data_6M4G
# 
_entry.id   6M4G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.341 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6M4G         
WWPDB D_1300016055 
EMDB  EMD-30077    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'cryo-EM structure of human H2A.B nucleosome' 
_pdbx_database_related.db_id          EMD-30077 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6M4G 
_pdbx_database_status.recvd_initial_deposition_date   2020-03-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zhou, M.'  1 ? 
'Dai, L.C.' 2 ? 
'Li, C.M.'  3 ? 
'Shi, L.X.' 4 ? 
'Huang, Y.' 5 ? 
'Guo, Z.Q.' 6 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_id_ASTM           EMJODG 
_citation.journal_id_CSD            0897 
_citation.journal_id_ISSN           1460-2075 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            40 
_citation.language                  ? 
_citation.page_first                e105907 
_citation.page_last                 e105907 
_citation.title                     'Structural basis of nucleosome dynamics modulation by histone variants H2A.B and H2A.Z.2.2.' 
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.15252/embj.2020105907 
_citation.pdbx_database_id_PubMed   33073403 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhou, M.'  1 ?                   
primary 'Dai, L.'   2 ?                   
primary 'Li, C.'    3 ?                   
primary 'Shi, L.'   4 ?                   
primary 'Huang, Y.' 5 ?                   
primary 'Guo, Z.'   6 ?                   
primary 'Wu, F.'    7 ?                   
primary 'Zhu, P.'   8 0000-0003-2648-3170 
primary 'Zhou, Z.'  9 0000-0002-1423-7231 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6M4G 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6M4G 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA (93-MER)'             45610.043 1 ? ? ? ? 
2 polymer man 'DNA (93-MER)'             45138.770 1 ? ? ? ? 
3 polymer man 'Histone H3.1'             15437.167 2 ? ? ? ? 
4 polymer man 'Histone H4'               11394.426 2 ? ? ? ? 
5 polymer man 'Histone H2B type 2-E'     13951.239 2 ? ? ? ? 
6 polymer man 'Histone H2A-Bbd type 2/3' 12732.389 2 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 
'Histone H3/a,Histone H3/b,Histone H3/c,Histone H3/d,Histone H3/f,Histone H3/h,Histone H3/i,Histone H3/j,Histone H3/k,Histone H3/l' 
5 'Histone H2B-GL105,Histone H2B.q,H2B/q' 
6 'H2A Barr body-deficient,H2A.Bbd' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)
(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)
(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)
(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)
(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)
(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)
(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)
(DT)(DC)(DT)(DC)(DG)(DA)(DT)
;
;ATCGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTA
CGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCGAT
;
I   ? 
2 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)
(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)
(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)
(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)
(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)
(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)
(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)
(DA)(DT)(DC)(DC)(DG)(DA)(DT)
;
;ATCGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCC
CCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCGAT
;
J   ? 
3 'polypeptide(L)'        no no 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
4 'polypeptide(L)'        no no 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
5 'polypeptide(L)'        no no 
;MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
;MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
D,H ? 
6 'polypeptide(L)'        no no 
;MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGE
RNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
;
;MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGE
RNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
;
C,G ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DG  n 
1 5   DG  n 
1 6   DA  n 
1 7   DT  n 
1 8   DG  n 
1 9   DT  n 
1 10  DA  n 
1 11  DT  n 
1 12  DA  n 
1 13  DT  n 
1 14  DA  n 
1 15  DT  n 
1 16  DC  n 
1 17  DT  n 
1 18  DG  n 
1 19  DA  n 
1 20  DC  n 
1 21  DA  n 
1 22  DC  n 
1 23  DG  n 
1 24  DT  n 
1 25  DG  n 
1 26  DC  n 
1 27  DC  n 
1 28  DT  n 
1 29  DG  n 
1 30  DG  n 
1 31  DA  n 
1 32  DG  n 
1 33  DA  n 
1 34  DC  n 
1 35  DT  n 
1 36  DA  n 
1 37  DG  n 
1 38  DG  n 
1 39  DG  n 
1 40  DA  n 
1 41  DG  n 
1 42  DT  n 
1 43  DA  n 
1 44  DA  n 
1 45  DT  n 
1 46  DC  n 
1 47  DC  n 
1 48  DC  n 
1 49  DC  n 
1 50  DT  n 
1 51  DT  n 
1 52  DG  n 
1 53  DG  n 
1 54  DC  n 
1 55  DG  n 
1 56  DG  n 
1 57  DT  n 
1 58  DT  n 
1 59  DA  n 
1 60  DA  n 
1 61  DA  n 
1 62  DA  n 
1 63  DC  n 
1 64  DG  n 
1 65  DC  n 
1 66  DG  n 
1 67  DG  n 
1 68  DG  n 
1 69  DG  n 
1 70  DG  n 
1 71  DA  n 
1 72  DC  n 
1 73  DA  n 
1 74  DG  n 
1 75  DC  n 
1 76  DG  n 
1 77  DC  n 
1 78  DG  n 
1 79  DT  n 
1 80  DA  n 
1 81  DC  n 
1 82  DG  n 
1 83  DT  n 
1 84  DG  n 
1 85  DC  n 
1 86  DG  n 
1 87  DT  n 
1 88  DT  n 
1 89  DT  n 
1 90  DA  n 
1 91  DA  n 
1 92  DG  n 
1 93  DC  n 
1 94  DG  n 
1 95  DG  n 
1 96  DT  n 
1 97  DG  n 
1 98  DC  n 
1 99  DT  n 
1 100 DA  n 
1 101 DG  n 
1 102 DA  n 
1 103 DG  n 
1 104 DC  n 
1 105 DT  n 
1 106 DG  n 
1 107 DT  n 
1 108 DC  n 
1 109 DT  n 
1 110 DA  n 
1 111 DC  n 
1 112 DG  n 
1 113 DA  n 
1 114 DC  n 
1 115 DC  n 
1 116 DA  n 
1 117 DA  n 
1 118 DT  n 
1 119 DT  n 
1 120 DG  n 
1 121 DA  n 
1 122 DG  n 
1 123 DC  n 
1 124 DG  n 
1 125 DG  n 
1 126 DC  n 
1 127 DC  n 
1 128 DT  n 
1 129 DC  n 
1 130 DG  n 
1 131 DG  n 
1 132 DC  n 
1 133 DA  n 
1 134 DC  n 
1 135 DC  n 
1 136 DG  n 
1 137 DG  n 
1 138 DG  n 
1 139 DA  n 
1 140 DT  n 
1 141 DT  n 
1 142 DC  n 
1 143 DT  n 
1 144 DC  n 
1 145 DG  n 
1 146 DA  n 
1 147 DT  n 
2 1   DA  n 
2 2   DT  n 
2 3   DC  n 
2 4   DG  n 
2 5   DA  n 
2 6   DG  n 
2 7   DA  n 
2 8   DA  n 
2 9   DT  n 
2 10  DC  n 
2 11  DC  n 
2 12  DC  n 
2 13  DG  n 
2 14  DG  n 
2 15  DT  n 
2 16  DG  n 
2 17  DC  n 
2 18  DC  n 
2 19  DG  n 
2 20  DA  n 
2 21  DG  n 
2 22  DG  n 
2 23  DC  n 
2 24  DC  n 
2 25  DG  n 
2 26  DC  n 
2 27  DT  n 
2 28  DC  n 
2 29  DA  n 
2 30  DA  n 
2 31  DT  n 
2 32  DT  n 
2 33  DG  n 
2 34  DG  n 
2 35  DT  n 
2 36  DC  n 
2 37  DG  n 
2 38  DT  n 
2 39  DA  n 
2 40  DG  n 
2 41  DA  n 
2 42  DC  n 
2 43  DA  n 
2 44  DG  n 
2 45  DC  n 
2 46  DT  n 
2 47  DC  n 
2 48  DT  n 
2 49  DA  n 
2 50  DG  n 
2 51  DC  n 
2 52  DA  n 
2 53  DC  n 
2 54  DC  n 
2 55  DG  n 
2 56  DC  n 
2 57  DT  n 
2 58  DT  n 
2 59  DA  n 
2 60  DA  n 
2 61  DA  n 
2 62  DC  n 
2 63  DG  n 
2 64  DC  n 
2 65  DA  n 
2 66  DC  n 
2 67  DG  n 
2 68  DT  n 
2 69  DA  n 
2 70  DC  n 
2 71  DG  n 
2 72  DC  n 
2 73  DG  n 
2 74  DC  n 
2 75  DT  n 
2 76  DG  n 
2 77  DT  n 
2 78  DC  n 
2 79  DC  n 
2 80  DC  n 
2 81  DC  n 
2 82  DC  n 
2 83  DG  n 
2 84  DC  n 
2 85  DG  n 
2 86  DT  n 
2 87  DT  n 
2 88  DT  n 
2 89  DT  n 
2 90  DA  n 
2 91  DA  n 
2 92  DC  n 
2 93  DC  n 
2 94  DG  n 
2 95  DC  n 
2 96  DC  n 
2 97  DA  n 
2 98  DA  n 
2 99  DG  n 
2 100 DG  n 
2 101 DG  n 
2 102 DG  n 
2 103 DA  n 
2 104 DT  n 
2 105 DT  n 
2 106 DA  n 
2 107 DC  n 
2 108 DT  n 
2 109 DC  n 
2 110 DC  n 
2 111 DC  n 
2 112 DT  n 
2 113 DA  n 
2 114 DG  n 
2 115 DT  n 
2 116 DC  n 
2 117 DT  n 
2 118 DC  n 
2 119 DC  n 
2 120 DA  n 
2 121 DG  n 
2 122 DG  n 
2 123 DC  n 
2 124 DA  n 
2 125 DC  n 
2 126 DG  n 
2 127 DT  n 
2 128 DG  n 
2 129 DT  n 
2 130 DC  n 
2 131 DA  n 
2 132 DG  n 
2 133 DA  n 
2 134 DT  n 
2 135 DA  n 
2 136 DT  n 
2 137 DA  n 
2 138 DT  n 
2 139 DA  n 
2 140 DC  n 
2 141 DA  n 
2 142 DT  n 
2 143 DC  n 
2 144 DC  n 
2 145 DG  n 
2 146 DA  n 
2 147 DT  n 
3 1   MET n 
3 2   ALA n 
3 3   ARG n 
3 4   THR n 
3 5   LYS n 
3 6   GLN n 
3 7   THR n 
3 8   ALA n 
3 9   ARG n 
3 10  LYS n 
3 11  SER n 
3 12  THR n 
3 13  GLY n 
3 14  GLY n 
3 15  LYS n 
3 16  ALA n 
3 17  PRO n 
3 18  ARG n 
3 19  LYS n 
3 20  GLN n 
3 21  LEU n 
3 22  ALA n 
3 23  THR n 
3 24  LYS n 
3 25  ALA n 
3 26  ALA n 
3 27  ARG n 
3 28  LYS n 
3 29  SER n 
3 30  ALA n 
3 31  PRO n 
3 32  ALA n 
3 33  THR n 
3 34  GLY n 
3 35  GLY n 
3 36  VAL n 
3 37  LYS n 
3 38  LYS n 
3 39  PRO n 
3 40  HIS n 
3 41  ARG n 
3 42  TYR n 
3 43  ARG n 
3 44  PRO n 
3 45  GLY n 
3 46  THR n 
3 47  VAL n 
3 48  ALA n 
3 49  LEU n 
3 50  ARG n 
3 51  GLU n 
3 52  ILE n 
3 53  ARG n 
3 54  ARG n 
3 55  TYR n 
3 56  GLN n 
3 57  LYS n 
3 58  SER n 
3 59  THR n 
3 60  GLU n 
3 61  LEU n 
3 62  LEU n 
3 63  ILE n 
3 64  ARG n 
3 65  LYS n 
3 66  LEU n 
3 67  PRO n 
3 68  PHE n 
3 69  GLN n 
3 70  ARG n 
3 71  LEU n 
3 72  VAL n 
3 73  ARG n 
3 74  GLU n 
3 75  ILE n 
3 76  ALA n 
3 77  GLN n 
3 78  ASP n 
3 79  PHE n 
3 80  LYS n 
3 81  THR n 
3 82  ASP n 
3 83  LEU n 
3 84  ARG n 
3 85  PHE n 
3 86  GLN n 
3 87  SER n 
3 88  SER n 
3 89  ALA n 
3 90  VAL n 
3 91  MET n 
3 92  ALA n 
3 93  LEU n 
3 94  GLN n 
3 95  GLU n 
3 96  ALA n 
3 97  CYS n 
3 98  GLU n 
3 99  ALA n 
3 100 TYR n 
3 101 LEU n 
3 102 VAL n 
3 103 GLY n 
3 104 LEU n 
3 105 PHE n 
3 106 GLU n 
3 107 ASP n 
3 108 THR n 
3 109 ASN n 
3 110 LEU n 
3 111 CYS n 
3 112 ALA n 
3 113 ILE n 
3 114 HIS n 
3 115 ALA n 
3 116 LYS n 
3 117 ARG n 
3 118 VAL n 
3 119 THR n 
3 120 ILE n 
3 121 MET n 
3 122 PRO n 
3 123 LYS n 
3 124 ASP n 
3 125 ILE n 
3 126 GLN n 
3 127 LEU n 
3 128 ALA n 
3 129 ARG n 
3 130 ARG n 
3 131 ILE n 
3 132 ARG n 
3 133 GLY n 
3 134 GLU n 
3 135 ARG n 
3 136 ALA n 
4 1   MET n 
4 2   SER n 
4 3   GLY n 
4 4   ARG n 
4 5   GLY n 
4 6   LYS n 
4 7   GLY n 
4 8   GLY n 
4 9   LYS n 
4 10  GLY n 
4 11  LEU n 
4 12  GLY n 
4 13  LYS n 
4 14  GLY n 
4 15  GLY n 
4 16  ALA n 
4 17  LYS n 
4 18  ARG n 
4 19  HIS n 
4 20  ARG n 
4 21  LYS n 
4 22  VAL n 
4 23  LEU n 
4 24  ARG n 
4 25  ASP n 
4 26  ASN n 
4 27  ILE n 
4 28  GLN n 
4 29  GLY n 
4 30  ILE n 
4 31  THR n 
4 32  LYS n 
4 33  PRO n 
4 34  ALA n 
4 35  ILE n 
4 36  ARG n 
4 37  ARG n 
4 38  LEU n 
4 39  ALA n 
4 40  ARG n 
4 41  ARG n 
4 42  GLY n 
4 43  GLY n 
4 44  VAL n 
4 45  LYS n 
4 46  ARG n 
4 47  ILE n 
4 48  SER n 
4 49  GLY n 
4 50  LEU n 
4 51  ILE n 
4 52  TYR n 
4 53  GLU n 
4 54  GLU n 
4 55  THR n 
4 56  ARG n 
4 57  GLY n 
4 58  VAL n 
4 59  LEU n 
4 60  LYS n 
4 61  VAL n 
4 62  PHE n 
4 63  LEU n 
4 64  GLU n 
4 65  ASN n 
4 66  VAL n 
4 67  ILE n 
4 68  ARG n 
4 69  ASP n 
4 70  ALA n 
4 71  VAL n 
4 72  THR n 
4 73  TYR n 
4 74  THR n 
4 75  GLU n 
4 76  HIS n 
4 77  ALA n 
4 78  LYS n 
4 79  ARG n 
4 80  LYS n 
4 81  THR n 
4 82  VAL n 
4 83  THR n 
4 84  ALA n 
4 85  MET n 
4 86  ASP n 
4 87  VAL n 
4 88  VAL n 
4 89  TYR n 
4 90  ALA n 
4 91  LEU n 
4 92  LYS n 
4 93  ARG n 
4 94  GLN n 
4 95  GLY n 
4 96  ARG n 
4 97  THR n 
4 98  LEU n 
4 99  TYR n 
4 100 GLY n 
4 101 PHE n 
4 102 GLY n 
4 103 GLY n 
5 1   MET n 
5 2   PRO n 
5 3   GLU n 
5 4   PRO n 
5 5   ALA n 
5 6   LYS n 
5 7   SER n 
5 8   ALA n 
5 9   PRO n 
5 10  ALA n 
5 11  PRO n 
5 12  LYS n 
5 13  LYS n 
5 14  GLY n 
5 15  SER n 
5 16  LYS n 
5 17  LYS n 
5 18  ALA n 
5 19  VAL n 
5 20  THR n 
5 21  LYS n 
5 22  ALA n 
5 23  GLN n 
5 24  LYS n 
5 25  LYS n 
5 26  ASP n 
5 27  GLY n 
5 28  LYS n 
5 29  LYS n 
5 30  ARG n 
5 31  LYS n 
5 32  ARG n 
5 33  SER n 
5 34  ARG n 
5 35  LYS n 
5 36  GLU n 
5 37  SER n 
5 38  TYR n 
5 39  SER n 
5 40  ILE n 
5 41  TYR n 
5 42  VAL n 
5 43  TYR n 
5 44  LYS n 
5 45  VAL n 
5 46  LEU n 
5 47  LYS n 
5 48  GLN n 
5 49  VAL n 
5 50  HIS n 
5 51  PRO n 
5 52  ASP n 
5 53  THR n 
5 54  GLY n 
5 55  ILE n 
5 56  SER n 
5 57  SER n 
5 58  LYS n 
5 59  ALA n 
5 60  MET n 
5 61  GLY n 
5 62  ILE n 
5 63  MET n 
5 64  ASN n 
5 65  SER n 
5 66  PHE n 
5 67  VAL n 
5 68  ASN n 
5 69  ASP n 
5 70  ILE n 
5 71  PHE n 
5 72  GLU n 
5 73  ARG n 
5 74  ILE n 
5 75  ALA n 
5 76  GLY n 
5 77  GLU n 
5 78  ALA n 
5 79  SER n 
5 80  ARG n 
5 81  LEU n 
5 82  ALA n 
5 83  HIS n 
5 84  TYR n 
5 85  ASN n 
5 86  LYS n 
5 87  ARG n 
5 88  SER n 
5 89  THR n 
5 90  ILE n 
5 91  THR n 
5 92  SER n 
5 93  ARG n 
5 94  GLU n 
5 95  ILE n 
5 96  GLN n 
5 97  THR n 
5 98  ALA n 
5 99  VAL n 
5 100 ARG n 
5 101 LEU n 
5 102 LEU n 
5 103 LEU n 
5 104 PRO n 
5 105 GLY n 
5 106 GLU n 
5 107 LEU n 
5 108 ALA n 
5 109 LYS n 
5 110 HIS n 
5 111 ALA n 
5 112 VAL n 
5 113 SER n 
5 114 GLU n 
5 115 GLY n 
5 116 THR n 
5 117 LYS n 
5 118 ALA n 
5 119 VAL n 
5 120 THR n 
5 121 LYS n 
5 122 TYR n 
5 123 THR n 
5 124 SER n 
5 125 SER n 
5 126 LYS n 
6 1   MET n 
6 2   PRO n 
6 3   ARG n 
6 4   ARG n 
6 5   ARG n 
6 6   ARG n 
6 7   ARG n 
6 8   ARG n 
6 9   GLY n 
6 10  SER n 
6 11  SER n 
6 12  GLY n 
6 13  ALA n 
6 14  GLY n 
6 15  GLY n 
6 16  ARG n 
6 17  GLY n 
6 18  ARG n 
6 19  THR n 
6 20  CYS n 
6 21  SER n 
6 22  ARG n 
6 23  THR n 
6 24  VAL n 
6 25  ARG n 
6 26  ALA n 
6 27  GLU n 
6 28  LEU n 
6 29  SER n 
6 30  PHE n 
6 31  SER n 
6 32  VAL n 
6 33  SER n 
6 34  GLN n 
6 35  VAL n 
6 36  GLU n 
6 37  ARG n 
6 38  SER n 
6 39  LEU n 
6 40  ARG n 
6 41  GLU n 
6 42  GLY n 
6 43  HIS n 
6 44  TYR n 
6 45  ALA n 
6 46  GLN n 
6 47  ARG n 
6 48  LEU n 
6 49  SER n 
6 50  ARG n 
6 51  THR n 
6 52  ALA n 
6 53  PRO n 
6 54  VAL n 
6 55  TYR n 
6 56  LEU n 
6 57  ALA n 
6 58  ALA n 
6 59  VAL n 
6 60  ILE n 
6 61  GLU n 
6 62  TYR n 
6 63  LEU n 
6 64  THR n 
6 65  ALA n 
6 66  LYS n 
6 67  VAL n 
6 68  LEU n 
6 69  GLU n 
6 70  LEU n 
6 71  ALA n 
6 72  GLY n 
6 73  ASN n 
6 74  GLU n 
6 75  ALA n 
6 76  GLN n 
6 77  ASN n 
6 78  SER n 
6 79  GLY n 
6 80  GLU n 
6 81  ARG n 
6 82  ASN n 
6 83  ILE n 
6 84  THR n 
6 85  PRO n 
6 86  LEU n 
6 87  LEU n 
6 88  LEU n 
6 89  ASP n 
6 90  MET n 
6 91  VAL n 
6 92  VAL n 
6 93  HIS n 
6 94  ASN n 
6 95  ASP n 
6 96  ARG n 
6 97  LEU n 
6 98  LEU n 
6 99  SER n 
6 100 THR n 
6 101 LEU n 
6 102 PHE n 
6 103 ASN n 
6 104 THR n 
6 105 THR n 
6 106 THR n 
6 107 ILE n 
6 108 SER n 
6 109 GLN n 
6 110 VAL n 
6 111 ALA n 
6 112 PRO n 
6 113 GLY n 
6 114 GLU n 
6 115 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 147 ?     ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 147 ?     ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 136 Human ? 
;HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H, H3FK, HIST1H3I, H3FF, HIST1H3J, H3FJ
;
? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 103 Human ? 
;HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
;
? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 126 Human ? 'HIST2H2BE, H2BFQ' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 115 Human ? 'H2AB2, H2AFB2, H2AB3, H2ABBD, H2AFB, H2AFB3' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? 
? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 6M4G        6M4G   ? 1 ? 1 
2 PDB 6M4G        6M4G   ? 2 ? 1 
3 UNP H31_HUMAN   P68431 ? 3 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1 
4 UNP H4_HUMAN    P62805 ? 4 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1 
5 UNP H2B2E_HUMAN Q16778 ? 5 
;MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
1 
6 UNP H2AB2_HUMAN P0C5Z0 ? 6 
;MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGE
RNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6M4G I 1 ? 147 ? 6M4G   1 ? 147 ? 1 147 
2  2 6M4G J 1 ? 147 ? 6M4G   1 ? 147 ? 1 147 
3  3 6M4G A 1 ? 136 ? P68431 1 ? 136 ? 0 135 
4  4 6M4G B 1 ? 103 ? P62805 1 ? 103 ? 0 102 
5  5 6M4G D 1 ? 126 ? Q16778 1 ? 126 ? 0 125 
6  3 6M4G E 1 ? 136 ? P68431 1 ? 136 ? 0 135 
7  4 6M4G F 1 ? 103 ? P62805 1 ? 103 ? 0 102 
8  5 6M4G H 1 ? 126 ? Q16778 1 ? 126 ? 0 125 
9  6 6M4G C 1 ? 115 ? P0C5Z0 1 ? 115 ? 0 114 
10 6 6M4G G 1 ? 115 ? P0C5Z0 1 ? 115 ? 0 114 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6M4G 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6M4G 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.006  ? 9539  ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.920  ? 13685 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 23.392 ? 5094  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.058  ? 1586  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.010  ? 1080  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6M4G 
_struct.title                        
'Structural mechanism of nucleosome dynamics governed by human histone variants H2A.B and H2A.Z.2.2' 
_struct.pdbx_descriptor              'Histone H3.1, Histone H4, Histone H2B type 2-E, Histone H2A-Bbd type 2/3/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6M4G 
_struct_keywords.text            'histone; variant; H2A.B; nucleosome, NUCLEAR PROTEIN' 
_struct_keywords.pdbx_keywords   'NUCLEAR PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ARG C 64  ? ALA C 76  ? ARG A 63  ALA A 75  1 ? 13 
HELX_P HELX_P2  AA2 GLN C 77  ? PHE C 79  ? GLN A 76  PHE A 78  5 ? 3  
HELX_P HELX_P3  AA3 GLN C 86  ? ALA C 115 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  AA4 MET C 121 ? GLY C 133 ? MET A 120 GLY A 132 1 ? 13 
HELX_P HELX_P5  AA5 ASN D 26  ? ILE D 30  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  AA6 THR D 31  ? GLY D 43  ? THR B 30  GLY B 42  1 ? 13 
HELX_P HELX_P7  AA7 LEU D 50  ? ALA D 77  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  AA8 THR D 83  ? ARG D 93  ? THR B 82  ARG B 92  1 ? 11 
HELX_P HELX_P9  AA9 TYR E 38  ? HIS E 50  ? TYR D 37  HIS D 49  1 ? 13 
HELX_P HELX_P10 AB1 SER E 57  ? ASN E 85  ? SER D 56  ASN D 84  1 ? 29 
HELX_P HELX_P11 AB2 THR E 91  ? LEU E 103 ? THR D 90  LEU D 102 1 ? 13 
HELX_P HELX_P12 AB3 GLY E 105 ? SER E 124 ? GLY D 104 SER D 123 1 ? 20 
HELX_P HELX_P13 AB4 ARG F 64  ? ALA F 76  ? ARG E 63  ALA E 75  1 ? 13 
HELX_P HELX_P14 AB5 GLN F 77  ? PHE F 79  ? GLN E 76  PHE E 78  5 ? 3  
HELX_P HELX_P15 AB6 GLN F 86  ? ALA F 115 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P16 AB7 MET F 121 ? GLY F 133 ? MET E 120 GLY E 132 1 ? 13 
HELX_P HELX_P17 AB8 ASN G 26  ? ILE G 30  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P18 AB9 THR G 31  ? GLY G 43  ? THR F 30  GLY F 42  1 ? 13 
HELX_P HELX_P19 AC1 LEU G 50  ? ALA G 77  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P20 AC2 THR G 83  ? ARG G 93  ? THR F 82  ARG F 92  1 ? 11 
HELX_P HELX_P21 AC3 TYR H 38  ? HIS H 50  ? TYR H 37  HIS H 49  1 ? 13 
HELX_P HELX_P22 AC4 SER H 57  ? ASN H 85  ? SER H 56  ASN H 84  1 ? 29 
HELX_P HELX_P23 AC5 THR H 91  ? LEU H 103 ? THR H 90  LEU H 102 1 ? 13 
HELX_P HELX_P24 AC6 GLY H 105 ? SER H 124 ? GLY H 104 SER H 123 1 ? 20 
HELX_P HELX_P25 AC7 ARG I 22  ? ALA I 26  ? ARG C 21  ALA C 25  1 ? 5  
HELX_P HELX_P26 AC8 SER I 31  ? HIS I 43  ? SER C 30  HIS C 42  1 ? 13 
HELX_P HELX_P27 AC9 THR I 51  ? GLY I 79  ? THR C 50  GLY C 78  1 ? 29 
HELX_P HELX_P28 AD1 THR I 84  ? ASN I 94  ? THR C 83  ASN C 93  1 ? 11 
HELX_P HELX_P29 AD2 ARG J 22  ? ALA J 26  ? ARG G 21  ALA G 25  1 ? 5  
HELX_P HELX_P30 AD3 SER J 31  ? HIS J 43  ? SER G 30  HIS G 42  1 ? 13 
HELX_P HELX_P31 AD4 THR J 51  ? GLY J 79  ? THR G 50  GLY G 78  1 ? 29 
HELX_P HELX_P32 AD5 THR J 84  ? ASN J 94  ? THR G 83  ASN G 93  1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1   hydrog ? ? A DG 29  N1 ? ? ? 1_555 B DC 119 N3 ? ? I DG 29  J DC 119 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog2   hydrog ? ? A DG 29  N2 ? ? ? 1_555 B DC 119 O2 ? ? I DG 29  J DC 119 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog3   hydrog ? ? A DG 29  O6 ? ? ? 1_555 B DC 119 N4 ? ? I DG 29  J DC 119 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog4   hydrog ? ? A DG 30  O6 ? ? ? 1_555 B DT 117 N3 ? ? I DG 30  J DT 117 1_555 ? ? ? ? ? ? 'DG-DT MISPAIR'         ? ? ? 
hydrog5   hydrog ? ? A DG 30  O6 ? ? ? 1_555 B DC 118 N4 ? ? I DG 30  J DC 118 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? ? 
hydrog6   hydrog ? ? A DG 32  N2 ? ? ? 1_555 B DC 116 O2 ? ? I DG 32  J DC 116 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? ? 
hydrog7   hydrog ? ? A DA 33  N1 ? ? ? 1_555 B DT 115 N3 ? ? I DA 33  J DT 115 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? ? 
hydrog8   hydrog ? ? A DA 33  N6 ? ? ? 1_555 B DT 115 O2 ? ? I DA 33  J DT 115 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? ? 
hydrog9   hydrog ? ? A DC 34  N3 ? ? ? 1_555 B DG 114 N1 ? ? I DC 34  J DG 114 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog10  hydrog ? ? A DC 34  N4 ? ? ? 1_555 B DG 114 O6 ? ? I DC 34  J DG 114 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog11  hydrog ? ? A DC 34  O2 ? ? ? 1_555 B DG 114 N2 ? ? I DC 34  J DG 114 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog12  hydrog ? ? A DT 35  N3 ? ? ? 1_555 B DA 113 N1 ? ? I DT 35  J DA 113 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog13  hydrog ? ? A DT 35  O4 ? ? ? 1_555 B DA 113 N6 ? ? I DT 35  J DA 113 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog14  hydrog ? ? A DG 37  O6 ? ? ? 1_555 B DC 111 N4 ? ? I DG 37  J DC 111 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? ? 
hydrog15  hydrog ? ? A DG 38  N1 ? ? ? 1_555 B DC 110 N3 ? ? I DG 38  J DC 110 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog16  hydrog ? ? A DG 38  N2 ? ? ? 1_555 B DC 110 O2 ? ? I DG 38  J DC 110 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog17  hydrog ? ? A DG 38  O6 ? ? ? 1_555 B DC 110 N4 ? ? I DG 38  J DC 110 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog18  hydrog ? ? A DG 39  O6 ? ? ? 1_555 B DC 109 N4 ? ? I DG 39  J DC 109 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? ? 
hydrog19  hydrog ? ? A DA 40  N1 ? ? ? 1_555 B DT 108 N3 ? ? I DA 40  J DT 108 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog20  hydrog ? ? A DA 40  N6 ? ? ? 1_555 B DT 108 O4 ? ? I DA 40  J DT 108 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog21  hydrog ? ? A DG 41  N1 ? ? ? 1_555 B DC 107 N3 ? ? I DG 41  J DC 107 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog22  hydrog ? ? A DG 41  N2 ? ? ? 1_555 B DC 107 O2 ? ? I DG 41  J DC 107 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog23  hydrog ? ? A DG 41  O6 ? ? ? 1_555 B DC 107 N4 ? ? I DG 41  J DC 107 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog24  hydrog ? ? A DT 42  N3 ? ? ? 1_555 B DA 106 N1 ? ? I DT 42  J DA 106 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog25  hydrog ? ? A DT 42  O4 ? ? ? 1_555 B DA 106 N6 ? ? I DT 42  J DA 106 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog26  hydrog ? ? A DA 43  N1 ? ? ? 1_555 B DT 105 N3 ? ? I DA 43  J DT 105 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog27  hydrog ? ? A DA 43  N6 ? ? ? 1_555 B DT 105 O4 ? ? I DA 43  J DT 105 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog28  hydrog ? ? A DA 44  N1 ? ? ? 1_555 B DT 104 N3 ? ? I DA 44  J DT 104 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog29  hydrog ? ? A DA 44  N6 ? ? ? 1_555 B DT 104 O4 ? ? I DA 44  J DT 104 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog30  hydrog ? ? A DT 45  N3 ? ? ? 1_555 B DA 103 N1 ? ? I DT 45  J DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog31  hydrog ? ? A DT 45  O4 ? ? ? 1_555 B DA 103 N6 ? ? I DT 45  J DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog32  hydrog ? ? A DC 46  N4 ? ? ? 1_555 B DG 102 O6 ? ? I DC 46  J DG 102 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? ? 
hydrog33  hydrog ? ? A DC 47  N3 ? ? ? 1_555 B DG 101 N1 ? ? I DC 47  J DG 101 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog34  hydrog ? ? A DC 47  N4 ? ? ? 1_555 B DG 101 O6 ? ? I DC 47  J DG 101 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog35  hydrog ? ? A DC 47  O2 ? ? ? 1_555 B DG 101 N2 ? ? I DC 47  J DG 101 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog36  hydrog ? ? A DC 48  N3 ? ? ? 1_555 B DG 100 N1 ? ? I DC 48  J DG 100 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog37  hydrog ? ? A DC 48  N4 ? ? ? 1_555 B DG 100 O6 ? ? I DC 48  J DG 100 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog38  hydrog ? ? A DC 48  O2 ? ? ? 1_555 B DG 100 N2 ? ? I DC 48  J DG 100 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog39  hydrog ? ? A DC 49  O2 ? ? ? 1_555 B DG 99  N2 ? ? I DC 49  J DG 99  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? ? 
hydrog40  hydrog ? ? A DT 50  N3 ? ? ? 1_555 B DA 98  N1 ? ? I DT 50  J DA 98  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog41  hydrog ? ? A DT 50  O4 ? ? ? 1_555 B DA 98  N6 ? ? I DT 50  J DA 98  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog42  hydrog ? ? A DT 51  N3 ? ? ? 1_555 B DA 97  N1 ? ? I DT 51  J DA 97  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog43  hydrog ? ? A DT 51  O4 ? ? ? 1_555 B DA 97  N6 ? ? I DT 51  J DA 97  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog44  hydrog ? ? A DG 52  N1 ? ? ? 1_555 B DC 96  N3 ? ? I DG 52  J DC 96  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog45  hydrog ? ? A DG 52  N2 ? ? ? 1_555 B DC 96  O2 ? ? I DG 52  J DC 96  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog46  hydrog ? ? A DG 52  O6 ? ? ? 1_555 B DC 96  N4 ? ? I DG 52  J DC 96  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog47  hydrog ? ? A DG 53  N1 ? ? ? 1_555 B DC 95  N3 ? ? I DG 53  J DC 95  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog48  hydrog ? ? A DG 53  N2 ? ? ? 1_555 B DC 95  O2 ? ? I DG 53  J DC 95  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog49  hydrog ? ? A DG 53  O6 ? ? ? 1_555 B DC 95  N4 ? ? I DG 53  J DC 95  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog50  hydrog ? ? A DC 54  N3 ? ? ? 1_555 B DG 94  N1 ? ? I DC 54  J DG 94  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog51  hydrog ? ? A DC 54  N4 ? ? ? 1_555 B DG 94  O6 ? ? I DC 54  J DG 94  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog52  hydrog ? ? A DC 54  O2 ? ? ? 1_555 B DG 94  N2 ? ? I DC 54  J DG 94  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog53  hydrog ? ? A DG 55  N1 ? ? ? 1_555 B DC 93  N3 ? ? I DG 55  J DC 93  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog54  hydrog ? ? A DG 55  N2 ? ? ? 1_555 B DC 93  O2 ? ? I DG 55  J DC 93  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog55  hydrog ? ? A DG 55  O6 ? ? ? 1_555 B DC 93  N4 ? ? I DG 55  J DC 93  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog56  hydrog ? ? A DG 56  N1 ? ? ? 1_555 B DC 92  N3 ? ? I DG 56  J DC 92  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog57  hydrog ? ? A DG 56  N2 ? ? ? 1_555 B DC 92  O2 ? ? I DG 56  J DC 92  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog58  hydrog ? ? A DG 56  O6 ? ? ? 1_555 B DC 92  N4 ? ? I DG 56  J DC 92  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog59  hydrog ? ? A DT 57  N3 ? ? ? 1_555 B DA 91  N1 ? ? I DT 57  J DA 91  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog60  hydrog ? ? A DT 57  O4 ? ? ? 1_555 B DA 91  N6 ? ? I DT 57  J DA 91  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog61  hydrog ? ? A DT 58  N3 ? ? ? 1_555 B DA 90  N1 ? ? I DT 58  J DA 90  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? ? ? 
hydrog62  hydrog ? ? A DA 59  N1 ? ? ? 1_555 B DT 89  N3 ? ? I DA 59  J DT 89  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? ? 
hydrog63  hydrog ? ? A DA 60  N1 ? ? ? 1_555 B DT 88  N3 ? ? I DA 60  J DT 88  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? ? 
hydrog64  hydrog ? ? A DA 61  N1 ? ? ? 1_555 B DT 87  N3 ? ? I DA 61  J DT 87  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? ? 
hydrog65  hydrog ? ? A DA 62  N1 ? ? ? 1_555 B DT 86  N3 ? ? I DA 62  J DT 86  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog66  hydrog ? ? A DA 62  N6 ? ? ? 1_555 B DT 86  O4 ? ? I DA 62  J DT 86  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog67  hydrog ? ? A DC 63  N3 ? ? ? 1_555 B DG 85  N1 ? ? I DC 63  J DG 85  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog68  hydrog ? ? A DC 63  N4 ? ? ? 1_555 B DG 85  O6 ? ? I DC 63  J DG 85  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog69  hydrog ? ? A DC 63  O2 ? ? ? 1_555 B DG 85  N2 ? ? I DC 63  J DG 85  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog70  hydrog ? ? A DG 64  N1 ? ? ? 1_555 B DC 84  N3 ? ? I DG 64  J DC 84  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog71  hydrog ? ? A DG 64  N2 ? ? ? 1_555 B DC 84  O2 ? ? I DG 64  J DC 84  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog72  hydrog ? ? A DG 64  O6 ? ? ? 1_555 B DC 84  N4 ? ? I DG 64  J DC 84  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog73  hydrog ? ? A DC 65  N3 ? ? ? 1_555 B DG 83  N1 ? ? I DC 65  J DG 83  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog74  hydrog ? ? A DC 65  N4 ? ? ? 1_555 B DG 83  O6 ? ? I DC 65  J DG 83  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog75  hydrog ? ? A DC 65  O2 ? ? ? 1_555 B DG 83  N2 ? ? I DC 65  J DG 83  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog76  hydrog ? ? A DG 66  N1 ? ? ? 1_555 B DC 82  N3 ? ? I DG 66  J DC 82  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog77  hydrog ? ? A DG 66  N2 ? ? ? 1_555 B DC 82  O2 ? ? I DG 66  J DC 82  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog78  hydrog ? ? A DG 66  O6 ? ? ? 1_555 B DC 82  N4 ? ? I DG 66  J DC 82  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog79  hydrog ? ? A DG 67  N1 ? ? ? 1_555 B DC 81  N3 ? ? I DG 67  J DC 81  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog80  hydrog ? ? A DG 67  N2 ? ? ? 1_555 B DC 81  O2 ? ? I DG 67  J DC 81  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog81  hydrog ? ? A DG 67  O6 ? ? ? 1_555 B DC 81  N4 ? ? I DG 67  J DC 81  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog82  hydrog ? ? A DG 68  N1 ? ? ? 1_555 B DC 80  N3 ? ? I DG 68  J DC 80  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog83  hydrog ? ? A DG 68  N2 ? ? ? 1_555 B DC 80  O2 ? ? I DG 68  J DC 80  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog84  hydrog ? ? A DG 68  O6 ? ? ? 1_555 B DC 80  N4 ? ? I DG 68  J DC 80  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog85  hydrog ? ? A DG 69  N1 ? ? ? 1_555 B DC 79  N3 ? ? I DG 69  J DC 79  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog86  hydrog ? ? A DG 69  N2 ? ? ? 1_555 B DC 79  O2 ? ? I DG 69  J DC 79  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog87  hydrog ? ? A DG 69  O6 ? ? ? 1_555 B DC 79  N4 ? ? I DG 69  J DC 79  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog88  hydrog ? ? A DG 70  N1 ? ? ? 1_555 B DC 78  N3 ? ? I DG 70  J DC 78  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog89  hydrog ? ? A DG 70  N2 ? ? ? 1_555 B DC 78  O2 ? ? I DG 70  J DC 78  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog90  hydrog ? ? A DG 70  O6 ? ? ? 1_555 B DC 78  N4 ? ? I DG 70  J DC 78  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog91  hydrog ? ? A DC 72  N3 ? ? ? 1_555 B DG 76  N1 ? ? I DC 72  J DG 76  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog92  hydrog ? ? A DC 72  N4 ? ? ? 1_555 B DG 76  O6 ? ? I DC 72  J DG 76  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog93  hydrog ? ? A DC 72  O2 ? ? ? 1_555 B DG 76  N2 ? ? I DC 72  J DG 76  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog94  hydrog ? ? A DA 73  N1 ? ? ? 1_555 B DT 75  N3 ? ? I DA 73  J DT 75  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog95  hydrog ? ? A DA 73  N6 ? ? ? 1_555 B DT 75  O4 ? ? I DA 73  J DT 75  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog96  hydrog ? ? A DG 74  N1 ? ? ? 1_555 B DC 74  N3 ? ? I DG 74  J DC 74  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog97  hydrog ? ? A DG 74  N2 ? ? ? 1_555 B DC 74  O2 ? ? I DG 74  J DC 74  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog98  hydrog ? ? A DG 74  O6 ? ? ? 1_555 B DC 74  N4 ? ? I DG 74  J DC 74  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog99  hydrog ? ? A DC 75  N3 ? ? ? 1_555 B DG 73  N1 ? ? I DC 75  J DG 73  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog100 hydrog ? ? A DC 75  N4 ? ? ? 1_555 B DG 73  O6 ? ? I DC 75  J DG 73  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog101 hydrog ? ? A DC 75  O2 ? ? ? 1_555 B DG 73  N2 ? ? I DC 75  J DG 73  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog102 hydrog ? ? A DG 76  N1 ? ? ? 1_555 B DC 72  N3 ? ? I DG 76  J DC 72  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog103 hydrog ? ? A DG 76  N2 ? ? ? 1_555 B DC 72  O2 ? ? I DG 76  J DC 72  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog104 hydrog ? ? A DG 76  O6 ? ? ? 1_555 B DC 72  N4 ? ? I DG 76  J DC 72  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog105 hydrog ? ? A DC 77  N3 ? ? ? 1_555 B DG 71  N1 ? ? I DC 77  J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog106 hydrog ? ? A DC 77  N4 ? ? ? 1_555 B DG 71  O6 ? ? I DC 77  J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog107 hydrog ? ? A DC 77  O2 ? ? ? 1_555 B DG 71  N2 ? ? I DC 77  J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog108 hydrog ? ? A DG 78  N1 ? ? ? 1_555 B DC 70  N3 ? ? I DG 78  J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog109 hydrog ? ? A DG 78  N2 ? ? ? 1_555 B DC 70  O2 ? ? I DG 78  J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog110 hydrog ? ? A DG 78  O6 ? ? ? 1_555 B DC 70  N4 ? ? I DG 78  J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog111 hydrog ? ? A DT 79  N3 ? ? ? 1_555 B DA 69  N1 ? ? I DT 79  J DA 69  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog112 hydrog ? ? A DT 79  O4 ? ? ? 1_555 B DA 69  N6 ? ? I DT 79  J DA 69  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog113 hydrog ? ? A DA 80  N1 ? ? ? 1_555 B DT 68  N3 ? ? I DA 80  J DT 68  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog114 hydrog ? ? A DA 80  N6 ? ? ? 1_555 B DT 68  O4 ? ? I DA 80  J DT 68  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog115 hydrog ? ? A DC 81  N3 ? ? ? 1_555 B DG 67  N1 ? ? I DC 81  J DG 67  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog116 hydrog ? ? A DC 81  N4 ? ? ? 1_555 B DG 67  O6 ? ? I DC 81  J DG 67  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog117 hydrog ? ? A DC 81  O2 ? ? ? 1_555 B DG 67  N2 ? ? I DC 81  J DG 67  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog118 hydrog ? ? A DG 82  N1 ? ? ? 1_555 B DC 66  N3 ? ? I DG 82  J DC 66  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog119 hydrog ? ? A DG 82  N2 ? ? ? 1_555 B DC 66  O2 ? ? I DG 82  J DC 66  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog120 hydrog ? ? A DG 82  O6 ? ? ? 1_555 B DC 66  N4 ? ? I DG 82  J DC 66  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog121 hydrog ? ? A DT 83  N3 ? ? ? 1_555 B DA 65  N1 ? ? I DT 83  J DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog122 hydrog ? ? A DT 83  O4 ? ? ? 1_555 B DA 65  N6 ? ? I DT 83  J DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog123 hydrog ? ? A DG 84  N1 ? ? ? 1_555 B DC 64  N3 ? ? I DG 84  J DC 64  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog124 hydrog ? ? A DG 84  N2 ? ? ? 1_555 B DC 64  O2 ? ? I DG 84  J DC 64  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog125 hydrog ? ? A DG 84  O6 ? ? ? 1_555 B DC 64  N4 ? ? I DG 84  J DC 64  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog126 hydrog ? ? A DC 85  N3 ? ? ? 1_555 B DG 63  N1 ? ? I DC 85  J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog127 hydrog ? ? A DC 85  N4 ? ? ? 1_555 B DG 63  O6 ? ? I DC 85  J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog128 hydrog ? ? A DC 85  O2 ? ? ? 1_555 B DG 63  N2 ? ? I DC 85  J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog129 hydrog ? ? A DG 86  N1 ? ? ? 1_555 B DC 62  N3 ? ? I DG 86  J DC 62  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog130 hydrog ? ? A DG 86  N2 ? ? ? 1_555 B DC 62  O2 ? ? I DG 86  J DC 62  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog131 hydrog ? ? A DG 86  O6 ? ? ? 1_555 B DC 62  N4 ? ? I DG 86  J DC 62  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog132 hydrog ? ? A DT 87  N3 ? ? ? 1_555 B DA 61  N1 ? ? I DT 87  J DA 61  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? ? ? 
hydrog133 hydrog ? ? A DT 88  N3 ? ? ? 1_555 B DA 60  N1 ? ? I DT 88  J DA 60  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? ? ? 
hydrog134 hydrog ? ? A DT 89  N3 ? ? ? 1_555 B DA 59  N1 ? ? I DT 89  J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog135 hydrog ? ? A DT 89  O4 ? ? ? 1_555 B DA 59  N6 ? ? I DT 89  J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog136 hydrog ? ? A DA 90  N6 ? ? ? 1_555 B DT 58  O4 ? ? I DA 90  J DT 58  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? ? 
hydrog137 hydrog ? ? A DA 91  N1 ? ? ? 1_555 B DT 57  N3 ? ? I DA 91  J DT 57  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog138 hydrog ? ? A DA 91  N6 ? ? ? 1_555 B DT 57  O4 ? ? I DA 91  J DT 57  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog139 hydrog ? ? A DG 92  N1 ? ? ? 1_555 B DC 56  N3 ? ? I DG 92  J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog140 hydrog ? ? A DG 92  N2 ? ? ? 1_555 B DC 56  O2 ? ? I DG 92  J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog141 hydrog ? ? A DG 92  O6 ? ? ? 1_555 B DC 56  N4 ? ? I DG 92  J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog142 hydrog ? ? A DC 93  N3 ? ? ? 1_555 B DG 55  N1 ? ? I DC 93  J DG 55  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog143 hydrog ? ? A DC 93  N4 ? ? ? 1_555 B DG 55  O6 ? ? I DC 93  J DG 55  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog144 hydrog ? ? A DC 93  O2 ? ? ? 1_555 B DG 55  N2 ? ? I DC 93  J DG 55  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog145 hydrog ? ? A DG 94  N1 ? ? ? 1_555 B DC 54  N3 ? ? I DG 94  J DC 54  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog146 hydrog ? ? A DG 94  N2 ? ? ? 1_555 B DC 54  O2 ? ? I DG 94  J DC 54  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog147 hydrog ? ? A DG 94  O6 ? ? ? 1_555 B DC 54  N4 ? ? I DG 94  J DC 54  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog148 hydrog ? ? A DG 95  N1 ? ? ? 1_555 B DC 53  N3 ? ? I DG 95  J DC 53  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog149 hydrog ? ? A DG 95  N2 ? ? ? 1_555 B DC 53  O2 ? ? I DG 95  J DC 53  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog150 hydrog ? ? A DG 95  O6 ? ? ? 1_555 B DC 53  N4 ? ? I DG 95  J DC 53  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog151 hydrog ? ? A DT 96  N3 ? ? ? 1_555 B DA 52  N1 ? ? I DT 96  J DA 52  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog152 hydrog ? ? A DT 96  O4 ? ? ? 1_555 B DA 52  N6 ? ? I DT 96  J DA 52  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog153 hydrog ? ? A DG 97  N1 ? ? ? 1_555 B DC 51  N3 ? ? I DG 97  J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog154 hydrog ? ? A DG 97  N2 ? ? ? 1_555 B DC 51  O2 ? ? I DG 97  J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog155 hydrog ? ? A DG 97  O6 ? ? ? 1_555 B DC 51  N4 ? ? I DG 97  J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog156 hydrog ? ? A DC 98  N3 ? ? ? 1_555 B DG 50  N1 ? ? I DC 98  J DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog157 hydrog ? ? A DC 98  N4 ? ? ? 1_555 B DG 50  O6 ? ? I DC 98  J DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog158 hydrog ? ? A DC 98  O2 ? ? ? 1_555 B DG 50  N2 ? ? I DC 98  J DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog159 hydrog ? ? A DT 99  N3 ? ? ? 1_555 B DA 49  N1 ? ? I DT 99  J DA 49  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? ? ? 
hydrog160 hydrog ? ? A DA 100 N1 ? ? ? 1_555 B DT 48  N3 ? ? I DA 100 J DT 48  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog161 hydrog ? ? A DA 100 N6 ? ? ? 1_555 B DT 48  O4 ? ? I DA 100 J DT 48  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog162 hydrog ? ? A DG 101 N1 ? ? ? 1_555 B DC 47  N3 ? ? I DG 101 J DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog163 hydrog ? ? A DG 101 N2 ? ? ? 1_555 B DC 47  O2 ? ? I DG 101 J DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog164 hydrog ? ? A DG 101 O6 ? ? ? 1_555 B DC 47  N4 ? ? I DG 101 J DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog165 hydrog ? ? A DA 102 N1 ? ? ? 1_555 B DT 46  N3 ? ? I DA 102 J DT 46  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog166 hydrog ? ? A DA 102 N6 ? ? ? 1_555 B DT 46  O4 ? ? I DA 102 J DT 46  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog167 hydrog ? ? A DG 103 N1 ? ? ? 1_555 B DC 45  N3 ? ? I DG 103 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog168 hydrog ? ? A DG 103 N2 ? ? ? 1_555 B DC 45  O2 ? ? I DG 103 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog169 hydrog ? ? A DG 103 O6 ? ? ? 1_555 B DC 45  N4 ? ? I DG 103 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog170 hydrog ? ? A DC 104 N3 ? ? ? 1_555 B DG 44  N1 ? ? I DC 104 J DG 44  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog171 hydrog ? ? A DC 104 N4 ? ? ? 1_555 B DG 44  O6 ? ? I DC 104 J DG 44  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog172 hydrog ? ? A DC 104 O2 ? ? ? 1_555 B DG 44  N2 ? ? I DC 104 J DG 44  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog173 hydrog ? ? A DT 105 N3 ? ? ? 1_555 B DA 43  N1 ? ? I DT 105 J DA 43  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog174 hydrog ? ? A DT 105 O4 ? ? ? 1_555 B DA 43  N6 ? ? I DT 105 J DA 43  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog175 hydrog ? ? A DG 106 N1 ? ? ? 1_555 B DC 42  O2 ? ? I DG 106 J DC 42  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? ? 
hydrog176 hydrog ? ? A DT 107 N3 ? ? ? 1_555 B DA 41  N1 ? ? I DT 107 J DA 41  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog177 hydrog ? ? A DT 107 O4 ? ? ? 1_555 B DA 41  N6 ? ? I DT 107 J DA 41  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog178 hydrog ? ? A DC 108 N3 ? ? ? 1_555 B DG 40  N2 ? ? I DC 108 J DG 40  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? ? 
hydrog179 hydrog ? ? A DC 108 O2 ? ? ? 1_555 B DG 40  N1 ? ? I DC 108 J DG 40  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? ? 
hydrog180 hydrog ? ? A DT 109 N3 ? ? ? 1_555 B DA 39  N1 ? ? I DT 109 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog181 hydrog ? ? A DT 109 O4 ? ? ? 1_555 B DA 39  N6 ? ? I DT 109 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog182 hydrog ? ? A DA 110 N1 ? ? ? 1_555 B DT 38  N3 ? ? I DA 110 J DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog183 hydrog ? ? A DA 110 N6 ? ? ? 1_555 B DT 38  O4 ? ? I DA 110 J DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog184 hydrog ? ? A DC 111 N4 ? ? ? 1_555 B DG 37  O6 ? ? I DC 111 J DG 37  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? ? 
hydrog185 hydrog ? ? A DG 112 N1 ? ? ? 1_555 B DC 36  N3 ? ? I DG 112 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog186 hydrog ? ? A DG 112 N2 ? ? ? 1_555 B DC 36  O2 ? ? I DG 112 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog187 hydrog ? ? A DG 112 O6 ? ? ? 1_555 B DC 36  N4 ? ? I DG 112 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog188 hydrog ? ? A DA 113 N6 ? ? ? 1_555 B DT 35  O2 ? ? I DA 113 J DT 35  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? ? 
hydrog189 hydrog ? ? A DC 114 N3 ? ? ? 1_555 B DG 34  N1 ? ? I DC 114 J DG 34  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog190 hydrog ? ? A DC 114 N4 ? ? ? 1_555 B DG 34  O6 ? ? I DC 114 J DG 34  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog191 hydrog ? ? A DC 114 O2 ? ? ? 1_555 B DG 34  N2 ? ? I DC 114 J DG 34  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog192 hydrog ? ? A DC 115 O2 ? ? ? 1_555 B DG 33  N1 ? ? I DC 115 J DG 33  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? ? 
