GLY A 1 996  ? 54.603  -4.833  139.745 1.00 37.70  ? 995  GLY A O     1 
ATOM   7211  N  N     . THR A 1 997  ? 56.018  -6.343  140.481 1.00 41.04  ? 996  THR A N     1 
ATOM   7212  C  CA    . THR A 1 997  ? 55.076  -7.091  141.253 1.00 39.70  ? 996  THR A CA    1 
ATOM   7213  C  C     . THR A 1 997  ? 54.896  -6.439  142.577 1.00 38.33  ? 996  THR A C     1 
ATOM   7214  O  O     . THR A 1 997  ? 55.821  -5.945  143.130 1.00 37.95  ? 996  THR A O     1 
ATOM   7215  C  CB    . THR A 1 997  ? 55.675  -8.464  141.496 1.00 44.30  ? 996  THR A CB    1 
ATOM   7216  O  OG1   . THR A 1 997  ? 55.510  -9.238  140.317 1.00 45.16  ? 996  THR A OG1   1 
ATOM   7217  C  CG2   . THR A 1 997  ? 55.028  -9.143  142.650 1.00 46.30  ? 996  THR A CG2   1 
ATOM   7218  N  N     . TYR A 1 998  ? 53.685  -6.454  143.071 1.00 37.90  ? 997  TYR A N     1 
ATOM   7219  C  CA    . TYR A 1 998  ? 53.374  -5.887  144.333 1.00 37.00  ? 997  TYR A CA    1 
ATOM   7220  C  C     . TYR A 1 998  ? 53.420  -7.069  145.247 1.00 37.78  ? 997  TYR A C     1 
ATOM   7221  O  O     . TYR A 1 998  ? 52.640  -7.948  145.111 1.00 38.49  ? 997  TYR A O     1 
ATOM   7222  C  CB    . TYR A 1 998  ? 51.999  -5.268  144.265 1.00 36.26  ? 997  TYR A CB    1 
ATOM   7223  C  CG    . TYR A 1 998  ? 51.675  -4.400  145.435 1.00 35.24  ? 997  TYR A CG    1 
ATOM   7224  C  CD1   . TYR A 1 998  ? 52.169  -3.132  145.531 1.00 34.32  ? 997  TYR A CD1   1 
ATOM   7225  C  CD2   . TYR A 1 998  ? 50.878  -4.856  146.425 1.00 35.33  ? 997  TYR A CD2   1 
ATOM   7226  C  CE1   . TYR A 1 998  ? 51.879  -2.347  146.583 1.00 33.52  ? 997  TYR A CE1   1 
ATOM   7227  C  CE2   . TYR A 1 998  ? 50.585  -4.083  147.486 1.00 34.76  ? 997  TYR A CE2   1 
ATOM   7228  C  CZ    . TYR A 1 998  ? 51.087  -2.829  147.554 1.00 35.12  ? 997  TYR A CZ    1 
ATOM   7229  O  OH    . TYR A 1 998  ? 50.788  -2.092  148.641 1.00 39.88  ? 997  TYR A OH    1 
ATOM   7230  N  N     . LYS A 1 999  ? 54.353  -7.083  146.177 1.00 37.76  ? 998  LYS A N     1 
ATOM   7231  C  CA    . LYS A 1 999  ? 54.589  -8.235  147.031 1.00 38.73  ? 998  LYS A CA    1 
ATOM   7232  C  C     . LYS A 1 999  ? 55.329  -7.815  148.293 1.00 38.28  ? 998  LYS A C     1 
ATOM   7233  O  O     . LYS A 1 999  ? 55.761  -6.670  148.449 1.00 39.02  ? 998  LYS A O     1 
ATOM   7234  C  CB    . LYS A 1 999  ? 55.391  -9.304  146.289 1.00 40.15  ? 998  LYS A CB    1 
ATOM   7235  C  CG    . LYS A 1 999  ? 56.634  -8.761  145.623 1.00 41.24  ? 998  LYS A CG    1 
ATOM   7236  C  CD    . LYS A 1 999  ? 57.833  -9.627  145.891 1.00 42.29  ? 998  LYS A CD    1 
ATOM   7237  C  CE    . LYS A 1 999  ? 57.663  -11.001 145.299 1.00 44.21  ? 998  LYS A CE    1 
ATOM   7238  N  NZ    . LYS A 1 999  ? 58.907  -11.791 145.488 1.00 48.23  ? 998  LYS A NZ    1 
ATOM   7239  N  N     . ILE A 1 1000 ? 55.462  -8.773  149.197 1.00 39.12  ? 999  ILE A N     1 
ATOM   7240  C  CA    . ILE A 1 1000 ? 56.455  -8.730  150.256 1.00 39.21  ? 999  ILE A CA    1 
ATOM   7241  C  C     . ILE A 1 1000 ? 57.327  -9.960  150.081 1.00 40.78  ? 999  ILE A C     1 
ATOM   7242  O  O     . ILE A 1 1000 ? 56.843  -11.008 149.644 1.00 41.83  ? 999  ILE A O     1 
ATOM   7243  C  CB    . ILE A 1 1000 ? 55.801  -8.682  151.652 1.00 38.86  ? 999  ILE A CB    1 
ATOM   7244  C  CG1   . ILE A 1 1000 ? 56.864  -8.535  152.749 1.00 38.94  ? 999  ILE A CG1   1 
ATOM   7245  C  CG2   . ILE A 1 1000 ? 54.948  -9.896  151.877 1.00 39.90  ? 999  ILE A CG2   1 
ATOM   7246  C  CD1   . ILE A 1 1000 ? 56.295  -8.399  154.132 1.00 38.61  ? 999  ILE A CD1   1 
ATOM   7247  N  N     . SER A 1 1001 ? 58.615  -9.824  150.354 1.00 42.95  ? 1000 SER A N     1 
ATOM   7248  C  CA    . SER A 1 1001 ? 59.516  -10.952 150.197 1.00 45.10  ? 1000 SER A CA    1 
ATOM   7249  C  C     . SER A 1 1001 ? 59.666  -11.714 151.509 1.00 46.54  ? 1000 SER A C     1 
ATOM   7250  O  O     . SER A 1 1001 ? 59.329  -11.220 152.588 1.00 45.60  ? 1000 SER A O     1 
ATOM   7251  C  CB    . SER A 1 1001 ? 60.881  -10.485 149.702 1.00 43.25  ? 1000 SER A CB    1 
ATOM   7252  O  OG    . SER A 1 1001 ? 61.479  -9.598  150.625 1.00 42.05  ? 1000 SER A OG    1 
ATOM   7253  N  N     . GLN A 1 1002 ? 60.186  -12.940 151.400 1.00 54.55  ? 1001 GLN A N     1 
ATOM   7254  C  CA    . GLN A 1 1002 ? 60.390  -13.770 152.584 1.00 56.84  ? 1001 GLN A CA    1 
ATOM   7255  C  C     . GLN A 1 1002 ? 61.356  -13.116 153.558 1.00 57.93  ? 1001 GLN A C     1 
ATOM   7256  O  O     . GLN A 1 1002 ? 61.143  -13.162 154.774 1.00 58.49  ? 1001 GLN A O     1 
ATOM   7257  C  CB    . GLN A 1 1002 ? 60.905  -15.153 152.183 1.00 61.53  ? 1001 GLN A CB    1 
ATOM   7258  C  CG    . GLN A 1 1002 ? 59.821  -16.161 151.848 1.00 62.99  ? 1001 GLN A CG    1 
ATOM   7259  C  CD    . GLN A 1 1002 ? 59.088  -16.651 153.070 1.00 61.52  ? 1001 GLN A CD    1 
ATOM   7260  O  OE1   . GLN A 1 1002 ? 59.569  -16.512 154.192 1.00 60.72  ? 1001 GLN A OE1   1 
ATOM   7261  N  NE2   . GLN A 1 1002 ? 57.912  -17.223 152.862 1.00 61.66  ? 1001 GLN A NE2   1 
ATOM   7262  N  N     . GLU A 1 1003 ? 62.429  -12.511 153.044 1.00 57.35  ? 1002 GLU A N     1 
ATOM   7263  C  CA    . GLU A 1 1003 ? 63.438  -11.939 153.924 1.00 61.13  ? 1002 GLU A CA    1 
ATOM   7264  C  C     . GLU A 1 1003 ? 62.848  -10.823 154.764 1.00 55.48  ? 1002 GLU A C     1 
ATOM   7265  O  O     . GLU A 1 1003 ? 63.091  -10.751 155.973 1.00 56.00  ? 1002 GLU A O     1 
ATOM   7266  C  CB    . GLU A 1 1003 ? 64.631  -11.430 153.117 1.00 67.60  ? 1002 GLU A CB    1 
ATOM   7267  C  CG    . GLU A 1 1003 ? 65.276  -12.477 152.224 1.00 73.69  ? 1002 GLU A CG    1 
ATOM   7268  C  CD    . GLU A 1 1003 ? 64.558  -12.644 150.900 1.00 76.46  ? 1002 GLU A CD    1 
ATOM   7269  O  OE1   . GLU A 1 1003 ? 63.338  -12.914 150.905 1.00 78.94  ? 1002 GLU A OE1   1 
ATOM   7270  O  OE2   . GLU A 1 1003 ? 65.215  -12.493 149.851 1.00 80.20  ? 1002 GLU A OE2   1 
ATOM   7271  N  N     . LYS A 1 1004 ? 62.046  -9.956  154.148 1.00 51.71  ? 1003 LYS A N     1 
ATOM   7272  C  CA    . LYS A 1 1004 ? 61.378  -8.921  154.922 1.00 48.79  ? 1003 LYS A CA    1 
ATOM   7273  C  C     . LYS A 1 1004 ? 60.316  -9.521  155.830 1.00 46.81  ? 1003 LYS A C     1 
ATOM   7274  O  O     . LYS A 1 1004 ? 60.173  -9.106  156.983 1.00 47.28  ? 1003 LYS A O     1 
ATOM   7275  C  CB    . LYS A 1 1004 ? 60.764  -7.881  153.994 1.00 50.44  ? 1003 LYS A CB    1 
ATOM   7276  C  CG    . LYS A 1 1004 ? 60.052  -6.798  154.749 1.00 53.22  ? 1003 LYS A CG    1 
ATOM   7277  C  CD    . LYS A 1 1004 ? 59.522  -5.719  153.843 1.00 54.42  ? 1003 LYS A CD    1 
ATOM   7278  C  CE    . LYS A 1 1004 ? 59.054  -4.538  154.673 1.00 54.14  ? 1003 LYS A CE    1 
ATOM   7279  N  NZ    . LYS A 1 1004 ? 58.801  -3.334  153.840 1.00 55.38  ? 1003 LYS A NZ    1 
ATOM   7280  N  N     . TYR A 1 1005 ? 59.563  -10.497 155.323 1.00 41.88  ? 1004 TYR A N     1 
ATOM   7281  C  CA    . TYR A 1 1005 ? 58.605  -11.201 156.163 1.00 42.33  ? 1004 TYR A CA    1 
ATOM   7282  C  C     . TYR A 1 1005 ? 59.302  -11.876 157.334 1.00 43.43  ? 1004 TYR A C     1 
ATOM   7283  O  O     . TYR A 1 1005 ? 58.781  -11.888 158.451 1.00 43.34  ? 1004 TYR A O     1 
ATOM   7284  C  CB    . TYR A 1 1005 ? 57.835  -12.228 155.333 1.00 43.24  ? 1004 TYR A CB    1 
ATOM   7285  C  CG    . TYR A 1 1005 ? 56.746  -12.926 156.105 1.00 43.78  ? 1004 TYR A CG    1 
ATOM   7286  C  CD1   . TYR A 1 1005 ? 55.467  -12.406 156.157 1.00 42.84  ? 1004 TYR A CD1   1 
ATOM   7287  C  CD2   . TYR A 1 1005 ? 57.001  -14.095 156.794 1.00 45.36  ? 1004 TYR A CD2   1 
ATOM   7288  C  CE1   . TYR A 1 1005 ? 54.474  -13.039 156.873 1.00 43.46  ? 1004 TYR A CE1   1 
ATOM   7289  C  CE2   . TYR A 1 1005 ? 56.021  -14.729 157.507 1.00 45.98  ? 1004 TYR A CE2   1 
ATOM   7290  C  CZ    . TYR A 1 1005 ? 54.762  -14.205 157.547 1.00 45.03  ? 1004 TYR A CZ    1 
ATOM   7291  O  OH    . TYR A 1 1005 ? 53.787  -14.857 158.263 1.00 45.80  ? 1004 TYR A OH    1 
ATOM   7292  N  N     . ASN A 1 1006 ? 60.479  -12.450 157.098 1.00 48.90  ? 1005 ASN A N     1 
ATOM   7293  C  CA    . ASN A 1 1006 ? 61.214  -13.063 158.194 1.00 49.85  ? 1005 ASN A CA    1 
ATOM   7294  C  C     . ASN A 1 1006 ? 61.757  -12.017 159.159 1.00 50.37  ? 1005 ASN A C     1 
ATOM   7295  O  O     . ASN A 1 1006 ? 61.893  -12.298 160.353 1.00 52.08  ? 1005 ASN A O     1 
ATOM   7296  C  CB    . ASN A 1 1006 ? 62.346  -13.930 157.652 1.00 50.75  ? 1005 ASN A CB    1 
ATOM   7297  C  CG    . ASN A 1 1006 ? 61.845  -15.176 156.941 1.00 50.97  ? 1005 ASN A CG    1 
ATOM   7298  O  OD1   . ASN A 1 1006 ? 60.760  -15.682 157.225 1.00 50.00  ? 1005 ASN A OD1   1 
ATOM   7299  N  ND2   . ASN A 1 1006 ? 62.646  -15.680 156.015 1.00 52.21  ? 1005 ASN A ND2   1 
ATOM   7300  N  N     . ASP A 1 1007 ? 62.065  -10.812 158.670 1.00 48.82  ? 1006 ASP A N     1 
ATOM   7301  C  CA    . ASP A 1 1007 ? 62.491  -9.745  159.569 1.00 49.34  ? 1006 ASP A CA    1 
ATOM   7302  C  C     . ASP A 1 1007 ? 61.334  -9.257  160.425 1.00 45.65  ? 1006 ASP A C     1 
ATOM   7303  O  O     . ASP A 1 1007 ? 61.505  -9.001  161.621 1.00 47.38  ? 1006 ASP A O     1 
ATOM   7304  C  CB    . ASP A 1 1007 ? 63.080  -8.580  158.779 1.00 50.27  ? 1006 ASP A CB    1 
ATOM   7305  C  CG    . ASP A 1 1007 ? 64.335  -8.958  158.020 1.00 54.28  ? 1006 ASP A CG    1 
ATOM   7306  O  OD1   . ASP A 1 1007 ? 64.936  -10.011 158.329 1.00 57.26  ? 1006 ASP A OD1   1 
ATOM   7307  O  OD2   . ASP A 1 1007 ? 64.728  -8.187  157.114 1.00 55.85  ? 1006 ASP A OD2   1 
ATOM   7308  N  N     . ILE A 1 1008 ? 60.155  -9.101  159.824 1.00 44.94  ? 1007 ILE A N     1 
ATOM   7309  C  CA    . ILE A 1 1008 ? 58.973  -8.740  160.597 1.00 42.22  ? 1007 ILE A CA    1 
ATOM   7310  C  C     . ILE A 1 1008 ? 58.643  -9.848  161.577 1.00 44.67  ? 1007 ILE A C     1 
ATOM   7311  O  O     . ILE A 1 1008 ? 58.311  -9.597  162.741 1.00 47.86  ? 1007 ILE A O     1 
ATOM   7312  C  CB    . ILE A 1 1008 ? 57.790  -8.454  159.658 1.00 41.66  ? 1007 ILE A CB    1 
ATOM   7313  C  CG1   . ILE A 1 1008 ? 58.101  -7.259  158.767 1.00 41.53  ? 1007 ILE A CG1   1 
ATOM   7314  C  CG2   . ILE A 1 1008 ? 56.517  -8.238  160.448 1.00 40.69  ? 1007 ILE A CG2   1 
ATOM   7315  C  CD1   . ILE A 1 1008 ? 57.030  -6.981  157.760 1.00 41.18  ? 1007 ILE A CD1   1 
ATOM   7316  N  N     . LYS A 1 1009 ? 58.730  -11.091 161.116 1.00 45.13  ? 1008 LYS A N     1 
ATOM   7317  C  CA    . LYS A 1 1009 ? 58.515  -12.232 161.991 1.00 45.81  ? 1008 LYS A CA    1 
ATOM   7318  C  C     . LYS A 1 1009 ? 59.406  -12.148 163.220 1.00 46.37  ? 1008 LYS A C     1 
ATOM   7319  O  O     . LYS A 1 1009 ? 58.965  -12.435 164.336 1.00 45.12  ? 1008 LYS A O     1 
ATOM   7320  C  CB    . LYS A 1 1009 ? 58.777  -13.518 161.210 1.00 45.98  ? 1008 LYS A CB    1 
ATOM   7321  C  CG    . LYS A 1 1009 ? 58.304  -14.778 161.877 1.00 47.30  ? 1008 LYS A CG    1 
ATOM   7322  C  CD    . LYS A 1 1009 ? 58.557  -15.967 160.975 1.00 48.82  ? 1008 LYS A CD    1 
ATOM   7323  C  CE    . LYS A 1 1009 ? 58.189  -17.261 161.657 1.00 50.66  ? 1008 LYS A CE    1 
ATOM   7324  N  NZ    . LYS A 1 1009 ? 58.511  -18.416 160.790 1.00 52.31  ? 1008 LYS A NZ    1 
ATOM   7325  N  N     . LYS A 1 1010 ? 60.656  -11.726 163.037 1.00 47.79  ? 1009 LYS A N     1 
ATOM   7326  C  CA    . LYS A 1 1010 ? 61.571  -11.615 164.162 1.00 51.01  ? 1009 LYS A CA    1 
ATOM   7327  C  C     . LYS A 1 1010 ? 61.211  -10.434 165.051 1.00 51.01  ? 1009 LYS A C     1 
ATOM   7328  O  O     . LYS A 1 1010 ? 61.011  -10.594 166.260 1.00 51.80  ? 1009 LYS A O     1 
ATOM   7329  C  CB    . LYS A 1 1010 ? 63.009  -11.499 163.660 1.00 52.79  ? 1009 LYS A CB    1 
ATOM   7330  C  CG    . LYS A 1 1010 ? 63.668  -12.843 163.393 1.00 56.96  ? 1009 LYS A CG    1 
ATOM   7331  C  CD    . LYS A 1 1010 ? 65.073  -12.895 163.967 1.00 59.47  ? 1009 LYS A CD    1 
ATOM   7332  C  CE    . LYS A 1 1010 ? 65.534  -14.334 164.186 1.00 62.41  ? 1009 LYS A CE    1 
ATOM   7333  N  NZ    . LYS A 1 1010 ? 65.741  -15.088 162.917 1.00 63.00  ? 1009 LYS A NZ    1 
ATOM   7334  N  N     . LYS A 1 1011 ? 61.115  -9.239  164.473 1.00 55.40  ? 1010 LYS A N     1 
ATOM   7335  C  CA    . LYS A 1 1011 ? 60.909  -8.060  165.302 1.00 57.56  ? 1010 LYS A CA    1 
ATOM   7336  C  C     . LYS A 1 1011 ? 59.569  -8.066  166.019 1.00 57.41  ? 1010 LYS A C     1 
ATOM   7337  O  O     . LYS A 1 1011 ? 59.384  -7.276  166.947 1.00 57.09  ? 1010 LYS A O     1 
ATOM   7338  C  CB    . LYS A 1 1011 ? 61.041  -6.789  164.471 1.00 61.22  ? 1010 LYS A CB    1 
ATOM   7339  C  CG    . LYS A 1 1011 ? 59.860  -6.504  163.583 1.00 64.01  ? 1010 LYS A CG    1 
ATOM   7340  C  CD    . LYS A 1 1011 ? 59.755  -5.015  163.305 1.00 64.53  ? 1010 LYS A CD    1 
ATOM   7341  C  CE    . LYS A 1 1011 ? 61.102  -4.427  162.915 1.00 66.54  ? 1010 LYS A CE    1 
ATOM   7342  N  NZ    . LYS A 1 1011 ? 61.667  -5.062  161.694 1.00 68.60  ? 1010 LYS A NZ    1 
ATOM   7343  N  N     . GLU A 1 1012 ? 58.645  -8.939  165.637 1.00 49.44  ? 1011 GLU A N     1 
ATOM   7344  C  CA    . GLU A 1 1012 ? 57.376  -9.056  166.332 1.00 49.30  ? 1011 GLU A CA    1 
ATOM   7345  C  C     . GLU A 1 1012 ? 57.375  -10.164 167.373 1.00 47.05  ? 1011 GLU A C     1 
ATOM   7346  O  O     . GLU A 1 1012 ? 56.344  -10.408 168.003 1.00 48.51  ? 1011 GLU A O     1 
ATOM   7347  C  CB    . GLU A 1 1012 ? 56.246  -9.285  165.332 1.00 48.91  ? 1011 GLU A CB    1 
ATOM   7348  C  CG    . GLU A 1 1012 ? 54.904  -8.891  165.879 1.00 49.18  ? 1011 GLU A CG    1 
ATOM   7349  C  CD    . GLU A 1 1012 ? 54.510  -7.522  165.424 1.00 48.67  ? 1011 GLU A CD    1 
ATOM   7350  O  OE1   . GLU A 1 1012 ? 53.846  -7.420  164.377 1.00 49.98  ? 1011 GLU A OE1   1 
ATOM   7351  O  OE2   . GLU A 1 1012 ? 54.836  -6.546  166.131 1.00 49.78  ? 1011 GLU A OE2   1 
ATOM   7352  N  N     . GLY A 1 1013 ? 58.501  -10.834 167.574 1.00 55.59  ? 1012 GLY A N     1 
ATOM   7353  C  CA    . GLY A 1 1013 ? 58.601  -11.839 168.610 1.00 54.69  ? 1012 GLY A CA    1 
ATOM   7354  C  C     . GLY A 1 1013 ? 58.067  -13.200 168.245 1.00 56.90  ? 1012 GLY A C     1 
ATOM   7355  O  O     . GLY A 1 1013 ? 57.761  -13.984 169.147 1.00 59.61  ? 1012 GLY A O     1 
ATOM   7356  N  N     . VAL A 1 1014 ? 57.937  -13.503 166.957 1.00 51.48  ? 1013 VAL A N     1 
ATOM   7357  C  CA    . VAL A 1 1014 ? 57.555  -14.831 166.495 1.00 52.77  ? 1013 VAL A CA    1 
ATOM   7358  C  C     . VAL A 1 1014 ? 58.826  -15.656 166.331 1.00 49.80  ? 1013 VAL A C     1 
ATOM   7359  O  O     . VAL A 1 1014 ? 59.727  -15.281 165.571 1.00 49.36  ? 1013 VAL A O     1 
ATOM   7360  C  CB    . VAL A 1 1014 ? 56.768  -14.756 165.177 1.00 47.68  ? 1013 VAL A CB    1 
ATOM   7361  C  CG1   . VAL A 1 1014 ? 56.393  -16.140 164.698 1.00 49.33  ? 1013 VAL A CG1   1 
ATOM   7362  C  CG2   . VAL A 1 1014 ? 55.523  -13.909 165.348 1.00 46.39  ? 1013 VAL A CG2   1 
ATOM   7363  N  N     . ASP A 1 1015 ? 58.904  -16.774 167.047 1.00 54.95  ? 1014 ASP A N     1 
ATOM   7364  C  CA    . ASP A 1 1015 ? 60.086  -17.622 166.985 1.00 56.25  ? 1014 ASP A CA    1 
ATOM   7365  C  C     . ASP A 1 1015 ? 60.200  -18.264 165.609 1.00 57.64  ? 1014 ASP A C     1 
ATOM   7366  O  O     . ASP A 1 1015 ? 59.211  -18.738 165.046 1.00 57.92  ? 1014 ASP A O     1 
ATOM   7367  C  CB    . ASP A 1 1015 ? 60.021  -18.696 168.074 1.00 60.72  ? 1014 ASP A CB    1 
ATOM   7368  C  CG    . ASP A 1 1015 ? 61.358  -19.377 168.314 1.00 63.85  ? 1014 ASP A CG    1 
ATOM   7369  O  OD1   . ASP A 1 1015 ? 61.640  -20.394 167.648 1.00 65.03  ? 1014 ASP A OD1   1 
ATOM   7370  O  OD2   . ASP A 1 1015 ? 62.121  -18.900 169.180 1.00 65.16  ? 1014 ASP A OD2   1 
ATOM   7371  N  N     . SER A 1 1016 ? 61.417  -18.276 165.059 1.00 56.59  ? 1015 SER A N     1 
ATOM   7372  C  CA    . SER A 1 1016 ? 61.611  -18.847 163.731 1.00 56.67  ? 1015 SER A CA    1 
ATOM   7373  C  C     . SER A 1 1016 ? 61.191  -20.312 163.666 1.00 56.88  ? 1015 SER A C     1 
ATOM   7374  O  O     . SER A 1 1016 ? 60.896  -20.809 162.574 1.00 57.32  ? 1015 SER A O     1 
ATOM   7375  C  CB    . SER A 1 1016 ? 63.070  -18.682 163.296 1.00 55.34  ? 1015 SER A CB    1 
ATOM   7376  O  OG    . SER A 1 1016 ? 63.963  -19.292 164.210 1.00 56.77  ? 1015 SER A OG    1 
ATOM   7377  N  N     . ASP A 1 1017 ? 61.143  -21.001 164.807 1.00 61.05  ? 1016 ASP A N     1 
ATOM   7378  C  CA    . ASP A 1 1017 ? 60.652  -22.374 164.921 1.00 64.13  ? 1016 ASP A CA    1 
ATOM   7379  C  C     . ASP A 1 1017 ? 59.321  -22.339 165.671 1.00 64.62  ? 1016 ASP A C     1 
ATOM   7380  O  O     . ASP A 1 1017 ? 59.250  -22.622 166.869 1.00 65.93  ? 1016 ASP A O     1 
ATOM   7381  C  CB    . ASP A 1 1017 ? 61.669  -23.272 165.646 1.00 67.31  ? 1016 ASP A CB    1 
ATOM   7382  C  CG    . ASP A 1 1017 ? 62.979  -23.398 164.904 1.00 67.66  ? 1016 ASP A CG    1 
ATOM   7383  O  OD1   . ASP A 1 1017 ? 62.956  -23.478 163.662 1.00 67.50  ? 1016 ASP A OD1   1 
ATOM   7384  O  OD2   . ASP A 1 1017 ? 64.036  -23.434 165.569 1.00 67.89  ? 1016 ASP A OD2   1 
ATOM   7385  N  N     . SER A 1 1018 ? 58.258  -21.980 164.957 1.00 58.87  ? 1017 SER A N     1 
ATOM   7386  C  CA    . SER A 1 1018 ? 56.916  -21.981 165.519 1.00 61.53  ? 1017 SER A CA    1 
ATOM   7387  C  C     . SER A 1 1018 ? 55.929  -22.302 164.411 1.00 59.59  ? 1017 SER A C     1 
ATOM   7388  O  O     . SER A 1 1018 ? 56.151  -21.956 163.250 1.00 59.34  ? 1017 SER A O     1 
ATOM   7389  C  CB    . SER A 1 1018 ? 56.567  -20.646 166.175 1.00 56.58  ? 1017 SER A CB    1 
ATOM   7390  O  OG    . SER A 1 1018 ? 56.986  -20.621 167.528 1.00 57.11  ? 1017 SER A OG    1 
ATOM   7391  N  N     . GLU A 1 1019 ? 54.843  -22.979 164.773 1.00 71.39  ? 1018 GLU A N     1 
ATOM   7392  C  CA    . GLU A 1 1019 ? 53.940  -23.524 163.769 1.00 73.25  ? 1018 GLU A CA    1 
ATOM   7393  C  C     . GLU A 1 1019 ? 52.939  -22.469 163.322 1.00 69.82  ? 1018 GLU A C     1 
ATOM   7394  O  O     . GLU A 1 1019 ? 52.319  -21.794 164.148 1.00 67.88  ? 1018 GLU A O     1 
ATOM   7395  C  CB    . GLU A 1 1019 ? 53.208  -24.751 164.309 1.00 79.74  ? 1018 GLU A CB    1 
ATOM   7396  C  CG    . GLU A 1 1019 ? 52.363  -24.487 165.533 1.00 83.00  ? 1018 GLU A CG    1 
ATOM   7397  C  CD    . GLU A 1 1019 ? 51.480  -25.658 165.884 1.00 87.51  ? 1018 GLU A CD    1 
ATOM   7398  O  OE1   . GLU A 1 1019 ? 51.109  -25.776 167.064 1.00 89.95  ? 1018 GLU A OE1   1 
ATOM   7399  O  OE2   . GLU A 1 1019 ? 51.158  -26.459 164.984 1.00 90.21  ? 1018 GLU A OE2   1 
ATOM   7400  N  N     . PHE A 1 1020 ? 52.793  -22.321 162.010 1.00 61.87  ? 1019 PHE A N     1 
ATOM   7401  C  CA    . PHE A 1 1020 ? 51.775  -21.428 161.486 1.00 59.24  ? 1019 PHE A CA    1 
ATOM   7402  C  C     . PHE A 1 1020 ? 50.400  -22.042 161.691 1.00 60.08  ? 1019 PHE A C     1 
ATOM   7403  O  O     . PHE A 1 1020 ? 50.206  -23.249 161.515 1.00 62.23  ? 1019 PHE A O     1 
ATOM   7404  C  CB    . PHE A 1 1020 ? 52.008  -21.146 160.008 1.00 57.41  ? 1019 PHE A CB    1 
ATOM   7405  C  CG    . PHE A 1 1020 ? 50.916  -20.345 159.375 1.00 54.01  ? 1019 PHE A CG    1 
ATOM   7406  C  CD1   . PHE A 1 1020 ? 50.813  -18.987 159.608 1.00 51.63  ? 1019 PHE A CD1   1 
ATOM   7407  C  CD2   . PHE A 1 1020 ? 49.988  -20.949 158.545 1.00 54.53  ? 1019 PHE A CD2   1 
ATOM   7408  C  CE1   . PHE A 1 1020 ? 49.806  -18.251 159.029 1.00 50.44  ? 1019 PHE A CE1   1 
ATOM   7409  C  CE2   . PHE A 1 1020 ? 48.980  -20.216 157.963 1.00 53.30  ? 1019 PHE A CE2   1 
ATOM   7410  C  CZ    . PHE A 1 1020 ? 48.889  -18.867 158.204 1.00 51.27  ? 1019 PHE A CZ    1 
ATOM   7411  N  N     . LYS A 1 1021 ? 49.444  -21.204 162.072 1.00 56.38  ? 1020 LYS A N     1 
ATOM   7412  C  CA    . LYS A 1 1021 ? 48.110  -21.667 162.411 1.00 56.65  ? 1020 LYS A CA    1 
ATOM   7413  C  C     . LYS A 1 1021 ? 47.064  -21.120 161.453 1.00 55.64  ? 1020 LYS A C     1 
ATOM   7414  O  O     . LYS A 1 1021 ? 46.370  -21.897 160.798 1.00 56.87  ? 1020 LYS A O     1 
ATOM   7415  C  CB    . LYS A 1 1021 ? 47.785  -21.281 163.853 1.00 56.48  ? 1020 LYS A CB    1 
ATOM   7416  C  CG    . LYS A 1 1021 ? 48.763  -21.855 164.858 1.00 57.63  ? 1020 LYS A CG    1 
ATOM   7417  C  CD    . LYS A 1 1021 ? 48.363  -23.249 165.312 1.00 60.20  ? 1020 LYS A CD    1 
ATOM   7418  C  CE    . LYS A 1 1021 ? 47.032  -23.233 166.056 1.00 60.64  ? 1020 LYS A CE    1 
ATOM   7419  N  NZ    . LYS A 1 1021 ? 46.431  -24.595 166.196 1.00 63.20  ? 1020 LYS A NZ    1 
ATOM   7420  N  N     . PHE A 1 1022 ? 46.940  -19.803 161.345 1.00 53.55  ? 1021 PHE A N     1 
ATOM   7421  C  CA    . PHE A 1 1022 ? 46.033  -19.198 160.381 1.00 52.56  ? 1021 PHE A CA    1 
ATOM   7422  C  C     . PHE A 1 1022 ? 46.369  -17.722 160.259 1.00 50.28  ? 1021 PHE A C     1 
ATOM   7423  O  O     . PHE A 1 1022 ? 47.151  -17.171 161.035 1.00 49.54  ? 1021 PHE A O     1 
ATOM   7424  C  CB    . PHE A 1 1022 ? 44.562  -19.385 160.763 1.00 53.27  ? 1021 PHE A CB    1 
ATOM   7425  C  CG    . PHE A 1 1022 ? 44.303  -19.353 162.234 1.00 53.69  ? 1021 PHE A CG    1 
ATOM   7426  C  CD1   . PHE A 1 1022 ? 44.210  -18.155 162.908 1.00 52.13  ? 1021 PHE A CD1   1 
ATOM   7427  C  CD2   . PHE A 1 1022 ? 44.133  -20.529 162.942 1.00 55.78  ? 1021 PHE A CD2   1 
ATOM   7428  C  CE1   . PHE A 1 1022 ? 43.968  -18.130 164.270 1.00 52.62  ? 1021 PHE A CE1   1 
ATOM   7429  C  CE2   . PHE A 1 1022 ? 43.887  -20.510 164.293 1.00 56.27  ? 1021 PHE A CE2   1 
ATOM   7430  C  CZ    . PHE A 1 1022 ? 43.804  -19.308 164.958 1.00 54.67  ? 1021 PHE A CZ    1 
ATOM   7431  N  N     . THR A 1 1023 ? 45.770  -17.096 159.252 1.00 51.25  ? 1022 THR A N     1 
ATOM   7432  C  CA    . THR A 1 1023 ? 45.894  -15.671 158.993 1.00 49.04  ? 1022 THR A CA    1 
ATOM   7433  C  C     . THR A 1 1023 ? 44.527  -15.032 159.158 1.00 52.24  ? 1022 THR A C     1 
ATOM   7434  O  O     . THR A 1 1023 ? 43.542  -15.515 158.589 1.00 53.59  ? 1022 THR A O     1 
ATOM   7435  C  CB    . THR A 1 1023 ? 46.422  -15.407 157.585 1.00 46.57  ? 1022 THR A CB    1 
ATOM   7436  O  OG1   . THR A 1 1023 ? 47.795  -15.794 157.512 1.00 47.32  ? 1022 THR A OG1   1 
ATOM   7437  C  CG2   . THR A 1 1023 ? 46.307  -13.952 157.251 1.00 44.67  ? 1022 THR A CG2   1 
ATOM   7438  N  N     . LEU A 1 1024 ? 44.468  -13.956 159.933 1.00 47.16  ? 1023 LEU A N     1 
ATOM   7439  C  CA    . LEU A 1 1024 ? 43.226  -13.234 160.169 1.00 45.13  ? 1023 LEU A CA    1 
ATOM   7440  C  C     . LEU A 1 1024 ? 43.260  -11.915 159.411 1.00 43.40  ? 1023 LEU A C     1 
ATOM   7441  O  O     . LEU A 1 1024 ? 44.200  -11.127 159.568 1.00 42.26  ? 1023 LEU A O     1 
ATOM   7442  C  CB    . LEU A 1 1024 ? 43.010  -12.996 161.658 1.00 45.31  ? 1023 LEU A CB    1 
ATOM   7443  C  CG    . LEU A 1 1024 ? 42.917  -14.269 162.485 1.00 47.14  ? 1023 LEU A CG    1 
ATOM   7444  C  CD1   . LEU A 1 1024 ? 43.385  -13.986 163.904 1.00 47.08  ? 1023 LEU A CD1   1 
ATOM   7445  C  CD2   . LEU A 1 1024 ? 41.483  -14.794 162.466 1.00 48.36  ? 1023 LEU A CD2   1 
ATOM   7446  N  N     . TYR A 1 1025 ? 42.242  -11.689 158.585 1.00 43.33  ? 1024 TYR A N     1 
ATOM   7447  C  CA    . TYR A 1 1025 ? 42.013  -10.415 157.926 1.00 41.89  ? 1024 TYR A CA    1 
ATOM   7448  C  C     . TYR A 1 1025 ? 40.890  -9.676  158.636 1.00 41.72  ? 1024 TYR A C     1 
ATOM   7449  O  O     . TYR A 1 1025 ? 40.173  -10.234 159.465 1.00 42.81  ? 1024 TYR A O     1 
ATOM   7450  C  CB    . TYR A 1 1025 ? 41.663  -10.615 156.447 1.00 42.00  ? 1024 TYR A CB    1 
ATOM   7451  C  CG    . TYR A 1 1025 ? 42.757  -11.242 155.620 1.00 42.18  ? 1024 TYR A CG    1 
ATOM   7452  C  CD1   . TYR A 1 1025 ? 43.711  -10.463 154.996 1.00 40.97  ? 1024 TYR A CD1   1 
ATOM   7453  C  CD2   . TYR A 1 1025 ? 42.838  -12.615 155.469 1.00 43.70  ? 1024 TYR A CD2   1 
ATOM   7454  C  CE1   . TYR A 1 1025 ? 44.706  -11.027 154.250 1.00 41.26  ? 1024 TYR A CE1   1 
ATOM   7455  C  CE2   . TYR A 1 1025 ? 43.837  -13.188 154.721 1.00 44.01  ? 1024 TYR A CE2   1 
ATOM   7456  C  CZ    . TYR A 1 1025 ? 44.764  -12.388 154.113 1.00 42.78  ? 1024 TYR A CZ    1 
ATOM   7457  O  OH    . TYR A 1 1025 ? 45.764  -12.945 153.363 1.00 43.19  ? 1024 TYR A OH    1 
ATOM   7458  N  N     . LYS A 1 1026 ? 40.704  -8.425  158.295 1.00 40.46  ? 1025 LYS A N     1 
ATOM   7459  C  CA    . LYS A 1 1026 ? 39.688  -7.648  158.925 1.00 40.29  ? 1025 LYS A CA    1 
ATOM   7460  C  C     . LYS A 1 1026 ? 38.320  -8.252  158.722 1.00 41.55  ? 1025 LYS A C     1 
ATOM   7461  O  O     . LYS A 1 1026 ? 37.907  -8.528  157.626 1.00 41.77  ? 1025 LYS A O     1 
ATOM   7462  C  CB    . LYS A 1 1026 ? 39.724  -6.265  158.311 1.00 38.93  ? 1025 LYS A CB    1 
ATOM   7463  C  CG    . LYS A 1 1026 ? 38.507  -5.409  158.545 1.00 38.94  ? 1025 LYS A CG    1 
ATOM   7464  C  CD    . LYS A 1 1026 ? 38.805  -3.960  158.271 1.00 37.69  ? 1025 LYS A CD    1 
ATOM   7465  C  CE    . LYS A 1 1026 ? 37.549  -3.139  158.314 1.00 39.29  ? 1025 LYS A CE    1 
ATOM   7466  N  NZ    . LYS A 1 1026 ? 37.771  -1.756  157.854 1.00 39.00  ? 1025 LYS A NZ    1 
ATOM   7467  N  N     . ASN A 1 1027 ? 37.613  -8.407  159.823 1.00 42.45  ? 1026 ASN A N     1 
ATOM   7468  C  CA    . ASN A 1 1027 ? 36.287  -8.946  159.849 1.00 43.83  ? 1026 ASN A CA    1 
ATOM   7469  C  C     . ASN A 1 1027 ? 36.181  -10.461 159.868 1.00 45.36  ? 1026 ASN A C     1 
ATOM   7470  O  O     . ASN A 1 1027 ? 35.113  -10.993 159.827 1.00 46.66  ? 1026 ASN A O     1 
ATOM   7471  C  CB    . ASN A 1 1027 ? 35.431  -8.297  158.787 1.00 44.06  ? 1026 ASN A CB    1 
ATOM   7472  C  CG    . ASN A 1 1027 ? 34.886  -6.962  159.219 1.00 42.70  ? 1026 ASN A CG    1 
ATOM   7473  O  OD1   . ASN A 1 1027 ? 34.801  -6.666  160.378 1.00 43.17  ? 1026 ASN A OD1   1 
ATOM   7474  N  ND2   . ASN A 1 1027 ? 34.526  -6.153  158.274 1.00 42.39  ? 1026 ASN A ND2   1 
ATOM   7475  N  N     . ASP A 1 1028 ? 37.304  -11.145 159.960 1.00 45.39  ? 1027 ASP A N     1 
ATOM   7476  C  CA    . ASP A 1 1028 ? 37.334  -12.581 160.096 1.00 47.07  ? 1027 ASP A CA    1 
ATOM   7477  C  C     . ASP A 1 1028 ? 36.883  -12.712 161.535 1.00 47.90  ? 1027 ASP A C     1 
ATOM   7478  O  O     . ASP A 1 1028 ? 36.897  -11.760 162.257 1.00 47.03  ? 1027 ASP A O     1 
ATOM   7479  C  CB    . ASP A 1 1028 ? 38.741  -13.136 159.954 1.00 46.98  ? 1027 ASP A CB    1 
ATOM   7480  C  CG    . ASP A 1 1028 ? 38.964  -13.901 158.676 1.00 47.26  ? 1027 ASP A CG    1 
ATOM   7481  O  OD1   . ASP A 1 1028 ? 38.045  -14.513 158.137 1.00 48.33  ? 1027 ASP A OD1   1 
ATOM   7482  O  OD2   . ASP A 1 1028 ? 40.091  -13.915 158.201 1.00 46.52  ? 1027 ASP A OD2   1 
ATOM   7483  N  N     . LEU A 1 1029 ? 36.451  -13.884 161.949 1.00 49.72  ? 1028 LEU A N     1 
ATOM   7484  C  CA    . LEU A 1 1029 ? 35.979  -14.076 163.303 1.00 50.79  ? 1028 LEU A CA    1 
ATOM   7485  C  C     . LEU A 1 1029 ? 36.871  -15.005 164.110 1.00 52.69  ? 1028 LEU A C     1 
ATOM   7486  O  O     . LEU A 1 1029 ? 37.411  -15.916 163.584 1.00 55.26  ? 1028 LEU A O     1 
ATOM   7487  C  CB    . LEU A 1 1029 ? 34.573  -14.628 163.283 1.00 52.43  ? 1028 LEU A CB    1 
ATOM   7488  C  CG    . LEU A 1 1029 ? 33.492  -13.904 162.525 1.00 51.93  ? 1028 LEU A CG    1 
ATOM   7489  C  CD1   . LEU A 1 1029 ? 32.435  -14.924 162.210 1.00 53.81  ? 1028 LEU A CD1   1 
ATOM   7490  C  CD2   . LEU A 1 1029 ? 32.876  -12.796 163.328 1.00 51.37  ? 1028 LEU A CD2   1 
ATOM   7491  N  N     . LEU A 1 1030 ? 37.035  -14.730 165.394 1.00 53.91  ? 1029 LEU A N     1 
ATOM   7492  C  CA    . LEU A 1 1030 ? 37.849  -15.534 166.290 1.00 55.33  ? 1029 LEU A CA    1 
ATOM   7493  C  C     . LEU A 1 1030 ? 36.988  -16.213 167.333 1.00 55.01  ? 1029 LEU A C     1 
ATOM   7494  O  O     . LEU A 1 1030 ? 35.902  -15.746 167.677 1.00 54.77  ? 1029 LEU A O     1 
ATOM   7495  C  CB    . LEU A 1 1030 ? 38.875  -14.693 167.041 1.00 57.51  ? 1029 LEU A CB    1 
ATOM   7496  C  CG    . LEU A 1 1030 ? 40.134  -14.174 166.387 1.00 56.99  ? 1029 LEU A CG    1 
ATOM   7497  C  CD1   . LEU A 1 1030 ? 39.784  -13.015 165.482 1.00 58.45  ? 1029 LEU A CD1   1 
ATOM   7498  C  CD2   . LEU A 1 1030 ? 41.067  -13.751 167.499 1.00 55.90  ? 1029 LEU A CD2   1 
ATOM   7499  N  N     . LEU A 1 1031 ? 37.519  -17.303 167.871 1.00 57.70  ? 1030 LEU A N     1 
ATOM   7500  C  CA    . LEU A 1 1031 ? 37.013  -17.879 169.104 1.00 58.81  ? 1030 LEU A CA    1 
ATOM   7501  C  C     . LEU A 1 1031 ? 38.177  -17.942 170.075 1.00 57.57  ? 1030 LEU A C     1 
ATOM   7502  O  O     . LEU A 1 1031 ? 39.204  -18.559 169.779 1.00 58.80  ? 1030 LEU A O     1 
ATOM   7503  C  CB    . LEU A 1 1031 ? 36.407  -19.262 168.879 1.00 59.99  ? 1030 LEU A CB    1 
ATOM   7504  C  CG    . LEU A 1 1031 ? 35.556  -19.733 170.052 1.00 61.91  ? 1030 LEU A CG    1 
ATOM   7505  C  CD1   . LEU A 1 1031 ? 34.164  -19.132 169.970 1.00 61.99  ? 1030 LEU A CD1   1 
ATOM   7506  C  CD2   . LEU A 1 1031 ? 35.497  -21.246 170.085 1.00 64.33  ? 1030 LEU A CD2   1 
ATOM   7507  N  N     . VAL A 1 1032 ? 38.033  -17.276 171.209 1.00 57.34  ? 1031 VAL A N     1 
ATOM   7508  C  CA    . VAL A 1 1032 ? 39.058  -17.243 172.239 1.00 57.29  ? 1031 VAL A CA    1 
ATOM   7509  C  C     . VAL A 1 1032 ? 38.548  -18.082 173.401 1.00 59.50  ? 1031 VAL A C     1 
ATOM   7510  O  O     . VAL A 1 1032 ? 37.557  -17.722 174.043 1.00 60.02  ? 1031 VAL A O     1 
ATOM   7511  C  CB    . VAL A 1 1032 ? 39.366  -15.806 172.676 1.00 55.42  ? 1031 VAL A CB    1 
ATOM   7512  C  CG1   . VAL A 1 1032 ? 40.533  -15.775 173.647 1.00 55.34  ? 1031 VAL A CG1   1 
ATOM   7513  C  CG2   . VAL A 1 1032 ? 39.651  -14.950 171.466 1.00 53.43  ? 1031 VAL A CG2   1 
ATOM   7514  N  N     . LYS A 1 1033 ? 39.203  -19.207 173.668 1.00 60.94  ? 1032 LYS A N     1 
ATOM   7515  C  CA    . LYS A 1 1033 ? 38.823  -20.086 174.764 1.00 63.22  ? 1032 LYS A CA    1 
ATOM   7516  C  C     . LYS A 1 1033 ? 39.858  -20.030 175.883 1.00 63.30  ? 1032 LYS A C     1 
ATOM   7517  O  O     . LYS A 1 1033 ? 41.065  -19.960 175.628 1.00 62.38  ? 1032 LYS A O     1 
ATOM   7518  C  CB    . LYS A 1 1033 ? 38.662  -21.532 174.285 1.00 65.29  ? 1032 LYS A CB    1 
ATOM   7519  N  N     . ASP A 1 1034 ? 39.372  -20.054 177.120 1.00 68.46  ? 1033 ASP A N     1 
ATOM   7520  C  CA    . ASP A 1 1034 ? 40.219  -20.209 178.293 1.00 70.47  ? 1033 ASP A CA    1 
ATOM   7521  C  C     . ASP A 1 1034 ? 40.415  -21.694 178.565 1.00 74.21  ? 1033 ASP A C     1 
ATOM   7522  O  O     . ASP A 1 1034 ? 39.442  -22.442 178.681 1.00 75.90  ? 1033 ASP A O     1 
ATOM   7523  C  CB    . ASP A 1 1034 ? 39.585  -19.519 179.504 1.00 72.57  ? 1033 ASP A CB    1 
ATOM   7524  C  CG    . ASP A 1 1034 ? 40.450  -19.586 180.762 1.00 75.40  ? 1033 ASP A CG    1 
ATOM   7525  O  OD1   . ASP A 1 1034 ? 41.294  -20.494 180.898 1.00 76.75  ? 1033 ASP A OD1   1 
ATOM   7526  O  OD2   . ASP A 1 1034 ? 40.267  -18.719 181.640 1.00 77.32  ? 1033 ASP A OD2   1 
ATOM   7527  N  N     . THR A 1 1035 ? 41.675  -22.112 178.677 1.00 71.34  ? 1034 THR A N     1 
ATOM   7528  C  CA    . THR A 1 1035 ? 41.964  -23.510 178.980 1.00 75.59  ? 1034 THR A CA    1 
ATOM   7529  C  C     . THR A 1 1035 ? 41.530  -23.880 180.397 1.00 78.33  ? 1034 THR A C     1 
ATOM   7530  O  O     . THR A 1 1035 ? 41.041  -24.992 180.635 1.00 82.53  ? 1034 THR A O     1 
ATOM   7531  C  CB    . THR A 1 1035 ? 43.457  -23.780 178.789 1.00 71.61  ? 1034 THR A CB    1 
ATOM   7532  O  OG1   . THR A 1 1035 ? 43.787  -23.678 177.398 1.00 68.52  ? 1034 THR A OG1   1 
ATOM   7533  C  CG2   . THR A 1 1035 ? 43.835  -25.165 179.313 1.00 73.03  ? 1034 THR A CG2   1 
ATOM   7534  N  N     . GLU A 1 1036 ? 41.682  -22.960 181.346 1.00 88.68  ? 1035 GLU A N     1 
ATOM   7535  C  CA    . GLU A 1 1036 ? 41.507  -23.310 182.748 1.00 94.15  ? 1035 GLU A CA    1 
ATOM   7536  C  C     . GLU A 1 1036 ? 40.055  -23.260 183.204 1.00 95.46  ? 1035 GLU A C     1 
ATOM   7537  O  O     . GLU A 1 1036 ? 39.617  -24.143 183.945 1.00 100.88 ? 1035 GLU A O     1 
ATOM   7538  C  CB    . GLU A 1 1036 ? 42.362  -22.392 183.624 1.00 100.25 ? 1035 GLU A CB    1 
ATOM   7539  C  CG    . GLU A 1 1036 ? 42.894  -23.061 184.884 1.00 106.90 ? 1035 GLU A CG    1 
ATOM   7540  C  CD    . GLU A 1 1036 ? 44.087  -23.974 184.618 1.00 110.14 ? 1035 GLU A CD    1 