hydrog193 hydrog ? ? A DA 116 N1 ? ? ? 1_555 B DT 32  N3 ? ? I DA 116 J DT 32  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog194 hydrog ? ? A DA 116 N6 ? ? ? 1_555 B DT 32  O4 ? ? I DA 116 J DT 32  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog195 hydrog ? ? A DA 117 N1 ? ? ? 1_555 B DT 31  N3 ? ? I DA 117 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog196 hydrog ? ? A DA 117 N6 ? ? ? 1_555 B DT 31  O4 ? ? I DA 117 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog197 hydrog ? ? A DT 118 N3 ? ? ? 1_555 B DA 30  N1 ? ? I DT 118 J DA 30  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog198 hydrog ? ? A DT 118 O4 ? ? ? 1_555 B DA 30  N6 ? ? I DT 118 J DA 30  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog199 hydrog ? ? A DT 119 N3 ? ? ? 1_555 B DA 29  N1 ? ? I DT 119 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog200 hydrog ? ? A DT 119 O4 ? ? ? 1_555 B DA 29  N6 ? ? I DT 119 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog201 hydrog ? ? A DG 120 N1 ? ? ? 1_555 B DC 28  N3 ? ? I DG 120 J DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog202 hydrog ? ? A DG 120 N2 ? ? ? 1_555 B DC 28  O2 ? ? I DG 120 J DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
hydrog203 hydrog ? ? A DG 120 O6 ? ? ? 1_555 B DC 28  N4 ? ? I DG 120 J DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG C 84  ? PHE C 85  ? ARG A 83  PHE A 84  
AA1 2 THR D 81  ? VAL D 82  ? THR B 80  VAL B 81  
AA2 1 THR C 119 ? ILE C 120 ? THR A 118 ILE A 119 
AA2 2 ARG D 46  ? ILE D 47  ? ARG B 45  ILE B 46  
AA3 1 LEU D 98  ? TYR D 99  ? LEU B 97  TYR B 98  
AA3 2 THR J 106 ? ILE J 107 ? THR G 105 ILE G 106 
AA4 1 ARG F 84  ? PHE F 85  ? ARG E 83  PHE E 84  
AA4 2 THR G 81  ? VAL G 82  ? THR F 80  VAL F 81  
AA5 1 THR F 119 ? ILE F 120 ? THR E 118 ILE E 119 
AA5 2 ARG G 46  ? ILE G 47  ? ARG F 45  ILE F 46  
AA6 1 THR G 97  ? TYR G 99  ? THR F 96  TYR F 98  
AA6 2 THR I 105 ? ILE I 107 ? THR C 104 ILE C 106 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG C 84  ? N ARG A 83  O VAL D 82  ? O VAL B 81  
AA2 1 2 N ILE C 120 ? N ILE A 119 O ARG D 46  ? O ARG B 45  
AA3 1 2 N TYR D 99  ? N TYR B 98  O THR J 106 ? O THR G 105 
AA4 1 2 N ARG F 84  ? N ARG E 83  O VAL G 82  ? O VAL F 81  
AA5 1 2 N ILE F 120 ? N ILE E 119 O ARG G 46  ? O ARG F 45  
AA6 1 2 N THR G 97  ? N THR F 96  O THR I 106 ? O THR C 105 
# 
_atom_sites.entry_id                    6M4G 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    P P     . DT  A 1 28  ? 110.509 95.631  157.624 1.00 115.60 ? 28  DT  I P     1 
ATOM 2    O OP1   . DT  A 1 28  ? 111.129 94.300  157.809 1.00 115.60 ? 28  DT  I OP1   1 
ATOM 3    O OP2   . DT  A 1 28  ? 109.960 96.355  158.790 1.00 115.60 ? 28  DT  I OP2   1 
ATOM 4    O "O5'" . DT  A 1 28  ? 111.562 96.600  156.913 1.00 115.60 ? 28  DT  I "O5'" 1 
ATOM 5    C "C5'" . DT  A 1 28  ? 111.857 96.453  155.525 1.00 115.60 ? 28  DT  I "C5'" 1 
ATOM 6    C "C4'" . DT  A 1 28  ? 111.035 97.421  154.690 1.00 115.60 ? 28  DT  I "C4'" 1 
ATOM 7    O "O4'" . DT  A 1 28  ? 109.604 97.196  154.889 1.00 115.60 ? 28  DT  I "O4'" 1 
ATOM 8    C "C3'" . DT  A 1 28  ? 111.259 98.906  154.978 1.00 115.60 ? 28  DT  I "C3'" 1 
ATOM 9    O "O3'" . DT  A 1 28  ? 111.301 99.613  153.731 1.00 115.60 ? 28  DT  I "O3'" 1 
ATOM 10   C "C2'" . DT  A 1 28  ? 110.042 99.275  155.824 1.00 115.60 ? 28  DT  I "C2'" 1 
ATOM 11   C "C1'" . DT  A 1 28  ? 109.003 98.456  155.107 1.00 115.60 ? 28  DT  I "C1'" 1 
ATOM 12   N N1    . DT  A 1 28  ? 107.708 98.287  155.820 1.00 115.60 ? 28  DT  I N1    1 
ATOM 13   C C2    . DT  A 1 28  ? 106.537 98.491  155.131 1.00 115.60 ? 28  DT  I C2    1 
ATOM 14   O O2    . DT  A 1 28  ? 106.501 98.960  154.008 1.00 115.60 ? 28  DT  I O2    1 
ATOM 15   N N3    . DT  A 1 28  ? 105.400 98.278  155.861 1.00 115.60 ? 28  DT  I N3    1 
ATOM 16   C C4    . DT  A 1 28  ? 105.315 97.786  157.150 1.00 115.60 ? 28  DT  I C4    1 
ATOM 17   O O4    . DT  A 1 28  ? 104.241 97.598  157.711 1.00 115.60 ? 28  DT  I O4    1 
ATOM 18   C C5    . DT  A 1 28  ? 106.581 97.510  157.788 1.00 115.60 ? 28  DT  I C5    1 
ATOM 19   C C7    . DT  A 1 28  ? 106.618 96.972  159.188 1.00 115.60 ? 28  DT  I C7    1 
ATOM 20   C C6    . DT  A 1 28  ? 107.703 97.749  157.090 1.00 115.60 ? 28  DT  I C6    1 
ATOM 21   P P     . DG  A 1 29  ? 110.894 101.164 153.647 1.00 111.53 ? 29  DG  I P     1 
ATOM 22   O OP1   . DG  A 1 29  ? 111.498 101.886 154.789 1.00 111.53 ? 29  DG  I OP1   1 
ATOM 23   O OP2   . DG  A 1 29  ? 109.433 101.174 153.424 1.00 111.53 ? 29  DG  I OP2   1 
ATOM 24   O "O5'" . DG  A 1 29  ? 111.570 101.695 152.298 1.00 111.53 ? 29  DG  I "O5'" 1 
ATOM 25   C "C5'" . DG  A 1 29  ? 111.788 103.089 152.160 1.00 111.53 ? 29  DG  I "C5'" 1 
ATOM 26   C "C4'" . DG  A 1 29  ? 110.754 103.765 151.263 1.00 111.53 ? 29  DG  I "C4'" 1 
ATOM 27   O "O4'" . DG  A 1 29  ? 109.402 103.388 151.647 1.00 111.53 ? 29  DG  I "O4'" 1 
ATOM 28   C "C3'" . DG  A 1 29  ? 110.745 105.271 151.342 1.00 111.53 ? 29  DG  I "C3'" 1 
ATOM 29   O "O3'" . DG  A 1 29  ? 110.016 105.743 150.204 1.00 111.53 ? 29  DG  I "O3'" 1 
ATOM 30   C "C2'" . DG  A 1 29  ? 109.983 105.458 152.657 1.00 111.53 ? 29  DG  I "C2'" 1 
ATOM 31   C "C1'" . DG  A 1 29  ? 108.878 104.424 152.461 1.00 111.53 ? 29  DG  I "C1'" 1 
ATOM 32   N N9    . DG  A 1 29  ? 108.320 103.785 153.652 1.00 111.53 ? 29  DG  I N9    1 
ATOM 33   C C8    . DG  A 1 29  ? 108.940 103.558 154.854 1.00 111.53 ? 29  DG  I C8    1 
ATOM 34   N N7    . DG  A 1 29  ? 108.162 103.000 155.743 1.00 111.53 ? 29  DG  I N7    1 
ATOM 35   C C5    . DG  A 1 29  ? 106.908 103.018 155.147 1.00 111.53 ? 29  DG  I C5    1 
ATOM 36   C C6    . DG  A 1 29  ? 105.650 102.606 155.646 1.00 111.53 ? 29  DG  I C6    1 
ATOM 37   O O6    . DG  A 1 29  ? 105.378 102.117 156.746 1.00 111.53 ? 29  DG  I O6    1 
ATOM 38   N N1    . DG  A 1 29  ? 104.635 102.797 154.710 1.00 111.53 ? 29  DG  I N1    1 
ATOM 39   C C2    . DG  A 1 29  ? 104.812 103.320 153.457 1.00 111.53 ? 29  DG  I C2    1 
ATOM 40   N N2    . DG  A 1 29  ? 103.712 103.428 152.701 1.00 111.53 ? 29  DG  I N2    1 
ATOM 41   N N3    . DG  A 1 29  ? 105.983 103.713 152.977 1.00 111.53 ? 29  DG  I N3    1 
ATOM 42   C C4    . DG  A 1 29  ? 106.984 103.532 153.874 1.00 111.53 ? 29  DG  I C4    1 
ATOM 43   P P     . DG  A 1 30  ? 110.219 107.227 149.621 1.00 104.44 ? 30  DG  I P     1 
ATOM 44   O OP1   . DG  A 1 30  ? 109.240 107.424 148.528 1.00 104.44 ? 30  DG  I OP1   1 
ATOM 45   O OP2   . DG  A 1 30  ? 111.664 107.374 149.337 1.00 104.44 ? 30  DG  I OP2   1 
ATOM 46   O "O5'" . DG  A 1 30  ? 109.827 108.220 150.812 1.00 104.44 ? 30  DG  I "O5'" 1 
ATOM 47   C "C5'" . DG  A 1 30  ? 109.030 109.363 150.475 1.00 104.44 ? 30  DG  I "C5'" 1 
ATOM 48   C "C4'" . DG  A 1 30  ? 107.545 109.140 150.730 1.00 104.44 ? 30  DG  I "C4'" 1 
ATOM 49   O "O4'" . DG  A 1 30  ? 107.360 108.227 151.852 1.00 104.44 ? 30  DG  I "O4'" 1 
ATOM 50   C "C3'" . DG  A 1 30  ? 106.741 110.397 151.098 1.00 104.44 ? 30  DG  I "C3'" 1 
ATOM 51   O "O3'" . DG  A 1 30  ? 105.566 110.452 150.263 1.00 104.44 ? 30  DG  I "O3'" 1 
ATOM 52   C "C2'" . DG  A 1 30  ? 106.411 110.190 152.576 1.00 104.44 ? 30  DG  I "C2'" 1 
ATOM 53   C "C1'" . DG  A 1 30  ? 106.262 108.697 152.595 1.00 104.44 ? 30  DG  I "C1'" 1 
ATOM 54   N N9    . DG  A 1 30  ? 106.294 108.105 153.931 1.00 104.44 ? 30  DG  I N9    1 
ATOM 55   C C8    . DG  A 1 30  ? 105.242 107.543 154.611 1.00 104.44 ? 30  DG  I C8    1 
ATOM 56   N N7    . DG  A 1 30  ? 105.577 107.037 155.767 1.00 104.44 ? 30  DG  I N7    1 
ATOM 57   C C5    . DG  A 1 30  ? 106.956 107.178 155.810 1.00 104.44 ? 30  DG  I C5    1 
ATOM 58   C C6    . DG  A 1 30  ? 107.887 106.778 156.800 1.00 104.44 ? 30  DG  I C6    1 
ATOM 59   O O6    . DG  A 1 30  ? 107.678 106.224 157.892 1.00 104.44 ? 30  DG  I O6    1 
ATOM 60   N N1    . DG  A 1 30  ? 109.189 107.119 156.444 1.00 104.44 ? 30  DG  I N1    1 
ATOM 61   C C2    . DG  A 1 30  ? 109.549 107.750 155.280 1.00 104.44 ? 30  DG  I C2    1 
ATOM 62   N N2    . DG  A 1 30  ? 110.857 107.986 155.115 1.00 104.44 ? 30  DG  I N2    1 
ATOM 63   N N3    . DG  A 1 30  ? 108.691 108.124 154.343 1.00 104.44 ? 30  DG  I N3    1 
ATOM 64   C C4    . DG  A 1 30  ? 107.416 107.808 154.672 1.00 104.44 ? 30  DG  I C4    1 
ATOM 65   P P     . DA  A 1 31  ? 104.939 111.863 149.807 1.00 93.68  ? 31  DA  I P     1 
ATOM 66   O OP1   . DA  A 1 31  ? 103.880 111.605 148.812 1.00 93.68  ? 31  DA  I OP1   1 
ATOM 67   O OP2   . DA  A 1 31  ? 106.057 112.764 149.451 1.00 93.68  ? 31  DA  I OP2   1 
ATOM 68   O "O5'" . DA  A 1 31  ? 104.273 112.412 151.148 1.00 93.68  ? 31  DA  I "O5'" 1 
ATOM 69   C "C5'" . DA  A 1 31  ? 103.145 111.721 151.696 1.00 93.68  ? 31  DA  I "C5'" 1 
ATOM 70   C "C4'" . DA  A 1 31  ? 102.868 112.189 153.107 1.00 93.68  ? 31  DA  I "C4'" 1 
ATOM 71   O "O4'" . DA  A 1 31  ? 103.988 111.808 153.936 1.00 93.68  ? 31  DA  I "O4'" 1 
ATOM 72   C "C3'" . DA  A 1 31  ? 102.695 113.694 153.277 1.00 93.68  ? 31  DA  I "C3'" 1 
ATOM 73   O "O3'" . DA  A 1 31  ? 101.570 113.982 154.143 1.00 93.68  ? 31  DA  I "O3'" 1 
ATOM 74   C "C2'" . DA  A 1 31  ? 104.027 114.125 153.887 1.00 93.68  ? 31  DA  I "C2'" 1 
ATOM 75   C "C1'" . DA  A 1 31  ? 104.410 112.899 154.705 1.00 93.68  ? 31  DA  I "C1'" 1 
ATOM 76   N N9    . DA  A 1 31  ? 105.848 112.758 154.884 1.00 93.68  ? 31  DA  I N9    1 
ATOM 77   C C8    . DA  A 1 31  ? 106.823 113.084 153.986 1.00 93.68  ? 31  DA  I C8    1 
ATOM 78   N N7    . DA  A 1 31  ? 108.035 112.800 154.395 1.00 93.68  ? 31  DA  I N7    1 
ATOM 79   C C5    . DA  A 1 31  ? 107.837 112.209 155.628 1.00 93.68  ? 31  DA  I C5    1 
ATOM 80   C C6    . DA  A 1 31  ? 108.728 111.675 156.574 1.00 93.68  ? 31  DA  I C6    1 
ATOM 81   N N6    . DA  A 1 31  ? 110.052 111.658 156.405 1.00 93.68  ? 31  DA  I N6    1 
ATOM 82   N N1    . DA  A 1 31  ? 108.205 111.158 157.705 1.00 93.68  ? 31  DA  I N1    1 
ATOM 83   C C2    . DA  A 1 31  ? 106.878 111.178 157.869 1.00 93.68  ? 31  DA  I C2    1 
ATOM 84   N N3    . DA  A 1 31  ? 105.941 111.651 157.050 1.00 93.68  ? 31  DA  I N3    1 
ATOM 85   C C4    . DA  A 1 31  ? 106.493 112.157 155.937 1.00 93.68  ? 31  DA  I C4    1 
ATOM 86   P P     . DG  A 1 32  ? 100.291 114.768 153.565 1.00 93.67  ? 32  DG  I P     1 
ATOM 87   O OP1   . DG  A 1 32  ? 99.199  113.778 153.445 1.00 93.67  ? 32  DG  I OP1   1 
ATOM 88   O OP2   . DG  A 1 32  ? 100.740 115.518 152.373 1.00 93.67  ? 32  DG  I OP2   1 
ATOM 89   O "O5'" . DG  A 1 32  ? 99.890  115.826 154.711 1.00 93.67  ? 32  DG  I "O5'" 1 
ATOM 90   C "C5'" . DG  A 1 32  ? 98.768  115.591 155.596 1.00 93.67  ? 32  DG  I "C5'" 1 
ATOM 91   C "C4'" . DG  A 1 32  ? 99.228  115.170 156.983 1.00 93.67  ? 32  DG  I "C4'" 1 
ATOM 92   O "O4'" . DG  A 1 32  ? 100.519 114.577 156.920 1.00 93.67  ? 32  DG  I "O4'" 1 
ATOM 93   C "C3'" . DG  A 1 32  ? 99.329  116.278 158.025 1.00 93.67  ? 32  DG  I "C3'" 1 
ATOM 94   O "O3'" . DG  A 1 32  ? 98.049  116.404 158.648 1.00 93.67  ? 32  DG  I "O3'" 1 
ATOM 95   C "C2'" . DG  A 1 32  ? 100.398 115.762 158.998 1.00 93.67  ? 32  DG  I "C2'" 1 
ATOM 96   C "C1'" . DG  A 1 32  ? 101.205 114.779 158.138 1.00 93.67  ? 32  DG  I "C1'" 1 
ATOM 97   N N9    . DG  A 1 32  ? 102.588 115.067 157.796 1.00 93.67  ? 32  DG  I N9    1 
ATOM 98   C C8    . DG  A 1 32  ? 103.034 115.614 156.623 1.00 93.67  ? 32  DG  I C8    1 
ATOM 99   N N7    . DG  A 1 32  ? 104.331 115.628 156.515 1.00 93.67  ? 32  DG  I N7    1 
ATOM 100  C C5    . DG  A 1 32  ? 104.772 114.982 157.652 1.00 93.67  ? 32  DG  I C5    1 
ATOM 101  C C6    . DG  A 1 32  ? 106.085 114.694 158.079 1.00 93.67  ? 32  DG  I C6    1 
ATOM 102  O O6    . DG  A 1 32  ? 107.152 114.956 157.509 1.00 93.67  ? 32  DG  I O6    1 
ATOM 103  N N1    . DG  A 1 32  ? 106.091 114.026 159.299 1.00 93.67  ? 32  DG  I N1    1 
ATOM 104  C C2    . DG  A 1 32  ? 104.969 113.686 160.017 1.00 93.67  ? 32  DG  I C2    1 
ATOM 105  N N2    . DG  A 1 32  ? 105.172 113.045 161.175 1.00 93.67  ? 32  DG  I N2    1 
ATOM 106  N N3    . DG  A 1 32  ? 103.732 113.952 159.626 1.00 93.67  ? 32  DG  I N3    1 
ATOM 107  C C4    . DG  A 1 32  ? 103.709 114.600 158.439 1.00 93.67  ? 32  DG  I C4    1 
ATOM 108  P P     . DA  A 1 33  ? 97.488  117.832 159.106 1.00 91.86  ? 33  DA  I P     1 
ATOM 109  O OP1   . DA  A 1 33  ? 96.012  117.752 159.146 1.00 91.86  ? 33  DA  I OP1   1 
ATOM 110  O OP2   . DA  A 1 33  ? 98.163  118.883 158.314 1.00 91.86  ? 33  DA  I OP2   1 
ATOM 111  O "O5'" . DA  A 1 33  ? 98.031  117.915 160.602 1.00 91.86  ? 33  DA  I "O5'" 1 
ATOM 112  C "C5'" . DA  A 1 33  ? 99.212  118.603 160.868 1.00 91.86  ? 33  DA  I "C5'" 1 
ATOM 113  C "C4'" . DA  A 1 33  ? 99.578  118.510 162.333 1.00 91.86  ? 33  DA  I "C4'" 1 
ATOM 114  O "O4'" . DA  A 1 33  ? 100.929 118.018 162.442 1.00 91.86  ? 33  DA  I "O4'" 1 
ATOM 115  C "C3'" . DA  A 1 33  ? 99.589  119.821 163.069 1.00 91.86  ? 33  DA  I "C3'" 1 
ATOM 116  O "O3'" . DA  A 1 33  ? 99.557  119.560 164.462 1.00 91.86  ? 33  DA  I "O3'" 1 
ATOM 117  C "C2'" . DA  A 1 33  ? 100.941 120.373 162.620 1.00 91.86  ? 33  DA  I "C2'" 1 
ATOM 118  C "C1'" . DA  A 1 33  ? 101.801 119.108 162.665 1.00 91.86  ? 33  DA  I "C1'" 1 
ATOM 119  N N9    . DA  A 1 33  ? 102.795 119.025 161.605 1.00 91.86  ? 33  DA  I N9    1 
ATOM 120  C C8    . DA  A 1 33  ? 102.605 119.296 160.280 1.00 91.86  ? 33  DA  I C8    1 
ATOM 121  N N7    . DA  A 1 33  ? 103.673 119.116 159.544 1.00 91.86  ? 33  DA  I N7    1 
ATOM 122  C C5    . DA  A 1 33  ? 104.637 118.721 160.453 1.00 91.86  ? 33  DA  I C5    1 
ATOM 123  C C6    . DA  A 1 33  ? 105.994 118.387 160.308 1.00 91.86  ? 33  DA  I C6    1 
ATOM 124  N N6    . DA  A 1 33  ? 106.635 118.401 159.137 1.00 91.86  ? 33  DA  I N6    1 
ATOM 125  N N1    . DA  A 1 33  ? 106.670 118.036 161.416 1.00 91.86  ? 33  DA  I N1    1 
ATOM 126  C C2    . DA  A 1 33  ? 106.028 118.020 162.589 1.00 91.86  ? 33  DA  I C2    1 
ATOM 127  N N3    . DA  A 1 33  ? 104.757 118.313 162.850 1.00 91.86  ? 33  DA  I N3    1 
ATOM 128  C C4    . DA  A 1 33  ? 104.111 118.659 161.729 1.00 91.86  ? 33  DA  I C4    1 
ATOM 129  P P     . DC  A 1 34  ? 99.549  120.769 165.511 1.00 89.57  ? 34  DC  I P     1 
ATOM 130  O OP1   . DC  A 1 34  ? 98.893  120.287 166.748 1.00 89.57  ? 34  DC  I OP1   1 
ATOM 131  O OP2   . DC  A 1 34  ? 99.014  121.958 164.815 1.00 89.57  ? 34  DC  I OP2   1 
ATOM 132  O "O5'" . DC  A 1 34  ? 101.103 121.010 165.790 1.00 89.57  ? 34  DC  I "O5'" 1 
ATOM 133  C "C5'" . DC  A 1 34  ? 101.596 122.326 165.828 1.00 89.57  ? 34  DC  I "C5'" 1 
ATOM 134  C "C4'" . DC  A 1 34  ? 103.097 122.358 166.034 1.00 89.57  ? 34  DC  I "C4'" 1 
ATOM 135  O "O4'" . DC  A 1 34  ? 103.736 121.762 164.885 1.00 89.57  ? 34  DC  I "O4'" 1 
ATOM 136  C "C3'" . DC  A 1 34  ? 103.661 123.774 166.132 1.00 89.57  ? 34  DC  I "C3'" 1 
ATOM 137  O "O3'" . DC  A 1 34  ? 104.025 124.134 167.505 1.00 89.57  ? 34  DC  I "O3'" 1 
ATOM 138  C "C2'" . DC  A 1 34  ? 104.807 123.825 165.104 1.00 89.57  ? 34  DC  I "C2'" 1 
ATOM 139  C "C1'" . DC  A 1 34  ? 104.988 122.361 164.706 1.00 89.57  ? 34  DC  I "C1'" 1 
ATOM 140  N N1    . DC  A 1 34  ? 105.329 122.208 163.270 1.00 89.57  ? 34  DC  I N1    1 
ATOM 141  C C2    . DC  A 1 34  ? 106.631 121.873 162.867 1.00 89.57  ? 34  DC  I C2    1 
ATOM 142  O O2    . DC  A 1 34  ? 107.524 121.750 163.714 1.00 89.57  ? 34  DC  I O2    1 
ATOM 143  N N3    . DC  A 1 34  ? 106.886 121.745 161.539 1.00 89.57  ? 34  DC  I N3    1 
ATOM 144  C C4    . DC  A 1 34  ? 105.905 121.900 160.651 1.00 89.57  ? 34  DC  I C4    1 
ATOM 145  N N4    . DC  A 1 34  ? 106.197 121.750 159.359 1.00 89.57  ? 34  DC  I N4    1 
ATOM 146  C C5    . DC  A 1 34  ? 104.577 122.207 161.047 1.00 89.57  ? 34  DC  I C5    1 
ATOM 147  C C6    . DC  A 1 34  ? 104.335 122.340 162.350 1.00 89.57  ? 34  DC  I C6    1 
ATOM 148  P P     . DT  A 1 35  ? 105.376 123.671 168.256 1.00 85.30  ? 35  DT  I P     1 
ATOM 149  O OP1   . DT  A 1 35  ? 106.239 122.783 167.454 1.00 85.30  ? 35  DT  I OP1   1 
ATOM 150  O OP2   . DT  A 1 35  ? 104.937 123.195 169.584 1.00 85.30  ? 35  DT  I OP2   1 
ATOM 151  O "O5'" . DT  A 1 35  ? 106.143 125.058 168.476 1.00 85.30  ? 35  DT  I "O5'" 1 
ATOM 152  C "C5'" . DT  A 1 35  ? 106.662 125.779 167.365 1.00 85.30  ? 35  DT  I "C5'" 1 
ATOM 153  C "C4'" . DT  A 1 35  ? 108.118 125.429 167.113 1.00 85.30  ? 35  DT  I "C4'" 1 
ATOM 154  O "O4'" . DT  A 1 35  ? 108.238 124.710 165.870 1.00 85.30  ? 35  DT  I "O4'" 1 
ATOM 155  C "C3'" . DT  A 1 35  ? 109.042 126.639 167.018 1.00 85.30  ? 35  DT  I "C3'" 1 
ATOM 156  O "O3'" . DT  A 1 35  ? 110.044 126.627 168.065 1.00 85.30  ? 35  DT  I "O3'" 1 
ATOM 157  C "C2'" . DT  A 1 35  ? 109.619 126.617 165.593 1.00 85.30  ? 35  DT  I "C2'" 1 
ATOM 158  C "C1'" . DT  A 1 35  ? 109.293 125.223 165.082 1.00 85.30  ? 35  DT  I "C1'" 1 
ATOM 159  N N1    . DT  A 1 35  ? 108.820 125.175 163.669 1.00 85.30  ? 35  DT  I N1    1 
ATOM 160  C C2    . DT  A 1 35  ? 109.700 124.873 162.649 1.00 85.30  ? 35  DT  I C2    1 
ATOM 161  O O2    . DT  A 1 35  ? 110.892 124.701 162.822 1.00 85.30  ? 35  DT  I O2    1 
ATOM 162  N N3    . DT  A 1 35  ? 109.124 124.814 161.402 1.00 85.30  ? 35  DT  I N3    1 
ATOM 163  C C4    . DT  A 1 35  ? 107.785 124.997 161.092 1.00 85.30  ? 35  DT  I C4    1 
ATOM 164  O O4    . DT  A 1 35  ? 107.354 124.922 159.950 1.00 85.30  ? 35  DT  I O4    1 
ATOM 165  C C5    . DT  A 1 35  ? 106.926 125.285 162.209 1.00 85.30  ? 35  DT  I C5    1 
ATOM 166  C C7    . DT  A 1 35  ? 105.460 125.506 161.991 1.00 85.30  ? 35  DT  I C7    1 
ATOM 167  C C6    . DT  A 1 35  ? 107.475 125.348 163.425 1.00 85.30  ? 35  DT  I C6    1 
ATOM 168  P P     . DA  A 1 36  ? 111.333 125.658 168.064 1.00 82.21  ? 36  DA  I P     1 
ATOM 169  O OP1   . DA  A 1 36  ? 110.964 124.312 167.577 1.00 82.21  ? 36  DA  I OP1   1 
ATOM 170  O OP2   . DA  A 1 36  ? 111.949 125.785 169.403 1.00 82.21  ? 36  DA  I OP2   1 
ATOM 171  O "O5'" . DA  A 1 36  ? 112.340 126.342 167.033 1.00 82.21  ? 36  DA  I "O5'" 1 
ATOM 172  C "C5'" . DA  A 1 36  ? 112.683 127.698 167.198 1.00 82.21  ? 36  DA  I "C5'" 1 
ATOM 173  C "C4'" . DA  A 1 36  ? 113.534 128.191 166.044 1.00 82.21  ? 36  DA  I "C4'" 1 
ATOM 174  O "O4'" . DA  A 1 36  ? 112.830 128.027 164.790 1.00 82.21  ? 36  DA  I "O4'" 1 
ATOM 175  C "C3'" . DA  A 1 36  ? 113.912 129.653 166.111 1.00 82.21  ? 36  DA  I "C3'" 1 
ATOM 176  O "O3'" . DA  A 1 36  ? 115.149 129.815 165.455 1.00 82.21  ? 36  DA  I "O3'" 1 
ATOM 177  C "C2'" . DA  A 1 36  ? 112.756 130.298 165.337 1.00 82.21  ? 36  DA  I "C2'" 1 
ATOM 178  C "C1'" . DA  A 1 36  ? 112.602 129.294 164.205 1.00 82.21  ? 36  DA  I "C1'" 1 
ATOM 179  N N9    . DA  A 1 36  ? 111.269 129.202 163.631 1.00 82.21  ? 36  DA  I N9    1 
ATOM 180  C C8    . DA  A 1 36  ? 110.084 129.525 164.228 1.00 82.21  ? 36  DA  I C8    1 
ATOM 181  N N7    . DA  A 1 36  ? 109.034 129.291 163.476 1.00 82.21  ? 36  DA  I N7    1 
ATOM 182  C C5    . DA  A 1 36  ? 109.573 128.823 162.289 1.00 82.21  ? 36  DA  I C5    1 
ATOM 183  C C6    . DA  A 1 36  ? 108.988 128.416 161.076 1.00 82.21  ? 36  DA  I C6    1 
ATOM 184  N N6    . DA  A 1 36  ? 107.671 128.420 160.858 1.00 82.21  ? 36  DA  I N6    1 
ATOM 185  N N1    . DA  A 1 36  ? 109.813 128.003 160.092 1.00 82.21  ? 36  DA  I N1    1 
ATOM 186  C C2    . DA  A 1 36  ? 111.132 128.000 160.315 1.00 82.21  ? 36  DA  I C2    1 
ATOM 187  N N3    . DA  A 1 36  ? 111.797 128.358 161.411 1.00 82.21  ? 36  DA  I N3    1 
ATOM 188  C C4    . DA  A 1 36  ? 110.950 128.763 162.369 1.00 82.21  ? 36  DA  I C4    1 
ATOM 189  P P     . DG  A 1 37  ? 116.146 130.992 165.882 1.00 78.35  ? 37  DG  I P     1 
ATOM 190  O OP1   . DG  A 1 37  ? 117.365 130.360 166.435 1.00 78.35  ? 37  DG  I OP1   1 
ATOM 191  O OP2   . DG  A 1 37  ? 115.383 131.968 166.693 1.00 78.35  ? 37  DG  I OP2   1 
ATOM 192  O "O5'" . DG  A 1 37  ? 116.511 131.676 164.491 1.00 78.35  ? 37  DG  I "O5'" 1 
ATOM 193  C "C5'" . DG  A 1 37  ? 115.488 132.008 163.572 1.00 78.35  ? 37  DG  I "C5'" 1 
ATOM 194  C "C4'" . DG  A 1 37  ? 115.917 131.653 162.161 1.00 78.35  ? 37  DG  I "C4'" 1 
ATOM 195  O "O4'" . DG  A 1 37  ? 114.807 131.067 161.423 1.00 78.35  ? 37  DG  I "O4'" 1 
ATOM 196  C "C3'" . DG  A 1 37  ? 116.391 132.829 161.317 1.00 78.35  ? 37  DG  I "C3'" 1 
ATOM 197  O "O3'" . DG  A 1 37  ? 117.500 132.403 160.554 1.00 78.35  ? 37  DG  I "O3'" 1 
ATOM 198  C "C2'" . DG  A 1 37  ? 115.175 133.123 160.442 1.00 78.35  ? 37  DG  I "C2'" 1 
ATOM 199  C "C1'" . DG  A 1 37  ? 114.723 131.715 160.172 1.00 78.35  ? 37  DG  I "C1'" 1 
ATOM 200  N N9    . DG  A 1 37  ? 113.360 131.579 159.670 1.00 78.35  ? 37  DG  I N9    1 
ATOM 201  C C8    . DG  A 1 37  ? 112.973 131.019 158.477 1.00 78.35  ? 37  DG  I C8    1 
ATOM 202  N N7    . DG  A 1 37  ? 111.681 130.958 158.325 1.00 78.35  ? 37  DG  I N7    1 
ATOM 203  C C5    . DG  A 1 37  ? 111.177 131.427 159.528 1.00 78.35  ? 37  DG  I C5    1 
ATOM 204  C C6    . DG  A 1 37  ? 109.839 131.570 159.960 1.00 78.35  ? 37  DG  I C6    1 
ATOM 205  O O6    . DG  A 1 37  ? 108.802 131.303 159.341 1.00 78.35  ? 37  DG  I O6    1 
ATOM 206  N N1    . DG  A 1 37  ? 109.766 132.082 161.253 1.00 78.35  ? 37  DG  I N1    1 
ATOM 207  C C2    . DG  A 1 37  ? 110.850 132.414 162.029 1.00 78.35  ? 37  DG  I C2    1 
ATOM 208  N N2    . DG  A 1 37  ? 110.581 132.895 163.253 1.00 78.35  ? 37  DG  I N2    1 
ATOM 209  N N3    . DG  A 1 37  ? 112.111 132.284 161.636 1.00 78.35  ? 37  DG  I N3    1 
ATOM 210  C C4    . DG  A 1 37  ? 112.198 131.787 160.379 1.00 78.35  ? 37  DG  I C4    1 
ATOM 211  P P     . DG  A 1 38  ? 118.567 133.466 160.012 1.00 73.66  ? 38  DG  I P     1 
ATOM 212  O OP1   . DG  A 1 38  ? 119.800 133.305 160.814 1.00 73.66  ? 38  DG  I OP1   1 
ATOM 213  O OP2   . DG  A 1 38  ? 117.899 134.783 159.948 1.00 73.66  ? 38  DG  I OP2   1 
ATOM 214  O "O5'" . DG  A 1 38  ? 118.856 132.999 158.514 1.00 73.66  ? 38  DG  I "O5'" 1 
ATOM 215  C "C5'" . DG  A 1 38  ? 117.966 132.115 157.817 1.00 73.66  ? 38  DG  I "C5'" 1 
ATOM 216  C "C4'" . DG  A 1 38  ? 117.229 132.889 156.743 1.00 73.66  ? 38  DG  I "C4'" 1 
ATOM 217  O "O4'" . DG  A 1 38  ? 115.890 133.208 157.156 1.00 73.66  ? 38  DG  I "O4'" 1 
ATOM 218  C "C3'" . DG  A 1 38  ? 117.888 134.196 156.345 1.00 73.66  ? 38  DG  I "C3'" 1 
ATOM 219  O "O3'" . DG  A 1 38  ? 118.276 134.096 154.969 1.00 73.66  ? 38  DG  I "O3'" 1 
ATOM 220  C "C2'" . DG  A 1 38  ? 116.825 135.287 156.677 1.00 73.66  ? 38  DG  I "C2'" 1 
ATOM 221  C "C1'" . DG  A 1 38  ? 115.540 134.476 156.655 1.00 73.66  ? 38  DG  I "C1'" 1 
ATOM 222  N N9    . DG  A 1 38  ? 114.461 134.911 157.534 1.00 73.66  ? 38  DG  I N9    1 
ATOM 223  C C8    . DG  A 1 38  ? 114.552 135.683 158.663 1.00 73.66  ? 38  DG  I C8    1 
ATOM 224  N N7    . DG  A 1 38  ? 113.401 135.872 159.255 1.00 73.66  ? 38  DG  I N7    1 
ATOM 225  C C5    . DG  A 1 38  ? 112.481 135.283 158.398 1.00 73.66  ? 38  DG  I C5    1 
ATOM 226  C C6    . DG  A 1 38  ? 111.066 135.207 158.473 1.00 73.66  ? 38  DG  I C6    1 
ATOM 227  O O6    . DG  A 1 38  ? 110.302 135.646 159.345 1.00 73.66  ? 38  DG  I O6    1 
ATOM 228  N N1    . DG  A 1 38  ? 110.534 134.516 157.394 1.00 73.66  ? 38  DG  I N1    1 
ATOM 229  C C2    . DG  A 1 38  ? 111.260 133.966 156.370 1.00 73.66  ? 38  DG  I C2    1 
ATOM 230  N N2    . DG  A 1 38  ? 110.551 133.352 155.413 1.00 73.66  ? 38  DG  I N2    1 
ATOM 231  N N3    . DG  A 1 38  ? 112.579 134.033 156.280 1.00 73.66  ? 38  DG  I N3    1 
ATOM 232  C C4    . DG  A 1 38  ? 113.121 134.703 157.326 1.00 73.66  ? 38  DG  I C4    1 
ATOM 233  P P     . DG  A 1 39  ? 117.589 134.970 153.820 1.00 67.76  ? 39  DG  I P     1 
ATOM 234  O OP1   . DG  A 1 39  ? 118.011 136.381 153.952 1.00 67.76  ? 39  DG  I OP1   1 
ATOM 235  O OP2   . DG  A 1 39  ? 116.171 134.566 153.782 1.00 67.76  ? 39  DG  I OP2   1 
ATOM 236  O "O5'" . DG  A 1 39  ? 118.160 134.352 152.465 1.00 67.76  ? 39  DG  I "O5'" 1 
ATOM 237  C "C5'" . DG  A 1 39  ? 117.852 134.994 151.253 1.00 67.76  ? 39  DG  I "C5'" 1 
ATOM 238  C "C4'" . DG  A 1 39  ? 116.808 134.268 150.411 1.00 67.76  ? 39  DG  I "C4'" 1 
ATOM 239  O "O4'" . DG  A 1 39  ? 115.518 134.236 151.088 1.00 67.76  ? 39  DG  I "O4'" 1 
ATOM 240  C "C3'" . DG  A 1 39  ? 116.492 134.952 149.121 1.00 67.76  ? 39  DG  I "C3'" 1 
ATOM 241  O "O3'" . DG  A 1 39  ? 115.796 134.012 148.305 1.00 67.76  ? 39  DG  I "O3'" 1 
ATOM 242  C "C2'" . DG  A 1 39  ? 115.610 136.106 149.621 1.00 67.76  ? 39  DG  I "C2'" 1 
ATOM 243  C "C1'" . DG  A 1 39  ? 114.785 135.393 150.687 1.00 67.76  ? 39  DG  I "C1'" 1 
ATOM 244  N N9    . DG  A 1 39  ? 114.506 136.099 151.940 1.00 67.76  ? 39  DG  I N9    1 
ATOM 245  C C8    . DG  A 1 39  ? 115.349 136.924 152.631 1.00 67.76  ? 39  DG  I C8    1 
ATOM 246  N N7    . DG  A 1 39  ? 114.834 137.392 153.731 1.00 67.76  ? 39  DG  I N7    1 
ATOM 247  C C5    . DG  A 1 39  ? 113.513 136.987 153.682 1.00 67.76  ? 39  DG  I C5    1 
ATOM 248  C C6    . DG  A 1 39  ? 112.447 137.255 154.567 1.00 67.76  ? 39  DG  I C6    1 
ATOM 249  O O6    . DG  A 1 39  ? 112.464 137.926 155.607 1.00 67.76  ? 39  DG  I O6    1 
ATOM 250  N N1    . DG  A 1 39  ? 111.268 136.656 154.146 1.00 67.76  ? 39  DG  I N1    1 
ATOM 251  C C2    . DG  A 1 39  ? 111.137 135.893 153.014 1.00 67.76  ? 39  DG  I C2    1 
ATOM 252  N N2    . DG  A 1 39  ? 109.916 135.396 152.773 1.00 67.76  ? 39  DG  I N2    1 
ATOM 253  N N3    . DG  A 1 39  ? 112.129 135.633 152.174 1.00 67.76  ? 39  DG  I N3    1 
ATOM 254  C C4    . DG  A 1 39  ? 113.285 136.211 152.570 1.00 67.76  ? 39  DG  I C4    1 
ATOM 255  P P     . DA  A 1 40  ? 115.135 134.425 146.906 1.00 64.76  ? 40  DA  I P     1 
ATOM 256  O OP1   . DA  A 1 40  ? 115.197 133.242 146.029 1.00 64.76  ? 40  DA  I OP1   1 
ATOM 257  O OP2   . DA  A 1 40  ? 115.752 135.692 146.460 1.00 64.76  ? 40  DA  I OP2   1 
ATOM 258  O "O5'" . DA  A 1 40  ? 113.621 134.741 147.284 1.00 64.76  ? 40  DA  I "O5'" 1 
ATOM 259  C "C5'" . DA  A 1 40  ? 112.844 135.503 146.409 1.00 64.76  ? 40  DA  I "C5'" 1 
ATOM 260  C "C4'" . DA  A 1 40  ? 111.547 135.931 147.058 1.00 64.76  ? 40  DA  I "C4'" 1 
ATOM 261  O "O4'" . DA  A 1 40  ? 111.796 136.383 148.409 1.00 64.76  ? 40  DA  I "O4'" 1 
ATOM 262  C "C3'" . DA  A 1 40  ? 110.836 137.068 146.353 1.00 64.76  ? 40  DA  I "C3'" 1 
ATOM 263  O "O3'" . DA  A 1 40  ? 109.436 136.829 146.390 1.00 64.76  ? 40  DA  I "O3'" 1 
ATOM 264  C "C2'" . DA  A 1 40  ? 111.248 138.282 147.198 1.00 64.76  ? 40  DA  I "C2'" 1 
ATOM 265  C "C1'" . DA  A 1 40  ? 111.235 137.663 148.581 1.00 64.76  ? 40  DA  I "C1'" 1 
ATOM 266  N N9    . DA  A 1 40  ? 112.052 138.332 149.590 1.00 64.76  ? 40  DA  I N9    1 
ATOM 267  C C8    . DA  A 1 40  ? 113.391 138.584 149.523 1.00 64.76  ? 40  DA  I C8    1 
ATOM 268  N N7    . DA  A 1 40  ? 113.875 139.171 150.589 1.00 64.76  ? 40  DA  I N7    1 
ATOM 269  C C5    . DA  A 1 40  ? 112.769 139.351 151.399 1.00 64.76  ? 40  DA  I C5    1 
ATOM 270  C C6    . DA  A 1 40  ? 112.611 139.937 152.667 1.00 64.76  ? 40  DA  I C6    1 
ATOM 271  N N6    . DA  A 1 40  ? 113.620 140.467 153.363 1.00 64.76  ? 40  DA  I N6    1 
ATOM 272  N N1    . DA  A 1 40  ? 111.374 139.954 153.197 1.00 64.76  ? 40  DA  I N1    1 
ATOM 273  C C2    . DA  A 1 40  ? 110.367 139.421 152.498 1.00 64.76  ? 40  DA  I C2    1 
ATOM 274  N N3    . DA  A 1 40  ? 110.393 138.843 151.298 1.00 64.76  ? 40  DA  I N3    1 
ATOM 275  C C4    . DA  A 1 40  ? 111.635 138.842 150.799 1.00 64.76  ? 40  DA  I C4    1 
ATOM 276  P P     . DG  A 1 41  ? 108.518 137.333 145.177 1.00 65.54  ? 41  DG  I P     1 
ATOM 277  O OP1   . DG  A 1 41  ? 108.006 136.123 144.500 1.00 65.54  ? 41  DG  I OP1   1 
ATOM 278  O OP2   . DG  A 1 41  ? 109.289 138.335 144.412 1.00 65.54  ? 41  DG  I OP2   1 
ATOM 279  O "O5'" . DG  A 1 41  ? 107.292 138.078 145.878 1.00 65.54  ? 41  DG  I "O5'" 1 
ATOM 280  C "C5'" . DG  A 1 41  ? 106.478 137.419 146.853 1.00 65.54  ? 41  DG  I "C5'" 1 
ATOM 281  C "C4'" . DG  A 1 41  ? 105.827 138.452 147.753 1.00 65.54  ? 41  DG  I "C4'" 1 
ATOM 282  O "O4'" . DG  A 1 41  ? 106.799 139.030 148.644 1.00 65.54  ? 41  DG  I "O4'" 1 
ATOM 283  C "C3'" . DG  A 1 41  ? 105.145 139.595 147.030 1.00 65.54  ? 41  DG  I "C3'" 1 
ATOM 284  O "O3'" . DG  A 1 41  ? 103.871 139.801 147.639 1.00 65.54  ? 41  DG  I "O3'" 1 
ATOM 285  C "C2'" . DG  A 1 41  ? 106.125 140.776 147.234 1.00 65.54  ? 41  DG  I "C2'" 1 
ATOM 286  C "C1'" . DG  A 1 41  ? 106.731 140.434 148.588 1.00 65.54  ? 41  DG  I "C1'" 1 
ATOM 287  N N9    . DG  A 1 41  ? 108.110 140.855 148.828 1.00 65.54  ? 41  DG  I N9    1 
ATOM 288  C C8    . DG  A 1 41  ? 109.178 140.670 147.994 1.00 65.54  ? 41  DG  I C8    1 
ATOM 289  N N7    . DG  A 1 41  ? 110.303 141.108 148.480 1.00 65.54  ? 41  DG  I N7    1 
ATOM 290  C C5    . DG  A 1 41  ? 109.948 141.692 149.684 1.00 65.54  ? 41  DG  I C5    1 
ATOM 291  C C6    . DG  A 1 41  ? 110.745 142.364 150.636 1.00 65.54  ? 41  DG  I C6    1 
ATOM 292  O O6    . DG  A 1 41  ? 111.963 142.581 150.598 1.00 65.54  ? 41  DG  I O6    1 
ATOM 293  N N1    . DG  A 1 41  ? 109.993 142.806 151.718 1.00 65.54  ? 41  DG  I N1    1 
ATOM 294  C C2    . DG  A 1 41  ? 108.636 142.618 151.862 1.00 65.54  ? 41  DG  I C2    1 
ATOM 295  N N2    . DG  A 1 41  ? 108.080 143.119 152.976 1.00 65.54  ? 41  DG  I N2    1 
ATOM 296  N N3    . DG  A 1 41  ? 107.876 141.988 150.973 1.00 65.54  ? 41  DG  I N3    1 
ATOM 297  C C4    . DG  A 1 41  ? 108.597 141.553 149.913 1.00 65.54  ? 41  DG  I C4    1 
ATOM 298  P P     . DT  A 1 42  ? 102.763 140.724 146.940 1.00 65.91  ? 42  DT  I P     1 
ATOM 299  O OP1   . DT  A 1 42  ? 101.429 140.225 147.340 1.00 65.91  ? 42  DT  I OP1   1 
ATOM 300  O OP2   . DT  A 1 42  ? 103.111 140.822 145.507 1.00 65.91  ? 42  DT  I OP2   1 
ATOM 301  O "O5'" . DT  A 1 42  ? 102.995 142.157 147.593 1.00 65.91  ? 42  DT  I "O5'" 1 
ATOM 302  C "C5'" . DT  A 1 42  ? 103.045 142.319 149.020 1.00 65.91  ? 42  DT  I "C5'" 1 
ATOM 303  C "C4'" . DT  A 1 42  ? 103.440 143.745 149.319 1.00 65.91  ? 42  DT  I "C4'" 1 
ATOM 304  O "O4'" . DT  A 1 42  ? 104.880 143.860 149.395 1.00 65.91  ? 42  DT  I "O4'" 1 
ATOM 305  C "C3'" . DT  A 1 42  ? 102.969 144.760 148.280 1.00 65.91  ? 42  DT  I "C3'" 1 
ATOM 306  O "O3'" . DT  A 1 42  ? 102.347 145.853 148.955 1.00 65.91  ? 42  DT  I "O3'" 1 
ATOM 307  C "C2'" . DT  A 1 42  ? 104.266 145.163 147.567 1.00 65.91  ? 42  DT  I "C2'" 1 
ATOM 308  C "C1'" . DT  A 1 42  ? 105.253 145.018 148.706 1.00 65.91  ? 42  DT  I "C1'" 1 
ATOM 309  N N1    . DT  A 1 42  ? 106.688 144.900 148.325 1.00 65.91  ? 42  DT  I N1    1 
ATOM 310  C C2    . DT  A 1 42  ? 107.647 145.333 149.207 1.00 65.91  ? 42  DT  I C2    1 
ATOM 311  O O2    . DT  A 1 42  ? 107.386 146.014 150.183 1.00 65.91  ? 42  DT  I O2    1 
ATOM 312  N N3    . DT  A 1 42  ? 108.936 145.134 148.798 1.00 65.91  ? 42  DT  I N3    1 
ATOM 313  C C4    . DT  A 1 42  ? 109.352 144.423 147.688 1.00 65.91  ? 42  DT  I C4    1 
ATOM 314  O O4    . DT  A 1 42  ? 110.536 144.258 147.418 1.00 65.91  ? 42  DT  I O4    1 
ATOM 315  C C5    . DT  A 1 42  ? 108.293 143.888 146.867 1.00 65.91  ? 42  DT  I C5    1 
ATOM 316  C C7    . DT  A 1 42  ? 108.622 143.100 145.635 1.00 65.91  ? 42  DT  I C7    1 
ATOM 317  C C6    . DT  A 1 42  ? 107.027 144.121 147.241 1.00 65.91  ? 42  DT  I C6    1 
ATOM 318  P P     . DA  A 1 43  ? 100.804 146.207 148.678 1.00 64.16  ? 43  DA  I P     1 
ATOM 319  O OP1   . DA  A 1 43  ? 99.982  145.344 149.554 1.00 64.16  ? 43  DA  I OP1   1 
ATOM 320  O OP2   . DA  A 1 43  ? 100.596 146.178 147.214 1.00 64.16  ? 43  DA  I OP2   1 
ATOM 321  O "O5'" . DA  A 1 43  ? 100.658 147.727 149.160 1.00 64.16  ? 43  DA  I "O5'" 1 
ATOM 322  C "C5'" . DA  A 1 43  ? 101.394 148.747 148.514 1.00 64.16  ? 43  DA  I "C5'" 1 
ATOM 323  C "C4'" . DA  A 1 43  ? 102.533 149.240 149.394 1.00 64.16  ? 43  DA  I "C4'" 1 
ATOM 324  O "O4'" . DA  A 1 43  ? 103.736 148.542 149.071 1.00 64.16  ? 43  DA  I "O4'" 1 
ATOM 325  C "C3'" . DA  A 1 43  ? 102.859 150.727 149.265 1.00 64.16  ? 43  DA  I "C3'" 1 
ATOM 326  O "O3'" . DA  A 1 43  ? 102.439 151.417 150.442 1.00 64.16  ? 43  DA  I "O3'" 1 
ATOM 327  C "C2'" . DA  A 1 43  ? 104.391 150.781 149.079 1.00 64.16  ? 43  DA  I "C2'" 1 
ATOM 328  C "C1'" . DA  A 1 43  ? 104.826 149.359 149.393 1.00 64.16  ? 43  DA  I "C1'" 1 
ATOM 329  N N9    . DA  A 1 43  ? 105.974 148.845 148.647 1.00 64.16  ? 43  DA  I N9    1 
ATOM 330  C C8    . DA  A 1 43  ? 105.916 147.998 147.584 1.00 64.16  ? 43  DA  I C8    1 
ATOM 331  N N7    . DA  A 1 43  ? 107.081 147.647 147.115 1.00 64.16  ? 43  DA  I N7    1 
ATOM 332  C C5    . DA  A 1 43  ? 107.977 148.339 147.900 1.00 64.16  ? 43  DA  I C5    1 
ATOM 333  C C6    . DA  A 1 43  ? 109.376 148.400 147.884 1.00 64.16  ? 43  DA  I C6    1 
ATOM 334  N N6    . DA  A 1 43  ? 110.118 147.723 147.009 1.00 64.16  ? 43  DA  I N6    1 
ATOM 335  N N1    . DA  A 1 43  ? 109.982 149.184 148.796 1.00 64.16  ? 43  DA  I N1    1 
ATOM 336  C C2    . DA  A 1 43  ? 109.220 149.865 149.669 1.00 64.16  ? 43  DA  I C2    1 
ATOM 337  N N3    . DA  A 1 43  ? 107.886 149.880 149.785 1.00 64.16  ? 43  DA  I N3    1 
ATOM 338  C C4    . DA  A 1 43  ? 107.319 149.088 148.858 1.00 64.16  ? 43  DA  I C4    1 
ATOM 339  P P     . DA  A 1 44  ? 101.933 152.936 150.341 1.00 60.19  ? 44  DA  I P     1 
ATOM 340  O OP1   . DA  A 1 44  ? 101.272 153.273 151.620 1.00 60.19  ? 44  DA  I OP1   1 
ATOM 341  O OP2   . DA  A 1 44  ? 101.194 153.081 149.069 1.00 60.19  ? 44  DA  I OP2   1 
ATOM 342  O "O5'" . DA  A 1 44  ? 103.282 153.782 150.213 1.00 60.19  ? 44  DA  I "O5'" 1 
ATOM 343  C "C5'" . DA  A 1 44  ? 104.223 153.844 151.288 1.00 60.19  ? 44  DA  I "C5'" 1 
ATOM 344  C "C4'" . DA  A 1 44  ? 105.515 154.460 150.789 1.00 60.19  ? 44  DA  I "C4'" 1 
ATOM 345  O "O4'" . DA  A 1 44  ? 106.246 153.485 150.028 1.00 60.19  ? 44  DA  I "O4'" 1 
ATOM 346  C "C3'" . DA  A 1 44  ? 105.346 155.676 149.875 1.00 60.19  ? 44  DA  I "C3'" 1 
ATOM 347  O "O3'" . DA  A 1 44  ? 105.965 156.811 150.458 1.00 60.19  ? 44  DA  I "O3'" 1 
ATOM 348  C "C2'" . DA  A 1 44  ? 106.013 155.250 148.554 1.00 60.19  ? 44  DA  I "C2'" 1 
ATOM 349  C "C1'" . DA  A 1 44  ? 106.948 154.146 149.015 1.00 60.19  ? 44  DA  I "C1'" 1 
ATOM 350  N N9    . DA  A 1 44  ? 107.227 153.134 148.003 1.00 60.19  ? 44  DA  I N9    1 
ATOM 351  C C8    . DA  A 1 44  ? 106.308 152.471 147.249 1.00 60.19  ? 44  DA  I C8    1 
ATOM 352  N N7    . DA  A 1 44  ? 106.824 151.597 146.427 1.00 60.19  ? 44  DA  I N7    1 
ATOM 353  C C5    . DA  A 1 44  ? 108.182 151.733 146.613 1.00 60.19  ? 44  DA  I C5    1 
ATOM 354  C C6    . DA  A 1 44  ? 109.277 151.099 146.015 1.00 60.19  ? 44  DA  I C6    1 
ATOM 355  N N6    . DA  A 1 44  ? 109.154 150.165 145.071 1.00 60.19  ? 44  DA  I N6    1 
ATOM 356  N N1    . DA  A 1 44  ? 110.506 151.459 146.424 1.00 60.19  ? 44  DA  I N1    1 
ATOM 357  C C2    . DA  A 1 44  ? 110.624 152.397 147.370 1.00 60.19  ? 44  DA  I C2    1 
ATOM 358  N N3    . DA  A 1 44  ? 109.665 153.066 148.010 1.00 60.19  ? 44  DA  I N3    1 
ATOM 359  C C4    . DA  A 1 44  ? 108.454 152.681 147.579 1.00 60.19  ? 44  DA  I C4    1 
ATOM 360  P P     . DT  A 1 45  ? 105.844 158.247 149.752 1.00 56.65  ? 45  DT  I P     1 
ATOM 361  O OP1   . DT  A 1 45  ? 105.841 159.267 150.825 1.00 56.65  ? 45  DT  I OP1   1 
ATOM 362  O OP2   . DT  A 1 45  ? 104.727 158.189 148.786 1.00 56.65  ? 45  DT  I OP2   1 
ATOM 363  O "O5'" . DT  A 1 45  ? 107.202 158.378 148.922 1.00 56.65  ? 45  DT  I "O5'" 1 
ATOM 364  C "C5'" . DT  A 1 45  ? 108.435 158.428 149.618 1.00 56.65  ? 45  DT  I "C5'" 1 
ATOM 365  C "C4'" . DT  A 1 45  ? 109.616 158.269 148.677 1.00 56.65  ? 45  DT  I "C4'" 1 
ATOM 366  O "O4'" . DT  A 1 45  ? 109.649 156.957 148.111 1.00 56.65  ? 45  DT  I "O4'" 1 
ATOM 367  C "C3'" . DT  A 1 45  ? 109.642 159.210 147.488 1.00 56.65  ? 45  DT  I "C3'" 1 
ATOM 368  O "O3'" . DT  A 1 45  ? 110.222 160.421 147.923 1.00 56.65  ? 45  DT  I "O3'" 1 
ATOM 369  C "C2'" . DT  A 1 45  ? 110.532 158.472 146.481 1.00 56.65  ? 45  DT  I "C2'" 1 
ATOM 370  C "C1'" . DT  A 1 45  ? 110.367 157.001 146.890 1.00 56.65  ? 45  DT  I "C1'" 1 
ATOM 371  N N1    . DT  A 1 45  ? 109.696 156.087 145.929 1.00 56.65  ? 45  DT  I N1    1 
ATOM 372  C C2    . DT  A 1 45  ? 110.462 155.208 145.204 1.00 56.65  ? 45  DT  I C2    1 
ATOM 373  O O2    . DT  A 1 45  ? 111.677 155.201 145.236 1.00 56.65  ? 45  DT  I O2    1 
ATOM 374  N N3    . DT  A 1 45  ? 109.754 154.355 144.404 1.00 56.65  ? 45  DT  I N3    1 
ATOM 375  C C4    . DT  A 1 45  ? 108.382 154.271 144.283 1.00 56.65  ? 45  DT  I C4    1 
ATOM 376  O O4    . DT  A 1 45  ? 107.837 153.467 143.536 1.00 56.65  ? 45  DT  I O4    1 
ATOM 377  C C5    . DT  A 1 45  ? 107.633 155.197 145.097 1.00 56.65  ? 45  DT  I C5    1 
ATOM 378  C C7    . DT  A 1 45  ? 106.134 155.199 145.048 1.00 56.65  ? 45  DT  I C7    1 
ATOM 379  C C6    . DT  A 1 45  ? 108.319 156.040 145.886 1.00 56.65  ? 45  DT  I C6    1 
ATOM 380  P P     . DC  A 1 46  ? 110.541 161.612 146.902 1.00 50.17  ? 46  DC  I P     1 
ATOM 381  O OP1   . DC  A 1 46  ? 110.485 162.883 147.658 1.00 50.17  ? 46  DC  I OP1   1 
ATOM 382  O OP2   . DC  A 1 46  ? 109.706 161.435 145.694 1.00 50.17  ? 46  DC  I OP2   1 
ATOM 383  O "O5'" . DC  A 1 46  ? 112.061 161.318 146.505 1.00 50.17  ? 46  DC  I "O5'" 1 
ATOM 384  C "C5'" . DC  A 1 46  ? 112.579 161.793 145.295 1.00 50.17  ? 46  DC  I "C5'" 1 
ATOM 385  C "C4'" . DC  A 1 46  ? 113.795 160.996 144.851 1.00 50.17  ? 46  DC  I "C4'" 1 
ATOM 386  O "O4'" . DC  A 1 46  ? 113.420 159.636 144.479 1.00 50.17  ? 46  DC  I "O4'" 1 
ATOM 387  C "C3'" . DC  A 1 46  ? 114.495 161.556 143.635 1.00 50.17  ? 46  DC  I "C3'" 1 
ATOM 388  O "O3'" . DC  A 1 46  ? 115.870 161.197 143.685 1.00 50.17  ? 46  DC  I "O3'" 1 
ATOM 389  C "C2'" . DC  A 1 46  ? 113.775 160.866 142.484 1.00 50.17  ? 46  DC  I "C2'" 1 
ATOM 390  C "C1'" . DC  A 1 46  ? 113.575 159.483 143.072 1.00 50.17  ? 46  DC  I "C1'" 1 
ATOM 391  N N1    . DC  A 1 46  ? 112.437 158.672 142.523 1.00 50.17  ? 46  DC  I N1    1 
ATOM 392  C C2    . DC  A 1 46  ? 112.710 157.475 141.852 1.00 50.17  ? 46  DC  I C2    1 
ATOM 393  O O2    . DC  A 1 46  ? 113.882 157.194 141.585 1.00 50.17  ? 46  DC  I O2    1 
ATOM 394  N N3    . DC  A 1 46  ? 111.678 156.722 141.398 1.00 50.17  ? 46  DC  I N3    1 
ATOM 395  C C4    . DC  A 1 46  ? 110.428 157.069 141.684 1.00 50.17  ? 46  DC  I C4    1 
ATOM 396  N N4    . DC  A 1 46  ? 109.435 156.300 141.221 1.00 50.17  ? 46  DC  I N4    1 
ATOM 397  C C5    . DC  A 1 46  ? 110.130 158.248 142.430 1.00 50.17  ? 46  DC  I C5    1 
ATOM 398  C C6    . DC  A 1 46  ? 111.156 158.998 142.849 1.00 50.17  ? 46  DC  I C6    1 
ATOM 399  P P     . DC  A 1 47  ? 116.952 162.151 142.992 1.00 47.19  ? 47  DC  I P     1 
ATOM 400  O OP1   . DC  A 1 47  ? 118.291 161.776 143.498 1.00 47.19  ? 47  DC  I OP1   1 
ATOM 401  O OP2   . DC  A 1 47  ? 116.477 163.548 143.103 1.00 47.19  ? 47  DC  I OP2   1 
ATOM 402  O "O5'" . DC  A 1 47  ? 116.838 161.710 141.472 1.00 47.19  ? 47  DC  I "O5'" 1 
ATOM 403  C "C5'" . DC  A 1 47  ? 117.149 160.379 141.080 1.00 47.19  ? 47  DC  I "C5'" 1 
ATOM 404  C "C4'" . DC  A 1 47  ? 116.679 160.174 139.663 1.00 47.19  ? 47  DC  I "C4'" 1 
ATOM 405  O "O4'" . DC  A 1 47  ? 115.300 159.747 139.656 1.00 47.19  ? 47  DC  I "O4'" 1 
ATOM 406  C "C3'" . DC  A 1 47  ? 116.761 161.421 138.779 1.00 47.19  ? 47  DC  I "C3'" 1 
ATOM 407  O "O3'" . DC  A 1 47  ? 117.381 161.088 137.551 1.00 47.19  ? 47  DC  I "O3'" 1 
ATOM 408  C "C2'" . DC  A 1 47  ? 115.286 161.800 138.586 1.00 47.19  ? 47  DC  I "C2'" 1 
ATOM 409  C "C1'" . DC  A 1 47  ? 114.659 160.422 138.619 1.00 47.19  ? 47  DC  I "C1'" 1 
ATOM 410  N N1    . DC  A 1 47  ? 113.187 160.368 138.825 1.00 47.19  ? 47  DC  I N1    1 
ATOM 411  C C2    . DC  A 1 47  ? 112.524 159.184 138.536 1.00 47.19  ? 47  DC  I C2    1 
ATOM 412  O O2    . DC  A 1 47  ? 113.168 158.260 138.036 1.00 47.19  ? 47  DC  I O2    1 
ATOM 413  N N3    . DC  A 1 47  ? 111.189 159.110 138.728 1.00 47.19  ? 47  DC  I N3    1 
ATOM 414  C C4    . DC  A 1 47  ? 110.537 160.143 139.253 1.00 47.19  ? 47  DC  I C4    1 
ATOM 415  N N4    . DC  A 1 47  ? 109.220 160.017 139.444 1.00 47.19  ? 47  DC  I N4    1 
ATOM 416  C C5    . DC  A 1 47  ? 111.206 161.352 139.607 1.00 47.19  ? 47  DC  I C5    1 
ATOM 417  C C6    . DC  A 1 47  ? 112.525 161.416 139.387 1.00 47.19  ? 47  DC  I C6    1 
ATOM 418  P P     . DC  A 1 48  ? 118.966 161.257 137.379 1.00 44.19  ? 48  DC  I P     1 
ATOM 419  O OP1   . DC  A 1 48  ? 119.559 161.442 138.721 1.00 44.19  ? 48  DC  I OP1   1 
ATOM 420  O OP2   . DC  A 1 48  ? 119.191 162.268 136.324 1.00 44.19  ? 48  DC  I OP2   1 
ATOM 421  O "O5'" . DC  A 1 48  ? 119.437 159.845 136.803 1.00 44.19  ? 48  DC  I "O5'" 1 
ATOM 422  C "C5'" . DC  A 1 48  ? 119.474 159.632 135.406 1.00 44.19  ? 48  DC  I "C5'" 1 
ATOM 423  C "C4'" . DC  A 1 48  ? 118.648 158.422 134.998 1.00 44.19  ? 48  DC  I "C4'" 1 
ATOM 424  O "O4'" . DC  A 1 48  ? 117.279 158.552 135.458 1.00 44.19  ? 48  DC  I "O4'" 1 
ATOM 425  C "C3'" . DC  A 1 48  ? 118.557 158.179 133.499 1.00 44.19  ? 48  DC  I "C3'" 1 
ATOM 426  O "O3'" . DC  A 1 48  ? 118.704 156.790 133.256 1.00 44.19  ? 48  DC  I "O3'" 1 
ATOM 427  C "C2'" . DC  A 1 48  ? 117.162 158.687 133.126 1.00 44.19  ? 48  DC  I "C2'" 1 
ATOM 428  C "C1'" . DC  A 1 48  ? 116.394 158.333 134.372 1.00 44.19  ? 48  DC  I "C1'" 1 
ATOM 429  N N1    . DC  A 1 48  ? 115.140 159.094 134.633 1.00 44.19  ? 48  DC  I N1    1 
ATOM 430  C C2    . DC  A 1 48  ? 113.911 158.444 134.522 1.00 44.19  ? 48  DC  I C2    1 
ATOM 431  O O2    . DC  A 1 48  ? 113.880 157.295 134.072 1.00 44.19  ? 48  DC  I O2    1 
ATOM 432  N N3    . DC  A 1 48  ? 112.779 159.122 134.829 1.00 44.19  ? 48  DC  I N3    1 
ATOM 433  C C4    . DC  A 1 48  ? 112.854 160.364 135.297 1.00 44.19  ? 48  DC  I C4    1 
ATOM 434  N N4    . DC  A 1 48  ? 111.713 160.988 135.601 1.00 44.19  ? 48  DC  I N4    1 
ATOM 435  C C5    . DC  A 1 48  ? 114.100 161.026 135.463 1.00 44.19  ? 48  DC  I C5    1 
ATOM 436  C C6    . DC  A 1 48  ? 115.209 160.350 135.152 1.00 44.19  ? 48  DC  I C6    1 
ATOM 437  P P     . DC  A 1 49  ? 119.275 156.280 131.850 1.00 40.08  ? 49  DC  I P     1 
ATOM 438  O OP1   . DC  A 1 49  ? 119.764 154.896 132.021 1.00 40.08  ? 49  DC  I OP1   1 
ATOM 439  O OP2   . DC  A 1 49  ? 120.187 157.323 131.331 1.00 40.08  ? 49  DC  I OP2   1 
ATOM 440  O "O5'" . DC  A 1 49  ? 117.966 156.262 130.942 1.00 40.08  ? 49  DC  I "O5'" 1 
ATOM 441  C "C5'" . DC  A 1 49  ? 116.842 155.466 131.324 1.00 40.08  ? 49  DC  I "C5'" 1 
ATOM 442  C "C4'" . DC  A 1 49  ? 115.674 155.754 130.409 1.00 40.08  ? 49  DC  I "C4'" 1 
ATOM 443  O "O4'" . DC  A 1 49  ? 114.854 156.820 130.958 1.00 40.08  ? 49  DC  I "O4'" 1 
ATOM 444  C "C3'" . DC  A 1 49  ? 116.060 156.187 129.004 1.00 40.08  ? 49  DC  I "C3'" 1 
ATOM 445  O "O3'" . DC  A 1 49  ? 115.182 155.596 128.084 1.00 40.08  ? 49  DC  I "O3'" 1 
ATOM 446  C "C2'" . DC  A 1 49  ? 115.829 157.694 129.077 1.00 40.08  ? 49  DC  I "C2'" 1 
ATOM 447  C "C1'" . DC  A 1 49  ? 114.576 157.738 129.935 1.00 40.08  ? 49  DC  I "C1'" 1 
ATOM 448  N N1    . DC  A 1 49  ? 114.294 159.066 130.571 1.00 40.08  ? 49  DC  I N1    1 
ATOM 449  C C2    . DC  A 1 49  ? 112.994 159.371 131.005 1.00 40.08  ? 49  DC  I C2    1 
ATOM 450  O O2    . DC  A 1 49  ? 112.090 158.549 130.830 1.00 40.08  ? 49  DC  I O2    1 
ATOM 451  N N3    . DC  A 1 49  ? 112.763 160.565 131.599 1.00 40.08  ? 49  DC  I N3    1 
ATOM 452  C C4    . DC  A 1 49  ? 113.763 161.426 131.773 1.00 40.08  ? 49  DC  I C4    1 
ATOM 453  N N4    . DC  A 1 49  ? 113.488 162.592 132.366 1.00 40.08  ? 49  DC  I N4    1 
ATOM 454  C C5    . DC  A 1 49  ? 115.090 161.131 131.348 1.00 40.08  ? 49  DC  I C5    1 
ATOM 455  C C6    . DC  A 1 49  ? 115.305 159.953 130.756 1.00 40.08  ? 49  DC  I C6    1 
ATOM 456  P P     . DT  A 1 50  ? 115.640 154.327 127.213 1.00 36.28  ? 50  DT  I P     1 
ATOM 457  O OP1   . DT  A 1 50  ? 116.162 153.289 128.125 1.00 36.28  ? 50  DT  I OP1   1 
ATOM 458  O OP2   . DT  A 1 50  ? 116.475 154.810 126.095 1.00 36.28  ? 50  DT  I OP2   1 
ATOM 459  O "O5'" . DT  A 1 50  ? 114.267 153.817 126.595 1.00 36.28  ? 50  DT  I "O5'" 1 
ATOM 460  C "C5'" . DT  A 1 50  ? 113.243 153.366 127.460 1.00 36.28  ? 50  DT  I "C5'" 1 
ATOM 461  C "C4'" . DT  A 1 50  ? 111.925 154.015 127.089 1.00 36.28  ? 50  DT  I "C4'" 1 
ATOM 462  O "O4'" . DT  A 1 50  ? 111.867 155.364 127.612 1.00 36.28  ? 50  DT  I "O4'" 1 
ATOM 463  C "C3'" . DT  A 1 50  ? 111.665 154.134 125.594 1.00 36.28  ? 50  DT  I "C3'" 1 
ATOM 464  O "O3'" . DT  A 1 50  ? 110.471 153.450 125.304 1.00 36.28  ? 50  DT  I "O3'" 1 
ATOM 465  C "C2'" . DT  A 1 50  ? 111.552 155.657 125.350 1.00 36.28  ? 50  DT  I "C2'" 1 
ATOM 466  C "C1'" . DT  A 1 50  ? 111.137 156.163 126.716 1.00 36.28  ? 50  DT  I "C1'" 1 
ATOM 467  N N1    . DT  A 1 50  ? 111.504 157.599 127.010 1.00 36.28  ? 50  DT  I N1    1 
ATOM 468  C C2    . DT  A 1 50  ? 110.569 158.442 127.583 1.00 36.28  ? 50  DT  I C2    1 
ATOM 469  O O2    . DT  A 1 50  ? 109.418 158.119 127.799 1.00 36.28  ? 50  DT  I O2    1 
ATOM 470  N N3    . DT  A 1 50  ? 111.036 159.702 127.856 1.00 36.28  ? 50  DT  I N3    1 
ATOM 471  C C4    . DT  A 1 50  ? 112.300 160.192 127.651 1.00 36.28  ? 50  DT  I C4    1 
ATOM 472  O O4    . DT  A 1 50  ? 112.610 161.343 127.934 1.00 36.28  ? 50  DT  I O4    1 
ATOM 473  C C5    . DT  A 1 50  ? 113.236 159.262 127.083 1.00 36.28  ? 50  DT  I C5    1 
ATOM 474  C C7    . DT  A 1 50  ? 114.641 159.700 126.808 1.00 36.28  ? 50  DT  I C7    1 
ATOM 475  C C6    . DT  A 1 50  ? 112.806 158.018 126.809 1.00 36.28  ? 50  DT  I C6    1 
ATOM 476  P P     . DT  A 1 51  ? 109.941 153.321 123.802 1.00 36.19  ? 51  DT  I P     1 
ATOM 477  O OP1   . DT  A 1 51  ? 109.205 152.047 123.695 1.00 36.19  ? 51  DT  I OP1   1 
ATOM 478  O OP2   . DT  A 1 51  ? 111.063 153.604 122.883 1.00 36.19  ? 51  DT  I OP2   1 
ATOM 479  O "O5'" . DT  A 1 51  ? 108.892 154.507 123.708 1.00 36.19  ? 51  DT  I "O5'" 1 
ATOM 480  C "C5'" . DT  A 1 51  ? 107.698 154.423 124.451 1.00 36.19  ? 51  DT  I "C5'" 1 
ATOM 481  C "C4'" . DT  A 1 51  ? 106.875 155.669 124.252 1.00 36.19  ? 51  DT  I "C4'" 1 
ATOM 482  O "O4'" . DT  A 1 51  ? 107.608 156.826 124.726 1.00 36.19  ? 51  DT  I "O4'" 1 
ATOM 483  C "C3'" . DT  A 1 51  ? 106.504 155.954 122.806 1.00 36.19  ? 51  DT  I "C3'" 1 
ATOM 484  O "O3'" . DT  A 1 51  ? 105.107 156.134 122.725 1.00 36.19  ? 51  DT  I "O3'" 1 
ATOM 485  C "C2'" . DT  A 1 51  ? 107.291 157.231 122.466 1.00 36.19  ? 51  DT  I "C2'" 1 
ATOM 486  C "C1'" . DT  A 1 51  ? 107.408 157.883 123.828 1.00 36.19  ? 51  DT  I "C1'" 1 
ATOM 487  N N1    . DT  A 1 51  ? 108.558 158.820 123.982 1.00 36.19  ? 51  DT  I N1    1 
ATOM 488  C C2    . DT  A 1 51  ? 108.363 160.041 124.585 1.00 36.19  ? 51  DT  I C2    1 
ATOM 489  O O2    . DT  A 1 51  ? 107.263 160.472 124.874 1.00 36.19  ? 51  DT  I O2    1 
ATOM 490  N N3    . DT  A 1 51  ? 109.497 160.798 124.721 1.00 36.19  ? 51  DT  I N3    1 
ATOM 491  C C4    . DT  A 1 51  ? 110.787 160.428 124.405 1.00 36.19  ? 51  DT  I C4    1 
ATOM 492  O O4    . DT  A 1 51  ? 111.745 161.171 124.585 1.00 36.19  ? 51  DT  I O4    1 
ATOM 493  C C5    . DT  A 1 51  ? 110.929 159.108 123.848 1.00 36.19  ? 51  DT  I C5    1 
ATOM 494  C C7    . DT  A 1 51  ? 112.283 158.597 123.462 1.00 36.19  ? 51  DT  I C7    1 
ATOM 495  C C6    . DT  A 1 51  ? 109.825 158.369 123.688 1.00 36.19  ? 51  DT  I C6    1 
ATOM 496  P P     . DG  A 1 52  ? 104.406 156.296 121.299 1.00 38.68  ? 52  DG  I P     1 
ATOM 497  O OP1   . DG  A 1 52  ? 103.059 155.692 121.380 1.00 38.68  ? 52  DG  I OP1   1 
ATOM 498  O OP2   . DG  A 1 52  ? 105.365 155.831 120.275 1.00 38.68  ? 52  DG  I OP2   1 
ATOM 499  O "O5'" . DG  A 1 52  ? 104.264 157.872 121.163 1.00 38.68  ? 52  DG  I "O5'" 1 
ATOM 500  C "C5'" . DG  A 1 52  ? 103.535 158.594 122.152 1.00 38.68  ? 52  DG  I "C5'" 1 
ATOM 501  C "C4'" . DG  A 1 52  ? 103.667 160.072 121.902 1.00 38.68  ? 52  DG  I "C4'" 1 
ATOM 502  O "O4'" . DG  A 1 52  ? 104.917 160.533 122.403 1.00 38.68  ? 52  DG  I "O4'" 1 
ATOM 503  C "C3'" . DG  A 1 52  ? 103.651 160.455 120.441 1.00 38.68  ? 52  DG  I "C3'" 1 
ATOM 504  O "O3'" . DG  A 1 52  ? 102.302 160.709 120.065 1.00 38.68  ? 52  DG  I "O3'" 1 
ATOM 505  C "C2'" . DG  A 1 52  ? 104.545 161.713 120.380 1.00 38.68  ? 52  DG  I "C2'" 1 
ATOM 506  C "C1'" . DG  A 1 52  ? 105.249 161.726 121.749 1.00 38.68  ? 52  DG  I "C1'" 1 
ATOM 507  N N9    . DG  A 1 52  ? 106.710 161.798 121.740 1.00 38.68  ? 52  DG  I N9    1 
ATOM 508  C C8    . DG  A 1 52  ? 107.578 160.803 121.370 1.00 38.68  ? 52  DG  I C8    1 
ATOM 509  N N7    . DG  A 1 52  ? 108.831 161.138 121.487 1.00 38.68  ? 52  DG  I N7    1 
ATOM 510  C C5    . DG  A 1 52  ? 108.792 162.455 121.918 1.00 38.68  ? 52  DG  I C5    1 
ATOM 511  C C6    . DG  A 1 52  ? 109.848 163.351 122.194 1.00 38.68  ? 52  DG  I C6    1 
ATOM 512  O O6    . DG  A 1 52  ? 111.066 163.148 122.110 1.00 38.68  ? 52  DG  I O6    1 
ATOM 513  N N1    . DG  A 1 52  ? 109.375 164.595 122.607 1.00 38.68  ? 52  DG  I N1    1 
ATOM 514  C C2    . DG  A 1 52  ? 108.049 164.925 122.730 1.00 38.68  ? 52  DG  I C2    1 
ATOM 515  N N2    . DG  A 1 52  ? 107.773 166.170 123.143 1.00 38.68  ? 52  DG  I N2    1 
ATOM 516  N N3    . DG  A 1 52  ? 107.051 164.090 122.475 1.00 38.68  ? 52  DG  I N3    1 
ATOM 517  C C4    . DG  A 1 52  ? 107.495 162.878 122.075 1.00 38.68  ? 52  DG  I C4    1 
ATOM 518  P P     . DG  A 1 53  ? 101.929 161.214 118.593 1.00 39.57  ? 53  DG  I P     1 
ATOM 519  O OP1   . DG  A 1 53  ? 100.572 160.709 118.292 1.00 39.57  ? 53  DG  I OP1   1 
ATOM 520  O OP2   . DG  A 1 53  ? 103.054 160.870 117.697 1.00 39.57  ? 53  DG  I OP2   1 
ATOM 521  O "O5'" . DG  A 1 53  ? 101.866 162.803 118.734 1.00 39.57  ? 53  DG  I "O5'" 1 
ATOM 522  C "C5'" . DG  A 1 53  ? 102.566 163.614 117.832 1.00 39.57  ? 53  DG  I "C5'" 1 
ATOM 523  C "C4'" . DG  A 1 53  ? 102.836 164.985 118.422 1.00 39.57  ? 53  DG  I "C4'" 1 
ATOM 524  O "O4'" . DG  A 1 53  ? 103.805 164.924 119.500 1.00 39.57  ? 53  DG  I "O4'" 1 
ATOM 525  C "C3'" . DG  A 1 53  ? 103.317 166.031 117.415 1.00 39.57  ? 53  DG  I "C3'" 1 
ATOM 526  O "O3'" . DG  A 1 53  ? 102.191 166.810 117.041 1.00 39.57  ? 53  DG  I "O3'" 1 
ATOM 527  C "C2'" . DG  A 1 53  ? 104.321 166.865 118.188 1.00 39.57  ? 53  DG  I "C2'" 1 
ATOM 528  C "C1'" . DG  A 1 53  ? 104.778 165.915 119.283 1.00 39.57  ? 53  DG  I "C1'" 1 
ATOM 529  N N9    . DG  A 1 53  ? 106.114 165.318 119.249 1.00 39.57  ? 53  DG  I N9    1 
ATOM 530  C C8    . DG  A 1 53  ? 106.433 164.022 118.940 1.00 39.57  ? 53  DG  I C8    1 
ATOM 531  N N7    . DG  A 1 53  ? 107.708 163.768 119.015 1.00 39.57  ? 53  DG  I N7    1 
ATOM 532  C C5    . DG  A 1 53  ? 108.277 164.998 119.302 1.00 39.57  ? 53  DG  I C5    1 
ATOM 533  C C6    . DG  A 1 53  ? 109.630 165.357 119.465 1.00 39.57  ? 53  DG  I C6    1 
ATOM 534  O O6    . DG  A 1 53  ? 110.631 164.634 119.384 1.00 39.57  ? 53  DG  I O6    1 
ATOM 535  N N1    . DG  A 1 53  ? 109.770 166.710 119.748 1.00 39.57  ? 53  DG  I N1    1 
ATOM 536  C C2    . DG  A 1 53  ? 108.736 167.604 119.859 1.00 39.57  ? 53  DG  I C2    1 
ATOM 537  N N2    . DG  A 1 53  ? 109.067 168.872 120.139 1.00 39.57  ? 53  DG  I N2    1 
ATOM 538  N N3    . DG  A 1 53  ? 107.461 167.279 119.710 1.00 39.57  ? 53  DG  I N3    1 
ATOM 539  C C4    . DG  A 1 53  ? 107.308 165.965 119.434 1.00 39.57  ? 53  DG  I C4    1 
ATOM 540  P P     . DC  A 1 54  ? 101.960 167.248 115.521 1.00 39.13  ? 54  DC  I P     1 
ATOM 541  O OP1   . DC  A 1 54  ? 100.619 167.863 115.422 1.00 39.13  ? 54  DC  I OP1   1 
ATOM 542  O OP2   . DC  A 1 54  ? 102.316 166.099 114.661 1.00 39.13  ? 54  DC  I OP2   1 
ATOM 543  O "O5'" . DC  A 1 54  ? 103.063 168.380 115.314 1.00 39.13  ? 54  DC  I "O5'" 1 
ATOM 544  C "C5'" . DC  A 1 54  ? 103.054 169.562 116.135 1.00 39.13  ? 54  DC  I "C5'" 1 
ATOM 545  C "C4'" . DC  A 1 54  ? 104.399 170.245 116.032 1.00 39.13  ? 54  DC  I "C4'" 1 
ATOM 546  O "O4'" . DC  A 1 54  ? 105.427 169.347 116.449 1.00 39.13  ? 54  DC  I "O4'" 1 
ATOM 547  C "C3'" . DC  A 1 54  ? 104.787 170.698 114.632 1.00 39.13  ? 54  DC  I "C3'" 1 
ATOM 548  O "O3'" . DC  A 1 54  ? 104.623 172.109 114.537 1.00 39.13  ? 54  DC  I "O3'" 1 
ATOM 549  C "C2'" . DC  A 1 54  ? 106.254 170.247 114.459 1.00 39.13  ? 54  DC  I "C2'" 1 
ATOM 550  C "C1'" . DC  A 1 54  ? 106.623 169.748 115.850 1.00 39.13  ? 54  DC  I "C1'" 1 
ATOM 551  N N1    . DC  A 1 54  ? 107.514 168.565 115.893 1.00 39.13  ? 54  DC  I N1    1 
ATOM 552  C C2    . DC  A 1 54  ? 108.842 168.688 116.319 1.00 39.13  ? 54  DC  I C2    1 
ATOM 553  O O2    . DC  A 1 54  ? 109.335 169.816 116.438 1.00 39.13  ? 54  DC  I O2    1 
ATOM 554  N N3    . DC  A 1 54  ? 109.599 167.566 116.412 1.00 39.13  ? 54  DC  I N3    1 
ATOM 555  C C4    . DC  A 1 54  ? 109.042 166.369 116.233 1.00 39.13  ? 54  DC  I C4    1 
ATOM 556  N N4    . DC  A 1 54  ? 109.812 165.289 116.370 1.00 39.13  ? 54  DC  I N4    1 
ATOM 557  C C5    . DC  A 1 54  ? 107.668 166.224 115.912 1.00 39.13  ? 54  DC  I C5    1 
ATOM 558  C C6    . DC  A 1 54  ? 106.945 167.333 115.788 1.00 39.13  ? 54  DC  I C6    1 
ATOM 559  P P     . DG  A 1 55  ? 104.427 172.798 113.105 1.00 37.05  ? 55  DG  I P     1 
ATOM 560  O OP1   . DG  A 1 55  ? 103.871 174.151 113.324 1.00 37.05  ? 55  DG  I OP1   1 
ATOM 561  O OP2   . DG  A 1 55  ? 103.717 171.839 112.231 1.00 37.05  ? 55  DG  I OP2   1 
ATOM 562  O "O5'" . DG  A 1 55  ? 105.927 172.923 112.580 1.00 37.05  ? 55  DG  I "O5'" 1 
ATOM 563  C "C5'" . DG  A 1 55  ? 106.869 173.711 113.315 1.00 37.05  ? 55  DG  I "C5'" 1 
ATOM 564  C "C4'" . DG  A 1 55  ? 108.251 173.564 112.719 1.00 37.05  ? 55  DG  I "C4'" 1 
ATOM 565  O "O4'" . DG  A 1 55  ? 108.839 172.316 113.158 1.00 37.05  ? 55  DG  I "O4'" 1 
ATOM 566  C "C3'" . DG  A 1 55  ? 108.296 173.545 111.192 1.00 37.05  ? 55  DG  I "C3'" 1 
ATOM 567  O "O3'" . DG  A 1 55  ? 109.349 174.359 110.737 1.00 37.05  ? 55  DG  I "O3'" 1 
ATOM 568  C "C2'" . DG  A 1 55  ? 108.558 172.071 110.879 1.00 37.05  ? 55  DG  I "C2'" 1 
ATOM 569  C "C1'" . DG  A 1 55  ? 109.438 171.697 112.053 1.00 37.05  ? 55  DG  I "C1'" 1 
ATOM 570  N N9    . DG  A 1 55  ? 109.500 170.270 112.323 1.00 37.05  ? 55  DG  I N9    1 
ATOM 571  C C8    . DG  A 1 55  ? 108.472 169.367 112.251 1.00 37.05  ? 55  DG  I C8    1 
ATOM 572  N N7    . DG  A 1 55  ? 108.827 168.152 112.551 1.00 37.05  ? 55  DG  I N7    1 
ATOM 573  C C5    . DG  A 1 55  ? 110.185 168.253 112.802 1.00 37.05  ? 55  DG  I C5    1 
ATOM 574  C C6    . DG  A 1 55  ? 111.117 167.261 113.162 1.00 37.05  ? 55  DG  I C6    1 
ATOM 575  O O6    . DG  A 1 55  ? 110.919 166.054 113.336 1.00 37.05  ? 55  DG  I O6    1 
ATOM 576  N N1    . DG  A 1 55  ? 112.389 167.787 113.325 1.00 37.05  ? 55  DG  I N1    1 
ATOM 577  C C2    . DG  A 1 55  ? 112.721 169.107 113.157 1.00 37.05  ? 55  DG  I C2    1 
ATOM 578  N N2    . DG  A 1 55  ? 114.004 169.430 113.356 1.00 37.05  ? 55  DG  I N2    1 
ATOM 579  N N3    . DG  A 1 55  ? 111.856 170.048 112.821 1.00 37.05  ? 55  DG  I N3    1 
ATOM 580  C C4    . DG  A 1 55  ? 110.612 169.550 112.661 1.00 37.05  ? 55  DG  I C4    1 
ATOM 581  P P     . DG  A 1 56  ? 109.267 175.022 109.281 1.00 34.22  ? 56  DG  I P     1 
ATOM 582  O OP1   . DG  A 1 56  ? 108.916 176.449 109.457 1.00 34.22  ? 56  DG  I OP1   1 
ATOM 583  O OP2   . DG  A 1 56  ? 108.412 174.151 108.445 1.00 34.22  ? 56  DG  I OP2   1 
ATOM 584  O "O5'" . DG  A 1 56  ? 110.761 174.921 108.728 1.00 34.22  ? 56  DG  I "O5'" 1 
ATOM 585  C "C5'" . DG  A 1 56  ? 111.863 175.332 109.530 1.00 34.22  ? 56  DG  I "C5'" 1 
ATOM 586  C "C4'" . DG  A 1 56  ? 113.061 174.429 109.286 1.00 34.22  ? 56  DG  I "C4'" 1 
ATOM 587  O "O4'" . DG  A 1 56  ? 112.815 173.085 109.756 1.00 34.22  ? 56  DG  I "O4'" 1 
ATOM 588  C "C3'" . DG  A 1 56  ? 113.484 174.321 107.825 1.00 34.22  ? 56  DG  I "C3'" 1 
ATOM 589  O "O3'" . DG  A 1 56  ? 114.893 174.378 107.731 1.00 34.22  ? 56  DG  I "O3'" 1 
ATOM 590  C "C2'" . DG  A 1 56  ? 112.974 172.935 107.423 1.00 34.22  ? 56  DG  I "C2'" 1 
ATOM 591  C "C1'" . DG  A 1 56  ? 113.127 172.172 108.731 1.00 34.22  ? 56  DG  I "C1'" 1 
ATOM 592  N N9    . DG  A 1 56  ? 112.288 170.986 108.882 1.00 34.22  ? 56  DG  I N9    1 
ATOM 593  C C8    . DG  A 1 56  ? 110.935 170.886 108.678 1.00 34.22  ? 56  DG  I C8    1 
ATOM 594  N N7    . DG  A 1 56  ? 110.465 169.691 108.910 1.00 34.22  ? 56  DG  I N7    1 
ATOM 595  C C5    . DG  A 1 56  ? 111.580 168.954 109.283 1.00 34.22  ? 56  DG  I C5    1 
ATOM 596  C C6    . DG  A 1 56  ? 111.694 167.594 109.646 1.00 34.22  ? 56  DG  I C6    1 
ATOM 597  O O6    . DG  A 1 56  ? 110.798 166.744 109.713 1.00 34.22  ? 56  DG  I O6    1 
ATOM 598  N N1    . DG  A 1 56  ? 113.010 167.247 109.952 1.00 34.22  ? 56  DG  I N1    1 
ATOM 599  C C2    . DG  A 1 56  ? 114.078 168.110 109.908 1.00 34.22  ? 56  DG  I C2    1 
ATOM 600  N N2    . DG  A 1 56  ? 115.283 167.608 110.242 1.00 34.22  ? 56  DG  I N2    1 
ATOM 601  N N3    . DG  A 1 56  ? 113.979 169.388 109.571 1.00 34.22  ? 56  DG  I N3    1 
ATOM 602  C C4    . DG  A 1 56  ? 112.707 169.737 109.271 1.00 34.22  ? 56  DG  I C4    1 
ATOM 603  P P     . DT  A 1 57  ? 115.585 175.083 106.468 1.00 31.33  ? 57  DT  I P     1 
ATOM 604  O OP1   . DT  A 1 57  ? 116.979 175.380 106.862 1.00 31.33  ? 57  DT  I OP1   1 
ATOM 605  O OP2   . DT  A 1 57  ? 114.695 176.180 106.026 1.00 31.33  ? 57  DT  I OP2   1 
ATOM 606  O "O5'" . DT  A 1 57  ? 115.601 173.961 105.327 1.00 31.33  ? 57  DT  I "O5'" 1 
ATOM 607  C "C5'" . DT  A 1 57  ? 116.835 173.408 104.887 1.00 31.33  ? 57  DT  I "C5'" 1 
ATOM 608  C "C4'" . DT  A 1 57  ? 117.255 172.226 105.744 1.00 31.33  ? 57  DT  I "C4'" 1 
ATOM 609  O "O4'" . DT  A 1 57  ? 116.108 171.610 106.345 1.00 31.33  ? 57  DT  I "O4'" 1 
ATOM 610  C "C3'" . DT  A 1 57  ? 117.971 171.117 104.989 1.00 31.33  ? 57  DT  I "C3'" 1 
ATOM 611  O "O3'" . DT  A 1 57  ? 119.348 171.365 105.081 1.00 31.33  ? 57  DT  I "O3'" 1 
ATOM 612  C "C2'" . DT  A 1 57  ? 117.602 169.829 105.730 1.00 31.33  ? 57  DT  I "C2'" 1 
ATOM 613  C "C1'" . DT  A 1 57  ? 116.349 170.223 106.499 1.00 31.33  ? 57  DT  I "C1'" 1 
ATOM 614  N N1    . DT  A 1 57  ? 115.086 169.428 106.337 1.00 31.33  ? 57  DT  I N1    1 
ATOM 615  C C2    . DT  A 1 57  ? 115.045 168.126 106.785 1.00 31.33  ? 57  DT  I C2    1 
ATOM 616  O O2    . DT  A 1 57  ? 116.019 167.534 107.207 1.00 31.33  ? 57  DT  I O2    1 
ATOM 617  N N3    . DT  A 1 57  ? 113.817 167.528 106.690 1.00 31.33  ? 57  DT  I N3    1 
ATOM 618  C C4    . DT  A 1 57  ? 112.646 168.100 106.233 1.00 31.33  ? 57  DT  I C4    1 
ATOM 619  O O4    . DT  A 1 57  ? 111.589 167.483 106.186 1.00 31.33  ? 57  DT  I O4    1 
ATOM 620  C C5    . DT  A 1 57  ? 112.753 169.475 105.818 1.00 31.33  ? 57  DT  I C5    1 
ATOM 621  C C7    . DT  A 1 57  ? 111.548 170.202 105.305 1.00 31.33  ? 57  DT  I C7    1 
ATOM 622  C C6    . DT  A 1 57  ? 113.949 170.067 105.905 1.00 31.33  ? 57  DT  I C6    1 
ATOM 623  P P     . DT  A 1 58  ? 120.209 171.670 103.773 1.00 28.23  ? 58  DT  I P     1 
ATOM 624  O OP1   . DT  A 1 58  ? 121.456 172.347 104.188 1.00 28.23  ? 58  DT  I OP1   1 
ATOM 625  O OP2   . DT  A 1 58  ? 119.320 172.291 102.765 1.00 28.23  ? 58  DT  I OP2   1 
ATOM 626  O "O5'" . DT  A 1 58  ? 120.560 170.204 103.294 1.00 28.23  ? 58  DT  I "O5'" 1 
ATOM 627  C "C5'" . DT  A 1 58  ? 121.065 169.268 104.237 1.00 28.23  ? 58  DT  I "C5'" 1 
ATOM 628  C "C4'" . DT  A 1 58  ? 120.664 167.867 103.835 1.00 28.23  ? 58  DT  I "C4'" 1 
ATOM 629  O "O4'" . DT  A 1 58  ? 119.221 167.712 103.871 1.00 28.23  ? 58  DT  I "O4'" 1 
ATOM 630  C "C3'" . DT  A 1 58  ? 121.113 167.464 102.440 1.00 28.23  ? 58  DT  I "C3'" 1 
ATOM 631  O "O3'" . DT  A 1 58  ? 121.678 166.191 102.514 1.00 28.23  ? 58  DT  I "O3'" 1 
ATOM 632  C "C2'" . DT  A 1 58  ? 119.802 167.470 101.637 1.00 28.23  ? 58  DT  I "C2'" 1 
ATOM 633  C "C1'" . DT  A 1 58  ? 118.827 167.031 102.709 1.00 28.23  ? 58  DT  I "C1'" 1 
ATOM 634  N N1    . DT  A 1 58  ? 117.392 167.348 102.448 1.00 28.23  ? 58  DT  I N1    1 
ATOM 635  C C2    . DT  A 1 58  ? 116.421 166.620 103.091 1.00 28.23  ? 58  DT  I C2    1 
ATOM 636  O O2    . DT  A 1 58  ? 116.664 165.615 103.728 1.00 28.23  ? 58  DT  I O2    1 
ATOM 637  N N3    . DT  A 1 58  ? 115.137 167.011 102.827 1.00 28.23  ? 58  DT  I N3    1 
ATOM 638  C C4    . DT  A 1 58  ? 114.737 168.109 102.093 1.00 28.23  ? 58  DT  I C4    1 
ATOM 639  O O4    . DT  A 1 58  ? 113.558 168.403 101.934 1.00 28.23  ? 58  DT  I O4    1 
ATOM 640  C C5    . DT  A 1 58  ? 115.813 168.878 101.529 1.00 28.23  ? 58  DT  I C5    1 
ATOM 641  C C6    . DT  A 1 58  ? 117.073 168.491 101.746 1.00 28.23  ? 58  DT  I C6    1 
ATOM 642  P P     . DA  A 1 59  ? 122.867 165.791 101.523 1.00 26.53  ? 59  DA  I P     1 
ATOM 643  O OP1   . DA  A 1 59  ? 124.094 166.456 102.011 1.00 26.53  ? 59  DA  I OP1   1 
ATOM 644  O OP2   . DA  A 1 59  ? 122.401 166.022 100.139 1.00 26.53  ? 59  DA  I OP2   1 
ATOM 645  O "O5'" . DA  A 1 59  ? 123.012 164.221 101.733 1.00 26.53  ? 59  DA  I "O5'" 1 
ATOM 646  C "C5'" . DA  A 1 59  ? 123.025 163.653 103.049 1.00 26.53  ? 59  DA  I "C5'" 1 
ATOM 647  C "C4'" . DA  A 1 59  ? 121.973 162.567 103.155 1.00 26.53  ? 59  DA  I "C4'" 1 
ATOM 648  O "O4'" . DA  A 1 59  ? 120.659 163.100 102.897 1.00 26.53  ? 59  DA  I "O4'" 1 
ATOM 649  C "C3'" . DA  A 1 59  ? 122.171 161.396 102.216 1.00 26.53  ? 59  DA  I "C3'" 1 
ATOM 650  O "O3'" . DA  A 1 59  ? 122.055 160.202 102.967 1.00 26.53  ? 59  DA  I "O3'" 1 
ATOM 651  C "C2'" . DA  A 1 59  ? 121.048 161.572 101.171 1.00 26.53  ? 59  DA  I "C2'" 1 
ATOM 652  C "C1'" . DA  A 1 59  ? 119.977 162.264 101.993 1.00 26.53  ? 59  DA  I "C1'" 1 
ATOM 653  N N9    . DA  A 1 59  ? 119.061 163.150 101.274 1.00 26.53  ? 59  DA  I N9    1 
ATOM 654  C C8    . DA  A 1 59  ? 119.399 164.178 100.443 1.00 26.53  ? 59  DA  I C8    1 
ATOM 655  N N7    . DA  A 1 59  ? 118.371 164.821 99.949  1.00 26.53  ? 59  DA  I N7    1 
ATOM 656  C C5    . DA  A 1 59  ? 117.283 164.114 100.419 1.00 26.53  ? 59  DA  I C5    1 
ATOM 657  C C6    . DA  A 1 59  ? 115.900 164.270 100.225 1.00 26.53  ? 59  DA  I C6    1 
ATOM 658  N N6    . DA  A 1 59  ? 115.367 165.234 99.469  1.00 26.53  ? 59  DA  I N6    1 
ATOM 659  N N1    . DA  A 1 59  ? 115.083 163.393 100.837 1.00 26.53  ? 59  DA  I N1    1 
ATOM 660  C C2    . DA  A 1 59  ? 115.622 162.431 101.594 1.00 26.53  ? 59  DA  I C2    1 
ATOM 661  N N3    . DA  A 1 59  ? 116.904 162.186 101.851 1.00 26.53  ? 59  DA  I N3    1 
ATOM 662  C C4    . DA  A 1 59  ? 117.690 163.072 101.227 1.00 26.53  ? 59  DA  I C4    1 
ATOM 663  P P     . DA  A 1 60  ? 122.528 158.808 102.343 1.00 24.87  ? 60  DA  I P     1 
ATOM 664  O OP1   . DA  A 1 60  ? 123.177 158.040 103.425 1.00 24.87  ? 60  DA  I OP1   1 
ATOM 665  O OP2   . DA  A 1 60  ? 123.247 159.077 101.080 1.00 24.87  ? 60  DA  I OP2   1 
ATOM 666  O "O5'" . DA  A 1 60  ? 121.157 158.094 101.986 1.00 24.87  ? 60  DA  I "O5'" 1 
ATOM 667  C "C5'" . DA  A 1 60  ? 120.083 158.113 102.922 1.00 24.87  ? 60  DA  I "C5'" 1 
ATOM 668  C "C4'" . DA  A 1 60  ? 118.809 157.691 102.236 1.00 24.87  ? 60  DA  I "C4'" 1 
ATOM 669  O "O4'" . DA  A 1 60  ? 118.243 158.797 101.502 1.00 24.87  ? 60  DA  I "O4'" 1 
ATOM 670  C "C3'" . DA  A 1 60  ? 118.967 156.547 101.257 1.00 24.87  ? 60  DA  I "C3'" 1 
ATOM 671  O "O3'" . DA  A 1 60  ? 117.935 155.631 101.485 1.00 24.87  ? 60  DA  I "O3'" 1 
ATOM 672  C "C2'" . DA  A 1 60  ? 118.847 157.247 99.891  1.00 24.87  ? 60  DA  I "C2'" 1 
ATOM 673  C "C1'" . DA  A 1 60  ? 117.873 158.362 100.221 1.00 24.87  ? 60  DA  I "C1'" 1 
ATOM 674  N N9    . DA  A 1 60  ? 117.959 159.545 99.371  1.00 24.87  ? 60  DA  I N9    1 
ATOM 675  C C8    . DA  A 1 60  ? 119.091 160.127 98.887  1.00 24.87  ? 60  DA  I C8    1 
ATOM 676  N N7    . DA  A 1 60  ? 118.869 161.202 98.170  1.00 24.87  ? 60  DA  I N7    1 
ATOM 677  C C5    . DA  A 1 60  ? 117.492 161.304 98.145  1.00 24.87  ? 60  DA  I C5    1 
ATOM 678  C C6    . DA  A 1 60  ? 116.622 162.222 97.530  1.00 24.87  ? 60  DA  I C6    1 
ATOM 679  N N6    . DA  A 1 60  ? 117.043 163.254 96.794  1.00 24.87  ? 60  DA  I N6    1 
ATOM 680  N N1    . DA  A 1 60  ? 115.298 162.038 97.703  1.00 24.87  ? 60  DA  I N1    1 
ATOM 681  C C2    . DA  A 1 60  ? 114.883 161.004 98.441  1.00 24.87  ? 60  DA  I C2    1 
ATOM 682  N N3    . DA  A 1 60  ? 115.605 160.079 99.068  1.00 24.87  ? 60  DA  I N3    1 
ATOM 683  C C4    . DA  A 1 60  ? 116.914 160.288 98.878  1.00 24.87  ? 60  DA  I C4    1 
ATOM 684  P P     . DA  A 1 61  ? 118.075 154.116 100.994 1.00 24.09  ? 61  DA  I P     1 
ATOM 685  O OP1   . DA  A 1 61  ? 118.133 153.259 102.195 1.00 24.09  ? 61  DA  I OP1   1 
ATOM 686  O OP2   . DA  A 1 61  ? 119.155 154.051 99.989  1.00 24.09  ? 61  DA  I OP2   1 
ATOM 687  O "O5'" . DA  A 1 61  ? 116.695 153.858 100.257 1.00 24.09  ? 61  DA  I "O5'" 1 
ATOM 688  C "C5'" . DA  A 1 61  ? 115.476 154.042 100.956 1.00 24.09  ? 61  DA  I "C5'" 1 
ATOM 689  C "C4'" . DA  A 1 61  ? 114.427 154.623 100.036 1.00 24.09  ? 61  DA  I "C4'" 1 
ATOM 690  O "O4'" . DA  A 1 61  ? 114.906 155.825 99.419  1.00 24.09  ? 61  DA  I "O4'" 1 
ATOM 691  C "C3'" . DA  A 1 61  ? 113.971 153.707 98.918  1.00 24.09  ? 61  DA  I "C3'" 1 
ATOM 692  O "O3'" . DA  A 1 61  ? 112.576 153.562 99.025  1.00 24.09  ? 61  DA  I "O3'" 1 
ATOM 693  C "C2'" . DA  A 1 61  ? 114.406 154.437 97.623  1.00 24.09  ? 61  DA  I "C2'" 1 
ATOM 694  C "C1'" . DA  A 1 61  ? 114.454 155.875 98.093  1.00 24.09  ? 61  DA  I "C1'" 1 
ATOM 695  N N9    . DA  A 1 61  ? 115.364 156.763 97.397  1.00 20.00  ? 61  DA  I N9    1 
ATOM 696  C C8    . DA  A 1 61  ? 116.734 156.685 97.370  1.00 20.00  ? 61  DA  I C8    1 
ATOM 697  N N7    . DA  A 1 61  ? 117.302 157.647 96.689  1.00 20.00  ? 61  DA  I N7    1 
ATOM 698  C C5    . DA  A 1 61  ? 116.241 158.415 96.226  1.00 20.00  ? 61  DA  I C5    1 
ATOM 699  C C6    . DA  A 1 61  ? 116.187 159.597 95.441  1.00 20.00  ? 61  DA  I C6    1 
ATOM 700  N N6    . DA  A 1 61  ? 117.272 160.230 94.980  1.00 20.00  ? 61  DA  I N6    1 
ATOM 701  N N1    . DA  A 1 61  ? 114.969 160.111 95.155  1.00 20.00  ? 61  DA  I N1    1 
ATOM 702  C C2    . DA  A 1 61  ? 113.884 159.485 95.630  1.00 20.00  ? 61  DA  I C2    1 
ATOM 703  N N3    . DA  A 1 61  ? 113.808 158.374 96.385  1.00 20.00  ? 61  DA  I N3    1 
ATOM 704  C C4    . DA  A 1 61  ? 115.037 157.883 96.650  1.00 20.00  ? 61  DA  I C4    1 
ATOM 705  P P     . DA  A 1 62  ? 111.815 152.436 98.189  1.00 24.88  ? 62  DA  I P     1 
ATOM 706  O OP1   . DA  A 1 62  ? 110.679 151.959 99.003  1.00 24.88  ? 62  DA  I OP1   1 
ATOM 707  O OP2   . DA  A 1 62  ? 112.828 151.478 97.700  1.00 24.88  ? 62  DA  I OP2   1 
ATOM 708  O "O5'" . DA  A 1 62  ? 111.245 153.239 96.942  1.00 24.88  ? 62  DA  I "O5'" 1 
ATOM 709  C "C5'" . DA  A 1 62  ? 110.310 154.297 97.139  1.00 24.88  ? 62  DA  I "C5'" 1 
ATOM 710  C "C4'" . DA  A 1 62  ? 109.943 154.877 95.797  1.00 24.88  ? 62  DA  I "C4'" 1 
ATOM 711  O "O4'" . DA  A 1 62  ? 110.974 155.777 95.350  1.00 24.88  ? 62  DA  I "O4'" 1 
ATOM 712  C "C3'" . DA  A 1 62  ? 109.745 153.838 94.709  1.00 24.88  ? 62  DA  I "C3'" 1 
ATOM 713  O "O3'" . DA  A 1 62  ? 108.504 154.096 94.069  1.00 24.88  ? 62  DA  I "O3'" 1 
ATOM 714  C "C2'" . DA  A 1 62  ? 110.969 154.049 93.789  1.00 24.88  ? 62  DA  I "C2'" 1 
ATOM 715  C "C1'" . DA  A 1 62  ? 111.251 155.527 94.000  1.00 24.88  ? 62  DA  I "C1'" 1 
ATOM 716  N N9    . DA  A 1 62  ? 112.635 155.958 93.815  1.00 24.88  ? 62  DA  I N9    1 
ATOM 717  C C8    . DA  A 1 62  ? 113.755 155.313 94.241  1.00 24.88  ? 62  DA  I C8    1 
ATOM 718  N N7    . DA  A 1 62  ? 114.869 155.928 93.937  1.00 24.88  ? 62  DA  I N7    1 
ATOM 719  C C5    . DA  A 1 62  ? 114.457 156.997 93.168  1.00 24.88  ? 62  DA  I C5    1 
ATOM 720  C C6    . DA  A 1 62  ? 115.168 158.013 92.508  1.00 24.88  ? 62  DA  I C6    1 
ATOM 721  N N6    . DA  A 1 62  ? 116.499 158.103 92.531  1.00 24.88  ? 62  DA  I N6    1 
ATOM 722  N N1    . DA  A 1 62  ? 114.458 158.935 91.821  1.00 24.88  ? 62  DA  I N1    1 
ATOM 723  C C2    . DA  A 1 62  ? 113.124 158.834 91.807  1.00 24.88  ? 62  DA  I C2    1 
ATOM 724  N N3    . DA  A 1 62  ? 112.346 157.922 92.393  1.00 24.88  ? 62  DA  I N3    1 
ATOM 725  C C4    . DA  A 1 62  ? 113.083 157.024 93.064  1.00 24.88  ? 62  DA  I C4    1 
ATOM 726  P P     . DC  A 1 63  ? 107.886 153.053 93.022  1.00 26.06  ? 63  DC  I P     1 
ATOM 727  O OP1   . DC  A 1 63  ? 106.432 152.997 93.274  1.00 26.06  ? 63  DC  I OP1   1 
ATOM 728  O OP2   . DC  A 1 63  ? 108.688 151.813 93.082  1.00 26.06  ? 63  DC  I OP2   1 
ATOM 729  O "O5'" . DC  A 1 63  ? 108.129 153.746 91.612  1.00 26.06  ? 63  DC  I "O5'" 1 
ATOM 730  C "C5'" . DC  A 1 63  ? 107.561 155.027 91.355  1.00 26.06  ? 63  DC  I "C5'" 1 
ATOM 731  C "C4'" . DC  A 1 63  ? 108.175 155.625 90.115  1.00 26.06  ? 63  DC  I "C4'" 1 
ATOM 732  O "O4'" . DC  A 1 63  ? 109.572 155.842 90.340  1.00 26.06  ? 63  DC  I "O4'" 1 
ATOM 733  C "C3'" . DC  A 1 63  ? 108.078 154.767 88.856  1.00 26.06  ? 63  DC  I "C3'" 1 
ATOM 734  O "O3'" . DC  A 1 63  ? 107.282 155.457 87.896  1.00 26.06  ? 63  DC  I "O3'" 1 
ATOM 735  C "C2'" . DC  A 1 63  ? 109.544 154.569 88.413  1.00 26.06  ? 63  DC  I "C2'" 1 
ATOM 736  C "C1'" . DC  A 1 63  ? 110.238 155.718 89.121  1.00 26.06  ? 63  DC  I "C1'" 1 
ATOM 737  N N1    . DC  A 1 63  ? 111.647 155.479 89.476  1.00 26.06  ? 63  DC  I N1    1 
ATOM 738  C C2    . DC  A 1 63  ? 112.640 156.344 89.019  1.00 26.06  ? 63  DC  I C2    1 
ATOM 739  O O2    . DC  A 1 63  ? 112.347 157.207 88.186  1.00 26.06  ? 63  DC  I O2    1 
ATOM 740  N N3    . DC  A 1 63  ? 113.914 156.137 89.417  1.00 26.06  ? 63  DC  I N3    1 
ATOM 741  C C4    . DC  A 1 63  ? 114.189 155.180 90.300  1.00 26.06  ? 63  DC  I C4    1 
ATOM 742  N N4    . DC  A 1 63  ? 115.456 155.022 90.680  1.00 26.06  ? 63  DC  I N4    1 
ATOM 743  C C5    . DC  A 1 63  ? 113.179 154.341 90.833  1.00 26.06  ? 63  DC  I C5    1 
ATOM 744  C C6    . DC  A 1 63  ? 111.932 154.541 90.417  1.00 26.06  ? 63  DC  I C6    1 
ATOM 745  P P     . DG  A 1 64  ? 106.720 154.698 86.601  1.00 27.12  ? 64  DG  I P     1 
ATOM 746  O OP1   . DG  A 1 64  ? 105.457 155.359 86.207  1.00 27.12  ? 64  DG  I OP1   1 
ATOM 747  O OP2   . DG  A 1 64  ? 106.730 153.248 86.887  1.00 27.12  ? 64  DG  I OP2   1 
ATOM 748  O "O5'" . DG  A 1 64  ? 107.833 155.004 85.501  1.00 27.12  ? 64  DG  I "O5'" 1 
ATOM 749  C "C5'" . DG  A 1 64  ? 108.159 156.365 85.199  1.00 27.12  ? 64  DG  I "C5'" 1 
ATOM 750  C "C4'" . DG  A 1 64  ? 109.337 156.427 84.254  1.00 27.12  ? 64  DG  I "C4'" 1 
ATOM 751  O "O4'" . DG  A 1 64  ? 110.565 156.277 84.993  1.00 27.12  ? 64  DG  I "O4'" 1 
ATOM 752  C "C3'" . DG  A 1 64  ? 109.351 155.361 83.161  1.00 27.12  ? 64  DG  I "C3'" 1 
ATOM 753  O "O3'" . DG  A 1 64  ? 109.607 155.984 81.911  1.00 27.12  ? 64  DG  I "O3'" 1 
ATOM 754  C "C2'" . DG  A 1 64  ? 110.500 154.438 83.592  1.00 27.12  ? 64  DG  I "C2'" 1 
ATOM 755  C "C1'" . DG  A 1 64  ? 111.416 155.431 84.278  1.00 27.12  ? 64  DG  I "C1'" 1 
ATOM 756  N N9    . DG  A 1 64  ? 112.341 154.851 85.238  1.00 27.12  ? 64  DG  I N9    1 
ATOM 757  C C8    . DG  A 1 64  ? 112.074 153.872 86.160  1.00 27.12  ? 64  DG  I C8    1 
ATOM 758  N N7    . DG  A 1 64  ? 113.104 153.555 86.891  1.00 27.12  ? 64  DG  I N7    1 
ATOM 759  C C5    . DG  A 1 64  ? 114.126 154.349 86.394  1.00 27.12  ? 64  DG  I C5    1 
ATOM 760  C C6    . DG  A 1 64  ? 115.479 154.432 86.780  1.00 27.12  ? 64  DG  I C6    1 
ATOM 761  O O6    . DG  A 1 64  ? 116.059 153.801 87.669  1.00 27.12  ? 64  DG  I O6    1 
ATOM 762  N N1    . DG  A 1 64  ? 116.176 155.364 86.018  1.00 27.12  ? 64  DG  I N1    1 
ATOM 763  C C2    . DG  A 1 64  ? 115.632 156.117 85.008  1.00 27.12  ? 64  DG  I C2    1 
ATOM 764  N N2    . DG  A 1 64  ? 116.456 156.967 84.383  1.00 27.12  ? 64  DG  I N2    1 
ATOM 765  N N3    . DG  A 1 64  ? 114.364 156.049 84.639  1.00 27.12  ? 64  DG  I N3    1 
ATOM 766  C C4    . DG  A 1 64  ? 113.674 155.146 85.373  1.00 27.12  ? 64  DG  I C4    1 
ATOM 767  P P     . DC  A 1 65  ? 109.159 155.280 80.542  1.00 26.39  ? 65  DC  I P     1 
ATOM 768  O OP1   . DC  A 1 65  ? 108.143 156.142 79.901  1.00 26.39  ? 65  DC  I OP1   1 
ATOM 769  O OP2   . DC  A 1 65  ? 108.838 153.869 80.846  1.00 26.39  ? 65  DC  I OP2   1 
ATOM 770  O "O5'" . DC  A 1 65  ? 110.487 155.308 79.656  1.00 26.39  ? 65  DC  I "O5'" 1 
ATOM 771  C "C5'" . DC  A 1 65  ? 111.283 156.493 79.566  1.00 26.39  ? 65  DC  I "C5'" 1 
ATOM 772  C "C4'" . DC  A 1 65  ? 112.733 156.109 79.355  1.00 26.39  ? 65  DC  I "C4'" 1 
ATOM 773  O "O4'" . DC  A 1 65  ? 113.266 155.560 80.564  1.00 26.39  ? 65  DC  I "O4'" 1 
ATOM 774  C "C3'" . DC  A 1 65  ? 112.973 155.052 78.284  1.00 26.39  ? 65  DC  I "C3'" 1 
ATOM 775  O "O3'" . DC  A 1 65  ? 113.507 155.665 77.123  1.00 26.39  ? 65  DC  I "O3'" 1 
ATOM 776  C "C2'" . DC  A 1 65  ? 113.955 154.046 78.923  1.00 26.39  ? 65  DC  I "C2'" 1 
ATOM 777  C "C1'" . DC  A 1 65  ? 114.333 154.715 80.237  1.00 26.39  ? 65  DC  I "C1'" 1 
ATOM 778  N N1    . DC  A 1 65  ? 114.503 153.795 81.384  1.00 26.39  ? 65  DC  I N1    1 
ATOM 779  C C2    . DC  A 1 65  ? 115.721 153.744 82.067  1.00 26.39  ? 65  DC  I C2    1 
ATOM 780  O O2    . DC  A 1 65  ? 116.688 154.362 81.615  1.00 26.39  ? 65  DC  I O2    1 
ATOM 781  N N3    . DC  A 1 65  ? 115.829 152.934 83.148  1.00 26.39  ? 65  DC  I N3    1 
ATOM 782  C C4    . DC  A 1 65  ? 114.766 152.268 83.590  1.00 26.39  ? 65  DC  I C4    1 
ATOM 783  N N4    . DC  A 1 65  ? 114.911 151.496 84.669  1.00 26.39  ? 65  DC  I N4    1 
ATOM 784  C C5    . DC  A 1 65  ? 113.503 152.361 82.947  1.00 26.39  ? 65  DC  I C5    1 
ATOM 785  C C6    . DC  A 1 65  ? 113.413 153.146 81.874  1.00 26.39  ? 65  DC  I C6    1 
ATOM 786  P P     . DG  A 1 66  ? 113.536 154.857 75.741  1.00 24.90  ? 66  DG  I P     1 
ATOM 787  O OP1   . DG  A 1 66  ? 113.462 155.848 74.645  1.00 24.90  ? 66  DG  I OP1   1 
ATOM 788  O OP2   . DG  A 1 66  ? 112.547 153.760 75.820  1.00 24.90  ? 66  DG  I OP2   1 
ATOM 789  O "O5'" . DG  A 1 66  ? 114.991 154.209 75.744  1.00 24.90  ? 66  DG  I "O5'" 1 
ATOM 790  C "C5'" . DG  A 1 66  ? 116.121 155.010 76.071  1.00 24.90  ? 66  DG  I "C5'" 1 
ATOM 791  C "C4'" . DG  A 1 66  ? 117.302 154.138 76.451  1.00 24.90  ? 66  DG  I "C4'" 1 
ATOM 792  O "O4'" . DG  A 1 66  ? 117.107 153.552 77.751  1.00 24.90  ? 66  DG  I "O4'" 1 
ATOM 793  C "C3'" . DG  A 1 66  ? 117.580 152.983 75.491  1.00 24.90  ? 66  DG  I "C3'" 1 
ATOM 794  O "O3'" . DG  A 1 66  ? 118.916 153.052 75.079  1.00 24.90  ? 66  DG  I "O3'" 1 
ATOM 795  C "C2'" . DG  A 1 66  ? 117.302 151.729 76.337  1.00 24.90  ? 66  DG  I "C2'" 1 
ATOM 796  C "C1'" . DG  A 1 66  ? 117.607 152.244 77.727  1.00 24.90  ? 66  DG  I "C1'" 1 
ATOM 797  N N9    . DG  A 1 66  ? 116.964 151.521 78.811  1.00 24.90  ? 66  DG  I N9    1 
ATOM 798  C C8    . DG  A 1 66  ? 115.645 151.164 78.892  1.00 24.90  ? 66  DG  I C8    1 
ATOM 799  N N7    . DG  A 1 66  ? 115.346 150.524 79.983  1.00 24.90  ? 66  DG  I N7    1 
ATOM 800  C C5    . DG  A 1 66  ? 116.556 150.400 80.642  1.00 24.90  ? 66  DG  I C5    1 
ATOM 801  C C6    . DG  A 1 66  ? 116.856 149.779 81.868  1.00 24.90  ? 66  DG  I C6    1 
ATOM 802  O O6    . DG  A 1 66  ? 116.084 149.198 82.637  1.00 24.90  ? 66  DG  I O6    1 
ATOM 803  N N1    . DG  A 1 66  ? 118.206 149.879 82.181  1.00 24.90  ? 66  DG  I N1    1 
ATOM 804  C C2    . DG  A 1 66  ? 119.150 150.501 81.405  1.00 24.90  ? 66  DG  I C2    1 
ATOM 805  N N2    . DG  A 1 66  ? 120.406 150.489 81.875  1.00 24.90  ? 66  DG  I N2    1 
ATOM 806  N N3    . DG  A 1 66  ? 118.881 151.091 80.247  1.00 24.90  ? 66  DG  I N3    1 
ATOM 807  C C4    . DG  A 1 66  ? 117.566 151.000 79.931  1.00 24.90  ? 66  DG  I C4    1 
ATOM 808  P P     . DG  A 1 67  ? 119.357 152.459 73.660  1.00 25.17  ? 67  DG  I P     1 
ATOM 809  O OP1   . DG  A 1 67  ? 119.727 153.588 72.780  1.00 25.17  ? 67  DG  I OP1   1 
ATOM 810  O OP2   . DG  A 1 67  ? 118.314 151.505 73.228  1.00 25.17  ? 67  DG  I OP2   1 
ATOM 811  O "O5'" . DG  A 1 67  ? 120.665 151.621 74.008  1.00 25.17  ? 67  DG  I "O5'" 1 
ATOM 812  C "C5'" . DG  A 1 67  ? 121.689 152.198 74.816  1.00 25.17  ? 67  DG  I "C5'" 1 
ATOM 813  C "C4'" . DG  A 1 67  ? 122.359 151.131 75.660  1.00 25.17  ? 67  DG  I "C4'" 1 
ATOM 814  O "O4'" . DG  A 1 67  ? 121.449 150.622 76.661  1.00 25.17  ? 67  DG  I "O4'" 1 
ATOM 815  C "C3'" . DG  A 1 67  ? 122.852 149.929 74.873  1.00 25.17  ? 67  DG  I "C3'" 1 
ATOM 816  O "O3'" . DG  A 1 67  ? 124.158 149.632 75.297  1.00 25.17  ? 67  DG  I "O3'" 1 
ATOM 817  C "C2'" . DG  A 1 67  ? 121.846 148.826 75.257  1.00 25.17  ? 67  DG  I "C2'" 1 
ATOM 818  C "C1'" . DG  A 1 67  ? 121.530 149.216 76.687  1.00 25.17  ? 67  DG  I "C1'" 1 
ATOM 819  N N9    . DG  A 1 67  ? 120.238 148.758 77.194  1.00 25.17  ? 67  DG  I N9    1 
ATOM 820  C C8    . DG  A 1 67  ? 119.039 148.824 76.536  1.00 25.17  ? 67  DG  I C8    1 
ATOM 821  N N7    . DG  A 1 67  ? 118.037 148.368 77.227  1.00 25.17  ? 67  DG  I N7    1 
ATOM 822  C C5    . DG  A 1 67  ? 118.612 147.917 78.403  1.00 25.17  ? 67  DG  I C5    1 
ATOM 823  C C6    . DG  A 1 67  ? 118.013 147.299 79.520  1.00 25.17  ? 67  DG  I C6    1 
ATOM 824  O O6    . DG  A 1 67  ? 116.820 147.024 79.693  1.00 25.17  ? 67  DG  I O6    1 
ATOM 825  N N1    . DG  A 1 67  ? 118.941 146.996 80.503  1.00 25.17  ? 67  DG  I N1    1 
ATOM 826  C C2    . DG  A 1 67  ? 120.285 147.254 80.420  1.00 25.17  ? 67  DG  I C2    1 
ATOM 827  N N2    . DG  A 1 67  ? 121.021 146.881 81.477  1.00 25.17  ? 67  DG  I N2    1 
ATOM 828  N N3    . DG  A 1 67  ? 120.867 147.837 79.373  1.00 25.17  ? 67  DG  I N3    1 
ATOM 829  C C4    . DG  A 1 67  ? 119.970 148.140 78.403  1.00 25.17  ? 67  DG  I C4    1 
ATOM 830  P P     . DG  A 1 68  ? 125.134 148.787 74.353  1.00 25.53  ? 68  DG  I P     1 
ATOM 831  O OP1   . DG  A 1 68  ? 126.360 149.589 74.153  1.00 25.53  ? 68  DG  I OP1   1 
ATOM 832  O OP2   . DG  A 1 68  ? 124.355 148.326 73.183  1.00 25.53  ? 68  DG  I OP2   1 
ATOM 833  O "O5'" . DG  A 1 68  ? 125.477 147.518 75.237  1.00 25.53  ? 68  DG  I "O5'" 1 
ATOM 834  C "C5'" . DG  A 1 68  ? 125.812 147.675 76.610  1.00 25.53  ? 68  DG  I "C5'" 1 
ATOM 835  C "C4'" . DG  A 1 68  ? 125.478 146.403 77.348  1.00 25.53  ? 68  DG  I "C4'" 1 
ATOM 836  O "O4'" . DG  A 1 68  ? 124.051 146.255 77.457  1.00 25.53  ? 68  DG  I "O4'" 1 
ATOM 837  C "C3'" . DG  A 1 68  ? 125.997 145.132 76.696  1.00 25.53  ? 68  DG  I "C3'" 1 
ATOM 838  O "O3'" . DG  A 1 68  ? 126.505 144.285 77.705  1.00 25.53  ? 68  DG  I "O3'" 1 
ATOM 839  C "C2'" . DG  A 1 68  ? 124.736 144.553 76.045  1.00 25.53  ? 68  DG  I "C2'" 1 
ATOM 840  C "C1'" . DG  A 1 68  ? 123.704 144.953 77.078  1.00 25.53  ? 68  DG  I "C1'" 1 
ATOM 841  N N9    . DG  A 1 68  ? 122.323 144.995 76.629  1.00 25.53  ? 68  DG  I N9    1 
ATOM 842  C C8    . DG  A 1 68  ? 121.839 145.337 75.391  1.00 25.53  ? 68  DG  I C8    1 
ATOM 843  N N7    . DG  A 1 68  ? 120.534 145.293 75.320  1.00 25.53  ? 68  DG  I N7    1 
ATOM 844  C C5    . DG  A 1 68  ? 120.146 144.870 76.583  1.00 25.53  ? 68  DG  I C5    1 
ATOM 845  C C6    . DG  A 1 68  ? 118.861 144.623 77.115  1.00 25.53  ? 68  DG  I C6    1 
ATOM 846  O O6    . DG  A 1 68  ? 117.758 144.731 76.564  1.00 25.53  ? 68  DG  I O6    1 
ATOM 847  N N1    . DG  A 1 68  ? 118.932 144.210 78.440  1.00 25.53  ? 68  DG  I N1    1 
ATOM 848  C C2    . DG  A 1 68  ? 120.092 144.055 79.155  1.00 25.53  ? 68  DG  I C2    1 
ATOM 849  N N2    . DG  A 1 68  ? 119.966 143.649 80.421  1.00 25.53  ? 68  DG  I N2    1 
ATOM 850  N N3    . DG  A 1 68  ? 121.289 144.283 78.670  1.00 25.53  ? 68  DG  I N3    1 
ATOM 851  C C4    . DG  A 1 68  ? 121.241 144.685 77.388  1.00 25.53  ? 68  DG  I C4    1 