ATOM   7541  O  OE1   . GLU A 1 1036 ? 44.927  -24.128 185.530 1.00 112.08 ? 1035 GLU A OE1   1 
ATOM   7542  O  OE2   . GLU A 1 1036 ? 44.192  -24.535 183.503 1.00 111.52 ? 1035 GLU A OE2   1 
ATOM   7543  N  N     . THR A 1 1037 ? 39.291  -22.252 182.787 1.00 89.34  ? 1036 THR A N     1 
ATOM   7544  C  CA    . THR A 1 1037 ? 37.899  -22.138 183.203 1.00 87.25  ? 1036 THR A CA    1 
ATOM   7545  C  C     . THR A 1 1037 ? 36.916  -22.542 182.112 1.00 84.31  ? 1036 THR A C     1 
ATOM   7546  O  O     . THR A 1 1037 ? 35.712  -22.615 182.382 1.00 82.56  ? 1036 THR A O     1 
ATOM   7547  C  CB    . THR A 1 1037 ? 37.596  -20.706 183.661 1.00 85.03  ? 1036 THR A CB    1 
ATOM   7548  O  OG1   . THR A 1 1037 ? 36.334  -20.669 184.337 1.00 87.41  ? 1036 THR A OG1   1 
ATOM   7549  C  CG2   . THR A 1 1037 ? 37.537  -19.785 182.472 1.00 83.97  ? 1036 THR A CG2   1 
ATOM   7550  N  N     . LYS A 1 1038 ? 37.398  -22.797 180.897 1.00 77.75  ? 1037 LYS A N     1 
ATOM   7551  C  CA    . LYS A 1 1038 ? 36.649  -23.312 179.755 1.00 78.37  ? 1037 LYS A CA    1 
ATOM   7552  C  C     . LYS A 1 1038 ? 35.702  -22.291 179.133 1.00 72.67  ? 1037 LYS A C     1 
ATOM   7553  O  O     . LYS A 1 1038 ? 34.978  -22.645 178.194 1.00 72.45  ? 1037 LYS A O     1 
ATOM   7554  C  CB    . LYS A 1 1038 ? 35.853  -24.580 180.098 1.00 76.65  ? 1037 LYS A CB    1 
ATOM   7555  N  N     . GLU A 1 1039 ? 35.675  -21.046 179.611 1.00 75.98  ? 1038 GLU A N     1 
ATOM   7556  C  CA    . GLU A 1 1039 ? 34.904  -20.022 178.922 1.00 75.29  ? 1038 GLU A CA    1 
ATOM   7557  C  C     . GLU A 1 1039 ? 35.487  -19.757 177.546 1.00 72.52  ? 1038 GLU A C     1 
ATOM   7558  O  O     . GLU A 1 1039 ? 36.684  -19.932 177.308 1.00 66.51  ? 1038 GLU A O     1 
ATOM   7559  C  CB    . GLU A 1 1039 ? 34.888  -18.703 179.688 1.00 77.41  ? 1038 GLU A CB    1 
ATOM   7560  C  CG    . GLU A 1 1039 ? 34.522  -18.754 181.137 1.00 82.02  ? 1038 GLU A CG    1 
ATOM   7561  C  CD    . GLU A 1 1039 ? 34.726  -17.403 181.792 1.00 82.57  ? 1038 GLU A CD    1 
ATOM   7562  O  OE1   . GLU A 1 1039 ? 35.788  -17.195 182.415 1.00 83.50  ? 1038 GLU A OE1   1 
ATOM   7563  O  OE2   . GLU A 1 1039 ? 33.832  -16.540 181.661 1.00 82.76  ? 1038 GLU A OE2   1 
ATOM   7564  N  N     . GLN A 1 1040 ? 34.627  -19.309 176.638 1.00 67.20  ? 1039 GLN A N     1 
ATOM   7565  C  CA    . GLN A 1 1040 ? 35.073  -18.916 175.314 1.00 64.36  ? 1039 GLN A CA    1 
ATOM   7566  C  C     . GLN A 1 1040 ? 34.176  -17.808 174.796 1.00 63.09  ? 1039 GLN A C     1 
ATOM   7567  O  O     . GLN A 1 1040 ? 32.980  -17.761 175.097 1.00 64.22  ? 1039 GLN A O     1 
ATOM   7568  C  CB    . GLN A 1 1040 ? 35.089  -20.094 174.340 1.00 65.45  ? 1039 GLN A CB    1 
ATOM   7569  C  CG    . GLN A 1 1040 ? 33.927  -21.044 174.487 1.00 67.94  ? 1039 GLN A CG    1 
ATOM   7570  C  CD    . GLN A 1 1040 ? 34.010  -22.194 173.511 1.00 69.07  ? 1039 GLN A CD    1 
ATOM   7571  O  OE1   . GLN A 1 1040 ? 33.510  -22.106 172.394 1.00 68.60  ? 1039 GLN A OE1   1 
ATOM   7572  N  NE2   . GLN A 1 1040 ? 34.646  -23.281 173.927 1.00 70.67  ? 1039 GLN A NE2   1 
ATOM   7573  N  N     . GLN A 1 1041 ? 34.777  -16.915 174.016 1.00 60.84  ? 1040 GLN A N     1 
ATOM   7574  C  CA    . GLN A 1 1041 ? 34.098  -15.767 173.444 1.00 62.43  ? 1040 GLN A CA    1 
ATOM   7575  C  C     . GLN A 1 1041 ? 34.409  -15.705 171.957 1.00 58.17  ? 1040 GLN A C     1 
ATOM   7576  O  O     . GLN A 1 1041 ? 35.535  -15.982 171.532 1.00 57.44  ? 1040 GLN A O     1 
ATOM   7577  C  CB    . GLN A 1 1041 ? 34.529  -14.465 174.135 1.00 58.70  ? 1040 GLN A CB    1 
ATOM   7578  C  CG    . GLN A 1 1041 ? 33.680  -13.242 173.789 1.00 56.86  ? 1040 GLN A CG    1 
ATOM   7579  C  CD    . GLN A 1 1041 ? 33.414  -12.367 174.989 1.00 58.09  ? 1040 GLN A CD    1 
ATOM   7580  O  OE1   . GLN A 1 1041 ? 33.968  -12.589 176.082 1.00 59.96  ? 1040 GLN A OE1   1 
ATOM   7581  N  NE2   . GLN A 1 1041 ? 32.572  -11.346 174.798 1.00 58.21  ? 1040 GLN A NE2   1 
ATOM   7582  N  N     . LEU A 1 1042 ? 33.406  -15.349 171.170 1.00 58.03  ? 1041 LEU A N     1 
ATOM   7583  C  CA    . LEU A 1 1042 ? 33.561  -15.208 169.731 1.00 56.89  ? 1041 LEU A CA    1 
ATOM   7584  C  C     . LEU A 1 1042 ? 33.695  -13.728 169.405 1.00 54.75  ? 1041 LEU A C     1 
ATOM   7585  O  O     . LEU A 1 1042 ? 32.814  -12.929 169.741 1.00 54.71  ? 1041 LEU A O     1 
ATOM   7586  C  CB    . LEU A 1 1042 ? 32.382  -15.828 168.985 1.00 58.25  ? 1041 LEU A CB    1 
ATOM   7587  C  CG    . LEU A 1 1042 ? 32.358  -15.727 167.460 1.00 57.34  ? 1041 LEU A CG    1 
ATOM   7588  C  CD1   . LEU A 1 1042 ? 33.187  -16.815 166.805 1.00 57.80  ? 1041 LEU A CD1   1 
ATOM   7589  C  CD2   . LEU A 1 1042 ? 30.940  -15.838 167.009 1.00 58.49  ? 1041 LEU A CD2   1 
ATOM   7590  N  N     . PHE A 1 1043 ? 34.799  -13.369 168.771 1.00 53.13  ? 1042 PHE A N     1 
ATOM   7591  C  CA    . PHE A 1 1043 ? 35.085  -12.004 168.377 1.00 51.13  ? 1042 PHE A CA    1 
ATOM   7592  C  C     . PHE A 1 1043 ? 35.200  -11.947 166.867 1.00 50.24  ? 1042 PHE A C     1 
ATOM   7593  O  O     . PHE A 1 1043 ? 35.320  -12.973 166.198 1.00 51.02  ? 1042 PHE A O     1 
ATOM   7594  C  CB    . PHE A 1 1043 ? 36.400  -11.498 168.988 1.00 49.95  ? 1042 PHE A CB    1 
ATOM   7595  C  CG    . PHE A 1 1043 ? 36.420  -11.473 170.479 1.00 50.72  ? 1042 PHE A CG    1 
ATOM   7596  C  CD1   . PHE A 1 1043 ? 35.877  -10.411 171.169 1.00 50.35  ? 1042 PHE A CD1   1 
ATOM   7597  C  CD2   . PHE A 1 1043 ? 37.020  -12.492 171.188 1.00 51.86  ? 1042 PHE A CD2   1 
ATOM   7598  C  CE1   . PHE A 1 1043 ? 35.910  -10.374 172.539 1.00 51.12  ? 1042 PHE A CE1   1 
ATOM   7599  C  CE2   . PHE A 1 1043 ? 37.055  -12.462 172.560 1.00 52.63  ? 1042 PHE A CE2   1 
ATOM   7600  C  CZ    . PHE A 1 1043 ? 36.501  -11.398 173.236 1.00 52.23  ? 1042 PHE A CZ    1 
ATOM   7601  N  N     . ARG A 1 1044 ? 35.191  -10.736 166.328 1.00 48.67  ? 1043 ARG A N     1 
ATOM   7602  C  CA    . ARG A 1 1044 ? 35.697  -10.535 164.986 1.00 47.52  ? 1043 ARG A CA    1 
ATOM   7603  C  C     . ARG A 1 1044 ? 36.990  -9.741  165.051 1.00 45.87  ? 1043 ARG A C     1 
ATOM   7604  O  O     . ARG A 1 1044 ? 37.211  -8.940  165.963 1.00 45.31  ? 1043 ARG A O     1 
ATOM   7605  C  CB    . ARG A 1 1044 ? 34.684  -9.850  164.060 1.00 47.16  ? 1043 ARG A CB    1 
ATOM   7606  C  CG    . ARG A 1 1044 ? 34.157  -8.518  164.484 1.00 46.42  ? 1043 ARG A CG    1 
ATOM   7607  C  CD    . ARG A 1 1044 ? 33.013  -8.125  163.568 1.00 46.58  ? 1043 ARG A CD    1 
ATOM   7608  N  NE    . ARG A 1 1044 ? 32.331  -6.939  164.062 1.00 46.28  ? 1043 ARG A NE    1 
ATOM   7609  C  CZ    . ARG A 1 1044 ? 32.519  -5.724  163.573 1.00 44.92  ? 1043 ARG A CZ    1 
ATOM   7610  N  NH1   . ARG A 1 1044 ? 31.865  -4.696  164.083 1.00 46.73  ? 1043 ARG A NH1   1 
ATOM   7611  N  NH2   . ARG A 1 1044 ? 33.357  -5.543  162.569 1.00 43.71  ? 1043 ARG A NH2   1 
ATOM   7612  N  N     . PHE A 1 1045 ? 37.851  -10.010 164.081 1.00 45.23  ? 1044 PHE A N     1 
ATOM   7613  C  CA    . PHE A 1 1045 ? 39.180  -9.440  164.051 1.00 43.88  ? 1044 PHE A CA    1 
ATOM   7614  C  C     . PHE A 1 1045 ? 39.130  -8.069  163.422 1.00 42.35  ? 1044 PHE A C     1 
ATOM   7615  O  O     . PHE A 1 1045 ? 38.375  -7.834  162.479 1.00 42.23  ? 1044 PHE A O     1 
ATOM   7616  C  CB    . PHE A 1 1045 ? 40.116  -10.335 163.248 1.00 44.03  ? 1044 PHE A CB    1 
ATOM   7617  C  CG    . PHE A 1 1045 ? 41.561  -9.963  163.356 1.00 43.02  ? 1044 PHE A CG    1 
ATOM   7618  C  CD1   . PHE A 1 1045 ? 42.267  -10.217 164.513 1.00 43.39  ? 1044 PHE A CD1   1 
ATOM   7619  C  CD2   . PHE A 1 1045 ? 42.224  -9.385  162.292 1.00 41.81  ? 1044 PHE A CD2   1 
ATOM   7620  C  CE1   . PHE A 1 1045 ? 43.601  -9.893  164.612 1.00 42.58  ? 1044 PHE A CE1   1 
ATOM   7621  C  CE2   . PHE A 1 1045 ? 43.560  -9.063  162.390 1.00 41.02  ? 1044 PHE A CE2   1 
ATOM   7622  C  CZ    . PHE A 1 1045 ? 44.244  -9.317  163.553 1.00 41.42  ? 1044 PHE A CZ    1 
ATOM   7623  N  N     . LEU A 1 1046 ? 40.017  -7.216  163.887 1.00 41.29  ? 1045 LEU A N     1 
ATOM   7624  C  CA    . LEU A 1 1046 ? 40.237  -5.922  163.305 1.00 39.83  ? 1045 LEU A CA    1 
ATOM   7625  C  C     . LEU A 1 1046 ? 41.659  -5.942  162.831 1.00 38.99  ? 1045 LEU A C     1 
ATOM   7626  O  O     . LEU A 1 1046 ? 41.912  -6.079  161.680 1.00 38.56  ? 1045 LEU A O     1 
ATOM   7627  C  CB    . LEU A 1 1046 ? 40.079  -4.800  164.284 1.00 39.36  ? 1045 LEU A CB    1 
ATOM   7628  C  CG    . LEU A 1 1046 ? 40.207  -3.482  163.562 1.00 38.01  ? 1045 LEU A CG    1 
ATOM   7629  C  CD1   . LEU A 1 1046 ? 39.058  -3.293  162.608 1.00 38.03  ? 1045 LEU A CD1   1 
ATOM   7630  C  CD2   . LEU A 1 1046 ? 40.240  -2.359  164.552 1.00 37.69  ? 1045 LEU A CD2   1 
ATOM   7631  N  N     . SER A 1 1047 ? 42.597  -5.833  163.743 1.00 38.87  ? 1046 SER A N     1 
ATOM   7632  C  CA    . SER A 1 1047 ? 43.990  -5.838  163.383 1.00 38.16  ? 1046 SER A CA    1 
ATOM   7633  C  C     . SER A 1 1047 ? 44.887  -6.165  164.523 1.00 38.64  ? 1046 SER A C     1 
ATOM   7634  O  O     . SER A 1 1047 ? 44.469  -6.369  165.612 1.00 39.38  ? 1046 SER A O     1 
ATOM   7635  C  CB    . SER A 1 1047 ? 44.404  -4.456  162.892 1.00 36.78  ? 1046 SER A CB    1 
ATOM   7636  O  OG    . SER A 1 1047 ? 44.233  -3.494  163.888 1.00 36.50  ? 1046 SER A OG    1 
ATOM   7637  N  N     . ARG A 1 1048 ? 46.156  -6.208  164.219 1.00 38.32  ? 1047 ARG A N     1 
ATOM   7638  C  CA    . ARG A 1 1048 ? 47.167  -6.358  165.201 1.00 39.69  ? 1047 ARG A CA    1 
ATOM   7639  C  C     . ARG A 1 1048 ? 47.463  -4.908  165.557 1.00 41.69  ? 1047 ARG A C     1 
ATOM   7640  O  O     . ARG A 1 1048 ? 47.791  -4.132  164.701 1.00 41.41  ? 1047 ARG A O     1 
ATOM   7641  C  CB    . ARG A 1 1048 ? 48.358  -7.050  164.579 1.00 38.54  ? 1047 ARG A CB    1 
ATOM   7642  C  CG    . ARG A 1 1048 ? 49.704  -6.752  165.174 1.00 38.51  ? 1047 ARG A CG    1 
ATOM   7643  C  CD    . ARG A 1 1048 ? 50.109  -7.648  166.323 1.00 39.75  ? 1047 ARG A CD    1 
ATOM   7644  N  NE    . ARG A 1 1048 ? 51.436  -7.305  166.779 1.00 39.41  ? 1047 ARG A NE    1 
ATOM   7645  C  CZ    . ARG A 1 1048 ? 51.668  -6.560  167.827 1.00 39.12  ? 1047 ARG A CZ    1 
ATOM   7646  N  NH1   . ARG A 1 1048 ? 52.879  -6.273  168.184 1.00 39.20  ? 1047 ARG A NH1   1 
ATOM   7647  N  NH2   . ARG A 1 1048 ? 50.672  -6.122  168.521 1.00 38.89  ? 1047 ARG A NH2   1 
ATOM   7648  N  N     . THR A 1 1049 ? 47.261  -4.538  166.813 1.00 50.80  ? 1048 THR A N     1 
ATOM   7649  C  CA    . THR A 1 1049 ? 47.487  -3.190  167.303 1.00 58.56  ? 1048 THR A CA    1 
ATOM   7650  C  C     . THR A 1 1049 ? 48.706  -3.141  168.178 1.00 61.97  ? 1048 THR A C     1 
ATOM   7651  O  O     . THR A 1 1049 ? 49.076  -4.124  168.755 1.00 73.51  ? 1048 THR A O     1 
ATOM   7652  C  CB    . THR A 1 1049 ? 46.388  -2.676  168.250 1.00 62.17  ? 1048 THR A CB    1 
ATOM   7653  O  OG1   . THR A 1 1049 ? 45.182  -3.384  168.066 1.00 67.48  ? 1048 THR A OG1   1 
ATOM   7654  C  CG2   . THR A 1 1049 ? 46.112  -1.255  168.011 1.00 64.92  ? 1048 THR A CG2   1 
ATOM   7655  N  N     . MET A 1 1050 ? 49.270  -1.951  168.307 1.00 56.20  ? 1049 MET A N     1 
ATOM   7656  C  CA    . MET A 1 1050 ? 50.435  -1.646  169.117 1.00 46.76  ? 1049 MET A CA    1 
ATOM   7657  C  C     . MET A 1 1050 ? 51.685  -2.421  168.842 1.00 42.55  ? 1049 MET A C     1 
ATOM   7658  O  O     . MET A 1 1050 ? 51.939  -3.422  169.428 1.00 42.96  ? 1049 MET A O     1 
ATOM   7659  C  CB    . MET A 1 1050 ? 50.081  -1.676  170.569 1.00 42.95  ? 1049 MET A CB    1 
ATOM   7660  C  CG    . MET A 1 1050 ? 48.771  -1.004  170.812 1.00 40.62  ? 1049 MET A CG    1 
ATOM   7661  S  SD    . MET A 1 1050 ? 48.080  -1.496  172.335 1.00 38.92  ? 1049 MET A SD    1 
ATOM   7662  C  CE    . MET A 1 1050 ? 46.976  -0.164  172.641 1.00 39.26  ? 1049 MET A CE    1 
ATOM   7663  N  N     . PRO A 1 1051 ? 52.517  -1.889  167.984 1.00 35.48  ? 1050 PRO A N     1 
ATOM   7664  C  CA    . PRO A 1 1051 ? 53.752  -2.576  167.631 1.00 35.82  ? 1050 PRO A CA    1 
ATOM   7665  C  C     . PRO A 1 1051 ? 54.626  -2.945  168.806 1.00 36.63  ? 1050 PRO A C     1 
ATOM   7666  O  O     . PRO A 1 1051 ? 55.172  -4.012  168.822 1.00 37.51  ? 1050 PRO A O     1 
ATOM   7667  C  CB    . PRO A 1 1051 ? 54.464  -1.565  166.762 1.00 34.86  ? 1050 PRO A CB    1 
ATOM   7668  C  CG    . PRO A 1 1051 ? 53.402  -0.849  166.102 1.00 34.05  ? 1050 PRO A CG    1 
ATOM   7669  C  CD    . PRO A 1 1051 ? 52.519  -0.570  167.223 1.00 34.45  ? 1050 PRO A CD    1 
ATOM   7670  N  N     . LYS A 1 1052 ? 54.748  -2.061  169.764 1.00 38.35  ? 1051 LYS A N     1 
ATOM   7671  C  CA    . LYS A 1 1052 ? 55.534  -2.279  170.937 1.00 39.28  ? 1051 LYS A CA    1 
ATOM   7672  C  C     . LYS A 1 1052 ? 55.046  -3.408  171.824 1.00 40.82  ? 1051 LYS A C     1 
ATOM   7673  O  O     . LYS A 1 1052 ? 55.835  -4.057  172.414 1.00 39.58  ? 1051 LYS A O     1 
ATOM   7674  C  CB    . LYS A 1 1052 ? 55.613  -1.001  171.717 1.00 41.85  ? 1051 LYS A CB    1 
ATOM   7675  C  CG    . LYS A 1 1052 ? 56.929  -0.771  172.397 1.00 44.85  ? 1051 LYS A CG    1 
ATOM   7676  C  CD    . LYS A 1 1052 ? 56.949  0.591   173.057 1.00 46.92  ? 1051 LYS A CD    1 
ATOM   7677  C  CE    . LYS A 1 1052 ? 57.371  0.552   174.513 1.00 48.74  ? 1051 LYS A CE    1 
ATOM   7678  N  NZ    . LYS A 1 1052 ? 57.711  1.932   174.934 1.00 49.45  ? 1051 LYS A NZ    1 
ATOM   7679  N  N     . GLN A 1 1053 ? 53.749  -3.606  171.943 1.00 44.92  ? 1052 GLN A N     1 
ATOM   7680  C  CA    . GLN A 1 1053 ? 53.161  -4.666  172.763 1.00 47.35  ? 1052 GLN A CA    1 
ATOM   7681  C  C     . GLN A 1 1053 ? 52.930  -5.887  171.882 1.00 47.49  ? 1052 GLN A C     1 
ATOM   7682  O  O     . GLN A 1 1053 ? 51.935  -5.968  171.167 1.00 53.95  ? 1052 GLN A O     1 
ATOM   7683  C  CB    . GLN A 1 1053 ? 51.854  -4.201  173.391 1.00 49.43  ? 1052 GLN A CB    1 
ATOM   7684  C  CG    . GLN A 1 1053 ? 51.949  -2.886  174.128 1.00 49.12  ? 1052 GLN A CG    1 
ATOM   7685  C  CD    . GLN A 1 1053 ? 52.804  -2.985  175.370 1.00 50.28  ? 1052 GLN A CD    1 
ATOM   7686  O  OE1   . GLN A 1 1053 ? 52.979  -4.069  175.938 1.00 52.35  ? 1052 GLN A OE1   1 
ATOM   7687  N  NE2   . GLN A 1 1053 ? 53.347  -1.851  175.800 1.00 49.99  ? 1052 GLN A NE2   1 
ATOM   7688  N  N     . LYS A 1 1054 ? 53.831  -6.856  171.953 1.00 48.08  ? 1053 LYS A N     1 
ATOM   7689  C  CA    . LYS A 1 1054 ? 53.766  -7.993  171.052 1.00 43.06  ? 1053 LYS A CA    1 
ATOM   7690  C  C     . LYS A 1 1054 ? 52.536  -8.852  171.327 1.00 42.85  ? 1053 LYS A C     1 
ATOM   7691  O  O     . LYS A 1 1054 ? 52.108  -9.028  172.473 1.00 43.56  ? 1053 LYS A O     1 
ATOM   7692  C  CB    . LYS A 1 1054 ? 55.029  -8.837  171.174 1.00 44.11  ? 1053 LYS A CB    1 
ATOM   7693  C  CG    . LYS A 1 1054 ? 56.278  -8.014  171.309 1.00 43.51  ? 1053 LYS A CG    1 
ATOM   7694  C  CD    . LYS A 1 1054 ? 56.371  -7.001  170.196 1.00 41.28  ? 1053 LYS A CD    1 
ATOM   7695  C  CE    . LYS A 1 1054 ? 57.585  -7.243  169.369 1.00 40.88  ? 1053 LYS A CE    1 
ATOM   7696  N  NZ    . LYS A 1 1054 ? 58.042  -5.984  168.744 1.00 39.60  ? 1053 LYS A NZ    1 
ATOM   7697  N  N     . HIS A 1 1055 ? 51.977  -9.390  170.236 1.00 42.82  ? 1054 HIS A N     1 
ATOM   7698  C  CA    . HIS A 1 1055 ? 50.800  -10.259 170.202 1.00 43.77  ? 1054 HIS A CA    1 
ATOM   7699  C  C     . HIS A 1 1055 ? 49.527  -9.536  170.597 1.00 43.33  ? 1054 HIS A C     1 
ATOM   7700  O  O     . HIS A 1 1055 ? 48.534  -10.181 170.947 1.00 44.33  ? 1054 HIS A O     1 
ATOM   7701  C  CB    . HIS A 1 1055 ? 50.990  -11.490 171.084 1.00 45.55  ? 1054 HIS A CB    1 
ATOM   7702  C  CG    . HIS A 1 1055 ? 52.404  -12.006 171.108 1.00 46.11  ? 1054 HIS A CG    1 
ATOM   7703  N  ND1   . HIS A 1 1055 ? 53.204  -11.937 172.236 1.00 46.60  ? 1054 HIS A ND1   1 
ATOM   7704  C  CD2   . HIS A 1 1055 ? 53.161  -12.579 170.142 1.00 46.34  ? 1054 HIS A CD2   1 
ATOM   7705  C  CE1   . HIS A 1 1055 ? 54.384  -12.464 171.964 1.00 47.15  ? 1054 HIS A CE1   1 
ATOM   7706  N  NE2   . HIS A 1 1055 ? 54.384  -12.856 170.701 1.00 47.01  ? 1054 HIS A NE2   1 
ATOM   7707  N  N     . TYR A 1 1056 ? 49.521  -8.208  170.523 1.00 41.97  ? 1055 TYR A N     1 
ATOM   7708  C  CA    . TYR A 1 1056 ? 48.355  -7.422  170.895 1.00 41.59  ? 1055 TYR A CA    1 
ATOM   7709  C  C     . TYR A 1 1056 ? 47.433  -7.242  169.703 1.00 41.03  ? 1055 TYR A C     1 
ATOM   7710  O  O     . TYR A 1 1056 ? 47.868  -7.085  168.566 1.00 40.28  ? 1055 TYR A O     1 
ATOM   7711  C  CB    . TYR A 1 1056 ? 48.773  -6.063  171.447 1.00 40.59  ? 1055 TYR A CB    1 
ATOM   7712  C  CG    . TYR A 1 1056 ? 48.558  -5.948  172.926 1.00 41.33  ? 1055 TYR A CG    1 
ATOM   7713  C  CD1   . TYR A 1 1056 ? 49.334  -6.678  173.814 1.00 42.33  ? 1055 TYR A CD1   1 
ATOM   7714  C  CD2   . TYR A 1 1056 ? 47.572  -5.128  173.439 1.00 41.16  ? 1055 TYR A CD2   1 
ATOM   7715  C  CE1   . TYR A 1 1056 ? 49.131  -6.593  175.154 1.00 43.09  ? 1055 TYR A CE1   1 
ATOM   7716  C  CE2   . TYR A 1 1056 ? 47.366  -5.037  174.785 1.00 41.94  ? 1055 TYR A CE2   1 
ATOM   7717  C  CZ    . TYR A 1 1056 ? 48.149  -5.769  175.634 1.00 42.88  ? 1055 TYR A CZ    1 
ATOM   7718  O  OH    . TYR A 1 1056 ? 47.942  -5.686  176.977 1.00 43.74  ? 1055 TYR A OH    1 
ATOM   7719  N  N     . VAL A 1 1057 ? 46.143  -7.244  169.971 1.00 41.48  ? 1056 VAL A N     1 
ATOM   7720  C  CA    . VAL A 1 1057 ? 45.194  -7.316  168.877 1.00 41.31  ? 1056 VAL A CA    1 
ATOM   7721  C  C     . VAL A 1 1057 ? 43.960  -6.519  169.255 1.00 41.20  ? 1056 VAL A C     1 
ATOM   7722  O  O     . VAL A 1 1057 ? 43.498  -6.584  170.396 1.00 42.00  ? 1056 VAL A O     1 
ATOM   7723  C  CB    . VAL A 1 1057 ? 44.867  -8.789  168.558 1.00 42.66  ? 1056 VAL A CB    1 
ATOM   7724  C  CG1   . VAL A 1 1057 ? 43.572  -8.889  167.896 1.00 42.90  ? 1056 VAL A CG1   1 
ATOM   7725  C  CG2   . VAL A 1 1057 ? 45.947  -9.393  167.661 1.00 42.55  ? 1056 VAL A CG2   1 
ATOM   7726  N  N     . GLU A 1 1058 ? 43.447  -5.732  168.320 1.00 40.28  ? 1057 GLU A N     1 
ATOM   7727  C  CA    . GLU A 1 1058 ? 42.145  -5.116  168.515 1.00 41.24  ? 1057 GLU A CA    1 
ATOM   7728  C  C     . GLU A 1 1058 ? 41.060  -6.025  167.950 1.00 41.40  ? 1057 GLU A C     1 
ATOM   7729  O  O     . GLU A 1 1058 ? 41.194  -6.569  166.851 1.00 41.30  ? 1057 GLU A O     1 
ATOM   7730  C  CB    . GLU A 1 1058 ? 42.062  -3.733  167.870 1.00 44.52  ? 1057 GLU A CB    1 
ATOM   7731  C  CG    . GLU A 1 1058 ? 40.699  -3.068  168.065 1.00 49.14  ? 1057 GLU A CG    1 
ATOM   7732  C  CD    . GLU A 1 1058 ? 40.721  -1.567  167.826 1.00 53.83  ? 1057 GLU A CD    1 
ATOM   7733  O  OE1   . GLU A 1 1058 ? 41.793  -1.021  167.491 1.00 57.45  ? 1057 GLU A OE1   1 
ATOM   7734  O  OE2   . GLU A 1 1058 ? 39.659  -0.930  167.970 1.00 53.94  ? 1057 GLU A OE2   1 
ATOM   7735  N  N     . LEU A 1 1059 ? 40.000  -6.200  168.732 1.00 42.47  ? 1058 LEU A N     1 
ATOM   7736  C  CA    . LEU A 1 1059 ? 38.848  -7.016  168.402 1.00 43.66  ? 1058 LEU A CA    1 
ATOM   7737  C  C     . LEU A 1 1059 ? 37.601  -6.149  168.351 1.00 43.65  ? 1058 LEU A C     1 
ATOM   7738  O  O     . LEU A 1 1059 ? 37.571  -5.019  168.848 1.00 43.01  ? 1058 LEU A O     1 
ATOM   7739  C  CB    . LEU A 1 1059 ? 38.633  -8.129  169.432 1.00 45.32  ? 1058 LEU A CB    1 
ATOM   7740  C  CG    . LEU A 1 1059 ? 39.822  -8.942  169.909 1.00 45.66  ? 1058 LEU A CG    1 
ATOM   7741  C  CD1   . LEU A 1 1059 ? 39.416  -9.904  171.029 1.00 47.47  ? 1058 LEU A CD1   1 
ATOM   7742  C  CD2   . LEU A 1 1059 ? 40.350  -9.702  168.731 1.00 45.54  ? 1058 LEU A CD2   1 
ATOM   7743  N  N     . LYS A 1 1060 ? 36.551  -6.698  167.777 1.00 44.54  ? 1059 LYS A N     1 
ATOM   7744  C  CA    . LYS A 1 1060 ? 35.269  -6.033  167.657 1.00 44.81  ? 1059 LYS A CA    1 
ATOM   7745  C  C     . LYS A 1 1060 ? 34.179  -7.012  168.034 1.00 46.65  ? 1059 LYS A C     1 
ATOM   7746  O  O     . LYS A 1 1060 ? 34.425  -8.176  168.085 1.00 47.54  ? 1059 LYS A O     1 
ATOM   7747  C  CB    . LYS A 1 1060 ? 35.069  -5.539  166.242 1.00 44.41  ? 1059 LYS A CB    1 
ATOM   7748  C  CG    . LYS A 1 1060 ? 36.089  -4.537  165.784 1.00 44.37  ? 1059 LYS A CG    1 
ATOM   7749  C  CD    . LYS A 1 1060 ? 35.598  -3.132  165.993 1.00 46.65  ? 1059 LYS A CD    1 
ATOM   7750  C  CE    . LYS A 1 1060 ? 35.403  -2.423  164.681 1.00 45.68  ? 1059 LYS A CE    1 
ATOM   7751  N  NZ    . LYS A 1 1060 ? 34.923  -1.059  164.964 1.00 46.36  ? 1059 LYS A NZ    1 
ATOM   7752  N  N     . PRO A 1 1061 ? 32.975  -6.553  168.295 1.00 47.38  ? 1060 PRO A N     1 
ATOM   7753  C  CA    . PRO A 1 1061 ? 31.921  -7.470  168.727 1.00 49.31  ? 1060 PRO A CA    1 
ATOM   7754  C  C     . PRO A 1 1061 ? 31.428  -8.357  167.599 1.00 49.97  ? 1060 PRO A C     1 
ATOM   7755  O  O     . PRO A 1 1061 ? 31.630  -8.098  166.413 1.00 48.96  ? 1060 PRO A O     1 
ATOM   7756  C  CB    . PRO A 1 1061 ? 30.809  -6.536  169.212 1.00 49.79  ? 1060 PRO A CB    1 
ATOM   7757  C  CG    . PRO A 1 1061 ? 31.460  -5.269  169.473 1.00 48.31  ? 1060 PRO A CG    1 
ATOM   7758  C  CD    . PRO A 1 1061 ? 32.568  -5.154  168.487 1.00 46.70  ? 1060 PRO A CD    1 
ATOM   7759  N  N     . TYR A 1 1062 ? 30.747  -9.422  168.006 1.00 51.82  ? 1061 TYR A N     1 
ATOM   7760  C  CA    . TYR A 1 1062 ? 30.195  -10.379 167.067 1.00 52.91  ? 1061 TYR A CA    1 
ATOM   7761  C  C     . TYR A 1 1062 ? 28.866  -9.911  166.487 1.00 53.34  ? 1061 TYR A C     1 
ATOM   7762  O  O     . TYR A 1 1062 ? 28.551  -10.232 165.337 1.00 53.42  ? 1061 TYR A O     1 
ATOM   7763  C  CB    . TYR A 1 1062 ? 30.040  -11.729 167.767 1.00 54.76  ? 1061 TYR A CB    1 
ATOM   7764  C  CG    . TYR A 1 1062 ? 29.286  -12.767 166.966 1.00 56.35  ? 1061 TYR A CG    1 
ATOM   7765  C  CD1   . TYR A 1 1062 ? 29.611  -13.029 165.645 1.00 56.18  ? 1061 TYR A CD1   1 
ATOM   7766  C  CD2   . TYR A 1 1062 ? 28.246  -13.483 167.525 1.00 58.40  ? 1061 TYR A CD2   1 
ATOM   7767  C  CE1   . TYR A 1 1062 ? 28.921  -13.977 164.910 1.00 57.04  ? 1061 TYR A CE1   1 
ATOM   7768  C  CE2   . TYR A 1 1062 ? 27.555  -14.436 166.792 1.00 59.89  ? 1061 TYR A CE2   1 
ATOM   7769  C  CZ    . TYR A 1 1062 ? 27.895  -14.681 165.484 1.00 59.19  ? 1061 TYR A CZ    1 
ATOM   7770  O  OH    . TYR A 1 1062 ? 27.208  -15.631 164.748 1.00 60.77  ? 1061 TYR A OH    1 
ATOM   7771  N  N     . ASP A 1 1063 ? 28.097  -9.129  167.238 1.00 53.73  ? 1062 ASP A N     1 
ATOM   7772  C  CA    . ASP A 1 1063 ? 26.726  -8.813  166.875 1.00 54.70  ? 1062 ASP A CA    1 
ATOM   7773  C  C     . ASP A 1 1063 ? 26.445  -7.325  166.730 1.00 53.59  ? 1062 ASP A C     1 
ATOM   7774  O  O     . ASP A 1 1063 ? 25.284  -6.954  166.537 1.00 54.49  ? 1062 ASP A O     1 
ATOM   7775  C  CB    . ASP A 1 1063 ? 25.770  -9.397  167.920 1.00 56.97  ? 1062 ASP A CB    1 
ATOM   7776  C  CG    . ASP A 1 1063 ? 26.141  -8.984  169.328 1.00 57.79  ? 1062 ASP A CG    1 
ATOM   7777  O  OD1   . ASP A 1 1063 ? 27.336  -8.728  169.570 1.00 55.72  ? 1062 ASP A OD1   1 
ATOM   7778  O  OD2   . ASP A 1 1063 ? 25.243  -8.911  170.188 1.00 61.27  ? 1062 ASP A OD2   1 
ATOM   7779  N  N     . LYS A 1 1064 ? 27.454  -6.463  166.837 1.00 52.24  ? 1063 LYS A N     1 
ATOM   7780  C  CA    . LYS A 1 1064 ? 27.242  -5.026  166.739 1.00 52.71  ? 1063 LYS A CA    1 
ATOM   7781  C  C     . LYS A 1 1064 ? 28.505  -4.377  166.197 1.00 54.43  ? 1063 LYS A C     1 
ATOM   7782  O  O     . LYS A 1 1064 ? 29.546  -5.021  166.045 1.00 57.02  ? 1063 LYS A O     1 
ATOM   7783  C  CB    . LYS A 1 1064 ? 26.839  -4.408  168.086 1.00 54.35  ? 1063 LYS A CB    1 
ATOM   7784  C  CG    . LYS A 1 1064 ? 27.752  -4.736  169.264 1.00 54.98  ? 1063 LYS A CG    1 
ATOM   7785  C  CD    . LYS A 1 1064 ? 27.326  -3.975  170.510 1.00 54.73  ? 1063 LYS A CD    1 
ATOM   7786  C  CE    . LYS A 1 1064 ? 28.139  -4.377  171.724 1.00 53.56  ? 1063 LYS A CE    1 
ATOM   7787  N  NZ    . LYS A 1 1064 ? 27.772  -3.580  172.927 1.00 52.94  ? 1063 LYS A NZ    1 
ATOM   7788  N  N     . GLN A 1 1065 ? 28.396  -3.082  165.897 1.00 49.77  ? 1064 GLN A N     1 
ATOM   7789  C  CA    . GLN A 1 1065 ? 29.483  -2.376  165.226 1.00 48.75  ? 1064 GLN A CA    1 
ATOM   7790  C  C     . GLN A 1 1065 ? 30.699  -2.228  166.137 1.00 46.01  ? 1064 GLN A C     1 
ATOM   7791  O  O     . GLN A 1 1065 ? 31.826  -2.541  165.740 1.00 44.72  ? 1064 GLN A O     1 
ATOM   7792  C  CB    . GLN A 1 1065 ? 28.993  -1.009  164.742 1.00 49.29  ? 1064 GLN A CB    1 
ATOM   7793  C  CG    . GLN A 1 1065 ? 30.087  -0.113  164.185 1.00 48.58  ? 1064 GLN A CG    1 
ATOM   7794  C  CD    . GLN A 1 1065 ? 29.613  1.306   163.933 1.00 48.72  ? 1064 GLN A CD    1 
ATOM   7795  O  OE1   . GLN A 1 1065 ? 29.842  2.210   164.740 1.00 48.84  ? 1064 GLN A OE1   1 
ATOM   7796  N  NE2   . GLN A 1 1065 ? 28.954  1.510   162.805 1.00 50.12  ? 1064 GLN A NE2   1 
ATOM   7797  N  N     . LYS A 1 1066 ? 30.498  -1.753  167.362 1.00 48.50  ? 1065 LYS A N     1 
ATOM   7798  C  CA    . LYS A 1 1066 ? 31.619  -1.528  168.257 1.00 46.33  ? 1065 LYS A CA    1 
ATOM   7799  C  C     . LYS A 1 1066 ? 31.199  -1.845  169.680 1.00 47.78  ? 1065 LYS A C     1 
ATOM   7800  O  O     . LYS A 1 1066 ? 30.014  -1.974  169.987 1.00 49.47  ? 1065 LYS A O     1 
ATOM   7801  C  CB    . LYS A 1 1066 ? 32.121  -0.089  168.161 1.00 46.86  ? 1065 LYS A CB    1 
ATOM   7802  C  CG    . LYS A 1 1066 ? 31.049  0.922   168.489 1.00 48.66  ? 1065 LYS A CG    1 
ATOM   7803  C  CD    . LYS A 1 1066 ? 31.516  2.334   168.262 1.00 48.18  ? 1065 LYS A CD    1 
ATOM   7804  C  CE    . LYS A 1 1066 ? 30.386  3.297   168.550 1.00 50.16  ? 1065 LYS A CE    1 
ATOM   7805  N  NZ    . LYS A 1 1066 ? 30.864  4.704   168.629 1.00 51.33  ? 1065 LYS A NZ    1 
ATOM   7806  N  N     . PHE A 1 1067 ? 32.195  -1.971  170.551 1.00 45.99  ? 1066 PHE A N     1 
ATOM   7807  C  CA    . PHE A 1 1067 ? 31.962  -2.080  171.983 1.00 47.13  ? 1066 PHE A CA    1 
ATOM   7808  C  C     . PHE A 1 1067 ? 31.664  -0.709  172.579 1.00 47.00  ? 1066 PHE A C     1 
ATOM   7809  O  O     . PHE A 1 1067 ? 32.073  0.330   172.057 1.00 45.75  ? 1066 PHE A O     1 
ATOM   7810  C  CB    . PHE A 1 1067 ? 33.179  -2.667  172.693 1.00 46.87  ? 1066 PHE A CB    1 
ATOM   7811  C  CG    . PHE A 1 1067 ? 33.397  -4.126  172.455 1.00 47.53  ? 1066 PHE A CG    1 
ATOM   7812  C  CD1   . PHE A 1 1067 ? 32.590  -5.066  173.055 1.00 49.32  ? 1066 PHE A CD1   1 
ATOM   7813  C  CD2   . PHE A 1 1067 ? 34.448  -4.558  171.683 1.00 46.50  ? 1066 PHE A CD2   1 
ATOM   7814  C  CE1   . PHE A 1 1067 ? 32.810  -6.408  172.858 1.00 50.07  ? 1066 PHE A CE1   1 
ATOM   7815  C  CE2   . PHE A 1 1067 ? 34.670  -5.895  171.487 1.00 47.25  ? 1066 PHE A CE2   1 
ATOM   7816  C  CZ    . PHE A 1 1067 ? 33.854  -6.820  172.074 1.00 49.04  ? 1066 PHE A CZ    1 
ATOM   7817  N  N     . GLU A 1 1068 ? 30.962  -0.716  173.707 1.00 59.63  ? 1067 GLU A N     1 
ATOM   7818  C  CA    . GLU A 1 1068 ? 30.699  0.514   174.444 1.00 63.93  ? 1067 GLU A CA    1 
ATOM   7819  C  C     . GLU A 1 1068 ? 31.845  0.896   175.374 1.00 63.68  ? 1067 GLU A C     1 
ATOM   7820  O  O     . GLU A 1 1068 ? 32.202  2.074   175.469 1.00 67.37  ? 1067 GLU A O     1 
ATOM   7821  C  CB    . GLU A 1 1068 ? 29.407  0.378   175.252 1.00 71.07  ? 1067 GLU A CB    1 
ATOM   7822  C  CG    . GLU A 1 1068 ? 28.148  0.447   174.416 1.00 76.55  ? 1067 GLU A CG    1 
ATOM   7823  C  CD    . GLU A 1 1068 ? 26.905  0.180   175.230 1.00 81.00  ? 1067 GLU A CD    1 
ATOM   7824  O  OE1   . GLU A 1 1068 ? 26.232  -0.841  174.975 1.00 82.75  ? 1067 GLU A OE1   1 
ATOM   7825  O  OE2   . GLU A 1 1068 ? 26.606  0.986   176.134 1.00 82.67  ? 1067 GLU A OE2   1 
ATOM   7826  N  N     . GLY A 1 1069 ? 32.432  -0.075  176.061 1.00 52.26  ? 1068 GLY A N     1 
ATOM   7827  C  CA    . GLY A 1 1069 ? 33.481  0.265   177.012 1.00 52.02  ? 1068 GLY A CA    1 
ATOM   7828  C  C     . GLY A 1 1069 ? 33.045  -0.286  178.359 1.00 49.68  ? 1068 GLY A C     1 
ATOM   7829  O  O     . GLY A 1 1069 ? 31.904  -0.135  178.780 1.00 51.01  ? 1068 GLY A O     1 
ATOM   7830  N  N     . GLY A 1 1070 ? 33.979  -0.948  179.029 1.00 49.75  ? 1069 GLY A N     1 
ATOM   7831  C  CA    . GLY A 1 1070 ? 33.683  -1.593  180.289 1.00 51.43  ? 1069 GLY A CA    1 
ATOM   7832  C  C     . GLY A 1 1070 ? 32.903  -2.879  180.171 1.00 52.84  ? 1069 GLY A C     1 
ATOM   7833  O  O     . GLY A 1 1070 ? 32.641  -3.523  181.195 1.00 54.40  ? 1069 GLY A O     1 
ATOM   7834  N  N     . GLU A 1 1071 ? 32.522  -3.268  178.958 1.00 55.86  ? 1070 GLU A N     1 
ATOM   7835  C  CA    . GLU A 1 1071 ? 31.774  -4.497  178.762 1.00 61.32  ? 1070 GLU A CA    1 
ATOM   7836  C  C     . GLU A 1 1071 ? 32.596  -5.695  179.205 1.00 57.75  ? 1070 GLU A C     1 
ATOM   7837  O  O     . GLU A 1 1071 ? 33.793  -5.787  178.930 1.00 55.20  ? 1070 GLU A O     1 
ATOM   7838  C  CB    . GLU A 1 1071 ? 31.379  -4.638  177.298 1.00 68.92  ? 1070 GLU A CB    1 
ATOM   7839  C  CG    . GLU A 1 1071 ? 30.644  -3.431  176.781 1.00 73.75  ? 1070 GLU A CG    1 
ATOM   7840  C  CD    . GLU A 1 1071 ? 30.045  -3.662  175.423 1.00 77.13  ? 1070 GLU A CD    1 
ATOM   7841  O  OE1   . GLU A 1 1071 ? 30.058  -2.717  174.608 1.00 76.63  ? 1070 GLU A OE1   1 
ATOM   7842  O  OE2   . GLU A 1 1071 ? 29.565  -4.789  175.171 1.00 84.46  ? 1070 GLU A OE2   1 
ATOM   7843  N  N     . ALA A 1 1072 ? 31.946  -6.614  179.904 1.00 63.59  ? 1071 ALA A N     1 
ATOM   7844  C  CA    . ALA A 1 1072 ? 32.637  -7.762  180.463 1.00 64.39  ? 1071 ALA A CA    1 
ATOM   7845  C  C     . ALA A 1 1072 ? 32.926  -8.790  179.383 1.00 65.32  ? 1071 ALA A C     1 
ATOM   7846  O  O     . ALA A 1 1072 ? 32.066  -9.103  178.557 1.00 67.94  ? 1071 ALA A O     1 
ATOM   7847  C  CB    . ALA A 1 1072 ? 31.803  -8.393  181.575 1.00 68.13  ? 1071 ALA A CB    1 
ATOM   7848  N  N     . LEU A 1 1073 ? 34.145  -9.301  179.383 1.00 60.56  ? 1072 LEU A N     1 
ATOM   7849  C  CA    . LEU A 1 1073 ? 34.528  -10.416 178.536 1.00 59.50  ? 1072 LEU A CA    1 
ATOM   7850  C  C     . LEU A 1 1073 ? 34.974  -11.565 179.422 1.00 59.01  ? 1072 LEU A C     1 
ATOM   7851  O  O     . LEU A 1 1073 ? 34.932  -11.477 180.648 1.00 59.31  ? 1072 LEU A O     1 
ATOM   7852  C  CB    . LEU A 1 1073 ? 35.642  -10.024 177.566 1.00 56.41  ? 1072 LEU A CB    1 
ATOM   7853  C  CG    . LEU A 1 1073 ? 35.565  -8.655  176.900 1.00 53.98  ? 1072 LEU A CG    1 
ATOM   7854  C  CD1   . LEU A 1 1073 ? 36.914  -8.307  176.327 1.00 52.19  ? 1072 LEU A CD1   1 
ATOM   7855  C  CD2   . LEU A 1 1073 ? 34.508  -8.632  175.809 1.00 53.16  ? 1072 LEU A CD2   1 
ATOM   7856  N  N     . ILE A 1 1074 ? 35.418  -12.649 178.784 1.00 58.44  ? 1073 ILE A N     1 
ATOM   7857  C  CA    . ILE A 1 1074 ? 35.913  -13.784 179.546 1.00 60.70  ? 1073 ILE A CA    1 
ATOM   7858  C  C     . ILE A 1 1074 ? 37.060  -13.335 180.448 1.00 62.67  ? 1073 ILE A C     1 
ATOM   7859  O  O     . ILE A 1 1074 ? 37.739  -12.334 180.190 1.00 63.64  ? 1073 ILE A O     1 
ATOM   7860  C  CB    . ILE A 1 1074 ? 36.346  -14.930 178.620 1.00 60.38  ? 1073 ILE A CB    1 
ATOM   7861  C  CG1   . ILE A 1 1074 ? 37.299  -14.423 177.547 1.00 58.24  ? 1073 ILE A CG1   1 
ATOM   7862  C  CG2   . ILE A 1 1074 ? 35.142  -15.550 177.955 1.00 61.58  ? 1073 ILE A CG2   1 
ATOM   7863  C  CD1   . ILE A 1 1074 ? 37.733  -15.496 176.584 1.00 58.61  ? 1073 ILE A CD1   1 
ATOM   7864  N  N     . LYS A 1 1075 ? 37.264  -14.088 181.533 1.00 73.74  ? 1074 LYS A N     1 
ATOM   7865  C  CA    . LYS A 1 1075 ? 38.142  -13.631 182.604 1.00 75.62  ? 1074 LYS A CA    1 
ATOM   7866  C  C     . LYS A 1 1075 ? 39.564  -13.386 182.120 1.00 74.32  ? 1074 LYS A C     1 
ATOM   7867  O  O     . LYS A 1 1075 ? 40.222  -12.461 182.603 1.00 73.57  ? 1074 LYS A O     1 
ATOM   7868  C  CB    . LYS A 1 1075 ? 38.127  -14.639 183.757 1.00 82.67  ? 1074 LYS A CB    1 
ATOM   7869  C  CG    . LYS A 1 1075 ? 38.963  -14.231 184.975 1.00 86.65  ? 1074 LYS A CG    1 
ATOM   7870  C  CD    . LYS A 1 1075 ? 40.330  -14.900 184.966 1.00 88.41  ? 1074 LYS A CD    1 
ATOM   7871  C  CE    . LYS A 1 1075 ? 41.343  -14.113 185.774 1.00 89.14  ? 1074 LYS A CE    1 