ATOM 852  P P     . DG  A 1 69  ? 128.083 144.239 77.980  1.00 24.38  ? 69  DG  I P     1 
ATOM 853  O OP1   . DG  A 1 69  ? 128.429 145.513 78.643  1.00 24.38  ? 69  DG  I OP1   1 
ATOM 854  O OP2   . DG  A 1 69  ? 128.759 143.861 76.722  1.00 24.38  ? 69  DG  I OP2   1 
ATOM 855  O "O5'" . DG  A 1 69  ? 128.277 143.052 79.031  1.00 24.38  ? 69  DG  I "O5'" 1 
ATOM 856  C "C5'" . DG  A 1 69  ? 128.361 143.327 80.432  1.00 24.38  ? 69  DG  I "C5'" 1 
ATOM 857  C "C4'" . DG  A 1 69  ? 127.324 142.536 81.222  1.00 24.38  ? 69  DG  I "C4'" 1 
ATOM 858  O "O4'" . DG  A 1 69  ? 126.034 142.574 80.573  1.00 24.38  ? 69  DG  I "O4'" 1 
ATOM 859  C "C3'" . DG  A 1 69  ? 127.645 141.072 81.432  1.00 24.38  ? 69  DG  I "C3'" 1 
ATOM 860  O "O3'" . DG  A 1 69  ? 127.213 140.734 82.740  1.00 24.38  ? 69  DG  I "O3'" 1 
ATOM 861  C "C2'" . DG  A 1 69  ? 126.804 140.391 80.332  1.00 24.38  ? 69  DG  I "C2'" 1 
ATOM 862  C "C1'" . DG  A 1 69  ? 125.563 141.254 80.382  1.00 24.38  ? 69  DG  I "C1'" 1 
ATOM 863  N N9    . DG  A 1 69  ? 124.752 141.335 79.172  1.00 24.38  ? 69  DG  I N9    1 
ATOM 864  C C8    . DG  A 1 69  ? 125.192 141.607 77.905  1.00 24.38  ? 69  DG  I C8    1 
ATOM 865  N N7    . DG  A 1 69  ? 124.235 141.665 77.025  1.00 24.38  ? 69  DG  I N7    1 
ATOM 866  C C5    . DG  A 1 69  ? 123.096 141.354 77.742  1.00 24.38  ? 69  DG  I C5    1 
ATOM 867  C C6    . DG  A 1 69  ? 121.761 141.237 77.310  1.00 24.38  ? 69  DG  I C6    1 
ATOM 868  O O6    . DG  A 1 69  ? 121.309 141.395 76.170  1.00 24.38  ? 69  DG  I O6    1 
ATOM 869  N N1    . DG  A 1 69  ? 120.912 140.901 78.354  1.00 24.38  ? 69  DG  I N1    1 
ATOM 870  C C2    . DG  A 1 69  ? 121.307 140.705 79.652  1.00 24.38  ? 69  DG  I C2    1 
ATOM 871  N N2    . DG  A 1 69  ? 120.344 140.385 80.523  1.00 24.38  ? 69  DG  I N2    1 
ATOM 872  N N3    . DG  A 1 69  ? 122.557 140.813 80.071  1.00 24.38  ? 69  DG  I N3    1 
ATOM 873  C C4    . DG  A 1 69  ? 123.395 141.138 79.064  1.00 24.38  ? 69  DG  I C4    1 
ATOM 874  P P     . DG  A 1 70  ? 127.889 139.521 83.538  1.00 23.08  ? 70  DG  I P     1 
ATOM 875  O OP1   . DG  A 1 70  ? 128.422 140.065 84.804  1.00 23.08  ? 70  DG  I OP1   1 
ATOM 876  O OP2   . DG  A 1 70  ? 128.785 138.801 82.608  1.00 23.08  ? 70  DG  I OP2   1 
ATOM 877  O "O5'" . DG  A 1 70  ? 126.653 138.576 83.863  1.00 23.08  ? 70  DG  I "O5'" 1 
ATOM 878  C "C5'" . DG  A 1 70  ? 125.345 138.978 83.489  1.00 23.08  ? 70  DG  I "C5'" 1 
ATOM 879  C "C4'" . DG  A 1 70  ? 124.472 137.765 83.313  1.00 23.08  ? 70  DG  I "C4'" 1 
ATOM 880  O "O4'" . DG  A 1 70  ? 123.847 137.817 82.009  1.00 23.08  ? 70  DG  I "O4'" 1 
ATOM 881  C "C3'" . DG  A 1 70  ? 125.214 136.448 83.356  1.00 23.08  ? 70  DG  I "C3'" 1 
ATOM 882  O "O3'" . DG  A 1 70  ? 124.327 135.470 83.787  1.00 23.08  ? 70  DG  I "O3'" 1 
ATOM 883  C "C2'" . DG  A 1 70  ? 125.559 136.268 81.881  1.00 23.08  ? 70  DG  I "C2'" 1 
ATOM 884  C "C1'" . DG  A 1 70  ? 124.240 136.690 81.267  1.00 23.08  ? 70  DG  I "C1'" 1 
ATOM 885  N N9    . DG  A 1 70  ? 124.333 137.141 79.889  1.00 23.08  ? 70  DG  I N9    1 
ATOM 886  C C8    . DG  A 1 70  ? 125.466 137.457 79.186  1.00 23.08  ? 70  DG  I C8    1 
ATOM 887  N N7    . DG  A 1 70  ? 125.222 137.854 77.968  1.00 23.08  ? 70  DG  I N7    1 
ATOM 888  C C5    . DG  A 1 70  ? 123.842 137.769 77.856  1.00 23.08  ? 70  DG  I C5    1 
ATOM 889  C C6    . DG  A 1 70  ? 122.992 138.056 76.763  1.00 23.08  ? 70  DG  I C6    1 
ATOM 890  O O6    . DG  A 1 70  ? 123.293 138.460 75.631  1.00 23.08  ? 70  DG  I O6    1 
ATOM 891  N N1    . DG  A 1 70  ? 121.658 137.831 77.083  1.00 23.08  ? 70  DG  I N1    1 
ATOM 892  C C2    . DG  A 1 70  ? 121.204 137.386 78.301  1.00 23.08  ? 70  DG  I C2    1 
ATOM 893  N N2    . DG  A 1 70  ? 119.881 137.225 78.425  1.00 23.08  ? 70  DG  I N2    1 
ATOM 894  N N3    . DG  A 1 70  ? 121.989 137.118 79.325  1.00 23.08  ? 70  DG  I N3    1 
ATOM 895  C C4    . DG  A 1 70  ? 123.288 137.330 79.032  1.00 23.08  ? 70  DG  I C4    1 
ATOM 896  P P     . DA  A 1 71  ? 124.297 135.013 85.323  1.00 21.07  ? 71  DA  I P     1 
ATOM 897  O OP1   . DA  A 1 71  ? 124.713 136.156 86.157  1.00 21.07  ? 71  DA  I OP1   1 
ATOM 898  O OP2   . DA  A 1 71  ? 125.008 133.726 85.427  1.00 21.07  ? 71  DA  I OP2   1 
ATOM 899  O "O5'" . DA  A 1 71  ? 122.751 134.741 85.570  1.00 21.07  ? 71  DA  I "O5'" 1 
ATOM 900  C "C5'" . DA  A 1 71  ? 122.281 133.448 85.394  1.00 21.07  ? 71  DA  I "C5'" 1 
ATOM 901  C "C4'" . DA  A 1 71  ? 120.834 133.432 84.957  1.00 21.07  ? 71  DA  I "C4'" 1 
ATOM 902  O "O4'" . DA  A 1 71  ? 120.702 134.040 83.651  1.00 21.07  ? 71  DA  I "O4'" 1 
ATOM 903  C "C3'" . DA  A 1 71  ? 120.256 132.056 84.793  1.00 21.07  ? 71  DA  I "C3'" 1 
ATOM 904  O "O3'" . DA  A 1 71  ? 118.857 132.152 84.884  1.00 21.07  ? 71  DA  I "O3'" 1 
ATOM 905  C "C2'" . DA  A 1 71  ? 120.725 131.702 83.381  1.00 21.07  ? 71  DA  I "C2'" 1 
ATOM 906  C "C1'" . DA  A 1 71  ? 120.490 133.027 82.680  1.00 21.07  ? 71  DA  I "C1'" 1 
ATOM 907  N N9    . DA  A 1 71  ? 121.384 133.340 81.575  1.00 21.07  ? 71  DA  I N9    1 
ATOM 908  C C8    . DA  A 1 71  ? 122.742 133.428 81.622  1.00 21.07  ? 71  DA  I C8    1 
ATOM 909  N N7    . DA  A 1 71  ? 123.288 133.761 80.481  1.00 21.07  ? 71  DA  I N7    1 
ATOM 910  C C5    . DA  A 1 71  ? 122.216 133.863 79.618  1.00 21.07  ? 71  DA  I C5    1 
ATOM 911  C C6    . DA  A 1 71  ? 122.130 134.169 78.253  1.00 21.07  ? 71  DA  I C6    1 
ATOM 912  N N6    . DA  A 1 71  ? 123.194 134.445 77.495  1.00 21.07  ? 71  DA  I N6    1 
ATOM 913  N N1    . DA  A 1 71  ? 120.906 134.185 77.694  1.00 21.07  ? 71  DA  I N1    1 
ATOM 914  C C2    . DA  A 1 71  ? 119.846 133.910 78.456  1.00 21.07  ? 71  DA  I C2    1 
ATOM 915  N N3    . DA  A 1 71  ? 119.803 133.608 79.749  1.00 21.07  ? 71  DA  I N3    1 
ATOM 916  C C4    . DA  A 1 71  ? 121.034 133.602 80.275  1.00 21.07  ? 71  DA  I C4    1 
ATOM 917  P P     . DC  A 1 72  ? 117.981 130.842 85.142  1.00 22.97  ? 72  DC  I P     1 
ATOM 918  O OP1   . DC  A 1 72  ? 116.676 131.269 85.687  1.00 22.97  ? 72  DC  I OP1   1 
ATOM 919  O OP2   . DC  A 1 72  ? 118.816 129.882 85.892  1.00 22.97  ? 72  DC  I OP2   1 
ATOM 920  O "O5'" . DC  A 1 72  ? 117.768 130.267 83.672  1.00 22.97  ? 72  DC  I "O5'" 1 
ATOM 921  C "C5'" . DC  A 1 72  ? 117.040 131.029 82.705  1.00 22.97  ? 72  DC  I "C5'" 1 
ATOM 922  C "C4'" . DC  A 1 72  ? 116.986 130.267 81.402  1.00 22.97  ? 72  DC  I "C4'" 1 
ATOM 923  O "O4'" . DC  A 1 72  ? 118.103 130.635 80.543  1.00 22.97  ? 72  DC  I "O4'" 1 
ATOM 924  C "C3'" . DC  A 1 72  ? 117.028 128.752 81.547  1.00 22.97  ? 72  DC  I "C3'" 1 
ATOM 925  O "O3'" . DC  A 1 72  ? 116.061 128.203 80.674  1.00 22.97  ? 72  DC  I "O3'" 1 
ATOM 926  C "C2'" . DC  A 1 72  ? 118.465 128.417 81.120  1.00 22.97  ? 72  DC  I "C2'" 1 
ATOM 927  C "C1'" . DC  A 1 72  ? 118.662 129.452 80.036  1.00 22.97  ? 72  DC  I "C1'" 1 
ATOM 928  N N1    . DC  A 1 72  ? 120.077 129.728 79.647  1.00 22.97  ? 72  DC  I N1    1 
ATOM 929  C C2    . DC  A 1 72  ? 120.354 130.273 78.391  1.00 22.97  ? 72  DC  I C2    1 
ATOM 930  O O2    . DC  A 1 72  ? 119.450 130.315 77.550  1.00 22.97  ? 72  DC  I O2    1 
ATOM 931  N N3    . DC  A 1 72  ? 121.642 130.560 78.070  1.00 22.97  ? 72  DC  I N3    1 
ATOM 932  C C4    . DC  A 1 72  ? 122.595 130.458 78.994  1.00 22.97  ? 72  DC  I C4    1 
ATOM 933  N N4    . DC  A 1 72  ? 123.843 130.789 78.649  1.00 22.97  ? 72  DC  I N4    1 
ATOM 934  C C5    . DC  A 1 72  ? 122.311 130.010 80.314  1.00 22.97  ? 72  DC  I C5    1 
ATOM 935  C C6    . DC  A 1 72  ? 121.047 129.690 80.602  1.00 22.97  ? 72  DC  I C6    1 
ATOM 936  P P     . DA  A 1 73  ? 115.538 126.700 80.862  1.00 24.19  ? 73  DA  I P     1 
ATOM 937  O OP1   . DA  A 1 73  ? 114.161 126.770 81.392  1.00 24.19  ? 73  DA  I OP1   1 
ATOM 938  O OP2   . DA  A 1 73  ? 116.563 125.926 81.592  1.00 24.19  ? 73  DA  I OP2   1 
ATOM 939  O "O5'" . DA  A 1 73  ? 115.491 126.154 79.368  1.00 24.19  ? 73  DA  I "O5'" 1 
ATOM 940  C "C5'" . DA  A 1 73  ? 114.900 126.956 78.336  1.00 24.19  ? 73  DA  I "C5'" 1 
ATOM 941  C "C4'" . DA  A 1 73  ? 115.574 126.680 77.013  1.00 24.19  ? 73  DA  I "C4'" 1 
ATOM 942  O "O4'" . DA  A 1 73  ? 116.897 127.239 77.020  1.00 24.19  ? 73  DA  I "O4'" 1 
ATOM 943  C "C3'" . DA  A 1 73  ? 115.721 125.204 76.666  1.00 24.19  ? 73  DA  I "C3'" 1 
ATOM 944  O "O3'" . DA  A 1 73  ? 115.055 124.945 75.429  1.00 24.19  ? 73  DA  I "O3'" 1 
ATOM 945  C "C2'" . DA  A 1 73  ? 117.251 124.996 76.598  1.00 24.19  ? 73  DA  I "C2'" 1 
ATOM 946  C "C1'" . DA  A 1 73  ? 117.733 126.402 76.283  1.00 24.19  ? 73  DA  I "C1'" 1 
ATOM 947  N N9    . DA  A 1 73  ? 119.087 126.714 76.734  1.00 24.19  ? 73  DA  I N9    1 
ATOM 948  C C8    . DA  A 1 73  ? 119.566 126.577 78.003  1.00 24.19  ? 73  DA  I C8    1 
ATOM 949  N N7    . DA  A 1 73  ? 120.819 126.919 78.138  1.00 24.19  ? 73  DA  I N7    1 
ATOM 950  C C5    . DA  A 1 73  ? 121.220 127.218 76.854  1.00 24.19  ? 73  DA  I C5    1 
ATOM 951  C C6    . DA  A 1 73  ? 122.455 127.617 76.329  1.00 24.19  ? 73  DA  I C6    1 
ATOM 952  N N6    . DA  A 1 73  ? 123.541 127.787 77.080  1.00 24.19  ? 73  DA  I N6    1 
ATOM 953  N N1    . DA  A 1 73  ? 122.532 127.837 75.003  1.00 24.19  ? 73  DA  I N1    1 
ATOM 954  C C2    . DA  A 1 73  ? 121.436 127.664 74.256  1.00 24.19  ? 73  DA  I C2    1 
ATOM 955  N N3    . DA  A 1 73  ? 120.212 127.290 74.640  1.00 24.19  ? 73  DA  I N3    1 
ATOM 956  C C4    . DA  A 1 73  ? 120.173 127.080 75.966  1.00 24.19  ? 73  DA  I C4    1 
ATOM 957  P P     . DG  A 1 74  ? 114.746 123.438 74.979  1.00 24.92  ? 74  DG  I P     1 
ATOM 958  O OP1   . DG  A 1 74  ? 113.417 123.431 74.331  1.00 24.92  ? 74  DG  I OP1   1 
ATOM 959  O OP2   . DG  A 1 74  ? 115.021 122.555 76.133  1.00 24.92  ? 74  DG  I OP2   1 
ATOM 960  O "O5'" . DG  A 1 74  ? 115.850 123.149 73.875  1.00 24.92  ? 74  DG  I "O5'" 1 
ATOM 961  C "C5'" . DG  A 1 74  ? 116.040 124.070 72.811  1.00 24.92  ? 74  DG  I "C5'" 1 
ATOM 962  C "C4'" . DG  A 1 74  ? 117.321 123.744 72.091  1.00 24.92  ? 74  DG  I "C4'" 1 
ATOM 963  O "O4'" . DG  A 1 74  ? 118.420 124.263 72.851  1.00 24.92  ? 74  DG  I "O4'" 1 
ATOM 964  C "C3'" . DG  A 1 74  ? 117.594 122.251 71.899  1.00 24.92  ? 74  DG  I "C3'" 1 
ATOM 965  O "O3'" . DG  A 1 74  ? 117.735 121.963 70.513  1.00 24.92  ? 74  DG  I "O3'" 1 
ATOM 966  C "C2'" . DG  A 1 74  ? 118.881 121.995 72.697  1.00 24.92  ? 74  DG  I "C2'" 1 
ATOM 967  C "C1'" . DG  A 1 74  ? 119.493 123.381 72.748  1.00 24.92  ? 74  DG  I "C1'" 1 
ATOM 968  N N9    . DG  A 1 74  ? 120.337 123.620 73.903  1.00 24.92  ? 74  DG  I N9    1 
ATOM 969  C C8    . DG  A 1 74  ? 119.995 123.478 75.222  1.00 24.92  ? 74  DG  I C8    1 
ATOM 970  N N7    . DG  A 1 74  ? 120.963 123.769 76.040  1.00 24.92  ? 74  DG  I N7    1 
ATOM 971  C C5    . DG  A 1 74  ? 122.020 124.088 75.205  1.00 24.92  ? 74  DG  I C5    1 
ATOM 972  C C6    . DG  A 1 74  ? 123.337 124.468 75.516  1.00 24.92  ? 74  DG  I C6    1 
ATOM 973  O O6    . DG  A 1 74  ? 123.850 124.607 76.630  1.00 24.92  ? 74  DG  I O6    1 
ATOM 974  N N1    . DG  A 1 74  ? 124.086 124.701 74.369  1.00 24.92  ? 74  DG  I N1    1 
ATOM 975  C C2    . DG  A 1 74  ? 123.619 124.577 73.086  1.00 24.92  ? 74  DG  I C2    1 
ATOM 976  N N2    . DG  A 1 74  ? 124.483 124.842 72.102  1.00 24.92  ? 74  DG  I N2    1 
ATOM 977  N N3    . DG  A 1 74  ? 122.387 124.221 72.784  1.00 24.92  ? 74  DG  I N3    1 
ATOM 978  C C4    . DG  A 1 74  ? 121.648 123.994 73.889  1.00 24.92  ? 74  DG  I C4    1 
ATOM 979  P P     . DC  A 1 75  ? 117.831 120.445 70.005  1.00 25.46  ? 75  DC  I P     1 
ATOM 980  O OP1   . DC  A 1 75  ? 117.094 120.359 68.726  1.00 25.46  ? 75  DC  I OP1   1 
ATOM 981  O OP2   . DC  A 1 75  ? 117.456 119.568 71.135  1.00 25.46  ? 75  DC  I OP2   1 
ATOM 982  O "O5'" . DC  A 1 75  ? 119.391 120.245 69.713  1.00 25.46  ? 75  DC  I "O5'" 1 
ATOM 983  C "C5'" . DC  A 1 75  ? 120.061 121.143 68.832  1.00 25.46  ? 75  DC  I "C5'" 1 
ATOM 984  C "C4'" . DC  A 1 75  ? 121.561 120.911 68.845  1.00 25.46  ? 75  DC  I "C4'" 1 
ATOM 985  O "O4'" . DC  A 1 75  ? 122.124 121.385 70.089  1.00 25.46  ? 75  DC  I "O4'" 1 
ATOM 986  C "C3'" . DC  A 1 75  ? 122.002 119.452 68.706  1.00 25.46  ? 75  DC  I "C3'" 1 
ATOM 987  O "O3'" . DC  A 1 75  ? 122.979 119.356 67.691  1.00 25.46  ? 75  DC  I "O3'" 1 
ATOM 988  C "C2'" . DC  A 1 75  ? 122.577 119.114 70.086  1.00 25.46  ? 75  DC  I "C2'" 1 
ATOM 989  C "C1'" . DC  A 1 75  ? 123.089 120.468 70.534  1.00 25.46  ? 75  DC  I "C1'" 1 
ATOM 990  N N1    . DC  A 1 75  ? 123.187 120.622 72.004  1.00 25.46  ? 75  DC  I N1    1 
ATOM 991  C C2    . DC  A 1 75  ? 124.391 121.025 72.586  1.00 25.46  ? 75  DC  I C2    1 
ATOM 992  O O2    . DC  A 1 75  ? 125.378 121.204 71.866  1.00 25.46  ? 75  DC  I O2    1 
ATOM 993  N N3    . DC  A 1 75  ? 124.446 121.183 73.930  1.00 25.46  ? 75  DC  I N3    1 
ATOM 994  C C4    . DC  A 1 75  ? 123.358 120.974 74.668  1.00 25.46  ? 75  DC  I C4    1 
ATOM 995  N N4    . DC  A 1 75  ? 123.453 121.144 75.988  1.00 25.46  ? 75  DC  I N4    1 
ATOM 996  C C5    . DC  A 1 75  ? 122.121 120.582 74.089  1.00 25.46  ? 75  DC  I C5    1 
ATOM 997  C C6    . DC  A 1 75  ? 122.080 120.427 72.767  1.00 25.46  ? 75  DC  I C6    1 
ATOM 998  P P     . DG  A 1 76  ? 123.308 117.943 67.010  1.00 24.40  ? 76  DG  I P     1 
ATOM 999  O OP1   . DG  A 1 76  ? 123.259 118.118 65.542  1.00 24.40  ? 76  DG  I OP1   1 
ATOM 1000 O OP2   . DG  A 1 76  ? 122.461 116.922 67.664  1.00 24.40  ? 76  DG  I OP2   1 
ATOM 1001 O "O5'" . DG  A 1 76  ? 124.814 117.666 67.444  1.00 24.40  ? 76  DG  I "O5'" 1 
ATOM 1002 C "C5'" . DG  A 1 76  ? 125.787 118.688 67.298  1.00 24.40  ? 76  DG  I "C5'" 1 
ATOM 1003 C "C4'" . DG  A 1 76  ? 127.029 118.355 68.102  1.00 24.40  ? 76  DG  I "C4'" 1 
ATOM 1004 O "O4'" . DG  A 1 76  ? 126.813 118.662 69.500  1.00 24.40  ? 76  DG  I "O4'" 1 
ATOM 1005 C "C3'" . DG  A 1 76  ? 127.458 116.893 68.043  1.00 24.40  ? 76  DG  I "C3'" 1 
ATOM 1006 O "O3'" . DG  A 1 76  ? 128.853 116.831 67.861  1.00 24.40  ? 76  DG  I "O3'" 1 
ATOM 1007 C "C2'" . DG  A 1 76  ? 127.045 116.356 69.416  1.00 24.40  ? 76  DG  I "C2'" 1 
ATOM 1008 C "C1'" . DG  A 1 76  ? 127.249 117.582 70.287  1.00 24.40  ? 76  DG  I "C1'" 1 
ATOM 1009 N N9    . DG  A 1 76  ? 126.465 117.594 71.518  1.00 24.40  ? 76  DG  I N9    1 
ATOM 1010 C C8    . DG  A 1 76  ? 125.132 117.303 71.655  1.00 24.40  ? 76  DG  I C8    1 
ATOM 1011 N N7    . DG  A 1 76  ? 124.697 117.431 72.877  1.00 24.40  ? 76  DG  I N7    1 
ATOM 1012 C C5    . DG  A 1 76  ? 125.810 117.845 73.592  1.00 24.40  ? 76  DG  I C5    1 
ATOM 1013 C C6    . DG  A 1 76  ? 125.950 118.144 74.967  1.00 24.40  ? 76  DG  I C6    1 
ATOM 1014 O O6    . DG  A 1 76  ? 125.088 118.104 75.853  1.00 24.40  ? 76  DG  I O6    1 
ATOM 1015 N N1    . DG  A 1 76  ? 127.250 118.527 75.281  1.00 24.40  ? 76  DG  I N1    1 
ATOM 1016 C C2    . DG  A 1 76  ? 128.282 118.606 74.381  1.00 24.40  ? 76  DG  I C2    1 
ATOM 1017 N N2    . DG  A 1 76  ? 129.469 118.995 74.863  1.00 24.40  ? 76  DG  I N2    1 
ATOM 1018 N N3    . DG  A 1 76  ? 128.161 118.330 73.091  1.00 24.40  ? 76  DG  I N3    1 
ATOM 1019 C C4    . DG  A 1 76  ? 126.903 117.957 72.770  1.00 24.40  ? 76  DG  I C4    1 
ATOM 1020 P P     . DC  A 1 77  ? 129.513 115.575 67.116  1.00 25.25  ? 77  DC  I P     1 
ATOM 1021 O OP1   . DC  A 1 77  ? 129.892 116.018 65.757  1.00 25.25  ? 77  DC  I OP1   1 
ATOM 1022 O OP2   . DC  A 1 77  ? 128.604 114.420 67.279  1.00 25.25  ? 77  DC  I OP2   1 
ATOM 1023 O "O5'" . DC  A 1 77  ? 130.837 115.283 67.956  1.00 25.25  ? 77  DC  I "O5'" 1 
ATOM 1024 C "C5'" . DC  A 1 77  ? 131.710 116.348 68.325  1.00 25.25  ? 77  DC  I "C5'" 1 
ATOM 1025 C "C4'" . DC  A 1 77  ? 132.339 116.055 69.676  1.00 25.25  ? 77  DC  I "C4'" 1 
ATOM 1026 O "O4'" . DC  A 1 77  ? 131.344 116.090 70.726  1.00 25.25  ? 77  DC  I "O4'" 1 
ATOM 1027 C "C3'" . DC  A 1 77  ? 133.035 114.708 69.783  1.00 25.25  ? 77  DC  I "C3'" 1 
ATOM 1028 O "O3'" . DC  A 1 77  ? 134.293 114.910 70.386  1.00 25.25  ? 77  DC  I "O3'" 1 
ATOM 1029 C "C2'" . DC  A 1 77  ? 132.087 113.881 70.673  1.00 25.25  ? 77  DC  I "C2'" 1 
ATOM 1030 C "C1'" . DC  A 1 77  ? 131.509 114.964 71.561  1.00 25.25  ? 77  DC  I "C1'" 1 
ATOM 1031 N N1    . DC  A 1 77  ? 130.172 114.683 72.148  1.00 25.25  ? 77  DC  I N1    1 
ATOM 1032 C C2    . DC  A 1 77  ? 129.897 115.077 73.460  1.00 25.25  ? 77  DC  I C2    1 
ATOM 1033 O O2    . DC  A 1 77  ? 130.822 115.481 74.169  1.00 25.25  ? 77  DC  I O2    1 
ATOM 1034 N N3    . DC  A 1 77  ? 128.655 114.881 73.958  1.00 25.25  ? 77  DC  I N3    1 
ATOM 1035 C C4    . DC  A 1 77  ? 127.689 114.418 73.171  1.00 25.25  ? 77  DC  I C4    1 
ATOM 1036 N N4    . DC  A 1 77  ? 126.472 114.264 73.698  1.00 25.25  ? 77  DC  I N4    1 
ATOM 1037 C C5    . DC  A 1 77  ? 127.927 114.088 71.808  1.00 25.25  ? 77  DC  I C5    1 
ATOM 1038 C C6    . DC  A 1 77  ? 129.163 114.265 71.335  1.00 25.25  ? 77  DC  I C6    1 
ATOM 1039 P P     . DG  A 1 78  ? 135.442 113.802 70.281  1.00 25.05  ? 78  DG  I P     1 
ATOM 1040 O OP1   . DG  A 1 78  ? 136.717 114.486 69.972  1.00 25.05  ? 78  DG  I OP1   1 
ATOM 1041 O OP2   . DG  A 1 78  ? 134.959 112.698 69.421  1.00 25.05  ? 78  DG  I OP2   1 
ATOM 1042 O "O5'" . DG  A 1 78  ? 135.498 113.271 71.772  1.00 25.05  ? 78  DG  I "O5'" 1 
ATOM 1043 C "C5'" . DG  A 1 78  ? 135.043 114.117 72.821  1.00 25.05  ? 78  DG  I "C5'" 1 
ATOM 1044 C "C4'" . DG  A 1 78  ? 134.974 113.335 74.105  1.00 25.05  ? 78  DG  I "C4'" 1 
ATOM 1045 O "O4'" . DG  A 1 78  ? 133.593 113.193 74.508  1.00 25.05  ? 78  DG  I "O4'" 1 
ATOM 1046 C "C3'" . DG  A 1 78  ? 135.535 111.928 74.002  1.00 25.05  ? 78  DG  I "C3'" 1 
ATOM 1047 O "O3'" . DG  A 1 78  ? 136.188 111.589 75.204  1.00 25.05  ? 78  DG  I "O3'" 1 
ATOM 1048 C "C2'" . DG  A 1 78  ? 134.284 111.094 73.791  1.00 25.05  ? 78  DG  I "C2'" 1 
ATOM 1049 C "C1'" . DG  A 1 78  ? 133.302 111.831 74.676  1.00 25.05  ? 78  DG  I "C1'" 1 
ATOM 1050 N N9    . DG  A 1 78  ? 131.914 111.609 74.324  1.00 25.05  ? 78  DG  I N9    1 
ATOM 1051 C C8    . DG  A 1 78  ? 131.408 111.217 73.111  1.00 25.05  ? 78  DG  I C8    1 
ATOM 1052 N N7    . DG  A 1 78  ? 130.109 111.109 73.107  1.00 25.05  ? 78  DG  I N7    1 
ATOM 1053 C C5    . DG  A 1 78  ? 129.741 111.461 74.397  1.00 25.05  ? 78  DG  I C5    1 
ATOM 1054 C C6    . DG  A 1 78  ? 128.467 111.538 74.993  1.00 25.05  ? 78  DG  I C6    1 
ATOM 1055 O O6    . DG  A 1 78  ? 127.364 111.302 74.486  1.00 25.05  ? 78  DG  I O6    1 
ATOM 1056 N N1    . DG  A 1 78  ? 128.549 111.936 76.323  1.00 25.05  ? 78  DG  I N1    1 
ATOM 1057 C C2    . DG  A 1 78  ? 129.715 112.222 76.986  1.00 25.05  ? 78  DG  I C2    1 
ATOM 1058 N N2    . DG  A 1 78  ? 129.608 112.593 78.265  1.00 25.05  ? 78  DG  I N2    1 
ATOM 1059 N N3    . DG  A 1 78  ? 130.907 112.156 76.435  1.00 25.05  ? 78  DG  I N3    1 
ATOM 1060 C C4    . DG  A 1 78  ? 130.844 111.770 75.148  1.00 25.05  ? 78  DG  I C4    1 
ATOM 1061 P P     . DT  A 1 79  ? 137.773 111.775 75.332  1.00 25.04  ? 79  DT  I P     1 
ATOM 1062 O OP1   . DT  A 1 79  ? 138.182 112.887 74.446  1.00 25.04  ? 79  DT  I OP1   1 
ATOM 1063 O OP2   . DT  A 1 79  ? 138.390 110.442 75.170  1.00 25.04  ? 79  DT  I OP2   1 
ATOM 1064 O "O5'" . DT  A 1 79  ? 137.969 112.228 76.848  1.00 25.04  ? 79  DT  I "O5'" 1 
ATOM 1065 C "C5'" . DT  A 1 79  ? 137.759 111.295 77.903  1.00 25.04  ? 79  DT  I "C5'" 1 
ATOM 1066 C "C4'" . DT  A 1 79  ? 136.946 111.894 79.040  1.00 25.04  ? 79  DT  I "C4'" 1 
ATOM 1067 O "O4'" . DT  A 1 79  ? 135.526 111.855 78.704  1.00 25.04  ? 79  DT  I "O4'" 1 
ATOM 1068 C "C3'" . DT  A 1 79  ? 137.031 111.134 80.343  1.00 25.04  ? 79  DT  I "C3'" 1 
ATOM 1069 O "O3'" . DT  A 1 79  ? 136.741 112.037 81.405  1.00 25.04  ? 79  DT  I "O3'" 1 
ATOM 1070 C "C2'" . DT  A 1 79  ? 135.965 110.058 80.169  1.00 25.04  ? 79  DT  I "C2'" 1 
ATOM 1071 C "C1'" . DT  A 1 79  ? 134.875 110.853 79.490  1.00 25.04  ? 79  DT  I "C1'" 1 
ATOM 1072 N N1    . DT  A 1 79  ? 133.954 110.076 78.588  1.00 25.04  ? 79  DT  I N1    1 
ATOM 1073 C C2    . DT  A 1 79  ? 132.596 110.119 78.813  1.00 25.04  ? 79  DT  I C2    1 
ATOM 1074 O O2    . DT  A 1 79  ? 132.100 110.641 79.791  1.00 25.04  ? 79  DT  I O2    1 
ATOM 1075 N N3    . DT  A 1 79  ? 131.844 109.435 77.895  1.00 25.04  ? 79  DT  I N3    1 
ATOM 1076 C C4    . DT  A 1 79  ? 132.292 108.791 76.762  1.00 25.04  ? 79  DT  I C4    1 
ATOM 1077 O O4    . DT  A 1 79  ? 131.533 108.220 75.990  1.00 25.04  ? 79  DT  I O4    1 
ATOM 1078 C C5    . DT  A 1 79  ? 133.713 108.836 76.549  1.00 25.04  ? 79  DT  I C5    1 
ATOM 1079 C C7    . DT  A 1 79  ? 134.313 108.159 75.353  1.00 25.04  ? 79  DT  I C7    1 
ATOM 1080 C C6    . DT  A 1 79  ? 134.465 109.489 77.449  1.00 25.04  ? 79  DT  I C6    1 
ATOM 1081 P P     . DA  A 1 80  ? 137.248 111.716 82.890  1.00 23.54  ? 80  DA  I P     1 
ATOM 1082 O OP1   . DA  A 1 80  ? 137.261 112.979 83.656  1.00 23.54  ? 80  DA  I OP1   1 
ATOM 1083 O OP2   . DA  A 1 80  ? 138.477 110.902 82.778  1.00 23.54  ? 80  DA  I OP2   1 
ATOM 1084 O "O5'" . DA  A 1 80  ? 136.110 110.780 83.478  1.00 23.54  ? 80  DA  I "O5'" 1 
ATOM 1085 C "C5'" . DA  A 1 80  ? 134.777 111.268 83.550  1.00 23.54  ? 80  DA  I "C5'" 1 
ATOM 1086 C "C4'" . DA  A 1 80  ? 133.835 110.151 83.922  1.00 23.54  ? 80  DA  I "C4'" 1 
ATOM 1087 O "O4'" . DA  A 1 80  ? 133.469 109.384 82.759  1.00 23.54  ? 80  DA  I "O4'" 1 
ATOM 1088 C "C3'" . DA  A 1 80  ? 134.384 109.172 84.941  1.00 23.54  ? 80  DA  I "C3'" 1 
ATOM 1089 O "O3'" . DA  A 1 80  ? 133.358 108.863 85.828  1.00 23.54  ? 80  DA  I "O3'" 1 
ATOM 1090 C "C2'" . DA  A 1 80  ? 134.746 107.964 84.061  1.00 23.54  ? 80  DA  I "C2'" 1 
ATOM 1091 C "C1'" . DA  A 1 80  ? 133.619 108.022 83.045  1.00 23.54  ? 80  DA  I "C1'" 1 
ATOM 1092 N N9    . DA  A 1 80  ? 133.867 107.360 81.772  1.00 23.54  ? 80  DA  I N9    1 
ATOM 1093 C C8    . DA  A 1 80  ? 135.069 107.095 81.186  1.00 23.54  ? 80  DA  I C8    1 
ATOM 1094 N N7    . DA  A 1 80  ? 134.965 106.515 80.012  1.00 23.54  ? 80  DA  I N7    1 
ATOM 1095 C C5    . DA  A 1 80  ? 133.600 106.371 79.835  1.00 23.54  ? 80  DA  I C5    1 
ATOM 1096 C C6    . DA  A 1 80  ? 132.826 105.814 78.797  1.00 23.54  ? 80  DA  I C6    1 
ATOM 1097 N N6    . DA  A 1 80  ? 133.351 105.276 77.692  1.00 23.54  ? 80  DA  I N6    1 
ATOM 1098 N N1    . DA  A 1 80  ? 131.484 105.834 78.940  1.00 23.54  ? 80  DA  I N1    1 
ATOM 1099 C C2    . DA  A 1 80  ? 130.970 106.372 80.047  1.00 23.54  ? 80  DA  I C2    1 
ATOM 1100 N N3    . DA  A 1 80  ? 131.593 106.922 81.080  1.00 23.54  ? 80  DA  I N3    1 
ATOM 1101 C C4    . DA  A 1 80  ? 132.916 106.889 80.910  1.00 23.54  ? 80  DA  I C4    1 
ATOM 1102 P P     . DC  A 1 81  ? 133.632 108.753 87.402  1.00 21.80  ? 81  DC  I P     1 
ATOM 1103 O OP1   . DC  A 1 81  ? 133.754 110.124 87.940  1.00 21.80  ? 81  DC  I OP1   1 
ATOM 1104 O OP2   . DC  A 1 81  ? 134.710 107.766 87.624  1.00 21.80  ? 81  DC  I OP2   1 
ATOM 1105 O "O5'" . DC  A 1 81  ? 132.275 108.131 87.938  1.00 21.80  ? 81  DC  I "O5'" 1 
ATOM 1106 C "C5'" . DC  A 1 81  ? 131.037 108.723 87.582  1.00 21.80  ? 81  DC  I "C5'" 1 
ATOM 1107 C "C4'" . DC  A 1 81  ? 130.068 107.641 87.172  1.00 21.80  ? 81  DC  I "C4'" 1 
ATOM 1108 O "O4'" . DC  A 1 81  ? 130.474 107.069 85.907  1.00 21.80  ? 81  DC  I "O4'" 1 
ATOM 1109 C "C3'" . DC  A 1 81  ? 129.965 106.491 88.154  1.00 21.80  ? 81  DC  I "C3'" 1 
ATOM 1110 O "O3'" . DC  A 1 81  ? 128.628 106.349 88.554  1.00 21.80  ? 81  DC  I "O3'" 1 
ATOM 1111 C "C2'" . DC  A 1 81  ? 130.480 105.270 87.372  1.00 21.80  ? 81  DC  I "C2'" 1 
ATOM 1112 C "C1'" . DC  A 1 81  ? 130.253 105.682 85.930  1.00 21.80  ? 81  DC  I "C1'" 1 
ATOM 1113 N N1    . DC  A 1 81  ? 131.217 105.077 84.955  1.00 21.80  ? 81  DC  I N1    1 
ATOM 1114 C C2    . DC  A 1 81  ? 130.757 104.467 83.774  1.00 21.80  ? 81  DC  I C2    1 
ATOM 1115 O O2    . DC  A 1 81  ? 129.543 104.307 83.598  1.00 21.80  ? 81  DC  I O2    1 
ATOM 1116 N N3    . DC  A 1 81  ? 131.669 103.974 82.898  1.00 21.80  ? 81  DC  I N3    1 
ATOM 1117 C C4    . DC  A 1 81  ? 132.970 104.140 83.125  1.00 21.80  ? 81  DC  I C4    1 
ATOM 1118 N N4    . DC  A 1 81  ? 133.831 103.656 82.227  1.00 21.80  ? 81  DC  I N4    1 
ATOM 1119 C C5    . DC  A 1 81  ? 133.449 104.803 84.285  1.00 21.80  ? 81  DC  I C5    1 
ATOM 1120 C C6    . DC  A 1 81  ? 132.549 105.271 85.149  1.00 21.80  ? 81  DC  I C6    1 
ATOM 1121 P P     . DG  A 1 82  ? 128.257 105.391 89.778  1.00 23.36  ? 82  DG  I P     1 
ATOM 1122 O OP1   . DG  A 1 82  ? 127.287 106.097 90.635  1.00 23.36  ? 82  DG  I OP1   1 
ATOM 1123 O OP2   . DG  A 1 82  ? 129.511 104.886 90.370  1.00 23.36  ? 82  DG  I OP2   1 
ATOM 1124 O "O5'" . DG  A 1 82  ? 127.516 104.190 89.047  1.00 23.36  ? 82  DG  I "O5'" 1 
ATOM 1125 C "C5'" . DG  A 1 82  ? 126.320 104.438 88.323  1.00 23.36  ? 82  DG  I "C5'" 1 
ATOM 1126 C "C4'" . DG  A 1 82  ? 125.978 103.249 87.457  1.00 23.36  ? 82  DG  I "C4'" 1 
ATOM 1127 O "O4'" . DG  A 1 82  ? 127.004 103.042 86.466  1.00 23.36  ? 82  DG  I "O4'" 1 
ATOM 1128 C "C3'" . DG  A 1 82  ? 125.817 101.944 88.208  1.00 23.36  ? 82  DG  I "C3'" 1 
ATOM 1129 O "O3'" . DG  A 1 82  ? 124.618 101.337 87.793  1.00 23.36  ? 82  DG  I "O3'" 1 
ATOM 1130 C "C2'" . DG  A 1 82  ? 127.064 101.137 87.808  1.00 23.36  ? 82  DG  I "C2'" 1 
ATOM 1131 C "C1'" . DG  A 1 82  ? 127.361 101.685 86.424  1.00 23.36  ? 82  DG  I "C1'" 1 
ATOM 1132 N N9    . DG  A 1 82  ? 128.765 101.663 86.038  1.00 23.36  ? 82  DG  I N9    1 
ATOM 1133 C C8    . DG  A 1 82  ? 129.807 102.177 86.756  1.00 23.36  ? 82  DG  I C8    1 
ATOM 1134 N N7    . DG  A 1 82  ? 130.959 102.045 86.174  1.00 23.36  ? 82  DG  I N7    1 
ATOM 1135 C C5    . DG  A 1 82  ? 130.674 101.347 85.015  1.00 23.36  ? 82  DG  I C5    1 
ATOM 1136 C C6    . DG  A 1 82  ? 131.541 100.898 84.000  1.00 23.36  ? 82  DG  I C6    1 
ATOM 1137 O O6    . DG  A 1 82  ? 132.768 101.037 83.931  1.00 23.36  ? 82  DG  I O6    1 
ATOM 1138 N N1    . DG  A 1 82  ? 130.854 100.228 82.994  1.00 23.36  ? 82  DG  I N1    1 
ATOM 1139 C C2    . DG  A 1 82  ? 129.499 100.014 82.976  1.00 23.36  ? 82  DG  I C2    1 
ATOM 1140 N N2    . DG  A 1 82  ? 129.017 99.348  81.918  1.00 23.36  ? 82  DG  I N2    1 
ATOM 1141 N N3    . DG  A 1 82  ? 128.669 100.439 83.924  1.00 23.36  ? 82  DG  I N3    1 
ATOM 1142 C C4    . DG  A 1 82  ? 129.327 101.095 84.912  1.00 23.36  ? 82  DG  I C4    1 
ATOM 1143 P P     . DT  A 1 83  ? 123.923 100.226 88.709  1.00 26.99  ? 83  DT  I P     1 
ATOM 1144 O OP1   . DT  A 1 83  ? 122.492 100.577 88.825  1.00 26.99  ? 83  DT  I OP1   1 
ATOM 1145 O OP2   . DT  A 1 83  ? 124.745 100.082 89.930  1.00 26.99  ? 83  DT  I OP2   1 
ATOM 1146 O "O5'" . DT  A 1 83  ? 124.060 98.890  87.853  1.00 26.99  ? 83  DT  I "O5'" 1 
ATOM 1147 C "C5'" . DT  A 1 83  ? 123.644 98.875  86.486  1.00 26.99  ? 83  DT  I "C5'" 1 
ATOM 1148 C "C4'" . DT  A 1 83  ? 124.174 97.639  85.795  1.00 26.99  ? 83  DT  I "C4'" 1 
ATOM 1149 O "O4'" . DT  A 1 83  ? 125.558 97.836  85.414  1.00 26.99  ? 83  DT  I "O4'" 1 
ATOM 1150 C "C3'" . DT  A 1 83  ? 124.127 96.371  86.642  1.00 26.99  ? 83  DT  I "C3'" 1 
ATOM 1151 O "O3'" . DT  A 1 83  ? 123.499 95.330  85.889  1.00 26.99  ? 83  DT  I "O3'" 1 
ATOM 1152 C "C2'" . DT  A 1 83  ? 125.608 96.089  86.946  1.00 26.99  ? 83  DT  I "C2'" 1 
ATOM 1153 C "C1'" . DT  A 1 83  ? 126.271 96.667  85.712  1.00 26.99  ? 83  DT  I "C1'" 1 
ATOM 1154 N N1    . DT  A 1 83  ? 127.675 97.084  85.828  1.00 20.00  ? 83  DT  I N1    1 
ATOM 1155 C C2    . DT  A 1 83  ? 128.579 96.735  84.834  1.00 20.00  ? 83  DT  I C2    1 
ATOM 1156 O O2    . DT  A 1 83  ? 128.287 96.041  83.859  1.00 20.00  ? 83  DT  I O2    1 
ATOM 1157 N N3    . DT  A 1 83  ? 129.846 97.232  85.023  1.00 20.00  ? 83  DT  I N3    1 
ATOM 1158 C C4    . DT  A 1 83  ? 130.299 98.007  86.060  1.00 20.00  ? 83  DT  I C4    1 
ATOM 1159 O O4    . DT  A 1 83  ? 131.471 98.380  86.072  1.00 20.00  ? 83  DT  I O4    1 
ATOM 1160 C C5    . DT  A 1 83  ? 129.312 98.321  87.073  1.00 20.00  ? 83  DT  I C5    1 
ATOM 1161 C C7    . DT  A 1 83  ? 129.714 99.159  88.243  1.00 20.00  ? 83  DT  I C7    1 
ATOM 1162 C C6    . DT  A 1 83  ? 128.066 97.842  86.911  1.00 20.00  ? 83  DT  I C6    1 
ATOM 1163 P P     . DG  A 1 84  ? 123.110 93.945  86.596  1.00 28.36  ? 84  DG  I P     1 
ATOM 1164 O OP1   . DG  A 1 84  ? 121.771 93.558  86.103  1.00 28.36  ? 84  DG  I OP1   1 
ATOM 1165 O OP2   . DG  A 1 84  ? 123.338 94.104  88.048  1.00 28.36  ? 84  DG  I OP2   1 
ATOM 1166 O "O5'" . DG  A 1 84  ? 124.196 92.917  86.041  1.00 28.36  ? 84  DG  I "O5'" 1 
ATOM 1167 C "C5'" . DG  A 1 84  ? 124.406 92.807  84.626  1.00 28.36  ? 84  DG  I "C5'" 1 
ATOM 1168 C "C4'" . DG  A 1 84  ? 125.627 91.963  84.342  1.00 28.36  ? 84  DG  I "C4'" 1 
ATOM 1169 O "O4'" . DG  A 1 84  ? 126.805 92.761  84.577  1.00 28.36  ? 84  DG  I "O4'" 1 
ATOM 1170 C "C3'" . DG  A 1 84  ? 125.757 90.709  85.207  1.00 28.36  ? 84  DG  I "C3'" 1 
ATOM 1171 O "O3'" . DG  A 1 84  ? 126.023 89.559  84.391  1.00 28.36  ? 84  DG  I "O3'" 1 
ATOM 1172 C "C2'" . DG  A 1 84  ? 126.918 91.052  86.143  1.00 28.36  ? 84  DG  I "C2'" 1 
ATOM 1173 C "C1'" . DG  A 1 84  ? 127.736 92.002  85.284  1.00 28.36  ? 84  DG  I "C1'" 1 
ATOM 1174 N N9    . DG  A 1 84  ? 128.525 92.949  86.054  1.00 28.36  ? 84  DG  I N9    1 
ATOM 1175 C C8    . DG  A 1 84  ? 128.095 93.689  87.125  1.00 28.36  ? 84  DG  I C8    1 
ATOM 1176 N N7    . DG  A 1 84  ? 129.016 94.449  87.635  1.00 28.36  ? 84  DG  I N7    1 
ATOM 1177 C C5    . DG  A 1 84  ? 130.146 94.157  86.888  1.00 28.36  ? 84  DG  I C5    1 
ATOM 1178 C C6    . DG  A 1 84  ? 131.455 94.660  86.996  1.00 28.36  ? 84  DG  I C6    1 
ATOM 1179 O O6    . DG  A 1 84  ? 131.885 95.492  87.800  1.00 28.36  ? 84  DG  I O6    1 
ATOM 1180 N N1    . DG  A 1 84  ? 132.303 94.102  86.048  1.00 28.36  ? 84  DG  I N1    1 
ATOM 1181 C C2    . DG  A 1 84  ? 131.932 93.170  85.112  1.00 28.36  ? 84  DG  I C2    1 
ATOM 1182 N N2    . DG  A 1 84  ? 132.891 92.746  84.278  1.00 28.36  ? 84  DG  I N2    1 
ATOM 1183 N N3    . DG  A 1 84  ? 130.702 92.688  84.997  1.00 28.36  ? 84  DG  I N3    1 
ATOM 1184 C C4    . DG  A 1 84  ? 129.864 93.226  85.916  1.00 28.36  ? 84  DG  I C4    1 
ATOM 1185 P P     . DC  A 1 85  ? 125.917 88.086  85.026  1.00 29.59  ? 85  DC  I P     1 
ATOM 1186 O OP1   . DC  A 1 85  ? 125.349 87.197  83.989  1.00 29.59  ? 85  DC  I OP1   1 
ATOM 1187 O OP2   . DC  A 1 85  ? 125.245 88.220  86.336  1.00 29.59  ? 85  DC  I OP2   1 
ATOM 1188 O "O5'" . DC  A 1 85  ? 127.431 87.651  85.294  1.00 29.59  ? 85  DC  I "O5'" 1 
ATOM 1189 C "C5'" . DC  A 1 85  ? 128.199 87.063  84.241  1.00 29.59  ? 85  DC  I "C5'" 1 
ATOM 1190 C "C4'" . DC  A 1 85  ? 129.680 87.326  84.446  1.00 29.59  ? 85  DC  I "C4'" 1 
ATOM 1191 O "O4'" . DC  A 1 85  ? 129.871 88.615  85.003  1.00 29.59  ? 85  DC  I "O4'" 1 
ATOM 1192 C "C3'" . DC  A 1 85  ? 130.403 86.389  85.400  1.00 29.59  ? 85  DC  I "C3'" 1 
ATOM 1193 O "O3'" . DC  A 1 85  ? 130.829 85.243  84.687  1.00 29.59  ? 85  DC  I "O3'" 1 
ATOM 1194 C "C2'" . DC  A 1 85  ? 131.593 87.234  85.885  1.00 29.59  ? 85  DC  I "C2'" 1 
ATOM 1195 C "C1'" . DC  A 1 85  ? 131.165 88.670  85.547  1.00 29.59  ? 85  DC  I "C1'" 1 
ATOM 1196 N N1    . DC  A 1 85  ? 131.148 89.642  86.659  1.00 29.59  ? 85  DC  I N1    1 
ATOM 1197 C C2    . DC  A 1 85  ? 132.318 90.304  87.008  1.00 29.59  ? 85  DC  I C2    1 
ATOM 1198 O O2    . DC  A 1 85  ? 133.363 90.017  86.420  1.00 29.59  ? 85  DC  I O2    1 
ATOM 1199 N N3    . DC  A 1 85  ? 132.276 91.235  87.987  1.00 29.59  ? 85  DC  I N3    1 
ATOM 1200 C C4    . DC  A 1 85  ? 131.123 91.515  88.591  1.00 29.59  ? 85  DC  I C4    1 
ATOM 1201 N N4    . DC  A 1 85  ? 131.129 92.439  89.554  1.00 29.59  ? 85  DC  I N4    1 
ATOM 1202 C C5    . DC  A 1 85  ? 129.912 90.862  88.233  1.00 29.59  ? 85  DC  I C5    1 
ATOM 1203 C C6    . DC  A 1 85  ? 129.970 89.949  87.264  1.00 29.59  ? 85  DC  I C6    1 
ATOM 1204 P P     . DG  A 1 86  ? 130.985 83.832  85.429  1.00 29.61  ? 86  DG  I P     1 
ATOM 1205 O OP1   . DG  A 1 86  ? 130.927 82.781  84.388  1.00 29.61  ? 86  DG  I OP1   1 
ATOM 1206 O OP2   . DG  A 1 86  ? 130.037 83.804  86.563  1.00 29.61  ? 86  DG  I OP2   1 
ATOM 1207 O "O5'" . DG  A 1 86  ? 132.466 83.887  86.024  1.00 29.61  ? 86  DG  I "O5'" 1 
ATOM 1208 C "C5'" . DG  A 1 86  ? 133.582 84.056  85.152  1.00 29.61  ? 86  DG  I "C5'" 1 
ATOM 1209 C "C4'" . DG  A 1 86  ? 134.802 84.524  85.927  1.00 29.61  ? 86  DG  I "C4'" 1 
ATOM 1210 O "O4'" . DG  A 1 86  ? 134.529 85.757  86.631  1.00 29.61  ? 86  DG  I "O4'" 1 
ATOM 1211 C "C3'" . DG  A 1 86  ? 135.321 83.541  86.966  1.00 29.61  ? 86  DG  I "C3'" 1 
ATOM 1212 O "O3'" . DG  A 1 86  ? 136.727 83.484  86.887  1.00 29.61  ? 86  DG  I "O3'" 1 
ATOM 1213 C "C2'" . DG  A 1 86  ? 134.862 84.146  88.296  1.00 29.61  ? 86  DG  I "C2'" 1 
ATOM 1214 C "C1'" . DG  A 1 86  ? 134.919 85.627  87.983  1.00 29.61  ? 86  DG  I "C1'" 1 
ATOM 1215 N N9    . DG  A 1 86  ? 134.049 86.480  88.780  1.00 29.61  ? 86  DG  I N9    1 
ATOM 1216 C C8    . DG  A 1 86  ? 132.702 86.333  88.993  1.00 29.61  ? 86  DG  I C8    1 
ATOM 1217 N N7    . DG  A 1 86  ? 132.187 87.282  89.726  1.00 29.61  ? 86  DG  I N7    1 
ATOM 1218 C C5    . DG  A 1 86  ? 133.265 88.104  90.020  1.00 29.61  ? 86  DG  I C5    1 
ATOM 1219 C C6    . DG  A 1 86  ? 133.327 89.287  90.788  1.00 29.61  ? 86  DG  I C6    1 
ATOM 1220 O O6    . DG  A 1 86  ? 132.412 89.867  91.380  1.00 29.61  ? 86  DG  I O6    1 
ATOM 1221 N N1    . DG  A 1 86  ? 134.617 89.806  90.833  1.00 29.61  ? 86  DG  I N1    1 
ATOM 1222 C C2    . DG  A 1 86  ? 135.708 89.250  90.215  1.00 29.61  ? 86  DG  I C2    1 
ATOM 1223 N N2    . DG  A 1 86  ? 136.875 89.892  90.373  1.00 29.61  ? 86  DG  I N2    1 
ATOM 1224 N N3    . DG  A 1 86  ? 135.663 88.141  89.492  1.00 29.61  ? 86  DG  I N3    1 
ATOM 1225 C C4    . DG  A 1 86  ? 134.414 87.626  89.439  1.00 29.61  ? 86  DG  I C4    1 
ATOM 1226 P P     . DT  A 1 87  ? 137.519 82.297  87.610  1.00 29.42  ? 87  DT  I P     1 
ATOM 1227 O OP1   . DT  A 1 87  ? 138.462 81.725  86.624  1.00 29.42  ? 87  DT  I OP1   1 
ATOM 1228 O OP2   . DT  A 1 87  ? 136.524 81.431  88.279  1.00 29.42  ? 87  DT  I OP2   1 
ATOM 1229 O "O5'" . DT  A 1 87  ? 138.355 83.047  88.742  1.00 29.42  ? 87  DT  I "O5'" 1 
ATOM 1230 C "C5'" . DT  A 1 87  ? 139.206 84.138  88.413  1.00 29.42  ? 87  DT  I "C5'" 1 
ATOM 1231 C "C4'" . DT  A 1 87  ? 139.434 85.010  89.635  1.00 29.42  ? 87  DT  I "C4'" 1 
ATOM 1232 O "O4'" . DT  A 1 87  ? 138.194 85.585  90.100  1.00 29.42  ? 87  DT  I "O4'" 1 
ATOM 1233 C "C3'" . DT  A 1 87  ? 140.052 84.285  90.828  1.00 29.42  ? 87  DT  I "C3'" 1 
ATOM 1234 O "O3'" . DT  A 1 87  ? 141.164 85.012  91.287  1.00 29.42  ? 87  DT  I "O3'" 1 
ATOM 1235 C "C2'" . DT  A 1 87  ? 138.919 84.277  91.869  1.00 29.42  ? 87  DT  I "C2'" 1 
ATOM 1236 C "C1'" . DT  A 1 87  ? 138.181 85.549  91.506  1.00 29.42  ? 87  DT  I "C1'" 1 
ATOM 1237 N N1    . DT  A 1 87  ? 136.760 85.625  91.940  1.00 29.42  ? 87  DT  I N1    1 
ATOM 1238 C C2    . DT  A 1 87  ? 136.310 86.770  92.546  1.00 29.42  ? 87  DT  I C2    1 
ATOM 1239 O O2    . DT  A 1 87  ? 137.039 87.694  92.842  1.00 29.42  ? 87  DT  I O2    1 
ATOM 1240 N N3    . DT  A 1 87  ? 134.981 86.769  92.860  1.00 29.42  ? 87  DT  I N3    1 
ATOM 1241 C C4    . DT  A 1 87  ? 134.062 85.779  92.587  1.00 29.42  ? 87  DT  I C4    1 
ATOM 1242 O O4    . DT  A 1 87  ? 132.882 85.876  92.901  1.00 29.42  ? 87  DT  I O4    1 
ATOM 1243 C C5    . DT  A 1 87  ? 134.587 84.621  91.908  1.00 29.42  ? 87  DT  I C5    1 
ATOM 1244 C C7    . DT  A 1 87  ? 133.681 83.478  91.561  1.00 29.42  ? 87  DT  I C7    1 
ATOM 1245 C C6    . DT  A 1 87  ? 135.893 84.607  91.606  1.00 29.42  ? 87  DT  I C6    1 
ATOM 1246 P P     . DT  A 1 88  ? 142.348 84.264  92.063  1.00 28.37  ? 88  DT  I P     1 
ATOM 1247 O OP1   . DT  A 1 88  ? 143.554 84.349  91.211  1.00 28.37  ? 88  DT  I OP1   1 
ATOM 1248 O OP2   . DT  A 1 88  ? 141.844 82.947  92.512  1.00 28.37  ? 88  DT  I OP2   1 
ATOM 1249 O "O5'" . DT  A 1 88  ? 142.579 85.175  93.347  1.00 28.37  ? 88  DT  I "O5'" 1 
ATOM 1250 C "C5'" . DT  A 1 88  ? 142.709 86.578  93.204  1.00 28.37  ? 88  DT  I "C5'" 1 
ATOM 1251 C "C4'" . DT  A 1 88  ? 142.174 87.292  94.430  1.00 28.37  ? 88  DT  I "C4'" 1 
ATOM 1252 O "O4'" . DT  A 1 88  ? 140.746 87.127  94.527  1.00 28.37  ? 88  DT  I "O4'" 1 
ATOM 1253 C "C3'" . DT  A 1 88  ? 142.750 86.796  95.748  1.00 28.37  ? 88  DT  I "C3'" 1 
ATOM 1254 O "O3'" . DT  A 1 88  ? 143.247 87.885  96.473  1.00 28.37  ? 88  DT  I "O3'" 1 
ATOM 1255 C "C2'" . DT  A 1 88  ? 141.544 86.148  96.450  1.00 28.37  ? 88  DT  I "C2'" 1 
ATOM 1256 C "C1'" . DT  A 1 88  ? 140.392 86.943  95.874  1.00 28.37  ? 88  DT  I "C1'" 1 
ATOM 1257 N N1    . DT  A 1 88  ? 139.068 86.246  95.876  1.00 28.37  ? 88  DT  I N1    1 
ATOM 1258 C C2    . DT  A 1 88  ? 137.964 86.921  96.326  1.00 28.37  ? 88  DT  I C2    1 
ATOM 1259 O O2    . DT  A 1 88  ? 138.009 88.057  96.749  1.00 28.37  ? 88  DT  I O2    1 
ATOM 1260 N N3    . DT  A 1 88  ? 136.792 86.226  96.243  1.00 28.37  ? 88  DT  I N3    1 
ATOM 1261 C C4    . DT  A 1 88  ? 136.616 84.943  95.774  1.00 28.37  ? 88  DT  I C4    1 
ATOM 1262 O O4    . DT  A 1 88  ? 135.519 84.399  95.746  1.00 28.37  ? 88  DT  I O4    1 
ATOM 1263 C C5    . DT  A 1 88  ? 137.810 84.285  95.317  1.00 28.37  ? 88  DT  I C5    1 
ATOM 1264 C C7    . DT  A 1 88  ? 137.735 82.883  94.790  1.00 28.37  ? 88  DT  I C7    1 
ATOM 1265 C C6    . DT  A 1 88  ? 138.968 84.961  95.384  1.00 28.37  ? 88  DT  I C6    1 
ATOM 1266 P P     . DT  A 1 89  ? 144.414 87.658  97.546  1.00 28.78  ? 89  DT  I P     1 
ATOM 1267 O OP1   . DT  A 1 89  ? 145.540 88.530  97.155  1.00 28.78  ? 89  DT  I OP1   1 
ATOM 1268 O OP2   . DT  A 1 89  ? 144.631 86.205  97.707  1.00 28.78  ? 89  DT  I OP2   1 
ATOM 1269 O "O5'" . DT  A 1 89  ? 143.783 88.219  98.888  1.00 28.78  ? 89  DT  I "O5'" 1 
ATOM 1270 C "C5'" . DT  A 1 89  ? 143.411 89.574  98.967  1.00 28.78  ? 89  DT  I "C5'" 1 
ATOM 1271 C "C4'" . DT  A 1 89  ? 142.258 89.752  99.929  1.00 28.78  ? 89  DT  I "C4'" 1 
ATOM 1272 O "O4'" . DT  A 1 89  ? 141.085 89.109  99.422  1.00 28.78  ? 89  DT  I "O4'" 1 
ATOM 1273 C "C3'" . DT  A 1 89  ? 142.454 89.118  101.282 1.00 28.78  ? 89  DT  I "C3'" 1 
ATOM 1274 O "O3'" . DT  A 1 89  ? 143.252 89.965  102.135 1.00 28.78  ? 89  DT  I "O3'" 1 
ATOM 1275 C "C2'" . DT  A 1 89  ? 141.026 88.867  101.787 1.00 28.78  ? 89  DT  I "C2'" 1 
ATOM 1276 C "C1'" . DT  A 1 89  ? 140.201 88.826  100.495 1.00 28.78  ? 89  DT  I "C1'" 1 
ATOM 1277 N N1    . DT  A 1 89  ? 139.542 87.516  100.175 1.00 28.78  ? 89  DT  I N1    1 
ATOM 1278 C C2    . DT  A 1 89  ? 138.176 87.430  100.213 1.00 28.78  ? 89  DT  I C2    1 
ATOM 1279 O O2    . DT  A 1 89  ? 137.462 88.356  100.537 1.00 28.78  ? 89  DT  I O2    1 
ATOM 1280 N N3    . DT  A 1 89  ? 137.665 86.215  99.846  1.00 28.78  ? 89  DT  I N3    1 
ATOM 1281 C C4    . DT  A 1 89  ? 138.371 85.098  99.451  1.00 28.78  ? 89  DT  I C4    1 
ATOM 1282 O O4    . DT  A 1 89  ? 137.820 84.047  99.145  1.00 28.78  ? 89  DT  I O4    1 
ATOM 1283 C C5    . DT  A 1 89  ? 139.800 85.253  99.423  1.00 28.78  ? 89  DT  I C5    1 
ATOM 1284 C C7    . DT  A 1 89  ? 140.670 84.100  99.015  1.00 28.78  ? 89  DT  I C7    1 
ATOM 1285 C C6    . DT  A 1 89  ? 140.314 86.443  99.775  1.00 28.78  ? 89  DT  I C6    1 
ATOM 1286 P P     . DA  A 1 90  ? 142.763 91.411  102.650 1.00 29.07  ? 90  DA  I P     1 
ATOM 1287 O OP1   . DA  A 1 90  ? 142.166 92.211  101.564 1.00 29.07  ? 90  DA  I OP1   1 
ATOM 1288 O OP2   . DA  A 1 90  ? 143.902 91.984  103.392 1.00 29.07  ? 90  DA  I OP2   1 
ATOM 1289 O "O5'" . DA  A 1 90  ? 141.639 91.100  103.719 1.00 29.07  ? 90  DA  I "O5'" 1 
ATOM 1290 C "C5'" . DA  A 1 90  ? 140.443 91.845  103.685 1.00 29.07  ? 90  DA  I "C5'" 1 
ATOM 1291 C "C4'" . DA  A 1 90  ? 139.368 91.167  104.492 1.00 29.07  ? 90  DA  I "C4'" 1 
ATOM 1292 O "O4'" . DA  A 1 90  ? 138.944 89.931  103.873 1.00 29.07  ? 90  DA  I "O4'" 1 
ATOM 1293 C "C3'" . DA  A 1 90  ? 139.756 90.815  105.926 1.00 29.07  ? 90  DA  I "C3'" 1 
ATOM 1294 O "O3'" . DA  A 1 90  ? 138.730 91.237  106.763 1.00 29.07  ? 90  DA  I "O3'" 1 
ATOM 1295 C "C2'" . DA  A 1 90  ? 139.800 89.277  105.868 1.00 29.07  ? 90  DA  I "C2'" 1 
ATOM 1296 C "C1'" . DA  A 1 90  ? 138.642 89.056  104.915 1.00 29.07  ? 90  DA  I "C1'" 1 
ATOM 1297 N N9    . DA  A 1 90  ? 138.453 87.706  104.366 1.00 29.07  ? 90  DA  I N9    1 
ATOM 1298 C C8    . DA  A 1 90  ? 137.254 87.146  104.026 1.00 29.07  ? 90  DA  I C8    1 
ATOM 1299 N N7    . DA  A 1 90  ? 137.346 85.945  103.524 1.00 29.07  ? 90  DA  I N7    1 
ATOM 1300 C C5    . DA  A 1 90  ? 138.701 85.692  103.519 1.00 29.07  ? 90  DA  I C5    1 
ATOM 1301 C C6    . DA  A 1 90  ? 139.447 84.577  103.103 1.00 29.07  ? 90  DA  I C6    1 
ATOM 1302 N N6    . DA  A 1 90  ? 138.893 83.473  102.592 1.00 29.07  ? 90  DA  I N6    1 
ATOM 1303 N N1    . DA  A 1 90  ? 140.787 84.637  103.232 1.00 29.07  ? 90  DA  I N1    1 
ATOM 1304 C C2    . DA  A 1 90  ? 141.335 85.745  103.744 1.00 29.07  ? 90  DA  I C2    1 
ATOM 1305 N N3    . DA  A 1 90  ? 140.737 86.856  104.173 1.00 29.07  ? 90  DA  I N3    1 
ATOM 1306 C C4    . DA  A 1 90  ? 139.407 86.768  104.030 1.00 29.07  ? 90  DA  I C4    1 
ATOM 1307 P P     . DA  A 1 91  ? 138.818 92.661  107.494 1.00 28.63  ? 91  DA  I P     1 
ATOM 1308 O OP1   . DA  A 1 91  ? 139.091 93.694  106.476 1.00 28.63  ? 91  DA  I OP1   1 
ATOM 1309 O OP2   . DA  A 1 91  ? 139.699 92.522  108.669 1.00 28.63  ? 91  DA  I OP2   1 
ATOM 1310 O "O5'" . DA  A 1 91  ? 137.341 92.874  108.025 1.00 28.63  ? 91  DA  I "O5'" 1 
ATOM 1311 C "C5'" . DA  A 1 91  ? 136.275 93.113  107.121 1.00 28.63  ? 91  DA  I "C5'" 1 
ATOM 1312 C "C4'" . DA  A 1 91  ? 135.123 92.185  107.436 1.00 28.63  ? 91  DA  I "C4'" 1 
ATOM 1313 O "O4'" . DA  A 1 91  ? 135.423 90.830  107.029 1.00 28.63  ? 91  DA  I "O4'" 1 
ATOM 1314 C "C3'" . DA  A 1 91  ? 134.717 92.128  108.887 1.00 28.63  ? 91  DA  I "C3'" 1 
ATOM 1315 O "O3'" . DA  A 1 91  ? 133.325 92.193  108.928 1.00 28.63  ? 91  DA  I "O3'" 1 
ATOM 1316 C "C2'" . DA  A 1 91  ? 135.260 90.756  109.348 1.00 28.63  ? 91  DA  I "C2'" 1 
ATOM 1317 C "C1'" . DA  A 1 91  ? 135.112 89.939  108.077 1.00 28.63  ? 91  DA  I "C1'" 1 
ATOM 1318 N N9    . DA  A 1 91  ? 136.048 88.828  107.901 1.00 28.63  ? 91  DA  I N9    1 
ATOM 1319 C C8    . DA  A 1 91  ? 137.390 88.864  108.106 1.00 28.63  ? 91  DA  I C8    1 
ATOM 1320 N N7    . DA  A 1 91  ? 138.000 87.738  107.838 1.00 28.63  ? 91  DA  I N7    1 
ATOM 1321 C C5    . DA  A 1 91  ? 136.981 86.880  107.489 1.00 28.63  ? 91  DA  I C5    1 
ATOM 1322 C C6    . DA  A 1 91  ? 136.979 85.524  107.122 1.00 28.63  ? 91  DA  I C6    1 
ATOM 1323 N N6    . DA  A 1 91  ? 138.089 84.784  107.044 1.00 28.63  ? 91  DA  I N6    1 
ATOM 1324 N N1    . DA  A 1 91  ? 135.797 84.953  106.842 1.00 28.63  ? 91  DA  I N1    1 
ATOM 1325 C C2    . DA  A 1 91  ? 134.686 85.698  106.925 1.00 28.63  ? 91  DA  I C2    1 
ATOM 1326 N N3    . DA  A 1 91  ? 134.563 86.988  107.257 1.00 28.63  ? 91  DA  I N3    1 
ATOM 1327 C C4    . DA  A 1 91  ? 135.762 87.525  107.531 1.00 28.63  ? 91  DA  I C4    1 
ATOM 1328 P P     . DG  A 1 92  ? 132.564 92.516  110.292 1.00 31.05  ? 92  DG  I P     1 
ATOM 1329 O OP1   . DG  A 1 92  ? 131.423 93.398  109.975 1.00 31.05  ? 92  DG  I OP1   1 
ATOM 1330 O OP2   . DG  A 1 92  ? 133.564 92.936  111.295 1.00 31.05  ? 92  DG  I OP2   1 
ATOM 1331 O "O5'" . DG  A 1 92  ? 132.012 91.085  110.692 1.00 31.05  ? 92  DG  I "O5'" 1 
ATOM 1332 C "C5'" . DG  A 1 92  ? 131.071 90.445  109.847 1.00 31.05  ? 92  DG  I "C5'" 1 
ATOM 1333 C "C4'" . DG  A 1 92  ? 130.894 89.011  110.273 1.00 31.05  ? 92  DG  I "C4'" 1 
ATOM 1334 O "O4'" . DG  A 1 92  ? 132.048 88.218  109.928 1.00 31.05  ? 92  DG  I "O4'" 1 
ATOM 1335 C "C3'" . DG  A 1 92  ? 130.642 88.824  111.752 1.00 31.05  ? 92  DG  I "C3'" 1 
ATOM 1336 O "O3'" . DG  A 1 92  ? 129.471 88.062  111.870 1.00 31.05  ? 92  DG  I "O3'" 1 
ATOM 1337 C "C2'" . DG  A 1 92  ? 131.905 88.074  112.252 1.00 31.05  ? 92  DG  I "C2'" 1 
ATOM 1338 C "C1'" . DG  A 1 92  ? 132.353 87.352  110.991 1.00 31.05  ? 92  DG  I "C1'" 1 
ATOM 1339 N N9    . DG  A 1 92  ? 133.778 87.033  110.869 1.00 31.05  ? 92  DG  I N9    1 
ATOM 1340 C C8    . DG  A 1 92  ? 134.834 87.871  111.107 1.00 31.05  ? 92  DG  I C8    1 
ATOM 1341 N N7    . DG  A 1 92  ? 135.996 87.319  110.895 1.00 31.05  ? 92  DG  I N7    1 
ATOM 1342 C C5    . DG  A 1 92  ? 135.695 86.008  110.558 1.00 31.05  ? 92  DG  I C5    1 
ATOM 1343 C C6    . DG  A 1 92  ? 136.556 84.927  110.249 1.00 31.05  ? 92  DG  I C6    1 
ATOM 1344 O O6    . DG  A 1 92  ? 137.793 84.920  110.208 1.00 31.05  ? 92  DG  I O6    1 
ATOM 1345 N N1    . DG  A 1 92  ? 135.846 83.765  109.964 1.00 31.05  ? 92  DG  I N1    1 
ATOM 1346 C C2    . DG  A 1 92  ? 134.474 83.662  109.980 1.00 31.05  ? 92  DG  I C2    1 
ATOM 1347 N N2    . DG  A 1 92  ? 133.965 82.458  109.681 1.00 31.05  ? 92  DG  I N2    1 
ATOM 1348 N N3    . DG  A 1 92  ? 133.656 84.670  110.268 1.00 31.05  ? 92  DG  I N3    1 
ATOM 1349 C C4    . DG  A 1 92  ? 134.335 85.809  110.547 1.00 31.05  ? 92  DG  I C4    1 
ATOM 1350 P P     . DC  A 1 93  ? 128.700 87.925  113.261 1.00 35.26  ? 93  DC  I P     1 
ATOM 1351 O OP1   . DC  A 1 93  ? 127.263 88.152  113.000 1.00 35.26  ? 93  DC  I OP1   1 
ATOM 1352 O OP2   . DC  A 1 93  ? 129.403 88.758  114.259 1.00 35.26  ? 93  DC  I OP2   1 
ATOM 1353 O "O5'" . DC  A 1 93  ? 128.932 86.400  113.629 1.00 35.26  ? 93  DC  I "O5'" 1 
ATOM 1354 C "C5'" . DC  A 1 93  ? 128.908 85.402  112.602 1.00 35.26  ? 93  DC  I "C5'" 1 
ATOM 1355 C "C4'" . DC  A 1 93  ? 129.480 84.131  113.168 1.00 35.26  ? 93  DC  I "C4'" 1 
ATOM 1356 O "O4'" . DC  A 1 93  ? 130.901 84.090  112.922 1.00 35.26  ? 93  DC  I "O4'" 1 
ATOM 1357 C "C3'" . DC  A 1 93  ? 129.297 83.972  114.669 1.00 35.26  ? 93  DC  I "C3'" 1 
ATOM 1358 O "O3'" . DC  A 1 93  ? 128.663 82.733  114.915 1.00 35.26  ? 93  DC  I "O3'" 1 
ATOM 1359 C "C2'" . DC  A 1 93  ? 130.720 84.056  115.236 1.00 35.26  ? 93  DC  I "C2'" 1 
ATOM 1360 C "C1'" . DC  A 1 93  ? 131.532 83.569  114.059 1.00 35.26  ? 93  DC  I "C1'" 1 
ATOM 1361 N N1    . DC  A 1 93  ? 132.913 84.066  114.022 1.00 35.26  ? 93  DC  I N1    1 
ATOM 1362 C C2    . DC  A 1 93  ? 133.922 83.254  113.519 1.00 35.26  ? 93  DC  I C2    1 
ATOM 1363 O O2    . DC  A 1 93  ? 133.685 82.054  113.342 1.00 35.26  ? 93  DC  I O2    1 
ATOM 1364 N N3    . DC  A 1 93  ? 135.175 83.755  113.429 1.00 35.26  ? 93  DC  I N3    1 
ATOM 1365 C C4    . DC  A 1 93  ? 135.395 85.046  113.674 1.00 35.26  ? 93  DC  I C4    1 
ATOM 1366 N N4    . DC  A 1 93  ? 136.639 85.508  113.531 1.00 35.26  ? 93  DC  I N4    1 
ATOM 1367 C C5    . DC  A 1 93  ? 134.349 85.919  114.071 1.00 35.26  ? 93  DC  I C5    1 
ATOM 1368 C C6    . DC  A 1 93  ? 133.130 85.398  114.194 1.00 35.26  ? 93  DC  I C6    1 
ATOM 1369 P P     . DG  A 1 94  ? 127.865 82.500  116.281 1.00 39.62  ? 94  DG  I P     1 
ATOM 1370 O OP1   . DG  A 1 94  ? 126.499 82.057  115.928 1.00 39.62  ? 94  DG  I OP1   1 
ATOM 1371 O OP2   . DG  A 1 94  ? 128.055 83.694  117.132 1.00 39.62  ? 94  DG  I OP2   1 
ATOM 1372 O "O5'" . DG  A 1 94  ? 128.655 81.288  116.945 1.00 39.62  ? 94  DG  I "O5'" 1 
ATOM 1373 C "C5'" . DG  A 1 94  ? 129.117 80.205  116.127 1.00 39.62  ? 94  DG  I "C5'" 1 
ATOM 1374 C "C4'" . DG  A 1 94  ? 130.283 79.518  116.795 1.00 39.62  ? 94  DG  I "C4'" 1 
ATOM 1375 O "O4'" . DG  A 1 94  ? 131.512 80.171  116.416 1.00 39.62  ? 94  DG  I "O4'" 1 
ATOM 1376 C "C3'" . DG  A 1 94  ? 130.235 79.517  118.321 1.00 39.62  ? 94  DG  I "C3'" 1 
ATOM 1377 O "O3'" . DG  A 1 94  ? 130.387 78.180  118.789 1.00 39.62  ? 94  DG  I "O3'" 1 
ATOM 1378 C "C2'" . DG  A 1 94  ? 131.413 80.438  118.703 1.00 39.62  ? 94  DG  I "C2'" 1 
ATOM 1379 C "C1'" . DG  A 1 94  ? 132.350 80.210  117.529 1.00 39.62  ? 94  DG  I "C1'" 1 
ATOM 1380 N N9    . DG  A 1 94  ? 133.293 81.295  117.273 1.00 39.62  ? 94  DG  I N9    1 
ATOM 1381 C C8    . DG  A 1 94  ? 133.036 82.637  117.377 1.00 39.62  ? 94  DG  I C8    1 
ATOM 1382 N N7    . DG  A 1 94  ? 134.062 83.386  117.101 1.00 39.62  ? 94  DG  I N7    1 
ATOM 1383 C C5    . DG  A 1 94  ? 135.092 82.486  116.887 1.00 39.62  ? 94  DG  I C5    1 
ATOM 1384 C C6    . DG  A 1 94  ? 136.448 82.723  116.583 1.00 39.62  ? 94  DG  I C6    1 
ATOM 1385 O O6    . DG  A 1 94  ? 137.010 83.811  116.436 1.00 39.62  ? 94  DG  I O6    1 
ATOM 1386 N N1    . DG  A 1 94  ? 137.164 81.541  116.440 1.00 39.62  ? 94  DG  I N1    1 
ATOM 1387 C C2    . DG  A 1 94  ? 136.632 80.282  116.581 1.00 39.62  ? 94  DG  I C2    1 
ATOM 1388 N N2    . DG  A 1 94  ? 137.478 79.258  116.409 1.00 39.62  ? 94  DG  I N2    1 
ATOM 1389 N N3    . DG  A 1 94  ? 135.353 80.043  116.868 1.00 39.62  ? 94  DG  I N3    1 
ATOM 1390 C C4    . DG  A 1 94  ? 134.645 81.191  117.006 1.00 39.62  ? 94  DG  I C4    1 
ATOM 1391 P P     . DG  A 1 95  ? 130.346 77.840  120.355 1.00 41.99  ? 95  DG  I P     1 
ATOM 1392 O OP1   . DG  A 1 95  ? 129.755 76.491  120.498 1.00 41.99  ? 95  DG  I OP1   1 
ATOM 1393 O OP2   . DG  A 1 95  ? 129.740 78.997  121.049 1.00 41.99  ? 95  DG  I OP2   1 
ATOM 1394 O "O5'" . DG  A 1 95  ? 131.880 77.766  120.774 1.00 41.99  ? 95  DG  I "O5'" 1 
ATOM 1395 C "C5'" . DG  A 1 95  ? 132.758 76.931  120.040 1.00 41.99  ? 95  DG  I "C5'" 1 
ATOM 1396 C "C4'" . DG  A 1 95  ? 134.157 77.040  120.591 1.00 41.99  ? 95  DG  I "C4'" 1 
ATOM 1397 O "O4'" . DG  A 1 95  ? 134.777 78.227  120.057 1.00 41.99  ? 95  DG  I "O4'" 1 
ATOM 1398 C "C3'" . DG  A 1 95  ? 134.233 77.163  122.115 1.00 41.99  ? 95  DG  I "C3'" 1 
ATOM 1399 O "O3'" . DG  A 1 95  ? 135.088 76.161  122.648 1.00 41.99  ? 95  DG  I "O3'" 1 
ATOM 1400 C "C2'" . DG  A 1 95  ? 134.790 78.569  122.338 1.00 41.99  ? 95  DG  I "C2'" 1 
ATOM 1401 C "C1'" . DG  A 1 95  ? 135.566 78.799  121.054 1.00 41.99  ? 95  DG  I "C1'" 1 
ATOM 1402 N N9    . DG  A 1 95  ? 135.730 80.206  120.734 1.00 41.99  ? 95  DG  I N9    1 
ATOM 1403 C C8    . DG  A 1 95  ? 134.747 81.160  120.687 1.00 41.99  ? 95  DG  I C8    1 
ATOM 1404 N N7    . DG  A 1 95  ? 135.189 82.342  120.373 1.00 41.99  ? 95  DG  I N7    1 
ATOM 1405 C C5    . DG  A 1 95  ? 136.552 82.157  120.199 1.00 41.99  ? 95  DG  I C5    1 
ATOM 1406 C C6    . DG  A 1 95  ? 137.556 83.082  119.852 1.00 41.99  ? 95  DG  I C6    1 
ATOM 1407 O O6    . DG  A 1 95  ? 137.433 84.288  119.618 1.00 41.99  ? 95  DG  I O6    1 
ATOM 1408 N N1    . DG  A 1 95  ? 138.808 82.482  119.779 1.00 41.99  ? 95  DG  I N1    1 
ATOM 1409 C C2    . DG  A 1 95  ? 139.056 81.153  120.018 1.00 41.99  ? 95  DG  I C2    1 
ATOM 1410 N N2    . DG  A 1 95  ? 140.327 80.750  119.902 1.00 41.99  ? 95  DG  I N2    1 
ATOM 1411 N N3    . DG  A 1 95  ? 138.122 80.275  120.345 1.00 41.99  ? 95  DG  I N3    1 
ATOM 1412 C C4    . DG  A 1 95  ? 136.898 80.847  120.417 1.00 41.99  ? 95  DG  I C4    1 
ATOM 1413 P P     . DT  A 1 96  ? 134.757 75.492  124.070 1.00 43.65  ? 96  DT  I P     1 
ATOM 1414 O OP1   . DT  A 1 96  ? 134.172 74.158  123.810 1.00 43.65  ? 96  DT  I OP1   1 
ATOM 1415 O OP2   . DT  A 1 96  ? 133.997 76.490  124.852 1.00 43.65  ? 96  DT  I OP2   1 
ATOM 1416 O "O5'" . DT  A 1 96  ? 136.187 75.319  124.769 1.00 43.65  ? 96  DT  I "O5'" 1 
ATOM 1417 C "C5'" . DT  A 1 96  ? 136.715 76.369  125.571 1.00 43.65  ? 96  DT  I "C5'" 1 
ATOM 1418 C "C4'" . DT  A 1 96  ? 137.991 76.937  124.974 1.00 43.65  ? 96  DT  I "C4'" 1 
ATOM 1419 O "O4'" . DT  A 1 96  ? 137.682 78.095  124.192 1.00 43.65  ? 96  DT  I "O4'" 1 
ATOM 1420 C "C3'" . DT  A 1 96  ? 139.043 77.398  125.980 1.00 43.65  ? 96  DT  I "C3'" 1 
ATOM 1421 O "O3'" . DT  A 1 96  ? 139.974 76.338  126.195 1.00 43.65  ? 96  DT  I "O3'" 1 
ATOM 1422 C "C2'" . DT  A 1 96  ? 139.711 78.621  125.332 1.00 43.65  ? 96  DT  I "C2'" 1 
ATOM 1423 C "C1'" . DT  A 1 96  ? 138.817 78.927  124.133 1.00 43.65  ? 96  DT  I "C1'" 1 
ATOM 1424 N N1    . DT  A 1 96  ? 138.359 80.331  123.968 1.00 43.65  ? 96  DT  I N1    1 
ATOM 1425 C C2    . DT  A 1 96  ? 139.246 81.304  123.572 1.00 43.65  ? 96  DT  I C2    1 
ATOM 1426 O O2    . DT  A 1 96  ? 140.445 81.120  123.484 1.00 43.65  ? 96  DT  I O2    1 
ATOM 1427 N N3    . DT  A 1 96  ? 138.683 82.540  123.383 1.00 43.65  ? 96  DT  I N3    1 
ATOM 1428 C C4    . DT  A 1 96  ? 137.344 82.869  123.474 1.00 43.65  ? 96  DT  I C4    1 
ATOM 1429 O O4    . DT  A 1 96  ? 136.927 84.000  123.271 1.00 43.65  ? 96  DT  I O4    1 
ATOM 1430 C C5    . DT  A 1 96  ? 136.468 81.787  123.825 1.00 43.65  ? 96  DT  I C5    1 
ATOM 1431 C C7    . DT  A 1 96  ? 134.993 82.022  123.953 1.00 43.65  ? 96  DT  I C7    1 
ATOM 1432 C C6    . DT  A 1 96  ? 137.009 80.584  124.029 1.00 43.65  ? 96  DT  I C6    1 
ATOM 1433 P P     . DG  A 1 97  ? 140.752 76.223  127.590 1.00 43.50  ? 97  DG  I P     1 
ATOM 1434 O OP1   . DG  A 1 97  ? 141.466 74.926  127.605 1.00 43.50  ? 97  DG  I OP1   1 
ATOM 1435 O OP2   . DG  A 1 97  ? 139.820 76.591  128.678 1.00 43.50  ? 97  DG  I OP2   1 
ATOM 1436 O "O5'" . DG  A 1 97  ? 141.836 77.383  127.469 1.00 43.50  ? 97  DG  I "O5'" 1 
ATOM 1437 C "C5'" . DG  A 1 97  ? 141.742 78.527  128.273 1.00 43.50  ? 97  DG  I "C5'" 1 
ATOM 1438 C "C4'" . DG  A 1 97  ? 142.767 79.554  127.837 1.00 43.50  ? 97  DG  I "C4'" 1 
ATOM 1439 O "O4'" . DG  A 1 97  ? 142.198 80.511  126.912 1.00 43.50  ? 97  DG  I "O4'" 1 
ATOM 1440 C "C3'" . DG  A 1 97  ? 143.371 80.362  128.964 1.00 43.50  ? 97  DG  I "C3'" 1 
ATOM 1441 O "O3'" . DG  A 1 97  ? 144.718 80.644  128.656 1.00 43.50  ? 97  DG  I "O3'" 1 
ATOM 1442 C "C2'" . DG  A 1 97  ? 142.529 81.638  128.963 1.00 43.50  ? 97  DG  I "C2'" 1 
ATOM 1443 C "C1'" . DG  A 1 97  ? 142.251 81.806  127.478 1.00 43.50  ? 97  DG  I "C1'" 1 
ATOM 1444 N N9    . DG  A 1 97  ? 141.045 82.540  127.118 1.00 43.50  ? 97  DG  I N9    1 
ATOM 1445 C C8    . DG  A 1 97  ? 139.746 82.109  127.202 1.00 43.50  ? 97  DG  I C8    1 
ATOM 1446 N N7    . DG  A 1 97  ? 138.882 82.988  126.774 1.00 43.50  ? 97  DG  I N7    1 
ATOM 1447 C C5    . DG  A 1 97  ? 139.662 84.072  126.392 1.00 43.50  ? 97  DG  I C5    1 
ATOM 1448 C C6    . DG  A 1 97  ? 139.283 85.326  125.855 1.00 43.50  ? 97  DG  I C6    1 
ATOM 1449 O O6    . DG  A 1 97  ? 138.144 85.737  125.602 1.00 43.50  ? 97  DG  I O6    1 
ATOM 1450 N N1    . DG  A 1 97  ? 140.391 86.140  125.608 1.00 43.50  ? 97  DG  I N1    1 
ATOM 1451 C C2    . DG  A 1 97  ? 141.695 85.777  125.854 1.00 43.50  ? 97  DG  I C2    1 
ATOM 1452 N N2    . DG  A 1 97  ? 142.638 86.683  125.553 1.00 43.50  ? 97  DG  I N2    1 
ATOM 1453 N N3    . DG  A 1 97  ? 142.055 84.605  126.354 1.00 43.50  ? 97  DG  I N3    1 
ATOM 1454 C C4    . DG  A 1 97  ? 140.992 83.809  126.598 1.00 43.50  ? 97  DG  I C4    1 
ATOM 1455 P P     . DC  A 1 98  ? 145.837 80.590  129.796 1.00 43.36  ? 98  DC  I P     1 
ATOM 1456 O OP1   . DC  A 1 98  ? 147.024 79.898  129.248 1.00 43.36  ? 98  DC  I OP1   1 
ATOM 1457 O OP2   . DC  A 1 98  ? 145.197 80.094  131.034 1.00 43.36  ? 98  DC  I OP2   1 
ATOM 1458 O "O5'" . DC  A 1 98  ? 146.191 82.126  130.011 1.00 43.36  ? 98  DC  I "O5'" 1 
ATOM 1459 C "C5'" . DC  A 1 98  ? 145.960 83.087  128.973 1.00 43.36  ? 98  DC  I "C5'" 1 
ATOM 1460 C "C4'" . DC  A 1 98  ? 145.803 84.449  129.609 1.00 43.36  ? 98  DC  I "C4'" 1 
ATOM 1461 O "O4'" . DC  A 1 98  ? 144.515 85.031  129.264 1.00 43.36  ? 98  DC  I "O4'" 1 
ATOM 1462 C "C3'" . DC  A 1 98  ? 145.863 84.430  131.131 1.00 43.36  ? 98  DC  I "C3'" 1 
ATOM 1463 O "O3'" . DC  A 1 98  ? 146.528 85.576  131.569 1.00 43.36  ? 98  DC  I "O3'" 1 
ATOM 1464 C "C2'" . DC  A 1 98  ? 144.387 84.482  131.508 1.00 43.36  ? 98  DC  I "C2'" 1 
ATOM 1465 C "C1'" . DC  A 1 98  ? 143.900 85.453  130.457 1.00 43.36  ? 98  DC  I "C1'" 1 
ATOM 1466 N N1    . DC  A 1 98  ? 142.428 85.482  130.259 1.00 43.36  ? 98  DC  I N1    1 
ATOM 1467 C C2    . DC  A 1 98  ? 141.857 86.499  129.496 1.00 43.36  ? 98  DC  I C2    1 
ATOM 1468 O O2    . DC  A 1 98  ? 142.567 87.427  129.103 1.00 43.36  ? 98  DC  I O2    1 
ATOM 1469 N N3    . DC  A 1 98  ? 140.519 86.503  129.307 1.00 43.36  ? 98  DC  I N3    1 
ATOM 1470 C C4    . DC  A 1 98  ? 139.778 85.502  129.772 1.00 43.36  ? 98  DC  I C4    1 
ATOM 1471 N N4    . DC  A 1 98  ? 138.464 85.535  129.536 1.00 43.36  ? 98  DC  I N4    1 
ATOM 1472 C C5    . DC  A 1 98  ? 140.350 84.420  130.496 1.00 43.36  ? 98  DC  I C5    1 
ATOM 1473 C C6    . DC  A 1 98  ? 141.669 84.443  130.701 1.00 43.36  ? 98  DC  I C6    1 
ATOM 1474 P P     . DT  A 1 99  ? 147.766 85.463  132.576 1.00 43.88  ? 99  DT  I P     1 
ATOM 1475 O OP1   . DT  A 1 99  ? 148.866 84.789  131.850 1.00 43.88  ? 99  DT  I OP1   1 
ATOM 1476 O OP2   . DT  A 1 99  ? 147.270 84.905  133.853 1.00 43.88  ? 99  DT  I OP2   1 
ATOM 1477 O "O5'" . DT  A 1 99  ? 148.156 86.989  132.816 1.00 43.88  ? 99  DT  I "O5'" 1 
ATOM 1478 C "C5'" . DT  A 1 99  ? 148.303 87.853  131.698 1.00 43.88  ? 99  DT  I "C5'" 1 
ATOM 1479 C "C4'" . DT  A 1 99  ? 147.265 88.963  131.733 1.00 43.88  ? 99  DT  I "C4'" 1 
ATOM 1480 O "O4'" . DT  A 1 99  ? 145.931 88.409  131.746 1.00 43.88  ? 99  DT  I "O4'" 1 
ATOM 1481 C "C3'" . DT  A 1 99  ? 147.335 89.902  132.939 1.00 43.88  ? 99  DT  I "C3'" 1 
ATOM 1482 O "O3'" . DT  A 1 99  ? 147.499 91.221  132.460 1.00 43.88  ? 99  DT  I "O3'" 1 
ATOM 1483 C "C2'" . DT  A 1 99  ? 145.980 89.698  133.644 1.00 43.88  ? 99  DT  I "C2'" 1 
ATOM 1484 C "C1'" . DT  A 1 99  ? 145.118 89.287  132.474 1.00 43.88  ? 99  DT  I "C1'" 1 
ATOM 1485 N N1    . DT  A 1 99  ? 143.868 88.554  132.827 1.00 43.88  ? 99  DT  I N1    1 
ATOM 1486 C C2    . DT  A 1 99  ? 142.669 88.983  132.312 1.00 43.88  ? 99  DT  I C2    1 
ATOM 1487 O O2    . DT  A 1 99  ? 142.549 90.007  131.668 1.00 43.88  ? 99  DT  I O2    1 
ATOM 1488 N N3    . DT  A 1 99  ? 141.592 88.215  132.654 1.00 43.88  ? 99  DT  I N3    1 
ATOM 1489 C C4    . DT  A 1 99  ? 141.600 87.047  133.391 1.00 43.88  ? 99  DT  I C4    1 
ATOM 1490 O O4    . DT  A 1 99  ? 140.577 86.418  133.635 1.00 43.88  ? 99  DT  I O4    1 
ATOM 1491 C C5    . DT  A 1 99  ? 142.897 86.620  133.854 1.00 43.88  ? 99  DT  I C5    1 
ATOM 1492 C C7    . DT  A 1 99  ? 143.031 85.366  134.666 1.00 43.88  ? 99  DT  I C7    1 
ATOM 1493 C C6    . DT  A 1 99  ? 143.958 87.376  133.537 1.00 43.88  ? 99  DT  I C6    1 
ATOM 1494 P P     . DA  A 1 100 ? 148.249 92.315  133.356 1.00 43.67  ? 100 DA  I P     1 
ATOM 1495 O OP1   . DA  A 1 100 ? 149.601 92.492  132.785 1.00 43.67  ? 100 DA  I OP1   1 
ATOM 1496 O OP2   . DA  A 1 100 ? 148.094 91.929  134.775 1.00 43.67  ? 100 DA  I OP2   1 
ATOM 1497 O "O5'" . DA  A 1 100 ? 147.412 93.650  133.119 1.00 43.67  ? 100 DA  I "O5'" 1 
ATOM 1498 C "C5'" . DA  A 1 100 ? 147.120 94.099  131.789 1.00 43.67  ? 100 DA  I "C5'" 1 
ATOM 1499 C "C4'" . DA  A 1 100 ? 145.754 94.759  131.736 1.00 43.67  ? 100 DA  I "C4'" 1 
ATOM 1500 O "O4'" . DA  A 1 100 ? 144.715 93.818  132.061 1.00 43.67  ? 100 DA  I "O4'" 1 
ATOM 1501 C "C3'" . DA  A 1 100 ? 145.578 95.939  132.665 1.00 43.67  ? 100 DA  I "C3'" 1 
ATOM 1502 O "O3'" . DA  A 1 100 ? 144.926 96.964  131.930 1.00 43.67  ? 100 DA  I "O3'" 1 
ATOM 1503 C "C2'" . DA  A 1 100 ? 144.702 95.351  133.799 1.00 43.67  ? 100 DA  I "C2'" 1 
ATOM 1504 C "C1'" . DA  A 1 100 ? 143.841 94.394  133.003 1.00 43.67  ? 100 DA  I "C1'" 1 
ATOM 1505 N N9    . DA  A 1 100 ? 143.276 93.245  133.708 1.00 43.67  ? 100 DA  I N9    1 
ATOM 1506 C C8    . DA  A 1 100 ? 143.951 92.364  134.501 1.00 43.67  ? 100 DA  I C8    1 
ATOM 1507 N N7    . DA  A 1 100 ? 143.206 91.396  134.971 1.00 43.67  ? 100 DA  I N7    1 
ATOM 1508 C C5    . DA  A 1 100 ? 141.936 91.706  134.526 1.00 43.67  ? 100 DA  I C5    1 
ATOM 1509 C C6    . DA  A 1 100 ? 140.690 91.084  134.717 1.00 43.67  ? 100 DA  I C6    1 
ATOM 1510 N N6    . DA  A 1 100 ? 140.529 89.974  135.443 1.00 43.67  ? 100 DA  I N6    1 
ATOM 1511 N N1    . DA  A 1 100 ? 139.613 91.646  134.137 1.00 43.67  ? 100 DA  I N1    1 
ATOM 1512 C C2    . DA  A 1 100 ? 139.777 92.758  133.411 1.00 43.67  ? 100 DA  I C2    1 
ATOM 1513 N N3    . DA  A 1 100 ? 140.902 93.434  133.158 1.00 43.67  ? 100 DA  I N3    1 
ATOM 1514 C C4    . DA  A 1 100 ? 141.954 92.849  133.752 1.00 43.67  ? 100 DA  I C4    1 
ATOM 1515 P P     . DG  A 1 101 ? 145.009 98.490  132.404 1.00 44.56  ? 101 DG  I P     1 
ATOM 1516 O OP1   . DG  A 1 101 ? 145.338 99.308  131.218 1.00 44.56  ? 101 DG  I OP1   1 
ATOM 1517 O OP2   . DG  A 1 101 ? 145.860 98.547  133.614 1.00 44.56  ? 101 DG  I OP2   1 
ATOM 1518 O "O5'" . DG  A 1 101 ? 143.516 98.806  132.835 1.00 44.56  ? 101 DG  I "O5'" 1 
ATOM 1519 C "C5'" . DG  A 1 101 ? 142.462 98.019  132.316 1.00 44.56  ? 101 DG  I "C5'" 1 
ATOM 1520 C "C4'" . DG  A 1 101 ? 141.276 98.089  133.241 1.00 44.56  ? 101 DG  I "C4'" 1 
ATOM 1521 O "O4'" . DG  A 1 101 ? 141.180 96.858  133.990 1.00 44.56  ? 101 DG  I "O4'" 1 
ATOM 1522 C "C3'" . DG  A 1 101 ? 141.335 99.211  134.266 1.00 44.56  ? 101 DG  I "C3'" 1 
ATOM 1523 O "O3'" . DG  A 1 101 ? 140.055 99.754  134.413 1.00 44.56  ? 101 DG  I "O3'" 1 
ATOM 1524 C "C2'" . DG  A 1 101 ? 141.771 98.467  135.531 1.00 44.56  ? 101 DG  I "C2'" 1 
ATOM 1525 C "C1'" . DG  A 1 101 ? 141.018 97.166  135.344 1.00 44.56  ? 101 DG  I "C1'" 1 
ATOM 1526 N N9    . DG  A 1 101 ? 141.538 96.037  136.098 1.00 44.56  ? 101 DG  I N9    1 
ATOM 1527 C C8    . DG  A 1 101 ? 142.825 95.830  136.520 1.00 44.56  ? 101 DG  I C8    1 
ATOM 1528 N N7    . DG  A 1 101 ? 142.986 94.696  137.145 1.00 44.56  ? 101 DG  I N7    1 
ATOM 1529 C C5    . DG  A 1 101 ? 141.723 94.122  137.131 1.00 44.56  ? 101 DG  I C5    1 
ATOM 1530 C C6    . DG  A 1 101 ? 141.268 92.891  137.660 1.00 44.56  ? 101 DG  I C6    1 
ATOM 1531 O O6    . DG  A 1 101 ? 141.911 92.024  138.271 1.00 44.56  ? 101 DG  I O6    1 
ATOM 1532 N N1    . DG  A 1 101 ? 139.911 92.706  137.421 1.00 44.56  ? 101 DG  I N1    1 
ATOM 1533 C C2    . DG  A 1 101 ? 139.099 93.595  136.757 1.00 44.56  ? 101 DG  I C2    1 
ATOM 1534 N N2    . DG  A 1 101 ? 137.816 93.248  136.621 1.00 44.56  ? 101 DG  I N2    1 
ATOM 1535 N N3    . DG  A 1 101 ? 139.514 94.742  136.262 1.00 44.56  ? 101 DG  I N3    1 
ATOM 1536 C C4    . DG  A 1 101 ? 140.829 94.938  136.485 1.00 44.56  ? 101 DG  I C4    1 
ATOM 1537 P P     . DA  A 1 102 ? 139.689 101.154 133.725 1.00 45.30  ? 102 DA  I P     1 
ATOM 1538 O OP1   . DA  A 1 102 ? 140.487 101.262 132.489 1.00 45.30  ? 102 DA  I OP1   1 
ATOM 1539 O OP2   . DA  A 1 102 ? 139.766 102.209 134.756 1.00 45.30  ? 102 DA  I OP2   1 
ATOM 1540 O "O5'" . DA  A 1 102 ? 138.157 100.978 133.325 1.00 45.30  ? 102 DA  I "O5'" 1 
ATOM 1541 C "C5'" . DA  A 1 102 ? 137.172 101.393 134.242 1.00 45.30  ? 102 DA  I "C5'" 1 
ATOM 1542 C "C4'" . DA  A 1 102 ? 136.189 100.279 134.565 1.00 45.30  ? 102 DA  I "C4'" 1 
ATOM 1543 O "O4'" . DA  A 1 102 ? 136.867 99.128  135.122 1.00 45.30  ? 102 DA  I "O4'" 1 
ATOM 1544 C "C3'" . DA  A 1 102 ? 135.120 100.647 135.567 1.00 45.30  ? 102 DA  I "C3'" 1 
ATOM 1545 O "O3'" . DA  A 1 102 ? 133.940 99.961  135.200 1.00 45.30  ? 102 DA  I "O3'" 1 
ATOM 1546 C "C2'" . DA  A 1 102 ? 135.715 100.128 136.889 1.00 45.30  ? 102 DA  I "C2'" 1 
ATOM 1547 C "C1'" . DA  A 1 102 ? 136.335 98.838  136.402 1.00 45.30  ? 102 DA  I "C1'" 1 
ATOM 1548 N N9    . DA  A 1 102 ? 137.432 98.268  137.185 1.00 45.30  ? 102 DA  I N9    1 
ATOM 1549 C C8    . DA  A 1 102 ? 138.708 98.740  137.248 1.00 45.30  ? 102 DA  I C8    1 
ATOM 1550 N N7    . DA  A 1 102 ? 139.508 98.014  137.987 1.00 45.30  ? 102 DA  I N7    1 
ATOM 1551 C C5    . DA  A 1 102 ? 138.694 97.013  138.478 1.00 45.30  ? 102 DA  I C5    1 
ATOM 1552 C C6    . DA  A 1 102 ? 138.948 95.934  139.343 1.00 45.30  ? 102 DA  I C6    1 
ATOM 1553 N N6    . DA  A 1 102 ? 140.148 95.691  139.873 1.00 45.30  ? 102 DA  I N6    1 
ATOM 1554 N N1    . DA  A 1 102 ? 137.921 95.115  139.646 1.00 45.30  ? 102 DA  I N1    1 
ATOM 1555 C C2    . DA  A 1 102 ? 136.718 95.368  139.110 1.00 45.30  ? 102 DA  I C2    1 
ATOM 1556 N N3    . DA  A 1 102 ? 136.359 96.354  138.280 1.00 45.30  ? 102 DA  I N3    1 
ATOM 1557 C C4    . DA  A 1 102 ? 137.405 97.150  138.001 1.00 45.30  ? 102 DA  I C4    1 
ATOM 1558 P P     . DG  A 1 103 ? 132.513 100.684 135.284 1.00 51.88  ? 103 DG  I P     1 
ATOM 1559 O OP1   . DG  A 1 103 ? 131.728 100.284 134.096 1.00 51.88  ? 103 DG  I OP1   1 
ATOM 1560 O OP2   . DG  A 1 103 ? 132.756 102.116 135.560 1.00 51.88  ? 103 DG  I OP2   1 
ATOM 1561 O "O5'" . DG  A 1 103 ? 131.865 100.032 136.581 1.00 51.88  ? 103 DG  I "O5'" 1 
ATOM 1562 C "C5'" . DG  A 1 103 ? 132.203 100.543 137.835 1.00 51.88  ? 103 DG  I "C5'" 1 
ATOM 1563 C "C4'" . DG  A 1 103 ? 132.049 99.493  138.909 1.00 51.88  ? 103 DG  I "C4'" 1 
ATOM 1564 O "O4'" . DG  A 1 103 ? 133.322 98.847  139.161 1.00 51.88  ? 103 DG  I "O4'" 1 
ATOM 1565 C "C3'" . DG  A 1 103 ? 131.574 100.039 140.245 1.00 51.88  ? 103 DG  I "C3'" 1 
ATOM 1566 O "O3'" . DG  A 1 103 ? 130.653 99.134  140.821 1.00 51.88  ? 103 DG  I "O3'" 1 
ATOM 1567 C "C2'" . DG  A 1 103 ? 132.876 100.112 141.046 1.00 51.88  ? 103 DG  I "C2'" 1 
ATOM 1568 C "C1'" . DG  A 1 103 ? 133.567 98.862  140.542 1.00 51.88  ? 103 DG  I "C1'" 1 
ATOM 1569 N N9    . DG  A 1 103 ? 135.012 98.822  140.741 1.00 51.88  ? 103 DG  I N9    1 
ATOM 1570 C C8    . DG  A 1 103 ? 135.938 99.711  140.260 1.00 51.88  ? 103 DG  I C8    1 
ATOM 1571 N N7    . DG  A 1 103 ? 137.162 99.415  140.592 1.00 51.88  ? 103 DG  I N7    1 
ATOM 1572 C C5    . DG  A 1 103 ? 137.036 98.276  141.372 1.00 51.88  ? 103 DG  I C5    1 
ATOM 1573 C C6    . DG  A 1 103 ? 138.024 97.509  142.026 1.00 51.88  ? 103 DG  I C6    1 
ATOM 1574 O O6    . DG  A 1 103 ? 139.249 97.689  142.042 1.00 51.88  ? 103 DG  I O6    1 
ATOM 1575 N N1    . DG  A 1 103 ? 137.471 96.433  142.712 1.00 51.88  ? 103 DG  I N1    1 
ATOM 1576 C C2    . DG  A 1 103 ? 136.131 96.139  142.759 1.00 51.88  ? 103 DG  I C2    1 
ATOM 1577 N N2    . DG  A 1 103 ? 135.785 95.059  143.474 1.00 51.88  ? 103 DG  I N2    1 
ATOM 1578 N N3    . DG  A 1 103 ? 135.194 96.851  142.150 1.00 51.88  ? 103 DG  I N3    1 
ATOM 1579 C C4    . DG  A 1 103 ? 135.719 97.902  141.479 1.00 51.88  ? 103 DG  I C4    1 
ATOM 1580 P P     . DC  A 1 104 ? 129.475 99.685  141.758 1.00 57.28  ? 104 DC  I P     1 
ATOM 1581 O OP1   . DC  A 1 104 ? 128.791 98.510  142.342 1.00 57.28  ? 104 DC  I OP1   1 
ATOM 1582 O OP2   . DC  A 1 104 ? 128.703 100.670 140.970 1.00 57.28  ? 104 DC  I OP2   1 
ATOM 1583 O "O5'" . DC  A 1 104 ? 130.246 100.472 142.909 1.00 57.28  ? 104 DC  I "O5'" 1 
ATOM 1584 C "C5'" . DC  A 1 104 ? 130.074 100.116 144.263 1.00 57.28  ? 104 DC  I "C5'" 1 
ATOM 1585 C "C4'" . DC  A 1 104 ? 130.996 98.985  144.679 1.00 57.28  ? 104 DC  I "C4'" 1 
ATOM 1586 O "O4'" . DC  A 1 104 ? 132.303 99.192  144.155 1.00 57.28  ? 104 DC  I "O4'" 1 
ATOM 1587 C "C3'" . DC  A 1 104 ? 131.174 98.837  146.182 1.00 57.28  ? 104 DC  I "C3'" 1 
ATOM 1588 O "O3'" . DC  A 1 104 ? 130.226 97.877  146.645 1.00 57.28  ? 104 DC  I "O3'" 1 
ATOM 1589 C "C2'" . DC  A 1 104 ? 132.638 98.371  146.357 1.00 57.28  ? 104 DC  I "C2'" 1 
ATOM 1590 C "C1'" . DC  A 1 104 ? 133.209 98.460  144.937 1.00 57.28  ? 104 DC  I "C1'" 1 
ATOM 1591 N N1    . DC  A 1 104 ? 134.555 99.080  144.751 1.00 57.28  ? 104 DC  I N1    1 
ATOM 1592 C C2    . DC  A 1 104 ? 135.719 98.465  145.237 1.00 57.28  ? 104 DC  I C2    1 
ATOM 1593 O O2    . DC  A 1 104 ? 135.629 97.498  146.002 1.00 57.28  ? 104 DC  I O2    1 
ATOM 1594 N N3    . DC  A 1 104 ? 136.920 99.042  144.961 1.00 57.28  ? 104 DC  I N3    1 
ATOM 1595 C C4    . DC  A 1 104 ? 136.983 100.106 144.158 1.00 57.28  ? 104 DC  I C4    1 
ATOM 1596 N N4    . DC  A 1 104 ? 138.182 100.627 143.889 1.00 57.28  ? 104 DC  I N4    1 
ATOM 1597 C C5    . DC  A 1 104 ? 135.821 100.682 143.589 1.00 57.28  ? 104 DC  I C5    1 
ATOM 1598 C C6    . DC  A 1 104 ? 134.651 100.128 143.887 1.00 57.28  ? 104 DC  I C6    1 
ATOM 1599 P P     . DT  A 1 105 ? 129.340 98.200  147.939 1.00 62.22  ? 105 DT  I P     1 
ATOM 1600 O OP1   . DT  A 1 105 ? 128.292 97.160  148.042 1.00 62.22  ? 105 DT  I OP1   1 
ATOM 1601 O OP2   . DT  A 1 105 ? 128.963 99.628  147.858 1.00 62.22  ? 105 DT  I OP2   1 
ATOM 1602 O "O5'" . DT  A 1 105 ? 130.357 98.030  149.152 1.00 62.22  ? 105 DT  I "O5'" 1 
ATOM 1603 C "C5'" . DT  A 1 105 ? 130.990 96.769  149.386 1.00 62.22  ? 105 DT  I "C5'" 1 
ATOM 1604 C "C4'" . DT  A 1 105 ? 132.143 96.946  150.346 1.00 62.22  ? 105 DT  I "C4'" 1 
ATOM 1605 O "O4'" . DT  A 1 105 ? 133.292 97.452  149.647 1.00 62.22  ? 105 DT  I "O4'" 1 
ATOM 1606 C "C3'" . DT  A 1 105 ? 131.871 97.912  151.500 1.00 62.22  ? 105 DT  I "C3'" 1 
ATOM 1607 O "O3'" . DT  A 1 105 ? 131.898 97.212  152.734 1.00 62.22  ? 105 DT  I "O3'" 1 
ATOM 1608 C "C2'" . DT  A 1 105 ? 132.997 98.963  151.393 1.00 62.22  ? 105 DT  I "C2'" 1 
ATOM 1609 C "C1'" . DT  A 1 105 ? 134.026 98.243  150.534 1.00 62.22  ? 105 DT  I "C1'" 1 
ATOM 1610 N N1    . DT  A 1 105 ? 134.901 99.125  149.720 1.00 62.22  ? 105 DT  I N1    1 
ATOM 1611 C C2    . DT  A 1 105 ? 136.261 98.944  149.762 1.00 62.22  ? 105 DT  I C2    1 
ATOM 1612 O O2    . DT  A 1 105 ? 136.809 98.191  150.546 1.00 62.22  ? 105 DT  I O2    1 
ATOM 1613 N N3    . DT  A 1 105 ? 136.971 99.771  148.934 1.00 62.22  ? 105 DT  I N3    1 
ATOM 1614 C C4    . DT  A 1 105 ? 136.464 100.678 148.025 1.00 62.22  ? 105 DT  I C4    1 
ATOM 1615 O O4    . DT  A 1 105 ? 137.184 101.363 147.309 1.00 62.22  ? 105 DT  I O4    1 
ATOM 1616 C C5    . DT  A 1 105 ? 135.026 100.765 147.981 1.00 62.22  ? 105 DT  I C5    1 
ATOM 1617 C C7    . DT  A 1 105 ? 134.357 101.716 147.035 1.00 62.22  ? 105 DT  I C7    1 
ATOM 1618 C C6    . DT  A 1 105 ? 134.323 99.978  148.806 1.00 62.22  ? 105 DT  I C6    1 
ATOM 1619 P P     . DG  A 1 106 ? 131.557 97.982  154.099 1.00 65.35  ? 106 DG  I P     1 
ATOM 1620 O OP1   . DG  A 1 106 ? 130.961 97.014  155.045 1.00 65.35  ? 106 DG  I OP1   1 
ATOM 1621 O OP2   . DG  A 1 106 ? 130.820 99.217  153.751 1.00 65.35  ? 106 DG  I OP2   1 
ATOM 1622 O "O5'" . DG  A 1 106 ? 133.000 98.398  154.634 1.00 65.35  ? 106 DG  I "O5'" 1 
ATOM 1623 C "C5'" . DG  A 1 106 ? 134.038 97.421  154.674 1.00 65.35  ? 106 DG  I "C5'" 1 
ATOM 1624 C "C4'" . DG  A 1 106 ? 135.340 98.046  155.125 1.00 65.35  ? 106 DG  I "C4'" 1 
ATOM 1625 O "O4'" . DG  A 1 106 ? 135.964 98.712  153.998 1.00 65.35  ? 106 DG  I "O4'" 1 
ATOM 1626 C "C3'" . DG  A 1 106 ? 135.203 99.105  156.222 1.00 65.35  ? 106 DG  I "C3'" 1 
ATOM 1627 O "O3'" . DG  A 1 106 ? 136.201 98.907  157.215 1.00 65.35  ? 106 DG  I "O3'" 1 
ATOM 1628 C "C2'" . DG  A 1 106 ? 135.405 100.414 155.460 1.00 65.35  ? 106 DG  I "C2'" 1 
ATOM 1629 C "C1'" . DG  A 1 106 ? 136.408 99.976  154.411 1.00 65.35  ? 106 DG  I "C1'" 1 
ATOM 1630 N N9    . DG  A 1 106 ? 136.446 100.836 153.236 1.00 65.35  ? 106 DG  I N9    1 
ATOM 1631 C C8    . DG  A 1 106 ? 135.373 101.347 152.550 1.00 65.35  ? 106 DG  I C8    1 
ATOM 1632 N N7    . DG  A 1 106 ? 135.712 102.087 151.533 1.00 65.35  ? 106 DG  I N7    1 
ATOM 1633 C C5    . DG  A 1 106 ? 137.098 102.080 151.556 1.00 65.35  ? 106 DG  I C5    1 
ATOM 1634 C C6    . DG  A 1 106 ? 138.025 102.715 150.700 1.00 65.35  ? 106 DG  I C6    1 
ATOM 1635 O O6    . DG  A 1 106 ? 137.794 103.432 149.719 1.00 65.35  ? 106 DG  I O6    1 
ATOM 1636 N N1    . DG  A 1 106 ? 139.338 102.450 151.077 1.00 65.35  ? 106 DG  I N1    1 
ATOM 1637 C C2    . DG  A 1 106 ? 139.706 101.669 152.146 1.00 65.35  ? 106 DG  I C2    1 
ATOM 1638 N N2    . DG  A 1 106 ? 141.023 101.527 152.355 1.00 65.35  ? 106 DG  I N2    1 
ATOM 1639 N N3    . DG  A 1 106 ? 138.846 101.068 152.955 1.00 65.35  ? 106 DG  I N3    1 
ATOM 1640 C C4    . DG  A 1 106 ? 137.565 101.318 152.601 1.00 65.35  ? 106 DG  I C4    1 
ATOM 1641 P P     . DT  A 1 107 ? 136.175 99.780  158.561 1.00 67.62  ? 107 DT  I P     1 
ATOM 1642 O OP1   . DT  A 1 107 ? 136.882 99.008  159.606 1.00 67.62  ? 107 DT  I OP1   1 
ATOM 1643 O OP2   . DT  A 1 107 ? 134.779 100.217 158.784 1.00 67.62  ? 107 DT  I OP2   1 
ATOM 1644 O "O5'" . DT  A 1 107 ? 137.043 101.071 158.190 1.00 67.62  ? 107 DT  I "O5'" 1 
ATOM 1645 C "C5'" . DT  A 1 107 ? 138.088 101.495 159.055 1.00 67.62  ? 107 DT  I "C5'" 1 
ATOM 1646 C "C4'" . DT  A 1 107 ? 139.405 101.608 158.308 1.00 67.62  ? 107 DT  I "C4'" 1 
ATOM 1647 O "O4'" . DT  A 1 107 ? 139.157 101.906 156.915 1.00 67.62  ? 107 DT  I "O4'" 1 
ATOM 1648 C "C3'" . DT  A 1 107 ? 140.338 102.701 158.811 1.00 67.62  ? 107 DT  I "C3'" 1 
ATOM 1649 O "O3'" . DT  A 1 107 ? 141.687 102.249 158.732 1.00 67.62  ? 107 DT  I "O3'" 1 
ATOM 1650 C "C2'" . DT  A 1 107 ? 140.065 103.847 157.831 1.00 67.62  ? 107 DT  I "C2'" 1 
ATOM 1651 C "C1'" . DT  A 1 107 ? 139.861 103.072 156.543 1.00 67.62  ? 107 DT  I "C1'" 1 
ATOM 1652 N N1    . DT  A 1 107 ? 139.049 103.760 155.495 1.00 67.62  ? 107 DT  I N1    1 
ATOM 1653 C C2    . DT  A 1 107 ? 139.681 104.385 154.440 1.00 67.62  ? 107 DT  I C2    1 
ATOM 1654 O O2    . DT  A 1 107 ? 140.892 104.449 154.327 1.00 67.62  ? 107 DT  I O2    1 
ATOM 1655 N N3    . DT  A 1 107 ? 138.830 104.940 153.515 1.00 67.62  ? 107 DT  I N3    1 
ATOM 1656 C C4    . DT  A 1 107 ? 137.447 104.924 153.541 1.00 67.62  ? 107 DT  I C4    1 
ATOM 1657 O O4    . DT  A 1 107 ? 136.766 105.450 152.670 1.00 67.62  ? 107 DT  I O4    1 
ATOM 1658 C C5    . DT  A 1 107 ? 136.858 104.243 154.664 1.00 67.62  ? 107 DT  I C5    1 
ATOM 1659 C C7    . DT  A 1 107 ? 135.367 104.162 154.795 1.00 67.62  ? 107 DT  I C7    1 
ATOM 1660 C C6    . DT  A 1 107 ? 137.676 103.694 155.570 1.00 67.62  ? 107 DT  I C6    1 
ATOM 1661 P P     . DC  A 1 108 ? 142.771 102.817 159.768 1.00 67.72  ? 108 DC  I P     1 
ATOM 1662 O OP1   . DC  A 1 108 ? 143.956 101.933 159.702 1.00 67.72  ? 108 DC  I OP1   1 
ATOM 1663 O OP2   . DC  A 1 108 ? 142.089 103.045 161.060 1.00 67.72  ? 108 DC  I OP2   1 
ATOM 1664 O "O5'" . DC  A 1 108 ? 143.156 104.243 159.169 1.00 67.72  ? 108 DC  I "O5'" 1 
ATOM 1665 C "C5'" . DC  A 1 108 ? 143.788 104.358 157.895 1.00 67.72  ? 108 DC  I "C5'" 1 
ATOM 1666 C "C4'" . DC  A 1 108 ? 143.800 105.814 157.479 1.00 67.72  ? 108 DC  I "C4'" 1 
ATOM 1667 O "O4'" . DC  A 1 108 ? 142.574 106.138 156.815 1.00 67.72  ? 108 DC  I "O4'" 1 
ATOM 1668 C "C3'" . DC  A 1 108 ? 143.947 106.788 158.644 1.00 67.72  ? 108 DC  I "C3'" 1 
ATOM 1669 O "O3'" . DC  A 1 108 ? 145.196 107.455 158.563 1.00 67.72  ? 108 DC  I "O3'" 1 
ATOM 1670 C "C2'" . DC  A 1 108 ? 142.761 107.761 158.494 1.00 67.72  ? 108 DC  I "C2'" 1 
ATOM 1671 C "C1'" . DC  A 1 108 ? 142.230 107.465 157.095 1.00 67.72  ? 108 DC  I "C1'" 1 
ATOM 1672 N N1    . DC  A 1 108 ? 140.757 107.574 156.942 1.00 67.72  ? 108 DC  I N1    1 
ATOM 1673 C C2    . DC  A 1 108 ? 140.233 107.964 155.709 1.00 67.72  ? 108 DC  I C2    1 
ATOM 1674 O O2    . DC  A 1 108 ? 141.018 108.247 154.796 1.00 67.72  ? 108 DC  I O2    1 
ATOM 1675 N N3    . DC  A 1 108 ? 138.889 108.026 155.556 1.00 67.72  ? 108 DC  I N3    1 
ATOM 1676 C C4    . DC  A 1 108 ? 138.090 107.700 156.570 1.00 67.72  ? 108 DC  I C4    1 
ATOM 1677 N N4    . DC  A 1 108 ? 136.770 107.776 156.376 1.00 67.72  ? 108 DC  I N4    1 
ATOM 1678 C C5    . DC  A 1 108 ? 138.609 107.280 157.830 1.00 67.72  ? 108 DC  I C5    1 
ATOM 1679 C C6    . DC  A 1 108 ? 139.936 107.225 157.968 1.00 67.72  ? 108 DC  I C6    1 
ATOM 1680 P P     . DT  A 1 109 ? 146.010 107.795 159.902 1.00 68.34  ? 109 DT  I P     1 
ATOM 1681 O OP1   . DT  A 1 109 ? 146.735 106.574 160.317 1.00 68.34  ? 109 DT  I OP1   1 
ATOM 1682 O OP2   . DT  A 1 109 ? 145.054 108.431 160.834 1.00 68.34  ? 109 DT  I OP2   1 
ATOM 1683 O "O5'" . DT  A 1 109 ? 147.065 108.912 159.454 1.00 68.34  ? 109 DT  I "O5'" 1 
ATOM 1684 C "C5'" . DT  A 1 109 ? 146.612 110.207 159.073 1.00 68.34  ? 109 DT  I "C5'" 1 
ATOM 1685 C "C4'" . DT  A 1 109 ? 146.490 110.361 157.567 1.00 68.34  ? 109 DT  I "C4'" 1 
ATOM 1686 O "O4'" . DT  A 1 109 ? 145.114 110.153 157.167 1.00 68.34  ? 109 DT  I "O4'" 1 
ATOM 1687 C "C3'" . DT  A 1 109 ? 146.864 111.725 157.016 1.00 68.34  ? 109 DT  I "C3'" 1 
ATOM 1688 O "O3'" . DT  A 1 109 ? 147.395 111.536 155.706 1.00 68.34  ? 109 DT  I "O3'" 1 
ATOM 1689 C "C2'" . DT  A 1 109 ? 145.508 112.442 157.002 1.00 68.34  ? 109 DT  I "C2'" 1 
ATOM 1690 C "C1'" . DT  A 1 109 ? 144.627 111.313 156.515 1.00 68.34  ? 109 DT  I "C1'" 1 
ATOM 1691 N N1    . DT  A 1 109 ? 143.197 111.392 156.885 1.00 68.34  ? 109 DT  I N1    1 
ATOM 1692 C C2    . DT  A 1 109 ? 142.241 111.597 155.917 1.00 68.34  ? 109 DT  I C2    1 
ATOM 1693 O O2    . DT  A 1 109 ? 142.508 111.881 154.766 1.00 68.34  ? 109 DT  I O2    1 
ATOM 1694 N N3    . DT  A 1 109 ? 140.949 111.551 156.380 1.00 68.34  ? 109 DT  I N3    1 
ATOM 1695 C C4    . DT  A 1 109 ? 140.532 111.254 157.665 1.00 68.34  ? 109 DT  I C4    1 
ATOM 1696 O O4    . DT  A 1 109 ? 139.353 111.225 157.985 1.00 68.34  ? 109 DT  I O4    1 
ATOM 1697 C C5    . DT  A 1 109 ? 141.583 110.984 158.605 1.00 68.34  ? 109 DT  I C5    1 
ATOM 1698 C C7    . DT  A 1 109 ? 141.252 110.650 160.030 1.00 68.34  ? 109 DT  I C7    1 
ATOM 1699 C C6    . DT  A 1 109 ? 142.844 111.045 158.169 1.00 68.34  ? 109 DT  I C6    1 
ATOM 1700 P P     . DA  A 1 110 ? 148.788 112.204 155.270 1.00 67.15  ? 110 DA  I P     1 
ATOM 1701 O OP1   . DA  A 1 110 ? 149.599 111.173 154.588 1.00 67.15  ? 110 DA  I OP1   1 
ATOM 1702 O OP2   . DA  A 1 110 ? 149.339 112.917 156.443 1.00 67.15  ? 110 DA  I OP2   1 
ATOM 1703 O "O5'" . DA  A 1 110 ? 148.341 113.297 154.204 1.00 67.15  ? 110 DA  I "O5'" 1 
ATOM 1704 C "C5'" . DA  A 1 110 ? 147.694 114.454 154.651 1.00 67.15  ? 110 DA  I "C5'" 1 
ATOM 1705 C "C4'" . DA  A 1 110 ? 146.797 115.030 153.579 1.00 67.15  ? 110 DA  I "C4'" 1 
ATOM 1706 O "O4'" . DA  A 1 110 ? 145.419 114.860 153.984 1.00 67.15  ? 110 DA  I "O4'" 1 
ATOM 1707 C "C3'" . DA  A 1 110 ? 146.947 116.516 153.377 1.00 67.15  ? 110 DA  I "C3'" 1 
ATOM 1708 O "O3'" . DA  A 1 110 ? 146.401 116.879 152.121 1.00 67.15  ? 110 DA  I "O3'" 1 
ATOM 1709 C "C2'" . DA  A 1 110 ? 146.106 117.037 154.526 1.00 67.15  ? 110 DA  I "C2'" 1 
ATOM 1710 C "C1'" . DA  A 1 110 ? 144.907 116.099 154.441 1.00 67.15  ? 110 DA  I "C1'" 1 
ATOM 1711 N N9    . DA  A 1 110 ? 144.274 115.842 155.727 1.00 67.15  ? 110 DA  I N9    1 
ATOM 1712 C C8    . DA  A 1 110 ? 144.897 115.714 156.935 1.00 67.15  ? 110 DA  I C8    1 
ATOM 1713 N N7    . DA  A 1 110 ? 144.082 115.447 157.925 1.00 67.15  ? 110 DA  I N7    1 
ATOM 1714 C C5    . DA  A 1 110 ? 142.839 115.393 157.324 1.00 67.15  ? 110 DA  I C5    1 
ATOM 1715 C C6    . DA  A 1 110 ? 141.554 115.150 157.834 1.00 67.15  ? 110 DA  I C6    1 
ATOM 1716 N N6    . DA  A 1 110 ? 141.309 114.909 159.125 1.00 67.15  ? 110 DA  I N6    1 
ATOM 1717 N N1    . DA  A 1 110 ? 140.524 115.166 156.965 1.00 67.15  ? 110 DA  I N1    1 
ATOM 1718 C C2    . DA  A 1 110 ? 140.770 115.409 155.674 1.00 67.15  ? 110 DA  I C2    1 
ATOM 1719 N N3    . DA  A 1 110 ? 141.936 115.650 155.077 1.00 67.15  ? 110 DA  I N3    1 
ATOM 1720 C C4    . DA  A 1 110 ? 142.939 115.627 155.967 1.00 67.15  ? 110 DA  I C4    1 
ATOM 1721 P P     . DC  A 1 111 ? 146.778 118.287 151.448 1.00 64.69  ? 111 DC  I P     1 
ATOM 1722 O OP1   . DC  A 1 111 ? 147.248 118.011 150.074 1.00 64.69  ? 111 DC  I OP1   1 
ATOM 1723 O OP2   . DC  A 1 111 ? 147.648 119.029 152.386 1.00 64.69  ? 111 DC  I OP2   1 
ATOM 1724 O "O5'" . DC  A 1 111 ? 145.377 119.050 151.369 1.00 64.69  ? 111 DC  I "O5'" 1 
ATOM 1725 C "C5'" . DC  A 1 111 ? 144.465 118.762 150.318 1.00 64.69  ? 111 DC  I "C5'" 1 
ATOM 1726 C "C4'" . DC  A 1 111 ? 143.027 118.895 150.793 1.00 64.69  ? 111 DC  I "C4'" 1 
ATOM 1727 O "O4'" . DC  A 1 111 ? 142.871 118.287 152.081 1.00 64.69  ? 111 DC  I "O4'" 1 
ATOM 1728 C "C3'" . DC  A 1 111 ? 142.539 120.319 150.957 1.00 64.69  ? 111 DC  I "C3'" 1 
ATOM 1729 O "O3'" . DC  A 1 111 ? 141.996 120.743 149.726 1.00 64.69  ? 111 DC  I "O3'" 1 