ATOM   7872  N  NZ    . LYS A 1 1075 ? 42.733  -14.427 185.340 1.00 89.87  ? 1074 LYS A NZ    1 
ATOM   7873  N  N     . VAL A 1 1076 ? 40.054  -14.183 181.169 1.00 66.42  ? 1075 VAL A N     1 
ATOM   7874  C  CA    . VAL A 1 1076 ? 41.439  -14.028 180.729 1.00 61.64  ? 1075 VAL A CA    1 
ATOM   7875  C  C     . VAL A 1 1076 ? 41.669  -12.634 180.175 1.00 58.41  ? 1075 VAL A C     1 
ATOM   7876  O  O     . VAL A 1 1076 ? 42.736  -12.042 180.370 1.00 62.77  ? 1075 VAL A O     1 
ATOM   7877  C  CB    . VAL A 1 1076 ? 41.805  -15.096 179.687 1.00 58.34  ? 1075 VAL A CB    1 
ATOM   7878  C  CG1   . VAL A 1 1076 ? 43.308  -15.234 179.586 1.00 58.30  ? 1075 VAL A CG1   1 
ATOM   7879  C  CG2   . VAL A 1 1076 ? 41.202  -16.385 180.057 1.00 60.38  ? 1075 VAL A CG2   1 
ATOM   7880  N  N     . LEU A 1 1077 ? 40.679  -12.091 179.472 1.00 55.32  ? 1076 LEU A N     1 
ATOM   7881  C  CA    . LEU A 1 1077 ? 40.800  -10.781 178.855 1.00 52.82  ? 1076 LEU A CA    1 
ATOM   7882  C  C     . LEU A 1 1077 ? 40.211  -9.675  179.711 1.00 52.66  ? 1076 LEU A C     1 
ATOM   7883  O  O     . LEU A 1 1077 ? 40.352  -8.504  179.360 1.00 51.14  ? 1076 LEU A O     1 
ATOM   7884  C  CB    . LEU A 1 1077 ? 40.130  -10.777 177.476 1.00 52.15  ? 1076 LEU A CB    1 
ATOM   7885  C  CG    . LEU A 1 1077 ? 40.362  -12.032 176.642 1.00 52.81  ? 1076 LEU A CG    1 
ATOM   7886  C  CD1   . LEU A 1 1077 ? 39.467  -12.024 175.404 1.00 52.45  ? 1076 LEU A CD1   1 
ATOM   7887  C  CD2   . LEU A 1 1077 ? 41.839  -12.161 176.258 1.00 51.92  ? 1076 LEU A CD2   1 
ATOM   7888  N  N     . GLY A 1 1078 ? 39.563  -10.014 180.815 1.00 54.30  ? 1077 GLY A N     1 
ATOM   7889  C  CA    . GLY A 1 1078 ? 39.056  -8.983  181.698 1.00 54.32  ? 1077 GLY A CA    1 
ATOM   7890  C  C     . GLY A 1 1078 ? 37.893  -8.257  181.068 1.00 53.87  ? 1077 GLY A C     1 
ATOM   7891  O  O     . GLY A 1 1078 ? 36.942  -8.870  180.575 1.00 55.41  ? 1077 GLY A O     1 
ATOM   7892  N  N     . ASN A 1 1079 ? 37.956  -6.934  181.086 1.00 55.70  ? 1078 ASN A N     1 
ATOM   7893  C  CA    . ASN A 1 1079 ? 36.914  -6.094  180.524 1.00 55.78  ? 1078 ASN A CA    1 
ATOM   7894  C  C     . ASN A 1 1079 ? 37.513  -5.195  179.457 1.00 52.02  ? 1078 ASN A C     1 
ATOM   7895  O  O     . ASN A 1 1079 ? 38.687  -4.825  179.529 1.00 49.91  ? 1078 ASN A O     1 
ATOM   7896  C  CB    . ASN A 1 1079 ? 36.241  -5.235  181.597 1.00 57.44  ? 1078 ASN A CB    1 
ATOM   7897  C  CG    . ASN A 1 1079 ? 35.569  -6.060  182.656 1.00 60.25  ? 1078 ASN A CG    1 
ATOM   7898  O  OD1   . ASN A 1 1079 ? 35.111  -7.172  182.395 1.00 64.03  ? 1078 ASN A OD1   1 
ATOM   7899  N  ND2   . ASN A 1 1079 ? 35.507  -5.528  183.868 1.00 61.30  ? 1078 ASN A ND2   1 
ATOM   7900  N  N     . VAL A 1 1080 ? 36.696  -4.845  178.462 1.00 49.69  ? 1079 VAL A N     1 
ATOM   7901  C  CA    . VAL A 1 1080 ? 37.150  -3.923  177.433 1.00 47.89  ? 1079 VAL A CA    1 
ATOM   7902  C  C     . VAL A 1 1080 ? 37.379  -2.546  178.043 1.00 47.24  ? 1079 VAL A C     1 
ATOM   7903  O  O     . VAL A 1 1080 ? 36.630  -2.095  178.916 1.00 48.18  ? 1079 VAL A O     1 
ATOM   7904  C  CB    . VAL A 1 1080 ? 36.140  -3.873  176.272 1.00 47.74  ? 1079 VAL A CB    1 
ATOM   7905  C  CG1   . VAL A 1 1080 ? 34.761  -3.644  176.789 1.00 49.04  ? 1079 VAL A CG1   1 
ATOM   7906  C  CG2   . VAL A 1 1080 ? 36.488  -2.778  175.298 1.00 46.04  ? 1079 VAL A CG2   1 
ATOM   7907  N  N     . ALA A 1 1081 ? 38.439  -1.880  177.588 1.00 45.74  ? 1080 ALA A N     1 
ATOM   7908  C  CA    . ALA A 1 1081 ? 38.750  -0.528  178.027 1.00 45.07  ? 1080 ALA A CA    1 
ATOM   7909  C  C     . ALA A 1 1081 ? 37.529  0.374   177.954 1.00 45.38  ? 1080 ALA A C     1 
ATOM   7910  O  O     . ALA A 1 1081 ? 36.831  0.411   176.939 1.00 45.11  ? 1080 ALA A O     1 
ATOM   7911  C  CB    . ALA A 1 1081 ? 39.870  0.049   177.164 1.00 43.42  ? 1080 ALA A CB    1 
ATOM   7912  N  N     . ASN A 1 1082 ? 37.285  1.119   179.036 1.00 50.25  ? 1081 ASN A N     1 
ATOM   7913  C  CA    . ASN A 1 1082 ? 36.189  2.082   179.053 1.00 54.32  ? 1081 ASN A CA    1 
ATOM   7914  C  C     . ASN A 1 1082 ? 36.288  3.083   177.912 1.00 51.83  ? 1081 ASN A C     1 
ATOM   7915  O  O     . ASN A 1 1082 ? 35.302  3.757   177.599 1.00 52.22  ? 1081 ASN A O     1 
ATOM   7916  C  CB    . ASN A 1 1082 ? 36.156  2.819   180.394 1.00 57.15  ? 1081 ASN A CB    1 
ATOM   7917  C  CG    . ASN A 1 1082 ? 36.062  1.874   181.571 1.00 59.35  ? 1081 ASN A CG    1 
ATOM   7918  O  OD1   . ASN A 1 1082 ? 36.691  0.817   181.578 1.00 60.58  ? 1081 ASN A OD1   1 
ATOM   7919  N  ND2   . ASN A 1 1082 ? 35.263  2.240   182.567 1.00 61.03  ? 1081 ASN A ND2   1 
ATOM   7920  N  N     . SER A 1 1083 ? 37.452  3.183   177.277 1.00 54.13  ? 1082 SER A N     1 
ATOM   7921  C  CA    . SER A 1 1083 ? 37.643  4.077   176.148 1.00 52.34  ? 1082 SER A CA    1 
ATOM   7922  C  C     . SER A 1 1083 ? 36.937  3.605   174.888 1.00 51.59  ? 1082 SER A C     1 
ATOM   7923  O  O     . SER A 1 1083 ? 36.848  4.381   173.936 1.00 50.83  ? 1082 SER A O     1 
ATOM   7924  C  CB    . SER A 1 1083 ? 39.137  4.233   175.875 1.00 51.42  ? 1082 SER A CB    1 
ATOM   7925  O  OG    . SER A 1 1083 ? 39.841  4.379   177.092 1.00 49.93  ? 1082 SER A OG    1 
ATOM   7926  N  N     . GLY A 1 1084 ? 36.451  2.360   174.851 1.00 49.94  ? 1083 GLY A N     1 
ATOM   7927  C  CA    . GLY A 1 1084 ? 35.666  1.839   173.748 1.00 48.03  ? 1083 GLY A CA    1 
ATOM   7928  C  C     . GLY A 1 1084 ? 36.369  0.766   172.932 1.00 46.09  ? 1083 GLY A C     1 
ATOM   7929  O  O     . GLY A 1 1084 ? 35.712  -0.168  172.460 1.00 46.76  ? 1083 GLY A O     1 
ATOM   7930  N  N     . GLN A 1 1085 ? 37.683  0.876   172.764 1.00 42.06  ? 1084 GLN A N     1 
ATOM   7931  C  CA    . GLN A 1 1085 ? 38.447  -0.026  171.914 1.00 40.89  ? 1084 GLN A CA    1 
ATOM   7932  C  C     . GLN A 1 1085 ? 38.894  -1.256  172.694 1.00 41.76  ? 1084 GLN A C     1 
ATOM   7933  O  O     . GLN A 1 1085 ? 39.531  -1.135  173.744 1.00 42.76  ? 1084 GLN A O     1 
ATOM   7934  C  CB    . GLN A 1 1085 ? 39.671  0.691   171.348 1.00 39.45  ? 1084 GLN A CB    1 
ATOM   7935  C  CG    . GLN A 1 1085 ? 39.383  1.590   170.169 1.00 38.55  ? 1084 GLN A CG    1 
ATOM   7936  C  CD    . GLN A 1 1085 ? 40.589  2.411   169.774 1.00 37.31  ? 1084 GLN A CD    1 
ATOM   7937  O  OE1   . GLN A 1 1085 ? 40.900  3.422   170.406 1.00 37.09  ? 1084 GLN A OE1   1 
ATOM   7938  N  NE2   . GLN A 1 1085 ? 41.283  1.975   168.737 1.00 36.61  ? 1084 GLN A NE2   1 
ATOM   7939  N  N     . CYS A 1 1086 ? 38.595  -2.436  172.161 1.00 42.35  ? 1085 CYS A N     1 
ATOM   7940  C  CA    . CYS A 1 1086 ? 38.960  -3.690  172.813 1.00 43.37  ? 1085 CYS A CA    1 
ATOM   7941  C  C     . CYS A 1 1086 ? 40.350  -4.076  172.343 1.00 42.56  ? 1085 CYS A C     1 
ATOM   7942  O  O     . CYS A 1 1086 ? 40.521  -4.585  171.238 1.00 42.21  ? 1085 CYS A O     1 
ATOM   7943  C  CB    . CYS A 1 1086 ? 37.953  -4.785  172.501 1.00 44.63  ? 1085 CYS A CB    1 
ATOM   7944  S  SG    . CYS A 1 1086 ? 38.354  -6.358  173.250 1.00 46.10  ? 1085 CYS A SG    1 
ATOM   7945  N  N     . LYS A 1 1087 ? 41.361  -3.816  173.152 1.00 42.37  ? 1086 LYS A N     1 
ATOM   7946  C  CA    . LYS A 1 1087 ? 42.712  -4.176  172.786 1.00 41.70  ? 1086 LYS A CA    1 
ATOM   7947  C  C     . LYS A 1 1087 ? 43.251  -5.105  173.832 1.00 42.83  ? 1086 LYS A C     1 
ATOM   7948  O  O     . LYS A 1 1087 ? 43.472  -4.719  174.942 1.00 43.15  ? 1086 LYS A O     1 
ATOM   7949  C  CB    . LYS A 1 1087 ? 43.587  -2.934  172.673 1.00 40.42  ? 1086 LYS A CB    1 
ATOM   7950  C  CG    . LYS A 1 1087 ? 43.181  -1.989  171.580 1.00 39.53  ? 1086 LYS A CG    1 
ATOM   7951  C  CD    . LYS A 1 1087 ? 44.053  -0.774  171.604 1.00 42.14  ? 1086 LYS A CD    1 
ATOM   7952  C  CE    . LYS A 1 1087 ? 43.830  0.091   170.407 1.00 40.87  ? 1086 LYS A CE    1 
ATOM   7953  N  NZ    . LYS A 1 1087 ? 44.039  1.509   170.733 1.00 42.49  ? 1086 LYS A NZ    1 
ATOM   7954  N  N     . LYS A 1 1088 ? 43.493  -6.335  173.441 1.00 43.50  ? 1087 LYS A N     1 
ATOM   7955  C  CA    . LYS A 1 1088 ? 43.961  -7.375  174.332 1.00 44.78  ? 1087 LYS A CA    1 
ATOM   7956  C  C     . LYS A 1 1088 ? 45.138  -8.086  173.694 1.00 44.61  ? 1087 LYS A C     1 
ATOM   7957  O  O     . LYS A 1 1088 ? 45.295  -8.126  172.470 1.00 43.88  ? 1087 LYS A O     1 
ATOM   7958  C  CB    . LYS A 1 1088 ? 42.853  -8.383  174.664 1.00 46.40  ? 1087 LYS A CB    1 
ATOM   7959  C  CG    . LYS A 1 1088 ? 41.617  -7.734  175.252 1.00 46.75  ? 1087 LYS A CG    1 
ATOM   7960  C  CD    . LYS A 1 1088 ? 41.909  -7.044  176.566 1.00 46.88  ? 1087 LYS A CD    1 
ATOM   7961  C  CE    . LYS A 1 1088 ? 40.667  -6.356  177.094 1.00 47.31  ? 1087 LYS A CE    1 
ATOM   7962  N  NZ    . LYS A 1 1088 ? 40.837  -5.861  178.479 1.00 47.82  ? 1087 LYS A NZ    1 
ATOM   7963  N  N     . GLY A 1 1089 ? 45.992  -8.638  174.521 1.00 45.41  ? 1088 GLY A N     1 
ATOM   7964  C  CA    . GLY A 1 1089 ? 47.155  -9.351  174.055 1.00 45.55  ? 1088 GLY A CA    1 
ATOM   7965  C  C     . GLY A 1 1089 ? 46.827  -10.813 174.095 1.00 47.25  ? 1088 GLY A C     1 
ATOM   7966  O  O     . GLY A 1 1089 ? 46.314  -11.275 175.067 1.00 48.56  ? 1088 GLY A O     1 
ATOM   7967  N  N     . LEU A 1 1090 ? 47.111  -11.533 173.031 1.00 47.30  ? 1089 LEU A N     1 
ATOM   7968  C  CA    . LEU A 1 1090 ? 46.764  -12.921 172.975 1.00 50.25  ? 1089 LEU A CA    1 
ATOM   7969  C  C     . LEU A 1 1090 ? 47.927  -13.847 173.077 1.00 53.79  ? 1089 LEU A C     1 
ATOM   7970  O  O     . LEU A 1 1090 ? 47.855  -14.952 172.628 1.00 54.45  ? 1089 LEU A O     1 
ATOM   7971  C  CB    . LEU A 1 1090 ? 46.007  -13.217 171.705 1.00 50.26  ? 1089 LEU A CB    1 
ATOM   7972  C  CG    . LEU A 1 1090 ? 44.741  -12.423 171.540 1.00 48.10  ? 1089 LEU A CG    1 
ATOM   7973  C  CD1   . LEU A 1 1090 ? 43.990  -12.941 170.351 1.00 48.26  ? 1089 LEU A CD1   1 
ATOM   7974  C  CD2   . LEU A 1 1090 ? 43.893  -12.536 172.772 1.00 48.95  ? 1089 LEU A CD2   1 
ATOM   7975  N  N     . GLY A 1 1091 ? 49.001  -13.400 173.678 1.00 65.92  ? 1090 GLY A N     1 
ATOM   7976  C  CA    . GLY A 1 1091 ? 50.154  -14.248 173.844 1.00 70.78  ? 1090 GLY A CA    1 
ATOM   7977  C  C     . GLY A 1 1091 ? 50.301  -14.749 175.259 1.00 75.29  ? 1090 GLY A C     1 
ATOM   7978  O  O     . GLY A 1 1091 ? 51.369  -15.120 175.656 1.00 75.11  ? 1090 GLY A O     1 
ATOM   7979  N  N     . LYS A 1 1092 ? 49.230  -14.733 176.029 1.00 77.84  ? 1091 LYS A N     1 
ATOM   7980  C  CA    . LYS A 1 1092 ? 49.280  -15.230 177.397 1.00 80.80  ? 1091 LYS A CA    1 
ATOM   7981  C  C     . LYS A 1 1092 ? 49.231  -16.765 177.399 1.00 83.82  ? 1091 LYS A C     1 
ATOM   7982  O  O     . LYS A 1 1092 ? 48.827  -17.368 176.411 1.00 86.37  ? 1091 LYS A O     1 
ATOM   7983  C  CB    . LYS A 1 1092 ? 48.151  -14.636 178.236 1.00 82.75  ? 1091 LYS A CB    1 
ATOM   7984  C  CG    . LYS A 1 1092 ? 47.716  -13.239 177.824 1.00 83.46  ? 1091 LYS A CG    1 
ATOM   7985  C  CD    . LYS A 1 1092 ? 47.561  -12.299 178.999 1.00 84.58  ? 1091 LYS A CD    1 
ATOM   7986  C  CE    . LYS A 1 1092 ? 46.108  -11.903 179.211 1.00 85.99  ? 1091 LYS A CE    1 
ATOM   7987  N  NZ    . LYS A 1 1092 ? 45.613  -12.009 180.619 1.00 87.41  ? 1091 LYS A NZ    1 
ATOM   7988  N  N     . SER A 1 1093 ? 49.653  -17.404 178.489 1.00 82.93  ? 1092 SER A N     1 
ATOM   7989  C  CA    . SER A 1 1093 ? 49.663  -18.888 178.539 1.00 83.89  ? 1092 SER A CA    1 
ATOM   7990  C  C     . SER A 1 1093 ? 48.325  -19.621 178.569 1.00 81.51  ? 1092 SER A C     1 
ATOM   7991  O  O     . SER A 1 1093 ? 48.123  -20.679 177.983 1.00 81.68  ? 1092 SER A O     1 
ATOM   7992  C  CB    . SER A 1 1093 ? 50.496  -19.385 179.699 1.00 82.55  ? 1092 SER A CB    1 
ATOM   7993  O  OG    . SER A 1 1093 ? 51.116  -20.591 179.319 1.00 83.46  ? 1092 SER A OG    1 
ATOM   7994  N  N     . ASN A 1 1094 ? 47.433  -19.033 179.312 1.00 85.27  ? 1093 ASN A N     1 
ATOM   7995  C  CA    . ASN A 1 1094 ? 46.104  -19.528 179.494 1.00 85.99  ? 1093 ASN A CA    1 
ATOM   7996  C  C     . ASN A 1 1094 ? 45.191  -19.412 178.296 1.00 84.83  ? 1093 ASN A C     1 
ATOM   7997  O  O     . ASN A 1 1094 ? 43.993  -19.461 178.477 1.00 86.17  ? 1093 ASN A O     1 
ATOM   7998  C  CB    . ASN A 1 1094 ? 45.512  -18.626 180.578 1.00 91.03  ? 1093 ASN A CB    1 
ATOM   7999  C  CG    . ASN A 1 1094 ? 44.579  -19.341 181.523 1.00 93.32  ? 1093 ASN A CG    1 
ATOM   8000  O  OD1   . ASN A 1 1094 ? 44.853  -20.459 181.964 1.00 95.14  ? 1093 ASN A OD1   1 
ATOM   8001  N  ND2   . ASN A 1 1094 ? 43.487  -18.680 181.880 1.00 93.69  ? 1093 ASN A ND2   1 
ATOM   8002  N  N     . ILE A 1 1095 ? 45.707  -19.312 177.082 1.00 81.95  ? 1094 ILE A N     1 
ATOM   8003  C  CA    . ILE A 1 1095 ? 44.822  -19.042 175.961 1.00 81.36  ? 1094 ILE A CA    1 
ATOM   8004  C  C     . ILE A 1 1095 ? 44.704  -19.999 174.815 1.00 81.22  ? 1094 ILE A C     1 
ATOM   8005  O  O     . ILE A 1 1095 ? 45.631  -20.684 174.486 1.00 85.45  ? 1094 ILE A O     1 
ATOM   8006  C  CB    . ILE A 1 1095 ? 45.065  -17.599 175.459 1.00 81.83  ? 1094 ILE A CB    1 
ATOM   8007  C  CG1   . ILE A 1 1095 ? 43.986  -16.696 176.008 1.00 83.06  ? 1094 ILE A CG1   1 
ATOM   8008  C  CG2   . ILE A 1 1095 ? 45.082  -17.484 173.955 1.00 82.49  ? 1094 ILE A CG2   1 
ATOM   8009  C  CD1   . ILE A 1 1095 ? 44.273  -15.236 175.794 1.00 88.76  ? 1094 ILE A CD1   1 
ATOM   8010  N  N     . SER A 1 1096 ? 43.520  -20.004 174.224 1.00 75.80  ? 1095 SER A N     1 
ATOM   8011  C  CA    . SER A 1 1096 ? 43.220  -20.808 173.039 1.00 73.94  ? 1095 SER A CA    1 
ATOM   8012  C  C     . SER A 1 1096 ? 42.445  -19.982 172.019 1.00 67.86  ? 1095 SER A C     1 
ATOM   8013  O  O     . SER A 1 1096 ? 41.413  -19.392 172.352 1.00 67.69  ? 1095 SER A O     1 
ATOM   8014  C  CB    . SER A 1 1096 ? 42.425  -22.061 173.406 1.00 76.02  ? 1095 SER A CB    1 
ATOM   8015  N  N     . ILE A 1 1097 ? 42.930  -19.955 170.777 1.00 64.37  ? 1096 ILE A N     1 
ATOM   8016  C  CA    . ILE A 1 1097 ? 42.330  -19.158 169.713 1.00 61.13  ? 1096 ILE A CA    1 
ATOM   8017  C  C     . ILE A 1 1097 ? 42.195  -20.011 168.461 1.00 60.49  ? 1096 ILE A C     1 
ATOM   8018  O  O     . ILE A 1 1097 ? 43.170  -20.631 168.026 1.00 58.21  ? 1096 ILE A O     1 
ATOM   8019  C  CB    . ILE A 1 1097 ? 43.158  -17.896 169.396 1.00 60.23  ? 1096 ILE A CB    1 
ATOM   8020  C  CG1   . ILE A 1 1097 ? 43.623  -17.204 170.673 1.00 60.79  ? 1096 ILE A CG1   1 
ATOM   8021  C  CG2   . ILE A 1 1097 ? 42.353  -16.923 168.563 1.00 60.50  ? 1096 ILE A CG2   1 
ATOM   8022  C  CD1   . ILE A 1 1097 ? 44.847  -16.356 170.510 1.00 64.10  ? 1096 ILE A CD1   1 
ATOM   8023  N  N     . TYR A 1 1098 ? 40.995  -20.018 167.866 1.00 63.53  ? 1097 TYR A N     1 
ATOM   8024  C  CA    . TYR A 1 1098 ? 40.777  -20.576 166.538 1.00 63.05  ? 1097 TYR A CA    1 
ATOM   8025  C  C     . TYR A 1 1098 ? 40.078  -19.575 165.638 1.00 61.14  ? 1097 TYR A C     1 
ATOM   8026  O  O     . TYR A 1 1098 ? 39.231  -18.791 166.076 1.00 63.29  ? 1097 TYR A O     1 
ATOM   8027  C  CB    . TYR A 1 1098 ? 39.915  -21.815 166.543 1.00 66.42  ? 1097 TYR A CB    1 
ATOM   8028  C  CG    . TYR A 1 1098 ? 40.164  -22.732 167.689 1.00 69.19  ? 1097 TYR A CG    1 
ATOM   8029  C  CD1   . TYR A 1 1098 ? 41.427  -23.187 167.971 1.00 70.01  ? 1097 TYR A CD1   1 
ATOM   8030  C  CD2   . TYR A 1 1098 ? 39.132  -23.145 168.494 1.00 70.56  ? 1097 TYR A CD2   1 
ATOM   8031  C  CE1   . TYR A 1 1098 ? 41.657  -24.027 169.029 1.00 71.34  ? 1097 TYR A CE1   1 
ATOM   8032  C  CE2   . TYR A 1 1098 ? 39.352  -23.989 169.555 1.00 71.75  ? 1097 TYR A CE2   1 
ATOM   8033  C  CZ    . TYR A 1 1098 ? 40.619  -24.426 169.821 1.00 73.70  ? 1097 TYR A CZ    1 
ATOM   8034  O  OH    . TYR A 1 1098 ? 40.857  -25.272 170.883 1.00 78.28  ? 1097 TYR A OH    1 
ATOM   8035  N  N     . LYS A 1 1099 ? 40.416  -19.654 164.361 1.00 56.31  ? 1098 LYS A N     1 
ATOM   8036  C  CA    . LYS A 1 1099 ? 39.733  -18.890 163.336 1.00 55.11  ? 1098 LYS A CA    1 
ATOM   8037  C  C     . LYS A 1 1099 ? 38.388  -19.529 163.008 1.00 56.65  ? 1098 LYS A C     1 
ATOM   8038  O  O     . LYS A 1 1099 ? 38.241  -20.753 163.048 1.00 58.64  ? 1098 LYS A O     1 
ATOM   8039  C  CB    . LYS A 1 1099 ? 40.609  -18.817 162.093 1.00 54.19  ? 1098 LYS A CB    1 
ATOM   8040  C  CG    . LYS A 1 1099 ? 39.882  -18.394 160.848 1.00 53.53  ? 1098 LYS A CG    1 
ATOM   8041  C  CD    . LYS A 1 1099 ? 40.788  -17.526 160.027 1.00 51.66  ? 1098 LYS A CD    1 
ATOM   8042  C  CE    . LYS A 1 1099 ? 40.369  -17.536 158.569 1.00 51.52  ? 1098 LYS A CE    1 
ATOM   8043  N  NZ    . LYS A 1 1099 ? 41.566  -17.407 157.700 1.00 50.67  ? 1098 LYS A NZ    1 
ATOM   8044  N  N     . VAL A 1 1100 ? 37.394  -18.700 162.710 1.00 55.87  ? 1099 VAL A N     1 
ATOM   8045  C  CA    . VAL A 1 1100 ? 36.050  -19.180 162.415 1.00 57.31  ? 1099 VAL A CA    1 
ATOM   8046  C  C     . VAL A 1 1100 ? 35.600  -18.588 161.093 1.00 56.29  ? 1099 VAL A C     1 
ATOM   8047  O  O     . VAL A 1 1100 ? 35.569  -17.361 160.939 1.00 54.51  ? 1099 VAL A O     1 
ATOM   8048  C  CB    . VAL A 1 1100 ? 35.051  -18.815 163.518 1.00 57.83  ? 1099 VAL A CB    1 
ATOM   8049  C  CG1   . VAL A 1 1100 ? 33.658  -19.276 163.123 1.00 59.37  ? 1099 VAL A CG1   1 
ATOM   8050  C  CG2   . VAL A 1 1100 ? 35.480  -19.433 164.826 1.00 58.98  ? 1099 VAL A CG2   1 
ATOM   8051  N  N     . ARG A 1 1101 ? 35.252  -19.449 160.147 1.00 57.52  ? 1100 ARG A N     1 
ATOM   8052  C  CA    . ARG A 1 1101 ? 34.687  -19.048 158.869 1.00 56.96  ? 1100 ARG A CA    1 
ATOM   8053  C  C     . ARG A 1 1101 ? 33.174  -19.193 158.919 1.00 58.26  ? 1100 ARG A C     1 
ATOM   8054  O  O     . ARG A 1 1101 ? 32.650  -20.091 159.582 1.00 60.20  ? 1100 ARG A O     1 
ATOM   8055  C  CB    . ARG A 1 1101 ? 35.248  -19.918 157.737 1.00 65.91  ? 1100 ARG A CB    1 
ATOM   8056  C  CG    . ARG A 1 1101 ? 34.640  -19.664 156.375 1.00 66.29  ? 1100 ARG A CG    1 
ATOM   8057  C  CD    . ARG A 1 1101 ? 35.679  -19.423 155.317 1.00 66.08  ? 1100 ARG A CD    1 
ATOM   8058  N  NE    . ARG A 1 1101 ? 36.617  -20.536 155.168 1.00 71.20  ? 1100 ARG A NE    1 
ATOM   8059  C  CZ    . ARG A 1 1101 ? 37.936  -20.400 154.990 1.00 72.58  ? 1100 ARG A CZ    1 
ATOM   8060  N  NH1   . ARG A 1 1101 ? 38.690  -21.493 154.862 1.00 74.81  ? 1100 ARG A NH1   1 
ATOM   8061  N  NH2   . ARG A 1 1101 ? 38.531  -19.193 154.934 1.00 72.59  ? 1100 ARG A NH2   1 
ATOM   8062  N  N     . THR A 1 1102 ? 32.472  -18.314 158.215 1.00 57.33  ? 1101 THR A N     1 
ATOM   8063  C  CA    . THR A 1 1102 ? 31.043  -18.483 158.009 1.00 58.67  ? 1101 THR A CA    1 
ATOM   8064  C  C     . THR A 1 1102 ? 30.700  -18.338 156.532 1.00 58.41  ? 1101 THR A C     1 
ATOM   8065  O  O     . THR A 1 1102 ? 31.341  -17.580 155.796 1.00 56.66  ? 1101 THR A O     1 
ATOM   8066  C  CB    . THR A 1 1102 ? 30.209  -17.475 158.816 1.00 58.17  ? 1101 THR A CB    1 
ATOM   8067  O  OG1   . THR A 1 1102 ? 30.342  -16.166 158.254 1.00 56.12  ? 1101 THR A OG1   1 
ATOM   8068  C  CG2   . THR A 1 1102 ? 30.648  -17.451 160.262 1.00 58.18  ? 1101 THR A CG2   1 
ATOM   8069  N  N     . ASP A 1 1103 ? 29.693  -19.089 156.094 1.00 66.51  ? 1102 ASP A N     1 
ATOM   8070  C  CA    . ASP A 1 1103 ? 29.077  -18.773 154.817 1.00 67.01  ? 1102 ASP A CA    1 
ATOM   8071  C  C     . ASP A 1 1103 ? 28.263  -17.493 154.978 1.00 66.83  ? 1102 ASP A C     1 
ATOM   8072  O  O     . ASP A 1 1103 ? 28.152  -16.928 156.070 1.00 64.87  ? 1102 ASP A O     1 
ATOM   8073  C  CB    . ASP A 1 1103 ? 28.234  -19.943 154.311 1.00 71.73  ? 1102 ASP A CB    1 
ATOM   8074  C  CG    . ASP A 1 1103 ? 27.164  -20.379 155.292 1.00 75.73  ? 1102 ASP A CG    1 
ATOM   8075  O  OD1   . ASP A 1 1103 ? 26.638  -19.524 156.027 1.00 76.57  ? 1102 ASP A OD1   1 
ATOM   8076  O  OD2   . ASP A 1 1103 ? 26.839  -21.585 155.320 1.00 79.00  ? 1102 ASP A OD2   1 
ATOM   8077  N  N     . VAL A 1 1104 ? 27.673  -17.024 153.888 1.00 58.81  ? 1103 VAL A N     1 
ATOM   8078  C  CA    . VAL A 1 1104 ? 26.975  -15.747 153.942 1.00 57.80  ? 1103 VAL A CA    1 
ATOM   8079  C  C     . VAL A 1 1104 ? 25.684  -15.899 154.730 1.00 59.46  ? 1103 VAL A C     1 
ATOM   8080  O  O     . VAL A 1 1104 ? 24.966  -14.922 154.961 1.00 59.02  ? 1103 VAL A O     1 
ATOM   8081  C  CB    . VAL A 1 1104 ? 26.711  -15.198 152.533 1.00 57.16  ? 1103 VAL A CB    1 
ATOM   8082  C  CG1   . VAL A 1 1104 ? 28.005  -15.226 151.716 1.00 55.85  ? 1103 VAL A CG1   1 
ATOM   8083  C  CG2   . VAL A 1 1104 ? 25.624  -16.001 151.862 1.00 59.22  ? 1103 VAL A CG2   1 
ATOM   8084  N  N     . LEU A 1 1105 ? 25.399  -17.117 155.178 1.00 61.47  ? 1104 LEU A N     1 
ATOM   8085  C  CA    . LEU A 1 1105 ? 24.192  -17.395 155.936 1.00 63.34  ? 1104 LEU A CA    1 
ATOM   8086  C  C     . LEU A 1 1105 ? 24.400  -17.301 157.439 1.00 63.35  ? 1104 LEU A C     1 
ATOM   8087  O  O     . LEU A 1 1105 ? 23.415  -17.217 158.178 1.00 64.58  ? 1104 LEU A O     1 
ATOM   8088  C  CB    . LEU A 1 1105 ? 23.657  -18.788 155.585 1.00 65.82  ? 1104 LEU A CB    1 
ATOM   8089  C  CG    . LEU A 1 1105 ? 23.294  -19.012 154.120 1.00 66.25  ? 1104 LEU A CG    1 
ATOM   8090  C  CD1   . LEU A 1 1105 ? 23.260  -20.510 153.778 1.00 68.46  ? 1104 LEU A CD1   1 
ATOM   8091  C  CD2   . LEU A 1 1105 ? 21.953  -18.344 153.809 1.00 66.81  ? 1104 LEU A CD2   1 
ATOM   8092  N  N     . GLY A 1 1106 ? 25.642  -17.321 157.906 1.00 62.15  ? 1105 GLY A N     1 
ATOM   8093  C  CA    . GLY A 1 1106 ? 25.918  -17.324 159.323 1.00 62.28  ? 1105 GLY A CA    1 
ATOM   8094  C  C     . GLY A 1 1106 ? 26.324  -18.659 159.903 1.00 63.92  ? 1105 GLY A C     1 
ATOM   8095  O  O     . GLY A 1 1106 ? 26.475  -18.758 161.123 1.00 64.33  ? 1105 GLY A O     1 
ATOM   8096  N  N     . ASN A 1 1107 ? 26.516  -19.681 159.079 1.00 64.96  ? 1106 ASN A N     1 
ATOM   8097  C  CA    . ASN A 1 1107 ? 26.876  -20.999 159.581 1.00 66.76  ? 1106 ASN A CA    1 
ATOM   8098  C  C     . ASN A 1 1107 ? 28.378  -21.065 159.802 1.00 65.46  ? 1106 ASN A C     1 
ATOM   8099  O  O     . ASN A 1 1107 ? 29.156  -20.956 158.851 1.00 64.27  ? 1106 ASN A O     1 
ATOM   8100  C  CB    . ASN A 1 1107 ? 26.420  -22.081 158.608 1.00 68.65  ? 1106 ASN A CB    1 
ATOM   8101  C  CG    . ASN A 1 1107 ? 24.936  -22.046 158.370 1.00 70.10  ? 1106 ASN A CG    1 
ATOM   8102  O  OD1   . ASN A 1 1107 ? 24.484  -22.006 157.230 1.00 70.21  ? 1106 ASN A OD1   1 
ATOM   8103  N  ND2   . ASN A 1 1107 ? 24.164  -22.048 159.451 1.00 71.30  ? 1106 ASN A ND2   1 
ATOM   8104  N  N     . GLN A 1 1108 ? 28.779  -21.267 161.050 1.00 65.81  ? 1107 GLN A N     1 
ATOM   8105  C  CA    . GLN A 1 1108 ? 30.171  -21.165 161.449 1.00 66.90  ? 1107 GLN A CA    1 
ATOM   8106  C  C     . GLN A 1 1108 ? 30.901  -22.493 161.287 1.00 67.35  ? 1107 GLN A C     1 
ATOM   8107  O  O     . GLN A 1 1108 ? 30.339  -23.569 161.503 1.00 68.33  ? 1107 GLN A O     1 
ATOM   8108  C  CB    . GLN A 1 1108 ? 30.263  -20.707 162.901 1.00 67.31  ? 1107 GLN A CB    1 
ATOM   8109  C  CG    . GLN A 1 1108 ? 29.354  -19.544 163.241 1.00 66.83  ? 1107 GLN A CG    1 
ATOM   8110  C  CD    . GLN A 1 1108 ? 29.377  -19.201 164.719 1.00 67.22  ? 1107 GLN A CD    1 
ATOM   8111  O  OE1   . GLN A 1 1108 ? 30.006  -19.894 165.524 1.00 67.82  ? 1107 GLN A OE1   1 
ATOM   8112  N  NE2   . GLN A 1 1108 ? 28.692  -18.126 165.083 1.00 66.90  ? 1107 GLN A NE2   1 
ATOM   8113  N  N     . HIS A 1 1109 ? 32.172  -22.402 160.909 1.00 64.85  ? 1108 HIS A N     1 
ATOM   8114  C  CA    . HIS A 1 1109 ? 33.075  -23.542 160.869 1.00 68.25  ? 1108 HIS A CA    1 
ATOM   8115  C  C     . HIS A 1 1109 ? 34.323  -23.177 161.649 1.00 66.29  ? 1108 HIS A C     1 
ATOM   8116  O  O     . HIS A 1 1109 ? 34.896  -22.105 161.437 1.00 62.32  ? 1108 HIS A O     1 
ATOM   8117  C  CB    . HIS A 1 1109 ? 33.463  -23.914 159.438 1.00 74.16  ? 1108 HIS A CB    1 
ATOM   8118  C  CG    . HIS A 1 1109 ? 32.325  -23.866 158.471 1.00 78.44  ? 1108 HIS A CG    1 
ATOM   8119  N  ND1   . HIS A 1 1109 ? 31.078  -24.375 158.763 1.00 81.42  ? 1108 HIS A ND1   1 
ATOM   8120  C  CD2   . HIS A 1 1109 ? 32.246  -23.371 157.214 1.00 78.63  ? 1108 HIS A CD2   1 
ATOM   8121  C  CE1   . HIS A 1 1109 ? 30.279  -24.197 157.726 1.00 83.18  ? 1108 HIS A CE1   1 
ATOM   8122  N  NE2   . HIS A 1 1109 ? 30.963  -23.588 156.773 1.00 80.76  ? 1108 HIS A NE2   1 
ATOM   8123  N  N     . ILE A 1 1110 ? 34.750  -24.062 162.532 1.00 67.87  ? 1109 ILE A N     1 
ATOM   8124  C  CA    . ILE A 1 1110 ? 35.942  -23.807 163.323 1.00 67.41  ? 1109 ILE A CA    1 
ATOM   8125  C  C     . ILE A 1 1110 ? 37.160  -24.194 162.495 1.00 71.56  ? 1109 ILE A C     1 
ATOM   8126  O  O     . ILE A 1 1110 ? 37.209  -25.282 161.909 1.00 81.82  ? 1109 ILE A O     1 
ATOM   8127  C  CB    . ILE A 1 1110 ? 35.896  -24.574 164.655 1.00 67.04  ? 1109 ILE A CB    1 
ATOM   8128  C  CG1   . ILE A 1 1110 ? 34.846  -23.983 165.612 1.00 67.12  ? 1109 ILE A CG1   1 
ATOM   8129  C  CG2   . ILE A 1 1110 ? 37.266  -24.565 165.314 1.00 66.44  ? 1109 ILE A CG2   1 
ATOM   8130  C  CD1   . ILE A 1 1110 ? 33.382  -24.119 165.192 1.00 68.24  ? 1109 ILE A CD1   1 
ATOM   8131  N  N     . ILE A 1 1111 ? 38.132  -23.293 162.416 1.00 67.64  ? 1110 ILE A N     1 
ATOM   8132  C  CA    . ILE A 1 1111 ? 39.393  -23.546 161.732 1.00 65.96  ? 1110 ILE A CA    1 
ATOM   8133  C  C     . ILE A 1 1111 ? 40.490  -23.451 162.773 1.00 66.22  ? 1110 ILE A C     1 
ATOM   8134  O  O     . ILE A 1 1111 ? 40.687  -22.390 163.376 1.00 64.71  ? 1110 ILE A O     1 
ATOM   8135  C  CB    . ILE A 1 1111 ? 39.651  -22.551 160.591 1.00 62.37  ? 1110 ILE A CB    1 
ATOM   8136  C  CG1   . ILE A 1 1111 ? 38.533  -22.601 159.560 1.00 61.03  ? 1110 ILE A CG1   1 
ATOM   8137  C  CG2   . ILE A 1 1111 ? 40.977  -22.847 159.923 1.00 62.13  ? 1110 ILE A CG2   1 
ATOM   8138  C  CD1   . ILE A 1 1111 ? 38.781  -21.668 158.390 1.00 58.51  ? 1110 ILE A CD1   1 
ATOM   8139  N  N     . LYS A 1 1112 ? 41.203  -24.552 162.984 1.00 69.46  ? 1111 LYS A N     1 
ATOM   8140  C  CA    . LYS A 1 1112 ? 42.322  -24.573 163.908 1.00 70.94  ? 1111 LYS A CA    1 
ATOM   8141  C  C     . LYS A 1 1112 ? 43.673  -24.590 163.207 1.00 71.16  ? 1111 LYS A C     1 
ATOM   8142  O  O     . LYS A 1 1112 ? 44.690  -24.332 163.859 1.00 71.60  ? 1111 LYS A O     1 
ATOM   8143  C  CB    . LYS A 1 1112 ? 42.201  -25.778 164.853 1.00 72.15  ? 1111 LYS A CB    1 
ATOM   8144  C  CG    . LYS A 1 1112 ? 40.809  -25.925 165.460 1.00 70.95  ? 1111 LYS A CG    1 
ATOM   8145  C  CD    . LYS A 1 1112 ? 40.790  -26.904 166.618 1.00 71.75  ? 1111 LYS A CD    1 
ATOM   8146  C  CE    . LYS A 1 1112 ? 39.367  -27.220 167.066 1.00 72.26  ? 1111 LYS A CE    1 
ATOM   8147  N  NZ    . LYS A 1 1112 ? 39.341  -28.143 168.243 1.00 74.73  ? 1111 LYS A NZ    1 
ATOM   8148  N  N     . ASN A 1 1113 ? 43.713  -24.888 161.909 1.00 76.02  ? 1112 ASN A N     1 
ATOM   8149  C  CA    . ASN A 1 1113 ? 44.919  -24.724 161.111 1.00 76.57  ? 1112 ASN A CA    1 
ATOM   8150  C  C     . ASN A 1 1113 ? 44.512  -24.608 159.650 1.00 75.71  ? 1112 ASN A C     1 
ATOM   8151  O  O     . ASN A 1 1113 ? 43.591  -25.294 159.201 1.00 77.16  ? 1112 ASN A O     1 
ATOM   8152  C  CB    . ASN A 1 1113 ? 45.906  -25.886 161.302 1.00 80.67  ? 1112 ASN A CB    1 
ATOM   8153  C  CG    . ASN A 1 1113 ? 47.284  -25.593 160.704 1.00 81.78  ? 1112 ASN A CG    1 
ATOM   8154  O  OD1   . ASN A 1 1113 ? 47.402  -25.153 159.557 1.00 80.28  ? 1112 ASN A OD1   1 
ATOM   8155  N  ND2   . ASN A 1 1113 ? 48.331  -25.830 161.489 1.00 83.35  ? 1112 ASN A ND2   1 
ATOM   8156  N  N     . GLU A 1 1114 ? 45.203  -23.736 158.919 1.00 73.15  ? 1113 GLU A N     1 
ATOM   8157  C  CA    . GLU A 1 1114 ? 44.955  -23.522 157.501 1.00 73.13  ? 1113 GLU A CA    1 
ATOM   8158  C  C     . GLU A 1 1114 ? 45.957  -24.236 156.609 1.00 75.27  ? 1113 GLU A C     1 
ATOM   8159  O  O     . GLU A 1 1114 ? 45.562  -24.873 155.631 1.00 77.93  ? 1113 GLU A O     1 
ATOM   8160  C  CB    . GLU A 1 1114 ? 44.972  -22.025 157.177 1.00 71.45  ? 1113 GLU A CB    1 
ATOM   8161  C  CG    . GLU A 1 1114 ? 43.756  -21.265 157.669 1.00 69.86  ? 1113 GLU A CG    1 
ATOM   8162  C  CD    . GLU A 1 1114 ? 43.677  -19.857 157.104 1.00 66.52  ? 1113 GLU A CD    1 
ATOM   8163  O  OE1   . GLU A 1 1114 ? 42.571  -19.280 157.123 1.00 64.98  ? 1113 GLU A OE1   1 
ATOM   8164  O  OE2   . GLU A 1 1114 ? 44.714  -19.330 156.637 1.00 64.31  ? 1113 GLU A OE2   1 
ATOM   8165  N  N     . GLY A 1 1115 ? 47.241  -24.143 156.916 1.00 71.92  ? 1114 GLY A N     1 
ATOM   8166  C  CA    . GLY A 1 1115 ? 48.236  -24.746 156.053 1.00 74.25  ? 1114 GLY A CA    1 
ATOM   8167  C  C     . GLY A 1 1115 ? 49.573  -24.788 156.751 1.00 72.68  ? 1114 GLY A C     1 
ATOM   8168  O  O     . GLY A 1 1115 ? 49.719  -24.351 157.895 1.00 72.64  ? 1114 GLY A O     1 
ATOM   8169  N  N     . ASP A 1 1116 ? 50.561  -25.329 156.038 1.00 84.24  ? 1115 ASP A N     1 
ATOM   8170  C  CA    . ASP A 1 1116 ? 51.893  -25.441 156.618 1.00 85.55  ? 1115 ASP A CA    1 
ATOM   8171  C  C     . ASP A 1 1116 ? 52.533  -24.071 156.809 1.00 81.55  ? 1115 ASP A C     1 
ATOM   8172  O  O     . ASP A 1 1116 ? 53.090  -23.777 157.875 1.00 78.47  ? 1115 ASP A O     1 
ATOM   8173  C  CB    . ASP A 1 1116 ? 52.776  -26.331 155.748 1.00 91.82  ? 1115 ASP A CB    1 
ATOM   8174  C  CG    . ASP A 1 1116 ? 54.106  -26.628 156.402 1.00 95.70  ? 1115 ASP A CG    1 
ATOM   8175  O  OD1   . ASP A 1 1116 ? 54.117  -26.864 157.628 1.00 97.15  ? 1115 ASP A OD1   1 
ATOM   8176  O  OD2   . ASP A 1 1116 ? 55.138  -26.614 155.700 1.00 97.50  ? 1115 ASP A OD2   1 
ATOM   8177  N  N     . LYS A 1 1117 ? 52.450  -23.222 155.803 1.00 76.65  ? 1116 LYS A N     1 
ATOM   8178  C  CA    . LYS A 1 1117 ? 53.080  -21.913 155.816 1.00 56.01  ? 1116 LYS A CA    1 
ATOM   8179  C  C     . LYS A 1 1117 ? 52.065  -20.839 155.472 1.00 54.10  ? 1116 LYS A C     1 
ATOM   8180  O  O     . LYS A 1 1117 ? 50.991  -21.142 154.954 1.00 54.49  ? 1116 LYS A O     1 
ATOM   8181  C  CB    . LYS A 1 1117 ? 54.248  -21.858 154.827 1.00 56.07  ? 1116 LYS A CB    1 
ATOM   8182  C  CG    . LYS A 1 1117 ? 55.453  -22.666 155.287 1.00 58.10  ? 1116 LYS A CG    1 
ATOM   8183  C  CD    . LYS A 1 1117 ? 56.614  -22.558 154.319 1.00 57.83  ? 1116 LYS A CD    1 
ATOM   8184  C  CE    . LYS A 1 1117 ? 56.527  -21.287 153.485 1.00 55.68  ? 1116 LYS A CE    1 
ATOM   8185  N  NZ    . LYS A 1 1117 ? 57.348  -21.373 152.242 1.00 56.14  ? 1116 LYS A NZ    1 
ATOM   8186  N  N     . PRO A 1 1118 ? 52.354  -19.575 155.781 1.00 53.31  ? 1117 PRO A N     1 
ATOM   8187  C  CA    . PRO A 1 1118 ? 51.438  -18.498 155.381 1.00 52.01  ? 1117 PRO A CA    1 
ATOM   8188  C  C     . PRO A 1 1118 ? 51.412  -18.330 153.872 1.00 52.45  ? 1117 PRO A C     1 
ATOM   8189  O  O     . PRO A 1 1118 ? 52.359  -18.682 153.168 1.00 52.59  ? 1117 PRO A O     1 
ATOM   8190  C  CB    . PRO A 1 1118 ? 52.025  -17.258 156.060 1.00 48.87  ? 1117 PRO A CB    1 
ATOM   8191  C  CG    . PRO A 1 1118 ? 53.348  -17.671 156.634 1.00 49.47  ? 1117 PRO A CG    1 
ATOM   8192  C  CD    . PRO A 1 1118 ? 53.308  -19.140 156.824 1.00 51.68  ? 1117 PRO A CD    1 
ATOM   8193  N  N     . LYS A 1 1119 ? 50.294  -17.800 153.385 1.00 53.91  ? 1118 LYS A N     1 
ATOM   8194  C  CA    . LYS A 1 1119 ? 50.098  -17.553 151.966 1.00 55.58  ? 1118 LYS A CA    1 
ATOM   8195  C  C     . LYS A 1 1119 ? 50.738  -16.228 151.580 1.00 55.03  ? 1118 LYS A C     1 
ATOM   8196  O  O     . LYS A 1 1119 ? 50.312  -15.171 152.050 1.00 52.14  ? 1118 LYS A O     1 
ATOM   8197  C  CB    . LYS A 1 1119 ? 48.606  -17.538 151.620 1.00 58.90  ? 1118 LYS A CB    1 
ATOM   8198  C  CG    . LYS A 1 1119 ? 48.273  -18.081 150.226 1.00 61.43  ? 1118 LYS A CG    1 
ATOM   8199  C  CD    . LYS A 1 1119 ? 48.043  -19.598 150.291 1.00 64.96  ? 1118 LYS A CD    1 
ATOM   8200  C  CE    . LYS A 1 1119 ? 48.204  -20.260 148.927 1.00 67.31  ? 1118 LYS A CE    1 
ATOM   8201  N  NZ    . LYS A 1 1119 ? 49.549  -20.865 148.723 1.00 69.53  ? 1118 LYS A NZ    1 
ATOM   8202  N  N     . LEU A 1 1120 ? 51.756  -16.275 150.725 1.00 57.64  ? 1119 LEU A N     1 
ATOM   8203  C  CA    . LEU A 1 1120 ? 52.407  -15.074 150.216 1.00 56.98  ? 1119 LEU A CA    1 