ATOM 1730 C "C2'" . DC  A 1 111 ? 141.451 120.205 152.032 1.00 64.69  ? 111 DC  I "C2'" 1 
ATOM 1731 C "C1'" . DC  A 1 111 ? 141.838 118.939 152.797 1.00 64.69  ? 111 DC  I "C1'" 1 
ATOM 1732 N N1    . DC  A 1 111 ? 142.274 119.085 154.219 1.00 64.69  ? 111 DC  I N1    1 
ATOM 1733 C C2    . DC  A 1 111 ? 141.343 118.919 155.248 1.00 64.69  ? 111 DC  I C2    1 
ATOM 1734 O O2    . DC  A 1 111 ? 140.155 118.746 154.962 1.00 64.69  ? 111 DC  I O2    1 
ATOM 1735 N N3    . DC  A 1 111 ? 141.767 118.982 156.534 1.00 64.69  ? 111 DC  I N3    1 
ATOM 1736 C C4    . DC  A 1 111 ? 143.059 119.169 156.802 1.00 64.69  ? 111 DC  I C4    1 
ATOM 1737 N N4    . DC  A 1 111 ? 143.432 119.227 158.084 1.00 64.69  ? 111 DC  I N4    1 
ATOM 1738 C C5    . DC  A 1 111 ? 144.023 119.313 155.768 1.00 64.69  ? 111 DC  I C5    1 
ATOM 1739 C C6    . DC  A 1 111 ? 143.592 119.252 154.504 1.00 64.69  ? 111 DC  I C6    1 
ATOM 1740 P P     . DG  A 1 112 ? 142.015 122.293 149.334 1.00 61.37  ? 112 DG  I P     1 
ATOM 1741 O OP1   . DG  A 1 112 ? 141.984 122.379 147.860 1.00 61.37  ? 112 DG  I OP1   1 
ATOM 1742 O OP2   . DG  A 1 112 ? 143.104 122.946 150.091 1.00 61.37  ? 112 DG  I OP2   1 
ATOM 1743 O "O5'" . DG  A 1 112 ? 140.625 122.822 149.899 1.00 61.37  ? 112 DG  I "O5'" 1 
ATOM 1744 C "C5'" . DG  A 1 112 ? 139.396 122.344 149.358 1.00 61.37  ? 112 DG  I "C5'" 1 
ATOM 1745 C "C4'" . DG  A 1 112 ? 138.247 122.713 150.276 1.00 61.37  ? 112 DG  I "C4'" 1 
ATOM 1746 O "O4'" . DG  A 1 112 ? 138.498 122.226 151.618 1.00 61.37  ? 112 DG  I "O4'" 1 
ATOM 1747 C "C3'" . DG  A 1 112 ? 137.971 124.196 150.385 1.00 61.37  ? 112 DG  I "C3'" 1 
ATOM 1748 O "O3'" . DG  A 1 112 ? 136.565 124.410 150.419 1.00 61.37  ? 112 DG  I "O3'" 1 
ATOM 1749 C "C2'" . DG  A 1 112 ? 138.662 124.573 151.708 1.00 61.37  ? 112 DG  I "C2'" 1 
ATOM 1750 C "C1'" . DG  A 1 112 ? 138.488 123.301 152.528 1.00 61.37  ? 112 DG  I "C1'" 1 
ATOM 1751 N N9    . DG  A 1 112 ? 139.552 123.020 153.493 1.00 61.37  ? 112 DG  I N9    1 
ATOM 1752 C C8    . DG  A 1 112 ? 140.897 123.208 153.312 1.00 61.37  ? 112 DG  I C8    1 
ATOM 1753 N N7    . DG  A 1 112 ? 141.615 122.871 154.345 1.00 61.37  ? 112 DG  I N7    1 
ATOM 1754 C C5    . DG  A 1 112 ? 140.682 122.515 155.305 1.00 61.37  ? 112 DG  I C5    1 
ATOM 1755 C C6    . DG  A 1 112 ? 140.869 122.091 156.642 1.00 61.37  ? 112 DG  I C6    1 
ATOM 1756 O O6    . DG  A 1 112 ? 141.934 121.943 157.257 1.00 61.37  ? 112 DG  I O6    1 
ATOM 1757 N N1    . DG  A 1 112 ? 139.659 121.829 157.277 1.00 61.37  ? 112 DG  I N1    1 
ATOM 1758 C C2    . DG  A 1 112 ? 138.420 121.960 156.690 1.00 61.37  ? 112 DG  I C2    1 
ATOM 1759 N N2    . DG  A 1 112 ? 137.362 121.663 157.461 1.00 61.37  ? 112 DG  I N2    1 
ATOM 1760 N N3    . DG  A 1 112 ? 138.231 122.358 155.435 1.00 61.37  ? 112 DG  I N3    1 
ATOM 1761 C C4    . DG  A 1 112 ? 139.404 122.614 154.804 1.00 61.37  ? 112 DG  I C4    1 
ATOM 1762 P P     . DA  A 1 113 ? 135.977 125.900 150.486 1.00 64.23  ? 113 DA  I P     1 
ATOM 1763 O OP1   . DA  A 1 113 ? 134.901 125.980 149.482 1.00 64.23  ? 113 DA  I OP1   1 
ATOM 1764 O OP2   . DA  A 1 113 ? 137.092 126.867 150.411 1.00 64.23  ? 113 DA  I OP2   1 
ATOM 1765 O "O5'" . DA  A 1 113 ? 135.301 125.990 151.928 1.00 64.23  ? 113 DA  I "O5'" 1 
ATOM 1766 C "C5'" . DA  A 1 113 ? 134.175 125.161 152.249 1.00 64.23  ? 113 DA  I "C5'" 1 
ATOM 1767 C "C4'" . DA  A 1 113 ? 133.822 125.311 153.716 1.00 64.23  ? 113 DA  I "C4'" 1 
ATOM 1768 O "O4'" . DA  A 1 113 ? 134.896 124.838 154.550 1.00 64.23  ? 113 DA  I "O4'" 1 
ATOM 1769 C "C3'" . DA  A 1 113 ? 133.494 126.724 154.163 1.00 64.23  ? 113 DA  I "C3'" 1 
ATOM 1770 O "O3'" . DA  A 1 113 ? 132.317 126.649 154.976 1.00 64.23  ? 113 DA  I "O3'" 1 
ATOM 1771 C "C2'" . DA  A 1 113 ? 134.770 127.144 154.934 1.00 64.23  ? 113 DA  I "C2'" 1 
ATOM 1772 C "C1'" . DA  A 1 113 ? 135.184 125.809 155.523 1.00 64.23  ? 113 DA  I "C1'" 1 
ATOM 1773 N N9    . DA  A 1 113 ? 136.597 125.605 155.845 1.00 64.23  ? 113 DA  I N9    1 
ATOM 1774 C C8    . DA  A 1 113 ? 137.666 125.838 155.035 1.00 64.23  ? 113 DA  I C8    1 
ATOM 1775 N N7    . DA  A 1 113 ? 138.822 125.575 155.592 1.00 64.23  ? 113 DA  I N7    1 
ATOM 1776 C C5    . DA  A 1 113 ? 138.496 125.285 156.902 1.00 64.23  ? 113 DA  I C5    1 
ATOM 1777 C C6    . DA  A 1 113 ? 139.280 124.973 158.028 1.00 64.23  ? 113 DA  I C6    1 
ATOM 1778 N N6    . DA  A 1 113 ? 140.613 124.896 157.999 1.00 64.23  ? 113 DA  I N6    1 
ATOM 1779 N N1    . DA  A 1 113 ? 138.638 124.741 159.191 1.00 64.23  ? 113 DA  I N1    1 
ATOM 1780 C C2    . DA  A 1 113 ? 137.303 124.819 159.217 1.00 64.23  ? 113 DA  I C2    1 
ATOM 1781 N N3    . DA  A 1 113 ? 136.460 125.105 158.225 1.00 64.23  ? 113 DA  I N3    1 
ATOM 1782 C C4    . DA  A 1 113 ? 137.128 125.329 157.084 1.00 64.23  ? 113 DA  I C4    1 
ATOM 1783 P P     . DC  A 1 114 ? 131.545 127.960 155.486 1.00 70.49  ? 114 DC  I P     1 
ATOM 1784 O OP1   . DC  A 1 114 ? 130.094 127.681 155.407 1.00 70.49  ? 114 DC  I OP1   1 
ATOM 1785 O OP2   . DC  A 1 114 ? 132.114 129.113 154.756 1.00 70.49  ? 114 DC  I OP2   1 
ATOM 1786 O "O5'" . DC  A 1 114 ? 131.969 128.095 157.019 1.00 70.49  ? 114 DC  I "O5'" 1 
ATOM 1787 C "C5'" . DC  A 1 114 ? 132.728 129.183 157.443 1.00 70.49  ? 114 DC  I "C5'" 1 
ATOM 1788 C "C4'" . DC  A 1 114 ? 133.214 128.980 158.863 1.00 70.49  ? 114 DC  I "C4'" 1 
ATOM 1789 O "O4'" . DC  A 1 114 ? 134.502 128.323 158.844 1.00 70.49  ? 114 DC  I "O4'" 1 
ATOM 1790 C "C3'" . DC  A 1 114 ? 133.407 130.267 159.660 1.00 70.49  ? 114 DC  I "C3'" 1 
ATOM 1791 O "O3'" . DC  A 1 114 ? 133.098 130.029 161.038 1.00 70.49  ? 114 DC  I "O3'" 1 
ATOM 1792 C "C2'" . DC  A 1 114 ? 134.888 130.531 159.441 1.00 70.49  ? 114 DC  I "C2'" 1 
ATOM 1793 C "C1'" . DC  A 1 114 ? 135.416 129.118 159.551 1.00 70.49  ? 114 DC  I "C1'" 1 
ATOM 1794 N N1    . DC  A 1 114 ? 136.729 128.901 158.937 1.00 70.49  ? 114 DC  I N1    1 
ATOM 1795 C C2    . DC  A 1 114 ? 137.805 128.515 159.730 1.00 70.49  ? 114 DC  I C2    1 
ATOM 1796 O O2    . DC  A 1 114 ? 137.672 128.509 160.959 1.00 70.49  ? 114 DC  I O2    1 
ATOM 1797 N N3    . DC  A 1 114 ? 138.996 128.276 159.138 1.00 70.49  ? 114 DC  I N3    1 
ATOM 1798 C C4    . DC  A 1 114 ? 139.101 128.321 157.811 1.00 70.49  ? 114 DC  I C4    1 
ATOM 1799 N N4    . DC  A 1 114 ? 140.292 128.054 157.270 1.00 70.49  ? 114 DC  I N4    1 
ATOM 1800 C C5    . DC  A 1 114 ? 137.992 128.640 156.980 1.00 70.49  ? 114 DC  I C5    1 
ATOM 1801 C C6    . DC  A 1 114 ? 136.830 128.895 157.579 1.00 70.49  ? 114 DC  I C6    1 
ATOM 1802 P P     . DC  A 1 115 ? 132.742 131.245 162.028 1.00 75.12  ? 115 DC  I P     1 
ATOM 1803 O OP1   . DC  A 1 115 ? 132.274 130.650 163.299 1.00 75.12  ? 115 DC  I OP1   1 
ATOM 1804 O OP2   . DC  A 1 115 ? 131.864 132.170 161.280 1.00 75.12  ? 115 DC  I OP2   1 
ATOM 1805 O "O5'" . DC  A 1 115 ? 134.136 131.993 162.280 1.00 75.12  ? 115 DC  I "O5'" 1 
ATOM 1806 C "C5'" . DC  A 1 115 ? 134.341 132.738 163.495 1.00 75.12  ? 115 DC  I "C5'" 1 
ATOM 1807 C "C4'" . DC  A 1 115 ? 135.820 132.825 163.839 1.00 75.12  ? 115 DC  I "C4'" 1 
ATOM 1808 O "O4'" . DC  A 1 115 ? 136.616 132.249 162.779 1.00 75.12  ? 115 DC  I "O4'" 1 
ATOM 1809 C "C3'" . DC  A 1 115 ? 136.370 134.234 164.067 1.00 75.12  ? 115 DC  I "C3'" 1 
ATOM 1810 O "O3'" . DC  A 1 115 ? 137.262 134.191 165.189 1.00 75.12  ? 115 DC  I "O3'" 1 
ATOM 1811 C "C2'" . DC  A 1 115 ? 137.108 134.521 162.752 1.00 75.12  ? 115 DC  I "C2'" 1 
ATOM 1812 C "C1'" . DC  A 1 115 ? 137.658 133.140 162.460 1.00 75.12  ? 115 DC  I "C1'" 1 
ATOM 1813 N N1    . DC  A 1 115 ? 138.043 132.871 161.054 1.00 75.12  ? 115 DC  I N1    1 
ATOM 1814 C C2    . DC  A 1 115 ? 139.307 132.348 160.775 1.00 75.12  ? 115 DC  I C2    1 
ATOM 1815 O O2    . DC  A 1 115 ? 140.142 132.277 161.684 1.00 75.12  ? 115 DC  I O2    1 
ATOM 1816 N N3    . DC  A 1 115 ? 139.622 132.049 159.492 1.00 75.12  ? 115 DC  I N3    1 
ATOM 1817 C C4    . DC  A 1 115 ? 138.705 132.162 158.535 1.00 75.12  ? 115 DC  I C4    1 
ATOM 1818 N N4    . DC  A 1 115 ? 139.059 131.835 157.289 1.00 75.12  ? 115 DC  I N4    1 
ATOM 1819 C C5    . DC  A 1 115 ? 137.388 132.622 158.812 1.00 75.12  ? 115 DC  I C5    1 
ATOM 1820 C C6    . DC  A 1 115 ? 137.096 132.936 160.078 1.00 75.12  ? 115 DC  I C6    1 
ATOM 1821 P P     . DA  A 1 116 ? 137.515 135.468 166.132 1.00 79.16  ? 116 DA  I P     1 
ATOM 1822 O OP1   . DA  A 1 116 ? 136.639 135.339 167.319 1.00 79.16  ? 116 DA  I OP1   1 
ATOM 1823 O OP2   . DA  A 1 116 ? 137.433 136.676 165.283 1.00 79.16  ? 116 DA  I OP2   1 
ATOM 1824 O "O5'" . DA  A 1 116 ? 139.047 135.294 166.580 1.00 79.16  ? 116 DA  I "O5'" 1 
ATOM 1825 C "C5'" . DA  A 1 116 ? 139.661 136.222 167.483 1.00 79.16  ? 116 DA  I "C5'" 1 
ATOM 1826 C "C4'" . DA  A 1 116 ? 141.061 136.558 167.003 1.00 79.16  ? 116 DA  I "C4'" 1 
ATOM 1827 O "O4'" . DA  A 1 116 ? 141.257 135.974 165.695 1.00 79.16  ? 116 DA  I "O4'" 1 
ATOM 1828 C "C3'" . DA  A 1 116 ? 141.325 138.046 166.816 1.00 79.16  ? 116 DA  I "C3'" 1 
ATOM 1829 O "O3'" . DA  A 1 116 ? 142.741 138.312 166.842 1.00 79.16  ? 116 DA  I "O3'" 1 
ATOM 1830 C "C2'" . DA  A 1 116 ? 140.782 138.223 165.411 1.00 79.16  ? 116 DA  I "C2'" 1 
ATOM 1831 C "C1'" . DA  A 1 116 ? 141.455 137.021 164.782 1.00 79.16  ? 116 DA  I "C1'" 1 
ATOM 1832 N N9    . DA  A 1 116 ? 140.937 136.614 163.487 1.00 79.16  ? 116 DA  I N9    1 
ATOM 1833 C C8    . DA  A 1 116 ? 139.684 136.806 162.978 1.00 79.16  ? 116 DA  I C8    1 
ATOM 1834 N N7    . DA  A 1 116 ? 139.536 136.333 161.760 1.00 79.16  ? 116 DA  I N7    1 
ATOM 1835 C C5    . DA  A 1 116 ? 140.787 135.830 161.450 1.00 79.16  ? 116 DA  I C5    1 
ATOM 1836 C C6    . DA  A 1 116 ? 141.308 135.199 160.304 1.00 79.16  ? 116 DA  I C6    1 
ATOM 1837 N N6    . DA  A 1 116 ? 140.595 134.954 159.200 1.00 79.16  ? 116 DA  I N6    1 
ATOM 1838 N N1    . DA  A 1 116 ? 142.607 134.830 160.336 1.00 79.16  ? 116 DA  I N1    1 
ATOM 1839 C C2    . DA  A 1 116 ? 143.318 135.072 161.438 1.00 79.16  ? 116 DA  I C2    1 
ATOM 1840 N N3    . DA  A 1 116 ? 142.942 135.655 162.562 1.00 79.16  ? 116 DA  I N3    1 
ATOM 1841 C C4    . DA  A 1 116 ? 141.656 136.011 162.503 1.00 79.16  ? 116 DA  I C4    1 
ATOM 1842 P P     . DA  A 1 117 ? 143.260 139.830 166.718 1.00 85.01  ? 117 DA  I P     1 
ATOM 1843 O OP1   . DA  A 1 117 ? 142.633 140.582 167.827 1.00 85.01  ? 117 DA  I OP1   1 
ATOM 1844 O OP2   . DA  A 1 117 ? 143.072 140.280 165.322 1.00 85.01  ? 117 DA  I OP2   1 
ATOM 1845 O "O5'" . DA  A 1 117 ? 144.848 139.792 166.958 1.00 85.01  ? 117 DA  I "O5'" 1 
ATOM 1846 C "C5'" . DA  A 1 117 ? 145.583 140.964 166.596 1.00 85.01  ? 117 DA  I "C5'" 1 
ATOM 1847 C "C4'" . DA  A 1 117 ? 146.520 140.798 165.403 1.00 85.01  ? 117 DA  I "C4'" 1 
ATOM 1848 O "O4'" . DA  A 1 117 ? 145.768 140.312 164.250 1.00 85.01  ? 117 DA  I "O4'" 1 
ATOM 1849 C "C3'" . DA  A 1 117 ? 147.192 142.076 164.918 1.00 85.01  ? 117 DA  I "C3'" 1 
ATOM 1850 O "O3'" . DA  A 1 117 ? 148.453 141.677 164.312 1.00 85.01  ? 117 DA  I "O3'" 1 
ATOM 1851 C "C2'" . DA  A 1 117 ? 146.139 142.601 163.936 1.00 85.01  ? 117 DA  I "C2'" 1 
ATOM 1852 C "C1'" . DA  A 1 117 ? 145.854 141.304 163.238 1.00 85.01  ? 117 DA  I "C1'" 1 
ATOM 1853 N N9    . DA  A 1 117 ? 144.602 141.199 162.495 1.00 85.01  ? 117 DA  I N9    1 
ATOM 1854 C C8    . DA  A 1 117 ? 143.459 141.897 162.703 1.00 85.01  ? 117 DA  I C8    1 
ATOM 1855 N N7    . DA  A 1 117 ? 142.522 141.670 161.819 1.00 85.01  ? 117 DA  I N7    1 
ATOM 1856 C C5    . DA  A 1 117 ? 143.194 141.019 160.813 1.00 85.01  ? 117 DA  I C5    1 
ATOM 1857 C C6    . DA  A 1 117 ? 142.799 140.574 159.538 1.00 85.01  ? 117 DA  I C6    1 
ATOM 1858 N N6    . DA  A 1 117 ? 141.565 140.734 159.055 1.00 85.01  ? 117 DA  I N6    1 
ATOM 1859 N N1    . DA  A 1 117 ? 143.723 139.949 158.783 1.00 85.01  ? 117 DA  I N1    1 
ATOM 1860 C C2    . DA  A 1 117 ? 144.959 139.807 159.279 1.00 85.01  ? 117 DA  I C2    1 
ATOM 1861 N N3    . DA  A 1 117 ? 145.443 140.180 160.458 1.00 85.01  ? 117 DA  I N3    1 
ATOM 1862 C C4    . DA  A 1 117 ? 144.501 140.781 161.187 1.00 85.01  ? 117 DA  I C4    1 
ATOM 1863 P P     . DT  A 1 118 ? 149.501 142.696 163.636 1.00 89.02  ? 118 DT  I P     1 
ATOM 1864 O OP1   . DT  A 1 118 ? 150.838 142.069 163.732 1.00 89.02  ? 118 DT  I OP1   1 
ATOM 1865 O OP2   . DT  A 1 118 ? 149.273 144.044 164.202 1.00 89.02  ? 118 DT  I OP2   1 
ATOM 1866 O "O5'" . DT  A 1 118 ? 149.069 142.740 162.095 1.00 89.02  ? 118 DT  I "O5'" 1 
ATOM 1867 C "C5'" . DT  A 1 118 ? 148.770 143.943 161.425 1.00 89.02  ? 118 DT  I "C5'" 1 
ATOM 1868 C "C4'" . DT  A 1 118 ? 148.917 143.730 159.920 1.00 89.02  ? 118 DT  I "C4'" 1 
ATOM 1869 O "O4'" . DT  A 1 118 ? 147.663 143.330 159.346 1.00 89.02  ? 118 DT  I "O4'" 1 
ATOM 1870 C "C3'" . DT  A 1 118 ? 149.391 144.953 159.140 1.00 89.02  ? 118 DT  I "C3'" 1 
ATOM 1871 O "O3'" . DT  A 1 118 ? 150.285 144.564 158.068 1.00 89.02  ? 118 DT  I "O3'" 1 
ATOM 1872 C "C2'" . DT  A 1 118 ? 148.068 145.500 158.593 1.00 89.02  ? 118 DT  I "C2'" 1 
ATOM 1873 C "C1'" . DT  A 1 118 ? 147.303 144.212 158.318 1.00 89.02  ? 118 DT  I "C1'" 1 
ATOM 1874 N N1    . DT  A 1 118 ? 145.829 144.328 158.337 1.00 89.02  ? 118 DT  I N1    1 
ATOM 1875 C C2    . DT  A 1 118 ? 145.145 144.131 157.173 1.00 89.02  ? 118 DT  I C2    1 
ATOM 1876 O O2    . DT  A 1 118 ? 145.692 143.817 156.133 1.00 89.02  ? 118 DT  I O2    1 
ATOM 1877 N N3    . DT  A 1 118 ? 143.787 144.190 157.281 1.00 89.02  ? 118 DT  I N3    1 
ATOM 1878 C C4    . DT  A 1 118 ? 143.062 144.524 158.409 1.00 89.02  ? 118 DT  I C4    1 
ATOM 1879 O O4    . DT  A 1 118 ? 141.839 144.601 158.403 1.00 89.02  ? 118 DT  I O4    1 
ATOM 1880 C C5    . DT  A 1 118 ? 143.846 144.756 159.600 1.00 89.02  ? 118 DT  I C5    1 
ATOM 1881 C C7    . DT  A 1 118 ? 143.169 145.106 160.892 1.00 89.02  ? 118 DT  I C7    1 
ATOM 1882 C C6    . DT  A 1 118 ? 145.179 144.649 159.507 1.00 89.02  ? 118 DT  I C6    1 
ATOM 1883 P P     . DT  A 1 119 ? 151.873 144.484 158.321 1.00 94.38  ? 119 DT  I P     1 
ATOM 1884 O OP1   . DT  A 1 119 ? 152.249 143.059 158.200 1.00 94.38  ? 119 DT  I OP1   1 
ATOM 1885 O OP2   . DT  A 1 119 ? 152.137 145.200 159.586 1.00 94.38  ? 119 DT  I OP2   1 
ATOM 1886 O "O5'" . DT  A 1 119 ? 152.598 145.317 157.144 1.00 94.38  ? 119 DT  I "O5'" 1 
ATOM 1887 C "C5'" . DT  A 1 119 ? 153.297 144.634 156.070 1.00 94.38  ? 119 DT  I "C5'" 1 
ATOM 1888 C "C4'" . DT  A 1 119 ? 152.842 145.106 154.690 1.00 94.38  ? 119 DT  I "C4'" 1 
ATOM 1889 O "O4'" . DT  A 1 119 ? 151.403 145.322 154.698 1.00 94.38  ? 119 DT  I "O4'" 1 
ATOM 1890 C "C3'" . DT  A 1 119 ? 153.452 146.438 154.243 1.00 94.38  ? 119 DT  I "C3'" 1 
ATOM 1891 O "O3'" . DT  A 1 119 ? 153.720 146.402 152.829 1.00 94.38  ? 119 DT  I "O3'" 1 
ATOM 1892 C "C2'" . DT  A 1 119 ? 152.339 147.419 154.598 1.00 94.38  ? 119 DT  I "C2'" 1 
ATOM 1893 C "C1'" . DT  A 1 119 ? 151.128 146.609 154.186 1.00 94.38  ? 119 DT  I "C1'" 1 
ATOM 1894 N N1    . DT  A 1 119 ? 149.891 147.038 154.872 1.00 94.38  ? 119 DT  I N1    1 
ATOM 1895 C C2    . DT  A 1 119 ? 148.668 146.591 154.426 1.00 94.38  ? 119 DT  I C2    1 
ATOM 1896 O O2    . DT  A 1 119 ? 148.522 145.961 153.395 1.00 94.38  ? 119 DT  I O2    1 
ATOM 1897 N N3    . DT  A 1 119 ? 147.603 146.993 155.190 1.00 94.38  ? 119 DT  I N3    1 
ATOM 1898 C C4    . DT  A 1 119 ? 147.647 147.728 156.359 1.00 94.38  ? 119 DT  I C4    1 
ATOM 1899 O O4    . DT  A 1 119 ? 146.639 148.024 156.990 1.00 94.38  ? 119 DT  I O4    1 
ATOM 1900 C C5    . DT  A 1 119 ? 148.965 148.104 156.802 1.00 94.38  ? 119 DT  I C5    1 
ATOM 1901 C C7    . DT  A 1 119 ? 149.143 148.892 158.066 1.00 94.38  ? 119 DT  I C7    1 
ATOM 1902 C C6    . DT  A 1 119 ? 150.008 147.727 156.058 1.00 94.38  ? 119 DT  I C6    1 
ATOM 1903 P P     . DG  A 1 120 ? 153.958 147.757 151.996 1.00 95.90  ? 120 DG  I P     1 
ATOM 1904 O OP1   . DG  A 1 120 ? 154.715 147.394 150.778 1.00 95.90  ? 120 DG  I OP1   1 
ATOM 1905 O OP2   . DG  A 1 120 ? 154.487 148.810 152.893 1.00 95.90  ? 120 DG  I OP2   1 
ATOM 1906 O "O5'" . DG  A 1 120 ? 152.485 148.156 151.558 1.00 95.90  ? 120 DG  I "O5'" 1 
ATOM 1907 C "C5'" . DG  A 1 120 ? 152.234 149.302 150.782 1.00 95.90  ? 120 DG  I "C5'" 1 
ATOM 1908 C "C4'" . DG  A 1 120 ? 150.835 149.208 150.228 1.00 95.90  ? 120 DG  I "C4'" 1 
ATOM 1909 O "O4'" . DG  A 1 120 ? 149.906 149.255 151.319 1.00 95.90  ? 120 DG  I "O4'" 1 
ATOM 1910 C "C3'" . DG  A 1 120 ? 150.433 150.310 149.249 1.00 95.90  ? 120 DG  I "C3'" 1 
ATOM 1911 O "O3'" . DG  A 1 120 ? 149.804 149.744 148.105 1.00 95.90  ? 120 DG  I "O3'" 1 
ATOM 1912 C "C2'" . DG  A 1 120 ? 149.464 151.166 150.082 1.00 95.90  ? 120 DG  I "C2'" 1 
ATOM 1913 C "C1'" . DG  A 1 120 ? 148.859 150.120 151.012 1.00 95.90  ? 120 DG  I "C1'" 1 
ATOM 1914 N N9    . DG  A 1 120 ? 148.386 150.650 152.279 1.00 95.90  ? 120 DG  I N9    1 
ATOM 1915 C C8    . DG  A 1 120 ? 149.139 151.219 153.279 1.00 95.90  ? 120 DG  I C8    1 
ATOM 1916 N N7    . DG  A 1 120 ? 148.442 151.534 154.335 1.00 95.90  ? 120 DG  I N7    1 
ATOM 1917 C C5    . DG  A 1 120 ? 147.164 151.079 154.041 1.00 95.90  ? 120 DG  I C5    1 
ATOM 1918 C C6    . DG  A 1 120 ? 145.976 151.121 154.808 1.00 95.90  ? 120 DG  I C6    1 
ATOM 1919 O O6    . DG  A 1 120 ? 145.804 151.584 155.945 1.00 95.90  ? 120 DG  I O6    1 
ATOM 1920 N N1    . DG  A 1 120 ? 144.910 150.545 154.126 1.00 95.90  ? 120 DG  I N1    1 
ATOM 1921 C C2    . DG  A 1 120 ? 144.983 150.001 152.865 1.00 95.90  ? 120 DG  I C2    1 
ATOM 1922 N N2    . DG  A 1 120 ? 143.856 149.486 152.364 1.00 95.90  ? 120 DG  I N2    1 
ATOM 1923 N N3    . DG  A 1 120 ? 146.085 149.957 152.143 1.00 95.90  ? 120 DG  I N3    1 
ATOM 1924 C C4    . DG  A 1 120 ? 147.129 150.510 152.789 1.00 95.90  ? 120 DG  I C4    1 
ATOM 1925 P P     . DC  B 2 28  ? 135.604 152.102 156.006 1.00 95.65  ? 28  DC  J P     1 
ATOM 1926 O OP1   . DC  B 2 28  ? 134.250 151.814 155.484 1.00 95.65  ? 28  DC  J OP1   1 
ATOM 1927 O OP2   . DC  B 2 28  ? 135.967 151.668 157.373 1.00 95.65  ? 28  DC  J OP2   1 
ATOM 1928 O "O5'" . DC  B 2 28  ? 136.677 151.479 155.000 1.00 95.65  ? 28  DC  J "O5'" 1 
ATOM 1929 C "C5'" . DC  B 2 28  ? 136.276 151.075 153.698 1.00 95.65  ? 28  DC  J "C5'" 1 
ATOM 1930 C "C4'" . DC  B 2 28  ? 137.152 149.939 153.206 1.00 95.65  ? 28  DC  J "C4'" 1 
ATOM 1931 O "O4'" . DC  B 2 28  ? 138.559 150.252 153.398 1.00 95.65  ? 28  DC  J "O4'" 1 
ATOM 1932 C "C3'" . DC  B 2 28  ? 136.920 148.588 153.876 1.00 95.65  ? 28  DC  J "C3'" 1 
ATOM 1933 O "O3'" . DC  B 2 28  ? 137.036 147.567 152.881 1.00 95.65  ? 28  DC  J "O3'" 1 
ATOM 1934 C "C2'" . DC  B 2 28  ? 138.020 148.507 154.930 1.00 95.65  ? 28  DC  J "C2'" 1 
ATOM 1935 C "C1'" . DC  B 2 28  ? 139.131 149.266 154.236 1.00 95.65  ? 28  DC  J "C1'" 1 
ATOM 1936 N N1    . DC  B 2 28  ? 140.195 149.854 155.096 1.00 95.65  ? 28  DC  J N1    1 
ATOM 1937 C C2    . DC  B 2 28  ? 141.362 150.288 154.490 1.00 95.65  ? 28  DC  J C2    1 
ATOM 1938 O O2    . DC  B 2 28  ? 141.531 150.030 153.297 1.00 95.65  ? 28  DC  J O2    1 
ATOM 1939 N N3    . DC  B 2 28  ? 142.339 150.826 155.248 1.00 95.65  ? 28  DC  J N3    1 
ATOM 1940 C C4    . DC  B 2 28  ? 142.126 151.054 156.542 1.00 95.65  ? 28  DC  J C4    1 
ATOM 1941 N N4    . DC  B 2 28  ? 143.114 151.624 157.241 1.00 95.65  ? 28  DC  J N4    1 
ATOM 1942 C C5    . DC  B 2 28  ? 140.894 150.701 157.173 1.00 95.65  ? 28  DC  J C5    1 
ATOM 1943 C C6    . DC  B 2 28  ? 139.952 150.130 156.410 1.00 95.65  ? 28  DC  J C6    1 
ATOM 1944 P P     . DA  B 2 29  ? 135.920 146.422 152.755 1.00 91.65  ? 29  DA  J P     1 
ATOM 1945 O OP1   . DA  B 2 29  ? 134.714 147.033 152.155 1.00 91.65  ? 29  DA  J OP1   1 
ATOM 1946 O OP2   . DA  B 2 29  ? 135.830 145.761 154.076 1.00 91.65  ? 29  DA  J OP2   1 
ATOM 1947 O "O5'" . DA  B 2 29  ? 136.543 145.362 151.723 1.00 91.65  ? 29  DA  J "O5'" 1 
ATOM 1948 C "C5'" . DA  B 2 29  ? 137.758 144.658 151.996 1.00 91.65  ? 29  DA  J "C5'" 1 
ATOM 1949 C "C4'" . DA  B 2 29  ? 138.689 144.732 150.786 1.00 91.65  ? 29  DA  J "C4'" 1 
ATOM 1950 O "O4'" . DA  B 2 29  ? 139.690 145.768 150.991 1.00 91.65  ? 29  DA  J "O4'" 1 
ATOM 1951 C "C3'" . DA  B 2 29  ? 139.480 143.466 150.507 1.00 91.65  ? 29  DA  J "C3'" 1 
ATOM 1952 O "O3'" . DA  B 2 29  ? 139.762 143.386 149.096 1.00 91.65  ? 29  DA  J "O3'" 1 
ATOM 1953 C "C2'" . DA  B 2 29  ? 140.737 143.661 151.356 1.00 91.65  ? 29  DA  J "C2'" 1 
ATOM 1954 C "C1'" . DA  B 2 29  ? 140.939 145.172 151.304 1.00 91.65  ? 29  DA  J "C1'" 1 
ATOM 1955 N N9    . DA  B 2 29  ? 141.421 145.760 152.556 1.00 91.65  ? 29  DA  J N9    1 
ATOM 1956 C C8    . DA  B 2 29  ? 140.687 145.986 153.687 1.00 91.65  ? 29  DA  J C8    1 
ATOM 1957 N N7    . DA  B 2 29  ? 141.378 146.494 154.678 1.00 91.65  ? 29  DA  J N7    1 
ATOM 1958 C C5    . DA  B 2 29  ? 142.674 146.542 154.190 1.00 91.65  ? 29  DA  J C5    1 
ATOM 1959 C C6    . DA  B 2 29  ? 143.887 146.965 154.767 1.00 91.65  ? 29  DA  J C6    1 
ATOM 1960 N N6    . DA  B 2 29  ? 143.977 147.435 156.014 1.00 91.65  ? 29  DA  J N6    1 
ATOM 1961 N N1    . DA  B 2 29  ? 145.002 146.885 154.013 1.00 91.65  ? 29  DA  J N1    1 
ATOM 1962 C C2    . DA  B 2 29  ? 144.903 146.412 152.765 1.00 91.65  ? 29  DA  J C2    1 
ATOM 1963 N N3    . DA  B 2 29  ? 143.818 145.985 152.112 1.00 91.65  ? 29  DA  J N3    1 
ATOM 1964 C C4    . DA  B 2 29  ? 142.725 146.077 152.889 1.00 91.65  ? 29  DA  J C4    1 
ATOM 1965 P P     . DA  B 2 30  ? 139.466 142.019 148.299 1.00 78.42  ? 30  DA  J P     1 
ATOM 1966 O OP1   . DA  B 2 30  ? 139.525 142.318 146.853 1.00 78.42  ? 30  DA  J OP1   1 
ATOM 1967 O OP2   . DA  B 2 30  ? 138.235 141.431 148.869 1.00 78.42  ? 30  DA  J OP2   1 
ATOM 1968 O "O5'" . DA  B 2 30  ? 140.691 141.056 148.659 1.00 78.42  ? 30  DA  J "O5'" 1 
ATOM 1969 C "C5'" . DA  B 2 30  ? 141.998 141.379 148.183 1.00 78.42  ? 30  DA  J "C5'" 1 
ATOM 1970 C "C4'" . DA  B 2 30  ? 143.076 140.744 149.037 1.00 78.42  ? 30  DA  J "C4'" 1 
ATOM 1971 O "O4'" . DA  B 2 30  ? 142.973 141.219 150.397 1.00 78.42  ? 30  DA  J "O4'" 1 
ATOM 1972 C "C3'" . DA  B 2 30  ? 143.063 139.220 149.109 1.00 78.42  ? 30  DA  J "C3'" 1 
ATOM 1973 O "O3'" . DA  B 2 30  ? 144.403 138.750 148.993 1.00 78.42  ? 30  DA  J "O3'" 1 
ATOM 1974 C "C2'" . DA  B 2 30  ? 142.451 138.935 150.483 1.00 78.42  ? 30  DA  J "C2'" 1 
ATOM 1975 C "C1'" . DA  B 2 30  ? 142.946 140.125 151.282 1.00 78.42  ? 30  DA  J "C1'" 1 
ATOM 1976 N N9    . DA  B 2 30  ? 142.099 140.499 152.406 1.00 78.42  ? 30  DA  J N9    1 
ATOM 1977 C C8    . DA  B 2 30  ? 140.736 140.469 152.468 1.00 78.42  ? 30  DA  J C8    1 
ATOM 1978 N N7    . DA  B 2 30  ? 140.253 140.873 153.620 1.00 78.42  ? 30  DA  J N7    1 
ATOM 1979 C C5    . DA  B 2 30  ? 141.381 141.153 154.370 1.00 78.42  ? 30  DA  J C5    1 
ATOM 1980 C C6    . DA  B 2 30  ? 141.558 141.613 155.691 1.00 78.42  ? 30  DA  J C6    1 
ATOM 1981 N N6    . DA  B 2 30  ? 140.543 141.879 156.517 1.00 78.42  ? 30  DA  J N6    1 
ATOM 1982 N N1    . DA  B 2 30  ? 142.827 141.804 156.121 1.00 78.42  ? 30  DA  J N1    1 
ATOM 1983 C C2    . DA  B 2 30  ? 143.829 141.502 155.289 1.00 78.42  ? 30  DA  J C2    1 
ATOM 1984 N N3    . DA  B 2 30  ? 143.786 141.085 154.034 1.00 78.42  ? 30  DA  J N3    1 
ATOM 1985 C C4    . DA  B 2 30  ? 142.523 140.922 153.634 1.00 78.42  ? 30  DA  J C4    1 
ATOM 1986 P P     . DT  B 2 31  ? 144.751 137.182 148.950 1.00 72.03  ? 31  DT  J P     1 
ATOM 1987 O OP1   . DT  B 2 31  ? 145.759 136.981 147.888 1.00 72.03  ? 31  DT  J OP1   1 
ATOM 1988 O OP2   . DT  B 2 31  ? 143.491 136.409 148.927 1.00 72.03  ? 31  DT  J OP2   1 
ATOM 1989 O "O5'" . DT  B 2 31  ? 145.451 136.957 150.369 1.00 72.03  ? 31  DT  J "O5'" 1 
ATOM 1990 C "C5'" . DT  B 2 31  ? 146.475 137.866 150.762 1.00 72.03  ? 31  DT  J "C5'" 1 
ATOM 1991 C "C4'" . DT  B 2 31  ? 146.916 137.647 152.196 1.00 72.03  ? 31  DT  J "C4'" 1 
ATOM 1992 O "O4'" . DT  B 2 31  ? 145.903 138.121 153.102 1.00 72.03  ? 31  DT  J "O4'" 1 
ATOM 1993 C "C3'" . DT  B 2 31  ? 147.200 136.193 152.585 1.00 72.03  ? 31  DT  J "C3'" 1 
ATOM 1994 O "O3'" . DT  B 2 31  ? 148.464 136.130 153.234 1.00 72.03  ? 31  DT  J "O3'" 1 
ATOM 1995 C "C2'" . DT  B 2 31  ? 146.062 135.872 153.563 1.00 72.03  ? 31  DT  J "C2'" 1 
ATOM 1996 C "C1'" . DT  B 2 31  ? 145.834 137.237 154.179 1.00 72.03  ? 31  DT  J "C1'" 1 
ATOM 1997 N N1    . DT  B 2 31  ? 144.536 137.440 154.860 1.00 72.03  ? 31  DT  J N1    1 
ATOM 1998 C C2    . DT  B 2 31  ? 144.553 137.798 156.179 1.00 72.03  ? 31  DT  J C2    1 
ATOM 1999 O O2    . DT  B 2 31  ? 145.583 137.981 156.799 1.00 72.03  ? 31  DT  J O2    1 
ATOM 2000 N N3    . DT  B 2 31  ? 143.330 138.019 156.740 1.00 72.03  ? 31  DT  J N3    1 
ATOM 2001 C C4    . DT  B 2 31  ? 142.099 137.852 156.127 1.00 72.03  ? 31  DT  J C4    1 
ATOM 2002 O O4    . DT  B 2 31  ? 141.042 138.044 156.716 1.00 72.03  ? 31  DT  J O4    1 
ATOM 2003 C C5    . DT  B 2 31  ? 142.148 137.450 154.738 1.00 72.03  ? 31  DT  J C5    1 
ATOM 2004 C C7    . DT  B 2 31  ? 140.879 137.252 153.968 1.00 72.03  ? 31  DT  J C7    1 
ATOM 2005 C C6    . DT  B 2 31  ? 143.354 137.265 154.176 1.00 72.03  ? 31  DT  J C6    1 
ATOM 2006 P P     . DT  B 2 32  ? 149.417 134.852 153.063 1.00 74.29  ? 32  DT  J P     1 
ATOM 2007 O OP1   . DT  B 2 32  ? 150.707 135.332 152.523 1.00 74.29  ? 32  DT  J OP1   1 
ATOM 2008 O OP2   . DT  B 2 32  ? 148.643 133.831 152.327 1.00 74.29  ? 32  DT  J OP2   1 
ATOM 2009 O "O5'" . DT  B 2 32  ? 149.671 134.303 154.544 1.00 74.29  ? 32  DT  J "O5'" 1 
ATOM 2010 C "C5'" . DT  B 2 32  ? 150.318 135.090 155.547 1.00 74.29  ? 32  DT  J "C5'" 1 
ATOM 2011 C "C4'" . DT  B 2 32  ? 149.864 134.600 156.910 1.00 74.29  ? 32  DT  J "C4'" 1 
ATOM 2012 O "O4'" . DT  B 2 32  ? 148.493 134.991 157.136 1.00 74.29  ? 32  DT  J "O4'" 1 
ATOM 2013 C "C3'" . DT  B 2 32  ? 149.877 133.079 157.060 1.00 74.29  ? 32  DT  J "C3'" 1 
ATOM 2014 O "O3'" . DT  B 2 32  ? 151.090 132.622 157.717 1.00 74.29  ? 32  DT  J "O3'" 1 
ATOM 2015 C "C2'" . DT  B 2 32  ? 148.598 132.714 157.825 1.00 74.29  ? 32  DT  J "C2'" 1 
ATOM 2016 C "C1'" . DT  B 2 32  ? 147.895 134.054 158.003 1.00 74.29  ? 32  DT  J "C1'" 1 
ATOM 2017 N N1    . DT  B 2 32  ? 146.427 134.037 157.743 1.00 74.29  ? 32  DT  J N1    1 
ATOM 2018 C C2    . DT  B 2 32  ? 145.585 134.581 158.670 1.00 74.29  ? 32  DT  J C2    1 
ATOM 2019 O O2    . DT  B 2 32  ? 145.947 134.900 159.787 1.00 74.29  ? 32  DT  J O2    1 
ATOM 2020 N N3    . DT  B 2 32  ? 144.265 134.563 158.320 1.00 74.29  ? 32  DT  J N3    1 
ATOM 2021 C C4    . DT  B 2 32  ? 143.723 134.187 157.116 1.00 74.29  ? 32  DT  J C4    1 
ATOM 2022 O O4    . DT  B 2 32  ? 142.518 134.246 156.895 1.00 74.29  ? 32  DT  J O4    1 
ATOM 2023 C C5    . DT  B 2 32  ? 144.669 133.724 156.139 1.00 74.29  ? 32  DT  J C5    1 
ATOM 2024 C C7    . DT  B 2 32  ? 144.193 133.283 154.788 1.00 74.29  ? 32  DT  J C7    1 
ATOM 2025 C C6    . DT  B 2 32  ? 145.969 133.700 156.484 1.00 74.29  ? 32  DT  J C6    1 
ATOM 2026 P P     . DG  B 2 33  ? 151.605 133.198 159.137 1.00 76.07  ? 33  DG  J P     1 
ATOM 2027 O OP1   . DG  B 2 33  ? 150.551 133.977 159.822 1.00 76.07  ? 33  DG  J OP1   1 
ATOM 2028 O OP2   . DG  B 2 33  ? 152.922 133.819 158.887 1.00 76.07  ? 33  DG  J OP2   1 
ATOM 2029 O "O5'" . DG  B 2 33  ? 151.847 131.883 160.011 1.00 76.07  ? 33  DG  J "O5'" 1 
ATOM 2030 C "C5'" . DG  B 2 33  ? 150.798 130.944 160.135 1.00 76.07  ? 33  DG  J "C5'" 1 
ATOM 2031 C "C4'" . DG  B 2 33  ? 150.087 131.105 161.474 1.00 76.07  ? 33  DG  J "C4'" 1 
ATOM 2032 O "O4'" . DG  B 2 33  ? 148.777 131.687 161.292 1.00 76.07  ? 33  DG  J "O4'" 1 
ATOM 2033 C "C3'" . DG  B 2 33  ? 149.882 129.815 162.261 1.00 76.07  ? 33  DG  J "C3'" 1 
ATOM 2034 O "O3'" . DG  B 2 33  ? 150.078 130.085 163.657 1.00 76.07  ? 33  DG  J "O3'" 1 
ATOM 2035 C "C2'" . DG  B 2 33  ? 148.424 129.456 161.931 1.00 76.07  ? 33  DG  J "C2'" 1 
ATOM 2036 C "C1'" . DG  B 2 33  ? 147.811 130.844 161.878 1.00 76.07  ? 33  DG  J "C1'" 1 
ATOM 2037 N N9    . DG  B 2 33  ? 146.598 130.988 161.083 1.00 76.07  ? 33  DG  J N9    1 
ATOM 2038 C C8    . DG  B 2 33  ? 146.479 130.801 159.730 1.00 76.07  ? 33  DG  J C8    1 
ATOM 2039 N N7    . DG  B 2 33  ? 145.273 131.001 159.282 1.00 76.07  ? 33  DG  J N7    1 
ATOM 2040 C C5    . DG  B 2 33  ? 144.527 131.250 160.422 1.00 76.07  ? 33  DG  J C5    1 
ATOM 2041 C C6    . DG  B 2 33  ? 143.148 131.506 160.561 1.00 76.07  ? 33  DG  J C6    1 
ATOM 2042 O O6    . DG  B 2 33  ? 142.292 131.559 159.676 1.00 76.07  ? 33  DG  J O6    1 
ATOM 2043 N N1    . DG  B 2 33  ? 142.792 131.707 161.891 1.00 76.07  ? 33  DG  J N1    1 
ATOM 2044 C C2    . DG  B 2 33  ? 143.664 131.669 162.952 1.00 76.07  ? 33  DG  J C2    1 
ATOM 2045 N N2    . DG  B 2 33  ? 143.134 131.889 164.166 1.00 76.07  ? 33  DG  J N2    1 
ATOM 2046 N N3    . DG  B 2 33  ? 144.966 131.430 162.834 1.00 76.07  ? 33  DG  J N3    1 
ATOM 2047 C C4    . DG  B 2 33  ? 145.324 131.230 161.543 1.00 76.07  ? 33  DG  J C4    1 
ATOM 2048 P P     . DG  B 2 34  ? 150.152 128.892 164.730 1.00 74.80  ? 34  DG  J P     1 
ATOM 2049 O OP1   . DG  B 2 34  ? 150.976 129.371 165.863 1.00 74.80  ? 34  DG  J OP1   1 
ATOM 2050 O OP2   . DG  B 2 34  ? 150.550 127.669 164.001 1.00 74.80  ? 34  DG  J OP2   1 
ATOM 2051 O "O5'" . DG  B 2 34  ? 148.636 128.720 165.216 1.00 74.80  ? 34  DG  J "O5'" 1 
ATOM 2052 C "C5'" . DG  B 2 34  ? 147.982 127.460 165.120 1.00 74.80  ? 34  DG  J "C5'" 1 
ATOM 2053 C "C4'" . DG  B 2 34  ? 146.572 127.548 165.681 1.00 74.80  ? 34  DG  J "C4'" 1 
ATOM 2054 O "O4'" . DG  B 2 34  ? 145.723 128.220 164.726 1.00 74.80  ? 34  DG  J "O4'" 1 
ATOM 2055 C "C3'" . DG  B 2 34  ? 145.896 126.207 165.965 1.00 74.80  ? 34  DG  J "C3'" 1 
ATOM 2056 O "O3'" . DG  B 2 34  ? 145.015 126.307 167.086 1.00 74.80  ? 34  DG  J "O3'" 1 
ATOM 2057 C "C2'" . DG  B 2 34  ? 145.123 125.966 164.680 1.00 74.80  ? 34  DG  J "C2'" 1 
ATOM 2058 C "C1'" . DG  B 2 34  ? 144.659 127.374 164.355 1.00 74.80  ? 34  DG  J "C1'" 1 
ATOM 2059 N N9    . DG  B 2 34  ? 144.418 127.589 162.942 1.00 74.80  ? 34  DG  J N9    1 
ATOM 2060 C C8    . DG  B 2 34  ? 145.350 127.568 161.937 1.00 74.80  ? 34  DG  J C8    1 
ATOM 2061 N N7    . DG  B 2 34  ? 144.853 127.833 160.764 1.00 74.80  ? 34  DG  J N7    1 
ATOM 2062 C C5    . DG  B 2 34  ? 143.512 128.073 161.015 1.00 74.80  ? 34  DG  J C5    1 
ATOM 2063 C C6    . DG  B 2 34  ? 142.472 128.417 160.130 1.00 74.80  ? 34  DG  J C6    1 
ATOM 2064 O O6    . DG  B 2 34  ? 142.529 128.581 158.907 1.00 74.80  ? 34  DG  J O6    1 
ATOM 2065 N N1    . DG  B 2 34  ? 141.263 128.574 160.795 1.00 74.80  ? 34  DG  J N1    1 
ATOM 2066 C C2    . DG  B 2 34  ? 141.081 128.415 162.145 1.00 74.80  ? 34  DG  J C2    1 
ATOM 2067 N N2    . DG  B 2 34  ? 139.839 128.607 162.603 1.00 74.80  ? 34  DG  J N2    1 
ATOM 2068 N N3    . DG  B 2 34  ? 142.048 128.093 162.988 1.00 74.80  ? 34  DG  J N3    1 
ATOM 2069 C C4    . DG  B 2 34  ? 143.233 127.939 162.354 1.00 74.80  ? 34  DG  J C4    1 
ATOM 2070 P P     . DT  B 2 35  ? 144.511 124.971 167.826 1.00 72.87  ? 35  DT  J P     1 
ATOM 2071 O OP1   . DT  B 2 35  ? 144.177 125.340 169.218 1.00 72.87  ? 35  DT  J OP1   1 
ATOM 2072 O OP2   . DT  B 2 35  ? 145.504 123.906 167.568 1.00 72.87  ? 35  DT  J OP2   1 
ATOM 2073 O "O5'" . DT  B 2 35  ? 143.140 124.612 167.072 1.00 72.87  ? 35  DT  J "O5'" 1 
ATOM 2074 C "C5'" . DT  B 2 35  ? 141.981 125.420 167.272 1.00 72.87  ? 35  DT  J "C5'" 1 
ATOM 2075 C "C4'" . DT  B 2 35  ? 140.820 124.962 166.392 1.00 72.87  ? 35  DT  J "C4'" 1 
ATOM 2076 O "O4'" . DT  B 2 35  ? 141.119 125.213 165.000 1.00 72.87  ? 35  DT  J "O4'" 1 
ATOM 2077 C "C3'" . DT  B 2 35  ? 140.442 123.484 166.481 1.00 72.87  ? 35  DT  J "C3'" 1 
ATOM 2078 O "O3'" . DT  B 2 35  ? 139.025 123.376 166.518 1.00 72.87  ? 35  DT  J "O3'" 1 
ATOM 2079 C "C2'" . DT  B 2 35  ? 141.017 122.901 165.185 1.00 72.87  ? 35  DT  J "C2'" 1 
ATOM 2080 C "C1'" . DT  B 2 35  ? 140.811 124.067 164.237 1.00 72.87  ? 35  DT  J "C1'" 1 
ATOM 2081 N N1    . DT  B 2 35  ? 141.719 124.081 163.065 1.00 72.87  ? 35  DT  J N1    1 
ATOM 2082 C C2    . DT  B 2 35  ? 141.243 124.542 161.861 1.00 72.87  ? 35  DT  J C2    1 
ATOM 2083 O O2    . DT  B 2 35  ? 140.095 124.912 161.696 1.00 72.87  ? 35  DT  J O2    1 
ATOM 2084 N N3    . DT  B 2 35  ? 142.164 124.555 160.850 1.00 72.87  ? 35  DT  J N3    1 
ATOM 2085 C C4    . DT  B 2 35  ? 143.487 124.164 160.923 1.00 72.87  ? 35  DT  J C4    1 
ATOM 2086 O O4    . DT  B 2 35  ? 144.238 124.210 159.955 1.00 72.87  ? 35  DT  J O4    1 
ATOM 2087 C C5    . DT  B 2 35  ? 143.924 123.698 162.217 1.00 72.87  ? 35  DT  J C5    1 
ATOM 2088 C C7    . DT  B 2 35  ? 145.341 123.247 162.416 1.00 72.87  ? 35  DT  J C7    1 
ATOM 2089 C C6    . DT  B 2 35  ? 143.030 123.684 163.216 1.00 72.87  ? 35  DT  J C6    1 
ATOM 2090 P P     . DC  B 2 36  ? 138.306 122.120 167.210 1.00 69.89  ? 36  DC  J P     1 
ATOM 2091 O OP1   . DC  B 2 36  ? 138.198 122.411 168.657 1.00 69.89  ? 36  DC  J OP1   1 
ATOM 2092 O OP2   . DC  B 2 36  ? 138.985 120.888 166.755 1.00 69.89  ? 36  DC  J OP2   1 
ATOM 2093 O "O5'" . DC  B 2 36  ? 136.834 122.132 166.581 1.00 69.89  ? 36  DC  J "O5'" 1 
ATOM 2094 C "C5'" . DC  B 2 36  ? 136.581 122.783 165.326 1.00 69.89  ? 36  DC  J "C5'" 1 
ATOM 2095 C "C4'" . DC  B 2 36  ? 136.023 121.793 164.317 1.00 69.89  ? 36  DC  J "C4'" 1 
ATOM 2096 O "O4'" . DC  B 2 36  ? 136.782 121.831 163.082 1.00 69.89  ? 36  DC  J "O4'" 1 
ATOM 2097 C "C3'" . DC  B 2 36  ? 136.031 120.347 164.789 1.00 69.89  ? 36  DC  J "C3'" 1 
ATOM 2098 O "O3'" . DC  B 2 36  ? 134.865 119.701 164.343 1.00 69.89  ? 36  DC  J "O3'" 1 
ATOM 2099 C "C2'" . DC  B 2 36  ? 137.268 119.777 164.088 1.00 69.89  ? 36  DC  J "C2'" 1 
ATOM 2100 C "C1'" . DC  B 2 36  ? 137.227 120.532 162.766 1.00 69.89  ? 36  DC  J "C1'" 1 
ATOM 2101 N N1    . DC  B 2 36  ? 138.537 120.649 162.074 1.00 69.89  ? 36  DC  J N1    1 
ATOM 2102 C C2    . DC  B 2 36  ? 138.589 121.216 160.797 1.00 69.89  ? 36  DC  J C2    1 
ATOM 2103 O O2    . DC  B 2 36  ? 137.540 121.583 160.257 1.00 69.89  ? 36  DC  J O2    1 
ATOM 2104 N N3    . DC  B 2 36  ? 139.786 121.328 160.174 1.00 69.89  ? 36  DC  J N3    1 
ATOM 2105 C C4    . DC  B 2 36  ? 140.895 120.915 160.790 1.00 69.89  ? 36  DC  J C4    1 
ATOM 2106 N N4    . DC  B 2 36  ? 142.055 121.049 160.142 1.00 69.89  ? 36  DC  J N4    1 
ATOM 2107 C C5    . DC  B 2 36  ? 140.864 120.344 162.096 1.00 69.89  ? 36  DC  J C5    1 
ATOM 2108 C C6    . DC  B 2 36  ? 139.676 120.235 162.697 1.00 69.89  ? 36  DC  J C6    1 
ATOM 2109 P P     . DG  B 2 37  ? 134.048 118.736 165.328 1.00 69.32  ? 37  DG  J P     1 
ATOM 2110 O OP1   . DG  B 2 37  ? 133.106 119.582 166.092 1.00 69.32  ? 37  DG  J OP1   1 
ATOM 2111 O OP2   . DG  B 2 37  ? 135.027 117.891 166.048 1.00 69.32  ? 37  DG  J OP2   1 
ATOM 2112 O "O5'" . DG  B 2 37  ? 133.212 117.803 164.341 1.00 69.32  ? 37  DG  J "O5'" 1 
ATOM 2113 C "C5'" . DG  B 2 37  ? 133.858 117.169 163.238 1.00 69.32  ? 37  DG  J "C5'" 1 
ATOM 2114 C "C4'" . DG  B 2 37  ? 133.382 117.710 161.903 1.00 69.32  ? 37  DG  J "C4'" 1 
ATOM 2115 O "O4'" . DG  B 2 37  ? 134.502 118.334 161.201 1.00 69.32  ? 37  DG  J "O4'" 1 
ATOM 2116 C "C3'" . DG  B 2 37  ? 132.846 116.653 160.936 1.00 69.32  ? 37  DG  J "C3'" 1 
ATOM 2117 O "O3'" . DG  B 2 37  ? 131.743 117.185 160.235 1.00 69.32  ? 37  DG  J "O3'" 1 
ATOM 2118 C "C2'" . DG  B 2 37  ? 134.026 116.405 160.012 1.00 69.32  ? 37  DG  J "C2'" 1 
ATOM 2119 C "C1'" . DG  B 2 37  ? 134.551 117.812 159.887 1.00 69.32  ? 37  DG  J "C1'" 1 
ATOM 2120 N N9    . DG  B 2 37  ? 135.917 117.896 159.377 1.00 69.32  ? 37  DG  J N9    1 
ATOM 2121 C C8    . DG  B 2 37  ? 136.317 118.454 158.187 1.00 69.32  ? 37  DG  J C8    1 
ATOM 2122 N N7    . DG  B 2 37  ? 137.605 118.417 158.001 1.00 69.32  ? 37  DG  J N7    1 
ATOM 2123 C C5    . DG  B 2 37  ? 138.097 117.823 159.153 1.00 69.32  ? 37  DG  J C5    1 
ATOM 2124 C C6    . DG  B 2 37  ? 139.426 117.524 159.522 1.00 69.32  ? 37  DG  J C6    1 
ATOM 2125 O O6    . DG  B 2 37  ? 140.464 117.733 158.882 1.00 69.32  ? 37  DG  J O6    1 
ATOM 2126 N N1    . DG  B 2 37  ? 139.490 116.921 160.775 1.00 69.32  ? 37  DG  J N1    1 
ATOM 2127 C C2    . DG  B 2 37  ? 138.404 116.642 161.570 1.00 69.32  ? 37  DG  J C2    1 
ATOM 2128 N N2    . DG  B 2 37  ? 138.666 116.057 162.748 1.00 69.32  ? 37  DG  J N2    1 
ATOM 2129 N N3    . DG  B 2 37  ? 137.150 116.917 161.234 1.00 69.32  ? 37  DG  J N3    1 
ATOM 2130 C C4    . DG  B 2 37  ? 137.072 117.504 160.016 1.00 69.32  ? 37  DG  J C4    1 
ATOM 2131 P P     . DT  B 2 38  ? 130.704 116.208 159.505 1.00 67.82  ? 38  DT  J P     1 
ATOM 2132 O OP1   . DT  B 2 38  ? 129.486 116.992 159.207 1.00 67.82  ? 38  DT  J OP1   1 
ATOM 2133 O OP2   . DT  B 2 38  ? 130.615 114.970 160.308 1.00 67.82  ? 38  DT  J OP2   1 
ATOM 2134 O "O5'" . DT  B 2 38  ? 131.426 115.847 158.128 1.00 67.82  ? 38  DT  J "O5'" 1 
ATOM 2135 C "C5'" . DT  B 2 38  ? 131.704 116.876 157.184 1.00 67.82  ? 38  DT  J "C5'" 1 
ATOM 2136 C "C4'" . DT  B 2 38  ? 132.646 116.381 156.101 1.00 67.82  ? 38  DT  J "C4'" 1 
ATOM 2137 O "O4'" . DT  B 2 38  ? 134.006 116.295 156.615 1.00 67.82  ? 38  DT  J "O4'" 1 
ATOM 2138 C "C3'" . DT  B 2 38  ? 132.322 114.997 155.537 1.00 67.82  ? 38  DT  J "C3'" 1 
ATOM 2139 O "O3'" . DT  B 2 38  ? 132.460 115.023 154.131 1.00 67.82  ? 38  DT  J "O3'" 1 
ATOM 2140 C "C2'" . DT  B 2 38  ? 133.388 114.114 156.178 1.00 67.82  ? 38  DT  J "C2'" 1 
ATOM 2141 C "C1'" . DT  B 2 38  ? 134.553 115.077 156.180 1.00 67.82  ? 38  DT  J "C1'" 1 
ATOM 2142 N N1    . DT  B 2 38  ? 135.676 114.689 157.078 1.00 67.82  ? 38  DT  J N1    1 
ATOM 2143 C C2    . DT  B 2 38  ? 136.916 115.239 156.870 1.00 67.82  ? 38  DT  J C2    1 
ATOM 2144 O O2    . DT  B 2 38  ? 137.167 115.986 155.943 1.00 67.82  ? 38  DT  J O2    1 
ATOM 2145 N N3    . DT  B 2 38  ? 137.877 114.828 157.750 1.00 67.82  ? 38  DT  J N3    1 
ATOM 2146 C C4    . DT  B 2 38  ? 137.719 113.977 158.824 1.00 67.82  ? 38  DT  J C4    1 
ATOM 2147 O O4    . DT  B 2 38  ? 138.650 113.681 159.567 1.00 67.82  ? 38  DT  J O4    1 
ATOM 2148 C C5    . DT  B 2 38  ? 136.384 113.462 159.010 1.00 67.82  ? 38  DT  J C5    1 
ATOM 2149 C C7    . DT  B 2 38  ? 136.087 112.525 160.145 1.00 67.82  ? 38  DT  J C7    1 
ATOM 2150 C C6    . DT  B 2 38  ? 135.435 113.846 158.142 1.00 67.82  ? 38  DT  J C6    1 
ATOM 2151 P P     . DA  B 2 39  ? 131.235 114.568 153.199 1.00 65.08  ? 39  DA  J P     1 
ATOM 2152 O OP1   . DA  B 2 39  ? 130.156 115.562 153.381 1.00 65.08  ? 39  DA  J OP1   1 
ATOM 2153 O OP2   . DA  B 2 39  ? 130.975 113.137 153.463 1.00 65.08  ? 39  DA  J OP2   1 
ATOM 2154 O "O5'" . DA  B 2 39  ? 131.803 114.703 151.712 1.00 65.08  ? 39  DA  J "O5'" 1 
ATOM 2155 C "C5'" . DA  B 2 39  ? 132.273 115.962 151.247 1.00 65.08  ? 39  DA  J "C5'" 1 
ATOM 2156 C "C4'" . DA  B 2 39  ? 133.682 115.873 150.690 1.00 65.08  ? 39  DA  J "C4'" 1 
ATOM 2157 O "O4'" . DA  B 2 39  ? 134.591 115.432 151.728 1.00 65.08  ? 39  DA  J "O4'" 1 
ATOM 2158 C "C3'" . DA  B 2 39  ? 133.865 114.905 149.531 1.00 65.08  ? 39  DA  J "C3'" 1 
ATOM 2159 O "O3'" . DA  B 2 39  ? 134.688 115.499 148.556 1.00 65.08  ? 39  DA  J "O3'" 1 
ATOM 2160 C "C2'" . DA  B 2 39  ? 134.537 113.695 150.186 1.00 65.08  ? 39  DA  J "C2'" 1 
ATOM 2161 C "C1'" . DA  B 2 39  ? 135.377 114.353 151.267 1.00 65.08  ? 39  DA  J "C1'" 1 
ATOM 2162 N N9    . DA  B 2 39  ? 135.601 113.495 152.421 1.00 65.08  ? 39  DA  J N9    1 
ATOM 2163 C C8    . DA  B 2 39  ? 134.644 112.829 153.127 1.00 65.08  ? 39  DA  J C8    1 
ATOM 2164 N N7    . DA  B 2 39  ? 135.105 112.167 154.154 1.00 65.08  ? 39  DA  J N7    1 
ATOM 2165 C C5    . DA  B 2 39  ? 136.454 112.455 154.156 1.00 65.08  ? 39  DA  J C5    1 
ATOM 2166 C C6    . DA  B 2 39  ? 137.494 112.058 155.006 1.00 65.08  ? 39  DA  J C6    1 
ATOM 2167 N N6    . DA  B 2 39  ? 137.308 111.255 156.055 1.00 65.08  ? 39  DA  J N6    1 
ATOM 2168 N N1    . DA  B 2 39  ? 138.733 112.513 154.738 1.00 65.08  ? 39  DA  J N1    1 