ATOM   8204  C  C     . LEU A 1 1120 ? 52.603  -15.169 148.711 1.00 57.88  ? 1119 LEU A C     1 
ATOM   8205  O  O     . LEU A 1 1120 ? 53.673  -14.852 148.186 1.00 57.30  ? 1119 LEU A O     1 
ATOM   8206  C  CB    . LEU A 1 1120 ? 53.743  -14.842 150.912 1.00 56.83  ? 1119 LEU A CB    1 
ATOM   8207  C  CG    . LEU A 1 1120 ? 53.790  -14.951 152.434 1.00 57.22  ? 1119 LEU A CG    1 
ATOM   8208  C  CD1   . LEU A 1 1120 ? 55.223  -14.916 152.937 1.00 58.39  ? 1119 LEU A CD1   1 
ATOM   8209  C  CD2   . LEU A 1 1120 ? 52.982  -13.842 153.074 1.00 55.30  ? 1119 LEU A CD2   1 
ATOM   8210  N  N     . ASP A 1 1121 ? 51.572  -15.613 147.993 1.00 59.85  ? 1120 ASP A N     1 
ATOM   8211  C  CA    . ASP A 1 1121 ? 51.621  -15.709 146.540 1.00 63.45  ? 1120 ASP A CA    1 
ATOM   8212  C  C     . ASP A 1 1121 ? 51.244  -14.369 145.931 1.00 60.16  ? 1120 ASP A C     1 
ATOM   8213  O  O     . ASP A 1 1121 ? 50.183  -13.819 146.241 1.00 55.96  ? 1120 ASP A O     1 
ATOM   8214  C  CB    . ASP A 1 1121 ? 50.669  -16.789 146.026 1.00 69.85  ? 1120 ASP A CB    1 
ATOM   8215  C  CG    . ASP A 1 1121 ? 50.862  -18.117 146.715 1.00 72.19  ? 1120 ASP A CG    1 
ATOM   8216  O  OD1   . ASP A 1 1121 ? 51.810  -18.241 147.514 1.00 73.63  ? 1120 ASP A OD1   1 
ATOM   8217  O  OD2   . ASP A 1 1121 ? 50.064  -19.038 146.457 1.00 75.05  ? 1120 ASP A OD2   1 
ATOM   8218  N  N     . PHE A 1 1122 ? 52.105  -13.855 145.059 1.00 58.24  ? 1121 PHE A N     1 
ATOM   8219  C  CA    . PHE A 1 1122 ? 51.859  -12.567 144.417 1.00 55.52  ? 1121 PHE A CA    1 
ATOM   8220  C  C     . PHE A 1 1122 ? 52.101  -12.640 142.913 1.00 59.59  ? 1121 PHE A C     1 
ATOM   8221  O  O     . PHE A 1 1122 ? 51.429  -11.976 142.122 1.00 63.21  ? 1121 PHE A O     1 
ATOM   8222  C  CB    . PHE A 1 1122 ? 52.741  -11.476 145.039 1.00 48.58  ? 1121 PHE A CB    1 
ATOM   8223  C  CG    . PHE A 1 1122 ? 52.497  -11.259 146.508 1.00 42.70  ? 1121 PHE A CG    1 
ATOM   8224  C  CD1   . PHE A 1 1122 ? 51.423  -10.508 146.945 1.00 41.12  ? 1121 PHE A CD1   1 
ATOM   8225  C  CD2   . PHE A 1 1122 ? 53.344  -11.802 147.450 1.00 42.21  ? 1121 PHE A CD2   1 
ATOM   8226  C  CE1   . PHE A 1 1122 ? 51.193  -10.318 148.295 1.00 40.16  ? 1121 PHE A CE1   1 
ATOM   8227  C  CE2   . PHE A 1 1122 ? 53.121  -11.602 148.804 1.00 41.74  ? 1121 PHE A CE2   1 
ATOM   8228  C  CZ    . PHE A 1 1122 ? 52.043  -10.863 149.220 1.00 40.72  ? 1121 PHE A CZ    1 
ATOM   8229  O  OXT   . PHE A 1 1122 ? 52.977  -13.366 142.443 1.00 62.02  ? 1121 PHE A OXT   1 
ATOM   8230  P  P     . G   B 2 1    ? 1.051   0.409   144.781 1.00 105.10 ? 0    G   B P     1 
ATOM   8231  O  OP1   . G   B 2 1    ? 1.916   1.563   145.125 1.00 105.68 ? 0    G   B OP1   1 
ATOM   8232  O  OP2   . G   B 2 1    ? 0.103   0.526   143.646 1.00 109.70 ? 0    G   B OP2   1 
ATOM   8233  O  "O5'" . G   B 2 1    ? 1.998   -0.829  144.475 1.00 100.07 ? 0    G   B "O5'" 1 
ATOM   8234  C  "C5'" . G   B 2 1    ? 2.279   -1.800  145.471 1.00 96.69  ? 0    G   B "C5'" 1 
ATOM   8235  C  "C4'" . G   B 2 1    ? 2.870   -3.033  144.846 1.00 92.37  ? 0    G   B "C4'" 1 
ATOM   8236  O  "O4'" . G   B 2 1    ? 1.796   -3.903  144.399 1.00 93.78  ? 0    G   B "O4'" 1 
ATOM   8237  C  "C3'" . G   B 2 1    ? 3.684   -2.776  143.587 1.00 86.93  ? 0    G   B "C3'" 1 
ATOM   8238  O  "O3'" . G   B 2 1    ? 5.016   -2.381  143.842 1.00 80.34  ? 0    G   B "O3'" 1 
ATOM   8239  C  "C2'" . G   B 2 1    ? 3.543   -4.084  142.834 1.00 88.03  ? 0    G   B "C2'" 1 
ATOM   8240  O  "O2'" . G   B 2 1    ? 4.330   -5.098  143.439 1.00 86.75  ? 0    G   B "O2'" 1 
ATOM   8241  C  "C1'" . G   B 2 1    ? 2.080   -4.393  143.108 1.00 91.97  ? 0    G   B "C1'" 1 
ATOM   8242  N  N9    . G   B 2 1    ? 1.216   -3.653  142.171 1.00 91.25  ? 0    G   B N9    1 
ATOM   8243  C  C8    . G   B 2 1    ? 0.455   -2.556  142.503 1.00 91.86  ? 0    G   B C8    1 
ATOM   8244  N  N7    . G   B 2 1    ? -0.207  -2.060  141.501 1.00 93.73  ? 0    G   B N7    1 
ATOM   8245  C  C5    . G   B 2 1    ? 0.141   -2.876  140.439 1.00 90.64  ? 0    G   B C5    1 
ATOM   8246  C  C6    . G   B 2 1    ? -0.279  -2.812  139.096 1.00 91.19  ? 0    G   B C6    1 
ATOM   8247  O  O6    . G   B 2 1    ? -1.058  -2.000  138.590 1.00 93.27  ? 0    G   B O6    1 
ATOM   8248  N  N1    . G   B 2 1    ? 0.300   -3.819  138.336 1.00 90.97  ? 0    G   B N1    1 
ATOM   8249  C  C2    . G   B 2 1    ? 1.171   -4.766  138.811 1.00 89.31  ? 0    G   B C2    1 
ATOM   8250  N  N2    . G   B 2 1    ? 1.618   -5.653  137.911 1.00 88.44  ? 0    G   B N2    1 
ATOM   8251  N  N3    . G   B 2 1    ? 1.576   -4.836  140.069 1.00 89.20  ? 0    G   B N3    1 
ATOM   8252  C  C4    . G   B 2 1    ? 1.021   -3.865  140.825 1.00 89.90  ? 0    G   B C4    1 
ATOM   8253  P  P     . G   B 2 2    ? 5.748   -1.364  142.843 1.00 74.51  ? 1    G   B P     1 
ATOM   8254  O  OP1   . G   B 2 2    ? 6.932   -0.814  143.521 1.00 72.02  ? 1    G   B OP1   1 
ATOM   8255  O  OP2   . G   B 2 2    ? 4.758   -0.420  142.293 1.00 75.94  ? 1    G   B OP2   1 
ATOM   8256  O  "O5'" . G   B 2 2    ? 6.283   -2.312  141.695 1.00 74.07  ? 1    G   B "O5'" 1 
ATOM   8257  C  "C5'" . G   B 2 2    ? 6.976   -3.502  142.024 1.00 73.48  ? 1    G   B "C5'" 1 
ATOM   8258  C  "C4'" . G   B 2 2    ? 7.083   -4.416  140.834 1.00 73.96  ? 1    G   B "C4'" 1 
ATOM   8259  O  "O4'" . G   B 2 2    ? 5.762   -4.887  140.449 1.00 76.73  ? 1    G   B "O4'" 1 
ATOM   8260  C  "C3'" . G   B 2 2    ? 7.617   -3.781  139.566 1.00 72.72  ? 1    G   B "C3'" 1 
ATOM   8261  O  "O3'" . G   B 2 2    ? 9.019   -3.644  139.551 1.00 70.20  ? 1    G   B "O3'" 1 
ATOM   8262  C  "C2'" . G   B 2 2    ? 7.084   -4.714  138.501 1.00 74.44  ? 1    G   B "C2'" 1 
ATOM   8263  O  "O2'" . G   B 2 2    ? 7.815   -5.930  138.515 1.00 74.01  ? 1    G   B "O2'" 1 
ATOM   8264  C  "C1'" . G   B 2 2    ? 5.684   -4.980  139.044 1.00 77.09  ? 1    G   B "C1'" 1 
ATOM   8265  N  N9    . G   B 2 2    ? 4.736   -3.952  138.571 1.00 78.24  ? 1    G   B N9    1 
ATOM   8266  C  C8    . G   B 2 2    ? 4.280   -2.862  139.273 1.00 78.36  ? 1    G   B C8    1 
ATOM   8267  N  N7    . G   B 2 2    ? 3.454   -2.118  138.590 1.00 79.62  ? 1    G   B N7    1 
ATOM   8268  C  C5    . G   B 2 2    ? 3.363   -2.752  137.358 1.00 80.32  ? 1    G   B C5    1 
ATOM   8269  C  C6    . G   B 2 2    ? 2.616   -2.408  136.201 1.00 81.80  ? 1    G   B C6    1 
ATOM   8270  O  O6    . G   B 2 2    ? 1.862   -1.442  136.038 1.00 82.81  ? 1    G   B O6    1 
ATOM   8271  N  N1    . G   B 2 2    ? 2.812   -3.324  135.170 1.00 82.15  ? 1    G   B N1    1 
ATOM   8272  C  C2    . G   B 2 2    ? 3.625   -4.428  135.242 1.00 81.26  ? 1    G   B C2    1 
ATOM   8273  N  N2    . G   B 2 2    ? 3.688   -5.193  134.142 1.00 81.92  ? 1    G   B N2    1 
ATOM   8274  N  N3    . G   B 2 2    ? 4.330   -4.757  136.317 1.00 79.91  ? 1    G   B N3    1 
ATOM   8275  C  C4    . G   B 2 2    ? 4.152   -3.882  137.329 1.00 79.49  ? 1    G   B C4    1 
ATOM   8276  P  P     . U   B 2 3    ? 9.668   -2.336  138.896 1.00 68.40  ? 2    U   B P     1 
ATOM   8277  O  OP1   . U   B 2 3    ? 11.133  -2.434  139.081 1.00 66.00  ? 2    U   B OP1   1 
ATOM   8278  O  OP2   . U   B 2 3    ? 8.924   -1.149  139.384 1.00 68.95  ? 2    U   B OP2   1 
ATOM   8279  O  "O5'" . U   B 2 3    ? 9.352   -2.500  137.345 1.00 69.29  ? 2    U   B "O5'" 1 
ATOM   8280  C  "C5'" . U   B 2 3    ? 9.817   -3.636  136.630 1.00 69.35  ? 2    U   B "C5'" 1 
ATOM   8281  C  "C4'" . U   B 2 3    ? 9.202   -3.716  135.257 1.00 70.75  ? 2    U   B "C4'" 1 
ATOM   8282  O  "O4'" . U   B 2 3    ? 7.755   -3.824  135.363 1.00 73.27  ? 2    U   B "O4'" 1 
ATOM   8283  C  "C3'" . U   B 2 3    ? 9.411   -2.501  134.371 1.00 69.90  ? 2    U   B "C3'" 1 
ATOM   8284  O  "O3'" . U   B 2 3    ? 10.680  -2.472  133.750 1.00 67.98  ? 2    U   B "O3'" 1 
ATOM   8285  C  "C2'" . U   B 2 3    ? 8.257   -2.613  133.394 1.00 72.20  ? 2    U   B "C2'" 1 
ATOM   8286  O  "O2'" . U   B 2 3    ? 8.531   -3.624  132.441 1.00 72.64  ? 2    U   B "O2'" 1 
ATOM   8287  C  "C1'" . U   B 2 3    ? 7.145   -3.111  134.312 1.00 74.17  ? 2    U   B "C1'" 1 
ATOM   8288  N  N1    . U   B 2 3    ? 6.365   -1.990  134.885 1.00 74.77  ? 2    U   B N1    1 
ATOM   8289  C  C2    . U   B 2 3    ? 5.410   -1.441  134.060 1.00 76.43  ? 2    U   B C2    1 
ATOM   8290  O  O2    . U   B 2 3    ? 5.216   -1.850  132.937 1.00 77.31  ? 2    U   B O2    1 
ATOM   8291  N  N3    . U   B 2 3    ? 4.691   -0.404  134.582 1.00 78.18  ? 2    U   B N3    1 
ATOM   8292  C  C4    . U   B 2 3    ? 4.829   0.140   135.831 1.00 76.34  ? 2    U   B C4    1 
ATOM   8293  O  O4    . U   B 2 3    ? 4.092   1.078   136.134 1.00 77.30  ? 2    U   B O4    1 
ATOM   8294  C  C5    . U   B 2 3    ? 5.845   -0.472  136.643 1.00 74.56  ? 2    U   B C5    1 
ATOM   8295  C  C6    . U   B 2 3    ? 6.562   -1.494  136.153 1.00 73.86  ? 2    U   B C6    1 
ATOM   8296  P  P     . G   B 2 4    ? 11.254  -1.083  133.199 1.00 66.48  ? 3    G   B P     1 
ATOM   8297  O  OP1   . G   B 2 4    ? 12.691  -1.279  132.910 1.00 64.85  ? 3    G   B OP1   1 
ATOM   8298  O  OP2   . G   B 2 4    ? 10.802  0.010   134.089 1.00 68.25  ? 3    G   B OP2   1 
ATOM   8299  O  "O5'" . G   B 2 4    ? 10.480  -0.873  131.829 1.00 70.77  ? 3    G   B "O5'" 1 
ATOM   8300  C  "C5'" . G   B 2 4    ? 10.585  -1.819  130.777 1.00 71.03  ? 3    G   B "C5'" 1 
ATOM   8301  C  "C4'" . G   B 2 4    ? 9.925   -1.307  129.526 1.00 70.48  ? 3    G   B "C4'" 1 
ATOM   8302  O  "O4'" . G   B 2 4    ? 8.484   -1.417  129.654 1.00 72.46  ? 3    G   B "O4'" 1 
ATOM   8303  C  "C3'" . G   B 2 4    ? 10.149  0.164   129.220 1.00 69.13  ? 3    G   B "C3'" 1 
ATOM   8304  O  "O3'" . G   B 2 4    ? 11.401  0.428   128.616 1.00 67.30  ? 3    G   B "O3'" 1 
ATOM   8305  C  "C2'" . G   B 2 4    ? 8.956   0.494   128.344 1.00 71.94  ? 3    G   B "C2'" 1 
ATOM   8306  O  "O2'" . G   B 2 4    ? 9.141   -0.041  127.044 1.00 74.42  ? 3    G   B "O2'" 1 
ATOM   8307  C  "C1'" . G   B 2 4    ? 7.861   -0.311  129.039 1.00 73.23  ? 3    G   B "C1'" 1 
ATOM   8308  N  N9    . G   B 2 4    ? 7.188   0.490   130.080 1.00 73.62  ? 3    G   B N9    1 
ATOM   8309  C  C8    . G   B 2 4    ? 7.581   0.694   131.386 1.00 73.27  ? 3    G   B C8    1 
ATOM   8310  N  N7    . G   B 2 4    ? 6.770   1.476   132.050 1.00 73.27  ? 3    G   B N7    1 
ATOM   8311  C  C5    . G   B 2 4    ? 5.789   1.815   131.126 1.00 75.22  ? 3    G   B C5    1 
ATOM   8312  C  C6    . G   B 2 4    ? 4.638   2.639   131.242 1.00 77.03  ? 3    G   B C6    1 
ATOM   8313  O  O6    . G   B 2 4    ? 4.220   3.267   132.216 1.00 77.33  ? 3    G   B O6    1 
ATOM   8314  N  N1    . G   B 2 4    ? 3.923   2.702   130.057 1.00 81.56  ? 3    G   B N1    1 
ATOM   8315  C  C2    . G   B 2 4    ? 4.262   2.060   128.895 1.00 79.40  ? 3    G   B C2    1 
ATOM   8316  N  N2    . G   B 2 4    ? 3.446   2.245   127.842 1.00 80.70  ? 3    G   B N2    1 
ATOM   8317  N  N3    . G   B 2 4    ? 5.335   1.297   128.776 1.00 77.12  ? 3    G   B N3    1 
ATOM   8318  C  C4    . G   B 2 4    ? 6.042   1.220   129.913 1.00 75.42  ? 3    G   B C4    1 
ATOM   8319  P  P     . C   B 2 5    ? 12.047  1.891   128.709 1.00 65.68  ? 4    C   B P     1 
ATOM   8320  O  OP1   . C   B 2 5    ? 13.408  1.817   128.138 1.00 63.93  ? 4    C   B OP1   1 
ATOM   8321  O  OP2   . C   B 2 5    ? 11.799  2.442   130.051 1.00 65.29  ? 4    C   B OP2   1 
ATOM   8322  O  "O5'" . C   B 2 5    ? 11.132  2.779   127.767 1.00 67.23  ? 4    C   B "O5'" 1 
ATOM   8323  C  "C5'" . C   B 2 5    ? 11.199  2.677   126.356 1.00 67.85  ? 4    C   B "C5'" 1 
ATOM   8324  C  "C4'" . C   B 2 5    ? 10.308  3.707   125.725 1.00 69.28  ? 4    C   B "C4'" 1 
ATOM   8325  O  "O4'" . C   B 2 5    ? 8.937   3.446   126.113 1.00 71.38  ? 4    C   B "O4'" 1 
ATOM   8326  C  "C3'" . C   B 2 5    ? 10.546  5.129   126.186 1.00 68.34  ? 4    C   B "C3'" 1 
ATOM   8327  O  "O3'" . C   B 2 5    ? 11.630  5.748   125.532 1.00 66.88  ? 4    C   B "O3'" 1 
ATOM   8328  C  "C2'" . C   B 2 5    ? 9.203   5.791   125.930 1.00 70.53  ? 4    C   B "C2'" 1 
ATOM   8329  O  "O2'" . C   B 2 5    ? 9.042   6.086   124.553 1.00 71.48  ? 4    C   B "O2'" 1 
ATOM   8330  C  "C1'" . C   B 2 5    ? 8.248   4.662   126.295 1.00 72.15  ? 4    C   B "C1'" 1 
ATOM   8331  N  N1    . C   B 2 5    ? 7.828   4.746   127.706 1.00 72.18  ? 4    C   B N1    1 
ATOM   8332  C  C2    . C   B 2 5    ? 6.795   5.619   128.027 1.00 73.67  ? 4    C   B C2    1 
ATOM   8333  O  O2    . C   B 2 5    ? 6.282   6.273   127.109 1.00 74.90  ? 4    C   B O2    1 
ATOM   8334  N  N3    . C   B 2 5    ? 6.384   5.718   129.311 1.00 73.85  ? 4    C   B N3    1 
ATOM   8335  C  C4    . C   B 2 5    ? 6.983   4.982   130.249 1.00 72.55  ? 4    C   B C4    1 
ATOM   8336  N  N4    . C   B 2 5    ? 6.560   5.105   131.509 1.00 72.82  ? 4    C   B N4    1 
ATOM   8337  C  C5    . C   B 2 5    ? 8.045   4.083   129.944 1.00 71.01  ? 4    C   B C5    1 
ATOM   8338  C  C6    . C   B 2 5    ? 8.431   3.995   128.669 1.00 70.89  ? 4    C   B C6    1 
ATOM   8339  P  P     . U   B 2 6    ? 12.515  6.808   126.330 1.00 64.96  ? 5    U   B P     1 
ATOM   8340  O  OP1   . U   B 2 6    ? 13.779  7.060   125.603 1.00 63.45  ? 5    U   B OP1   1 
ATOM   8341  O  OP2   . U   B 2 6    ? 12.526  6.327   127.722 1.00 64.31  ? 5    U   B OP2   1 
ATOM   8342  O  "O5'" . U   B 2 6    ? 11.635  8.128   126.293 1.00 66.23  ? 5    U   B "O5'" 1 
ATOM   8343  C  "C5'" . U   B 2 6    ? 11.073  8.596   125.078 1.00 67.74  ? 5    U   B "C5'" 1 
ATOM   8344  C  "C4'" . U   B 2 6    ? 10.014  9.623   125.345 1.00 69.29  ? 5    U   B "C4'" 1 
ATOM   8345  O  "O4'" . U   B 2 6    ? 8.913   9.016   126.054 1.00 70.72  ? 5    U   B "O4'" 1 
ATOM   8346  C  "C3'" . U   B 2 6    ? 10.450  10.760  126.238 1.00 68.20  ? 5    U   B "C3'" 1 
ATOM   8347  O  "O3'" . U   B 2 6    ? 11.119  11.768  125.518 1.00 67.63  ? 5    U   B "O3'" 1 
ATOM   8348  C  "C2'" . U   B 2 6    ? 9.149   11.242  126.846 1.00 70.08  ? 5    U   B "C2'" 1 
ATOM   8349  O  "O2'" . U   B 2 6    ? 8.508   12.127  125.954 1.00 71.73  ? 5    U   B "O2'" 1 
ATOM   8350  C  "C1'" . U   B 2 6    ? 8.339   9.950   126.938 1.00 71.29  ? 5    U   B "C1'" 1 
ATOM   8351  N  N1    . U   B 2 6    ? 8.352   9.388   128.307 1.00 70.61  ? 5    U   B N1    1 
ATOM   8352  C  C2    . U   B 2 6    ? 7.532   9.956   129.259 1.00 71.65  ? 5    U   B C2    1 
ATOM   8353  O  O2    . U   B 2 6    ? 6.796   10.896  129.046 1.00 73.12  ? 5    U   B O2    1 
ATOM   8354  N  N3    . U   B 2 6    ? 7.607   9.380   130.497 1.00 71.01  ? 5    U   B N3    1 
ATOM   8355  C  C4    . U   B 2 6    ? 8.397   8.320   130.878 1.00 69.49  ? 5    U   B C4    1 
ATOM   8356  O  O4    . U   B 2 6    ? 8.340   7.923   132.037 1.00 69.19  ? 5    U   B O4    1 
ATOM   8357  C  C5    . U   B 2 6    ? 9.219   7.786   129.841 1.00 68.51  ? 5    U   B C5    1 
ATOM   8358  C  C6    . U   B 2 6    ? 9.166   8.328   128.622 1.00 69.09  ? 5    U   B C6    1 
ATOM   8359  P  P     . A   B 2 7    ? 12.353  12.523  126.192 1.00 70.37  ? 6    A   B P     1 
ATOM   8360  O  OP1   . A   B 2 7    ? 13.059  13.277  125.130 1.00 72.51  ? 6    A   B OP1   1 
ATOM   8361  O  OP2   . A   B 2 7    ? 13.071  11.498  126.987 1.00 66.68  ? 6    A   B OP2   1 
ATOM   8362  O  "O5'" . A   B 2 7    ? 11.682  13.558  127.194 1.00 68.42  ? 6    A   B "O5'" 1 
ATOM   8363  C  "C5'" . A   B 2 7    ? 11.050  14.726  126.706 1.00 70.12  ? 6    A   B "C5'" 1 
ATOM   8364  C  "C4'" . A   B 2 7    ? 10.232  15.396  127.777 1.00 71.51  ? 6    A   B "C4'" 1 
ATOM   8365  O  "O4'" . A   B 2 7    ? 9.221   14.487  128.272 1.00 72.48  ? 6    A   B "O4'" 1 
ATOM   8366  C  "C3'" . A   B 2 7    ? 10.964  15.819  129.035 1.00 68.81  ? 6    A   B "C3'" 1 
ATOM   8367  O  "O3'" . A   B 2 7    ? 11.715  17.004  128.856 1.00 68.84  ? 6    A   B "O3'" 1 
ATOM   8368  C  "C2'" . A   B 2 7    ? 9.818   15.964  130.027 1.00 69.85  ? 6    A   B "C2'" 1 
ATOM   8369  O  "O2'" . A   B 2 7    ? 9.096   17.163  129.793 1.00 71.48  ? 6    A   B "O2'" 1 
ATOM   8370  C  "C1'" . A   B 2 7    ? 8.925   14.798  129.617 1.00 70.82  ? 6    A   B "C1'" 1 
ATOM   8371  N  N9    . A   B 2 7    ? 9.165   13.610  130.444 1.00 68.92  ? 6    A   B N9    1 
ATOM   8372  C  C8    . A   B 2 7    ? 9.902   12.500  130.135 1.00 67.57  ? 6    A   B C8    1 
ATOM   8373  N  N7    . A   B 2 7    ? 9.925   11.610  131.097 1.00 67.02  ? 6    A   B N7    1 
ATOM   8374  C  C5    . A   B 2 7    ? 9.148   12.178  132.097 1.00 68.66  ? 6    A   B C5    1 
ATOM   8375  C  C6    . A   B 2 7    ? 8.782   11.734  133.377 1.00 69.63  ? 6    A   B C6    1 
ATOM   8376  N  N6    . A   B 2 7    ? 9.165   10.563  133.890 1.00 67.25  ? 6    A   B N6    1 
ATOM   8377  N  N1    . A   B 2 7    ? 7.999   12.544  134.118 1.00 69.49  ? 6    A   B N1    1 
ATOM   8378  C  C2    . A   B 2 7    ? 7.620   13.719  133.605 1.00 70.57  ? 6    A   B C2    1 
ATOM   8379  N  N3    . A   B 2 7    ? 7.896   14.245  132.417 1.00 72.47  ? 6    A   B N3    1 
ATOM   8380  C  C4    . A   B 2 7    ? 8.674   13.413  131.706 1.00 70.02  ? 6    A   B C4    1 
ATOM   8381  P  P     . A   B 2 8    ? 13.074  17.243  129.667 1.00 64.14  ? 7    A   B P     1 
ATOM   8382  O  OP1   . A   B 2 8    ? 13.765  18.393  129.039 1.00 63.89  ? 7    A   B OP1   1 
ATOM   8383  O  OP2   . A   B 2 8    ? 13.781  15.951  129.841 1.00 64.06  ? 7    A   B OP2   1 
ATOM   8384  O  "O5'" . A   B 2 8    ? 12.579  17.744  131.092 1.00 64.54  ? 7    A   B "O5'" 1 
ATOM   8385  C  "C5'" . A   B 2 8    ? 11.813  18.929  131.202 1.00 66.27  ? 7    A   B "C5'" 1 
ATOM   8386  C  "C4'" . A   B 2 8    ? 10.985  18.934  132.457 1.00 67.16  ? 7    A   B "C4'" 1 
ATOM   8387  O  "O4'" . A   B 2 8    ? 10.191  17.725  132.535 1.00 67.87  ? 7    A   B "O4'" 1 
ATOM   8388  C  "C3'" . A   B 2 8    ? 11.755  18.938  133.761 1.00 65.49  ? 7    A   B "C3'" 1 
ATOM   8389  O  "O3'" . A   B 2 8    ? 12.246  20.220  134.097 1.00 65.29  ? 7    A   B "O3'" 1 
ATOM   8390  C  "C2'" . A   B 2 8    ? 10.723  18.397  134.738 1.00 66.62  ? 7    A   B "C2'" 1 
ATOM   8391  O  "O2'" . A   B 2 8    ? 9.757   19.395  135.032 1.00 68.68  ? 7    A   B "O2'" 1 
ATOM   8392  C  "C1'" . A   B 2 8    ? 10.041  17.337  133.882 1.00 67.52  ? 7    A   B "C1'" 1 
ATOM   8393  N  N9    . A   B 2 8    ? 10.639  16.002  134.055 1.00 65.94  ? 7    A   B N9    1 
ATOM   8394  C  C8    . A   B 2 8    ? 11.553  15.362  133.256 1.00 64.48  ? 7    A   B C8    1 
ATOM   8395  N  N7    . A   B 2 8    ? 11.890  14.165  133.678 1.00 63.45  ? 7    A   B N7    1 
ATOM   8396  C  C5    . A   B 2 8    ? 11.143  14.007  134.837 1.00 64.27  ? 7    A   B C5    1 
ATOM   8397  C  C6    . A   B 2 8    ? 11.035  12.956  135.756 1.00 63.96  ? 7    A   B C6    1 
ATOM   8398  N  N6    . A   B 2 8    ? 11.706  11.811  135.662 1.00 62.70  ? 7    A   B N6    1 
ATOM   8399  N  N1    . A   B 2 8    ? 10.199  13.117  136.793 1.00 65.15  ? 7    A   B N1    1 
ATOM   8400  C  C2    . A   B 2 8    ? 9.518   14.262  136.894 1.00 66.56  ? 7    A   B C2    1 
ATOM   8401  N  N3    . A   B 2 8    ? 9.526   15.323  136.097 1.00 67.05  ? 7    A   B N3    1 
ATOM   8402  C  C4    . A   B 2 8    ? 10.370  15.128  135.076 1.00 65.81  ? 7    A   B C4    1 
ATOM   8403  P  P     . G   B 2 9    ? 13.597  20.367  134.939 1.00 63.00  ? 8    G   B P     1 
ATOM   8404  O  OP1   . G   B 2 9    ? 14.006  21.788  134.894 1.00 63.25  ? 8    G   B OP1   1 
ATOM   8405  O  OP2   . G   B 2 9    ? 14.535  19.292  134.541 1.00 61.10  ? 8    G   B OP2   1 
ATOM   8406  O  "O5'" . G   B 2 9    ? 13.145  20.030  136.418 1.00 63.12  ? 8    G   B "O5'" 1 
ATOM   8407  C  "C5'" . G   B 2 9    ? 12.103  20.756  137.037 1.00 65.06  ? 8    G   B "C5'" 1 
ATOM   8408  C  "C4'" . G   B 2 9    ? 11.753  20.129  138.350 1.00 65.00  ? 8    G   B "C4'" 1 
ATOM   8409  O  "O4'" . G   B 2 9    ? 11.137  18.839  138.124 1.00 65.36  ? 8    G   B "O4'" 1 
ATOM   8410  C  "C3'" . G   B 2 9    ? 12.939  19.807  139.234 1.00 62.74  ? 8    G   B "C3'" 1 
ATOM   8411  O  "O3'" . G   B 2 9    ? 13.435  20.937  139.920 1.00 62.49  ? 8    G   B "O3'" 1 
ATOM   8412  C  "C2'" . G   B 2 9    ? 12.395  18.707  140.132 1.00 62.90  ? 8    G   B "C2'" 1 
ATOM   8413  O  "O2'" . G   B 2 9    ? 11.567  19.251  141.145 1.00 64.42  ? 8    G   B "O2'" 1 
ATOM   8414  C  "C1'" . G   B 2 9    ? 11.507  17.944  139.153 1.00 64.14  ? 8    G   B "C1'" 1 
ATOM   8415  N  N9    . G   B 2 9    ? 12.200  16.793  138.551 1.00 62.62  ? 8    G   B N9    1 
ATOM   8416  C  C8    . G   B 2 9    ? 12.802  16.735  137.321 1.00 61.88  ? 8    G   B C8    1 
ATOM   8417  N  N7    . G   B 2 9    ? 13.332  15.568  137.075 1.00 60.67  ? 8    G   B N7    1 
ATOM   8418  C  C5    . G   B 2 9    ? 13.062  14.815  138.208 1.00 60.62  ? 8    G   B C5    1 
ATOM   8419  C  C6    . G   B 2 9    ? 13.384  13.474  138.517 1.00 59.71  ? 8    G   B C6    1 
ATOM   8420  O  O6    . G   B 2 9    ? 13.996  12.657  137.828 1.00 60.05  ? 8    G   B O6    1 
ATOM   8421  N  N1    . G   B 2 9    ? 12.917  13.109  139.773 1.00 60.15  ? 8    G   B N1    1 
ATOM   8422  C  C2    . G   B 2 9    ? 12.225  13.934  140.627 1.00 61.33  ? 8    G   B C2    1 
ATOM   8423  N  N2    . G   B 2 9    ? 11.855  13.405  141.805 1.00 61.90  ? 8    G   B N2    1 
ATOM   8424  N  N3    . G   B 2 9    ? 11.914  15.188  140.343 1.00 62.23  ? 8    G   B N3    1 
ATOM   8425  C  C4    . G   B 2 9    ? 12.361  15.558  139.127 1.00 61.81  ? 8    G   B C4    1 
ATOM   8426  P  P     . A   B 2 10   ? 14.926  20.906  140.488 1.00 60.08  ? 9    A   B P     1 
ATOM   8427  O  OP1   . A   B 2 10   ? 15.433  22.275  140.749 1.00 62.93  ? 9    A   B OP1   1 
ATOM   8428  O  OP2   . A   B 2 10   ? 15.687  19.989  139.611 1.00 58.55  ? 9    A   B OP2   1 
ATOM   8429  O  "O5'" . A   B 2 10   ? 14.728  20.231  141.905 1.00 59.81  ? 9    A   B "O5'" 1 
ATOM   8430  C  "C5'" . A   B 2 10   ? 15.767  19.484  142.481 1.00 57.77  ? 9    A   B "C5'" 1 
ATOM   8431  C  "C4'" . A   B 2 10   ? 15.228  18.341  143.284 1.00 59.21  ? 9    A   B "C4'" 1 
ATOM   8432  O  "O4'" . A   B 2 10   ? 14.424  17.477  142.447 1.00 60.51  ? 9    A   B "O4'" 1 
ATOM   8433  C  "C3'" . A   B 2 10   ? 16.294  17.430  143.842 1.00 58.11  ? 9    A   B "C3'" 1 
ATOM   8434  O  "O3'" . A   B 2 10   ? 16.862  17.968  145.012 1.00 59.18  ? 9    A   B "O3'" 1 
ATOM   8435  C  "C2'" . A   B 2 10   ? 15.547  16.120  144.024 1.00 57.75  ? 9    A   B "C2'" 1 
ATOM   8436  O  "O2'" . A   B 2 10   ? 14.716  16.172  145.173 1.00 58.58  ? 9    A   B "O2'" 1 
ATOM   8437  C  "C1'" . A   B 2 10   ? 14.655  16.129  142.789 1.00 58.76  ? 9    A   B "C1'" 1 
ATOM   8438  N  N9    . A   B 2 10   ? 15.301  15.483  141.635 1.00 56.86  ? 9    A   B N9    1 
ATOM   8439  C  C8    . A   B 2 10   ? 15.671  16.064  140.452 1.00 56.99  ? 9    A   B C8    1 
ATOM   8440  N  N7    . A   B 2 10   ? 16.219  15.235  139.598 1.00 55.72  ? 9    A   B N7    1 
ATOM   8441  C  C5    . A   B 2 10   ? 16.202  14.026  140.265 1.00 55.30  ? 9    A   B C5    1 
ATOM   8442  C  C6    . A   B 2 10   ? 16.637  12.745  139.901 1.00 55.05  ? 9    A   B C6    1 
ATOM   8443  N  N6    . A   B 2 10   ? 17.200  12.449  138.731 1.00 55.93  ? 9    A   B N6    1 
ATOM   8444  N  N1    . A   B 2 10   ? 16.476  11.759  140.803 1.00 55.55  ? 9    A   B N1    1 
ATOM   8445  C  C2    . A   B 2 10   ? 15.913  12.055  141.981 1.00 56.89  ? 9    A   B C2    1 
ATOM   8446  N  N3    . A   B 2 10   ? 15.460  13.217  142.437 1.00 55.94  ? 9    A   B N3    1 
ATOM   8447  C  C4    . A   B 2 10   ? 15.639  14.169  141.518 1.00 55.99  ? 9    A   B C4    1 
ATOM   8448  P  P     . U   B 2 11   ? 18.270  18.735  144.939 1.00 60.62  ? 10   U   B P     1 
ATOM   8449  O  OP1   . U   B 2 11   ? 18.137  20.033  145.644 1.00 65.86  ? 10   U   B OP1   1 
ATOM   8450  O  OP2   . U   B 2 11   ? 18.797  18.748  143.565 1.00 61.73  ? 10   U   B OP2   1 
ATOM   8451  O  "O5'" . U   B 2 11   ? 19.197  17.787  145.809 1.00 58.66  ? 10   U   B "O5'" 1 
ATOM   8452  C  "C5'" . U   B 2 11   ? 19.941  16.752  145.197 1.00 56.44  ? 10   U   B "C5'" 1 
ATOM   8453  C  "C4'" . U   B 2 11   ? 19.497  15.382  145.637 1.00 55.56  ? 10   U   B "C4'" 1 
ATOM   8454  O  "O4'" . U   B 2 11   ? 18.526  14.872  144.687 1.00 56.26  ? 10   U   B "O4'" 1 
ATOM   8455  C  "C3'" . U   B 2 11   ? 20.611  14.345  145.640 1.00 53.49  ? 10   U   B "C3'" 1 
ATOM   8456  O  "O3'" . U   B 2 11   ? 21.323  14.330  146.855 1.00 51.89  ? 10   U   B "O3'" 1 
ATOM   8457  C  "C2'" . U   B 2 11   ? 19.884  13.047  145.345 1.00 54.00  ? 10   U   B "C2'" 1 
ATOM   8458  O  "O2'" . U   B 2 11   ? 19.245  12.559  146.512 1.00 55.08  ? 10   U   B "O2'" 1 
ATOM   8459  C  "C1'" . U   B 2 11   ? 18.805  13.525  144.379 1.00 54.14  ? 10   U   B "C1'" 1 
ATOM   8460  N  N1    . U   B 2 11   ? 19.226  13.463  142.959 1.00 52.14  ? 10   U   B N1    1 
ATOM   8461  C  C2    . U   B 2 11   ? 19.543  12.252  142.376 1.00 53.73  ? 10   U   B C2    1 
ATOM   8462  O  O2    . U   B 2 11   ? 19.535  11.188  142.966 1.00 53.32  ? 10   U   B O2    1 
ATOM   8463  N  N3    . U   B 2 11   ? 19.884  12.333  141.046 1.00 52.23  ? 10   U   B N3    1 
ATOM   8464  C  C4    . U   B 2 11   ? 19.929  13.460  140.251 1.00 50.73  ? 10   U   B C4    1 
ATOM   8465  O  O4    . U   B 2 11   ? 20.259  13.354  139.074 1.00 49.87  ? 10   U   B O4    1 
ATOM   8466  C  C5    . U   B 2 11   ? 19.583  14.670  140.918 1.00 52.26  ? 10   U   B C5    1 
ATOM   8467  C  C6    . U   B 2 11   ? 19.248  14.619  142.210 1.00 52.13  ? 10   U   B C6    1 
ATOM   8468  P  P     . U   B 2 12   ? 22.820  14.881  146.903 1.00 48.96  ? 11   U   B P     1 
ATOM   8469  O  OP1   . U   B 2 12   ? 23.316  14.619  148.254 1.00 49.75  ? 11   U   B OP1   1 
ATOM   8470  O  OP2   . U   B 2 12   ? 22.836  16.268  146.406 1.00 52.29  ? 11   U   B OP2   1 
ATOM   8471  O  "O5'" . U   B 2 12   ? 23.569  13.988  145.827 1.00 47.30  ? 11   U   B "O5'" 1 
ATOM   8472  C  "C5'" . U   B 2 12   ? 24.431  12.954  146.239 1.00 45.95  ? 11   U   B "C5'" 1 
ATOM   8473  C  "C4'" . U   B 2 12   ? 24.146  11.654  145.539 1.00 46.15  ? 11   U   B "C4'" 1 
ATOM   8474  O  "O4'" . U   B 2 12   ? 23.063  11.782  144.590 1.00 47.91  ? 11   U   B "O4'" 1 
ATOM   8475  C  "C3'" . U   B 2 12   ? 25.273  11.091  144.704 1.00 44.06  ? 11   U   B "C3'" 1 
ATOM   8476  O  "O3'" . U   B 2 12   ? 26.313  10.534  145.478 1.00 41.87  ? 11   U   B "O3'" 1 
ATOM   8477  C  "C2'" . U   B 2 12   ? 24.543  10.085  143.834 1.00 45.39  ? 11   U   B "C2'" 1 
ATOM   8478  O  "O2'" . U   B 2 12   ? 24.215  8.914   144.564 1.00 46.37  ? 11   U   B "O2'" 1 
ATOM   8479  C  "C1'" . U   B 2 12   ? 23.244  10.840  143.545 1.00 47.48  ? 11   U   B "C1'" 1 
ATOM   8480  N  N1    . U   B 2 12   ? 23.302  11.543  142.243 1.00 47.23  ? 11   U   B N1    1 
ATOM   8481  C  C2    . U   B 2 12   ? 23.461  10.781  141.099 1.00 48.86  ? 11   U   B C2    1 
ATOM   8482  O  O2    . U   B 2 12   ? 23.543  9.563   141.106 1.00 51.78  ? 11   U   B O2    1 
ATOM   8483  N  N3    . U   B 2 12   ? 23.517  11.491  139.923 1.00 47.52  ? 11   U   B N3    1 
ATOM   8484  C  C4    . U   B 2 12   ? 23.435  12.857  139.787 1.00 48.16  ? 11   U   B C4    1 
ATOM   8485  O  O4    . U   B 2 12   ? 23.503  13.356  138.667 1.00 52.21  ? 11   U   B O4    1 
ATOM   8486  C  C5    . U   B 2 12   ? 23.272  13.573  141.013 1.00 47.08  ? 11   U   B C5    1 
ATOM   8487  C  C6    . U   B 2 12   ? 23.213  12.908  142.165 1.00 47.54  ? 11   U   B C6    1 
ATOM   8488  P  P     . A   B 2 13   ? 27.825  10.737  145.021 1.00 40.48  ? 12   A   B P     1 
ATOM   8489  O  OP1   . A   B 2 13   ? 28.682  10.447  146.175 1.00 42.36  ? 12   A   B OP1   1 
ATOM   8490  O  OP2   . A   B 2 13   ? 27.924  12.056  144.358 1.00 40.92  ? 12   A   B OP2   1 
ATOM   8491  O  "O5'" . A   B 2 13   ? 28.045  9.585   143.948 1.00 40.97  ? 12   A   B "O5'" 1 
ATOM   8492  C  "C5'" . A   B 2 13   ? 27.778  8.228   144.279 1.00 40.34  ? 12   A   B "C5'" 1 
ATOM   8493  C  "C4'" . A   B 2 13   ? 27.870  7.332   143.069 1.00 40.49  ? 12   A   B "C4'" 1 
ATOM   8494  O  "O4'" . A   B 2 13   ? 26.823  7.670   142.130 1.00 41.61  ? 12   A   B "O4'" 1 
ATOM   8495  C  "C3'" . A   B 2 13   ? 29.148  7.447   142.258 1.00 39.44  ? 12   A   B "C3'" 1 
ATOM   8496  O  "O3'" . A   B 2 13   ? 30.206  6.690   142.806 1.00 38.54  ? 12   A   B "O3'" 1 
ATOM   8497  C  "C2'" . A   B 2 13   ? 28.711  6.988   140.870 1.00 40.16  ? 12   A   B "C2'" 1 
ATOM   8498  O  "O2'" . A   B 2 13   ? 28.649  5.573   140.799 1.00 40.48  ? 12   A   B "O2'" 1 
ATOM   8499  C  "C1'" . A   B 2 13   ? 27.292  7.538   140.807 1.00 41.42  ? 12   A   B "C1'" 1 
ATOM   8500  N  N9    . A   B 2 13   ? 27.240  8.867   140.179 1.00 41.50  ? 12   A   B N9    1 
ATOM   8501  C  C8    . A   B 2 13   ? 27.048  10.073  140.793 1.00 41.54  ? 12   A   B C8    1 
ATOM   8502  N  N7    . A   B 2 13   ? 27.054  11.088  139.975 1.00 41.76  ? 12   A   B N7    1 
ATOM   8503  C  C5    . A   B 2 13   ? 27.248  10.506  138.730 1.00 41.84  ? 12   A   B C5    1 
ATOM   8504  C  C6    . A   B 2 13   ? 27.336  11.035  137.436 1.00 42.15  ? 12   A   B C6    1 
ATOM   8505  N  N6    . A   B 2 13   ? 27.246  12.325  137.136 1.00 42.46  ? 12   A   B N6    1 
ATOM   8506  N  N1    . A   B 2 13   ? 27.538  10.174  136.432 1.00 42.24  ? 12   A   B N1    1 
ATOM   8507  C  C2    . A   B 2 13   ? 27.635  8.870   136.701 1.00 42.07  ? 12   A   B C2    1 
ATOM   8508  N  N3    . A   B 2 13   ? 27.565  8.247   137.864 1.00 41.82  ? 12   A   B N3    1 
ATOM   8509  C  C4    . A   B 2 13   ? 27.367  9.136   138.847 1.00 41.69  ? 12   A   B C4    1 
ATOM   8510  P  P     . A   B 2 14   ? 31.705  7.234   142.721 1.00 37.26  ? 13   A   B P     1 
ATOM   8511  O  OP1   . A   B 2 14   ? 32.504  6.458   143.682 1.00 36.61  ? 13   A   B OP1   1 
ATOM   8512  O  OP2   . A   B 2 14   ? 31.722  8.701   142.729 1.00 37.10  ? 13   A   B OP2   1 
ATOM   8513  O  "O5'" . A   B 2 14   ? 32.194  6.771   141.297 1.00 37.24  ? 13   A   B "O5'" 1 
ATOM   8514  C  "C5'" . A   B 2 14   ? 32.037  5.421   140.897 1.00 37.71  ? 13   A   B "C5'" 1 
ATOM   8515  C  "C4'" . A   B 2 14   ? 32.188  5.298   139.410 1.00 38.00  ? 13   A   B "C4'" 1 
ATOM   8516  O  "O4'" . A   B 2 14   ? 31.058  5.919   138.760 1.00 38.90  ? 13   A   B "O4'" 1 
ATOM   8517  C  "C3'" . A   B 2 14   ? 33.384  6.025   138.834 1.00 37.16  ? 13   A   B "C3'" 1 
ATOM   8518  O  "O3'" . A   B 2 14   ? 34.572  5.276   138.948 1.00 36.52  ? 13   A   B "O3'" 1 
ATOM   8519  C  "C2'" . A   B 2 14   ? 32.964  6.276   137.398 1.00 37.85  ? 13   A   B "C2'" 1 
ATOM   8520  O  "O2'" . A   B 2 14   ? 33.134  5.100   136.629 1.00 38.25  ? 13   A   B "O2'" 1 
ATOM   8521  C  "C1'" . A   B 2 14   ? 31.471  6.539   137.565 1.00 38.83  ? 13   A   B "C1'" 1 
ATOM   8522  N  N9    . A   B 2 14   ? 31.184  7.974   137.673 1.00 38.82  ? 13   A   B N9    1 
ATOM   8523  C  C8    . A   B 2 14   ? 30.982  8.692   138.810 1.00 38.58  ? 13   A   B C8    1 
ATOM   8524  N  N7    . A   B 2 14   ? 30.748  9.955   138.592 1.00 38.80  ? 13   A   B N7    1 
ATOM   8525  C  C5    . A   B 2 14   ? 30.786  10.071  137.218 1.00 39.19  ? 13   A   B C5    1 
ATOM   8526  C  C6    . A   B 2 14   ? 30.609  11.158  136.356 1.00 39.66  ? 13   A   B C6    1 
ATOM   8527  N  N6    . A   B 2 14   ? 30.347  12.395  136.753 1.00 39.86  ? 13   A   B N6    1 
ATOM   8528  N  N1    . A   B 2 14   ? 30.720  10.928  135.038 1.00 40.04  ? 13   A   B N1    1 
ATOM   8529  C  C2    . A   B 2 14   ? 30.981  9.689   134.619 1.00 39.98  ? 13   A   B C2    1 
ATOM   8530  N  N3    . A   B 2 14   ? 31.160  8.585   135.325 1.00 39.60  ? 13   A   B N3    1 
ATOM   8531  C  C4    . A   B 2 14   ? 31.054  8.853   136.637 1.00 39.20  ? 13   A   B C4    1 
ATOM   8532  P  P     . U   B 2 15   ? 35.970  6.017   139.120 1.00 35.46  ? 14   U   B P     1 
ATOM   8533  O  OP1   . U   B 2 15   ? 36.974  4.948   139.223 1.00 36.48  ? 14   U   B OP1   1 
ATOM   8534  O  OP2   . U   B 2 15   ? 35.808  7.076   140.136 1.00 35.07  ? 14   U   B OP2   1 
ATOM   8535  O  "O5'" . U   B 2 15   ? 36.221  6.746   137.741 1.00 35.63  ? 14   U   B "O5'" 1 
ATOM   8536  C  "C5'" . U   B 2 15   ? 36.458  6.005   136.560 1.00 36.06  ? 14   U   B "C5'" 1 
ATOM   8537  C  "C4'" . U   B 2 15   ? 36.391  6.888   135.345 1.00 36.41  ? 14   U   B "C4'" 1 
ATOM   8538  O  "O4'" . U   B 2 15   ? 35.075  7.488   135.218 1.00 37.11  ? 14   U   B "O4'" 1 
ATOM   8539  C  "C3'" . U   B 2 15   ? 37.305  8.087   135.328 1.00 35.79  ? 14   U   B "C3'" 1 
ATOM   8540  O  "O3'" . U   B 2 15   ? 38.664  7.779   135.102 1.00 35.29  ? 14   U   B "O3'" 1 
ATOM   8541  C  "C2'" . U   B 2 15   ? 36.671  8.944   134.245 1.00 36.51  ? 14   U   B "C2'" 1 
ATOM   8542  O  "O2'" . U   B 2 15   ? 36.974  8.430   132.957 1.00 36.98  ? 14   U   B "O2'" 1 
ATOM   8543  C  "C1'" . U   B 2 15   ? 35.186  8.711   134.521 1.00 37.22  ? 14   U   B "C1'" 1 
ATOM   8544  N  N1    . U   B 2 15   ? 34.636  9.800   135.347 1.00 37.16  ? 14   U   B N1    1 
ATOM   8545  C  C2    . U   B 2 15   ? 34.242  10.959  134.703 1.00 37.69  ? 14   U   B C2    1 
ATOM   8546  O  O2    . U   B 2 15   ? 34.296  11.126  133.501 1.00 38.19  ? 14   U   B O2    1 
ATOM   8547  N  N3    . U   B 2 15   ? 33.765  11.941  135.525 1.00 37.74  ? 14   U   B N3    1 
ATOM   8548  C  C4    . U   B 2 15   ? 33.664  11.898  136.889 1.00 37.30  ? 14   U   B C4    1 
ATOM   8549  O  O4    . U   B 2 15   ? 33.215  12.869  137.476 1.00 37.53  ? 14   U   B O4    1 
ATOM   8550  C  C5    . U   B 2 15   ? 34.090  10.677  137.478 1.00 36.74  ? 14   U   B C5    1 
ATOM   8551  C  C6    . U   B 2 15   ? 34.559  9.695   136.709 1.00 36.69  ? 14   U   B C6    1 
ATOM   8552  P  P     . C   B 2 16   ? 39.772  8.836   135.563 1.00 34.54  ? 15   C   B P     1 
ATOM   8553  O  OP1   . C   B 2 16   ? 41.122  8.256   135.442 1.00 34.15  ? 15   C   B OP1   1 
ATOM   8554  O  OP2   . C   B 2 16   ? 39.334  9.398   136.856 1.00 34.16  ? 15   C   B OP2   1 
ATOM   8555  O  "O5'" . C   B 2 16   ? 39.700  9.959   134.460 1.00 35.00  ? 15   C   B "O5'" 1 
ATOM   8556  C  "C5'" . C   B 2 16   ? 39.952  9.618   133.111 1.00 35.55  ? 15   C   B "C5'" 1 
ATOM   8557  C  "C4'" . C   B 2 16   ? 39.667  10.764  132.187 1.00 36.12  ? 15   C   B "C4'" 1 
ATOM   8558  O  "O4'" . C   B 2 16   ? 38.270  11.154  132.274 1.00 36.66  ? 15   C   B "O4'" 1 
ATOM   8559  C  "C3'" . C   B 2 16   ? 40.405  12.049  132.480 1.00 35.77  ? 15   C   B "C3'" 1 
ATOM   8560  O  "O3'" . C   B 2 16   ? 41.757  12.018  132.085 1.00 35.54  ? 15   C   B "O3'" 1 
ATOM   8561  C  "C2'" . C   B 2 16   ? 39.563  13.054  131.723 1.00 36.60  ? 15   C   B "C2'" 1 
ATOM   8562  O  "O2'" . C   B 2 16   ? 39.757  12.884  130.323 1.00 37.26  ? 15   C   B "O2'" 1 
ATOM   8563  C  "C1'" . C   B 2 16   ? 38.162  12.545  132.051 1.00 36.94  ? 15   C   B "C1'" 1 
ATOM   8564  N  N1    . C   B 2 16   ? 37.618  13.187  133.266 1.00 36.69  ? 15   C   B N1    1 
ATOM   8565  C  C2    . C   B 2 16   ? 37.132  14.484  133.177 1.00 37.21  ? 15   C   B C2    1 
ATOM   8566  O  O2    . C   B 2 16   ? 37.166  15.058  132.091 1.00 37.86  ? 15   C   B O2    1 
ATOM   8567  N  N3    . C   B 2 16   ? 36.646  15.083  134.289 1.00 37.10  ? 15   C   B N3    1 
ATOM   8568  C  C4    . C   B 2 16   ? 36.623  14.439  135.450 1.00 36.46  ? 15   C   B C4    1 
ATOM   8569  N  N4    . C   B 2 16   ? 36.116  15.067  136.503 1.00 36.48  ? 15   C   B N4    1 
ATOM   8570  C  C5    . C   B 2 16   ? 37.108  13.120  135.576 1.00 35.91  ? 15   C   B C5    1 
ATOM   8571  C  C6    . C   B 2 16   ? 37.593  12.546  134.473 1.00 36.06  ? 15   C   B C6    1 
ATOM   8572  P  P     . A   B 2 17   ? 42.824  12.975  132.796 1.00 34.98  ? 16   A   B P     1 
ATOM   8573  O  OP1   . A   B 2 17   ? 44.190  12.654  132.366 1.00 34.87  ? 16   A   B OP1   1 
ATOM   8574  O  OP2   . A   B 2 17   ? 42.471  13.044  134.216 1.00 34.38  ? 16   A   B OP2   1 
ATOM   8575  O  "O5'" . A   B 2 17   ? 42.493  14.401  132.229 1.00 35.61  ? 16   A   B "O5'" 1 
ATOM   8576  C  "C5'" . A   B 2 17   ? 42.661  14.696  130.859 1.00 36.38  ? 16   A   B "C5'" 1 
ATOM   8577  C  "C4'" . A   B 2 17   ? 42.263  16.116  130.606 1.00 36.99  ? 16   A   B "C4'" 1 
ATOM   8578  O  "O4'" . A   B 2 17   ? 40.911  16.310  131.070 1.00 37.20  ? 16   A   B "O4'" 1 
ATOM   8579  C  "C3'" . A   B 2 17   ? 43.064  17.142  131.369 1.00 36.68  ? 16   A   B "C3'" 1 
ATOM   8580  O  "O3'" . A   B 2 17   ? 44.268  17.448  130.706 1.00 36.91  ? 16   A   B "O3'" 1 
ATOM   8581  C  "C2'" . A   B 2 17   ? 42.103  18.315  131.470 1.00 37.32  ? 16   A   B "C2'" 1 
ATOM   8582  O  "O2'" . A   B 2 17   ? 42.087  19.052  130.262 1.00 38.32  ? 16   A   B "O2'" 1 
ATOM   8583  C  "C1'" . A   B 2 17   ? 40.760  17.604  131.592 1.00 37.40  ? 16   A   B "C1'" 1 
ATOM   8584  N  N9    . A   B 2 17   ? 40.283  17.482  132.977 1.00 36.81  ? 16   A   B N9    1 
ATOM   8585  C  C8    . A   B 2 17   ? 40.231  16.344  133.735 1.00 36.07  ? 16   A   B C8    1 
ATOM   8586  N  N7    . A   B 2 17   ? 39.730  16.507  134.930 1.00 35.77  ? 16   A   B N7    1 
ATOM   8587  C  C5    . A   B 2 17   ? 39.425  17.854  134.950 1.00 36.37  ? 16   A   B C5    1 
ATOM   8588  C  C6    . A   B 2 17   ? 38.871  18.666  135.938 1.00 36.53  ? 16   A   B C6    1 
ATOM   8589  N  N6    . A   B 2 17   ? 38.512  18.212  137.130 1.00 36.04  ? 16   A   B N6    1 
ATOM   8590  N  N1    . A   B 2 17   ? 38.688  19.971  135.657 1.00 37.67  ? 16   A   B N1    1 
ATOM   8591  C  C2    . A   B 2 17   ? 39.053  20.417  134.457 1.00 37.91  ? 16   A   B C2    1 
ATOM   8592  N  N3    . A   B 2 17   ? 39.589  19.753  133.444 1.00 37.82  ? 16   A   B N3    1 
ATOM   8593  C  C4    . A   B 2 17   ? 39.751  18.465  133.759 1.00 37.02  ? 16   A   B C4    1 
ATOM   8594  P  P     . G   B 2 18   ? 45.589  17.806  131.522 1.00 36.35  ? 17   G   B P     1 
ATOM   8595  O  OP1   . G   B 2 18   ? 46.748  17.760  130.603 1.00 36.75  ? 17   G   B OP1   1 
ATOM   8596  O  OP2   . G   B 2 18   ? 45.602  16.974  132.746 1.00 35.38  ? 17   G   B OP2   1 
ATOM   8597  O  "O5'" . G   B 2 18   ? 45.366  19.321  131.919 1.00 36.78  ? 17   G   B "O5'" 1 
ATOM   8598  C  "C5'" . G   B 2 18   ? 45.431  19.741  133.263 1.00 36.24  ? 17   G   B "C5'" 1 
ATOM   8599  C  "C4'" . G   B 2 18   ? 44.696  21.035  133.453 1.00 36.93  ? 17   G   B "C4'" 1 
ATOM   8600  O  "O4'" . G   B 2 18   ? 43.282  20.768  133.615 1.00 37.02  ? 17   G   B "O4'" 1 
ATOM   8601  C  "C3'" . G   B 2 18   ? 45.049  21.824  134.694 1.00 36.69  ? 17   G   B "C3'" 1 
ATOM   8602  O  "O3'" . G   B 2 18   ? 46.263  22.541  134.590 1.00 36.96  ? 17   G   B "O3'" 1 
ATOM   8603  C  "C2'" . G   B 2 18   ? 43.815  22.690  134.872 1.00 37.39  ? 17   G   B "C2'" 1 
ATOM   8604  O  "O2'" . G   B 2 18   ? 43.791  23.726  133.902 1.00 38.53  ? 17   G   B "O2'" 1 
ATOM   8605  C  "C1'" . G   B 2 18   ? 42.721  21.689  134.521 1.00 37.24  ? 17   G   B "C1'" 1 
ATOM   8606  N  N9    . G   B 2 18   ? 42.271  20.930  135.703 1.00 36.42  ? 17   G   B N9    1 
ATOM   8607  C  C8    . G   B 2 18   ? 42.374  19.574  135.865 1.00 35.63  ? 17   G   B C8    1 
ATOM   8608  N  N7    . G   B 2 18   ? 41.893  19.148  136.986 1.00 35.13  ? 17   G   B N7    1 
ATOM   8609  C  C5    . G   B 2 18   ? 41.451  20.290  137.625 1.00 35.58  ? 17   G   B C5    1 
ATOM   8610  C  C6    . G   B 2 18   ? 40.843  20.447  138.895 1.00 35.43  ? 17   G   B C6    1 
ATOM   8611  O  O6    . G   B 2 18   ? 40.564  19.592  139.747 1.00 34.84  ? 17   G   B O6    1 
ATOM   8612  N  N1    . G   B 2 18   ? 40.548  21.775  139.139 1.00 36.20  ? 17   G   B N1    1 
ATOM   8613  C  C2    . G   B 2 18   ? 40.811  22.814  138.293 1.00 37.02  ? 17   G   B C2    1 
ATOM   8614  N  N2    . G   B 2 18   ? 40.451  24.023  138.726 1.00 37.82  ? 17   G   B N2    1 
ATOM   8615  N  N3    . G   B 2 18   ? 41.388  22.683  137.120 1.00 37.15  ? 17   G   B N3    1 
ATOM   8616  C  C4    . G   B 2 18   ? 41.678  21.400  136.848 1.00 36.39  ? 17   G   B C4    1 
ATOM   8617  P  P     . G   B 2 19   ? 47.209  22.664  135.877 1.00 36.32  ? 18   G   B P     1 
ATOM   8618  O  OP1   . G   B 2 19   ? 48.528  23.225  135.516 1.00 36.74  ? 18   G   B OP1   1 
ATOM   8619  O  OP2   . G   B 2 19   ? 47.097  21.360  136.549 1.00 35.27  ? 18   G   B OP2   1 
ATOM   8620  O  "O5'" . G   B 2 19   ? 46.502  23.777  136.764 1.00 36.73  ? 18   G   B "O5'" 1 
ATOM   8621  C  "C5'" . G   B 2 19   ? 46.154  25.018  136.174 1.00 37.91  ? 18   G   B "C5'" 1 
ATOM   8622  C  "C4'" . G   B 2 19   ? 45.304  25.870  137.077 1.00 38.32  ? 18   G   B "C4'" 1 
ATOM   8623  O  "O4'" . G   B 2 19   ? 44.097  25.173  137.454 1.00 37.91  ? 18   G   B "O4'" 1 
ATOM   8624  C  "C3'" . G   B 2 19   ? 45.926  26.273  138.396 1.00 38.00  ? 18   G   B "C3'" 1 
ATOM   8625  O  "O3'" . G   B 2 19   ? 46.805  27.365  138.238 1.00 38.82  ? 18   G   B "O3'" 1 
ATOM   8626  C  "C2'" . G   B 2 19   ? 44.711  26.601  139.246 1.00 38.20  ? 18   G   B "C2'" 1 
ATOM   8627  O  "O2'" . G   B 2 19   ? 44.239  27.905  138.966 1.00 39.54  ? 18   G   B "O2'" 1 
ATOM   8628  C  "C1'" . G   B 2 19   ? 43.688  25.589  138.731 1.00 37.85  ? 18   G   B "C1'" 1 
ATOM   8629  N  N9    . G   B 2 19   ? 43.592  24.398  139.583 1.00 36.70  ? 18   G   B N9    1 
ATOM   8630  C  C8    . G   B 2 19   ? 44.055  23.150  139.273 1.00 35.83  ? 18   G   B C8    1 
ATOM   8631  N  N7    . G   B 2 19   ? 43.815  22.279  140.205 1.00 35.04  ? 18   G   B N7    1 
ATOM   8632  C  C5    . G   B 2 19   ? 43.171  23.002  141.193 1.00 35.37  ? 18   G   B C5    1 
ATOM   8633  C  C6    . G   B 2 19   ? 42.675  22.589  142.445 1.00 34.94  ? 18   G   B C6    1 
ATOM   8634  O  O6    . G   B 2 19   ? 42.716  21.458  142.938 1.00 34.13  ? 18   G   B O6    1 
ATOM   8635  N  N1    . G   B 2 19   ? 42.084  23.638  143.134 1.00 35.66  ? 18   G   B N1    1 
ATOM   8636  C  C2    . G   B 2 19   ? 41.983  24.924  142.677 1.00 36.72  ? 18   G   B C2    1 
ATOM   8637  N  N2    . G   B 2 19   ? 41.379  25.799  143.483 1.00 37.44  ? 18   G   B N2    1 
ATOM   8638  N  N3    . G   B 2 19   ? 42.443  25.322  141.509 1.00 37.15  ? 18   G   B N3    1 
ATOM   8639  C  C4    . G   B 2 19   ? 43.018  24.314  140.824 1.00 36.42  ? 18   G   B C4    1 
ATOM   8640  P  P     . A   B 2 20   ? 48.237  27.381  138.954 1.00 38.39  ? 19   A   B P     1 
ATOM   8641  O  OP1   . A   B 2 20   ? 48.955  28.561  138.420 1.00 39.58  ? 19   A   B OP1   1 
ATOM   8642  O  OP2   . A   B 2 20   ? 48.866  26.046  138.863 1.00 37.28  ? 19   A   B OP2   1 
ATOM   8643  O  "O5'" . A   B 2 20   ? 47.869  27.714  140.456 1.00 38.17  ? 19   A   B "O5'" 1 
ATOM   8644  C  "C5'" . A   B 2 20   ? 47.055  28.830  140.737 1.00 39.19  ? 19   A   B "C5'" 1 
ATOM   8645  C  "C4'" . A   B 2 20   ? 46.466  28.775  142.117 1.00 38.82  ? 19   A   B "C4'" 1 
ATOM   8646  O  "O4'" . A   B 2 20   ? 45.391  27.805  142.200 1.00 38.14  ? 19   A   B "O4'" 1 
ATOM   8647  C  "C3'" . A   B 2 20   ? 47.375  28.360  143.258 1.00 38.32  ? 19   A   B "C3'" 1 
ATOM   8648  O  "O3'" . A   B 2 20   ? 48.336  29.324  143.619 1.00 38.65  ? 19   A   B "O3'" 1 
ATOM   8649  C  "C2'" . A   B 2 20   ? 46.358  28.089  144.343 1.00 37.66  ? 19   A   B "C2'" 1 
ATOM   8650  O  "O2'" . A   B 2 20   ? 45.802  29.320  144.774 1.00 38.82  ? 19   A   B "O2'" 1 
ATOM   8651  C  "C1'" . A   B 2 20   ? 45.295  27.342  143.537 1.00 37.42  ? 19   A   B "C1'" 1 
ATOM   8652  N  N9    . A   B 2 20   ? 45.554  25.893  143.579 1.00 36.16  ? 19   A   B N9    1 
ATOM   8653  C  C8    . A   B 2 20   ? 46.388  25.136  142.799 1.00 35.61  ? 19   A   B C8    1 
ATOM   8654  N  N7    . A   B 2 20   ? 46.417  23.869  143.135 1.00 34.62  ? 19   A   B N7    1 
ATOM   8655  C  C5    . A   B 2 20   ? 45.556  23.792  144.216 1.00 34.49  ? 19   A   B C5    1 
ATOM   8656  C  C6    . A   B 2 20   ? 45.140  22.731  145.027 1.00 33.73  ? 19   A   B C6    1 
ATOM   8657  N  N6    . A   B 2 20   ? 45.551  21.477  144.882 1.00 32.92  ? 19   A   B N6    1 
ATOM   8658  N  N1    . A   B 2 20   ? 44.268  23.003  146.014 1.00 33.96  ? 19   A   B N1    1 
ATOM   8659  C  C2    . A   B 2 20   ? 43.850  24.255  146.175 1.00 34.90  ? 19   A   B C2    1 
ATOM   8660  N  N3    . A   B 2 20   ? 44.167  25.333  145.477 1.00 35.70  ? 19   A   B N3    1 
ATOM   8661  C  C4    . A   B 2 20   ? 45.031  25.030  144.503 1.00 35.43  ? 19   A   B C4    1 
ATOM   8662  P  P     . U   B 2 21   ? 49.635  28.878  144.439 1.00 37.92  ? 20   U   B P     1 
ATOM   8663  O  OP1   . U   B 2 21   ? 50.597  29.990  144.394 1.00 38.94  ? 20   U   B OP1   1 
ATOM   8664  O  OP2   . U   B 2 21   ? 50.095  27.540  144.061 1.00 36.79  ? 20   U   B OP2   1 
ATOM   8665  O  "O5'" . U   B 2 21   ? 49.107  28.787  145.935 1.00 37.55  ? 20   U   B "O5'" 1 
ATOM   8666  C  "C5'" . U   B 2 21   ? 49.434  27.696  146.780 1.00 36.40  ? 20   U   B "C5'" 1 
ATOM   8667  C  "C4'" . U   B 2 21   ? 48.292  27.396  147.711 1.00 36.12  ? 20   U   B "C4'" 1 
ATOM   8668  O  "O4'" . U   B 2 21   ? 47.384  26.457  147.075 1.00 35.57  ? 20   U   B "O4'" 1 
ATOM   8669  C  "C3'" . U   B 2 21   ? 48.641  26.728  149.036 1.00 35.35  ? 20   U   B "C3'" 1 
ATOM   8670  O  "O3'" . U   B 2 21   ? 49.121  27.645  150.006 1.00 36.19  ? 20   U   B "O3'" 1 
ATOM   8671  C  "C2'" . U   B 2 21   ? 47.323  26.077  149.417 1.00 35.00  ? 20   U   B "C2'" 1 
ATOM   8672  O  "O2'" . U   B 2 21   ? 46.425  27.058  149.912 1.00 35.95  ? 20   U   B "O2'" 1 
ATOM   8673  C  "C1'" . U   B 2 21   ? 46.820  25.603  148.045 1.00 34.87  ? 20   U   B "C1'" 1 
ATOM   8674  N  N1    . U   B 2 21   ? 47.266  24.227  147.744 1.00 33.82  ? 20   U   B N1    1 
ATOM   8675  C  C2    . U   B 2 21   ? 46.705  23.178  148.445 1.00 35.56  ? 20   U   B C2    1 
ATOM   8676  O  O2    . U   B 2 21   ? 45.837  23.311  149.281 1.00 35.09  ? 20   U   B O2    1 
ATOM   8677  N  N3    . U   B 2 21   ? 47.195  21.950  148.116 1.00 35.64  ? 20   U   B N3    1 
ATOM   8678  C  C4    . U   B 2 21   ? 48.173  21.672  147.193 1.00 32.74  ? 20   U   B C4    1 
ATOM   8679  O  O4    . U   B 2 21   ? 48.514  20.504  147.011 1.00 35.41  ? 20   U   B O4    1 
ATOM   8680  C  C5    . U   B 2 21   ? 48.715  22.803  146.524 1.00 32.88  ? 20   U   B C5    1 
ATOM   8681  C  C6    . U   B 2 21   ? 48.248  24.011  146.810 1.00 33.67  ? 20   U   B C6    1 
ATOM   8682  P  P     . G   B 2 22   ? 50.315  27.260  151.023 1.00 35.47  ? 21   G   B P     1 
ATOM   8683  O  OP1   . G   B 2 22   ? 50.393  28.367  151.998 1.00 39.21  ? 21   G   B OP1   1 
ATOM   8684  O  OP2   . G   B 2 22   ? 51.528  26.820  150.307 1.00 35.11  ? 21   G   B OP2   1 
ATOM   8685  O  "O5'" . G   B 2 22   ? 49.772  26.014  151.822 1.00 34.47  ? 21   G   B "O5'" 1 
ATOM   8686  C  "C5'" . G   B 2 22   ? 48.726  26.148  152.760 1.00 34.68  ? 21   G   B "C5'" 1 
ATOM   8687  C  "C4'" . G   B 2 22   ? 48.352  24.796  153.304 1.00 33.72  ? 21   G   B "C4'" 1 
ATOM   8688  O  "O4'" . G   B 2 22   ? 47.844  23.968  152.228 1.00 33.23  ? 21   G   B "O4'" 1 
ATOM   8689  C  "C3'" . G   B 2 22   ? 49.499  23.983  153.886 1.00 33.01  ? 21   G   B "C3'" 1 
ATOM   8690  O  "O3'" . G   B 2 22   ? 49.810  24.343  155.215 1.00 33.28  ? 21   G   B "O3'" 1 
ATOM   8691  C  "C2'" . G   B 2 22   ? 48.994  22.563  153.749 1.00 32.16  ? 21   G   B "C2'" 1 
ATOM   8692  O  "O2'" . G   B 2 22   ? 48.026  22.296  154.750 1.00 32.19  ? 21   G   B "O2'" 1 
ATOM   8693  C  "C1'" . G   B 2 22   ? 48.285  22.641  152.396 1.00 32.30  ? 21   G   B "C1'" 1 
ATOM   8694  N  N9    . G   B 2 22   ? 49.190  22.323  151.275 1.00 32.02  ? 21   G   B N9    1 
ATOM   8695  C  C8    . G   B 2 22   ? 49.586  23.199  150.300 1.00 32.58  ? 21   G   B C8    1 
ATOM   8696  N  N7    . G   B 2 22   ? 50.388  22.661  149.427 1.00 32.27  ? 21   G   B N7    1 
ATOM   8697  C  C5    . G   B 2 22   ? 50.528  21.354  149.835 1.00 31.48  ? 21   G   B C5    1 
ATOM   8698  C  C6    . G   B 2 22   ? 51.286  20.299  149.277 1.00 30.98  ? 21   G   B C6    1 
ATOM   8699  O  O6    . G   B 2 22   ? 51.995  20.333  148.280 1.00 31.14  ? 21   G   B O6    1 
ATOM   8700  N  N1    . G   B 2 22   ? 51.178  19.120  150.015 1.00 30.37  ? 21   G   B N1    1 
ATOM   8701  C  C2    . G   B 2 22   ? 50.418  19.007  151.151 1.00 30.26  ? 21   G   B C2    1 
ATOM   8702  N  N2    . G   B 2 22   ? 50.401  17.818  151.743 1.00 29.77  ? 21   G   B N2    1 
ATOM   8703  N  N3    . G   B 2 22   ? 49.706  19.985  151.678 1.00 31.03  ? 21   G   B N3    1 
ATOM   8704  C  C4    . G   B 2 22   ? 49.802  21.127  150.978 1.00 31.31  ? 21   G   B C4    1 
ATOM   8705  P  P     . U   B 2 23   ? 51.332  24.415  155.712 1.00 33.24  ? 22   U   B P     1 
ATOM   8706  O  OP1   . U   B 2 23   ? 51.255  25.003  157.056 1.00 33.77  ? 22   U   B OP1   1 
ATOM   8707  O  OP2   . U   B 2 23   ? 52.200  25.053  154.715 1.00 36.29  ? 22   U   B OP2   1 
ATOM   8708  O  "O5'" . U   B 2 23   ? 51.804  22.903  155.751 1.00 32.24  ? 22   U   B "O5'" 1 
ATOM   8709  C  "C5'" . U   B 2 23   ? 51.239  21.974  156.656 1.00 31.78  ? 22   U   B "C5'" 1 
ATOM   8710  C  "C4'" . U   B 2 23   ? 51.765  20.581  156.405 1.00 31.00  ? 22   U   B "C4'" 1 
ATOM   8711  O  "O4'" . U   B 2 23   ? 51.409  20.140  155.068 1.00 30.71  ? 22   U   B "O4'" 1 
ATOM   8712  C  "C3'" . U   B 2 23   ? 53.272  20.402  156.451 1.00 31.72  ? 22   U   B "C3'" 1 
ATOM   8713  O  "O3'" . U   B 2 23   ? 53.777  20.327  157.770 1.00 33.81  ? 22   U   B "O3'" 1 
ATOM   8714  C  "C2'" . U   B 2 23   ? 53.461  19.114  155.658 1.00 30.72  ? 22   U   B "C2'" 1 
ATOM   8715  O  "O2'" . U   B 2 23   ? 53.081  17.991  156.433 1.00 29.91  ? 22   U   B "O2'" 1 
ATOM   8716  C  "C1'" . U   B 2 23   ? 52.413  19.283  154.564 1.00 30.30  ? 22   U   B "C1'" 1 
ATOM   8717  N  N1    . U   B 2 23   ? 52.968  19.877  153.330 1.00 32.69  ? 22   U   B N1    1 
ATOM   8718  C  C2    . U   B 2 23   ? 53.797  19.128  152.527 1.00 33.90  ? 22   U   B C2    1 
ATOM   8719  O  O2    . U   B 2 23   ? 54.119  17.997  152.775 1.00 35.08  ? 22   U   B O2    1 
ATOM   8720  N  N3    . U   B 2 23   ? 54.256  19.754  151.400 1.00 35.01  ? 22   U   B N3    1 
ATOM   8721  C  C4    . U   B 2 23   ? 53.969  21.033  150.984 1.00 35.93  ? 22   U   B C4    1 
ATOM   8722  O  O4    . U   B 2 23   ? 54.458  21.453  149.941 1.00 35.75  ? 22   U   B O4    1 
ATOM   8723  C  C5    . U   B 2 23   ? 53.105  21.752  151.858 1.00 37.87  ? 22   U   B C5    1 
ATOM   8724  C  C6    . U   B 2 23   ? 52.646  21.161  152.967 1.00 37.03  ? 22   U   B C6    1 
ATOM   8725  P  P     . U   B 2 24   ? 54.952  21.294  158.291 1.00 31.68  ? 23   U   B P     1 
ATOM   8726  O  OP1   . U   B 2 24   ? 54.863  21.105  159.753 1.00 31.77  ? 23   U   B OP1   1 
ATOM   8727  O  OP2   . U   B 2 24   ? 54.841  22.660  157.758 1.00 32.38  ? 23   U   B OP2   1 
ATOM   8728  O  "O5'" . U   B 2 24   ? 56.300  20.631  157.752 1.00 31.47  ? 23   U   B "O5'" 1 
ATOM   8729  C  "C5'" . U   B 2 24   ? 56.690  19.331  158.171 1.00 30.99  ? 23   U   B "C5'" 1 
ATOM   8730  C  "C4'" . U   B 2 24   ? 57.547  18.617  157.152 1.00 30.80  ? 23   U   B "C4'" 1 
ATOM   8731  O  "O4'" . U   B 2 24   ? 56.818  18.468  155.908 1.00 30.52  ? 23   U   B "O4'" 1 
ATOM   8732  C  "C3'" . U   B 2 24   ? 58.838  19.301  156.740 1.00 31.38  ? 23   U   B "C3'" 1 
ATOM   8733  O  "O3'" . U   B 2 24   ? 59.889  19.079  157.656 1.00 31.66  ? 23   U   B "O3'" 1 
ATOM   8734  C  "C2'" . U   B 2 24   ? 59.114  18.677  155.386 1.00 31.17  ? 23   U   B "C2'" 1 
ATOM   8735  O  "O2'" . U   B 2 24   ? 59.617  17.369  155.552 1.00 30.88  ? 23   U   B "O2'" 1 
ATOM   8736  C  "C1'" . U   B 2 24   ? 57.706  18.562  154.818 1.00 30.73  ? 23   U   B "C1'" 1 
ATOM   8737  N  N1    . U   B 2 24   ? 57.347  19.748  154.009 1.00 31.14  ? 23   U   B N1    1 
ATOM   8738  C  C2    . U   B 2 24   ? 57.831  19.814  152.713 1.00 31.33  ? 23   U   B C2    1 
ATOM   8739  O  O2    . U   B 2 24   ? 58.524  18.957  152.211 1.00 31.52  ? 23   U   B O2    1 
ATOM   8740  N  N3    . U   B 2 24   ? 57.479  20.928  152.010 1.00 31.81  ? 23   U   B N3    1 
ATOM   8741  C  C4    . U   B 2 24   ? 56.700  21.950  152.473 1.00 32.14  ? 23   U   B C4    1 
ATOM   8742  O  O4    . U   B 2 24   ? 56.480  22.883  151.732 1.00 32.68  ? 23   U   B O4    1 
ATOM   8743  C  C5    . U   B 2 24   ? 56.228  21.820  153.815 1.00 31.93  ? 23   U   B C5    1 
ATOM   8744  C  C6    . U   B 2 24   ? 56.561  20.747  154.527 1.00 31.43  ? 23   U   B C6    1 
ATOM   8745  P  P     . U   B 2 25   ? 61.113  20.097  157.760 1.00 32.53  ? 24   U   B P     1 
ATOM   8746  O  OP1   . U   B 2 25   ? 61.707  19.812  159.071 1.00 32.74  ? 24   U   B OP1   1 
ATOM   8747  O  OP2   . U   B 2 25   ? 60.673  21.465  157.437 1.00 34.17  ? 24   U   B OP2   1 
ATOM   8748  O  "O5'" . U   B 2 25   ? 62.116  19.685  156.607 1.00 32.70  ? 24   U   B "O5'" 1 
ATOM   8749  C  "C5'" . U   B 2 25   ? 62.683  18.397  156.526 1.00 32.44  ? 24   U   B "C5'" 1 
ATOM   8750  C  "C4'" . U   B 2 25   ? 63.450  18.242  155.236 1.00 32.75  ? 24   U   B "C4'" 1 
ATOM   8751  O  "O4'" . U   B 2 25   ? 62.549  18.315  154.091 1.00 32.38  ? 24   U   B "O4'" 1 
ATOM   8752  C  "C3'" . U   B 2 25   ? 64.478  19.315  154.946 1.00 33.70  ? 24   U   B "C3'" 1 
ATOM   8753  O  "O3'" . U   B 2 25   ? 65.684  19.117  155.649 1.00 34.28  ? 24   U   B "O3'" 1 
ATOM   8754  C  "C2'" . U   B 2 25   ? 64.638  19.219  153.432 1.00 33.83  ? 24   U   B "C2'" 1 
ATOM   8755  O  "O2'" . U   B 2 25   ? 65.430  18.088  153.094 1.00 33.90  ? 24   U   B "O2'" 1 
ATOM   8756  C  "C1'" . U   B 2 25   ? 63.204  18.936  153.001 1.00 33.00  ? 24   U   B "C1'" 1 
ATOM   8757  N  N1    . U   B 2 25   ? 62.449  20.159  152.630 1.00 33.17  ? 24   U   B N1    1 
ATOM   8758  C  C2    . U   B 2 25   ? 62.636  20.787  151.403 1.00 33.68  ? 24   U   B C2    1 
ATOM   8759  O  O2    . U   B 2 25   ? 63.440  20.435  150.560 1.00 34.03  ? 24   U   B O2    1 
ATOM   8760  N  N3    . U   B 2 25   ? 61.848  21.888  151.196 1.00 33.90  ? 24   U   B N3    1 
ATOM   8761  C  C4    . U   B 2 25   ? 60.903  22.410  152.048 1.00 33.71  ? 24   U   B C4    1 
ATOM   8762  O  O4    . U   B 2 25   ? 60.258  23.402  151.729 1.00 34.08  ? 24   U   B O4    1 
ATOM   8763  C  C5    . U   B 2 25   ? 60.760  21.707  153.274 1.00 33.17  ? 24   U   B C5    1 
ATOM   8764  C  C6    . U   B 2 25   ? 61.510  20.636  153.505 1.00 32.92  ? 24   U   B C6    1 
ATOM   8765  P  P     . U   B 2 26   ? 66.471  20.362  156.258 1.00 35.27  ? 25   U   B P     1 
ATOM   8766  O  OP1   . U   B 2 26   ? 67.536  19.749  157.058 1.00 35.68  ? 25   U   B OP1   1 
ATOM   8767  O  OP2   . U   B 2 26   ? 65.529  21.325  156.835 1.00 35.17  ? 25   U   B OP2   1 
ATOM   8768  O  "O5'" . U   B 2 26   ? 67.194  21.030  155.022 1.00 36.07  ? 25   U   B "O5'" 1 
ATOM   8769  C  "C5'" . U   B 2 26   ? 68.072  20.272  154.207 1.00 36.36  ? 25   U   B "C5'" 1 
ATOM   8770  C  "C4'" . U   B 2 26   ? 68.346  20.976  152.903 1.00 37.00  ? 25   U   B "C4'" 1 
ATOM   8771  O  "O4'" . U   B 2 26   ? 67.137  21.038  152.108 1.00 36.29  ? 25   U   B "O4'" 1 
ATOM   8772  C  "C3'" . U   B 2 26   ? 68.779  22.423  153.018 1.00 38.04  ? 25   U   B "C3'" 1 
ATOM   8773  O  "O3'" . U   B 2 26   ? 70.155  22.553  153.284 1.00 39.13  ? 25   U   B "O3'" 1 
ATOM   8774  C  "C2'" . U   B 2 26   ? 68.402  22.988  151.665 1.00 38.26  ? 25   U   B "C2'" 1 
ATOM   8775  O  "O2'" . U   B 2 26   ? 69.378  22.601  150.713 1.00 38.93  ? 25   U   B "O2'" 1 
ATOM   8776  C  "C1'" . U   B 2 26   ? 67.110  22.236  151.371 1.00 36.99  ? 25   U   B "C1'" 1 
ATOM   8777  N  N1    . U   B 2 26   ? 65.901  22.989  151.763 1.00 36.59  ? 25   U   B N1    1 
ATOM   8778  C  C2    . U   B 2 26   ? 65.421  23.953  150.910 1.00 37.01  ? 25   U   B C2    1 
ATOM   8779  O  O2    . U   B 2 26   ? 65.982  24.225  149.871 1.00 37.69  ? 25   U   B O2    1 
ATOM   8780  N  N3    . U   B 2 26   ? 64.278  24.591  151.316 1.00 36.72  ? 25   U   B N3    1 
ATOM   8781  C  C4    . U   B 2 26   ? 63.570  24.350  152.474 1.00 36.06  ? 25   U   B C4    1 
ATOM   8782  O  O4    . U   B 2 26   ? 62.556  24.997  152.734 1.00 35.98  ? 25   U   B O4    1 
ATOM   8783  C  C5    . U   B 2 26   ? 64.130  23.326  153.295 1.00 35.62  ? 25   U   B C5    1 
ATOM   8784  C  C6    . U   B 2 26   ? 65.240  22.693  152.921 1.00 35.89  ? 25   U   B C6    1 
ATOM   8785  P  P     . U   B 2 27   ? 70.687  23.865  154.009 1.00 40.25  ? 26   U   B P     1 
ATOM   8786  O  OP1   . U   B 2 27   ? 72.112  23.626  154.313 1.00 41.26  ? 26   U   B OP1   1 
ATOM   8787  O  OP2   . U   B 2 27   ? 69.693  24.159  155.058 1.00 39.58  ? 26   U   B OP2   1 
ATOM   8788  O  "O5'" . U   B 2 27   ? 70.571  25.028  152.928 1.00 41.03  ? 26   U   B "O5'" 1 
ATOM   8789  C  "C5'" . U   B 2 27   ? 71.428  25.080  151.796 1.00 41.93  ? 26   U   B "C5'" 1 
ATOM   8790  C  "C4'" . U   B 2 27   ? 70.946  26.090  150.781 1.00 42.41  ? 26   U   B "C4'" 1 
ATOM   8791  O  "O4'" . U   B 2 27   ? 69.580  25.794  150.412 1.00 41.18  ? 26   U   B "O4'" 1 
ATOM   8792  C  "C3'" . U   B 2 27   ? 70.887  27.529  151.255 1.00 43.39  ? 26   U   B "C3'" 1 
ATOM   8793  O  "O3'" . U   B 2 27   ? 72.138  28.174  151.187 1.00 44.99  ? 26   U   B "O3'" 1 
ATOM   8794  C  "C2'" . U   B 2 27   ? 69.856  28.148  150.329 1.00 43.24  ? 26   U   B "C2'" 1 
ATOM   8795  O  "O2'" . U   B 2 27   ? 70.446  28.465  149.081 1.00 44.24  ? 26   U   B "O2'" 1 
ATOM   8796  C  "C1'" . U   B 2 27   ? 68.890  26.989  150.123 1.00 41.61  ? 26   U   B "C1'" 1 
ATOM   8797  N  N1    . U   B 2 27   ? 67.704  27.081  150.993 1.00 40.68  ? 26   U   B N1    1 
ATOM   8798  C  C2    . U   B 2 27   ? 66.699  27.920  150.578 1.00 40.77  ? 26   U   B C2    1 
ATOM   8799  O  O2    . U   B 2 27   ? 66.763  28.573  149.562 1.00 41.55  ? 26   U   B O2    1 
ATOM   8800  N  N3    . U   B 2 27   ? 65.611  27.976  151.396 1.00 40.02  ? 26   U   B N3    1 
ATOM   8801  C  C4    . U   B 2 27   ? 65.432  27.278  152.555 1.00 39.20  ? 26   U   B C4    1 
ATOM   8802  O  O4    . U   B 2 27   ? 64.388  27.442  153.164 1.00 38.70  ? 26   U   B O4    1 
ATOM   8803  C  C5    . U   B 2 27   ? 66.510  26.423  152.925 1.00 39.14  ? 26   U   B C5    1 
ATOM   8804  C  C6    . U   B 2 27   ? 67.589  26.350  152.146 1.00 39.87  ? 26   U   B C6    1 
ATOM   8805  P  P     . G   B 2 28   ? 72.482  29.364  152.199 1.00 46.15  ? 27   G   B P     1 
ATOM   8806  O  OP1   . G   B 2 28   ? 73.936  29.553  152.038 1.00 47.66  ? 27   G   B OP1   1 
ATOM   8807  O  OP2   . G   B 2 28   ? 71.881  29.113  153.524 1.00 45.22  ? 27   G   B OP2   1 
ATOM   8808  O  "O5'" . G   B 2 28   ? 71.719  30.619  151.604 1.00 46.75  ? 27   G   B "O5'" 1 
ATOM   8809  C  "C5'" . G   B 2 28   ? 71.986  31.061  150.284 1.00 47.65  ? 27   G   B "C5'" 1 
ATOM   8810  C  "C4'" . G   B 2 28   ? 70.919  31.999  149.798 1.00 47.80  ? 27   G   B "C4'" 1 
ATOM   8811  O  "O4'" . G   B 2 28   ? 69.659  31.299  149.695 1.00 46.12  ? 27   G   B "O4'" 1 
ATOM   8812  C  "C3'" . G   B 2 28   ? 70.597  33.174  150.701 1.00 48.61  ? 27   G   B "C3'" 1 
ATOM   8813  O  "O3'" . G   B 2 28   ? 71.552  34.213  150.612 1.00 50.57  ? 27   G   B "O3'" 1 
ATOM   8814  C  "C2'" . G   B 2 28   ? 69.208  33.574  150.220 1.00 48.08  ? 27   G   B "C2'" 1 
ATOM   8815  O  "O2'" . G   B 2 28   ? 69.294  34.296  149.000 1.00 49.22  ? 27   G   B "O2'" 1 
ATOM   8816  C  "C1'" . G   B 2 28   ? 68.596  32.208  149.907 1.00 46.22  ? 27   G   B "C1'" 1 
ATOM   8817  N  N9    . G   B 2 28   ? 67.721  31.698  150.981 1.00 44.88  ? 27   G   B N9    1 
ATOM   8818  C  C8    . G   B 2 28   ? 67.997  30.668  151.838 1.00 43.91  ? 27   G   B C8    1 
ATOM   8819  N  N7    . G   B 2 28   ? 67.026  30.423  152.666 1.00 42.93  ? 27   G   B N7    1 
ATOM   8820  C  C5    . G   B 2 28   ? 66.051  31.337  152.336 1.00 43.27  ? 27   G   B C5    1 
ATOM   8821  C  C6    . G   B 2 28   ? 64.774  31.541  152.888 1.00 42.70  ? 27   G   B C6    1 
ATOM   8822  O  O6    . G   B 2 28   ? 64.234  30.946  153.800 1.00 41.74  ? 27   G   B O6    1 
ATOM   8823  N  N1    . G   B 2 28   ? 64.082  32.563  152.277 1.00 43.47  ? 27   G   B N1    1 
ATOM   8824  C  C2    . G   B 2 28   ? 64.571  33.300  151.245 1.00 44.66  ? 27   G   B C2    1 
ATOM   8825  N  N2    . G   B 2 28   ? 63.738  34.241  150.807 1.00 45.36  ? 27   G   B N2    1 
ATOM   8826  N  N3    . G   B 2 28   ? 65.764  33.126  150.703 1.00 45.21  ? 27   G   B N3    1 
ATOM   8827  C  C4    . G   B 2 28   ? 66.452  32.130  151.292 1.00 44.47  ? 27   G   B C4    1 
ATOM   8828  P  P     . U   B 2 29   ? 71.989  35.036  151.913 1.00 51.66  ? 28   U   B P     1 
ATOM   8829  O  OP1   . U   B 2 29   ? 73.177  35.817  151.527 1.00 53.70  ? 28   U   B OP1   1 
ATOM   8830  O  OP2   . U   B 2 29   ? 72.070  34.115  153.067 1.00 50.49  ? 28   U   B OP2   1 
ATOM   8831  O  "O5'" . U   B 2 29   ? 70.786  36.041  152.167 1.00 51.86  ? 28   U   B "O5'" 1 
ATOM   8832  C  "C5'" . U   B 2 29   ? 70.440  37.007  151.193 1.00 52.97  ? 28   U   B "C5'" 1 
ATOM   8833  C  "C4'" . U   B 2 29   ? 69.061  37.565  151.420 1.00 52.63  ? 28   U   B "C4'" 1 
ATOM   8834  O  "O4'" . U   B 2 29   ? 68.064  36.524  151.273 1.00 50.61  ? 28   U   B "O4'" 1 
ATOM   8835  C  "C3'" . U   B 2 29   ? 68.781  38.128  152.796 1.00 52.99  ? 28   U   B "C3'" 1 
ATOM   8836  O  "O3'" . U   B 2 29   ? 69.341  39.411  152.996 1.00 55.13  ? 28   U   B "O3'" 1 
ATOM   8837  C  "C2'" . U   B 2 29   ? 67.262  38.105  152.844 1.00 51.95  ? 28   U   B "C2'" 1 
ATOM   8838  O  "O2'" . U   B 2 29   ? 66.731  39.158  152.054 1.00 53.17  ? 28   U   B "O2'" 1 
ATOM   8839  C  "C1'" . U   B 2 29   ? 66.972  36.788  152.131 1.00 50.11  ? 28   U   B "C1'" 1 
ATOM   8840  N  N1    . U   B 2 29   ? 66.818  35.653  153.072 1.00 48.48  ? 28   U   B N1    1 
ATOM   8841  C  C2    . U   B 2 29   ? 65.611  35.503  153.711 1.00 47.54  ? 28   U   B C2    1 
ATOM   8842  O  O2    . U   B 2 29   ? 64.688  36.272  153.544 1.00 48.01  ? 28   U   B O2    1 
ATOM   8843  N  N3    . U   B 2 29   ? 65.531  34.429  154.559 1.00 46.16  ? 28   U   B N3    1 
ATOM   8844  C  C4    . U   B 2 29   ? 66.518  33.510  154.824 1.00 45.66  ? 28   U   B C4    1 
ATOM   8845  O  O4    . U   B 2 29   ? 66.297  32.594  155.610 1.00 44.49  ? 28   U   B O4    1 
ATOM   8846  C  C5    . U   B 2 29   ? 67.738  33.730  154.126 1.00 46.71  ? 28   U   B C5    1 
ATOM   8847  C  C6    . U   B 2 29   ? 67.838  34.764  153.297 1.00 48.04  ? 28   U   B C6    1 
ATOM   8848  P  P     . A   B 2 30   ? 69.776  39.871  154.467 1.00 55.96  ? 29   A   B P     1 
ATOM   8849  O  OP1   . A   B 2 30   ? 70.286  41.250  154.361 1.00 58.37  ? 29   A   B OP1   1 
ATOM   8850  O  OP2   . A   B 2 30   ? 70.606  38.812  155.075 1.00 55.04  ? 29   A   B OP2   1 
ATOM   8851  O  "O5'" . A   B 2 30   ? 68.411  39.941  155.263 1.00 55.06  ? 29   A   B "O5'" 1 
ATOM   8852  C  "C5'" . A   B 2 30   ? 67.568  41.069  155.139 1.00 56.19  ? 29   A   B "C5'" 1 
ATOM   8853  C  "C4'" . A   B 2 30   ? 66.282  40.865  155.889 1.00 55.10  ? 29   A   B "C4'" 1 
ATOM   8854  O  "O4'" . A   B 2 30   ? 65.706  39.595  155.513 1.00 52.93  ? 29   A   B "O4'" 1 
ATOM   8855  C  "C3'" . A   B 2 30   ? 66.387  40.768  157.400 1.00 55.01  ? 29   A   B "C3'" 1 
ATOM   8856  O  "O3'" . A   B 2 30   ? 66.515  42.025  158.031 1.00 57.01  ? 29   A   B "O3'" 1 
ATOM   8857  C  "C2'" . A   B 2 30   ? 65.102  40.044  157.754 1.00 53.28  ? 29   A   B "C2'" 1 
ATOM   8858  O  "O2'" . A   B 2 30   ? 64.000  40.930  157.649 1.00 54.06  ? 29   A   B "O2'" 1 
ATOM   8859  C  "C1'" . A   B 2 30   ? 65.008  39.048  156.608 1.00 51.78  ? 29   A   B "C1'" 1 
ATOM   8860  N  N9    . A   B 2 30   ? 65.604  37.745  156.945 1.00 50.30  ? 29   A   B N9    1 
ATOM   8861  C  C8    . A   B 2 30   ? 66.825  37.248  156.582 1.00 50.33  ? 29   A   B C8    1 
ATOM   8862  N  N7    . A   B 2 30   ? 67.054  36.041  157.028 1.00 48.93  ? 29   A   B N7    1 
ATOM   8863  C  C5    . A   B 2 30   ? 65.903  35.727  157.724 1.00 47.89  ? 29   A   B C5    1 
ATOM   8864  C  C6    . A   B 2 30   ? 65.514  34.592  158.438 1.00 46.35  ? 29   A   B C6    1 
ATOM   8865  N  N6    . A   B 2 30   ? 66.270  33.511  158.573 1.00 45.52  ? 29   A   B N6    1 