ATOM 2169 C C2    . DA  B 2 39  ? 138.910 113.318 153.682 1.00 65.08  ? 39  DA  J C2    1 
ATOM 2170 N N3    . DA  B 2 39  ? 138.002 113.762 152.807 1.00 65.08  ? 39  DA  J N3    1 
ATOM 2171 C C4    . DA  B 2 39  ? 136.782 113.287 153.105 1.00 65.08  ? 39  DA  J C4    1 
ATOM 2172 P P     . DG  B 2 40  ? 134.649 114.967 147.045 1.00 63.64  ? 40  DG  J P     1 
ATOM 2173 O OP1   . DG  B 2 40  ? 134.648 116.138 146.146 1.00 63.64  ? 40  DG  J OP1   1 
ATOM 2174 O OP2   . DG  B 2 40  ? 133.566 113.966 146.950 1.00 63.64  ? 40  DG  J OP2   1 
ATOM 2175 O "O5'" . DG  B 2 40  ? 136.033 114.195 146.904 1.00 63.64  ? 40  DG  J "O5'" 1 
ATOM 2176 C "C5'" . DG  B 2 40  ? 137.222 114.936 146.719 1.00 63.64  ? 40  DG  J "C5'" 1 
ATOM 2177 C "C4'" . DG  B 2 40  ? 138.421 114.162 147.222 1.00 63.64  ? 40  DG  J "C4'" 1 
ATOM 2178 O "O4'" . DG  B 2 40  ? 138.086 113.504 148.469 1.00 63.64  ? 40  DG  J "O4'" 1 
ATOM 2179 C "C3'" . DG  B 2 40  ? 138.933 113.073 146.287 1.00 63.64  ? 40  DG  J "C3'" 1 
ATOM 2180 O "O3'" . DG  B 2 40  ? 140.345 113.137 146.233 1.00 63.64  ? 40  DG  J "O3'" 1 
ATOM 2181 C "C2'" . DG  B 2 40  ? 138.444 111.786 146.962 1.00 63.64  ? 40  DG  J "C2'" 1 
ATOM 2182 C "C1'" . DG  B 2 40  ? 138.540 112.176 148.425 1.00 63.64  ? 40  DG  J "C1'" 1 
ATOM 2183 N N9    . DG  B 2 40  ? 137.690 111.392 149.318 1.00 63.64  ? 40  DG  J N9    1 
ATOM 2184 C C8    . DG  B 2 40  ? 136.359 111.103 149.151 1.00 63.64  ? 40  DG  J C8    1 
ATOM 2185 N N7    . DG  B 2 40  ? 135.854 110.400 150.125 1.00 63.64  ? 40  DG  J N7    1 
ATOM 2186 C C5    . DG  B 2 40  ? 136.919 110.208 150.993 1.00 63.64  ? 40  DG  J C5    1 
ATOM 2187 C C6    . DG  B 2 40  ? 136.978 109.514 152.223 1.00 63.64  ? 40  DG  J C6    1 
ATOM 2188 O O6    . DG  B 2 40  ? 136.069 108.910 152.807 1.00 63.64  ? 40  DG  J O6    1 
ATOM 2189 N N1    . DG  B 2 40  ? 138.249 109.562 152.780 1.00 63.64  ? 40  DG  J N1    1 
ATOM 2190 C C2    . DG  B 2 40  ? 139.326 110.200 152.220 1.00 63.64  ? 40  DG  J C2    1 
ATOM 2191 N N2    . DG  B 2 40  ? 140.474 110.144 152.906 1.00 63.64  ? 40  DG  J N2    1 
ATOM 2192 N N3    . DG  B 2 40  ? 139.284 110.854 151.069 1.00 63.64  ? 40  DG  J N3    1 
ATOM 2193 C C4    . DG  B 2 40  ? 138.054 110.816 150.513 1.00 63.64  ? 40  DG  J C4    1 
ATOM 2194 P P     . DA  B 2 41  ? 141.125 112.553 144.960 1.00 64.40  ? 41  DA  J P     1 
ATOM 2195 O OP1   . DA  B 2 41  ? 141.671 113.708 144.217 1.00 64.40  ? 41  DA  J OP1   1 
ATOM 2196 O OP2   . DA  B 2 41  ? 140.231 111.593 144.278 1.00 64.40  ? 41  DA  J OP2   1 
ATOM 2197 O "O5'" . DA  B 2 41  ? 142.339 111.735 145.592 1.00 64.40  ? 41  DA  J "O5'" 1 
ATOM 2198 C "C5'" . DA  B 2 41  ? 143.307 112.396 146.403 1.00 64.40  ? 41  DA  J "C5'" 1 
ATOM 2199 C "C4'" . DA  B 2 41  ? 143.906 111.427 147.403 1.00 64.40  ? 41  DA  J "C4'" 1 
ATOM 2200 O "O4'" . DA  B 2 41  ? 142.872 110.901 148.267 1.00 64.40  ? 41  DA  J "O4'" 1 
ATOM 2201 C "C3'" . DA  B 2 41  ? 144.617 110.226 146.795 1.00 64.40  ? 41  DA  J "C3'" 1 
ATOM 2202 O "O3'" . DA  B 2 41  ? 145.826 110.007 147.509 1.00 64.40  ? 41  DA  J "O3'" 1 
ATOM 2203 C "C2'" . DA  B 2 41  ? 143.597 109.093 147.007 1.00 64.40  ? 41  DA  J "C2'" 1 
ATOM 2204 C "C1'" . DA  B 2 41  ? 142.994 109.504 148.338 1.00 64.40  ? 41  DA  J "C1'" 1 
ATOM 2205 N N9    . DA  B 2 41  ? 141.650 108.999 148.620 1.00 64.40  ? 41  DA  J N9    1 
ATOM 2206 C C8    . DA  B 2 41  ? 140.532 109.192 147.862 1.00 64.40  ? 41  DA  J C8    1 
ATOM 2207 N N7    . DA  B 2 41  ? 139.450 108.646 148.361 1.00 64.40  ? 41  DA  J N7    1 
ATOM 2208 C C5    . DA  B 2 41  ? 139.894 108.014 149.507 1.00 64.40  ? 41  DA  J C5    1 
ATOM 2209 C C6    . DA  B 2 41  ? 139.231 107.238 150.474 1.00 64.40  ? 41  DA  J C6    1 
ATOM 2210 N N6    . DA  B 2 41  ? 137.925 106.967 150.422 1.00 64.40  ? 41  DA  J N6    1 
ATOM 2211 N N1    . DA  B 2 41  ? 139.961 106.750 151.498 1.00 64.40  ? 41  DA  J N1    1 
ATOM 2212 C C2    . DA  B 2 41  ? 141.271 107.027 151.543 1.00 64.40  ? 41  DA  J C2    1 
ATOM 2213 N N3    . DA  B 2 41  ? 142.006 107.745 150.690 1.00 64.40  ? 41  DA  J N3    1 
ATOM 2214 C C4    . DA  B 2 41  ? 141.249 108.215 149.685 1.00 64.40  ? 41  DA  J C4    1 
ATOM 2215 P P     . DC  B 2 42  ? 146.968 109.043 146.925 1.00 65.24  ? 42  DC  J P     1 
ATOM 2216 O OP1   . DC  B 2 42  ? 148.267 109.464 147.493 1.00 65.24  ? 42  DC  J OP1   1 
ATOM 2217 O OP2   . DC  B 2 42  ? 146.791 108.983 145.458 1.00 65.24  ? 42  DC  J OP2   1 
ATOM 2218 O "O5'" . DC  B 2 42  ? 146.585 107.614 147.512 1.00 65.24  ? 42  DC  J "O5'" 1 
ATOM 2219 C "C5'" . DC  B 2 42  ? 146.334 107.448 148.907 1.00 65.24  ? 42  DC  J "C5'" 1 
ATOM 2220 C "C4'" . DC  B 2 42  ? 145.879 106.030 149.160 1.00 65.24  ? 42  DC  J "C4'" 1 
ATOM 2221 O "O4'" . DC  B 2 42  ? 144.432 105.988 149.146 1.00 65.24  ? 42  DC  J "O4'" 1 
ATOM 2222 C "C3'" . DC  B 2 42  ? 146.345 105.028 148.108 1.00 65.24  ? 42  DC  J "C3'" 1 
ATOM 2223 O "O3'" . DC  B 2 42  ? 146.909 103.883 148.736 1.00 65.24  ? 42  DC  J "O3'" 1 
ATOM 2224 C "C2'" . DC  B 2 42  ? 145.063 104.701 147.340 1.00 65.24  ? 42  DC  J "C2'" 1 
ATOM 2225 C "C1'" . DC  B 2 42  ? 144.022 104.856 148.430 1.00 65.24  ? 42  DC  J "C1'" 1 
ATOM 2226 N N1    . DC  B 2 42  ? 142.657 105.132 147.916 1.00 65.24  ? 42  DC  J N1    1 
ATOM 2227 C C2    . DC  B 2 42  ? 141.540 104.650 148.606 1.00 65.24  ? 42  DC  J C2    1 
ATOM 2228 O O2    . DC  B 2 42  ? 141.705 103.948 149.610 1.00 65.24  ? 42  DC  J O2    1 
ATOM 2229 N N3    . DC  B 2 42  ? 140.304 104.934 148.129 1.00 65.24  ? 42  DC  J N3    1 
ATOM 2230 C C4    . DC  B 2 42  ? 140.167 105.688 147.039 1.00 65.24  ? 42  DC  J C4    1 
ATOM 2231 N N4    . DC  B 2 42  ? 138.929 105.948 146.609 1.00 65.24  ? 42  DC  J N4    1 
ATOM 2232 C C5    . DC  B 2 42  ? 141.292 106.208 146.340 1.00 65.24  ? 42  DC  J C5    1 
ATOM 2233 C C6    . DC  B 2 42  ? 142.504 105.913 146.813 1.00 65.24  ? 42  DC  J C6    1 
ATOM 2234 P P     . DA  B 2 43  ? 148.457 103.528 148.492 1.00 64.37  ? 43  DA  J P     1 
ATOM 2235 O OP1   . DA  B 2 43  ? 149.190 103.845 149.737 1.00 64.37  ? 43  DA  J OP1   1 
ATOM 2236 O OP2   . DA  B 2 43  ? 148.864 104.161 147.219 1.00 64.37  ? 43  DA  J OP2   1 
ATOM 2237 O "O5'" . DA  B 2 43  ? 148.464 101.945 148.273 1.00 64.37  ? 43  DA  J "O5'" 1 
ATOM 2238 C "C5'" . DA  B 2 43  ? 148.938 101.058 149.289 1.00 64.37  ? 43  DA  J "C5'" 1 
ATOM 2239 C "C4'" . DA  B 2 43  ? 147.793 100.288 149.927 1.00 64.37  ? 43  DA  J "C4'" 1 
ATOM 2240 O "O4'" . DA  B 2 43  ? 146.539 100.952 149.681 1.00 64.37  ? 43  DA  J "O4'" 1 
ATOM 2241 C "C3'" . DA  B 2 43  ? 147.637 98.845  149.443 1.00 64.37  ? 43  DA  J "C3'" 1 
ATOM 2242 O "O3'" . DA  B 2 43  ? 147.671 97.958  150.556 1.00 64.37  ? 43  DA  J "O3'" 1 
ATOM 2243 C "C2'" . DA  B 2 43  ? 146.269 98.839  148.734 1.00 64.37  ? 43  DA  J "C2'" 1 
ATOM 2244 C "C1'" . DA  B 2 43  ? 145.556 99.987  149.428 1.00 64.37  ? 43  DA  J "C1'" 1 
ATOM 2245 N N9    . DA  B 2 43  ? 144.504 100.639 148.653 1.00 64.37  ? 43  DA  J N9    1 
ATOM 2246 C C8    . DA  B 2 43  ? 144.674 101.453 147.574 1.00 64.37  ? 43  DA  J C8    1 
ATOM 2247 N N7    . DA  B 2 43  ? 143.553 101.905 147.069 1.00 64.37  ? 43  DA  J N7    1 
ATOM 2248 C C5    . DA  B 2 43  ? 142.577 101.308 147.840 1.00 64.37  ? 43  DA  J C5    1 
ATOM 2249 C C6    . DA  B 2 43  ? 141.173 101.368 147.798 1.00 64.37  ? 43  DA  J C6    1 
ATOM 2250 N N6    . DA  B 2 43  ? 140.494 102.094 146.906 1.00 64.37  ? 43  DA  J N6    1 
ATOM 2251 N N1    . DA  B 2 43  ? 140.492 100.647 148.708 1.00 64.37  ? 43  DA  J N1    1 
ATOM 2252 C C2    . DA  B 2 43  ? 141.177 99.919  149.598 1.00 64.37  ? 43  DA  J C2    1 
ATOM 2253 N N3    . DA  B 2 43  ? 142.495 99.786  149.736 1.00 64.37  ? 43  DA  J N3    1 
ATOM 2254 C C4    . DA  B 2 43  ? 143.143 100.514 148.817 1.00 64.37  ? 43  DA  J C4    1 
ATOM 2255 P P     . DG  B 2 44  ? 147.965 96.396  150.332 1.00 60.98  ? 44  DG  J P     1 
ATOM 2256 O OP1   . DG  B 2 44  ? 148.593 95.876  151.566 1.00 60.98  ? 44  DG  J OP1   1 
ATOM 2257 O OP2   . DG  B 2 44  ? 148.661 96.253  149.036 1.00 60.98  ? 44  DG  J OP2   1 
ATOM 2258 O "O5'" . DG  B 2 44  ? 146.514 95.748  150.173 1.00 60.98  ? 44  DG  J "O5'" 1 
ATOM 2259 C "C5'" . DG  B 2 44  ? 145.548 95.903  151.204 1.00 60.98  ? 44  DG  J "C5'" 1 
ATOM 2260 C "C4'" . DG  B 2 44  ? 144.232 95.273  150.795 1.00 60.98  ? 44  DG  J "C4'" 1 
ATOM 2261 O "O4'" . DG  B 2 44  ? 143.423 96.248  150.102 1.00 60.98  ? 44  DG  J "O4'" 1 
ATOM 2262 C "C3'" . DG  B 2 44  ? 144.350 94.073  149.852 1.00 60.98  ? 44  DG  J "C3'" 1 
ATOM 2263 O "O3'" . DG  B 2 44  ? 143.617 92.982  150.373 1.00 60.98  ? 44  DG  J "O3'" 1 
ATOM 2264 C "C2'" . DG  B 2 44  ? 143.762 94.582  148.532 1.00 60.98  ? 44  DG  J "C2'" 1 
ATOM 2265 C "C1'" . DG  B 2 44  ? 142.776 95.623  149.025 1.00 60.98  ? 44  DG  J "C1'" 1 
ATOM 2266 N N9    . DG  B 2 44  ? 142.485 96.660  148.048 1.00 60.98  ? 44  DG  J N9    1 
ATOM 2267 C C8    . DG  B 2 44  ? 143.398 97.434  147.382 1.00 60.98  ? 44  DG  J C8    1 
ATOM 2268 N N7    . DG  B 2 44  ? 142.856 98.306  146.585 1.00 60.98  ? 44  DG  J N7    1 
ATOM 2269 C C5    . DG  B 2 44  ? 141.494 98.105  146.738 1.00 60.98  ? 44  DG  J C5    1 
ATOM 2270 C C6    . DG  B 2 44  ? 140.411 98.761  146.123 1.00 60.98  ? 44  DG  J C6    1 
ATOM 2271 O O6    . DG  B 2 44  ? 140.449 99.680  145.301 1.00 60.98  ? 44  DG  J O6    1 
ATOM 2272 N N1    . DG  B 2 44  ? 139.190 98.259  146.553 1.00 60.98  ? 44  DG  J N1    1 
ATOM 2273 C C2    . DG  B 2 44  ? 139.035 97.243  147.463 1.00 60.98  ? 44  DG  J C2    1 
ATOM 2274 N N2    . DG  B 2 44  ? 137.772 96.892  147.750 1.00 60.98  ? 44  DG  J N2    1 
ATOM 2275 N N3    . DG  B 2 44  ? 140.047 96.614  148.051 1.00 60.98  ? 44  DG  J N3    1 
ATOM 2276 C C4    . DG  B 2 44  ? 141.245 97.099  147.640 1.00 60.98  ? 44  DG  J C4    1 
ATOM 2277 P P     . DC  B 2 45  ? 143.769 91.524  149.721 1.00 56.48  ? 45  DC  J P     1 
ATOM 2278 O OP1   . DC  B 2 45  ? 143.719 90.534  150.820 1.00 56.48  ? 45  DC  J OP1   1 
ATOM 2279 O OP2   . DC  B 2 45  ? 144.930 91.554  148.806 1.00 56.48  ? 45  DC  J OP2   1 
ATOM 2280 O "O5'" . DC  B 2 45  ? 142.452 91.380  148.832 1.00 56.48  ? 45  DC  J "O5'" 1 
ATOM 2281 C "C5'" . DC  B 2 45  ? 141.180 91.560  149.435 1.00 56.48  ? 45  DC  J "C5'" 1 
ATOM 2282 C "C4'" . DC  B 2 45  ? 140.070 91.491  148.403 1.00 56.48  ? 45  DC  J "C4'" 1 
ATOM 2283 O "O4'" . DC  B 2 45  ? 140.011 92.721  147.639 1.00 56.48  ? 45  DC  J "O4'" 1 
ATOM 2284 C "C3'" . DC  B 2 45  ? 140.208 90.361  147.385 1.00 56.48  ? 45  DC  J "C3'" 1 
ATOM 2285 O "O3'" . DC  B 2 45  ? 138.967 89.722  147.213 1.00 56.48  ? 45  DC  J "O3'" 1 
ATOM 2286 C "C2'" . DC  B 2 45  ? 140.632 91.083  146.109 1.00 56.48  ? 45  DC  J "C2'" 1 
ATOM 2287 C "C1'" . DC  B 2 45  ? 139.923 92.414  146.266 1.00 56.48  ? 45  DC  J "C1'" 1 
ATOM 2288 N N1    . DC  B 2 45  ? 140.539 93.519  145.497 1.00 56.48  ? 45  DC  J N1    1 
ATOM 2289 C C2    . DC  B 2 45  ? 139.722 94.504  144.937 1.00 56.48  ? 45  DC  J C2    1 
ATOM 2290 O O2    . DC  B 2 45  ? 138.501 94.446  145.118 1.00 56.48  ? 45  DC  J O2    1 
ATOM 2291 N N3    . DC  B 2 45  ? 140.294 95.511  144.239 1.00 56.48  ? 45  DC  J N3    1 
ATOM 2292 C C4    . DC  B 2 45  ? 141.615 95.542  144.075 1.00 56.48  ? 45  DC  J C4    1 
ATOM 2293 N N4    . DC  B 2 45  ? 142.134 96.552  143.373 1.00 56.48  ? 45  DC  J N4    1 
ATOM 2294 C C5    . DC  B 2 45  ? 142.465 94.537  144.623 1.00 56.48  ? 45  DC  J C5    1 
ATOM 2295 C C6    . DC  B 2 45  ? 141.889 93.550  145.316 1.00 56.48  ? 45  DC  J C6    1 
ATOM 2296 P P     . DT  B 2 46  ? 138.916 88.173  146.804 1.00 51.58  ? 46  DT  J P     1 
ATOM 2297 O OP1   . DT  B 2 46  ? 138.764 87.386  148.048 1.00 51.58  ? 46  DT  J OP1   1 
ATOM 2298 O OP2   . DT  B 2 46  ? 140.053 87.902  145.899 1.00 51.58  ? 46  DT  J OP2   1 
ATOM 2299 O "O5'" . DT  B 2 46  ? 137.577 88.060  145.945 1.00 51.58  ? 46  DT  J "O5'" 1 
ATOM 2300 C "C5'" . DT  B 2 46  ? 136.375 88.651  146.415 1.00 51.58  ? 46  DT  J "C5'" 1 
ATOM 2301 C "C4'" . DT  B 2 46  ? 135.591 89.269  145.269 1.00 51.58  ? 46  DT  J "C4'" 1 
ATOM 2302 O "O4'" . DT  B 2 46  ? 136.296 90.404  144.717 1.00 51.58  ? 46  DT  J "O4'" 1 
ATOM 2303 C "C3'" . DT  B 2 46  ? 135.318 88.325  144.101 1.00 51.58  ? 46  DT  J "C3'" 1 
ATOM 2304 O "O3'" . DT  B 2 46  ? 133.953 88.385  143.764 1.00 51.58  ? 46  DT  J "O3'" 1 
ATOM 2305 C "C2'" . DT  B 2 46  ? 136.200 88.889  142.972 1.00 51.58  ? 46  DT  J "C2'" 1 
ATOM 2306 C "C1'" . DT  B 2 46  ? 136.197 90.368  143.312 1.00 51.58  ? 46  DT  J "C1'" 1 
ATOM 2307 N N1    . DT  B 2 46  ? 137.349 91.155  142.770 1.00 51.58  ? 46  DT  J N1    1 
ATOM 2308 C C2    . DT  B 2 46  ? 137.114 92.392  142.207 1.00 51.58  ? 46  DT  J C2    1 
ATOM 2309 O O2    . DT  B 2 46  ? 136.002 92.866  142.081 1.00 51.58  ? 46  DT  J O2    1 
ATOM 2310 N N3    . DT  B 2 46  ? 138.237 93.055  141.786 1.00 51.58  ? 46  DT  J N3    1 
ATOM 2311 C C4    . DT  B 2 46  ? 139.544 92.616  141.883 1.00 51.58  ? 46  DT  J C4    1 
ATOM 2312 O O4    . DT  B 2 46  ? 140.491 93.277  141.478 1.00 51.58  ? 46  DT  J O4    1 
ATOM 2313 C C5    . DT  B 2 46  ? 139.720 91.323  142.494 1.00 51.58  ? 46  DT  J C5    1 
ATOM 2314 C C7    . DT  B 2 46  ? 141.097 90.749  142.645 1.00 51.58  ? 46  DT  J C7    1 
ATOM 2315 C C6    . DT  B 2 46  ? 138.629 90.666  142.911 1.00 51.58  ? 46  DT  J C6    1 
ATOM 2316 P P     . DC  B 2 47  ? 133.297 87.197  142.916 1.00 48.10  ? 47  DC  J P     1 
ATOM 2317 O OP1   . DC  B 2 47  ? 131.884 87.060  143.335 1.00 48.10  ? 47  DC  J OP1   1 
ATOM 2318 O OP2   . DC  B 2 47  ? 134.212 86.035  142.982 1.00 48.10  ? 47  DC  J OP2   1 
ATOM 2319 O "O5'" . DC  B 2 47  ? 133.340 87.766  141.435 1.00 48.10  ? 47  DC  J "O5'" 1 
ATOM 2320 C "C5'" . DC  B 2 47  ? 132.742 89.012  141.131 1.00 48.10  ? 47  DC  J "C5'" 1 
ATOM 2321 C "C4'" . DC  B 2 47  ? 133.138 89.418  139.734 1.00 48.10  ? 47  DC  J "C4'" 1 
ATOM 2322 O "O4'" . DC  B 2 47  ? 134.503 89.897  139.731 1.00 48.10  ? 47  DC  J "O4'" 1 
ATOM 2323 C "C3'" . DC  B 2 47  ? 133.075 88.290  138.705 1.00 48.10  ? 47  DC  J "C3'" 1 
ATOM 2324 O "O3'" . DC  B 2 47  ? 132.415 88.737  137.544 1.00 48.10  ? 47  DC  J "O3'" 1 
ATOM 2325 C "C2'" . DC  B 2 47  ? 134.547 87.995  138.427 1.00 48.10  ? 47  DC  J "C2'" 1 
ATOM 2326 C "C1'" . DC  B 2 47  ? 135.147 89.372  138.607 1.00 48.10  ? 47  DC  J "C1'" 1 
ATOM 2327 N N1    . DC  B 2 47  ? 136.610 89.384  138.835 1.00 48.10  ? 47  DC  J N1    1 
ATOM 2328 C C2    . DC  B 2 47  ? 137.303 90.564  138.627 1.00 48.10  ? 47  DC  J C2    1 
ATOM 2329 O O2    . DC  B 2 47  ? 136.681 91.560  138.262 1.00 48.10  ? 47  DC  J O2    1 
ATOM 2330 N N3    . DC  B 2 47  ? 138.636 90.591  138.814 1.00 48.10  ? 47  DC  J N3    1 
ATOM 2331 C C4    . DC  B 2 47  ? 139.275 89.494  139.205 1.00 48.10  ? 47  DC  J C4    1 
ATOM 2332 N N4    . DC  B 2 47  ? 140.596 89.578  139.381 1.00 48.10  ? 47  DC  J N4    1 
ATOM 2333 C C5    . DC  B 2 47  ? 138.586 88.265  139.428 1.00 48.10  ? 47  DC  J C5    1 
ATOM 2334 C C6    . DC  B 2 47  ? 137.262 88.255  139.230 1.00 48.10  ? 47  DC  J C6    1 
ATOM 2335 P P     . DT  B 2 48  ? 130.863 88.405  137.327 1.00 45.56  ? 48  DT  J P     1 
ATOM 2336 O OP1   . DT  B 2 48  ? 130.250 88.200  138.657 1.00 45.56  ? 48  DT  J OP1   1 
ATOM 2337 O OP2   . DT  B 2 48  ? 130.773 87.347  136.299 1.00 45.56  ? 48  DT  J OP2   1 
ATOM 2338 O "O5'" . DT  B 2 48  ? 130.279 89.747  136.698 1.00 45.56  ? 48  DT  J "O5'" 1 
ATOM 2339 C "C5'" . DT  B 2 48  ? 130.332 89.945  135.300 1.00 45.56  ? 48  DT  J "C5'" 1 
ATOM 2340 C "C4'" . DT  B 2 48  ? 131.114 91.196  134.933 1.00 45.56  ? 48  DT  J "C4'" 1 
ATOM 2341 O "O4'" . DT  B 2 48  ? 132.488 91.083  135.394 1.00 45.56  ? 48  DT  J "O4'" 1 
ATOM 2342 C "C3'" . DT  B 2 48  ? 131.196 91.472  133.437 1.00 45.56  ? 48  DT  J "C3'" 1 
ATOM 2343 O "O3'" . DT  B 2 48  ? 130.929 92.842  133.198 1.00 45.56  ? 48  DT  J "O3'" 1 
ATOM 2344 C "C2'" . DT  B 2 48  ? 132.635 91.092  133.070 1.00 45.56  ? 48  DT  J "C2'" 1 
ATOM 2345 C "C1'" . DT  B 2 48  ? 133.369 91.435  134.346 1.00 45.56  ? 48  DT  J "C1'" 1 
ATOM 2346 N N1    . DT  B 2 48  ? 134.657 90.699  134.555 1.00 45.56  ? 48  DT  J N1    1 
ATOM 2347 C C2    . DT  B 2 48  ? 135.844 91.398  134.560 1.00 45.56  ? 48  DT  J C2    1 
ATOM 2348 O O2    . DT  B 2 48  ? 135.914 92.591  134.338 1.00 45.56  ? 48  DT  J O2    1 
ATOM 2349 N N3    . DT  B 2 48  ? 136.956 90.634  134.803 1.00 45.56  ? 48  DT  J N3    1 
ATOM 2350 C C4    . DT  B 2 48  ? 136.999 89.281  135.062 1.00 45.56  ? 48  DT  J C4    1 
ATOM 2351 O O4    . DT  B 2 48  ? 138.049 88.687  135.271 1.00 45.56  ? 48  DT  J O4    1 
ATOM 2352 C C5    . DT  B 2 48  ? 135.723 88.614  135.068 1.00 45.56  ? 48  DT  J C5    1 
ATOM 2353 C C7    . DT  B 2 48  ? 135.648 87.140  135.330 1.00 45.56  ? 48  DT  J C7    1 
ATOM 2354 C C6    . DT  B 2 48  ? 134.626 89.347  134.828 1.00 45.56  ? 48  DT  J C6    1 
ATOM 2355 P P     . DA  B 2 49  ? 130.347 93.296  131.776 1.00 41.82  ? 49  DA  J P     1 
ATOM 2356 O OP1   . DA  B 2 49  ? 129.791 94.659  131.921 1.00 41.82  ? 49  DA  J OP1   1 
ATOM 2357 O OP2   . DA  B 2 49  ? 129.486 92.203  131.276 1.00 41.82  ? 49  DA  J OP2   1 
ATOM 2358 O "O5'" . DA  B 2 49  ? 131.652 93.364  130.866 1.00 41.82  ? 49  DA  J "O5'" 1 
ATOM 2359 C "C5'" . DA  B 2 49  ? 132.680 94.275  131.196 1.00 41.82  ? 49  DA  J "C5'" 1 
ATOM 2360 C "C4'" . DA  B 2 49  ? 133.902 94.033  130.342 1.00 41.82  ? 49  DA  J "C4'" 1 
ATOM 2361 O "O4'" . DA  B 2 49  ? 134.670 92.930  130.889 1.00 41.82  ? 49  DA  J "O4'" 1 
ATOM 2362 C "C3'" . DA  B 2 49  ? 133.606 93.675  128.887 1.00 41.82  ? 49  DA  J "C3'" 1 
ATOM 2363 O "O3'" . DA  B 2 49  ? 134.497 94.350  128.036 1.00 41.82  ? 49  DA  J "O3'" 1 
ATOM 2364 C "C2'" . DA  B 2 49  ? 133.880 92.174  128.859 1.00 41.82  ? 49  DA  J "C2'" 1 
ATOM 2365 C "C1'" . DA  B 2 49  ? 135.037 92.080  129.841 1.00 41.82  ? 49  DA  J "C1'" 1 
ATOM 2366 N N9    . DA  B 2 49  ? 135.256 90.737  130.368 1.00 41.82  ? 49  DA  J N9    1 
ATOM 2367 C C8    . DA  B 2 49  ? 134.328 89.751  130.524 1.00 41.82  ? 49  DA  J C8    1 
ATOM 2368 N N7    . DA  B 2 49  ? 134.813 88.645  131.032 1.00 41.82  ? 49  DA  J N7    1 
ATOM 2369 C C5    . DA  B 2 49  ? 136.148 88.935  131.248 1.00 41.82  ? 49  DA  J C5    1 
ATOM 2370 C C6    . DA  B 2 49  ? 137.210 88.177  131.777 1.00 41.82  ? 49  DA  J C6    1 
ATOM 2371 N N6    . DA  B 2 49  ? 137.074 86.919  132.202 1.00 41.82  ? 49  DA  J N6    1 
ATOM 2372 N N1    . DA  B 2 49  ? 138.420 88.764  131.852 1.00 41.82  ? 49  DA  J N1    1 
ATOM 2373 C C2    . DA  B 2 49  ? 138.550 90.024  131.425 1.00 41.82  ? 49  DA  J C2    1 
ATOM 2374 N N3    . DA  B 2 49  ? 137.627 90.834  130.910 1.00 41.82  ? 49  DA  J N3    1 
ATOM 2375 C C4    . DA  B 2 49  ? 136.437 90.222  130.849 1.00 41.82  ? 49  DA  J C4    1 
ATOM 2376 P P     . DG  B 2 50  ? 133.987 95.541  127.087 1.00 38.80  ? 50  DG  J P     1 
ATOM 2377 O OP1   . DG  B 2 50  ? 133.465 96.627  127.941 1.00 38.80  ? 50  DG  J OP1   1 
ATOM 2378 O OP2   . DG  B 2 50  ? 133.133 94.959  126.033 1.00 38.80  ? 50  DG  J OP2   1 
ATOM 2379 O "O5'" . DG  B 2 50  ? 135.333 96.033  126.399 1.00 38.80  ? 50  DG  J "O5'" 1 
ATOM 2380 C "C5'" . DG  B 2 50  ? 136.366 96.575  127.189 1.00 38.80  ? 50  DG  J "C5'" 1 
ATOM 2381 C "C4'" . DG  B 2 50  ? 137.663 95.849  126.904 1.00 38.80  ? 50  DG  J "C4'" 1 
ATOM 2382 O "O4'" . DG  B 2 50  ? 137.625 94.528  127.474 1.00 38.80  ? 50  DG  J "O4'" 1 
ATOM 2383 C "C3'" . DG  B 2 50  ? 137.991 95.666  125.429 1.00 38.80  ? 50  DG  J "C3'" 1 
ATOM 2384 O "O3'" . DG  B 2 50  ? 139.175 96.353  125.148 1.00 38.80  ? 50  DG  J "O3'" 1 
ATOM 2385 C "C2'" . DG  B 2 50  ? 138.160 94.143  125.240 1.00 38.80  ? 50  DG  J "C2'" 1 
ATOM 2386 C "C1'" . DG  B 2 50  ? 138.353 93.644  126.659 1.00 38.80  ? 50  DG  J "C1'" 1 
ATOM 2387 N N9    . DG  B 2 50  ? 137.843 92.301  126.909 1.00 38.80  ? 50  DG  J N9    1 
ATOM 2388 C C8    . DG  B 2 50  ? 136.563 91.852  126.710 1.00 38.80  ? 50  DG  J C8    1 
ATOM 2389 N N7    . DG  B 2 50  ? 136.386 90.611  127.063 1.00 38.80  ? 50  DG  J N7    1 
ATOM 2390 C C5    . DG  B 2 50  ? 137.625 90.217  127.546 1.00 38.80  ? 50  DG  J C5    1 
ATOM 2391 C C6    . DG  B 2 50  ? 138.043 88.974  128.072 1.00 38.80  ? 50  DG  J C6    1 
ATOM 2392 O O6    . DG  B 2 50  ? 137.380 87.940  128.220 1.00 38.80  ? 50  DG  J O6    1 
ATOM 2393 N N1    . DG  B 2 50  ? 139.380 88.999  128.447 1.00 38.80  ? 50  DG  J N1    1 
ATOM 2394 C C2    . DG  B 2 50  ? 140.210 90.085  128.329 1.00 38.80  ? 50  DG  J C2    1 
ATOM 2395 N N2    . DG  B 2 50  ? 141.473 89.918  128.744 1.00 38.80  ? 50  DG  J N2    1 
ATOM 2396 N N3    . DG  B 2 50  ? 139.831 91.256  127.839 1.00 38.80  ? 50  DG  J N3    1 
ATOM 2397 C C4    . DG  B 2 50  ? 138.529 91.249  127.469 1.00 38.80  ? 50  DG  J C4    1 
ATOM 2398 P P     . DC  B 2 51  ? 139.737 96.426  123.654 1.00 38.77  ? 51  DC  J P     1 
ATOM 2399 O OP1   . DC  B 2 51  ? 140.470 97.699  123.512 1.00 38.77  ? 51  DC  J OP1   1 
ATOM 2400 O OP2   . DC  B 2 51  ? 138.640 96.091  122.721 1.00 38.77  ? 51  DC  J OP2   1 
ATOM 2401 O "O5'" . DC  B 2 51  ? 140.791 95.238  123.653 1.00 38.77  ? 51  DC  J "O5'" 1 
ATOM 2402 C "C5'" . DC  B 2 51  ? 141.941 95.343  124.448 1.00 38.77  ? 51  DC  J "C5'" 1 
ATOM 2403 C "C4'" . DC  B 2 51  ? 142.770 94.087  124.343 1.00 38.77  ? 51  DC  J "C4'" 1 
ATOM 2404 O "O4'" . DC  B 2 51  ? 141.992 92.955  124.818 1.00 38.77  ? 51  DC  J "O4'" 1 
ATOM 2405 C "C3'" . DC  B 2 51  ? 143.217 93.742  122.928 1.00 38.77  ? 51  DC  J "C3'" 1 
ATOM 2406 O "O3'" . DC  B 2 51  ? 144.609 93.493  122.921 1.00 38.77  ? 51  DC  J "O3'" 1 
ATOM 2407 C "C2'" . DC  B 2 51  ? 142.401 92.489  122.586 1.00 38.77  ? 51  DC  J "C2'" 1 
ATOM 2408 C "C1'" . DC  B 2 51  ? 142.188 91.868  123.956 1.00 38.77  ? 51  DC  J "C1'" 1 
ATOM 2409 N N1    . DC  B 2 51  ? 140.981 90.982  124.038 1.00 38.77  ? 51  DC  J N1    1 
ATOM 2410 C C2    . DC  B 2 51  ? 141.055 89.752  124.708 1.00 38.77  ? 51  DC  J C2    1 
ATOM 2411 O O2    . DC  B 2 51  ? 142.126 89.396  125.203 1.00 38.77  ? 51  DC  J O2    1 
ATOM 2412 N N3    . DC  B 2 51  ? 139.951 88.969  124.772 1.00 38.77  ? 51  DC  J N3    1 
ATOM 2413 C C4    . DC  B 2 51  ? 138.812 89.381  124.221 1.00 38.77  ? 51  DC  J C4    1 
ATOM 2414 N N4    . DC  B 2 51  ? 137.748 88.580  124.314 1.00 38.77  ? 51  DC  J N4    1 
ATOM 2415 C C5    . DC  B 2 51  ? 138.712 90.633  123.548 1.00 38.77  ? 51  DC  J C5    1 
ATOM 2416 C C6    . DC  B 2 51  ? 139.808 91.394  123.484 1.00 38.77  ? 51  DC  J C6    1 
ATOM 2417 P P     . DA  B 2 52  ? 145.368 93.264  121.531 1.00 41.78  ? 52  DA  J P     1 
ATOM 2418 O OP1   . DA  B 2 52  ? 146.740 93.797  121.667 1.00 41.78  ? 52  DA  J OP1   1 
ATOM 2419 O OP2   . DA  B 2 52  ? 144.485 93.775  120.461 1.00 41.78  ? 52  DA  J OP2   1 
ATOM 2420 O "O5'" . DA  B 2 52  ? 145.429 91.680  121.394 1.00 41.78  ? 52  DA  J "O5'" 1 
ATOM 2421 C "C5'" . DA  B 2 52  ? 145.963 90.887  122.450 1.00 41.78  ? 52  DA  J "C5'" 1 
ATOM 2422 C "C4'" . DA  B 2 52  ? 145.935 89.439  122.035 1.00 41.78  ? 52  DA  J "C4'" 1 
ATOM 2423 O "O4'" . DA  B 2 52  ? 144.706 88.838  122.458 1.00 41.78  ? 52  DA  J "O4'" 1 
ATOM 2424 C "C3'" . DA  B 2 52  ? 146.033 89.216  120.533 1.00 41.78  ? 52  DA  J "C3'" 1 
ATOM 2425 O "O3'" . DA  B 2 52  ? 147.253 88.547  120.262 1.00 41.78  ? 52  DA  J "O3'" 1 
ATOM 2426 C "C2'" . DA  B 2 52  ? 144.781 88.385  120.172 1.00 41.78  ? 52  DA  J "C2'" 1 
ATOM 2427 C "C1'" . DA  B 2 52  ? 144.331 87.864  121.526 1.00 41.78  ? 52  DA  J "C1'" 1 
ATOM 2428 N N9    . DA  B 2 52  ? 142.891 87.713  121.685 1.00 41.78  ? 52  DA  J N9    1 
ATOM 2429 C C8    . DA  B 2 52  ? 141.939 88.634  121.366 1.00 41.78  ? 52  DA  J C8    1 
ATOM 2430 N N7    . DA  B 2 52  ? 140.718 88.238  121.610 1.00 41.78  ? 52  DA  J N7    1 
ATOM 2431 C C5    . DA  B 2 52  ? 140.873 86.936  122.042 1.00 41.78  ? 52  DA  J C5    1 
ATOM 2432 C C6    . DA  B 2 52  ? 139.946 85.957  122.425 1.00 41.78  ? 52  DA  J C6    1 
ATOM 2433 N N6    . DA  B 2 52  ? 138.629 86.168  122.433 1.00 41.78  ? 52  DA  J N6    1 
ATOM 2434 N N1    . DA  B 2 52  ? 140.423 84.753  122.803 1.00 41.78  ? 52  DA  J N1    1 
ATOM 2435 C C2    . DA  B 2 52  ? 141.744 84.552  122.789 1.00 41.78  ? 52  DA  J C2    1 
ATOM 2436 N N3    . DA  B 2 52  ? 142.716 85.400  122.447 1.00 41.78  ? 52  DA  J N3    1 
ATOM 2437 C C4    . DA  B 2 52  ? 142.205 86.586  122.079 1.00 41.78  ? 52  DA  J C4    1 
ATOM 2438 P P     . DC  B 2 53  ? 147.700 88.211  118.763 1.00 41.77  ? 53  DC  J P     1 
ATOM 2439 O OP1   . DC  B 2 53  ? 149.178 88.242  118.723 1.00 41.77  ? 53  DC  J OP1   1 
ATOM 2440 O OP2   . DC  B 2 53  ? 146.919 89.074  117.851 1.00 41.77  ? 53  DC  J OP2   1 
ATOM 2441 O "O5'" . DC  B 2 53  ? 147.203 86.708  118.572 1.00 41.77  ? 53  DC  J "O5'" 1 
ATOM 2442 C "C5'" . DC  B 2 53  ? 147.476 85.735  119.589 1.00 41.77  ? 53  DC  J "C5'" 1 
ATOM 2443 C "C4'" . DC  B 2 53  ? 146.793 84.433  119.244 1.00 41.77  ? 53  DC  J "C4'" 1 
ATOM 2444 O "O4'" . DC  B 2 53  ? 145.403 84.512  119.608 1.00 41.77  ? 53  DC  J "O4'" 1 
ATOM 2445 C "C3'" . DC  B 2 53  ? 146.835 84.056  117.768 1.00 41.77  ? 53  DC  J "C3'" 1 
ATOM 2446 O "O3'" . DC  B 2 53  ? 147.430 82.768  117.638 1.00 41.77  ? 53  DC  J "O3'" 1 
ATOM 2447 C "C2'" . DC  B 2 53  ? 145.362 84.091  117.330 1.00 41.77  ? 53  DC  J "C2'" 1 
ATOM 2448 C "C1'" . DC  B 2 53  ? 144.649 83.839  118.643 1.00 41.77  ? 53  DC  J "C1'" 1 
ATOM 2449 N N1    . DC  B 2 53  ? 143.294 84.416  118.723 1.00 41.77  ? 53  DC  J N1    1 
ATOM 2450 C C2    . DC  B 2 53  ? 142.245 83.656  119.231 1.00 41.77  ? 53  DC  J C2    1 
ATOM 2451 O O2    . DC  B 2 53  ? 142.426 82.451  119.431 1.00 41.77  ? 53  DC  J O2    1 
ATOM 2452 N N3    . DC  B 2 53  ? 141.023 84.229  119.351 1.00 41.77  ? 53  DC  J N3    1 
ATOM 2453 C C4    . DC  B 2 53  ? 140.868 85.526  119.091 1.00 41.77  ? 53  DC  J C4    1 
ATOM 2454 N N4    . DC  B 2 53  ? 139.654 86.059  119.249 1.00 41.77  ? 53  DC  J N4    1 
ATOM 2455 C C5    . DC  B 2 53  ? 141.951 86.338  118.661 1.00 41.77  ? 53  DC  J C5    1 
ATOM 2456 C C6    . DC  B 2 53  ? 143.139 85.754  118.521 1.00 41.77  ? 53  DC  J C6    1 
ATOM 2457 P P     . DC  B 2 54  ? 147.863 82.220  116.197 1.00 40.80  ? 54  DC  J P     1 
ATOM 2458 O OP1   . DC  B 2 54  ? 149.164 81.534  116.358 1.00 40.80  ? 54  DC  J OP1   1 
ATOM 2459 O OP2   . DC  B 2 54  ? 147.732 83.336  115.236 1.00 40.80  ? 54  DC  J OP2   1 
ATOM 2460 O "O5'" . DC  B 2 54  ? 146.758 81.125  115.845 1.00 40.80  ? 54  DC  J "O5'" 1 
ATOM 2461 C "C5'" . DC  B 2 54  ? 146.493 80.045  116.752 1.00 40.80  ? 54  DC  J "C5'" 1 
ATOM 2462 C "C4'" . DC  B 2 54  ? 145.251 79.302  116.310 1.00 40.80  ? 54  DC  J "C4'" 1 
ATOM 2463 O "O4'" . DC  B 2 54  ? 144.077 80.050  116.678 1.00 40.80  ? 54  DC  J "O4'" 1 
ATOM 2464 C "C3'" . DC  B 2 54  ? 145.147 79.049  114.807 1.00 40.80  ? 54  DC  J "C3'" 1 
ATOM 2465 O "O3'" . DC  B 2 54  ? 145.077 77.647  114.571 1.00 40.80  ? 54  DC  J "O3'" 1 
ATOM 2466 C "C2'" . DC  B 2 54  ? 143.871 79.799  114.382 1.00 40.80  ? 54  DC  J "C2'" 1 
ATOM 2467 C "C1'" . DC  B 2 54  ? 143.105 79.861  115.689 1.00 40.80  ? 54  DC  J "C1'" 1 
ATOM 2468 N N1    . DC  B 2 54  ? 142.180 81.009  115.808 1.00 40.80  ? 54  DC  J N1    1 
ATOM 2469 C C2    . DC  B 2 54  ? 140.878 80.825  116.291 1.00 40.80  ? 54  DC  J C2    1 
ATOM 2470 O O2    . DC  B 2 54  ? 140.438 79.675  116.411 1.00 40.80  ? 54  DC  J O2    1 
ATOM 2471 N N3    . DC  B 2 54  ? 140.084 81.916  116.449 1.00 40.80  ? 54  DC  J N3    1 
ATOM 2472 C C4    . DC  B 2 54  ? 140.590 83.136  116.268 1.00 40.80  ? 54  DC  J C4    1 
ATOM 2473 N N4    . DC  B 2 54  ? 139.793 84.184  116.469 1.00 40.80  ? 54  DC  J N4    1 
ATOM 2474 C C5    . DC  B 2 54  ? 141.940 83.340  115.882 1.00 40.80  ? 54  DC  J C5    1 
ATOM 2475 C C6    . DC  B 2 54  ? 142.697 82.263  115.699 1.00 40.80  ? 54  DC  J C6    1 
ATOM 2476 P P     . DG  B 2 55  ? 145.247 77.066  113.087 1.00 38.29  ? 55  DG  J P     1 
ATOM 2477 O OP1   . DG  B 2 55  ? 145.811 75.702  113.194 1.00 38.29  ? 55  DG  J OP1   1 
ATOM 2478 O OP2   . DG  B 2 55  ? 145.936 78.088  112.268 1.00 38.29  ? 55  DG  J OP2   1 
ATOM 2479 O "O5'" . DG  B 2 55  ? 143.737 76.975  112.589 1.00 38.29  ? 55  DG  J "O5'" 1 
ATOM 2480 C "C5'" . DG  B 2 55  ? 142.864 76.050  113.235 1.00 38.29  ? 55  DG  J "C5'" 1 
ATOM 2481 C "C4'" . DG  B 2 55  ? 141.466 76.128  112.665 1.00 38.29  ? 55  DG  J "C4'" 1 
ATOM 2482 O "O4'" . DG  B 2 55  ? 140.834 77.347  113.113 1.00 38.29  ? 55  DG  J "O4'" 1 
ATOM 2483 C "C3'" . DG  B 2 55  ? 141.376 76.134  111.140 1.00 38.29  ? 55  DG  J "C3'" 1 
ATOM 2484 O "O3'" . DG  B 2 55  ? 140.361 75.248  110.729 1.00 38.29  ? 55  DG  J "O3'" 1 
ATOM 2485 C "C2'" . DG  B 2 55  ? 141.026 77.587  110.819 1.00 38.29  ? 55  DG  J "C2'" 1 
ATOM 2486 C "C1'" . DG  B 2 55  ? 140.189 77.953  112.027 1.00 38.29  ? 55  DG  J "C1'" 1 
ATOM 2487 N N9    . DG  B 2 55  ? 140.137 79.379  112.297 1.00 38.29  ? 55  DG  J N9    1 
ATOM 2488 C C8    . DG  B 2 55  ? 141.178 80.271  112.249 1.00 38.29  ? 55  DG  J C8    1 
ATOM 2489 N N7    . DG  B 2 55  ? 140.831 81.485  112.566 1.00 38.29  ? 55  DG  J N7    1 
ATOM 2490 C C5    . DG  B 2 55  ? 139.477 81.385  112.844 1.00 38.29  ? 55  DG  J C5    1 
ATOM 2491 C C6    . DG  B 2 55  ? 138.556 82.373  113.243 1.00 38.29  ? 55  DG  J C6    1 
ATOM 2492 O O6    . DG  B 2 55  ? 138.759 83.575  113.436 1.00 38.29  ? 55  DG  J O6    1 
ATOM 2493 N N1    . DG  B 2 55  ? 137.285 81.847  113.423 1.00 38.29  ? 55  DG  J N1    1 
ATOM 2494 C C2    . DG  B 2 55  ? 136.946 80.532  113.238 1.00 38.29  ? 55  DG  J C2    1 
ATOM 2495 N N2    . DG  B 2 55  ? 135.667 80.209  113.457 1.00 38.29  ? 55  DG  J N2    1 
ATOM 2496 N N3    . DG  B 2 55  ? 137.800 79.596  112.866 1.00 38.29  ? 55  DG  J N3    1 
ATOM 2497 C C4    . DG  B 2 55  ? 139.042 80.093  112.688 1.00 38.29  ? 55  DG  J C4    1 
ATOM 2498 P P     . DC  B 2 56  ? 140.343 74.691  109.227 1.00 35.02  ? 56  DC  J P     1 
ATOM 2499 O OP1   . DC  B 2 56  ? 140.470 73.218  109.291 1.00 35.02  ? 56  DC  J OP1   1 
ATOM 2500 O OP2   . DC  B 2 56  ? 141.318 75.482  108.445 1.00 35.02  ? 56  DC  J OP2   1 
ATOM 2501 O "O5'" . DC  B 2 56  ? 138.879 75.060  108.707 1.00 35.02  ? 56  DC  J "O5'" 1 
ATOM 2502 C "C5'" . DC  B 2 56  ? 137.736 74.611  109.427 1.00 35.02  ? 56  DC  J "C5'" 1 
ATOM 2503 C "C4'" . DC  B 2 56  ? 136.544 75.522  109.187 1.00 35.02  ? 56  DC  J "C4'" 1 
ATOM 2504 O "O4'" . DC  B 2 56  ? 136.795 76.845  109.715 1.00 35.02  ? 56  DC  J "O4'" 1 
ATOM 2505 C "C3'" . DC  B 2 56  ? 136.181 75.699  107.718 1.00 35.02  ? 56  DC  J "C3'" 1 
ATOM 2506 O "O3'" . DC  B 2 56  ? 134.782 75.602  107.543 1.00 35.02  ? 56  DC  J "O3'" 1 
ATOM 2507 C "C2'" . DC  B 2 56  ? 136.667 77.121  107.417 1.00 35.02  ? 56  DC  J "C2'" 1 
ATOM 2508 C "C1'" . DC  B 2 56  ? 136.429 77.804  108.754 1.00 35.02  ? 56  DC  J "C1'" 1 
ATOM 2509 N N1    . DC  B 2 56  ? 137.251 79.028  108.986 1.00 35.02  ? 56  DC  J N1    1 
ATOM 2510 C C2    . DC  B 2 56  ? 136.660 80.158  109.560 1.00 35.02  ? 56  DC  J C2    1 
ATOM 2511 O O2    . DC  B 2 56  ? 135.465 80.128  109.860 1.00 35.02  ? 56  DC  J O2    1 
ATOM 2512 N N3    . DC  B 2 56  ? 137.412 81.261  109.773 1.00 35.02  ? 56  DC  J N3    1 
ATOM 2513 C C4    . DC  B 2 56  ? 138.702 81.257  109.439 1.00 35.02  ? 56  DC  J C4    1 
ATOM 2514 N N4    . DC  B 2 56  ? 139.409 82.365  109.668 1.00 35.02  ? 56  DC  J N4    1 
ATOM 2515 C C5    . DC  B 2 56  ? 139.323 80.119  108.850 1.00 35.02  ? 56  DC  J C5    1 
ATOM 2516 C C6    . DC  B 2 56  ? 138.568 79.037  108.642 1.00 35.02  ? 56  DC  J C6    1 
ATOM 2517 P P     . DT  B 2 57  ? 134.178 74.400  106.669 1.00 32.07  ? 57  DT  J P     1 
ATOM 2518 O OP1   . DT  B 2 57  ? 133.193 73.709  107.528 1.00 32.07  ? 57  DT  J OP1   1 
ATOM 2519 O OP2   . DT  B 2 57  ? 135.305 73.642  106.081 1.00 32.07  ? 57  DT  J OP2   1 
ATOM 2520 O "O5'" . DT  B 2 57  ? 133.393 75.131  105.490 1.00 32.07  ? 57  DT  J "O5'" 1 
ATOM 2521 C "C5'" . DT  B 2 57  ? 133.623 76.507  105.234 1.00 32.07  ? 57  DT  J "C5'" 1 
ATOM 2522 C "C4'" . DT  B 2 57  ? 132.505 77.351  105.808 1.00 32.07  ? 57  DT  J "C4'" 1 
ATOM 2523 O "O4'" . DT  B 2 57  ? 133.033 78.363  106.688 1.00 32.07  ? 57  DT  J "O4'" 1 
ATOM 2524 C "C3'" . DT  B 2 57  ? 131.676 78.081  104.774 1.00 32.07  ? 57  DT  J "C3'" 1 
ATOM 2525 O "O3'" . DT  B 2 57  ? 130.331 78.107  105.177 1.00 32.07  ? 57  DT  J "O3'" 1 
ATOM 2526 C "C2'" . DT  B 2 57  ? 132.280 79.490  104.734 1.00 32.07  ? 57  DT  J "C2'" 1 
ATOM 2527 C "C1'" . DT  B 2 57  ? 132.896 79.655  106.121 1.00 32.07  ? 57  DT  J "C1'" 1 
ATOM 2528 N N1    . DT  B 2 57  ? 134.235 80.305  106.138 1.00 32.07  ? 57  DT  J N1    1 
ATOM 2529 C C2    . DT  B 2 57  ? 134.380 81.506  106.782 1.00 32.07  ? 57  DT  J C2    1 
ATOM 2530 O O2    . DT  B 2 57  ? 133.467 82.065  107.357 1.00 32.07  ? 57  DT  J O2    1 
ATOM 2531 N N3    . DT  B 2 57  ? 135.646 82.018  106.767 1.00 32.07  ? 57  DT  J N3    1 
ATOM 2532 C C4    . DT  B 2 57  ? 136.758 81.460  106.165 1.00 32.07  ? 57  DT  J C4    1 
ATOM 2533 O O4    . DT  B 2 57  ? 137.860 81.994  106.199 1.00 32.07  ? 57  DT  J O4    1 
ATOM 2534 C C5    . DT  B 2 57  ? 136.532 80.208  105.489 1.00 32.07  ? 57  DT  J C5    1 
ATOM 2535 C C7    . DT  B 2 57  ? 137.663 79.513  104.795 1.00 32.07  ? 57  DT  J C7    1 
ATOM 2536 C C6    . DT  B 2 57  ? 135.294 79.698  105.504 1.00 32.07  ? 57  DT  J C6    1 
ATOM 2537 P P     . DT  B 2 58  ? 129.169 78.036  104.077 1.00 29.58  ? 58  DT  J P     1 
ATOM 2538 O OP1   . DT  B 2 58  ? 127.917 77.641  104.755 1.00 29.58  ? 58  DT  J OP1   1 
ATOM 2539 O OP2   . DT  B 2 58  ? 129.673 77.248  102.933 1.00 29.58  ? 58  DT  J OP2   1 
ATOM 2540 O "O5'" . DT  B 2 58  ? 129.039 79.551  103.617 1.00 29.58  ? 58  DT  J "O5'" 1 
ATOM 2541 C "C5'" . DT  B 2 58  ? 128.636 80.530  104.544 1.00 29.58  ? 58  DT  J "C5'" 1 
ATOM 2542 C "C4'" . DT  B 2 58  ? 129.014 81.911  104.051 1.00 29.58  ? 58  DT  J "C4'" 1 
ATOM 2543 O "O4'" . DT  B 2 58  ? 130.459 82.069  104.076 1.00 29.58  ? 58  DT  J "O4'" 1 
ATOM 2544 C "C3'" . DT  B 2 58  ? 128.577 82.215  102.619 1.00 29.58  ? 58  DT  J "C3'" 1 
ATOM 2545 O "O3'" . DT  B 2 58  ? 128.002 83.490  102.572 1.00 29.58  ? 58  DT  J "O3'" 1 
ATOM 2546 C "C2'" . DT  B 2 58  ? 129.893 82.170  101.838 1.00 29.58  ? 58  DT  J "C2'" 1 
ATOM 2547 C "C1'" . DT  B 2 58  ? 130.862 82.689  102.884 1.00 29.58  ? 58  DT  J "C1'" 1 
ATOM 2548 N N1    . DT  B 2 58  ? 132.286 82.337  102.620 1.00 29.58  ? 58  DT  J N1    1 
ATOM 2549 C C2    . DT  B 2 58  ? 133.273 83.016  103.283 1.00 29.58  ? 58  DT  J C2    1 
ATOM 2550 O O2    . DT  B 2 58  ? 133.047 83.903  104.081 1.00 29.58  ? 58  DT  J O2    1 
ATOM 2551 N N3    . DT  B 2 58  ? 134.545 82.624  102.975 1.00 29.58  ? 58  DT  J N3    1 
ATOM 2552 C C4    . DT  B 2 58  ? 134.921 81.634  102.091 1.00 29.58  ? 58  DT  J C4    1 
ATOM 2553 O O4    . DT  B 2 58  ? 136.096 81.353  101.883 1.00 29.58  ? 58  DT  J O4    1 
ATOM 2554 C C5    . DT  B 2 58  ? 133.834 80.956  101.429 1.00 29.58  ? 58  DT  J C5    1 
ATOM 2555 C C7    . DT  B 2 58  ? 134.117 79.863  100.442 1.00 29.58  ? 58  DT  J C7    1 
ATOM 2556 C C6    . DT  B 2 58  ? 132.584 81.337  101.722 1.00 29.58  ? 58  DT  J C6    1 
ATOM 2557 P P     . DA  B 2 59  ? 126.871 83.815  101.485 1.00 27.35  ? 59  DA  J P     1 
ATOM 2558 O OP1   . DA  B 2 59  ? 125.633 83.132  101.918 1.00 27.35  ? 59  DA  J OP1   1 
ATOM 2559 O OP2   . DA  B 2 59  ? 127.433 83.545  100.144 1.00 27.35  ? 59  DA  J OP2   1 
ATOM 2560 O "O5'" . DA  B 2 59  ? 126.669 85.388  101.625 1.00 27.35  ? 59  DA  J "O5'" 1 
ATOM 2561 C "C5'" . DA  B 2 59  ? 126.598 85.977  102.916 1.00 27.35  ? 59  DA  J "C5'" 1 
ATOM 2562 C "C4'" . DA  B 2 59  ? 127.666 87.043  103.062 1.00 27.35  ? 59  DA  J "C4'" 1 
ATOM 2563 O "O4'" . DA  B 2 59  ? 128.964 86.484  102.770 1.00 27.35  ? 59  DA  J "O4'" 1 
ATOM 2564 C "C3'" . DA  B 2 59  ? 127.496 88.247  102.150 1.00 27.35  ? 59  DA  J "C3'" 1 
ATOM 2565 O "O3'" . DA  B 2 59  ? 127.551 89.421  102.926 1.00 27.35  ? 59  DA  J "O3'" 1 
ATOM 2566 C "C2'" . DA  B 2 59  ? 128.671 88.142  101.162 1.00 27.35  ? 59  DA  J "C2'" 1 
ATOM 2567 C "C1'" . DA  B 2 59  ? 129.703 87.375  101.969 1.00 27.35  ? 59  DA  J "C1'" 1 
ATOM 2568 N N9    . DA  B 2 59  ? 130.609 86.551  101.171 1.00 27.35  ? 59  DA  J N9    1 
ATOM 2569 C C8    . DA  B 2 59  ? 130.261 85.616  100.240 1.00 27.35  ? 59  DA  J C8    1 
ATOM 2570 N N7    . DA  B 2 59  ? 131.282 84.996  99.703  1.00 27.35  ? 59  DA  J N7    1 
ATOM 2571 C C5    . DA  B 2 59  ? 132.376 85.559  100.328 1.00 27.35  ? 59  DA  J C5    1 
ATOM 2572 C C6    . DA  B 2 59  ? 133.758 85.335  100.198 1.00 27.35  ? 59  DA  J C6    1 
ATOM 2573 N N6    . DA  B 2 59  ? 134.282 84.442  99.355  1.00 27.35  ? 59  DA  J N6    1 
ATOM 2574 N N1    . DA  B 2 59  ? 134.583 86.067  100.969 1.00 27.35  ? 59  DA  J N1    1 
ATOM 2575 C C2    . DA  B 2 59  ? 134.053 86.960  101.813 1.00 27.35  ? 59  DA  J C2    1 
ATOM 2576 N N3    . DA  B 2 59  ? 132.774 87.257  102.023 1.00 27.35  ? 59  DA  J N3    1 
ATOM 2577 C C4    . DA  B 2 59  ? 131.980 86.515  101.242 1.00 27.35  ? 59  DA  J C4    1 
ATOM 2578 P P     . DA  B 2 60  ? 127.065 90.817  102.312 1.00 25.16  ? 60  DA  J P     1 
ATOM 2579 O OP1   . DA  B 2 60  ? 126.395 91.566  103.395 1.00 25.16  ? 60  DA  J OP1   1 
ATOM 2580 O OP2   . DA  B 2 60  ? 126.365 90.554  101.036 1.00 25.16  ? 60  DA  J OP2   1 
ATOM 2581 O "O5'" . DA  B 2 60  ? 128.437 91.540  101.984 1.00 25.16  ? 60  DA  J "O5'" 1 
ATOM 2582 C "C5'" . DA  B 2 60  ? 129.475 91.521  102.942 1.00 25.16  ? 60  DA  J "C5'" 1 
ATOM 2583 C "C4'" . DA  B 2 60  ? 130.774 91.949  102.307 1.00 25.16  ? 60  DA  J "C4'" 1 
ATOM 2584 O "O4'" . DA  B 2 60  ? 131.333 90.853  101.543 1.00 25.16  ? 60  DA  J "O4'" 1 
ATOM 2585 C "C3'" . DA  B 2 60  ? 130.659 93.128  101.356 1.00 25.16  ? 60  DA  J "C3'" 1 
ATOM 2586 O "O3'" . DA  B 2 60  ? 131.687 94.029  101.625 1.00 25.16  ? 60  DA  J "O3'" 1 
ATOM 2587 C "C2'" . DA  B 2 60  ? 130.820 92.480  99.976  1.00 25.16  ? 60  DA  J "C2'" 1 
ATOM 2588 C "C1'" . DA  B 2 60  ? 131.747 91.319  100.286 1.00 25.16  ? 60  DA  J "C1'" 1 
ATOM 2589 N N9    . DA  B 2 60  ? 131.634 90.204  99.353  1.00 25.16  ? 60  DA  J N9    1 
ATOM 2590 C C8    . DA  B 2 60  ? 130.496 89.733  98.768  1.00 25.16  ? 60  DA  J C8    1 
ATOM 2591 N N7    . DA  B 2 60  ? 130.690 88.699  97.987  1.00 25.16  ? 60  DA  J N7    1 
ATOM 2592 C C5    . DA  B 2 60  ? 132.049 88.468  98.077  1.00 25.16  ? 60  DA  J C5    1 
ATOM 2593 C C6    . DA  B 2 60  ? 132.886 87.507  97.483  1.00 25.16  ? 60  DA  J C6    1 
ATOM 2594 N N6    . DA  B 2 60  ? 132.445 86.563  96.647  1.00 25.16  ? 60  DA  J N6    1 
ATOM 2595 N N1    . DA  B 2 60  ? 134.200 87.553  97.782  1.00 25.16  ? 60  DA  J N1    1 
ATOM 2596 C C2    . DA  B 2 60  ? 134.636 88.500  98.619  1.00 25.16  ? 60  DA  J C2    1 
ATOM 2597 N N3    . DA  B 2 60  ? 133.945 89.454  99.238  1.00 25.16  ? 60  DA  J N3    1 
ATOM 2598 C C4    . DA  B 2 60  ? 132.646 89.381  98.921  1.00 25.16  ? 60  DA  J C4    1 
ATOM 2599 P P     . DA  B 2 61  ? 131.592 95.540  101.109 1.00 24.04  ? 61  DA  J P     1 
ATOM 2600 O OP1   . DA  B 2 61  ? 131.611 96.425  102.291 1.00 24.04  ? 61  DA  J OP1   1 
ATOM 2601 O OP2   . DA  B 2 61  ? 130.486 95.635  100.135 1.00 24.04  ? 61  DA  J OP2   1 
ATOM 2602 O "O5'" . DA  B 2 61  ? 132.960 95.712  100.326 1.00 24.04  ? 61  DA  J "O5'" 1 
ATOM 2603 C "C5'" . DA  B 2 61  ? 134.180 95.486  100.990 1.00 24.04  ? 61  DA  J "C5'" 1 
ATOM 2604 C "C4'" . DA  B 2 61  ? 135.178 94.868  100.038 1.00 24.04  ? 61  DA  J "C4'" 1 
ATOM 2605 O "O4'" . DA  B 2 61  ? 134.610 93.720  99.392  1.00 24.04  ? 61  DA  J "O4'" 1 
ATOM 2606 C "C3'" . DA  B 2 61  ? 135.669 95.786  98.929  1.00 24.04  ? 61  DA  J "C3'" 1 