ATOM   8866  N  N1    . A   B 2 30   ? 64.304  34.602  159.020 1.00 45.79  ? 29   A   B N1    1 
ATOM   8867  C  C2    . A   B 2 30   ? 63.537  35.685  158.887 1.00 46.74  ? 29   A   B C2    1 
ATOM   8868  N  N3    . A   B 2 30   ? 63.792  36.808  158.243 1.00 48.23  ? 29   A   B N3    1 
ATOM   8869  C  C4    . A   B 2 30   ? 65.004  36.763  157.681 1.00 48.72  ? 29   A   B C4    1 
ATOM   8870  P  P     . C   B 2 31   ? 67.449  42.204  159.324 1.00 57.90  ? 30   C   B P     1 
ATOM   8871  O  OP1   . C   B 2 31   ? 67.445  43.642  159.657 1.00 60.21  ? 30   C   B OP1   1 
ATOM   8872  O  OP2   . C   B 2 31   ? 68.727  41.495  159.107 1.00 57.58  ? 30   C   B OP2   1 
ATOM   8873  O  "O5'" . C   B 2 31   ? 66.659  41.456  160.476 1.00 56.39  ? 30   C   B "O5'" 1 
ATOM   8874  C  "C5'" . C   B 2 31   ? 65.357  41.862  160.856 1.00 56.38  ? 30   C   B "C5'" 1 
ATOM   8875  C  "C4'" . C   B 2 31   ? 64.763  40.888  161.835 1.00 54.75  ? 30   C   B "C4'" 1 
ATOM   8876  O  "O4'" . C   B 2 31   ? 64.470  39.632  161.166 1.00 52.68  ? 30   C   B "O4'" 1 
ATOM   8877  C  "C3'" . C   B 2 31   ? 65.668  40.484  162.989 1.00 54.78  ? 30   C   B "C3'" 1 
ATOM   8878  O  "O3'" . C   B 2 31   ? 65.695  41.444  164.033 1.00 56.43  ? 30   C   B "O3'" 1 
ATOM   8879  C  "C2'" . C   B 2 31   ? 65.075  39.150  163.407 1.00 52.64  ? 30   C   B "C2'" 1 
ATOM   8880  O  "O2'" . C   B 2 31   ? 63.890  39.366  164.155 1.00 52.58  ? 30   C   B "O2'" 1 
ATOM   8881  C  "C1'" . C   B 2 31   ? 64.693  38.555  162.047 1.00 51.39  ? 30   C   B "C1'" 1 
ATOM   8882  N  N1    . C   B 2 31   ? 65.773  37.708  161.487 1.00 50.69  ? 30   C   B N1    1 
ATOM   8883  C  C2    . C   B 2 31   ? 65.938  36.399  161.927 1.00 49.13  ? 30   C   B C2    1 
ATOM   8884  O  O2    . C   B 2 31   ? 65.169  35.959  162.775 1.00 48.33  ? 30   C   B O2    1 
ATOM   8885  N  N3    . C   B 2 31   ? 66.923  35.629  161.430 1.00 48.64  ? 30   C   B N3    1 
ATOM   8886  C  C4    . C   B 2 31   ? 67.747  36.122  160.519 1.00 49.63  ? 30   C   B C4    1 
ATOM   8887  N  N4    . C   B 2 31   ? 68.709  35.333  160.050 1.00 49.23  ? 30   C   B N4    1 
ATOM   8888  C  C5    . C   B 2 31   ? 67.614  37.451  160.046 1.00 51.21  ? 30   C   B C5    1 
ATOM   8889  C  C6    . C   B 2 31   ? 66.627  38.199  160.550 1.00 51.69  ? 30   C   B C6    1 
ATOM   8890  P  P     . U   B 2 32   ? 67.070  41.841  164.768 1.00 57.91  ? 31   U   B P     1 
ATOM   8891  O  OP1   . U   B 2 32   ? 66.733  42.904  165.743 1.00 59.62  ? 31   U   B OP1   1 
ATOM   8892  O  OP2   . U   B 2 32   ? 68.138  42.028  163.765 1.00 58.60  ? 31   U   B OP2   1 
ATOM   8893  O  "O5'" . U   B 2 32   ? 67.448  40.562  165.626 1.00 56.38  ? 31   U   B "O5'" 1 
ATOM   8894  C  "C5'" . U   B 2 32   ? 66.664  40.179  166.743 1.00 55.69  ? 31   U   B "C5'" 1 
ATOM   8895  C  "C4'" . U   B 2 32   ? 67.238  38.961  167.411 1.00 54.45  ? 31   U   B "C4'" 1 
ATOM   8896  O  "O4'" . U   B 2 32   ? 67.100  37.820  166.528 1.00 52.57  ? 31   U   B "O4'" 1 
ATOM   8897  C  "C3'" . U   B 2 32   ? 68.729  39.018  167.715 1.00 55.47  ? 31   U   B "C3'" 1 
ATOM   8898  O  "O3'" . U   B 2 32   ? 69.026  39.726  168.902 1.00 57.01  ? 31   U   B "O3'" 1 
ATOM   8899  C  "C2'" . U   B 2 32   ? 69.112  37.547  167.761 1.00 53.72  ? 31   U   B "C2'" 1 
ATOM   8900  O  "O2'" . U   B 2 32   ? 68.732  36.966  168.998 1.00 53.12  ? 31   U   B "O2'" 1 
ATOM   8901  C  "C1'" . U   B 2 32   ? 68.220  36.973  166.657 1.00 52.12  ? 31   U   B "C1'" 1 
ATOM   8902  N  N1    . U   B 2 32   ? 68.919  36.929  165.357 1.00 52.17  ? 31   U   B N1    1 
ATOM   8903  C  C2    . U   B 2 32   ? 69.714  35.845  165.110 1.00 51.27  ? 31   U   B C2    1 
ATOM   8904  O  O2    . U   B 2 32   ? 69.833  34.949  165.915 1.00 50.45  ? 31   U   B O2    1 
ATOM   8905  N  N3    . U   B 2 32   ? 70.346  35.837  163.892 1.00 51.46  ? 31   U   B N3    1 
ATOM   8906  C  C4    . U   B 2 32   ? 70.265  36.802  162.919 1.00 52.45  ? 31   U   B C4    1 
ATOM   8907  O  O4    . U   B 2 32   ? 70.896  36.664  161.879 1.00 52.58  ? 31   U   B O4    1 
ATOM   8908  C  C5    . U   B 2 32   ? 69.428  37.904  163.253 1.00 53.37  ? 31   U   B C5    1 
ATOM   8909  C  C6    . U   B 2 32   ? 68.801  37.929  164.431 1.00 53.21  ? 31   U   B C6    1 
ATOM   8910  P  P     . C   B 2 33   ? 70.400  40.542  169.060 1.00 59.12  ? 32   C   B P     1 
ATOM   8911  O  OP1   . C   B 2 33   ? 70.312  41.173  170.389 1.00 60.45  ? 32   C   B OP1   1 
ATOM   8912  O  OP2   . C   B 2 33   ? 70.703  41.397  167.903 1.00 60.25  ? 32   C   B OP2   1 
ATOM   8913  O  "O5'" . C   B 2 33   ? 71.520  39.427  169.083 1.00 58.30  ? 32   C   B "O5'" 1 
ATOM   8914  C  "C5'" . C   B 2 33   ? 71.661  38.579  170.201 1.00 57.59  ? 32   C   B "C5'" 1 
ATOM   8915  C  "C4'" . C   B 2 33   ? 72.753  37.571  169.984 1.00 56.98  ? 32   C   B "C4'" 1 
ATOM   8916  O  "O4'" . C   B 2 33   ? 72.382  36.670  168.911 1.00 55.19  ? 32   C   B "O4'" 1 
ATOM   8917  C  "C3'" . C   B 2 33   ? 74.097  38.112  169.536 1.00 58.62  ? 32   C   B "C3'" 1 
ATOM   8918  O  "O3'" . C   B 2 33   ? 74.847  38.697  170.574 1.00 60.37  ? 32   C   B "O3'" 1 
ATOM   8919  C  "C2'" . C   B 2 33   ? 74.739  36.875  168.935 1.00 57.37  ? 32   C   B "C2'" 1 
ATOM   8920  O  "O2'" . C   B 2 33   ? 75.148  35.979  169.960 1.00 56.92  ? 32   C   B "O2'" 1 
ATOM   8921  C  "C1'" . C   B 2 33   ? 73.541  36.260  168.215 1.00 55.39  ? 32   C   B "C1'" 1 
ATOM   8922  N  N1    . C   B 2 33   ? 73.456  36.739  166.818 1.00 55.56  ? 32   C   B N1    1 
ATOM   8923  C  C2    . C   B 2 33   ? 74.215  36.099  165.841 1.00 55.17  ? 32   C   B C2    1 
ATOM   8924  O  O2    . C   B 2 33   ? 74.926  35.140  166.139 1.00 54.70  ? 32   C   B O2    1 
ATOM   8925  N  N3    . C   B 2 33   ? 74.158  36.540  164.573 1.00 55.43  ? 32   C   B N3    1 
ATOM   8926  C  C4    . C   B 2 33   ? 73.388  37.578  164.246 1.00 56.05  ? 32   C   B C4    1 
ATOM   8927  N  N4    . C   B 2 33   ? 73.376  37.967  162.967 1.00 56.36  ? 32   C   B N4    1 
ATOM   8928  C  C5    . C   B 2 33   ? 72.603  38.257  165.219 1.00 56.50  ? 32   C   B C5    1 
ATOM   8929  C  C6    . C   B 2 33   ? 72.672  37.805  166.479 1.00 56.23  ? 32   C   B C6    1 
ATOM   8930  P  P     . G   B 2 34   ? 75.743  39.996  170.303 1.00 62.88  ? 33   G   B P     1 
ATOM   8931  O  OP1   . G   B 2 34   ? 76.396  40.336  171.591 1.00 64.39  ? 33   G   B OP1   1 
ATOM   8932  O  OP2   . G   B 2 34   ? 74.944  41.045  169.645 1.00 63.50  ? 33   G   B OP2   1 
ATOM   8933  O  "O5'" . G   B 2 34   ? 76.896  39.479  169.349 1.00 62.91  ? 33   G   B "O5'" 1 
ATOM   8934  C  "C5'" . G   B 2 34   ? 77.795  38.480  169.792 1.00 62.54  ? 33   G   B "C5'" 1 
ATOM   8935  C  "C4'" . G   B 2 34   ? 78.698  38.018  168.682 1.00 62.52  ? 33   G   B "C4'" 1 
ATOM   8936  O  "O4'" . G   B 2 34   ? 77.928  37.330  167.659 1.00 60.59  ? 33   G   B "O4'" 1 
ATOM   8937  C  "C3'" . G   B 2 34   ? 79.416  39.113  167.920 1.00 64.56  ? 33   G   B "C3'" 1 
ATOM   8938  O  "O3'" . G   B 2 34   ? 80.537  39.629  168.614 1.00 66.66  ? 33   G   B "O3'" 1 
ATOM   8939  C  "C2'" . G   B 2 34   ? 79.743  38.434  166.593 1.00 63.70  ? 33   G   B "C2'" 1 
ATOM   8940  O  "O2'" . G   B 2 34   ? 80.882  37.600  166.688 1.00 63.89  ? 33   G   B "O2'" 1 
ATOM   8941  C  "C1'" . G   B 2 34   ? 78.509  37.552  166.393 1.00 61.19  ? 33   G   B "C1'" 1 
ATOM   8942  N  N9    . G   B 2 34   ? 77.545  38.246  165.531 1.00 60.96  ? 33   G   B N9    1 
ATOM   8943  C  C8    . G   B 2 34   ? 76.487  39.043  165.881 1.00 61.07  ? 33   G   B C8    1 
ATOM   8944  N  N7    . G   B 2 34   ? 75.879  39.546  164.848 1.00 61.01  ? 33   G   B N7    1 
ATOM   8945  C  C5    . G   B 2 34   ? 76.603  39.061  163.769 1.00 60.86  ? 33   G   B C5    1 
ATOM   8946  C  C6    . G   B 2 34   ? 76.430  39.260  162.388 1.00 60.80  ? 33   G   B C6    1 
ATOM   8947  O  O6    . G   B 2 34   ? 75.565  39.934  161.842 1.00 60.88  ? 33   G   B O6    1 
ATOM   8948  N  N1    . G   B 2 34   ? 77.385  38.589  161.641 1.00 60.76  ? 33   G   B N1    1 
ATOM   8949  C  C2    . G   B 2 34   ? 78.387  37.812  162.147 1.00 60.80  ? 33   G   B C2    1 
ATOM   8950  N  N2    . G   B 2 34   ? 79.219  37.241  161.268 1.00 60.90  ? 33   G   B N2    1 
ATOM   8951  N  N3    . G   B 2 34   ? 78.567  37.619  163.440 1.00 60.87  ? 33   G   B N3    1 
ATOM   8952  C  C4    . G   B 2 34   ? 77.641  38.269  164.175 1.00 60.87  ? 33   G   B C4    1 
ATOM   8953  P  P     . A   B 2 35   ? 80.787  41.213  168.648 1.00 69.22  ? 34   A   B P     1 
ATOM   8954  O  OP1   . A   B 2 35   ? 82.037  41.482  169.390 1.00 71.23  ? 34   A   B OP1   1 
ATOM   8955  O  OP2   . A   B 2 35   ? 79.536  41.888  169.033 1.00 68.97  ? 34   A   B OP2   1 
ATOM   8956  O  "O5'" . A   B 2 35   ? 81.017  41.592  167.128 1.00 69.70  ? 34   A   B "O5'" 1 
ATOM   8957  C  "C5'" . A   B 2 35   ? 80.945  42.934  166.691 1.00 71.58  ? 34   A   B "C5'" 1 
ATOM   8958  C  "C4'" . A   B 2 35   ? 81.957  43.169  165.612 1.00 72.93  ? 34   A   B "C4'" 1 
ATOM   8959  O  "O4'" . A   B 2 35   ? 83.254  42.756  166.092 1.00 73.92  ? 34   A   B "O4'" 1 
ATOM   8960  C  "C3'" . A   B 2 35   ? 81.756  42.351  164.351 1.00 71.25  ? 34   A   B "C3'" 1 
ATOM   8961  O  "O3'" . A   B 2 35   ? 80.807  42.938  163.483 1.00 70.96  ? 34   A   B "O3'" 1 
ATOM   8962  C  "C2'" . A   B 2 35   ? 83.163  42.269  163.769 1.00 72.76  ? 34   A   B "C2'" 1 
ATOM   8963  O  "O2'" . A   B 2 35   ? 83.475  43.446  163.044 1.00 74.91  ? 34   A   B "O2'" 1 
ATOM   8964  C  "C1'" . A   B 2 35   ? 84.022  42.239  165.035 1.00 73.94  ? 34   A   B "C1'" 1 
ATOM   8965  N  N9    . A   B 2 35   ? 84.472  40.889  165.407 1.00 72.56  ? 34   A   B N9    1 
ATOM   8966  C  C8    . A   B 2 35   ? 83.953  40.054  166.357 1.00 70.84  ? 34   A   B C8    1 
ATOM   8967  N  N7    . A   B 2 35   ? 84.594  38.918  166.458 1.00 70.11  ? 34   A   B N7    1 
ATOM   8968  C  C5    . A   B 2 35   ? 85.609  39.018  165.522 1.00 71.44  ? 34   A   B C5    1 
ATOM   8969  C  C6    . A   B 2 35   ? 86.639  38.148  165.133 1.00 71.65  ? 34   A   B C6    1 
ATOM   8970  N  N6    . A   B 2 35   ? 86.837  36.942  165.653 1.00 70.45  ? 34   A   B N6    1 
ATOM   8971  N  N1    . A   B 2 35   ? 87.476  38.556  164.162 1.00 73.27  ? 34   A   B N1    1 
ATOM   8972  C  C2    . A   B 2 35   ? 87.281  39.760  163.620 1.00 74.58  ? 34   A   B C2    1 
ATOM   8973  N  N3    . A   B 2 35   ? 86.353  40.668  163.898 1.00 74.58  ? 34   A   B N3    1 
ATOM   8974  C  C4    . A   B 2 35   ? 85.543  40.229  164.870 1.00 72.95  ? 34   A   B C4    1 
ATOM   8975  P  P     . A   B 2 36   ? 79.662  42.038  162.826 1.00 69.20  ? 35   A   B P     1 
ATOM   8976  O  OP1   . A   B 2 36   ? 78.328  42.636  163.053 1.00 67.74  ? 35   A   B OP1   1 
ATOM   8977  O  OP2   . A   B 2 36   ? 79.927  40.644  163.226 1.00 66.48  ? 35   A   B OP2   1 
ATOM   8978  O  "O5'" . A   B 2 36   ? 79.967  42.166  161.283 1.00 68.64  ? 35   A   B "O5'" 1 
ATOM   8979  C  "C5'" . A   B 2 36   ? 80.116  41.006  160.502 1.00 67.04  ? 35   A   B "C5'" 1 
ATOM   8980  C  "C4'" . A   B 2 36   ? 81.500  40.881  159.935 1.00 68.46  ? 35   A   B "C4'" 1 
ATOM   8981  O  "O4'" . A   B 2 36   ? 82.480  40.866  160.998 1.00 69.65  ? 35   A   B "O4'" 1 
ATOM   8982  C  "C3'" . A   B 2 36   ? 81.728  39.585  159.194 1.00 66.89  ? 35   A   B "C3'" 1 
ATOM   8983  O  "O3'" . A   B 2 36   ? 81.268  39.667  157.868 1.00 66.50  ? 35   A   B "O3'" 1 
ATOM   8984  C  "C2'" . A   B 2 36   ? 83.224  39.363  159.313 1.00 68.45  ? 35   A   B "C2'" 1 
ATOM   8985  O  "O2'" . A   B 2 36   ? 83.913  40.091  158.317 1.00 70.39  ? 35   A   B "O2'" 1 
ATOM   8986  C  "C1'" . A   B 2 36   ? 83.520  39.966  160.688 1.00 69.66  ? 35   A   B "C1'" 1 
ATOM   8987  N  N9    . A   B 2 36   ? 83.551  38.931  161.735 1.00 68.30  ? 35   A   B N9    1 
ATOM   8988  C  C8    . A   B 2 36   ? 82.678  38.751  162.774 1.00 67.02  ? 35   A   B C8    1 
ATOM   8989  N  N7    . A   B 2 36   ? 82.975  37.729  163.531 1.00 66.10  ? 35   A   B N7    1 
ATOM   8990  C  C5    . A   B 2 36   ? 84.116  37.208  162.953 1.00 66.83  ? 35   A   B C5    1 
ATOM   8991  C  C6    . A   B 2 36   ? 84.922  36.117  163.280 1.00 66.57  ? 35   A   B C6    1 
ATOM   8992  N  N6    . A   B 2 36   ? 84.696  35.320  164.316 1.00 65.42  ? 35   A   B N6    1 
ATOM   8993  N  N1    . A   B 2 36   ? 85.987  35.867  162.499 1.00 67.67  ? 35   A   B N1    1 
ATOM   8994  C  C2    . A   B 2 36   ? 86.218  36.668  161.456 1.00 68.93  ? 35   A   B C2    1 
ATOM   8995  N  N3    . A   B 2 36   ? 85.532  37.726  161.041 1.00 69.31  ? 35   A   B N3    1 
ATOM   8996  C  C4    . A   B 2 36   ? 84.481  37.938  161.846 1.00 68.19  ? 35   A   B C4    1 
ATOM   8997  P  P     . A   B 2 37   ? 80.210  38.596  157.352 1.00 63.81  ? 36   A   B P     1 
ATOM   8998  O  OP1   . A   B 2 37   ? 79.818  39.043  155.996 1.00 64.07  ? 36   A   B OP1   1 
ATOM   8999  O  OP2   . A   B 2 37   ? 79.168  38.388  158.382 1.00 62.30  ? 36   A   B OP2   1 
ATOM   9000  O  "O5'" . A   B 2 37   ? 81.073  37.274  157.211 1.00 63.10  ? 36   A   B "O5'" 1 
ATOM   9001  C  "C5'" . A   B 2 37   ? 82.204  37.258  156.364 1.00 64.55  ? 36   A   B "C5'" 1 
ATOM   9002  C  "C4'" . A   B 2 37   ? 83.048  36.045  156.618 1.00 64.09  ? 36   A   B "C4'" 1 
ATOM   9003  O  "O4'" . A   B 2 37   ? 83.681  36.148  157.917 1.00 64.93  ? 36   A   B "O4'" 1 
ATOM   9004  C  "C3'" . A   B 2 37   ? 82.299  34.729  156.675 1.00 65.84  ? 36   A   B "C3'" 1 
ATOM   9005  O  "O3'" . A   B 2 37   ? 82.015  34.229  155.379 1.00 63.70  ? 36   A   B "O3'" 1 
ATOM   9006  C  "C2'" . A   B 2 37   ? 83.236  33.854  157.498 1.00 61.73  ? 36   A   B "C2'" 1 
ATOM   9007  O  "O2'" . A   B 2 37   ? 84.300  33.368  156.698 1.00 62.69  ? 36   A   B "O2'" 1 
ATOM   9008  C  "C1'" . A   B 2 37   ? 83.806  34.870  158.494 1.00 63.56  ? 36   A   B "C1'" 1 
ATOM   9009  N  N9    . A   B 2 37   ? 83.083  34.864  159.781 1.00 62.57  ? 36   A   B N9    1 
ATOM   9010  C  C8    . A   B 2 37   ? 82.051  35.676  160.177 1.00 62.23  ? 36   A   B C8    1 
ATOM   9011  N  N7    . A   B 2 37   ? 81.604  35.419  161.372 1.00 61.41  ? 36   A   B N7    1 
ATOM   9012  C  C5    . A   B 2 37   ? 82.402  34.369  161.800 1.00 61.20  ? 36   A   B C5    1 
ATOM   9013  C  C6    . A   B 2 37   ? 82.443  33.638  162.998 1.00 60.52  ? 36   A   B C6    1 
ATOM   9014  N  N6    . A   B 2 37   ? 81.627  33.868  164.028 1.00 59.88  ? 36   A   B N6    1 
ATOM   9015  N  N1    . A   B 2 37   ? 83.363  32.654  163.105 1.00 60.64  ? 36   A   B N1    1 
ATOM   9016  C  C2    . A   B 2 37   ? 84.181  32.427  162.070 1.00 61.40  ? 36   A   B C2    1 
ATOM   9017  N  N3    . A   B 2 37   ? 84.244  33.049  160.897 1.00 62.09  ? 36   A   B N3    1 
ATOM   9018  C  C4    . A   B 2 37   ? 83.317  34.017  160.829 1.00 61.92  ? 36   A   B C4    1 
ATOM   9019  P  P     . G   B 2 38   ? 81.076  32.947  155.159 1.00 65.02  ? 37   G   B P     1 
ATOM   9020  O  OP1   . G   B 2 38   ? 81.890  31.741  155.455 1.00 70.02  ? 37   G   B OP1   1 
ATOM   9021  O  OP2   . G   B 2 38   ? 80.391  33.089  153.849 1.00 64.77  ? 37   G   B OP2   1 
ATOM   9022  O  "O5'" . G   B 2 38   ? 79.963  33.040  156.280 1.00 59.01  ? 37   G   B "O5'" 1 
ATOM   9023  C  "C5'" . G   B 2 38   ? 79.442  31.852  156.847 1.00 56.83  ? 37   G   B "C5'" 1 
ATOM   9024  C  "C4'" . G   B 2 38   ? 79.914  31.663  158.266 1.00 57.54  ? 37   G   B "C4'" 1 
ATOM   9025  O  "O4'" . G   B 2 38   ? 80.112  32.961  158.887 1.00 57.20  ? 37   G   B "O4'" 1 
ATOM   9026  C  "C3'" . G   B 2 38   ? 78.928  30.949  159.177 1.00 58.02  ? 37   G   B "C3'" 1 
ATOM   9027  O  "O3'" . G   B 2 38   ? 79.036  29.537  159.101 1.00 59.51  ? 37   G   B "O3'" 1 
ATOM   9028  C  "C2'" . G   B 2 38   ? 79.256  31.519  160.546 1.00 58.65  ? 37   G   B "C2'" 1 
ATOM   9029  O  "O2'" . G   B 2 38   ? 80.430  30.909  161.052 1.00 55.19  ? 37   G   B "O2'" 1 
ATOM   9030  C  "C1'" . G   B 2 38   ? 79.588  32.962  160.191 1.00 56.26  ? 37   G   B "C1'" 1 
ATOM   9031  N  N9    . G   B 2 38   ? 78.401  33.836  160.174 1.00 55.90  ? 37   G   B N9    1 
ATOM   9032  C  C8    . G   B 2 38   ? 77.884  34.406  159.041 1.00 55.97  ? 37   G   B C8    1 
ATOM   9033  N  N7    . G   B 2 38   ? 76.851  35.161  159.253 1.00 55.78  ? 37   G   B N7    1 
ATOM   9034  C  C5    . G   B 2 38   ? 76.670  35.094  160.617 1.00 55.56  ? 37   G   B C5    1 
ATOM   9035  C  C6    . G   B 2 38   ? 75.687  35.720  161.416 1.00 55.40  ? 37   G   B C6    1 
ATOM   9036  O  O6    . G   B 2 38   ? 74.766  36.466  161.052 1.00 55.44  ? 37   G   B O6    1 
ATOM   9037  N  N1    . G   B 2 38   ? 75.862  35.398  162.760 1.00 55.31  ? 37   G   B N1    1 
ATOM   9038  C  C2    . G   B 2 38   ? 76.844  34.584  163.265 1.00 55.37  ? 37   G   B C2    1 
ATOM   9039  N  N2    . G   B 2 38   ? 76.824  34.406  164.592 1.00 55.34  ? 37   G   B N2    1 
ATOM   9040  N  N3    . G   B 2 38   ? 77.765  33.993  162.522 1.00 55.55  ? 37   G   B N3    1 
ATOM   9041  C  C4    . G   B 2 38   ? 77.623  34.290  161.213 1.00 55.64  ? 37   G   B C4    1 
ATOM   9042  P  P     . A   B 2 39   ? 77.739  28.620  159.311 1.00 59.87  ? 38   A   B P     1 
ATOM   9043  O  OP1   . A   B 2 39   ? 78.122  27.199  159.160 1.00 67.51  ? 38   A   B OP1   1 
ATOM   9044  O  OP2   . A   B 2 39   ? 76.635  29.197  158.506 1.00 60.37  ? 38   A   B OP2   1 
ATOM   9045  O  "O5'" . A   B 2 39   ? 77.371  28.833  160.836 1.00 57.53  ? 38   A   B "O5'" 1 
ATOM   9046  C  "C5'" . A   B 2 39   ? 78.189  28.319  161.869 1.00 55.61  ? 38   A   B "C5'" 1 
ATOM   9047  C  "C4'" . A   B 2 39   ? 77.649  28.756  163.198 1.00 51.89  ? 38   A   B "C4'" 1 
ATOM   9048  O  "O4'" . A   B 2 39   ? 77.517  30.193  163.196 1.00 51.49  ? 38   A   B "O4'" 1 
ATOM   9049  C  "C3'" . A   B 2 39   ? 76.255  28.258  163.522 1.00 50.37  ? 38   A   B "C3'" 1 
ATOM   9050  O  "O3'" . A   B 2 39   ? 76.288  26.966  164.084 1.00 50.96  ? 38   A   B "O3'" 1 
ATOM   9051  C  "C2'" . A   B 2 39   ? 75.731  29.316  164.482 1.00 49.11  ? 38   A   B "C2'" 1 
ATOM   9052  O  "O2'" . A   B 2 39   ? 76.260  29.099  165.778 1.00 49.66  ? 38   A   B "O2'" 1 
ATOM   9053  C  "C1'" . A   B 2 39   ? 76.380  30.577  163.930 1.00 50.81  ? 38   A   B "C1'" 1 
ATOM   9054  N  N9    . A   B 2 39   ? 75.514  31.385  163.053 1.00 50.64  ? 38   A   B N9    1 
ATOM   9055  C  C8    . A   B 2 39   ? 75.654  31.574  161.705 1.00 50.82  ? 38   A   B C8    1 
ATOM   9056  N  N7    . A   B 2 39   ? 74.780  32.397  161.182 1.00 50.80  ? 38   A   B N7    1 
ATOM   9057  C  C5    . A   B 2 39   ? 74.021  32.793  162.265 1.00 50.63  ? 38   A   B C5    1 
ATOM   9058  C  C6    . A   B 2 39   ? 72.934  33.666  162.384 1.00 50.67  ? 38   A   B C6    1 
ATOM   9059  N  N6    . A   B 2 39   ? 72.388  34.320  161.369 1.00 50.85  ? 38   A   B N6    1 
ATOM   9060  N  N1    . A   B 2 39   ? 72.400  33.847  163.605 1.00 50.61  ? 38   A   B N1    1 
ATOM   9061  C  C2    . A   B 2 39   ? 72.943  33.192  164.638 1.00 50.50  ? 38   A   B C2    1 
ATOM   9062  N  N3    . A   B 2 39   ? 73.972  32.350  164.657 1.00 50.47  ? 38   A   B N3    1 
ATOM   9063  C  C4    . A   B 2 39   ? 74.470  32.188  163.425 1.00 50.54  ? 38   A   B C4    1 
ATOM   9064  P  P     . A   B 2 40   ? 75.114  25.922  163.805 1.00 45.72  ? 39   A   B P     1 
ATOM   9065  O  OP1   . A   B 2 40   ? 75.408  24.753  164.675 1.00 45.34  ? 39   A   B OP1   1 
ATOM   9066  O  OP2   . A   B 2 40   ? 74.931  25.765  162.345 1.00 45.93  ? 39   A   B OP2   1 
ATOM   9067  O  "O5'" . A   B 2 40   ? 73.821  26.637  164.388 1.00 45.17  ? 39   A   B "O5'" 1 
ATOM   9068  C  "C5'" . A   B 2 40   ? 73.562  26.630  165.782 1.00 45.21  ? 39   A   B "C5'" 1 
ATOM   9069  C  "C4'" . A   B 2 40   ? 72.351  27.458  166.104 1.00 44.92  ? 39   A   B "C4'" 1 
ATOM   9070  O  "O4'" . A   B 2 40   ? 72.518  28.785  165.560 1.00 46.04  ? 39   A   B "O4'" 1 
ATOM   9071  C  "C3'" . A   B 2 40   ? 71.046  26.972  165.506 1.00 43.40  ? 39   A   B "C3'" 1 
ATOM   9072  O  "O3'" . A   B 2 40   ? 70.447  25.975  166.299 1.00 42.40  ? 39   A   B "O3'" 1 
ATOM   9073  C  "C2'" . A   B 2 40   ? 70.213  28.239  165.437 1.00 43.81  ? 39   A   B "C2'" 1 
ATOM   9074  O  "O2'" . A   B 2 40   ? 69.640  28.519  166.704 1.00 43.96  ? 39   A   B "O2'" 1 
ATOM   9075  C  "C1'" . A   B 2 40   ? 71.277  29.295  165.146 1.00 45.44  ? 39   A   B "C1'" 1 
ATOM   9076  N  N9    . A   B 2 40   ? 71.393  29.640  163.718 1.00 45.57  ? 39   A   B N9    1 
ATOM   9077  C  C8    . A   B 2 40   ? 72.266  29.107  162.812 1.00 45.64  ? 39   A   B C8    1 
ATOM   9078  N  N7    . A   B 2 40   ? 72.179  29.636  161.623 1.00 45.90  ? 39   A   B N7    1 
ATOM   9079  C  C5    . A   B 2 40   ? 71.192  30.592  161.768 1.00 46.03  ? 39   A   B C5    1 
ATOM   9080  C  C6    . A   B 2 40   ? 70.627  31.500  160.870 1.00 46.40  ? 39   A   B C6    1 
ATOM   9081  N  N6    . A   B 2 40   ? 71.005  31.589  159.600 1.00 46.68  ? 39   A   B N6    1 
ATOM   9082  N  N1    . A   B 2 40   ? 69.662  32.319  161.324 1.00 46.60  ? 39   A   B N1    1 
ATOM   9083  C  C2    . A   B 2 40   ? 69.286  32.225  162.596 1.00 46.41  ? 39   A   B C2    1 
ATOM   9084  N  N3    . A   B 2 40   ? 69.747  31.409  163.532 1.00 46.03  ? 39   A   B N3    1 
ATOM   9085  C  C4    . A   B 2 40   ? 70.703  30.611  163.049 1.00 45.85  ? 39   A   B C4    1 
ATOM   9086  P  P     . G   B 2 41   ? 69.866  24.640  165.645 1.00 40.91  ? 40   G   B P     1 
ATOM   9087  O  OP1   . G   B 2 41   ? 69.375  23.840  166.788 1.00 40.35  ? 40   G   B OP1   1 
ATOM   9088  O  OP2   . G   B 2 41   ? 70.786  24.050  164.646 1.00 40.98  ? 40   G   B OP2   1 
ATOM   9089  O  "O5'" . G   B 2 41   ? 68.608  25.144  164.824 1.00 40.41  ? 40   G   B "O5'" 1 
ATOM   9090  C  "C5'" . G   B 2 41   ? 67.509  25.781  165.465 1.00 40.14  ? 40   G   B "C5'" 1 
ATOM   9091  C  "C4'" . G   B 2 41   ? 66.468  26.182  164.458 1.00 39.60  ? 40   G   B "C4'" 1 
ATOM   9092  O  "O4'" . G   B 2 41   ? 67.056  27.160  163.554 1.00 40.51  ? 40   G   B "O4'" 1 
ATOM   9093  C  "C3'" . G   B 2 41   ? 65.972  25.036  163.578 1.00 38.33  ? 40   G   B "C3'" 1 
ATOM   9094  O  "O3'" . G   B 2 41   ? 64.611  25.256  163.217 1.00 37.71  ? 40   G   B "O3'" 1 
ATOM   9095  C  "C2'" . G   B 2 41   ? 66.851  25.167  162.347 1.00 38.69  ? 40   G   B "C2'" 1 
ATOM   9096  O  "O2'" . G   B 2 41   ? 66.325  24.580  161.181 1.00 37.83  ? 40   G   B "O2'" 1 
ATOM   9097  C  "C1'" . G   B 2 41   ? 66.981  26.682  162.231 1.00 39.86  ? 40   G   B "C1'" 1 
ATOM   9098  N  N9    . G   B 2 41   ? 68.167  27.104  161.482 1.00 40.82  ? 40   G   B N9    1 
ATOM   9099  C  C8    . G   B 2 41   ? 69.457  26.657  161.607 1.00 41.35  ? 40   G   B C8    1 
ATOM   9100  N  N7    . G   B 2 41   ? 70.267  27.192  160.739 1.00 42.25  ? 40   G   B N7    1 
ATOM   9101  C  C5    . G   B 2 41   ? 69.459  28.031  159.983 1.00 42.29  ? 40   G   B C5    1 
ATOM   9102  C  C6    . G   B 2 41   ? 69.758  28.877  158.886 1.00 43.16  ? 40   G   B C6    1 
ATOM   9103  O  O6    . G   B 2 41   ? 70.844  29.068  158.344 1.00 44.74  ? 40   G   B O6    1 
ATOM   9104  N  N1    . G   B 2 41   ? 68.641  29.549  158.417 1.00 42.96  ? 40   G   B N1    1 
ATOM   9105  C  C2    . G   B 2 41   ? 67.380  29.418  158.937 1.00 42.05  ? 40   G   B C2    1 
ATOM   9106  N  N2    . G   B 2 41   ? 66.414  30.143  158.364 1.00 44.70  ? 40   G   B N2    1 
ATOM   9107  N  N3    . G   B 2 41   ? 67.081  28.631  159.953 1.00 41.24  ? 40   G   B N3    1 
ATOM   9108  C  C4    . G   B 2 41   ? 68.161  27.976  160.424 1.00 41.40  ? 40   G   B C4    1 
ATOM   9109  P  P     . C   B 2 42   ? 63.448  24.425  163.942 1.00 37.66  ? 41   C   B P     1 
ATOM   9110  O  OP1   . C   B 2 42   ? 64.041  23.321  164.708 1.00 38.94  ? 41   C   B OP1   1 
ATOM   9111  O  OP2   . C   B 2 42   ? 62.417  24.109  162.938 1.00 39.70  ? 41   C   B OP2   1 
ATOM   9112  O  "O5'" . C   B 2 42   ? 62.790  25.481  164.913 1.00 37.45  ? 41   C   B "O5'" 1 
ATOM   9113  C  "C5'" . C   B 2 42   ? 62.172  26.633  164.383 1.00 37.95  ? 41   C   B "C5'" 1 
ATOM   9114  C  "C4'" . C   B 2 42   ? 62.087  27.746  165.389 1.00 39.07  ? 41   C   B "C4'" 1 
ATOM   9115  O  "O4'" . C   B 2 42   ? 63.359  28.417  165.478 1.00 40.15  ? 41   C   B "O4'" 1 
ATOM   9116  C  "C3'" . C   B 2 42   ? 61.103  28.832  165.016 1.00 39.58  ? 41   C   B "C3'" 1 
ATOM   9117  O  "O3'" . C   B 2 42   ? 59.808  28.531  165.477 1.00 39.07  ? 41   C   B "O3'" 1 
ATOM   9118  C  "C2'" . C   B 2 42   ? 61.675  30.084  165.652 1.00 41.09  ? 41   C   B "C2'" 1 
ATOM   9119  O  "O2'" . C   B 2 42   ? 61.217  30.216  166.975 1.00 41.47  ? 41   C   B "O2'" 1 
ATOM   9120  C  "C1'" . C   B 2 42   ? 63.171  29.794  165.672 1.00 41.37  ? 41   C   B "C1'" 1 
ATOM   9121  N  N1    . C   B 2 42   ? 63.928  30.516  164.631 1.00 42.11  ? 41   C   B N1    1 
ATOM   9122  C  C2    . C   B 2 42   ? 63.921  31.911  164.577 1.00 43.50  ? 41   C   B C2    1 
ATOM   9123  O  O2    . C   B 2 42   ? 63.245  32.580  165.363 1.00 44.12  ? 41   C   B O2    1 
ATOM   9124  N  N3    . C   B 2 42   ? 64.652  32.526  163.644 1.00 44.27  ? 41   C   B N3    1 
ATOM   9125  C  C4    . C   B 2 42   ? 65.380  31.805  162.814 1.00 43.71  ? 41   C   B C4    1 
ATOM   9126  N  N4    . C   B 2 42   ? 66.084  32.465  161.912 1.00 44.62  ? 41   C   B N4    1 
ATOM   9127  C  C5    . C   B 2 42   ? 65.429  30.394  162.856 1.00 42.33  ? 41   C   B C5    1 
ATOM   9128  C  C6    . C   B 2 42   ? 64.696  29.787  163.780 1.00 41.57  ? 41   C   B C6    1 
ATOM   9129  P  P     . U   B 2 43   ? 58.651  28.283  164.413 1.00 38.29  ? 42   U   B P     1 
ATOM   9130  O  OP1   . U   B 2 43   ? 57.406  27.927  165.111 1.00 37.95  ? 42   U   B OP1   1 
ATOM   9131  O  OP2   . U   B 2 43   ? 59.234  27.380  163.411 1.00 37.42  ? 42   U   B OP2   1 
ATOM   9132  O  "O5'" . U   B 2 43   ? 58.453  29.711  163.749 1.00 39.38  ? 42   U   B "O5'" 1 
ATOM   9133  C  "C5'" . U   B 2 43   ? 57.852  30.771  164.467 1.00 40.48  ? 42   U   B "C5'" 1 
ATOM   9134  C  "C4'" . U   B 2 43   ? 58.102  32.105  163.809 1.00 41.73  ? 42   U   B "C4'" 1 
ATOM   9135  O  "O4'" . U   B 2 43   ? 59.509  32.439  163.865 1.00 42.41  ? 42   U   B "O4'" 1 
ATOM   9136  C  "C3'" . U   B 2 43   ? 57.785  32.210  162.332 1.00 41.45  ? 42   U   B "C3'" 1 
ATOM   9137  O  "O3'" . U   B 2 43   ? 56.407  32.324  162.058 1.00 41.31  ? 42   U   B "O3'" 1 
ATOM   9138  C  "C2'" . U   B 2 43   ? 58.589  33.430  161.926 1.00 42.87  ? 42   U   B "C2'" 1 
ATOM   9139  O  "O2'" . U   B 2 43   ? 57.958  34.603  162.401 1.00 44.21  ? 42   U   B "O2'" 1 
ATOM   9140  C  "C1'" . U   B 2 43   ? 59.854  33.224  162.745 1.00 43.11  ? 42   U   B "C1'" 1 
ATOM   9141  N  N1    . U   B 2 43   ? 60.920  32.535  161.988 1.00 42.51  ? 42   U   B N1    1 
ATOM   9142  C  C2    . U   B 2 43   ? 61.748  33.329  161.232 1.00 43.53  ? 42   U   B C2    1 
ATOM   9143  O  O2    . U   B 2 43   ? 61.618  34.526  161.163 1.00 44.85  ? 42   U   B O2    1 
ATOM   9144  N  N3    . U   B 2 43   ? 62.738  32.686  160.561 1.00 43.10  ? 42   U   B N3    1 
ATOM   9145  C  C4    . U   B 2 43   ? 62.978  31.339  160.567 1.00 41.78  ? 42   U   B C4    1 
ATOM   9146  O  O4    . U   B 2 43   ? 63.915  30.907  159.903 1.00 41.68  ? 42   U   B O4    1 
ATOM   9147  C  C5    . U   B 2 43   ? 62.088  30.575  161.376 1.00 40.78  ? 42   U   B C5    1 
ATOM   9148  C  C6    . U   B 2 43   ? 61.111  31.183  162.049 1.00 41.16  ? 42   U   B C6    1 
ATOM   9149  P  P     . A   B 2 44   ? 55.793  31.574  160.782 1.00 40.20  ? 43   A   B P     1 
ATOM   9150  O  OP1   . A   B 2 44   ? 54.340  31.558  161.027 1.00 40.13  ? 43   A   B OP1   1 
ATOM   9151  O  OP2   . A   B 2 44   ? 56.542  30.323  160.548 1.00 38.98  ? 43   A   B OP2   1 
ATOM   9152  O  "O5'" . A   B 2 44   ? 56.135  32.547  159.580 1.00 41.09  ? 43   A   B "O5'" 1 
ATOM   9153  C  "C5'" . A   B 2 44   ? 55.483  33.793  159.474 1.00 42.41  ? 43   A   B "C5'" 1 
ATOM   9154  C  "C4'" . A   B 2 44   ? 56.204  34.726  158.539 1.00 43.47  ? 43   A   B "C4'" 1 
ATOM   9155  O  "O4'" . A   B 2 44   ? 57.592  34.865  158.931 1.00 43.90  ? 43   A   B "O4'" 1 
ATOM   9156  C  "C3'" . A   B 2 44   ? 56.292  34.307  157.085 1.00 42.85  ? 43   A   B "C3'" 1 
ATOM   9157  O  "O3'" . A   B 2 44   ? 55.077  34.504  156.383 1.00 42.90  ? 43   A   B "O3'" 1 
ATOM   9158  C  "C2'" . A   B 2 44   ? 57.441  35.169  156.584 1.00 44.04  ? 43   A   B "C2'" 1 
ATOM   9159  O  "O2'" . A   B 2 44   ? 57.005  36.509  156.418 1.00 45.64  ? 43   A   B "O2'" 1 
ATOM   9160  C  "C1'" . A   B 2 44   ? 58.377  35.144  157.790 1.00 44.28  ? 43   A   B "C1'" 1 
ATOM   9161  N  N9    . A   B 2 44   ? 59.447  34.135  157.687 1.00 43.33  ? 43   A   B N9    1 
ATOM   9162  C  C8    . A   B 2 44   ? 59.487  32.897  158.276 1.00 41.99  ? 43   A   B C8    1 
ATOM   9163  N  N7    . A   B 2 44   ? 60.587  32.229  158.025 1.00 41.57  ? 43   A   B N7    1 
ATOM   9164  C  C5    . A   B 2 44   ? 61.328  33.089  157.239 1.00 42.71  ? 43   A   B C5    1 
ATOM   9165  C  C6    . A   B 2 44   ? 62.586  32.968  156.647 1.00 43.04  ? 43   A   B C6    1 
ATOM   9166  N  N6    . A   B 2 44   ? 63.349  31.893  156.763 1.00 42.22  ? 43   A   B N6    1 
ATOM   9167  N  N1    . A   B 2 44   ? 63.046  33.999  155.914 1.00 44.39  ? 43   A   B N1    1 
ATOM   9168  C  C2    . A   B 2 44   ? 62.272  35.084  155.791 1.00 45.35  ? 43   A   B C2    1 
ATOM   9169  N  N3    . A   B 2 44   ? 61.063  35.316  156.301 1.00 45.18  ? 43   A   B N3    1 
ATOM   9170  C  C4    . A   B 2 44   ? 60.641  34.266  157.023 1.00 43.81  ? 43   A   B C4    1 
ATOM   9171  P  P     . C   B 2 45   ? 54.575  33.455  155.271 1.00 41.58  ? 44   C   B P     1 
ATOM   9172  O  OP1   . C   B 2 45   ? 53.142  33.773  155.089 1.00 46.37  ? 44   C   B OP1   1 
ATOM   9173  O  OP2   . C   B 2 45   ? 54.985  32.075  155.559 1.00 40.09  ? 44   C   B OP2   1 
ATOM   9174  O  "O5'" . C   B 2 45   ? 55.366  33.875  153.963 1.00 42.12  ? 44   C   B "O5'" 1 
ATOM   9175  C  "C5'" . C   B 2 45   ? 55.144  35.149  153.379 1.00 43.63  ? 44   C   B "C5'" 1 
ATOM   9176  C  "C4'" . C   B 2 45   ? 56.309  35.587  152.534 1.00 44.36  ? 44   C   B "C4'" 1 
ATOM   9177  O  "O4'" . C   B 2 45   ? 57.526  35.613  153.323 1.00 44.59  ? 44   C   B "O4'" 1 
ATOM   9178  C  "C3'" . C   B 2 45   ? 56.666  34.697  151.361 1.00 43.42  ? 44   C   B "C3'" 1 
ATOM   9179  O  "O3'" . C   B 2 45   ? 55.799  34.886  150.263 1.00 44.65  ? 44   C   B "O3'" 1 
ATOM   9180  C  "C2'" . C   B 2 45   ? 58.099  35.111  151.072 1.00 44.26  ? 44   C   B "C2'" 1 
ATOM   9181  O  "O2'" . C   B 2 45   ? 58.120  36.342  150.368 1.00 45.89  ? 44   C   B "O2'" 1 
ATOM   9182  C  "C1'" . C   B 2 45   ? 58.633  35.354  152.488 1.00 44.57  ? 44   C   B "C1'" 1 
ATOM   9183  N  N1    . C   B 2 45   ? 59.357  34.182  153.013 1.00 43.34  ? 44   C   B N1    1 
ATOM   9184  C  C2    . C   B 2 45   ? 60.675  33.998  152.607 1.00 43.58  ? 44   C   B C2    1 
ATOM   9185  O  O2    . C   B 2 45   ? 61.188  34.819  151.837 1.00 44.80  ? 44   C   B O2    1 
ATOM   9186  N  N3    . C   B 2 45   ? 61.357  32.932  153.064 1.00 42.59  ? 44   C   B N3    1 
ATOM   9187  C  C4    . C   B 2 45   ? 60.760  32.077  153.883 1.00 41.40  ? 44   C   B C4    1 
ATOM   9188  N  N4    . C   B 2 45   ? 61.480  31.047  154.309 1.00 40.59  ? 44   C   B N4    1 
ATOM   9189  C  C5    . C   B 2 45   ? 59.415  32.238  154.309 1.00 41.12  ? 44   C   B C5    1 
ATOM   9190  C  C6    . C   B 2 45   ? 58.751  33.298  153.850 1.00 42.11  ? 44   C   B C6    1 
ATOM   9191  P  P     . A   B 2 46   ? 55.483  33.692  149.242 1.00 42.27  ? 45   A   B P     1 
ATOM   9192  O  OP1   . A   B 2 46   ? 54.557  34.304  148.281 1.00 43.01  ? 45   A   B OP1   1 
ATOM   9193  O  OP2   . A   B 2 46   ? 55.037  32.485  149.960 1.00 40.76  ? 45   A   B OP2   1 
ATOM   9194  O  "O5'" . A   B 2 46   ? 56.857  33.446  148.485 1.00 42.36  ? 45   A   B "O5'" 1 
ATOM   9195  C  "C5'" . A   B 2 46   ? 57.339  34.408  147.563 1.00 43.76  ? 45   A   B "C5'" 1 
ATOM   9196  C  "C4'" . A   B 2 46   ? 58.721  34.083  147.053 1.00 43.85  ? 45   A   B "C4'" 1 
ATOM   9197  O  "O4'" . A   B 2 46   ? 59.687  34.149  148.129 1.00 44.02  ? 45   A   B "O4'" 1 
ATOM   9198  C  "C3'" . A   B 2 46   ? 58.926  32.698  146.471 1.00 42.48  ? 45   A   B "C3'" 1 
ATOM   9199  O  "O3'" . A   B 2 46   ? 58.404  32.565  145.160 1.00 42.51  ? 45   A   B "O3'" 1 
ATOM   9200  C  "C2'" . A   B 2 46   ? 60.439  32.534  146.562 1.00 42.81  ? 45   A   B "C2'" 1 
ATOM   9201  O  "O2'" . A   B 2 46   ? 61.097  33.231  145.516 1.00 44.11  ? 45   A   B "O2'" 1 
ATOM   9202  C  "C1'" . A   B 2 46   ? 60.737  33.237  147.890 1.00 43.40  ? 45   A   B "C1'" 1 
ATOM   9203  N  N9    . A   B 2 46   ? 60.789  32.256  148.992 1.00 42.14  ? 45   A   B N9    1 
ATOM   9204  C  C8    . A   B 2 46   ? 59.792  31.901  149.860 1.00 41.26  ? 45   A   B C8    1 
ATOM   9205  N  N7    . A   B 2 46   ? 60.139  30.953  150.694 1.00 40.29  ? 45   A   B N7    1 
ATOM   9206  C  C5    . A   B 2 46   ? 61.442  30.661  150.334 1.00 40.54  ? 45   A   B C5    1 
ATOM   9207  C  C6    . A   B 2 46   ? 62.370  29.745  150.831 1.00 39.99  ? 45   A   B C6    1 
ATOM   9208  N  N6    . A   B 2 46   ? 62.115  28.923  151.849 1.00 39.00  ? 45   A   B N6    1 
ATOM   9209  N  N1    . A   B 2 46   ? 63.582  29.698  150.252 1.00 40.60  ? 45   A   B N1    1 
ATOM   9210  C  C2    . A   B 2 46   ? 63.843  30.527  149.249 1.00 41.70  ? 45   A   B C2    1 
ATOM   9211  N  N3    . A   B 2 46   ? 63.055  31.435  148.698 1.00 42.32  ? 45   A   B N3    1 
ATOM   9212  C  C4    . A   B 2 46   ? 61.854  31.446  149.291 1.00 41.67  ? 45   A   B C4    1 
ATOM   9213  P  P     . A   B 2 47   ? 58.005  31.127  144.574 1.00 41.03  ? 46   A   B P     1 
ATOM   9214  O  OP1   . A   B 2 47   ? 57.362  31.395  143.279 1.00 41.51  ? 46   A   B OP1   1 
ATOM   9215  O  OP2   . A   B 2 47   ? 57.262  30.332  145.561 1.00 39.77  ? 46   A   B OP2   1 
ATOM   9216  O  "O5'" . A   B 2 47   ? 59.391  30.430  144.254 1.00 40.88  ? 46   A   B "O5'" 1 
ATOM   9217  C  "C5'" . A   B 2 47   ? 60.260  30.984  143.283 1.00 42.06  ? 46   A   B "C5'" 1 
ATOM   9218  C  "C4'" . A   B 2 47   ? 61.624  30.364  143.366 1.00 42.00  ? 46   A   B "C4'" 1 
ATOM   9219  O  "O4'" . A   B 2 47   ? 62.150  30.551  144.701 1.00 42.00  ? 46   A   B "O4'" 1 
ATOM   9220  C  "C3'" . A   B 2 47   ? 61.665  28.865  143.153 1.00 40.69  ? 46   A   B "C3'" 1 
ATOM   9221  O  "O3'" . A   B 2 47   ? 61.715  28.531  141.780 1.00 40.92  ? 46   A   B "O3'" 1 
ATOM   9222  C  "C2'" . A   B 2 47   ? 62.906  28.446  143.917 1.00 40.68  ? 46   A   B "C2'" 1 
ATOM   9223  O  "O2'" . A   B 2 47   ? 64.068  28.693  143.143 1.00 41.79  ? 46   A   B "O2'" 1 
ATOM   9224  C  "C1'" . A   B 2 47   ? 62.882  29.419  145.097 1.00 41.17  ? 46   A   B "C1'" 1 
ATOM   9225  N  N9    . A   B 2 47   ? 62.216  28.845  146.280 1.00 39.99  ? 46   A   B N9    1 
ATOM   9226  C  C8    . A   B 2 47   ? 60.940  29.077  146.712 1.00 39.53  ? 46   A   B C8    1 
ATOM   9227  N  N7    . A   B 2 47   ? 60.607  28.417  147.779 1.00 38.57  ? 46   A   B N7    1 
ATOM   9228  C  C5    . A   B 2 47   ? 61.756  27.705  148.080 1.00 38.38  ? 46   A   B C5    1 
ATOM   9229  C  C6    . A   B 2 47   ? 62.069  26.814  149.118 1.00 37.59  ? 46   A   B C6    1 
ATOM   9230  N  N6    . A   B 2 47   ? 61.210  26.472  150.075 1.00 36.79  ? 46   A   B N6    1 
ATOM   9231  N  N1    . A   B 2 47   ? 63.295  26.265  149.126 1.00 37.75  ? 46   A   B N1    1 
ATOM   9232  C  C2    . A   B 2 47   ? 64.152  26.605  148.161 1.00 38.66  ? 46   A   B C2    1 
ATOM   9233  N  N3    . A   B 2 47   ? 63.982  27.441  147.142 1.00 39.47  ? 46   A   B N3    1 
ATOM   9234  C  C4    . A   B 2 47   ? 62.750  27.959  147.165 1.00 39.26  ? 46   A   B C4    1 
ATOM   9235  P  P     . A   B 2 48   ? 60.998  27.212  141.231 1.00 39.68  ? 47   A   B P     1 
ATOM   9236  O  OP1   . A   B 2 48   ? 61.154  27.269  139.767 1.00 40.41  ? 47   A   B OP1   1 
ATOM   9237  O  OP2   . A   B 2 48   ? 59.653  27.092  141.825 1.00 38.79  ? 47   A   B OP2   1 
ATOM   9238  O  "O5'" . A   B 2 48   ? 61.922  26.021  141.731 1.00 38.99  ? 47   A   B "O5'" 1 
ATOM   9239  C  "C5'" . A   B 2 48   ? 63.223  25.847  141.200 1.00 39.75  ? 47   A   B "C5'" 1 
ATOM   9240  C  "C4'" . A   B 2 48   ? 64.046  24.900  142.037 1.00 39.21  ? 47   A   B "C4'" 1 
ATOM   9241  O  "O4'" . A   B 2 48   ? 64.230  25.443  143.373 1.00 39.20  ? 47   A   B "O4'" 1 
ATOM   9242  C  "C3'" . A   B 2 48   ? 63.443  23.533  142.293 1.00 37.87  ? 47   A   B "C3'" 1 
ATOM   9243  O  "O3'" . A   B 2 48   ? 63.593  22.641  141.220 1.00 37.84  ? 47   A   B "O3'" 1 
ATOM   9244  C  "C2'" . A   B 2 48   ? 64.173  23.087  143.549 1.00 37.57  ? 47   A   B "C2'" 1 
ATOM   9245  O  "O2'" . A   B 2 48   ? 65.496  22.688  143.240 1.00 38.25  ? 47   A   B "O2'" 1 
ATOM   9246  C  "C1'" . A   B 2 48   ? 64.226  24.394  144.320 1.00 38.16  ? 47   A   B "C1'" 1 
ATOM   9247  N  N9    . A   B 2 48   ? 63.026  24.522  145.148 1.00 37.33  ? 47   A   B N9    1 
ATOM   9248  C  C8    . A   B 2 48   ? 61.848  25.146  144.870 1.00 37.25  ? 47   A   B C8    1 
ATOM   9249  N  N7    . A   B 2 48   ? 60.959  25.056  145.820 1.00 36.52  ? 47   A   B N7    1 
ATOM   9250  C  C5    . A   B 2 48   ? 61.608  24.310  146.782 1.00 36.06  ? 47   A   B C5    1 
ATOM   9251  C  C6    . A   B 2 48   ? 61.215  23.871  148.041 1.00 35.31  ? 47   A   B C6    1 
ATOM   9252  N  N6    . A   B 2 48   ? 60.018  24.115  148.567 1.00 34.89  ? 47   A   B N6    1 
ATOM   9253  N  N1    . A   B 2 48   ? 62.105  23.154  148.739 1.00 35.13  ? 47   A   B N1    1 
ATOM   9254  C  C2    . A   B 2 48   ? 63.306  22.897  148.221 1.00 35.67  ? 47   A   B C2    1 
ATOM   9255  N  N3    . A   B 2 48   ? 63.803  23.260  147.059 1.00 36.42  ? 47   A   B N3    1 
ATOM   9256  C  C4    . A   B 2 48   ? 62.882  23.968  146.383 1.00 36.54  ? 47   A   B C4    1 
ATOM   9257  P  P     . G   B 2 49   ? 62.400  21.655  140.850 1.00 36.80  ? 48   G   B P     1 
ATOM   9258  O  OP1   . G   B 2 49   ? 62.798  21.115  139.538 1.00 37.30  ? 48   G   B OP1   1 
ATOM   9259  O  OP2   . G   B 2 49   ? 61.107  22.339  141.038 1.00 36.45  ? 48   G   B OP2   1 
ATOM   9260  O  "O5'" . G   B 2 49   ? 62.461  20.496  141.936 1.00 35.82  ? 48   G   B "O5'" 1 
ATOM   9261  C  "C5'" . G   B 2 49   ? 63.629  19.716  142.096 1.00 36.06  ? 48   G   B "C5'" 1 
ATOM   9262  C  "C4'" . G   B 2 49   ? 63.650  18.937  143.395 1.00 35.28  ? 48   G   B "C4'" 1 
ATOM   9263  O  "O4'" . G   B 2 49   ? 63.679  19.807  144.559 1.00 35.27  ? 48   G   B "O4'" 1 
ATOM   9264  C  "C3'" . G   B 2 49   ? 62.481  18.024  143.700 1.00 34.44  ? 48   G   B "C3'" 1 
ATOM   9265  O  "O3'" . G   B 2 49   ? 62.422  16.858  142.901 1.00 34.33  ? 48   G   B "O3'" 1 
ATOM   9266  C  "C2'" . G   B 2 49   ? 62.714  17.720  145.166 1.00 33.77  ? 48   G   B "C2'" 1 
ATOM   9267  O  "O2'" . G   B 2 49   ? 63.782  16.796  145.294 1.00 36.15  ? 48   G   B "O2'" 1 
ATOM   9268  C  "C1'" . G   B 2 49   ? 63.186  19.083  145.676 1.00 34.36  ? 48   G   B "C1'" 1 
ATOM   9269  N  N9    . G   B 2 49   ? 62.082  19.810  146.325 1.00 33.92  ? 48   G   B N9    1 
ATOM   9270  C  C8    . G   B 2 49   ? 61.411  20.911  145.891 1.00 34.23  ? 48   G   B C8    1 
ATOM   9271  N  N7    . G   B 2 49   ? 60.469  21.278  146.712 1.00 33.80  ? 48   G   B N7    1 
ATOM   9272  C  C5    . G   B 2 49   ? 60.524  20.367  147.751 1.00 33.15  ? 48   G   B C5    1 
ATOM   9273  C  C6    . G   B 2 49   ? 59.756  20.253  148.934 1.00 32.57  ? 48   G   B C6    1 
ATOM   9274  O  O6    . G   B 2 49   ? 58.839  20.965  149.328 1.00 36.36  ? 48   G   B O6    1 
ATOM   9275  N  N1    . G   B 2 49   ? 60.139  19.175  149.709 1.00 32.12  ? 48   G   B N1    1 
ATOM   9276  C  C2    . G   B 2 49   ? 61.146  18.313  149.399 1.00 32.25  ? 48   G   B C2    1 
ATOM   9277  N  N2    . G   B 2 49   ? 61.377  17.333  150.276 1.00 31.89  ? 48   G   B N2    1 
ATOM   9278  N  N3    . G   B 2 49   ? 61.876  18.411  148.308 1.00 32.81  ? 48   G   B N3    1 
ATOM   9279  C  C4    . G   B 2 49   ? 61.514  19.453  147.527 1.00 33.22  ? 48   G   B C4    1 
ATOM   9280  P  P     . A   B 2 50   ? 61.008  16.156  142.655 1.00 33.28  ? 49   A   B P     1 
ATOM   9281  O  OP1   . A   B 2 50   ? 61.244  14.979  141.810 1.00 33.44  ? 49   A   B OP1   1 
ATOM   9282  O  OP2   . A   B 2 50   ? 60.031  17.217  142.386 1.00 33.23  ? 49   A   B OP2   1 
ATOM   9283  O  "O5'" . A   B 2 50   ? 60.582  15.574  144.060 1.00 32.48  ? 49   A   B "O5'" 1 
ATOM   9284  C  "C5'" . A   B 2 50   ? 61.212  14.425  144.589 1.00 32.39  ? 49   A   B "C5'" 1 
ATOM   9285  C  "C4'" . A   B 2 50   ? 60.560  14.011  145.876 1.00 31.67  ? 49   A   B "C4'" 1 
ATOM   9286  O  "O4'" . A   B 2 50   ? 60.690  15.076  146.850 1.00 31.67  ? 49   A   B "O4'" 1 
ATOM   9287  C  "C3'" . A   B 2 50   ? 59.066  13.784  145.812 1.00 31.05  ? 49   A   B "C3'" 1 
ATOM   9288  O  "O3'" . A   B 2 50   ? 58.692  12.549  145.228 1.00 30.94  ? 49   A   B "O3'" 1 
ATOM   9289  C  "C2'" . A   B 2 50   ? 58.675  13.928  147.270 1.00 30.59  ? 49   A   B "C2'" 1 
ATOM   9290  O  "O2'" . A   B 2 50   ? 59.117  12.796  147.993 1.00 30.48  ? 49   A   B "O2'" 1 
ATOM   9291  C  "C1'" . A   B 2 50   ? 59.546  15.103  147.677 1.00 31.03  ? 49   A   B "C1'" 1 
ATOM   9292  N  N9    . A   B 2 50   ? 58.846  16.381  147.485 1.00 31.11  ? 49   A   B N9    1 
ATOM   9293  C  C8    . A   B 2 50   ? 58.962  17.257  146.448 1.00 31.63  ? 49   A   B C8    1 
ATOM   9294  N  N7    . A   B 2 50   ? 58.195  18.313  146.560 1.00 31.70  ? 49   A   B N7    1 
ATOM   9295  C  C5    . A   B 2 50   ? 57.535  18.119  147.756 1.00 31.18  ? 49   A   B C5    1 
ATOM   9296  C  C6    . A   B 2 50   ? 56.586  18.889  148.443 1.00 31.10  ? 49   A   B C6    1 
ATOM   9297  N  N6    . A   B 2 50   ? 56.124  20.052  148.007 1.00 31.57  ? 49   A   B N6    1 
ATOM   9298  N  N1    . A   B 2 50   ? 56.122  18.413  149.611 1.00 30.64  ? 49   A   B N1    1 
ATOM   9299  C  C2    . A   B 2 50   ? 56.597  17.246  150.054 1.00 30.29  ? 49   A   B C2    1 
ATOM   9300  N  N3    . A   B 2 50   ? 57.487  16.435  149.498 1.00 30.35  ? 49   A   B N3    1 
ATOM   9301  C  C4    . A   B 2 50   ? 57.926  16.933  148.334 1.00 30.80  ? 49   A   B C4    1 
ATOM   9302  P  P     . U   B 2 51   ? 57.325  12.438  144.398 1.00 30.70  ? 50   U   B P     1 
ATOM   9303  O  OP1   . U   B 2 51   ? 57.139  11.041  143.971 1.00 30.72  ? 50   U   B OP1   1 
ATOM   9304  O  OP2   . U   B 2 51   ? 57.292  13.534  143.434 1.00 31.08  ? 50   U   B OP2   1 
ATOM   9305  O  "O5'" . U   B 2 51   ? 56.185  12.801  145.432 1.00 30.14  ? 50   U   B "O5'" 1 
ATOM   9306  C  "C5'" . U   B 2 51   ? 55.963  12.026  146.597 1.00 29.76  ? 50   U   B "C5'" 1 
ATOM   9307  C  "C4'" . U   B 2 51   ? 54.888  12.643  147.460 1.00 29.40  ? 50   U   B "C4'" 1 
ATOM   9308  O  "O4'" . U   B 2 51   ? 55.279  13.957  147.923 1.00 29.55  ? 50   U   B "O4'" 1 
ATOM   9309  C  "C3'" . U   B 2 51   ? 53.545  12.881  146.803 1.00 29.34  ? 50   U   B "C3'" 1 
ATOM   9310  O  "O3'" . U   B 2 51   ? 52.780  11.701  146.721 1.00 29.18  ? 50   U   B "O3'" 1 
ATOM   9311  C  "C2'" . U   B 2 51   ? 52.912  13.913  147.722 1.00 29.24  ? 50   U   B "C2'" 1 
ATOM   9312  O  "O2'" . U   B 2 51   ? 52.335  13.282  148.849 1.00 28.94  ? 50   U   B "O2'" 1 
ATOM   9313  C  "C1'" . U   B 2 51   ? 54.127  14.734  148.163 1.00 29.45  ? 50   U   B "C1'" 1 
ATOM   9314  N  N1    . U   B 2 51   ? 54.219  15.986  147.394 1.00 29.88  ? 50   U   B N1    1 
ATOM   9315  C  C2    . U   B 2 51   ? 53.449  17.039  147.811 1.00 30.01  ? 50   U   B C2    1 
ATOM   9316  O  O2    . U   B 2 51   ? 52.737  16.989  148.786 1.00 29.78  ? 50   U   B O2    1 
ATOM   9317  N  N3    . U   B 2 51   ? 53.550  18.166  147.053 1.00 30.53  ? 50   U   B N3    1 
ATOM   9318  C  C4    . U   B 2 51   ? 54.322  18.323  145.931 1.00 30.93  ? 50   U   B C4    1 
ATOM   9319  O  O4    . U   B 2 51   ? 54.314  19.398  145.348 1.00 31.49  ? 50   U   B O4    1 
ATOM   9320  C  C5    . U   B 2 51   ? 55.094  17.184  145.561 1.00 30.75  ? 50   U   B C5    1 
ATOM   9321  C  C6    . U   B 2 51   ? 55.014  16.077  146.287 1.00 30.26  ? 50   U   B C6    1 
ATOM   9322  P  P     . A   B 2 52   ? 52.038  11.265  145.370 1.00 29.38  ? 51   A   B P     1 
ATOM   9323  O  OP1   . A   B 2 52   ? 53.055  10.640  144.503 1.00 29.69  ? 51   A   B OP1   1 
ATOM   9324  O  OP2   . A   B 2 52   ? 51.205  12.383  144.916 1.00 29.49  ? 51   A   B OP2   1 
ATOM   9325  O  "O5'" . A   B 2 52   ? 51.020  10.158  145.852 1.00 29.23  ? 51   A   B "O5'" 1 
ATOM   9326  C  "C5'" . A   B 2 52   ? 51.485  9.015   146.531 1.00 29.19  ? 51   A   B "C5'" 1 
ATOM   9327  C  "C4'" . A   B 2 52   ? 51.400  9.181   148.027 1.00 28.92  ? 51   A   B "C4'" 1 
ATOM   9328  O  "O4'" . A   B 2 52   ? 50.063  8.871   148.471 1.00 28.87  ? 51   A   B "O4'" 1 
ATOM   9329  C  "C3'" . A   B 2 52   ? 52.308  8.264   148.830 1.00 28.96  ? 51   A   B "C3'" 1 
ATOM   9330  O  "O3'" . A   B 2 52   ? 53.574  8.863   149.018 1.00 28.99  ? 51   A   B "O3'" 1 
ATOM   9331  C  "C2'" . A   B 2 52   ? 51.554  8.072   150.141 1.00 28.80  ? 51   A   B "C2'" 1 
ATOM   9332  O  "O2'" . A   B 2 52   ? 51.875  9.093   151.073 1.00 28.62  ? 51   A   B "O2'" 1 
ATOM   9333  C  "C1'" . A   B 2 52   ? 50.093  8.241   149.718 1.00 28.81  ? 51   A   B "C1'" 1 
ATOM   9334  N  N9    . A   B 2 52   ? 49.361  6.965   149.640 1.00 29.05  ? 51   A   B N9    1 
ATOM   9335  C  C8    . A   B 2 52   ? 48.420  6.544   150.525 1.00 29.14  ? 51   A   B C8    1 
ATOM   9336  N  N7    . A   B 2 52   ? 47.935  5.371   150.267 1.00 29.49  ? 51   A   B N7    1 
ATOM   9337  C  C5    . A   B 2 52   ? 48.592  4.982   149.118 1.00 29.62  ? 51   A   B C5    1 
ATOM   9338  C  C6    . A   B 2 52   ? 48.492  3.825   148.328 1.00 30.09  ? 51   A   B C6    1 
ATOM   9339  N  N6    . A   B 2 52   ? 47.677  2.807   148.593 1.00 30.52  ? 51   A   B N6    1 
ATOM   9340  N  N1    . A   B 2 52   ? 49.278  3.752   147.244 1.00 30.22  ? 51   A   B N1    1 
ATOM   9341  C  C2    . A   B 2 52   ? 50.093  4.781   146.988 1.00 29.91  ? 51   A   B C2    1 
ATOM   9342  N  N3    . A   B 2 52   ? 50.266  5.921   147.643 1.00 29.49  ? 51   A   B N3    1 
ATOM   9343  C  C4    . A   B 2 52   ? 49.474  5.961   148.716 1.00 29.35  ? 51   A   B C4    1 
ATOM   9344  P  P     . A   B 2 53   ? 54.909  8.261   148.385 1.00 29.37  ? 52   A   B P     1 
ATOM   9345  O  OP1   . A   B 2 53   ? 55.962  9.258   148.573 1.00 29.45  ? 52   A   B OP1   1 
ATOM   9346  O  OP2   . A   B 2 53   ? 54.664  7.760   147.028 1.00 29.63  ? 52   A   B OP2   1 
ATOM   9347  O  "O5'" . A   B 2 53   ? 55.214  6.972   149.269 1.00 29.52  ? 52   A   B "O5'" 1 
ATOM   9348  C  "C5'" . A   B 2 53   ? 55.950  7.053   150.483 1.00 29.52  ? 52   A   B "C5'" 1 
ATOM   9349  C  "C4'" . A   B 2 53   ? 56.319  5.690   151.019 1.00 29.87  ? 52   A   B "C4'" 1 
ATOM   9350  O  "O4'" . A   B 2 53   ? 55.109  4.936   151.267 1.00 29.81  ? 52   A   B "O4'" 1 
ATOM   9351  C  "C3'" . A   B 2 53   ? 57.144  4.798   150.100 1.00 30.45  ? 52   A   B "C3'" 1 
ATOM   9352  O  "O3'" . A   B 2 53   ? 58.534  5.016   150.211 1.00 30.81  ? 52   A   B "O3'" 1 
ATOM   9353  C  "C2'" . A   B 2 53   ? 56.754  3.401   150.548 1.00 30.79  ? 52   A   B "C2'" 1 
ATOM   9354  O  "O2'" . A   B 2 53   ? 57.445  3.065   151.737 1.00 32.10  ? 52   A   B "O2'" 1 
ATOM   9355  C  "C1'" . A   B 2 53   ? 55.286  3.591   150.892 1.00 30.34  ? 52   A   B "C1'" 1 
ATOM   9356  N  N9    . A   B 2 53   ? 54.409  3.313   149.735 1.00 30.48  ? 52   A   B N9    1 
ATOM   9357  C  C8    . A   B 2 53   ? 54.223  4.064   148.594 1.00 30.24  ? 52   A   B C8    1 
ATOM   9358  N  N7    . A   B 2 53   ? 53.372  3.539   147.749 1.00 30.43  ? 52   A   B N7    1 
ATOM   9359  C  C5    . A   B 2 53   ? 52.976  2.362   148.365 1.00 30.76  ? 52   A   B C5    1 
ATOM   9360  C  C6    . A   B 2 53   ? 52.086  1.350   147.998 1.00 31.18  ? 52   A   B C6    1 
ATOM   9361  N  N6    . A   B 2 53   ? 51.401  1.345   146.875 1.00 31.43  ? 52   A   B N6    1 
ATOM   9362  N  N1    . A   B 2 53   ? 51.904  0.315   148.835 1.00 32.93  ? 52   A   B N1    1 
ATOM   9363  C  C2    . A   B 2 53   ? 52.589  0.302   149.980 1.00 31.52  ? 52   A   B C2    1 
ATOM   9364  N  N3    . A   B 2 53   ? 53.455  1.187   150.439 1.00 31.12  ? 52   A   B N3    1 
ATOM   9365  C  C4    . A   B 2 53   ? 53.603  2.207   149.583 1.00 31.20  ? 52   A   B C4    1 
ATOM   9366  P  P     . G   B 2 54   ? 59.391  5.621   149.007 1.00 36.06  ? 53   G   B P     1 
ATOM   9367  O  OP1   . G   B 2 54   ? 60.807  5.504   149.376 1.00 37.11  ? 53   G   B OP1   1 
ATOM   9368  O  OP2   . G   B 2 54   ? 58.830  6.933   148.637 1.00 44.71  ? 53   G   B OP2   1 
ATOM   9369  O  "O5'" . G   B 2 54   ? 59.124  4.657   147.779 1.00 35.11  ? 53   G   B "O5'" 1 
ATOM   9370  C  "C5'" . G   B 2 54   ? 59.532  3.310   147.811 1.00 35.21  ? 53   G   B "C5'" 1 
ATOM   9371  C  "C4'" . G   B 2 54   ? 58.560  2.430   147.077 1.00 34.67  ? 53   G   B "C4'" 1 
ATOM   9372  O  "O4'" . G   B 2 54   ? 57.274  3.081   146.941 1.00 34.52  ? 53   G   B "O4'" 1 
ATOM   9373  C  "C3'" . G   B 2 54   ? 58.925  2.080   145.655 1.00 36.22  ? 53   G   B "C3'" 1 
ATOM   9374  O  "O3'" . G   B 2 54   ? 59.923  1.091   145.594 1.00 40.90  ? 53   G   B "O3'" 1 
ATOM   9375  C  "C2'" . G   B 2 54   ? 57.585  1.642   145.088 1.00 34.76  ? 53   G   B "C2'" 1 
ATOM   9376  O  "O2'" . G   B 2 54   ? 57.231  0.353   145.565 1.00 34.46  ? 53   G   B "O2'" 1 
ATOM   9377  C  "C1'" . G   B 2 54   ? 56.655  2.653   145.745 1.00 34.53  ? 53   G   B "C1'" 1 
ATOM   9378  N  N9    . G   B 2 54   ? 56.454  3.821   144.879 1.00 35.60  ? 53   G   B N9    1 
ATOM   9379  C  C8    . G   B 2 54   ? 56.968  5.076   145.062 1.00 36.93  ? 53   G   B C8    1 
ATOM   9380  N  N7    . G   B 2 54   ? 56.621  5.911   144.127 1.00 38.80  ? 53   G   B N7    1 
ATOM   9381  C  C5    . G   B 2 54   ? 55.831  5.154   143.279 1.00 36.06  ? 53   G   B C5    1 
ATOM   9382  C  C6    . G   B 2 54   ? 55.182  5.516   142.082 1.00 33.47  ? 53   G   B C6    1 
ATOM   9383  O  O6    . G   B 2 54   ? 55.159  6.610   141.529 1.00 34.04  ? 53   G   B O6    1 
ATOM   9384  N  N1    . G   B 2 54   ? 54.497  4.450   141.534 1.00 33.32  ? 53   G   B N1    1 
ATOM   9385  C  C2    . G   B 2 54   ? 54.438  3.193   142.056 1.00 33.70  ? 53   G   B C2    1 
ATOM   9386  N  N2    . G   B 2 54   ? 53.713  2.308   141.368 1.00 33.82  ? 53   G   B N2    1 
ATOM   9387  N  N3    . G   B 2 54   ? 55.041  2.834   143.169 1.00 36.74  ? 53   G   B N3    1 
ATOM   9388  C  C4    . G   B 2 54   ? 55.718  3.861   143.724 1.00 37.21  ? 53   G   B C4    1 
ATOM   9389  P  P     . G   B 2 55   ? 60.977  1.072   144.398 1.00 35.50  ? 54   G   B P     1 
ATOM   9390  O  OP1   . G   B 2 55   ? 62.118  0.242   144.827 1.00 38.12  ? 54   G   B OP1   1 
ATOM   9391  O  OP2   . G   B 2 55   ? 61.235  2.436   143.909 1.00 34.33  ? 54   G   B OP2   1 
ATOM   9392  O  "O5'" . G   B 2 55   ? 60.203  0.235   143.297 1.00 35.73  ? 54   G   B "O5'" 1 
ATOM   9393  C  "C5'" . G   B 2 55   ? 60.049  0.728   141.988 1.00 36.43  ? 54   G   B "C5'" 1 
ATOM   9394  C  "C4'" . G   B 2 55   ? 58.887  0.079   141.298 1.00 36.11  ? 54   G   B "C4'" 1 
ATOM   9395  O  "O4'" . G   B 2 55   ? 57.654  0.760   141.668 1.00 35.50  ? 54   G   B "O4'" 1 
ATOM   9396  C  "C3'" . G   B 2 55   ? 58.931  0.186   139.784 1.00 36.37  ? 54   G   B "C3'" 1 
ATOM   9397  O  "O3'" . G   B 2 55   ? 59.744  -0.801  139.193 1.00 37.86  ? 54   G   B "O3'" 1 
ATOM   9398  C  "C2'" . G   B 2 55   ? 57.462  0.127   139.406 1.00 36.10  ? 54   G   B "C2'" 1 
ATOM   9399  O  "O2'" . G   B 2 55   ? 56.950  -1.193  139.523 1.00 38.62  ? 54   G   B "O2'" 1 
ATOM   9400  C  "C1'" . G   B 2 55   ? 56.867  0.980   140.517 1.00 34.38  ? 54   G   B "C1'" 1 
ATOM   9401  N  N9    . G   B 2 55   ? 56.988  2.402   140.163 1.00 33.89  ? 54   G   B N9    1 
ATOM   9402  C  C8    . G   B 2 55   ? 57.749  3.371   140.782 1.00 33.51  ? 54   G   B C8    1 
ATOM   9403  N  N7    . G   B 2 55   ? 57.652  4.541   140.205 1.00 33.28  ? 54   G   B N7    1 
ATOM   9404  C  C5    . G   B 2 55   ? 56.795  4.316   139.125 1.00 33.50  ? 54   G   B C5    1 
ATOM   9405  C  C6    . G   B 2 55   ? 56.298  5.183   138.120 1.00 33.49  ? 54   G   B C6    1 
ATOM   9406  O  O6    . G   B 2 55   ? 56.511  6.371   137.940 1.00 33.33  ? 54   G   B O6    1 
ATOM   9407  N  N1    . G   B 2 55   ? 55.446  4.545   137.253 1.00 33.83  ? 54   G   B N1    1 
ATOM   9408  C  C2    . G   B 2 55   ? 55.110  3.224   137.310 1.00 34.19  ? 54   G   B C2    1 
ATOM   9409  N  N2    . G   B 2 55   ? 54.278  2.772   136.366 1.00 34.60  ? 54   G   B N2    1 
ATOM   9410  N  N3    . G   B 2 55   ? 55.557  2.401   138.234 1.00 34.24  ? 54   G   B N3    1 
ATOM   9411  C  C4    . G   B 2 55   ? 56.385  3.005   139.097 1.00 33.87  ? 54   G   B C4    1 
ATOM   9412  P  P     . C   B 2 56   ? 60.736  -0.408  138.003 1.00 37.90  ? 55   C   B P     1 
ATOM   9413  O  OP1   . C   B 2 56   ? 61.742  -1.479  137.877 1.00 39.80  ? 55   C   B OP1   1 
ATOM   9414  O  OP2   . C   B 2 56   ? 61.185  0.985   138.172 1.00 37.28  ? 55   C   B OP2   1 
ATOM   9415  O  "O5'" . C   B 2 56   ? 59.786  -0.447  136.729 1.00 38.07  ? 55   C   B "O5'" 1 
ATOM   9416  C  "C5'" . C   B 2 56   ? 58.827  -1.481  136.578 1.00 38.33  ? 55   C   B "C5'" 1 
ATOM   9417  C  "C4'" . C   B 2 56   ? 57.837  -1.145  135.500 1.00 39.90  ? 55   C   B "C4'" 1 
ATOM   9418  O  "O4'" . C   B 2 56   ? 57.093  0.038   135.874 1.00 38.68  ? 55   C   B "O4'" 1 
ATOM   9419  C  "C3'" . C   B 2 56   ? 58.434  -0.792  134.151 1.00 40.25  ? 55   C   B "C3'" 1 
ATOM   9420  O  "O3'" . C   B 2 56   ? 58.780  -1.939  133.394 1.00 42.53  ? 55   C   B "O3'" 1 
ATOM   9421  C  "C2'" . C   B 2 56   ? 57.337  0.050   133.518 1.00 38.68  ? 55   C   B "C2'" 1 
ATOM   9422  O  "O2'" . C   B 2 56   ? 56.300  -0.776  133.023 1.00 38.81  ? 55   C   B "O2'" 1 
ATOM   9423  C  "C1'" . C   B 2 56   ? 56.791  0.797   134.728 1.00 37.97  ? 55   C   B "C1'" 1 
ATOM   9424  N  N1    . C   B 2 56   ? 57.382  2.140   134.883 1.00 38.50  ? 55   C   B N1    1 
ATOM   9425  C  C2    . C   B 2 56   ? 57.005  3.152   133.997 1.00 41.94  ? 55   C   B C2    1 
ATOM   9426  O  O2    . C   B 2 56   ? 56.206  2.900   133.088 1.00 40.86  ? 55   C   B O2    1 
ATOM   9427  N  N3    . C   B 2 56   ? 57.532  4.386   134.152 1.00 41.57  ? 55   C   B N3    1 
ATOM   9428  C  C4    . C   B 2 56   ? 58.390  4.626   135.141 1.00 37.18  ? 55   C   B C4    1 
ATOM   9429  N  N4    . C   B 2 56   ? 58.886  5.854   135.248 1.00 36.54  ? 55   C   B N4    1 
ATOM   9430  C  C5    . C   B 2 56   ? 58.781  3.615   136.058 1.00 36.46  ? 55   C   B C5    1 
ATOM   9431  C  C6    . C   B 2 56   ? 58.255  2.400   135.897 1.00 36.61  ? 55   C   B C6    1 
ATOM   9432  P  P     . U   B 2 57   ? 60.131  -1.984  132.530 1.00 41.58  ? 56   U   B P     1 
ATOM   9433  O  OP1   . U   B 2 57   ? 60.388  -3.406  132.222 1.00 45.13  ? 56   U   B OP1   1 
ATOM   9434  O  OP2   . U   B 2 57   ? 61.182  -1.153  133.143 1.00 41.25  ? 56   U   B OP2   1 
ATOM   9435  O  "O5'" . U   B 2 57   ? 59.738  -1.247  131.185 1.00 41.76  ? 56   U   B "O5'" 1 
ATOM   9436  C  "C5'" . U   B 2 57   ? 58.514  -1.547  130.532 1.00 41.78  ? 56   U   B "C5'" 1 
ATOM   9437  C  "C4'" . U   B 2 57   ? 58.239  -0.586  129.409 1.00 41.82  ? 56   U   B "C4'" 1 
ATOM   9438  O  "O4'" . U   B 2 57   ? 58.021  0.745   129.949 1.00 40.60  ? 56   U   B "O4'" 1 
ATOM   9439  C  "C3'" . U   B 2 57   ? 59.356  -0.453  128.378 1.00 43.03  ? 56   U   B "C3'" 1 
ATOM   9440  O  "O3'" . U   B 2 57   ? 58.776  -0.288  127.093 1.00 43.60  ? 56   U   B "O3'" 1 
ATOM   9441  C  "C2'" . U   B 2 57   ? 60.024  0.855   128.770 1.00 42.37  ? 56   U   B "C2'" 1 
ATOM   9442  O  "O2'" . U   B 2 57   ? 60.677  1.499   127.701 1.00 44.29  ? 56   U   B "O2'" 1 
ATOM   9443  C  "C1'" . U   B 2 57   ? 58.833  1.662   129.258 1.00 41.00  ? 56   U   B "C1'" 1 
ATOM   9444  N  N1    . U   B 2 57   ? 59.175  2.786   130.137 1.00 40.05  ? 56   U   B N1    1 
ATOM   9445  C  C2    . U   B 2 57   ? 58.880  4.036   129.654 1.00 39.75  ? 56   U   B C2    1 
ATOM   9446  O  O2    . U   B 2 57   ? 58.350  4.222   128.573 1.00 41.45  ? 56   U   B O2    1 
ATOM   9447  N  N3    . U   B 2 57   ? 59.228  5.067   130.473 1.00 40.46  ? 56   U   B N3    1 
ATOM   9448  C  C4    . U   B 2 57   ? 59.825  4.982   131.707 1.00 38.52  ? 56   U   B C4    1 
ATOM   9449  O  O4    . U   B 2 57   ? 60.051  6.015   132.312 1.00 37.95  ? 56   U   B O4    1 
ATOM   9450  C  C5    . U   B 2 57   ? 60.108  3.660   132.142 1.00 38.85  ? 56   U   B C5    1 
ATOM   9451  C  C6    . U   B 2 57   ? 59.779  2.635   131.354 1.00 39.60  ? 56   U   B C6    1 
ATOM   9452  P  P     . U   B 2 58   ? 59.450  -0.931  125.790 1.00 45.36  ? 57   U   B P     1 
ATOM   9453  O  OP1   . U   B 2 58   ? 58.360  -1.722  125.182 1.00 45.79  ? 57   U   B OP1   1 
ATOM   9454  O  OP2   . U   B 2 58   ? 60.724  -1.621  126.082 1.00 46.29  ? 57   U   B OP2   1 
ATOM   9455  O  "O5'" . U   B 2 58   ? 59.764  0.329   124.881 1.00 45.55  ? 57   U   B "O5'" 1 
ATOM   9456  C  "C5'" . U   B 2 58   ? 59.050  0.520   123.668 1.00 48.15  ? 57   U   B "C5'" 1 
ATOM   9457  C  "C4'" . U   B 2 58   ? 58.556  1.934   123.503 1.00 47.21  ? 57   U   B "C4'" 1 
ATOM   9458  O  "O4'" . U   B 2 58   ? 57.321  2.135   124.241 1.00 47.06  ? 57   U   B "O4'" 1 
ATOM   9459  C  "C3'" . U   B 2 58   ? 59.502  3.041   123.957 1.00 49.76  ? 57   U   B "C3'" 1 
ATOM   9460  O  "O3'" . U   B 2 58   ? 59.325  4.124   123.055 1.00 54.68  ? 57   U   B "O3'" 1 
ATOM   9461  C  "C2'" . U   B 2 58   ? 58.922  3.431   125.313 1.00 47.97  ? 57   U   B "C2'" 1 
ATOM   9462  O  "O2'" . U   B 2 58   ? 59.260  4.729   125.751 1.00 48.83  ? 57   U   B "O2'" 1 
ATOM   9463  C  "C1'" . U   B 2 58   ? 57.438  3.300   125.025 1.00 46.25  ? 57   U   B "C1'" 1 
ATOM   9464  N  N1    . U   B 2 58   ? 56.553  3.169   126.186 1.00 43.18  ? 57   U   B N1    1 
ATOM   9465  C  C2    . U   B 2 58   ? 55.906  4.301   126.635 1.00 41.29  ? 57   U   B C2    1 
ATOM   9466  O  O2    . U   B 2 58   ? 56.074  5.403   126.148 1.00 43.42  ? 57   U   B O2    1 
ATOM   9467  N  N3    . U   B 2 58   ? 55.064  4.092   127.694 1.00 40.39  ? 57   U   B N3    1 
ATOM   9468  C  C4    . U   B 2 58   ? 54.808  2.893   128.315 1.00 41.24  ? 57   U   B C4    1 
ATOM   9469  O  O4    . U   B 2 58   ? 54.027  2.849   129.256 1.00 42.86  ? 57   U   B O4    1 
ATOM   9470  C  C5    . U   B 2 58   ? 55.500  1.771   127.783 1.00 42.04  ? 57   U   B C5    1 
ATOM   9471  C  C6    . U   B 2 58   ? 56.319  1.945   126.750 1.00 42.65  ? 57   U   B C6    1 
ATOM   9472  P  P     . C   B 2 59   ? 60.548  5.073   122.663 1.00 48.87  ? 58   C   B P     1 
ATOM   9473  O  OP1   . C   B 2 59   ? 60.472  5.475   121.246 1.00 47.14  ? 58   C   B OP1   1 
ATOM   9474  O  OP2   . C   B 2 59   ? 61.801  4.487   123.178 1.00 48.17  ? 58   C   B OP2   1 
ATOM   9475  O  "O5'" . C   B 2 59   ? 60.257  6.380   123.492 1.00 49.59  ? 58   C   B "O5'" 1 
ATOM   9476  C  "C5'" . C   B 2 59   ? 61.249  7.374   123.516 1.00 53.09  ? 58   C   B "C5'" 1 
ATOM   9477  C  "C4'" . C   B 2 59   ? 60.771  8.632   124.155 1.00 52.64  ? 58   C   B "C4'" 1 
ATOM   9478  O  "O4'" . C   B 2 59   ? 60.587  8.384   125.571 1.00 52.74  ? 58   C   B "O4'" 1 
ATOM   9479  C  "C3'" . C   B 2 59   ? 61.798  9.735   124.054 1.00 53.93  ? 58   C   B "C3'" 1 
ATOM   9480  O  "O3'" . C   B 2 59   ? 61.127  10.988  124.059 1.00 54.35  ? 58   C   B "O3'" 1 
ATOM   9481  C  "C2'" . C   B 2 59   ? 62.625  9.532   125.317 1.00 53.83  ? 58   C   B "C2'" 1 
ATOM   9482  O  "O2'" . C   B 2 59   ? 63.318  10.682  125.750 1.00 59.20  ? 58   C   B "O2'" 1 
ATOM   9483  C  "C1'" . C   B 2 59   ? 61.562  9.088   126.317 1.00 51.20  ? 58   C   B "C1'" 1 
ATOM   9484  N  N1    . C   B 2 59   ? 62.054  8.168   127.347 1.00 48.70  ? 58   C   B N1    1 
ATOM   9485  C  C2    . C   B 2 59   ? 62.811  8.639   128.423 1.00 45.26  ? 58   C   B C2    1 
ATOM   9486  O  O2    . C   B 2 59   ? 63.091  9.844   128.499 1.00 46.89  ? 58   C   B O2    1 
ATOM   9487  N  N3    . C   B 2 59   ? 63.234  7.763   129.357 1.00 44.24  ? 58   C   B N3    1 
ATOM   9488  C  C4    . C   B 2 59   ? 62.924  6.473   129.249 1.00 44.98  ? 58   C   B C4    1 
ATOM   9489  N  N4    . C   B 2 59   ? 63.357  5.641   130.195 1.00 46.92  ? 58   C   B N4    1 
ATOM   9490  C  C5    . C   B 2 59   ? 62.147  5.971   128.168 1.00 47.42  ? 58   C   B C5    1 
ATOM   9491  C  C6    . C   B 2 59   ? 61.734  6.849   127.251 1.00 49.02  ? 58   C   B C6    1 
ATOM   9492  P  P     . A   B 2 60   ? 60.709  11.637  122.658 1.00 59.24  ? 59   A   B P     1 
ATOM   9493  O  OP1   . A   B 2 60   ? 61.211  10.778  121.569 1.00 61.77  ? 59   A   B OP1   1 
ATOM   9494  O  OP2   . A   B 2 60   ? 61.078  13.069  122.705 1.00 68.62  ? 59   A   B OP2   1 
ATOM   9495  O  "O5'" . A   B 2 60   ? 59.131  11.561  122.668 1.00 55.85  ? 59   A   B "O5'" 1 
ATOM   9496  C  "C5'" . A   B 2 60   ? 58.371  12.527  123.373 1.00 48.13  ? 59   A   B "C5'" 1 
ATOM   9497  C  "C4'" . A   B 2 60   ? 57.161  11.906  124.009 1.00 44.14  ? 59   A   B "C4'" 1 
ATOM   9498  O  "O4'" . A   B 2 60   ? 57.588  10.983  125.044 1.00 44.27  ? 59   A   B "O4'" 1 
ATOM   9499  C  "C3'" . A   B 2 60   ? 56.235  12.892  124.697 1.00 41.72  ? 59   A   B "C3'" 1 
ATOM   9500  O  "O3'" . A   B 2 60   ? 54.938  12.314  124.736 1.00 40.68  ? 59   A   B "O3'" 1 
ATOM   9501  C  "C2'" . A   B 2 60   ? 56.779  12.895  126.110 1.00 40.28  ? 59   A   B "C2'" 1 
ATOM   9502  O  "O2'" . A   B 2 60   ? 55.861  13.365  127.062 1.00 39.38  ? 59   A   B "O2'" 1 
ATOM   9503  C  "C1'" . A   B 2 60   ? 57.077  11.415  126.291 1.00 42.10  ? 59   A   B "C1'" 1 
ATOM   9504  N  N9    . A   B 2 60   ? 58.059  11.108  127.326 1.00 39.79  ? 59   A   B N9    1 
ATOM   9505  C  C8    . A   B 2 60   ? 58.977  11.932  127.905 1.00 39.80  ? 59   A   B C8    1 
ATOM   9506  N  N7    . A   B 2 60   ? 59.711  11.332  128.805 1.00 39.48  ? 59   A   B N7    1 
ATOM   9507  C  C5    . A   B 2 60   ? 59.239  10.029  128.820 1.00 39.27  ? 59   A   B C5    1 
ATOM   9508  C  C6    . A   B 2 60   ? 59.593  8.883   129.552 1.00 39.02  ? 59   A   B C6    1 
ATOM   9509  N  N6    . A   B 2 60   ? 60.555  8.843   130.469 1.00 38.88  ? 59   A   B N6    1 
ATOM   9510  N  N1    . A   B 2 60   ? 58.914  7.743   129.310 1.00 39.02  ? 59   A   B N1    1 
ATOM   9511  C  C2    . A   B 2 60   ? 57.940  7.765   128.395 1.00 39.23  ? 59   A   B C2    1 
ATOM   9512  N  N3    . A   B 2 60   ? 57.521  8.775   127.649 1.00 39.45  ? 59   A   B N3    1 
ATOM   9513  C  C4    . A   B 2 60   ? 58.220  9.884   127.908 1.00 39.47  ? 59   A   B C4    1 
ATOM   9514  P  P     . U   B 2 61   ? 53.678  13.062  124.115 1.00 40.88  ? 60   U   B P     1 
ATOM   9515  O  OP1   . U   B 2 61   ? 52.697  11.996  123.870 1.00 40.75  ? 60   U   B OP1   1 
ATOM   9516  O  OP2   . U   B 2 61   ? 54.157  13.989  123.083 1.00 42.00  ? 60   U   B OP2   1 
ATOM   9517  O  "O5'" . U   B 2 61   ? 53.068  13.916  125.294 1.00 39.90  ? 60   U   B "O5'" 1 
ATOM   9518  C  "C5'" . U   B 2 61   ? 53.514  15.233  125.538 1.00 40.06  ? 60   U   B "C5'" 1 
ATOM   9519  C  "C4'" . U   B 2 61   ? 52.354  16.140  125.845 1.00 39.80  ? 60   U   B "C4'" 1 
ATOM   9520  O  "O4'" . U   B 2 61   ? 51.455  16.196  124.709 1.00 40.54  ? 60   U   B "O4'" 1 
ATOM   9521  C  "C3'" . U   B 2 61   ? 51.452  15.718  126.987 1.00 38.68  ? 60   U   B "C3'" 1 
ATOM   9522  O  "O3'" . U   B 2 61   ? 52.015  15.974  128.263 1.00 37.92  ? 60   U   B "O3'" 1 
ATOM   9523  C  "C2'" . U   B 2 61   ? 50.187  16.512  126.692 1.00 38.96  ? 60   U   B "C2'" 1 
ATOM   9524  O  "O2'" . U   B 2 61   ? 50.349  17.869  127.062 1.00 39.15  ? 60   U   B "O2'" 1 
ATOM   9525  C  "C1'" . U   B 2 61   ? 50.138  16.435  125.159 1.00 40.08  ? 60   U   B "C1'" 1 
ATOM   9526  N  N1    . U   B 2 61   ? 49.253  15.341  124.705 1.00 40.07  ? 60   U   B N1    1 
ATOM   9527  C  C2    . U   B 2 61   ? 47.911  15.624  124.607 1.00 40.16  ? 60   U   B C2    1 
ATOM   9528  O  O2    . U   B 2 61   ? 47.460  16.729  124.830 1.00 40.31  ? 60   U   B O2    1 
ATOM   9529  N  N3    . U   B 2 61   ? 47.109  14.582  124.213 1.00 40.23  ? 60   U   B N3    1 
ATOM   9530  C  C4    . U   B 2 61   ? 47.526  13.305  123.935 1.00 40.23  ? 60   U   B C4    1 
ATOM   9531  O  O4    . U   B 2 61   ? 46.700  12.466  123.611 1.00 40.40  ? 60   U   B O4    1 
ATOM   9532  C  C5    . U   B 2 61   ? 48.930  13.084  124.074 1.00 40.13  ? 60   U   B C5    1 
ATOM   9533  C  C6    . U   B 2 61   ? 49.724  14.085  124.449 1.00 40.05  ? 60   U   B C6    1 
ATOM   9534  P  P     . G   B 2 62   ? 51.776  14.979  129.500 1.00 36.81  ? 61   G   B P     1 
ATOM   9535  O  OP1   . G   B 2 62   ? 50.368  15.043  129.906 1.00 36.39  ? 61   G   B OP1   1 
ATOM   9536  O  OP2   . G   B 2 62   ? 52.853  15.256  130.458 1.00 36.43  ? 61   G   B OP2   1 
ATOM   9537  O  "O5'" . G   B 2 62   ? 51.995  13.522  128.928 1.00 36.97  ? 61   G   B "O5'" 1 
ATOM   9538  C  "C5'" . G   B 2 62   ? 53.271  12.907  128.901 1.00 37.16  ? 61   G   B "C5'" 1 
ATOM   9539  C  "C4'" . G   B 2 62   ? 53.138  11.456  128.524 1.00 37.29  ? 61   G   B "C4'" 1 
ATOM   9540  O  "O4'" . G   B 2 62   ? 54.441  10.852  128.327 1.00 37.75  ? 61   G   B "O4'" 1 
ATOM   9541  C  "C3'" . G   B 2 62   ? 52.475  10.560  129.551 1.00 36.45  ? 61   G   B "C3'" 1 
ATOM   9542  O  "O3'" . G   B 2 62   ? 51.068  10.663  129.548 1.00 36.23  ? 61   G   B "O3'" 1 
ATOM   9543  C  "C2'" . G   B 2 62   ? 52.988  9.187   129.154 1.00 36.89  ? 61   G   B "C2'" 1 
ATOM   9544  O  "O2'" . G   B 2 62   ? 52.338  8.728   127.983 1.00 37.61  ? 61   G   B "O2'" 1 
ATOM   9545  C  "C1'" . G   B 2 62   ? 54.422  9.515   128.780 1.00 37.48  ? 61   G   B "C1'" 1 
ATOM   9546  N  N9    . G   B 2 62   ? 55.317  9.403   129.945 1.00 36.96  ? 61   G   B N9    1 
ATOM   9547  C  C8    . G   B 2 62   ? 56.006  10.432  130.539 1.00 36.73  ? 61   G   B C8    1 
ATOM   9548  N  N7    . G   B 2 62   ? 56.729  10.052  131.550 1.00 36.35  ? 61   G   B N7    1 
ATOM   9549  C  C5    . G   B 2 62   ? 56.512  8.688   131.639 1.00 36.33  ? 61   G   B C5    1 
ATOM   9550  C  C6    . G   B 2 62   ? 57.035  7.738   132.547 1.00 36.09  ? 61   G   B C6    1 
ATOM   9551  O  O6    . G   B 2 62   ? 57.818  7.919   133.479 1.00 35.81  ? 61   G   B O6    1 
ATOM   9552  N  N1    . G   B 2 62   ? 56.554  6.460   132.286 1.00 36.33  ? 61   G   B N1    1 
ATOM   9553  C  C2    . G   B 2 62   ? 55.685  6.132   131.282 1.00 36.74  ? 61   G   B C2    1 
ATOM   9554  N  N2    . G   B 2 62   ? 55.347  4.838   131.204 1.00 37.04  ? 61   G   B N2    1 
ATOM   9555  N  N3    . G   B 2 62   ? 55.190  7.011   130.425 1.00 36.93  ? 61   G   B N3    1 
ATOM   9556  C  C4    . G   B 2 62   ? 55.638  8.265   130.657 1.00 36.71  ? 61   G   B C4    1 
ATOM   9557  P  P     . C   B 2 63   ? 50.228  10.421  130.887 1.00 35.29  ? 62   C   B P     1 
ATOM   9558  O  OP1   . C   B 2 63   ? 48.790  10.567  130.599 1.00 35.39  ? 62   C   B OP1   1 
ATOM   9559  O  OP2   . C   B 2 63   ? 50.783  11.283  131.949 1.00 34.71  ? 62   C   B OP2   1 
ATOM   9560  O  "O5'" . C   B 2 63   ? 50.532  8.907   131.243 1.00 35.19  ? 62   C   B "O5'" 1 
ATOM   9561  C  "C5'" . C   B 2 63   ? 50.014  7.846   130.466 1.00 35.74  ? 62   C   B "C5'" 1 
ATOM   9562  C  "C4'" . C   B 2 63   ? 50.297  6.510   131.104 1.00 35.62  ? 62   C   B "C4'" 1 
ATOM   9563  O  "O4'" . C   B 2 63   ? 51.727  6.291   131.215 1.00 35.78  ? 62   C   B "O4'" 1 
ATOM   9564  C  "C3'" . C   B 2 63   ? 49.793  6.341   132.525 1.00 34.78  ? 62   C   B "C3'" 1 
ATOM   9565  O  "O3'" . C   B 2 63   ? 48.413  6.050   132.574 1.00 34.77  ? 62   C   B "O3'" 1 
ATOM   9566  C  "C2'" . C   B 2 63   ? 50.676  5.226   133.057 1.00 34.84  ? 62   C   B "C2'" 1 
ATOM   9567  O  "O2'" . C   B 2 63   ? 50.225  3.963   132.606 1.00 36.36  ? 62   C   B "O2'" 1 
ATOM   9568  C  "C1'" . C   B 2 63   ? 52.004  5.534   132.372 1.00 35.32  ? 62   C   B "C1'" 1 
ATOM   9569  N  N1    . C   B 2 63   ? 52.906  6.301   133.252 1.00 34.79  ? 62   C   B N1    1 
ATOM   9570  C  C2    . C   B 2 63   ? 53.623  5.616   134.238 1.00 34.57  ? 62   C   B C2    1 
ATOM   9571  O  O2    . C   B 2 63   ? 53.488  4.396   134.347 1.00 34.84  ? 62   C   B O2    1 
ATOM   9572  N  N3    . C   B 2 63   ? 54.449  6.291   135.057 1.00 34.16  ? 62   C   B N3    1 
ATOM   9573  C  C4    . C   B 2 63   ? 54.589  7.601   134.937 1.00 33.99  ? 62   C   B C4    1 
ATOM   9574  N  N4    . C   B 2 63   ? 55.424  8.206   135.779 1.00 33.69  ? 62   C   B N4    1 
ATOM   9575  C  C5    . C   B 2 63   ? 53.871  8.337   133.952 1.00 34.24  ? 62   C   B C5    1 
ATOM   9576  C  C6    . C   B 2 63   ? 53.047  7.656   133.134 1.00 34.61  ? 62   C   B C6    1 
ATOM   9577  P  P     . C   B 2 64   ? 47.556  6.398   133.867 1.00 34.01  ? 63   C   B P     1 
ATOM   9578  O  OP1   . C   B 2 64   ? 46.142  6.060   133.682 1.00 34.28  ? 63   C   B OP1   1 
ATOM   9579  O  OP2   . C   B 2 64   ? 47.894  7.769   134.276 1.00 33.55  ? 63   C   B OP2   1 
ATOM   9580  O  "O5'" . C   B 2 64   ? 48.081  5.343   134.920 1.00 33.72  ? 63   C   B "O5'" 1 
ATOM   9581  C  "C5'" . C   B 2 64   ? 47.725  3.985   134.784 1.00 34.21  ? 63   C   B "C5'" 1 
ATOM   9582  C  "C4'" . C   B 2 64   ? 48.367  3.116   135.832 1.00 34.01  ? 63   C   B "C4'" 1 
ATOM   9583  O  "O4'" . C   B 2 64   ? 49.808  3.220   135.768 1.00 34.04  ? 63   C   B "O4'" 1 
ATOM   9584  C  "C3'" . C   B 2 64   ? 48.059  3.437   137.275 1.00 33.26  ? 63   C   B "C3'" 1 
ATOM   9585  O  "O3'" . C   B 2 64   ? 46.779  3.011   137.686 1.00 33.32  ? 63   C   B "O3'" 1 
ATOM   9586  C  "C2'" . C   B 2 64   ? 49.190  2.725   137.999 1.00 33.22  ? 63   C   B "C2'" 1 
ATOM   9587  O  "O2'" . C   B 2 64   ? 48.942  1.334   138.055 1.00 33.81  ? 63   C   B "O2'" 1 
ATOM   9588  C  "C1'" . C   B 2 64   ? 50.352  2.961   137.040 1.00 33.59  ? 63   C   B "C1'" 1 
ATOM   9589  N  N1    . C   B 2 64   ? 51.182  4.107   137.457 1.00 33.06  ? 63   C   B N1    1 
ATOM   9590  C  C2    . C   B 2 64   ? 52.156  3.865   138.417 1.00 32.85  ? 63   C   B C2    1 
ATOM   9591  O  O2    . C   B 2 64   ? 52.268  2.721   138.848 1.00 33.13  ? 63   C   B O2    1 
ATOM   9592  N  N3    . C   B 2 64   ? 52.951  4.861   138.837 1.00 32.47  ? 63   C   B N3    1 
ATOM   9593  C  C4    . C   B 2 64   ? 52.788  6.074   138.335 1.00 32.32  ? 63   C   B C4    1 
ATOM   9594  N  N4    . C   B 2 64   ? 53.598  7.030   138.778 1.00 33.25  ? 63   C   B N4    1 
ATOM   9595  C  C5    . C   B 2 64   ? 51.800  6.362   137.346 1.00 32.54  ? 63   C   B C5    1 
ATOM   9596  C  C6    . C   B 2 64   ? 51.018  5.356   136.935 1.00 32.89  ? 63   C   B C6    1 
ATOM   9597  P  P     . G   B 2 65   ? 46.037  3.770   138.883 1.00 32.66  ? 64   G   B P     1 
ATOM   9598  O  OP1   . G   B 2 65   ? 44.743  3.112   139.139 1.00 38.23  ? 64   G   B OP1   1 
ATOM   9599  O  OP2   . G   B 2 65   ? 46.083  5.219   138.618 1.00 33.05  ? 64   G   B OP2   1 
ATOM   9600  O  "O5'" . G   B 2 65   ? 46.951  3.474   140.146 1.00 32.22  ? 64   G   B "O5'" 1 
ATOM   9601  C  "C5'" . G   B 2 65   ? 46.971  2.184   140.742 1.00 32.53  ? 64   G   B "C5'" 1 
ATOM   9602  C  "C4'" . G   B 2 65   ? 47.821  2.152   141.991 1.00 32.09  ? 64   G   B "C4'" 1 
ATOM   9603  O  "O4'" . G   B 2 65   ? 49.179  2.520   141.676 1.00 31.99  ? 64   G   B "O4'" 1 
ATOM   9604  C  "C3'" . G   B 2 65   ? 47.421  3.109   143.096 1.00 31.43  ? 64   G   B "C3'" 1 
ATOM   9605  O  "O3'" . G   B 2 65   ? 46.407  2.551   143.900 1.00 33.29  ? 64   G   B "O3'" 1 
ATOM   9606  C  "C2'" . G   B 2 65   ? 48.717  3.304   143.863 1.00 31.08  ? 64   G   B "C2'" 1 
ATOM   9607  O  "O2'" . G   B 2 65   ? 48.926  2.215   144.747 1.00 32.06  ? 64   G   B "O2'" 1 
ATOM   9608  C  "C1'" . G   B 2 65   ? 49.759  3.199   142.759 1.00 31.40  ? 64   G   B "C1'" 1 
ATOM   9609  N  N9    . G   B 2 65   ? 50.254  4.499   142.289 1.00 31.09  ? 64   G   B N9    1 
ATOM   9610  C  C8    . G   B 2 65   ? 49.870  5.165   141.169 1.00 31.23  ? 64   G   B C8    1 
ATOM   9611  N  N7    . G   B 2 65   ? 50.500  6.282   140.990 1.00 31.02  ? 64   G   B N7    1 
ATOM   9612  C  C5    . G   B 2 65   ? 51.373  6.350   142.054 1.00 30.72  ? 64   G   B C5    1 
ATOM   9613  C  C6    . G   B 2 65   ? 52.324  7.339   142.401 1.00 30.51  ? 64   G   B C6    1 
ATOM   9614  O  O6    . G   B 2 65   ? 52.607  8.392   141.823 1.00 30.56  ? 64   G   B O6    1 
ATOM   9615  N  N1    . G   B 2 65   ? 52.976  6.996   143.574 1.00 30.98  ? 64   G   B N1    1 
ATOM   9616  C  C2    . G   B 2 65   ? 52.763  5.868   144.321 1.00 30.34  ? 64   G   B C2    1 
ATOM   9617  N  N2    . G   B 2 65   ? 53.512  5.714   145.425 1.00 30.40  ? 64   G   B N2    1 
ATOM   9618  N  N3    . G   B 2 65   ? 51.883  4.947   144.000 1.00 30.58  ? 64   G   B N3    1 
ATOM   9619  C  C4    . G   B 2 65   ? 51.233  5.250   142.863 1.00 30.75  ? 64   G   B C4    1 
ATOM   9620  P  P     . A   B 2 66   ? 44.935  3.165   143.921 1.00 31.58  ? 65   A   B P     1 
ATOM   9621  O  OP1   . A   B 2 66   ? 44.009  2.090   143.516 1.00 32.30  ? 65   A   B OP1   1 
ATOM   9622  O  OP2   . A   B 2 66   ? 44.927  4.457   143.218 1.00 31.30  ? 65   A   B OP2   1 
ATOM   9623  O  "O5'" . A   B 2 66   ? 44.694  3.429   145.467 1.00 31.22  ? 65   A   B "O5'" 1 
ATOM   9624  C  "C5'" . A   B 2 66   ? 44.767  2.362   146.406 1.00 31.46  ? 65   A   B "C5'" 1 
ATOM   9625  C  "C4'" . A   B 2 66   ? 43.984  2.664   147.659 1.00 31.37  ? 65   A   B "C4'" 1 
ATOM   9626  O  "O4'" . A   B 2 66   ? 44.704  3.649   148.432 1.00 30.74  ? 65   A   B "O4'" 1 
ATOM   9627  C  "C3'" . A   B 2 66   ? 42.598  3.242   147.431 1.00 31.58  ? 65   A   B "C3'" 1 
ATOM   9628  O  "O3'" . A   B 2 66   ? 41.751  2.855   148.504 1.00 31.92  ? 65   A   B "O3'" 1 
ATOM   9629  C  "C2'" . A   B 2 66   ? 42.853  4.742   147.494 1.00 31.00  ? 65   A   B "C2'" 1 
ATOM   9630  O  "O2'" . A   B 2 66   ? 41.726  5.506   147.850 1.00 31.15  ? 65   A   B "O2'" 1 
ATOM   9631  C  "C1'" . A   B 2 66   ? 43.934  4.823   148.561 1.00 30.55  ? 65   A   B "C1'" 1 
ATOM   9632  N  N9    . A   B 2 66   ? 44.859  5.951   148.434 1.00 30.03  ? 65   A   B N9    1 
ATOM   9633  C  C8    . A   B 2 66   ? 45.937  6.084   147.601 1.00 29.86  ? 65   A   B C8    1 
ATOM   9634  N  N7    . A   B 2 66   ? 46.586  7.206   147.744 1.00 29.51  ? 65   A   B N7    1 
ATOM   9635  C  C5    . A   B 2 66   ? 45.900  7.840   148.765 1.00 29.42  ? 65   A   B C5    1 
ATOM   9636  C  C6    . A   B 2 66   ? 46.083  9.064   149.421 1.00 29.20  ? 65   A   B C6    1 
ATOM   9637  N  N6    . A   B 2 66   ? 47.042  9.930   149.155 1.00 29.00  ? 65   A   B N6    1 
ATOM   9638  N  N1    . A   B 2 66   ? 45.219  9.388   150.377 1.00 29.31  ? 65   A   B N1    1 
ATOM   9639  C  C2    . A   B 2 66   ? 44.243  8.543   150.672 1.00 29.62  ? 65   A   B C2    1 
ATOM   9640  N  N3    . A   B 2 66   ? 43.966  7.364   150.147 1.00 29.87  ? 65   A   B N3    1 
ATOM   9641  C  C4    . A   B 2 66   ? 44.848  7.070   149.196 1.00 29.74  ? 65   A   B C4    1 
ATOM   9642  P  P     . A   B 2 67   ? 41.129  1.383   148.564 1.00 32.77  ? 66   A   B P     1 
ATOM   9643  O  OP1   . A   B 2 67   ? 40.479  1.173   149.864 1.00 33.06  ? 66   A   B OP1   1 
ATOM   9644  O  OP2   . A   B 2 67   ? 42.093  0.393   148.076 1.00 32.93  ? 66   A   B OP2   1 
ATOM   9645  O  "O5'" . A   B 2 67   ? 39.931  1.452   147.533 1.00 33.31  ? 66   A   B "O5'" 1 
ATOM   9646  C  "C5'" . A   B 2 67   ? 38.684  1.996   147.917 1.00 33.62  ? 66   A   B "C5'" 1 
ATOM   9647  C  "C4'" . A   B 2 67   ? 37.674  1.800   146.833 1.00 34.32  ? 66   A   B "C4'" 1 
ATOM   9648  O  "O4'" . A   B 2 67   ? 38.273  2.168   145.565 1.00 34.00  ? 66   A   B "O4'" 1 
ATOM   9649  C  "C3'" . A   B 2 67   ? 37.226  0.370   146.602 1.00 35.24  ? 66   A   B "C3'" 1 
ATOM   9650  O  "O3'" . A   B 2 67   ? 36.264  -0.099  147.530 1.00 35.95  ? 66   A   B "O3'" 1 
ATOM   9651  C  "C2'" . A   B 2 67   ? 36.733  0.427   145.165 1.00 35.66  ? 66   A   B "C2'" 1 
ATOM   9652  O  "O2'" . A   B 2 67   ? 35.487  1.098   145.084 1.00 37.16  ? 66   A   B "O2'" 1 
ATOM   9653  C  "C1'" . A   B 2 67   ? 37.781  1.325   144.542 1.00 34.77  ? 66   A   B "C1'" 1 
ATOM   9654  N  N9    . A   B 2 67   ? 38.888  0.534   143.987 1.00 34.70  ? 66   A   B N9    1 
ATOM   9655  C  C8    . A   B 2 67   ? 40.099  0.244   144.537 1.00 34.22  ? 66   A   B C8    1 
ATOM   9656  N  N7    . A   B 2 67   ? 40.867  -0.496  143.780 1.00 34.46  ? 66   A   B N7    1 
ATOM   9657  C  C5    . A   B 2 67   ? 40.104  -0.708  142.651 1.00 35.11  ? 66   A   B C5    1 
ATOM   9658  C  C6    . A   B 2 67   ? 40.343  -1.409  141.460 1.00 35.72  ? 66   A   B C6    1 
ATOM   9659  N  N6    . A   B 2 67   ? 41.469  -2.061  141.196 1.00 35.79  ? 66   A   B N6    1 
ATOM   9660  N  N1    . A   B 2 67   ? 39.367  -1.437  140.537 1.00 36.37  ? 66   A   B N1    1 
ATOM   9661  C  C2    . A   B 2 67   ? 38.230  -0.786  140.779 1.00 36.43  ? 66   A   B C2    1 
ATOM   9662  N  N3    . A   B 2 67   ? 37.882  -0.082  141.845 1.00 35.94  ? 66   A   B N3    1 
ATOM   9663  C  C4    . A   B 2 67   ? 38.879  -0.083  142.764 1.00 35.27  ? 66   A   B C4    1 
ATOM   9664  P  P     . A   B 2 68   ? 36.227  -1.652  147.920 1.00 36.81  ? 67   A   B P     1 
ATOM   9665  O  OP1   . A   B 2 68   ? 35.126  -1.880  148.867 1.00 37.59  ? 67   A   B OP1   1 
ATOM   9666  O  OP2   . A   B 2 68   ? 37.597  -2.087  148.222 1.00 36.29  ? 67   A   B OP2   1 
ATOM   9667  O  "O5'" . A   B 2 68   ? 35.895  -2.405  146.567 1.00 37.58  ? 67   A   B "O5'" 1 
ATOM   9668  C  "C5'" . A   B 2 68   ? 34.714  -2.148  145.829 1.00 38.22  ? 67   A   B "C5'" 1 
ATOM   9669  C  "C4'" . A   B 2 68   ? 34.741  -2.887  144.515 1.00 38.85  ? 67   A   B "C4'" 1 
ATOM   9670  O  "O4'" . A   B 2 68   ? 35.846  -2.444  143.684 1.00 38.02  ? 67   A   B "O4'" 1 
ATOM   9671  C  "C3'" . A   B 2 68   ? 34.953  -4.378  144.627 1.00 39.74  ? 67   A   B "C3'" 1 
ATOM   9672  O  "O3'" . A   B 2 68   ? 33.776  -5.052  145.002 1.00 40.95  ? 67   A   B "O3'" 1 
ATOM   9673  C  "C2'" . A   B 2 68   ? 35.473  -4.742  143.247 1.00 39.92  ? 67   A   B "C2'" 1 
ATOM   9674  O  "O2'" . A   B 2 68   ? 34.413  -4.770  142.311 1.00 40.77  ? 67   A   B "O2'" 1 
ATOM   9675  C  "C1'" . A   B 2 68   ? 36.348  -3.531  142.936 1.00 38.60  ? 67   A   B "C1'" 1 
ATOM   9676  N  N9    . A   B 2 68   ? 37.755  -3.759  143.319 1.00 40.15  ? 67   A   B N9    1 
ATOM   9677  C  C8    . A   B 2 68   ? 38.406  -3.337  144.451 1.00 40.50  ? 67   A   B C8    1 
ATOM   9678  N  N7    . A   B 2 68   ? 39.663  -3.694  144.498 1.00 40.87  ? 67   A   B N7    1 
ATOM   9679  C  C5    . A   B 2 68   ? 39.863  -4.406  143.331 1.00 43.60  ? 67   A   B C5    1 
ATOM   9680  C  C6    . A   B 2 68   ? 40.986  -5.053  142.781 1.00 43.68  ? 67   A   B C6    1 
ATOM   9681  N  N6    . A   B 2 68   ? 42.181  -5.101  143.367 1.00 44.79  ? 67   A   B N6    1 
ATOM   9682  N  N1    . A   B 2 68   ? 40.840  -5.666  141.583 1.00 45.50  ? 67   A   B N1    1 
ATOM   9683  C  C2    . A   B 2 68   ? 39.650  -5.624  140.989 1.00 45.99  ? 67   A   B C2    1 
ATOM   9684  N  N3    . A   B 2 68   ? 38.529  -5.047  141.403 1.00 44.17  ? 67   A   B N3    1 
ATOM   9685  C  C4    . A   B 2 68   ? 38.696  -4.452  142.593 1.00 42.56  ? 67   A   B C4    1 
ATOM   9686  P  P     . U   B 2 69   ? 33.874  -6.424  145.805 1.00 44.59  ? 68   U   B P     1 
ATOM   9687  O  OP1   . U   B 2 69   ? 32.582  -6.693  146.474 1.00 49.97  ? 68   U   B OP1   1 
ATOM   9688  O  OP2   . U   B 2 69   ? 35.100  -6.396  146.609 1.00 45.97  ? 68   U   B OP2   1 
ATOM   9689  O  "O5'" . U   B 2 69   ? 34.096  -7.472  144.643 1.00 47.43  ? 68   U   B "O5'" 1 
ATOM   9690  C  "C5'" . U   B 2 69   ? 35.113  -8.431  144.771 1.00 47.34  ? 68   U   B "C5'" 1 
ATOM   9691  C  "C4'" . U   B 2 69   ? 35.588  -8.963  143.448 1.00 46.50  ? 68   U   B "C4'" 1 
ATOM   9692  O  "O4'" . U   B 2 69   ? 36.540  -8.020  142.884 1.00 45.00  ? 68   U   B "O4'" 1 
ATOM   9693  C  "C3'" . U   B 2 69   ? 36.357  -10.266 143.604 1.00 46.09  ? 68   U   B "C3'" 1 
ATOM   9694  O  "O3'" . U   B 2 69   ? 35.524  -11.394 143.454 1.00 46.09  ? 68   U   B "O3'" 1 
ATOM   9695  C  "C2'" . U   B 2 69   ? 37.460  -10.169 142.564 1.00 46.75  ? 68   U   B "C2'" 1 
ATOM   9696  O  "O2'" . U   B 2 69   ? 36.979  -10.554 141.287 1.00 49.63  ? 68   U   B "O2'" 1 
ATOM   9697  C  "C1'" . U   B 2 69   ? 37.737  -8.671  142.550 1.00 45.33  ? 68   U   B "C1'" 1 
ATOM   9698  N  N1    . U   B 2 69   ? 38.767  -8.274  143.547 1.00 46.07  ? 68   U   B N1    1 
ATOM   9699  C  C2    . U   B 2 69   ? 40.088  -8.592  143.305 1.00 45.86  ? 68   U   B C2    1 
ATOM   9700  O  O2    . U   B 2 69   ? 40.460  -9.201  142.318 1.00 50.90  ? 68   U   B O2    1 
ATOM   9701  N  N3    . U   B 2 69   ? 40.969  -8.174  144.270 1.00 43.91  ? 68   U   B N3    1 
ATOM   9702  C  C4    . U   B 2 69   ? 40.690  -7.475  145.423 1.00 43.98  ? 68   U   B C4    1 
ATOM   9703  O  O4    . U   B 2 69   ? 41.606  -7.177  146.194 1.00 42.75  ? 68   U   B O4    1 
ATOM   9704  C  C5    . U   B 2 69   ? 39.312  -7.176  145.603 1.00 45.29  ? 68   U   B C5    1 
ATOM   9705  C  C6    . U   B 2 69   ? 38.432  -7.573  144.688 1.00 46.10  ? 68   U   B C6    1 
ATOM   9706  P  P     . C   B 2 70   ? 34.583  -11.905 144.652 1.00 46.93  ? 69   C   B P     1 
ATOM   9707  O  OP1   . C   B 2 70   ? 34.045  -13.210 144.206 1.00 50.29  ? 69   C   B OP1   1 
ATOM   9708  O  OP2   . C   B 2 70   ? 33.600  -10.893 145.095 1.00 46.40  ? 69   C   B OP2   1 
ATOM   9709  O  "O5'" . C   B 2 70   ? 35.609  -12.172 145.829 1.00 46.46  ? 69   C   B "O5'" 1 
ATOM   9710  C  "C5'" . C   B 2 70   ? 36.545  -13.240 145.744 1.00 47.19  ? 69   C   B "C5'" 1 
ATOM   9711  C  "C4'" . C   B 2 70   ? 36.923  -13.749 147.111 1.00 47.55  ? 69   C   B "C4'" 1 
ATOM   9712  O  "O4'" . C   B 2 70   ? 37.730  -12.743 147.772 1.00 45.80  ? 69   C   B "O4'" 1 
ATOM   9713  C  "C3'" . C   B 2 70   ? 35.747  -14.033 148.037 1.00 48.98  ? 69   C   B "C3'" 1 
ATOM   9714  O  "O3'" . C   B 2 70   ? 36.056  -15.150 148.865 1.00 52.52  ? 69   C   B "O3'" 1 
ATOM   9715  C  "C2'" . C   B 2 70   ? 35.657  -12.757 148.871 1.00 46.89  ? 69   C   B "C2'" 1 
ATOM   9716  O  "O2'" . C   B 2 70   ? 35.070  -12.918 150.142 1.00 47.43  ? 69   C   B "O2'" 1 
ATOM   9717  C  "C1'" . C   B 2 70   ? 37.120  -12.351 148.982 1.00 45.59  ? 69   C   B "C1'" 1 
ATOM   9718  N  N1    . C   B 2 70   ? 37.331  -10.907 149.141 1.00 43.87  ? 69   C   B N1    1 
ATOM   9719  C  C2    . C   B 2 70   ? 38.057  -10.451 150.246 1.00 43.00  ? 69   C   B C2    1 
ATOM   9720  O  O2    . C   B 2 70   ? 38.488  -11.275 151.059 1.00 43.67  ? 69   C   B O2    1 
ATOM   9721  N  N3    . C   B 2 70   ? 38.265  -9.126  150.406 1.00 41.54  ? 69   C   B N3    1 
ATOM   9722  C  C4    . C   B 2 70   ? 37.790  -8.269  149.512 1.00 40.97  ? 69   C   B C4    1 
ATOM   9723  N  N4    . C   B 2 70   ? 38.023  -6.976  149.722 1.00 39.67  ? 69   C   B N4    1 
ATOM   9724  C  C5    . C   B 2 70   ? 37.044  -8.699  148.378 1.00 41.82  ? 69   C   B C5    1 
ATOM   9725  C  C6    . C   B 2 70   ? 36.843  -10.015 148.231 1.00 43.24  ? 69   C   B C6    1 
ATOM   9726  P  P     . A   B 2 71   ? 35.401  -16.588 148.560 1.00 59.87  ? 70   A   B P     1 
ATOM   9727  O  OP1   . A   B 2 71   ? 35.258  -16.726 147.099 1.00 62.64  ? 70   A   B OP1   1 
ATOM   9728  O  OP2   . A   B 2 71   ? 34.206  -16.723 149.418 1.00 60.85  ? 70   A   B OP2   1 
ATOM   9729  O  "O5'" . A   B 2 71   ? 36.509  -17.626 149.053 1.00 60.84  ? 70   A   B "O5'" 1 
ATOM   9730  O  "O5'" . DG  C 3 1    ? 54.426  -7.946  180.103 1.00 48.80  ? 1    DG  C "O5'" 1 
ATOM   9731  C  "C5'" . DG  C 3 1    ? 53.685  -6.791  179.734 1.00 47.34  ? 1    DG  C "C5'" 1 
ATOM   9732  C  "C4'" . DG  C 3 1    ? 52.388  -6.724  180.513 1.00 47.98  ? 1    DG  C "C4'" 1 
ATOM   9733  O  "O4'" . DG  C 3 1    ? 52.313  -5.463  181.215 1.00 46.62  ? 1    DG  C "O4'" 1 
ATOM   9734  C  "C3'" . DG  C 3 1    ? 51.141  -6.747  179.670 1.00 47.85  ? 1    DG  C "C3'" 1 
ATOM   9735  O  "O3'" . DG  C 3 1    ? 50.050  -7.114  180.484 1.00 47.71  ? 1    DG  C "O3'" 1 
ATOM   9736  C  "C2'" . DG  C 3 1    ? 51.057  -5.288  179.222 1.00 44.40  ? 1    DG  C "C2'" 1 
ATOM   9737  C  "C1'" . DG  C 3 1    ? 51.510  -4.553  180.483 1.00 44.68  ? 1    DG  C "C1'" 1 
ATOM   9738  N  N9    . DG  C 3 1    ? 52.321  -3.361  180.244 1.00 43.52  ? 1    DG  C N9    1 
ATOM   9739  C  C8    . DG  C 3 1    ? 53.465  -3.282  179.495 1.00 42.86  ? 1    DG  C C8    1 
ATOM   9740  N  N7    . DG  C 3 1    ? 53.999  -2.090  179.485 1.00 42.02  ? 1    DG  C N7    1 
ATOM   9741  C  C5    . DG  C 3 1    ? 53.165  -1.334  180.300 1.00 42.14  ? 1    DG  C C5    1 
ATOM   9742  C  C6    . DG  C 3 1    ? 53.242  0.030   180.674 1.00 41.61  ? 1    DG  C C6    1 
ATOM   9743  O  O6    . DG  C 3 1    ? 54.085  0.870   180.353 1.00 42.18  ? 1    DG  C O6    1 
ATOM   9744  N  N1    . DG  C 3 1    ? 52.202  0.396   181.504 1.00 42.11  ? 1    DG  C N1    1 
ATOM   9745  C  C2    . DG  C 3 1    ? 51.212  -0.436  181.924 1.00 43.03  ? 1    DG  C C2    1 
ATOM   9746  N  N2    . DG  C 3 1    ? 50.295  0.108   182.723 1.00 43.52  ? 1    DG  C N2    1 
ATOM   9747  N  N3    . DG  C 3 1    ? 51.120  -1.717  181.590 1.00 43.56  ? 1    DG  C N3    1 
ATOM   9748  C  C4    . DG  C 3 1    ? 52.132  -2.099  180.778 1.00 43.06  ? 1    DG  C C4    1 
ATOM   9749  P  P     . DC  C 3 2    ? 48.641  -7.496  179.826 1.00 48.97  ? 2    DC  C P     1 
ATOM   9750  O  OP1   . DC  C 3 2    ? 48.039  -8.594  180.604 1.00 50.34  ? 2    DC  C OP1   1 
ATOM   9751  O  OP2   . DC  C 3 2    ? 48.852  -7.646  178.368 1.00 51.00  ? 2    DC  C OP2   1 
ATOM   9752  O  "O5'" . DC  C 3 2    ? 47.754  -6.201  180.068 1.00 49.58  ? 2    DC  C "O5'" 1 
ATOM   9753  C  "C5'" . DC  C 3 2    ? 47.287  -5.927  181.356 1.00 47.46  ? 2    DC  C "C5'" 1 
ATOM   9754  C  "C4'" . DC  C 3 2    ? 46.606  -4.575  181.415 1.00 46.51  ? 2    DC  C "C4'" 1 
ATOM   9755  O  "O4'" . DC  C 3 2    ? 47.563  -3.522  181.179 1.00 45.24  ? 2    DC  C "O4'" 1 
ATOM   9756  C  "C3'" . DC  C 3 2    ? 45.479  -4.353  180.410 1.00 45.94  ? 2    DC  C "C3'" 1 
ATOM   9757  O  "O3'" . DC  C 3 2    ? 44.414  -3.761  181.085 1.00 46.46  ? 2    DC  C "O3'" 1 
ATOM   9758  C  "C2'" . DC  C 3 2    ? 46.098  -3.389  179.402 1.00 44.23  ? 2    DC  C "C2'" 1 
ATOM   9759  C  "C1'" . DC  C 3 2    ? 46.996  -2.580  180.307 1.00 44.07  ? 2    DC  C "C1'" 1 
ATOM   9760  N  N1    . DC  C 3 2    ? 48.099  -1.877  179.609 1.00 42.76  ? 2    DC  C N1    1 
ATOM   9761  C  C2    . DC  C 3 2    ? 48.350  -0.539  179.902 1.00 42.10  ? 2    DC  C C2    1 
ATOM   9762  O  O2    . DC  C 3 2    ? 47.629  0.037   180.710 1.00 43.05  ? 2    DC  C O2    1 
ATOM   9763  N  N3    . DC  C 3 2    ? 49.368  0.091   179.290 1.00 41.06  ? 2    DC  C N3    1 
ATOM   9764  C  C4    . DC  C 3 2    ? 50.116  -0.560  178.412 1.00 40.65  ? 2    DC  C C4    1 
ATOM   9765  N  N4    . DC  C 3 2    ? 51.109  0.111   177.825 1.00 39.72  ? 2    DC  C N4    1 
ATOM   9766  C  C5    . DC  C 3 2    ? 49.885  -1.930  178.096 1.00 41.31  ? 2    DC  C C5    1 
ATOM   9767  C  C6    . DC  C 3 2    ? 48.876  -2.546  178.720 1.00 42.36  ? 2    DC  C C6    1 
ATOM   9768  P  P     . DT  C 3 3    ? 43.040  -3.454  180.345 1.00 46.27  ? 3    DT  C P     1 
ATOM   9769  O  OP1   . DT  C 3 3    ? 41.935  -3.816  181.252 1.00 47.83  ? 3    DT  C OP1   1 
ATOM   9770  O  OP2   . DT  C 3 3    ? 43.123  -4.075  179.021 1.00 45.65  ? 3    DT  C OP2   1 
ATOM   9771  O  "O5'" . DT  C 3 3    ? 43.040  -1.884  180.235 1.00 45.13  ? 3    DT  C "O5'" 1 
ATOM   9772  C  "C5'" . DT  C 3 3    ? 42.846  -1.137  181.386 1.00 45.70  ? 3    DT  C "C5'" 1 
ATOM   9773  C  "C4'" . DT  C 3 3    ? 43.112  0.317   181.126 1.00 44.55  ? 3    DT  C "C4'" 1 
ATOM   9774  O  "O4'" . DT  C 3 3    ? 44.347  0.460   180.406 1.00 43.33  ? 3    DT  C "O4'" 1 
ATOM   9775  C  "C3'" . DT  C 3 3    ? 42.057  1.042   180.299 1.00 44.06  ? 3    DT  C "C3'" 1 
ATOM   9776  O  "O3'" . DT  C 3 3    ? 41.695  2.201   181.003 1.00 44.31  ? 3    DT  C "O3'" 1 
ATOM   9777  C  "C2'" . DT  C 3 3    ? 42.789  1.365   178.985 1.00 42.51  ? 3    DT  C "C2'" 1 
ATOM   9778  C  "C1'" . DT  C 3 3    ? 44.205  1.495   179.474 1.00 42.16  ? 3    DT  C "C1'" 1 
ATOM   9779  N  N1    . DT  C 3 3    ? 45.262  1.333   178.446 1.00 41.03  ? 3    DT  C N1    1 
ATOM   9780  C  C2    . DT  C 3 3    ? 46.120  2.367   178.219 1.00 40.09  ? 3    DT  C C2    1 
ATOM   9781  O  O2    . DT  C 3 3    ? 46.022  3.432   178.769 1.00 40.11  ? 3    DT  C O2    1 
ATOM   9782  N  N3    . DT  C 3 3    ? 47.089  2.125   177.302 1.00 39.23  ? 3    DT  C N3    1 
ATOM   9783  C  C4    . DT  C 3 3    ? 47.297  0.968   176.609 1.00 39.24  ? 3    DT  C C4    1 
ATOM   9784  O  O4    . DT  C 3 3    ? 48.200  0.850   175.802 1.00 38.53  ? 3    DT  C O4    1 
ATOM   9785  C  C5    . DT  C 3 3    ? 46.380  -0.096  176.899 1.00 40.27  ? 3    DT  C C5    1 
ATOM   9786  C  C7    . DT  C 3 3    ? 46.517  -1.407  176.200 1.00 40.52  ? 3    DT  C C7    1 
ATOM   9787  C  C6    . DT  C 3 3    ? 45.417  0.130   177.804 1.00 41.11  ? 3    DT  C C6    1 
ATOM   9788  P  P     . DC  C 3 4    ? 40.614  3.230   180.450 1.00 44.08  ? 4    DC  C P     1 
ATOM   9789  O  OP1   . DC  C 3 4    ? 39.685  3.530   181.547 1.00 45.47  ? 4    DC  C OP1   1 
ATOM   9790  O  OP2   . DC  C 3 4    ? 40.092  2.730   179.174 1.00 43.57  ? 4    DC  C OP2   1 
ATOM   9791  O  "O5'" . DC  C 3 4    ? 41.472  4.539   180.172 1.00 42.92  ? 4    DC  C "O5'" 1 
ATOM   9792  C  "C5'" . DC  C 3 4    ? 42.286  5.072   181.207 1.00 43.16  ? 4    DC  C "C5'" 1 
ATOM   9793  C  "C4'" . DC  C 3 4    ? 43.049  6.299   180.746 1.00 42.08  ? 4    DC  C "C4'" 1 
ATOM   9794  O  "O4'" . DC  C 3 4    ? 44.037  5.927   179.760 1.00 40.91  ? 4    DC  C "O4'" 1 
ATOM   9795  C  "C3'" . DC  C 3 4    ? 42.211  7.381   180.101 1.00 41.81  ? 4    DC  C "C3'" 1 
ATOM   9796  O  "O3'" . DC  C 3 4    ? 42.757  8.655   180.463 1.00 41.66  ? 4    DC  C "O3'" 1 
ATOM   9797  C  "C2'" . DC  C 3 4    ? 42.389  7.117   178.604 1.00 40.60  ? 4    DC  C "C2'" 1 
ATOM   9798  C  "C1'" . DC  C 3 4    ? 43.823  6.628   178.549 1.00 39.94  ? 4    DC  C "C1'" 1 
ATOM   9799  N  N1    . DC  C 3 4    ? 44.109  5.687   177.440 1.00 39.22  ? 4    DC  C N1    1 
ATOM   9800  C  C2    . DC  C 3 4    ? 45.129  5.965   176.536 1.00 38.10  ? 4    DC  C C2    1 
ATOM   9801  O  O2    . DC  C 3 4    ? 45.753  7.013   176.645 1.00 37.72  ? 4    DC  C O2    1 
ATOM   9802  N  N3    . DC  C 3 4    ? 45.395  5.076   175.555 1.00 37.58  ? 4    DC  C N3    1 
ATOM   9803  C  C4    . DC  C 3 4    ? 44.695  3.952   175.467 1.00 38.14  ? 4    DC  C C4    1 
ATOM   9804  N  N4    . DC  C 3 4    ? 45.001  3.108   174.496 1.00 37.71  ? 4    DC  C N4    1 
ATOM   9805  C  C5    . DC  C 3 4    ? 43.654  3.645   176.373 1.00 39.29  ? 4    DC  C C5    1 
ATOM   9806  C  C6    . DC  C 3 4    ? 43.398  4.530   177.340 1.00 39.79  ? 4    DC  C C6    1 
ATOM   9807  P  P     . DC  C 3 5    ? 41.840  9.931   180.290 1.00 41.93  ? 5    DC  C P     1 
ATOM   9808  O  OP1   . DC  C 3 5    ? 42.155  10.796  181.439 1.00 42.68  ? 5    DC  C OP1   1 
ATOM   9809  O  OP2   . DC  C 3 5    ? 40.437  9.558   180.067 1.00 42.59  ? 5    DC  C OP2   1 
ATOM   9810  O  "O5'" . DC  C 3 5    ? 42.440  10.586  178.992 1.00 40.58  ? 5    DC  C "O5'" 1 
ATOM   9811  C  "C5'" . DC  C 3 5    ? 43.827  10.730  178.869 1.00 39.79  ? 5    DC  C "C5'" 1 
ATOM   9812  C  "C4'" . DC  C 3 5    ? 44.206  11.043  177.432 1.00 38.58  ? 5    DC  C "C4'" 1 
ATOM   9813  O  "O4'" . DC  C 3 5    ? 44.247  9.840   176.668 1.00 38.03  ? 5    DC  C "O4'" 1 
ATOM   9814  C  "C3'" . DC  C 3 5    ? 43.250  11.968  176.696 1.00 38.55  ? 5    DC  C "C3'" 1 
ATOM   9815  O  "O3'" . DC  C 3 5    ? 43.841  13.258  176.654 1.00 38.38  ? 5    DC  C "O3'" 1 
ATOM   9816  C  "C2'" . DC  C 3 5    ? 43.091  11.329  175.295 1.00 37.65  ? 5    DC  C "C2'" 1 
ATOM   9817  C  "C1'" . DC  C 3 5    ? 44.068  10.154  175.321 1.00 37.20  ? 5    DC  C "C1'" 1 
ATOM   9818  N  N1    . DC  C 3 5    ? 43.597  8.900   174.658 1.00 37.05  ? 5    DC  C N1    1 
ATOM   9819  C  C2    . DC  C 3 5    ? 44.365  8.314   173.657 1.00 36.16  ? 5    DC  C C2    1 
ATOM   9820  O  O2    . DC  C 3 5    ? 45.386  8.880   173.272 1.00 35.47  ? 5    DC  C O2    1 
ATOM   9821  N  N3    . DC  C 3 5    ? 43.954  7.150   173.120 1.00 36.18  ? 5    DC  C N3    1 
ATOM   9822  C  C4    . DC  C 3 5    ? 42.842  6.572   173.559 1.00 37.04  ? 5    DC  C C4    1 
ATOM   9823  N  N4    . DC  C 3 5    ? 42.477  5.426   173.002 1.00 37.14  ? 5    DC  C N4    1 
ATOM   9824  C  C5    . DC  C 3 5    ? 42.061  7.139   174.588 1.00 37.97  ? 5    DC  C C5    1 
ATOM   9825  C  C6    . DC  C 3 5    ? 42.478  8.284   175.114 1.00 37.94  ? 5    DC  C C6    1 
ATOM   9826  P  P     . DT  C 3 6    ? 43.289  14.414  175.698 1.00 38.19  ? 6    DT  C P     1 
ATOM   9827  O  OP1   . DT  C 3 6    ? 43.776  15.698  176.231 1.00 38.62  ? 6    DT  C OP1   1 
ATOM   9828  O  OP2   . DT  C 3 6    ? 41.841  14.213  175.534 1.00 38.79  ? 6    DT  C OP2   1 
ATOM   9829  O  "O5'" . DT  C 3 6    ? 44.075  14.165  174.345 1.00 36.91  ? 6    DT  C "O5'" 1 
ATOM   9830  C  "C5'" . DT  C 3 6    ? 45.477  14.174  174.345 1.00 36.34  ? 6    DT  C "C5'" 1 
ATOM   9831  C  "C4'" . DT  C 3 6    ? 46.043  13.859  172.966 1.00 35.25  ? 6    DT  C "C4'" 1 
ATOM   9832  O  "O4'" . DT  C 3 6    ? 45.620  12.546  172.536 1.00 34.99  ? 6    DT  C "O4'" 1 
ATOM   9833  C  "C3'" . DT  C 3 6    ? 45.659  14.812  171.843 1.00 34.95  ? 6    DT  C "C3'" 1 
ATOM   9834  O  "O3'" . DT  C 3 6    ? 46.833  15.070  171.063 1.00 34.20  ? 6    DT  C "O3'" 1 
ATOM   9835  C  "C2'" . DT  C 3 6    ? 44.600  14.008  171.070 1.00 34.78  ? 6    DT  C "C2'" 1 
ATOM   9836  C  "C1'" . DT  C 3 6    ? 45.151  12.605  171.217 1.00 34.45  ? 6    DT  C "C1'" 1 
ATOM   9837  N  N1    . DT  C 3 6    ? 44.168  11.487  171.051 1.00 34.66  ? 6    DT  C N1    1 
ATOM   9838  C  C2    . DT  C 3 6    ? 44.508  10.417  170.281 1.00 34.10  ? 6    DT  C C2    1 
ATOM   9839  O  O2    . DT  C 3 6    ? 45.541  10.351  169.671 1.00 33.42  ? 6    DT  C O2    1 
ATOM   9840  N  N3    . DT  C 3 6    ? 43.583  9.424   170.232 1.00 34.49  ? 6    DT  C N3    1 
ATOM   9841  C  C4    . DT  C 3 6    ? 42.382  9.379   170.880 1.00 35.38  ? 6    DT  C C4    1 
ATOM   9842  O  O4    . DT  C 3 6    ? 41.621  8.434   170.776 1.00 35.77  ? 6    DT  C O4    1 
ATOM   9843  C  C5    . DT  C 3 6    ? 42.084  10.521  171.692 1.00 35.94  ? 6    DT  C C5    1 
ATOM   9844  C  C7    . DT  C 3 6    ? 40.800  10.587  172.447 1.00 37.06  ? 6    DT  C C7    1 
ATOM   9845  C  C6    . DT  C 3 6    ? 42.985  11.509  171.744 1.00 35.56  ? 6    DT  C C6    1 
ATOM   9846  P  P     . DT  C 3 7    ? 46.872  16.227  169.954 1.00 33.93  ? 7    DT  C P     1 
ATOM   9847  O  OP1   . DT  C 3 7    ? 48.241  16.758  169.893 1.00 33.68  ? 7    DT  C OP1   1 
ATOM   9848  O  OP2   . DT  C 3 7    ? 45.734  17.130  170.185 1.00 34.69  ? 7    DT  C OP2   1 
ATOM   9849  O  "O5'" . DT  C 3 7    ? 46.630  15.444  168.593 1.00 33.16  ? 7    DT  C "O5'" 1 
ATOM   9850  C  "C5'" . DT  C 3 7    ? 47.453  14.375  168.249 1.00 32.54  ? 7    DT  C "C5'" 1 
ATOM   9851  C  "C4'" . DT  C 3 7    ? 46.932  13.688  167.006 1.00 32.04  ? 7    DT  C "C4'" 1 
ATOM   9852  O  "O4'" . DT  C 3 7    ? 45.861  12.805  167.356 1.00 32.39  ? 7    DT  C "O4'" 1 
ATOM   9853  C  "C3'" . DT  C 3 7    ? 46.381  14.624  165.934 1.00 31.95  ? 7    DT  C "C3'" 1 
ATOM   9854  O  "O3'" . DT  C 3 7    ? 47.142  14.451  164.777 1.00 31.29  ? 7    DT  C "O3'" 1 
ATOM   9855  C  "C2'" . DT  C 3 7    ? 44.917  14.172  165.743 1.00 32.27  ? 7    DT  C "C2'" 1 
ATOM   9856  C  "C1'" . DT  C 3 7    ? 44.930  12.765  166.308 1.00 32.27  ? 7    DT  C "C1'" 1 
ATOM   9857  N  N1    . DT  C 3 7    ? 43.634  12.304  166.898 1.00 32.97  ? 7    DT  C N1    1 
ATOM   9858  C  C2    . DT  C 3 7    ? 43.196  11.032  166.646 1.00 32.97  ? 7    DT  C C2    1 
ATOM   9859  O  O2