ATOM 2607 O "O3'" . DA  B 2 61  ? 137.053 95.951  99.082  1.00 24.04  ? 61  DA  J "O3'" 1 
ATOM 2608 C "C2'" . DA  B 2 61  ? 135.306 95.043  97.623  1.00 24.04  ? 61  DA  J "C2'" 1 
ATOM 2609 C "C1'" . DA  B 2 61  ? 135.160 93.617  98.111  1.00 24.04  ? 61  DA  J "C1'" 1 
ATOM 2610 N N9    . DA  B 2 61  ? 134.277 92.757  97.330  1.00 24.04  ? 61  DA  J N9    1 
ATOM 2611 C C8    . DA  B 2 61  ? 132.931 92.898  97.163  1.00 24.04  ? 61  DA  J C8    1 
ATOM 2612 N N7    . DA  B 2 61  ? 132.390 91.962  96.422  1.00 24.04  ? 61  DA  J N7    1 
ATOM 2613 C C5    . DA  B 2 61  ? 133.462 91.168  96.057  1.00 24.04  ? 61  DA  J C5    1 
ATOM 2614 C C6    . DA  B 2 61  ? 133.557 90.016  95.260  1.00 24.04  ? 61  DA  J C6    1 
ATOM 2615 N N6    . DA  B 2 61  ? 132.508 89.445  94.667  1.00 24.04  ? 61  DA  J N6    1 
ATOM 2616 N N1    . DA  B 2 61  ? 134.774 89.470  95.095  1.00 24.04  ? 61  DA  J N1    1 
ATOM 2617 C C2    . DA  B 2 61  ? 135.821 90.045  95.691  1.00 24.04  ? 61  DA  J C2    1 
ATOM 2618 N N3    . DA  B 2 61  ? 135.856 91.127  96.463  1.00 24.04  ? 61  DA  J N3    1 
ATOM 2619 C C4    . DA  B 2 61  ? 134.632 91.646  96.606  1.00 24.04  ? 61  DA  J C4    1 
ATOM 2620 P P     . DC  B 2 62  ? 137.840 97.057  98.241  1.00 24.73  ? 62  DC  J P     1 
ATOM 2621 O OP1   . DC  B 2 62  ? 139.017 97.477  99.028  1.00 24.73  ? 62  DC  J OP1   1 
ATOM 2622 O OP2   . DC  B 2 62  ? 136.855 98.062  97.793  1.00 24.73  ? 62  DC  J OP2   1 
ATOM 2623 O "O5'" . DC  B 2 62  ? 138.340 96.248  96.966  1.00 24.73  ? 62  DC  J "O5'" 1 
ATOM 2624 C "C5'" . DC  B 2 62  ? 139.072 95.037  97.129  1.00 24.73  ? 62  DC  J "C5'" 1 
ATOM 2625 C "C4'" . DC  B 2 62  ? 139.385 94.457  95.772  1.00 24.73  ? 62  DC  J "C4'" 1 
ATOM 2626 O "O4'" . DC  B 2 62  ? 138.272 93.647  95.319  1.00 24.73  ? 62  DC  J "O4'" 1 
ATOM 2627 C "C3'" . DC  B 2 62  ? 139.630 95.504  94.692  1.00 24.73  ? 62  DC  J "C3'" 1 
ATOM 2628 O "O3'" . DC  B 2 62  ? 140.881 95.241  94.066  1.00 24.73  ? 62  DC  J "O3'" 1 
ATOM 2629 C "C2'" . DC  B 2 62  ? 138.431 95.333  93.743  1.00 24.73  ? 62  DC  J "C2'" 1 
ATOM 2630 C "C1'" . DC  B 2 62  ? 138.096 93.870  93.948  1.00 24.73  ? 62  DC  J "C1'" 1 
ATOM 2631 N N1    . DC  B 2 62  ? 136.685 93.498  93.617  1.00 24.73  ? 62  DC  J N1    1 
ATOM 2632 C C2    . DC  B 2 62  ? 136.404 92.283  92.980  1.00 24.73  ? 62  DC  J C2    1 
ATOM 2633 O O2    . DC  B 2 62  ? 137.333 91.608  92.527  1.00 24.73  ? 62  DC  J O2    1 
ATOM 2634 N N3    . DC  B 2 62  ? 135.111 91.958  92.734  1.00 24.73  ? 62  DC  J N3    1 
ATOM 2635 C C4    . DC  B 2 62  ? 134.130 92.726  93.200  1.00 24.73  ? 62  DC  J C4    1 
ATOM 2636 N N4    . DC  B 2 62  ? 132.869 92.347  92.963  1.00 24.73  ? 62  DC  J N4    1 
ATOM 2637 C C5    . DC  B 2 62  ? 134.396 93.916  93.930  1.00 24.73  ? 62  DC  J C5    1 
ATOM 2638 C C6    . DC  B 2 62  ? 135.672 94.244  94.136  1.00 24.73  ? 62  DC  J C6    1 
ATOM 2639 P P     . DG  B 2 63  ? 141.585 96.369  93.168  1.00 26.31  ? 63  DG  J P     1 
ATOM 2640 O OP1   . DG  B 2 63  ? 142.990 96.460  93.613  1.00 26.31  ? 63  DG  J OP1   1 
ATOM 2641 O OP2   . DG  B 2 63  ? 140.736 97.577  93.186  1.00 26.31  ? 63  DG  J OP2   1 
ATOM 2642 O "O5'" . DG  B 2 63  ? 141.558 95.754  91.700  1.00 26.31  ? 63  DG  J "O5'" 1 
ATOM 2643 C "C5'" . DG  B 2 63  ? 142.110 94.458  91.481  1.00 26.31  ? 63  DG  J "C5'" 1 
ATOM 2644 C "C4'" . DG  B 2 63  ? 141.605 93.867  90.186  1.00 26.31  ? 63  DG  J "C4'" 1 
ATOM 2645 O "O4'" . DG  B 2 63  ? 140.206 93.548  90.322  1.00 26.31  ? 63  DG  J "O4'" 1 
ATOM 2646 C "C3'" . DG  B 2 63  ? 141.735 94.777  88.963  1.00 26.31  ? 63  DG  J "C3'" 1 
ATOM 2647 O "O3'" . DG  B 2 63  ? 142.276 94.030  87.871  1.00 26.31  ? 63  DG  J "O3'" 1 
ATOM 2648 C "C2'" . DG  B 2 63  ? 140.284 95.212  88.714  1.00 26.31  ? 63  DG  J "C2'" 1 
ATOM 2649 C "C1'" . DG  B 2 63  ? 139.534 93.976  89.177  1.00 26.31  ? 63  DG  J "C1'" 1 
ATOM 2650 N N9    . DG  B 2 63  ? 138.149 94.203  89.562  1.00 26.31  ? 63  DG  J N9    1 
ATOM 2651 C C8    . DG  B 2 63  ? 137.664 95.189  90.381  1.00 26.31  ? 63  DG  J C8    1 
ATOM 2652 N N7    . DG  B 2 63  ? 136.375 95.127  90.556  1.00 26.31  ? 63  DG  J N7    1 
ATOM 2653 C C5    . DG  B 2 63  ? 135.983 94.047  89.783  1.00 26.31  ? 63  DG  J C5    1 
ATOM 2654 C C6    . DG  B 2 63  ? 134.702 93.504  89.565  1.00 26.31  ? 63  DG  J C6    1 
ATOM 2655 O O6    . DG  B 2 63  ? 133.621 93.881  90.029  1.00 26.31  ? 63  DG  J O6    1 
ATOM 2656 N N1    . DG  B 2 63  ? 134.748 92.408  88.710  1.00 26.31  ? 63  DG  J N1    1 
ATOM 2657 C C2    . DG  B 2 63  ? 135.888 91.906  88.137  1.00 26.31  ? 63  DG  J C2    1 
ATOM 2658 N N2    . DG  B 2 63  ? 135.741 90.842  87.340  1.00 26.31  ? 63  DG  J N2    1 
ATOM 2659 N N3    . DG  B 2 63  ? 137.092 92.406  88.336  1.00 26.31  ? 63  DG  J N3    1 
ATOM 2660 C C4    . DG  B 2 63  ? 137.063 93.471  89.166  1.00 26.31  ? 63  DG  J C4    1 
ATOM 2661 P P     . DC  B 2 64  ? 142.974 94.779  86.631  1.00 26.90  ? 64  DC  J P     1 
ATOM 2662 O OP1   . DC  B 2 64  ? 143.738 93.767  85.870  1.00 26.90  ? 64  DC  J OP1   1 
ATOM 2663 O OP2   . DC  B 2 64  ? 143.658 95.974  87.168  1.00 26.90  ? 64  DC  J OP2   1 
ATOM 2664 O "O5'" . DC  B 2 64  ? 141.754 95.286  85.738  1.00 26.90  ? 64  DC  J "O5'" 1 
ATOM 2665 C "C5'" . DC  B 2 64  ? 141.696 94.969  84.345  1.00 26.90  ? 64  DC  J "C5'" 1 
ATOM 2666 C "C4'" . DC  B 2 64  ? 140.457 94.150  84.051  1.00 26.90  ? 64  DC  J "C4'" 1 
ATOM 2667 O "O4'" . DC  B 2 64  ? 139.485 94.385  85.052  1.00 26.90  ? 64  DC  J "O4'" 1 
ATOM 2668 C "C3'" . DC  B 2 64  ? 139.759 94.459  82.732  1.00 26.90  ? 64  DC  J "C3'" 1 
ATOM 2669 O "O3'" . DC  B 2 64  ? 140.222 93.549  81.732  1.00 26.90  ? 64  DC  J "O3'" 1 
ATOM 2670 C "C2'" . DC  B 2 64  ? 138.251 94.289  83.048  1.00 26.90  ? 64  DC  J "C2'" 1 
ATOM 2671 C "C1'" . DC  B 2 64  ? 138.241 93.993  84.553  1.00 26.90  ? 64  DC  J "C1'" 1 
ATOM 2672 N N1    . DC  B 2 64  ? 137.227 94.692  85.369  1.00 26.90  ? 64  DC  J N1    1 
ATOM 2673 C C2    . DC  B 2 64  ? 135.896 94.264  85.376  1.00 26.90  ? 64  DC  J C2    1 
ATOM 2674 O O2    . DC  B 2 64  ? 135.547 93.357  84.614  1.00 26.90  ? 64  DC  J O2    1 
ATOM 2675 N N3    . DC  B 2 64  ? 135.017 94.898  86.189  1.00 26.90  ? 64  DC  J N3    1 
ATOM 2676 C C4    . DC  B 2 64  ? 135.435 95.876  86.991  1.00 26.90  ? 64  DC  J C4    1 
ATOM 2677 N N4    . DC  B 2 64  ? 134.540 96.471  87.780  1.00 26.90  ? 64  DC  J N4    1 
ATOM 2678 C C5    . DC  B 2 64  ? 136.790 96.291  87.024  1.00 26.90  ? 64  DC  J C5    1 
ATOM 2679 C C6    . DC  B 2 64  ? 137.643 95.668  86.219  1.00 26.90  ? 64  DC  J C6    1 
ATOM 2680 P P     . DA  B 2 65  ? 140.590 94.080  80.264  1.00 27.21  ? 65  DA  J P     1 
ATOM 2681 O OP1   . DA  B 2 65  ? 141.375 93.027  79.583  1.00 27.21  ? 65  DA  J OP1   1 
ATOM 2682 O OP2   . DA  B 2 65  ? 141.157 95.436  80.414  1.00 27.21  ? 65  DA  J OP2   1 
ATOM 2683 O "O5'" . DA  B 2 65  ? 139.171 94.217  79.547  1.00 27.21  ? 65  DA  J "O5'" 1 
ATOM 2684 C "C5'" . DA  B 2 65  ? 138.287 93.097  79.475  1.00 27.21  ? 65  DA  J "C5'" 1 
ATOM 2685 C "C4'" . DA  B 2 65  ? 136.894 93.568  79.119  1.00 27.21  ? 65  DA  J "C4'" 1 
ATOM 2686 O "O4'" . DA  B 2 65  ? 136.256 94.124  80.285  1.00 27.21  ? 65  DA  J "O4'" 1 
ATOM 2687 C "C3'" . DA  B 2 65  ? 136.834 94.639  78.037  1.00 27.21  ? 65  DA  J "C3'" 1 
ATOM 2688 O "O3'" . DA  B 2 65  ? 135.967 94.216  77.000  1.00 27.21  ? 65  DA  J "O3'" 1 
ATOM 2689 C "C2'" . DA  B 2 65  ? 136.314 95.888  78.766  1.00 27.21  ? 65  DA  J "C2'" 1 
ATOM 2690 C "C1'" . DA  B 2 65  ? 135.549 95.283  79.927  1.00 27.21  ? 65  DA  J "C1'" 1 
ATOM 2691 N N9    . DA  B 2 65  ? 135.513 96.113  81.121  1.00 27.21  ? 65  DA  J N9    1 
ATOM 2692 C C8    . DA  B 2 65  ? 136.525 96.883  81.616  1.00 27.21  ? 65  DA  J C8    1 
ATOM 2693 N N7    . DA  B 2 65  ? 136.217 97.512  82.723  1.00 27.21  ? 65  DA  J N7    1 
ATOM 2694 C C5    . DA  B 2 65  ? 134.906 97.146  82.956  1.00 27.21  ? 65  DA  J C5    1 
ATOM 2695 C C6    . DA  B 2 65  ? 133.998 97.486  83.970  1.00 27.21  ? 65  DA  J C6    1 
ATOM 2696 N N6    . DA  B 2 65  ? 134.298 98.309  84.975  1.00 27.21  ? 65  DA  J N6    1 
ATOM 2697 N N1    . DA  B 2 65  ? 132.766 96.948  83.910  1.00 27.21  ? 65  DA  J N1    1 
ATOM 2698 C C2    . DA  B 2 65  ? 132.471 96.126  82.899  1.00 27.21  ? 65  DA  J C2    1 
ATOM 2699 N N3    . DA  B 2 65  ? 133.242 95.731  81.890  1.00 27.21  ? 65  DA  J N3    1 
ATOM 2700 C C4    . DA  B 2 65  ? 134.457 96.283  81.979  1.00 27.21  ? 65  DA  J C4    1 
ATOM 2701 P P     . DC  B 2 66  ? 136.002 94.944  75.573  1.00 25.65  ? 66  DC  J P     1 
ATOM 2702 O OP1   . DC  B 2 66  ? 136.265 93.903  74.554  1.00 25.65  ? 66  DC  J OP1   1 
ATOM 2703 O OP2   . DC  B 2 66  ? 136.877 96.133  75.658  1.00 25.65  ? 66  DC  J OP2   1 
ATOM 2704 O "O5'" . DC  B 2 66  ? 134.500 95.440  75.411  1.00 25.65  ? 66  DC  J "O5'" 1 
ATOM 2705 C "C5'" . DC  B 2 66  ? 133.447 94.638  75.920  1.00 25.65  ? 66  DC  J "C5'" 1 
ATOM 2706 C "C4'" . DC  B 2 66  ? 132.281 95.496  76.365  1.00 25.65  ? 66  DC  J "C4'" 1 
ATOM 2707 O "O4'" . DC  B 2 66  ? 132.550 96.071  77.655  1.00 25.65  ? 66  DC  J "O4'" 1 
ATOM 2708 C "C3'" . DC  B 2 66  ? 131.949 96.667  75.442  1.00 25.65  ? 66  DC  J "C3'" 1 
ATOM 2709 O "O3'" . DC  B 2 66  ? 130.656 96.522  74.946  1.00 25.65  ? 66  DC  J "O3'" 1 
ATOM 2710 C "C2'" . DC  B 2 66  ? 132.075 97.907  76.344  1.00 25.65  ? 66  DC  J "C2'" 1 
ATOM 2711 C "C1'" . DC  B 2 66  ? 131.904 97.309  77.726  1.00 25.65  ? 66  DC  J "C1'" 1 
ATOM 2712 N N1    . DC  B 2 66  ? 132.564 98.081  78.791  1.00 25.65  ? 66  DC  J N1    1 
ATOM 2713 C C2    . DC  B 2 66  ? 131.849 98.450  79.932  1.00 25.65  ? 66  DC  J C2    1 
ATOM 2714 O O2    . DC  B 2 66  ? 130.658 98.138  80.026  1.00 25.65  ? 66  DC  J O2    1 
ATOM 2715 N N3    . DC  B 2 66  ? 132.486 99.143  80.903  1.00 25.65  ? 66  DC  J N3    1 
ATOM 2716 C C4    . DC  B 2 66  ? 133.772 99.455  80.763  1.00 25.65  ? 66  DC  J C4    1 
ATOM 2717 N N4    . DC  B 2 66  ? 134.363 100.138 81.742  1.00 25.65  ? 66  DC  J N4    1 
ATOM 2718 C C5    . DC  B 2 66  ? 134.514 99.082  79.611  1.00 25.65  ? 66  DC  J C5    1 
ATOM 2719 C C6    . DC  B 2 66  ? 133.877 98.401  78.662  1.00 25.65  ? 66  DC  J C6    1 
ATOM 2720 P P     . DG  B 2 67  ? 130.250 97.204  73.557  1.00 25.10  ? 67  DG  J P     1 
ATOM 2721 O OP1   . DG  B 2 67  ? 129.801 96.143  72.628  1.00 25.10  ? 67  DG  J OP1   1 
ATOM 2722 O OP2   . DG  B 2 67  ? 131.344 98.115  73.159  1.00 25.10  ? 67  DG  J OP2   1 
ATOM 2723 O "O5'" . DG  B 2 67  ? 129.002 98.094  73.973  1.00 25.10  ? 67  DG  J "O5'" 1 
ATOM 2724 C "C5'" . DG  B 2 67  ? 127.953 97.513  74.723  1.00 25.10  ? 67  DG  J "C5'" 1 
ATOM 2725 C "C4'" . DG  B 2 67  ? 127.269 98.556  75.582  1.00 25.10  ? 67  DG  J "C4'" 1 
ATOM 2726 O "O4'" . DG  B 2 67  ? 128.165 99.046  76.612  1.00 25.10  ? 67  DG  J "O4'" 1 
ATOM 2727 C "C3'" . DG  B 2 67  ? 126.783 99.777  74.814  1.00 25.10  ? 67  DG  J "C3'" 1 
ATOM 2728 O "O3'" . DG  B 2 67  ? 125.500 100.101 75.243  1.00 25.10  ? 67  DG  J "O3'" 1 
ATOM 2729 C "C2'" . DG  B 2 67  ? 127.790 100.860 75.217  1.00 25.10  ? 67  DG  J "C2'" 1 
ATOM 2730 C "C1'" . DG  B 2 67  ? 128.104 100.453 76.645  1.00 25.10  ? 67  DG  J "C1'" 1 
ATOM 2731 N N9    . DG  B 2 67  ? 129.387 100.945 77.143  1.00 25.10  ? 67  DG  J N9    1 
ATOM 2732 C C8    . DG  B 2 67  ? 130.576 100.956 76.464  1.00 25.10  ? 67  DG  J C8    1 
ATOM 2733 N N7    . DG  B 2 67  ? 131.566 101.440 77.154  1.00 25.10  ? 67  DG  J N7    1 
ATOM 2734 C C5    . DG  B 2 67  ? 131.000 101.777 78.373  1.00 25.10  ? 67  DG  J C5    1 
ATOM 2735 C C6    . DG  B 2 67  ? 131.594 102.348 79.517  1.00 25.10  ? 67  DG  J C6    1 
ATOM 2736 O O6    . DG  B 2 67  ? 132.774 102.676 79.681  1.00 25.10  ? 67  DG  J O6    1 
ATOM 2737 N N1    . DG  B 2 67  ? 130.676 102.532 80.540  1.00 25.10  ? 67  DG  J N1    1 
ATOM 2738 C C2    . DG  B 2 67  ? 129.347 102.206 80.468  1.00 25.10  ? 67  DG  J C2    1 
ATOM 2739 N N2    . DG  B 2 67  ? 128.618 102.465 81.563  1.00 25.10  ? 67  DG  J N2    1 
ATOM 2740 N N3    . DG  B 2 67  ? 128.771 101.666 79.397  1.00 25.10  ? 67  DG  J N3    1 
ATOM 2741 C C4    . DG  B 2 67  ? 129.658 101.481 78.388  1.00 25.10  ? 67  DG  J C4    1 
ATOM 2742 P P     . DT  B 2 68  ? 124.540 100.984 74.316  1.00 25.46  ? 68  DT  J P     1 
ATOM 2743 O OP1   . DT  B 2 68  ? 123.349 100.167 74.003  1.00 25.46  ? 68  DT  J OP1   1 
ATOM 2744 O OP2   . DT  B 2 68  ? 125.350 101.560 73.219  1.00 25.46  ? 68  DT  J OP2   1 
ATOM 2745 O "O5'" . DT  B 2 68  ? 124.125 102.165 75.288  1.00 25.46  ? 68  DT  J "O5'" 1 
ATOM 2746 C "C5'" . DT  B 2 68  ? 123.719 101.858 76.600  1.00 25.46  ? 68  DT  J "C5'" 1 
ATOM 2747 C "C4'" . DT  B 2 68  ? 124.052 103.001 77.529  1.00 25.46  ? 68  DT  J "C4'" 1 
ATOM 2748 O "O4'" . DT  B 2 68  ? 125.492 103.160 77.598  1.00 25.46  ? 68  DT  J "O4'" 1 
ATOM 2749 C "C3'" . DT  B 2 68  ? 123.494 104.349 77.084  1.00 25.46  ? 68  DT  J "C3'" 1 
ATOM 2750 O "O3'" . DT  B 2 68  ? 122.909 105.000 78.180  1.00 25.46  ? 68  DT  J "O3'" 1 
ATOM 2751 C "C2'" . DT  B 2 68  ? 124.738 105.088 76.590  1.00 25.46  ? 68  DT  J "C2'" 1 
ATOM 2752 C "C1'" . DT  B 2 68  ? 125.802 104.522 77.510  1.00 25.46  ? 68  DT  J "C1'" 1 
ATOM 2753 N N1    . DT  B 2 68  ? 127.184 104.649 76.969  1.00 25.46  ? 68  DT  J N1    1 
ATOM 2754 C C2    . DT  B 2 68  ? 128.225 104.878 77.832  1.00 25.46  ? 68  DT  J C2    1 
ATOM 2755 O O2    . DT  B 2 68  ? 128.084 104.973 79.035  1.00 25.46  ? 68  DT  J O2    1 
ATOM 2756 N N3    . DT  B 2 68  ? 129.452 104.976 77.238  1.00 25.46  ? 68  DT  J N3    1 
ATOM 2757 C C4    . DT  B 2 68  ? 129.734 104.882 75.892  1.00 25.46  ? 68  DT  J C4    1 
ATOM 2758 O O4    . DT  B 2 68  ? 130.871 104.988 75.451  1.00 25.46  ? 68  DT  J O4    1 
ATOM 2759 C C5    . DT  B 2 68  ? 128.598 104.651 75.039  1.00 25.46  ? 68  DT  J C5    1 
ATOM 2760 C C7    . DT  B 2 68  ? 128.782 104.533 73.555  1.00 25.46  ? 68  DT  J C7    1 
ATOM 2761 C C6    . DT  B 2 68  ? 127.391 104.549 75.612  1.00 25.46  ? 68  DT  J C6    1 
ATOM 2762 P P     . DA  B 2 69  ? 121.401 105.529 78.056  1.00 23.87  ? 69  DA  J P     1 
ATOM 2763 O OP1   . DA  B 2 69  ? 120.528 104.511 78.676  1.00 23.87  ? 69  DA  J OP1   1 
ATOM 2764 O OP2   . DA  B 2 69  ? 121.173 105.928 76.652  1.00 23.87  ? 69  DA  J OP2   1 
ATOM 2765 O "O5'" . DA  B 2 69  ? 121.362 106.837 78.958  1.00 23.87  ? 69  DA  J "O5'" 1 
ATOM 2766 C "C5'" . DA  B 2 69  ? 121.133 106.720 80.346  1.00 23.87  ? 69  DA  J "C5'" 1 
ATOM 2767 C "C4'" . DA  B 2 69  ? 122.324 107.239 81.127  1.00 23.87  ? 69  DA  J "C4'" 1 
ATOM 2768 O "O4'" . DA  B 2 69  ? 123.528 107.114 80.341  1.00 23.87  ? 69  DA  J "O4'" 1 
ATOM 2769 C "C3'" . DA  B 2 69  ? 122.236 108.699 81.537  1.00 23.87  ? 69  DA  J "C3'" 1 
ATOM 2770 O "O3'" . DA  B 2 69  ? 122.554 108.789 82.905  1.00 23.87  ? 69  DA  J "O3'" 1 
ATOM 2771 C "C2'" . DA  B 2 69  ? 123.280 109.391 80.639  1.00 23.87  ? 69  DA  J "C2'" 1 
ATOM 2772 C "C1'" . DA  B 2 69  ? 124.297 108.286 80.477  1.00 23.87  ? 69  DA  J "C1'" 1 
ATOM 2773 N N9    . DA  B 2 69  ? 125.136 108.351 79.280  1.00 23.87  ? 69  DA  J N9    1 
ATOM 2774 C C8    . DA  B 2 69  ? 124.718 108.214 77.990  1.00 23.87  ? 69  DA  J C8    1 
ATOM 2775 N N7    . DA  B 2 69  ? 125.685 108.259 77.110  1.00 23.87  ? 69  DA  J N7    1 
ATOM 2776 C C5    . DA  B 2 69  ? 126.819 108.446 77.872  1.00 23.87  ? 69  DA  J C5    1 
ATOM 2777 C C6    . DA  B 2 69  ? 128.171 108.582 77.526  1.00 23.87  ? 69  DA  J C6    1 
ATOM 2778 N N6    . DA  B 2 69  ? 128.610 108.549 76.267  1.00 23.87  ? 69  DA  J N6    1 
ATOM 2779 N N1    . DA  B 2 69  ? 129.058 108.757 78.522  1.00 23.87  ? 69  DA  J N1    1 
ATOM 2780 C C2    . DA  B 2 69  ? 128.612 108.790 79.783  1.00 23.87  ? 69  DA  J C2    1 
ATOM 2781 N N3    . DA  B 2 69  ? 127.363 108.670 80.233  1.00 23.87  ? 69  DA  J N3    1 
ATOM 2782 C C4    . DA  B 2 69  ? 126.505 108.499 79.215  1.00 23.87  ? 69  DA  J C4    1 
ATOM 2783 P P     . DC  B 2 70  ? 121.896 109.928 83.816  1.00 22.83  ? 70  DC  J P     1 
ATOM 2784 O OP1   . DC  B 2 70  ? 121.843 109.428 85.205  1.00 22.83  ? 70  DC  J OP1   1 
ATOM 2785 O OP2   . DC  B 2 70  ? 120.659 110.389 83.150  1.00 22.83  ? 70  DC  J OP2   1 
ATOM 2786 O "O5'" . DC  B 2 70  ? 122.965 111.094 83.713  1.00 22.83  ? 70  DC  J "O5'" 1 
ATOM 2787 C "C5'" . DC  B 2 70  ? 124.330 110.805 83.934  1.00 22.83  ? 70  DC  J "C5'" 1 
ATOM 2788 C "C4'" . DC  B 2 70  ? 125.175 111.954 83.454  1.00 22.83  ? 70  DC  J "C4'" 1 
ATOM 2789 O "O4'" . DC  B 2 70  ? 125.583 111.708 82.081  1.00 22.83  ? 70  DC  J "O4'" 1 
ATOM 2790 C "C3'" . DC  B 2 70  ? 124.471 113.308 83.449  1.00 22.83  ? 70  DC  J "C3'" 1 
ATOM 2791 O "O3'" . DC  B 2 70  ? 125.378 114.292 83.842  1.00 22.83  ? 70  DC  J "O3'" 1 
ATOM 2792 C "C2'" . DC  B 2 70  ? 124.107 113.472 81.979  1.00 22.83  ? 70  DC  J "C2'" 1 
ATOM 2793 C "C1'" . DC  B 2 70  ? 125.341 112.872 81.344  1.00 22.83  ? 70  DC  J "C1'" 1 
ATOM 2794 N N1    . DC  B 2 70  ? 125.182 112.520 79.911  1.00 22.83  ? 70  DC  J N1    1 
ATOM 2795 C C2    . DC  B 2 70  ? 126.314 112.280 79.145  1.00 22.83  ? 70  DC  J C2    1 
ATOM 2796 O O2    . DC  B 2 70  ? 127.419 112.382 79.677  1.00 22.83  ? 70  DC  J O2    1 
ATOM 2797 N N3    . DC  B 2 70  ? 126.171 111.966 77.840  1.00 22.83  ? 70  DC  J N3    1 
ATOM 2798 C C4    . DC  B 2 70  ? 124.955 111.871 77.308  1.00 22.83  ? 70  DC  J C4    1 
ATOM 2799 N N4    . DC  B 2 70  ? 124.861 111.551 76.013  1.00 22.83  ? 70  DC  J N4    1 
ATOM 2800 C C5    . DC  B 2 70  ? 123.781 112.100 78.080  1.00 22.83  ? 70  DC  J C5    1 
ATOM 2801 C C6    . DC  B 2 70  ? 123.941 112.420 79.366  1.00 22.83  ? 70  DC  J C6    1 
ATOM 2802 P P     . DG  B 2 71  ? 125.448 114.768 85.370  1.00 21.55  ? 71  DG  J P     1 
ATOM 2803 O OP1   . DG  B 2 71  ? 124.788 113.743 86.198  1.00 21.55  ? 71  DG  J OP1   1 
ATOM 2804 O OP2   . DG  B 2 71  ? 124.983 116.166 85.430  1.00 21.55  ? 71  DG  J OP2   1 
ATOM 2805 O "O5'" . DG  B 2 71  ? 127.008 114.749 85.682  1.00 21.55  ? 71  DG  J "O5'" 1 
ATOM 2806 C "C5'" . DG  B 2 71  ? 127.691 115.961 85.829  1.00 21.55  ? 71  DG  J "C5'" 1 
ATOM 2807 C "C4'" . DG  B 2 71  ? 128.846 116.044 84.853  1.00 21.55  ? 71  DG  J "C4'" 1 
ATOM 2808 O "O4'" . DG  B 2 71  ? 128.459 115.508 83.569  1.00 21.55  ? 71  DG  J "O4'" 1 
ATOM 2809 C "C3'" . DG  B 2 71  ? 129.358 117.451 84.583  1.00 21.55  ? 71  DG  J "C3'" 1 
ATOM 2810 O "O3'" . DG  B 2 71  ? 130.757 117.457 84.711  1.00 21.55  ? 71  DG  J "O3'" 1 
ATOM 2811 C "C2'" . DG  B 2 71  ? 128.899 117.752 83.148  1.00 21.55  ? 71  DG  J "C2'" 1 
ATOM 2812 C "C1'" . DG  B 2 71  ? 128.906 116.369 82.545  1.00 21.55  ? 71  DG  J "C1'" 1 
ATOM 2813 N N9    . DG  B 2 71  ? 128.032 116.172 81.396  1.00 21.55  ? 71  DG  J N9    1 
ATOM 2814 C C8    . DG  B 2 71  ? 126.665 116.097 81.404  1.00 21.55  ? 71  DG  J C8    1 
ATOM 2815 N N7    . DG  B 2 71  ? 126.152 115.858 80.231  1.00 21.55  ? 71  DG  J N7    1 
ATOM 2816 C C5    . DG  B 2 71  ? 127.252 115.755 79.395  1.00 21.55  ? 71  DG  J C5    1 
ATOM 2817 C C6    . DG  B 2 71  ? 127.318 115.506 78.009  1.00 21.55  ? 71  DG  J C6    1 
ATOM 2818 O O6    . DG  B 2 71  ? 126.385 115.320 77.218  1.00 21.55  ? 71  DG  J O6    1 
ATOM 2819 N N1    . DG  B 2 71  ? 128.629 115.483 77.553  1.00 21.55  ? 71  DG  J N1    1 
ATOM 2820 C C2    . DG  B 2 71  ? 129.736 115.676 78.340  1.00 21.55  ? 71  DG  J C2    1 
ATOM 2821 N N2    . DG  B 2 71  ? 130.922 115.616 77.721  1.00 21.55  ? 71  DG  J N2    1 
ATOM 2822 N N3    . DG  B 2 71  ? 129.687 115.909 79.641  1.00 21.55  ? 71  DG  J N3    1 
ATOM 2823 C C4    . DG  B 2 71  ? 128.417 115.935 80.099  1.00 21.55  ? 71  DG  J C4    1 
ATOM 2824 P P     . DC  B 2 72  ? 131.512 118.820 85.063  1.00 23.23  ? 72  DC  J P     1 
ATOM 2825 O OP1   . DC  B 2 72  ? 132.807 118.470 85.682  1.00 23.23  ? 72  DC  J OP1   1 
ATOM 2826 O OP2   . DC  B 2 72  ? 130.563 119.693 85.784  1.00 23.23  ? 72  DC  J OP2   1 
ATOM 2827 O "O5'" . DC  B 2 72  ? 131.774 119.449 83.623  1.00 23.23  ? 72  DC  J "O5'" 1 
ATOM 2828 C "C5'" . DC  B 2 72  ? 132.561 118.733 82.673  1.00 23.23  ? 72  DC  J "C5'" 1 
ATOM 2829 C "C4'" . DC  B 2 72  ? 132.562 119.458 81.346  1.00 23.23  ? 72  DC  J "C4'" 1 
ATOM 2830 O "O4'" . DC  B 2 72  ? 131.435 119.037 80.528  1.00 23.23  ? 72  DC  J "O4'" 1 
ATOM 2831 C "C3'" . DC  B 2 72  ? 132.483 120.977 81.446  1.00 23.23  ? 72  DC  J "C3'" 1 
ATOM 2832 O "O3'" . DC  B 2 72  ? 133.407 121.527 80.532  1.00 23.23  ? 72  DC  J "O3'" 1 
ATOM 2833 C "C2'" . DC  B 2 72  ? 131.030 121.260 81.036  1.00 23.23  ? 72  DC  J "C2'" 1 
ATOM 2834 C "C1'" . DC  B 2 72  ? 130.841 120.187 79.987  1.00 23.23  ? 72  DC  J "C1'" 1 
ATOM 2835 N N1    . DC  B 2 72  ? 129.427 119.869 79.631  1.00 23.23  ? 72  DC  J N1    1 
ATOM 2836 C C2    . DC  B 2 72  ? 129.145 119.267 78.401  1.00 23.23  ? 72  DC  J C2    1 
ATOM 2837 O O2    . DC  B 2 72  ? 130.049 119.156 77.567  1.00 23.23  ? 72  DC  J O2    1 
ATOM 2838 N N3    . DC  B 2 72  ? 127.860 118.954 78.103  1.00 23.23  ? 72  DC  J N3    1 
ATOM 2839 C C4    . DC  B 2 72  ? 126.907 119.121 79.017  1.00 23.23  ? 72  DC  J C4    1 
ATOM 2840 N N4    . DC  B 2 72  ? 125.659 118.769 78.692  1.00 23.23  ? 72  DC  J N4    1 
ATOM 2841 C C5    . DC  B 2 72  ? 127.189 119.654 80.307  1.00 23.23  ? 72  DC  J C5    1 
ATOM 2842 C C6    . DC  B 2 72  ? 128.454 119.990 80.575  1.00 23.23  ? 72  DC  J C6    1 
ATOM 2843 P P     . DG  B 2 73  ? 133.960 123.019 80.722  1.00 24.28  ? 73  DG  J P     1 
ATOM 2844 O OP1   . DG  B 2 73  ? 135.313 122.921 81.310  1.00 24.28  ? 73  DG  J OP1   1 
ATOM 2845 O OP2   . DG  B 2 73  ? 132.925 123.822 81.406  1.00 24.28  ? 73  DG  J OP2   1 
ATOM 2846 O "O5'" . DG  B 2 73  ? 134.083 123.550 79.226  1.00 24.28  ? 73  DG  J "O5'" 1 
ATOM 2847 C "C5'" . DG  B 2 73  ? 134.638 122.702 78.216  1.00 24.28  ? 73  DG  J "C5'" 1 
ATOM 2848 C "C4'" . DG  B 2 73  ? 133.968 122.954 76.885  1.00 24.28  ? 73  DG  J "C4'" 1 
ATOM 2849 O "O4'" . DG  B 2 73  ? 132.644 122.383 76.896  1.00 24.28  ? 73  DG  J "O4'" 1 
ATOM 2850 C "C3'" . DG  B 2 73  ? 133.811 124.429 76.524  1.00 24.28  ? 73  DG  J "C3'" 1 
ATOM 2851 O "O3'" . DG  B 2 73  ? 134.394 124.667 75.242  1.00 24.28  ? 73  DG  J "O3'" 1 
ATOM 2852 C "C2'" . DG  B 2 73  ? 132.284 124.642 76.543  1.00 24.28  ? 73  DG  J "C2'" 1 
ATOM 2853 C "C1'" . DG  B 2 73  ? 131.779 123.245 76.220  1.00 24.28  ? 73  DG  J "C1'" 1 
ATOM 2854 N N9    . DG  B 2 73  ? 130.435 122.950 76.716  1.00 24.28  ? 73  DG  J N9    1 
ATOM 2855 C C8    . DG  B 2 73  ? 129.976 123.143 77.993  1.00 24.28  ? 73  DG  J C8    1 
ATOM 2856 N N7    . DG  B 2 73  ? 128.731 122.803 78.156  1.00 24.28  ? 73  DG  J N7    1 
ATOM 2857 C C5    . DG  B 2 73  ? 128.315 122.424 76.892  1.00 24.28  ? 73  DG  J C5    1 
ATOM 2858 C C6    . DG  B 2 73  ? 127.051 121.982 76.454  1.00 24.28  ? 73  DG  J C6    1 
ATOM 2859 O O6    . DG  B 2 73  ? 126.023 121.834 77.122  1.00 24.28  ? 73  DG  J O6    1 
ATOM 2860 N N1    . DG  B 2 73  ? 127.045 121.698 75.095  1.00 24.28  ? 73  DG  J N1    1 
ATOM 2861 C C2    . DG  B 2 73  ? 128.127 121.829 74.261  1.00 24.28  ? 73  DG  J C2    1 
ATOM 2862 N N2    . DG  B 2 73  ? 127.930 121.505 72.976  1.00 24.28  ? 73  DG  J N2    1 
ATOM 2863 N N3    . DG  B 2 73  ? 129.326 122.242 74.661  1.00 24.28  ? 73  DG  J N3    1 
ATOM 2864 C C4    . DG  B 2 73  ? 129.345 122.521 75.987  1.00 24.28  ? 73  DG  J C4    1 
ATOM 2865 P P     . DC  B 2 74  ? 134.672 126.168 74.747  1.00 25.29  ? 74  DC  J P     1 
ATOM 2866 O OP1   . DC  B 2 74  ? 135.893 126.143 73.913  1.00 25.29  ? 74  DC  J OP1   1 
ATOM 2867 O OP2   . DC  B 2 74  ? 134.601 127.047 75.933  1.00 25.29  ? 74  DC  J OP2   1 
ATOM 2868 O "O5'" . DC  B 2 74  ? 133.424 126.507 73.820  1.00 25.29  ? 74  DC  J "O5'" 1 
ATOM 2869 C "C5'" . DC  B 2 74  ? 133.255 125.820 72.589  1.00 25.29  ? 74  DC  J "C5'" 1 
ATOM 2870 C "C4'" . DC  B 2 74  ? 131.894 126.124 72.016  1.00 25.29  ? 74  DC  J "C4'" 1 
ATOM 2871 O "O4'" . DC  B 2 74  ? 130.906 125.355 72.700  1.00 25.29  ? 74  DC  J "O4'" 1 
ATOM 2872 C "C3'" . DC  B 2 74  ? 131.412 127.545 72.205  1.00 25.29  ? 74  DC  J "C3'" 1 
ATOM 2873 O "O3'" . DC  B 2 74  ? 132.012 128.465 71.262  1.00 25.29  ? 74  DC  J "O3'" 1 
ATOM 2874 C "C2'" . DC  B 2 74  ? 129.903 127.405 72.050  1.00 25.29  ? 74  DC  J "C2'" 1 
ATOM 2875 C "C1'" . DC  B 2 74  ? 129.652 125.942 72.445  1.00 25.29  ? 74  DC  J "C1'" 1 
ATOM 2876 N N1    . DC  B 2 74  ? 128.850 125.795 73.672  1.00 25.29  ? 74  DC  J N1    1 
ATOM 2877 C C2    . DC  B 2 74  ? 127.547 125.326 73.585  1.00 25.29  ? 74  DC  J C2    1 
ATOM 2878 O O2    . DC  B 2 74  ? 127.074 125.091 72.471  1.00 25.29  ? 74  DC  J O2    1 
ATOM 2879 N N3    . DC  B 2 74  ? 126.828 125.180 74.719  1.00 25.29  ? 74  DC  J N3    1 
ATOM 2880 C C4    . DC  B 2 74  ? 127.382 125.454 75.897  1.00 25.29  ? 74  DC  J C4    1 
ATOM 2881 N N4    . DC  B 2 74  ? 126.638 125.286 76.991  1.00 25.29  ? 74  DC  J N4    1 
ATOM 2882 C C5    . DC  B 2 74  ? 128.723 125.910 76.007  1.00 25.29  ? 74  DC  J C5    1 
ATOM 2883 C C6    . DC  B 2 74  ? 129.417 126.057 74.880  1.00 25.29  ? 74  DC  J C6    1 
ATOM 2884 P P     . DT  B 2 75  ? 131.728 128.428 69.673  1.00 26.33  ? 75  DT  J P     1 
ATOM 2885 O OP1   . DT  B 2 75  ? 131.798 127.044 69.162  1.00 26.33  ? 75  DT  J OP1   1 
ATOM 2886 O OP2   . DT  B 2 75  ? 132.620 129.448 69.087  1.00 26.33  ? 75  DT  J OP2   1 
ATOM 2887 O "O5'" . DT  B 2 75  ? 130.224 128.954 69.481  1.00 26.33  ? 75  DT  J "O5'" 1 
ATOM 2888 C "C5'" . DT  B 2 75  ? 129.385 128.339 68.493  1.00 26.33  ? 75  DT  J "C5'" 1 
ATOM 2889 C "C4'" . DT  B 2 75  ? 127.905 128.633 68.717  1.00 26.33  ? 75  DT  J "C4'" 1 
ATOM 2890 O "O4'" . DT  B 2 75  ? 127.497 128.257 70.045  1.00 26.33  ? 75  DT  J "O4'" 1 
ATOM 2891 C "C3'" . DT  B 2 75  ? 127.472 130.097 68.540  1.00 26.33  ? 75  DT  J "C3'" 1 
ATOM 2892 O "O3'" . DT  B 2 75  ? 126.556 130.203 67.461  1.00 26.33  ? 75  DT  J "O3'" 1 
ATOM 2893 C "C2'" . DT  B 2 75  ? 126.817 130.457 69.885  1.00 26.33  ? 75  DT  J "C2'" 1 
ATOM 2894 C "C1'" . DT  B 2 75  ? 126.424 129.086 70.399  1.00 26.33  ? 75  DT  J "C1'" 1 
ATOM 2895 N N1    . DT  B 2 75  ? 126.250 129.005 71.866  1.00 26.33  ? 75  DT  J N1    1 
ATOM 2896 C C2    . DT  B 2 75  ? 125.072 128.528 72.386  1.00 26.33  ? 75  DT  J C2    1 
ATOM 2897 O O2    . DT  B 2 75  ? 124.103 128.258 71.703  1.00 26.33  ? 75  DT  J O2    1 
ATOM 2898 N N3    . DT  B 2 75  ? 125.041 128.463 73.753  1.00 26.33  ? 75  DT  J N3    1 
ATOM 2899 C C4    . DT  B 2 75  ? 126.070 128.763 74.622  1.00 26.33  ? 75  DT  J C4    1 
ATOM 2900 O O4    . DT  B 2 75  ? 125.959 128.661 75.834  1.00 26.33  ? 75  DT  J O4    1 
ATOM 2901 C C5    . DT  B 2 75  ? 127.288 129.207 74.004  1.00 26.33  ? 75  DT  J C5    1 
ATOM 2902 C C7    . DT  B 2 75  ? 128.475 129.561 74.846  1.00 26.33  ? 75  DT  J C7    1 
ATOM 2903 C C6    . DT  B 2 75  ? 127.320 129.294 72.674  1.00 26.33  ? 75  DT  J C6    1 
ATOM 2904 P P     . DG  B 2 76  ? 126.113 131.649 66.927  1.00 25.75  ? 76  DG  J P     1 
ATOM 2905 O OP1   . DG  B 2 76  ? 125.930 131.560 65.462  1.00 25.75  ? 76  DG  J OP1   1 
ATOM 2906 O OP2   . DG  B 2 76  ? 127.045 132.645 67.500  1.00 25.75  ? 76  DG  J OP2   1 
ATOM 2907 O "O5'" . DG  B 2 76  ? 124.687 131.879 67.603  1.00 25.75  ? 76  DG  J "O5'" 1 
ATOM 2908 C "C5'" . DG  B 2 76  ? 123.606 131.021 67.250  1.00 25.75  ? 76  DG  J "C5'" 1 
ATOM 2909 C "C4'" . DG  B 2 76  ? 122.361 131.329 68.065  1.00 25.75  ? 76  DG  J "C4'" 1 
ATOM 2910 O "O4'" . DG  B 2 76  ? 122.582 130.970 69.453  1.00 25.75  ? 76  DG  J "O4'" 1 
ATOM 2911 C "C3'" . DG  B 2 76  ? 121.934 132.799 68.058  1.00 25.75  ? 76  DG  J "C3'" 1 
ATOM 2912 O "O3'" . DG  B 2 76  ? 120.521 132.912 67.934  1.00 25.75  ? 76  DG  J "O3'" 1 
ATOM 2913 C "C2'" . DG  B 2 76  ? 122.405 133.291 69.424  1.00 25.75  ? 76  DG  J "C2'" 1 
ATOM 2914 C "C1'" . DG  B 2 76  ? 122.202 132.045 70.272  1.00 25.75  ? 76  DG  J "C1'" 1 
ATOM 2915 N N9    . DG  B 2 76  ? 123.002 132.017 71.494  1.00 25.75  ? 76  DG  J N9    1 
ATOM 2916 C C8    . DG  B 2 76  ? 124.338 132.300 71.621  1.00 25.75  ? 76  DG  J C8    1 
ATOM 2917 N N7    . DG  B 2 76  ? 124.776 132.188 72.844  1.00 25.75  ? 76  DG  J N7    1 
ATOM 2918 C C5    . DG  B 2 76  ? 123.660 131.798 73.570  1.00 25.75  ? 76  DG  J C5    1 
ATOM 2919 C C6    . DG  B 2 76  ? 123.518 131.521 74.950  1.00 25.75  ? 76  DG  J C6    1 
ATOM 2920 O O6    . DG  B 2 76  ? 124.382 131.565 75.833  1.00 25.75  ? 76  DG  J O6    1 
ATOM 2921 N N1    . DG  B 2 76  ? 122.214 131.159 75.273  1.00 25.75  ? 76  DG  J N1    1 
ATOM 2922 C C2    . DG  B 2 76  ? 121.181 131.077 74.375  1.00 25.75  ? 76  DG  J C2    1 
ATOM 2923 N N2    . DG  B 2 76  ? 119.988 130.713 74.863  1.00 25.75  ? 76  DG  J N2    1 
ATOM 2924 N N3    . DG  B 2 76  ? 121.302 131.335 73.083  1.00 25.75  ? 76  DG  J N3    1 
ATOM 2925 C C4    . DG  B 2 76  ? 122.564 131.686 72.753  1.00 25.75  ? 76  DG  J C4    1 
ATOM 2926 P P     . DT  B 2 77  ? 119.903 133.913 66.838  1.00 27.58  ? 77  DT  J P     1 
ATOM 2927 O OP1   . DT  B 2 77  ? 119.425 133.083 65.710  1.00 27.58  ? 77  DT  J OP1   1 
ATOM 2928 O OP2   . DT  B 2 77  ? 120.903 134.973 66.592  1.00 27.58  ? 77  DT  J OP2   1 
ATOM 2929 O "O5'" . DT  B 2 77  ? 118.621 134.558 67.552  1.00 27.58  ? 77  DT  J "O5'" 1 
ATOM 2930 C "C5'" . DT  B 2 77  ? 117.463 133.768 67.810  1.00 27.58  ? 77  DT  J "C5'" 1 
ATOM 2931 C "C4'" . DT  B 2 77  ? 117.070 133.852 69.276  1.00 27.58  ? 77  DT  J "C4'" 1 
ATOM 2932 O "O4'" . DT  B 2 77  ? 118.250 133.808 70.087  1.00 27.58  ? 77  DT  J "O4'" 1 
ATOM 2933 C "C3'" . DT  B 2 77  ? 116.313 135.120 69.674  1.00 27.58  ? 77  DT  J "C3'" 1 
ATOM 2934 O "O3'" . DT  B 2 77  ? 115.013 134.778 70.103  1.00 27.58  ? 77  DT  J "O3'" 1 
ATOM 2935 C "C2'" . DT  B 2 77  ? 117.134 135.734 70.828  1.00 27.58  ? 77  DT  J "C2'" 1 
ATOM 2936 C "C1'" . DT  B 2 77  ? 118.090 134.614 71.224  1.00 27.58  ? 77  DT  J "C1'" 1 
ATOM 2937 N N1    . DT  B 2 77  ? 119.451 135.059 71.625  1.00 27.58  ? 77  DT  J N1    1 
ATOM 2938 C C2    . DT  B 2 77  ? 120.242 135.749 70.727  1.00 27.58  ? 77  DT  J C2    1 
ATOM 2939 O O2    . DT  B 2 77  ? 119.853 136.133 69.637  1.00 27.58  ? 77  DT  J O2    1 
ATOM 2940 N N3    . DT  B 2 77  ? 121.495 136.047 71.187  1.00 27.58  ? 77  DT  J N3    1 
ATOM 2941 C C4    . DT  B 2 77  ? 122.048 135.682 72.397  1.00 27.58  ? 77  DT  J C4    1 
ATOM 2942 O O4    . DT  B 2 77  ? 123.191 135.987 72.716  1.00 27.58  ? 77  DT  J O4    1 
ATOM 2943 C C5    . DT  B 2 77  ? 121.187 134.917 73.261  1.00 27.58  ? 77  DT  J C5    1 
ATOM 2944 C C7    . DT  B 2 77  ? 121.677 134.469 74.597  1.00 27.58  ? 77  DT  J C7    1 
ATOM 2945 C C6    . DT  B 2 77  ? 119.955 134.630 72.832  1.00 27.58  ? 77  DT  J C6    1 
ATOM 2946 P P     . DC  B 2 78  ? 113.911 135.922 70.322  1.00 26.61  ? 78  DC  J P     1 
ATOM 2947 O OP1   . DC  B 2 78  ? 112.577 135.297 70.182  1.00 26.61  ? 78  DC  J OP1   1 
ATOM 2948 O OP2   . DC  B 2 78  ? 114.280 137.084 69.484  1.00 26.61  ? 78  DC  J OP2   1 
ATOM 2949 O "O5'" . DC  B 2 78  ? 114.124 136.327 71.846  1.00 26.61  ? 78  DC  J "O5'" 1 
ATOM 2950 C "C5'" . DC  B 2 78  ? 114.182 135.327 72.841  1.00 26.61  ? 78  DC  J "C5'" 1 
ATOM 2951 C "C4'" . DC  B 2 78  ? 114.454 135.955 74.190  1.00 26.61  ? 78  DC  J "C4'" 1 
ATOM 2952 O "O4'" . DC  B 2 78  ? 115.879 136.153 74.343  1.00 26.61  ? 78  DC  J "O4'" 1 
ATOM 2953 C "C3'" . DC  B 2 78  ? 113.816 137.327 74.394  1.00 26.61  ? 78  DC  J "C3'" 1 
ATOM 2954 O "O3'" . DC  B 2 78  ? 113.155 137.370 75.634  1.00 26.61  ? 78  DC  J "O3'" 1 
ATOM 2955 C "C2'" . DC  B 2 78  ? 115.008 138.283 74.358  1.00 26.61  ? 78  DC  J "C2'" 1 
ATOM 2956 C "C1'" . DC  B 2 78  ? 116.107 137.408 74.924  1.00 26.61  ? 78  DC  J "C1'" 1 
ATOM 2957 N N1    . DC  B 2 78  ? 117.463 137.849 74.528  1.00 26.61  ? 78  DC  J N1    1 
ATOM 2958 C C2    . DC  B 2 78  ? 118.546 137.511 75.330  1.00 26.61  ? 78  DC  J C2    1 
ATOM 2959 O O2    . DC  B 2 78  ? 118.360 136.822 76.330  1.00 26.61  ? 78  DC  J O2    1 
ATOM 2960 N N3    . DC  B 2 78  ? 119.781 137.916 74.973  1.00 26.61  ? 78  DC  J N3    1 
ATOM 2961 C C4    . DC  B 2 78  ? 119.952 138.655 73.883  1.00 26.61  ? 78  DC  J C4    1 
ATOM 2962 N N4    . DC  B 2 78  ? 121.197 139.035 73.579  1.00 26.61  ? 78  DC  J N4    1 
ATOM 2963 C C5    . DC  B 2 78  ? 118.855 139.037 73.057  1.00 26.61  ? 78  DC  J C5    1 
ATOM 2964 C C6    . DC  B 2 78  ? 117.636 138.621 73.420  1.00 26.61  ? 78  DC  J C6    1 
ATOM 2965 P P     . DC  B 2 79  ? 111.765 138.157 75.766  1.00 25.97  ? 79  DC  J P     1 
ATOM 2966 O OP1   . DC  B 2 79  ? 110.705 137.154 75.998  1.00 25.97  ? 79  DC  J OP1   1 
ATOM 2967 O OP2   . DC  B 2 79  ? 111.668 139.088 74.621  1.00 25.97  ? 79  DC  J OP2   1 
ATOM 2968 O "O5'" . DC  B 2 79  ? 111.946 139.023 77.093  1.00 25.97  ? 79  DC  J "O5'" 1 
ATOM 2969 C "C5'" . DC  B 2 79  ? 111.407 138.563 78.314  1.00 25.97  ? 79  DC  J "C5'" 1 
ATOM 2970 C "C4'" . DC  B 2 79  ? 112.481 137.921 79.174  1.00 25.97  ? 79  DC  J "C4'" 1 
ATOM 2971 O "O4'" . DC  B 2 79  ? 113.767 138.000 78.513  1.00 25.97  ? 79  DC  J "O4'" 1 
ATOM 2972 C "C3'" . DC  B 2 79  ? 112.678 138.565 80.535  1.00 25.97  ? 79  DC  J "C3'" 1 
ATOM 2973 O "O3'" . DC  B 2 79  ? 113.006 137.561 81.481  1.00 25.97  ? 79  DC  J "O3'" 1 
ATOM 2974 C "C2'" . DC  B 2 79  ? 113.841 139.529 80.287  1.00 25.97  ? 79  DC  J "C2'" 1 
ATOM 2975 C "C1'" . DC  B 2 79  ? 114.681 138.722 79.320  1.00 25.97  ? 79  DC  J "C1'" 1 
ATOM 2976 N N1    . DC  B 2 79  ? 115.561 139.510 78.406  1.00 25.97  ? 79  DC  J N1    1 
ATOM 2977 C C2    . DC  B 2 79  ? 116.947 139.434 78.548  1.00 25.97  ? 79  DC  J C2    1 
ATOM 2978 O O2    . DC  B 2 79  ? 117.420 138.777 79.479  1.00 25.97  ? 79  DC  J O2    1 
ATOM 2979 N N3    . DC  B 2 79  ? 117.734 140.113 77.680  1.00 25.97  ? 79  DC  J N3    1 
ATOM 2980 C C4    . DC  B 2 79  ? 117.186 140.813 76.691  1.00 25.97  ? 79  DC  J C4    1 
ATOM 2981 N N4    . DC  B 2 79  ? 118.003 141.462 75.858  1.00 25.97  ? 79  DC  J N4    1 
ATOM 2982 C C5    . DC  B 2 79  ? 115.777 140.881 76.512  1.00 25.97  ? 79  DC  J C5    1 
ATOM 2983 C C6    . DC  B 2 79  ? 115.010 140.209 77.375  1.00 25.97  ? 79  DC  J C6    1 
ATOM 2984 P P     . DC  B 2 80  ? 112.551 137.715 83.012  1.00 23.72  ? 80  DC  J P     1 
ATOM 2985 O OP1   . DC  B 2 80  ? 112.737 136.412 83.683  1.00 23.72  ? 80  DC  J OP1   1 
ATOM 2986 O OP2   . DC  B 2 80  ? 111.231 138.378 83.027  1.00 23.72  ? 80  DC  J OP2   1 
ATOM 2987 O "O5'" . DC  B 2 80  ? 113.609 138.747 83.593  1.00 23.72  ? 80  DC  J "O5'" 1 
ATOM 2988 C "C5'" . DC  B 2 80  ? 114.980 138.409 83.614  1.00 23.72  ? 80  DC  J "C5'" 1 
ATOM 2989 C "C4'" . DC  B 2 80  ? 115.803 139.625 83.958  1.00 23.72  ? 80  DC  J "C4'" 1 
ATOM 2990 O "O4'" . DC  B 2 80  ? 116.131 140.345 82.742  1.00 23.72  ? 80  DC  J "O4'" 1 
ATOM 2991 C "C3'" . DC  B 2 80  ? 115.110 140.635 84.870  1.00 23.72  ? 80  DC  J "C3'" 1 
ATOM 2992 O "O3'" . DC  B 2 80  ? 116.040 141.115 85.803  1.00 23.72  ? 80  DC  J "O3'" 1 
ATOM 2993 C "C2'" . DC  B 2 80  ? 114.704 141.734 83.892  1.00 23.72  ? 80  DC  J "C2'" 1 
ATOM 2994 C "C1'" . DC  B 2 80  ? 115.895 141.707 82.960  1.00 23.72  ? 80  DC  J "C1'" 1 
ATOM 2995 N N1    . DC  B 2 80  ? 115.672 142.374 81.650  1.00 23.72  ? 80  DC  J N1    1 
ATOM 2996 C C2    . DC  B 2 80  ? 116.768 142.659 80.849  1.00 23.72  ? 80  DC  J C2    1 
ATOM 2997 O O2    . DC  B 2 80  ? 117.887 142.339 81.241  1.00 23.72  ? 80  DC  J O2    1 
ATOM 2998 N N3    . DC  B 2 80  ? 116.579 143.271 79.664  1.00 23.72  ? 80  DC  J N3    1 
ATOM 2999 C C4    . DC  B 2 80  ? 115.353 143.602 79.273  1.00 23.72  ? 80  DC  J C4    1 
ATOM 3000 N N4    . DC  B 2 80  ? 115.222 144.209 78.086  1.00 23.72  ? 80  DC  J N4    1 
ATOM 3001 C C5    . DC  B 2 80  ? 114.210 143.326 80.079  1.00 23.72  ? 80  DC  J C5    1 
ATOM 3002 C C6    . DC  B 2 80  ? 114.415 142.720 81.255  1.00 23.72  ? 80  DC  J C6    1 
ATOM 3003 P P     . DC  B 2 81  ? 115.882 140.803 87.368  1.00 22.11  ? 81  DC  J P     1 
ATOM 3004 O OP1   . DC  B 2 81  ? 115.909 139.338 87.556  1.00 22.11  ? 81  DC  J OP1   1 
ATOM 3005 O OP2   . DC  B 2 81  ? 114.754 141.605 87.887  1.00 22.11  ? 81  DC  J OP2   1 
ATOM 3006 O "O5'" . DC  B 2 81  ? 117.224 141.401 87.974  1.00 22.11  ? 81  DC  J "O5'" 1 
ATOM 3007 C "C5'" . DC  B 2 81  ? 118.470 140.832 87.624  1.00 22.11  ? 81  DC  J "C5'" 1 
ATOM 3008 C "C4'" . DC  B 2 81  ? 119.420 141.911 87.152  1.00 22.11  ? 81  DC  J "C4'" 1 
ATOM 3009 O "O4'" . DC  B 2 81  ? 118.959 142.454 85.901  1.00 22.11  ? 81  DC  J "O4'" 1 
ATOM 3010 C "C3'" . DC  B 2 81  ? 119.567 143.086 88.104  1.00 22.11  ? 81  DC  J "C3'" 1 
ATOM 3011 O "O3'" . DC  B 2 81  ? 120.891 143.151 88.556  1.00 22.11  ? 81  DC  J "O3'" 1 
ATOM 3012 C "C2'" . DC  B 2 81  ? 119.191 144.321 87.259  1.00 22.11  ? 81  DC  J "C2'" 1 
ATOM 3013 C "C1'" . DC  B 2 81  ? 119.296 143.812 85.830  1.00 22.11  ? 81  DC  J "C1'" 1 
ATOM 3014 N N1    . DC  B 2 81  ? 118.334 144.451 84.882  1.00 22.11  ? 81  DC  J N1    1 
ATOM 3015 C C2    . DC  B 2 81  ? 118.790 145.024 83.685  1.00 22.11  ? 81  DC  J C2    1 
ATOM 3016 O O2    . DC  B 2 81  ? 120.000 145.031 83.429  1.00 22.11  ? 81  DC  J O2    1 
ATOM 3017 N N3    . DC  B 2 81  ? 117.887 145.572 82.838  1.00 22.11  ? 81  DC  J N3    1 
ATOM 3018 C C4    . DC  B 2 81  ? 116.590 145.553 83.140  1.00 22.11  ? 81  DC  J C4    1 
ATOM 3019 N N4    . DC  B 2 81  ? 115.738 146.105 82.273  1.00 22.11  ? 81  DC  J N4    1 
ATOM 3020 C C5    . DC  B 2 81  ? 116.109 144.969 84.343  1.00 22.11  ? 81  DC  J C5    1 
ATOM 3021 C C6    . DC  B 2 81  ? 117.004 144.430 85.172  1.00 22.11  ? 81  DC  J C6    1 
ATOM 3022 P P     . DC  B 2 82  ? 121.296 144.162 89.728  1.00 22.48  ? 82  DC  J P     1 
ATOM 3023 O OP1   . DC  B 2 82  ? 122.279 143.489 90.596  1.00 22.48  ? 82  DC  J OP1   1 
ATOM 3024 O OP2   . DC  B 2 82  ? 120.056 144.701 90.318  1.00 22.48  ? 82  DC  J OP2   1 
ATOM 3025 O "O5'" . DC  B 2 82  ? 122.029 145.328 88.931  1.00 22.48  ? 82  DC  J "O5'" 1 
ATOM 3026 C "C5'" . DC  B 2 82  ? 123.251 145.067 88.280  1.00 22.48  ? 82  DC  J "C5'" 1 
ATOM 3027 C "C4'" . DC  B 2 82  ? 123.621 146.218 87.375  1.00 22.48  ? 82  DC  J "C4'" 1 
ATOM 3028 O "O4'" . DC  B 2 82  ? 122.530 146.449 86.445  1.00 22.48  ? 82  DC  J "O4'" 1 
ATOM 3029 C "C3'" . DC  B 2 82  ? 123.856 147.537 88.097  1.00 22.48  ? 82  DC  J "C3'" 1 
ATOM 3030 O "O3'" . DC  B 2 82  ? 125.072 148.117 87.664  1.00 22.48  ? 82  DC  J "O3'" 1 
ATOM 3031 C "C2'" . DC  B 2 82  ? 122.638 148.381 87.719  1.00 22.48  ? 82  DC  J "C2'" 1 
ATOM 3032 C "C1'" . DC  B 2 82  ? 122.266 147.823 86.357  1.00 22.48  ? 82  DC  J "C1'" 1 
ATOM 3033 N N1    . DC  B 2 82  ? 120.812 147.974 86.062  1.00 22.48  ? 82  DC  J N1    1 
ATOM 3034 C C2    . DC  B 2 82  ? 120.374 148.433 84.810  1.00 22.48  ? 82  DC  J C2    1 
ATOM 3035 O O2    . DC  B 2 82  ? 121.196 148.745 83.946  1.00 22.48  ? 82  DC  J O2    1 
ATOM 3036 N N3    . DC  B 2 82  ? 119.042 148.549 84.592  1.00 22.48  ? 82  DC  J N3    1 
ATOM 3037 C C4    . DC  B 2 82  ? 118.175 148.217 85.545  1.00 22.48  ? 82  DC  J C4    1 
ATOM 3038 N N4    . DC  B 2 82  ? 116.871 148.344 85.283  1.00 22.48  ? 82  DC  J N4    1 
ATOM 3039 C C5    . DC  B 2 82  ? 118.603 147.740 86.812  1.00 22.48  ? 82  DC  J C5    1 
ATOM 3040 C C6    . DC  B 2 82  ? 119.913 147.635 87.022  1.00 22.48  ? 82  DC  J C6    1 
ATOM 3041 P P     . DG  B 2 83  ? 125.749 149.265 88.555  1.00 26.17  ? 83  DG  J P     1 
ATOM 3042 O OP1   . DG  B 2 83  ? 127.202 148.998 88.595  1.00 26.17  ? 83  DG  J OP1   1 
ATOM 3043 O OP2   . DG  B 2 83  ? 124.983 149.348 89.817  1.00 26.17  ? 83  DG  J OP2   1 
ATOM 3044 O "O5'" . DG  B 2 83  ? 125.494 150.608 87.733  1.00 26.17  ? 83  DG  J "O5'" 1 
ATOM 3045 C "C5'" . DG  B 2 83  ? 125.947 150.707 86.384  1.00 26.17  ? 83  DG  J "C5'" 1 
ATOM 3046 C "C4'" . DG  B 2 83  ? 125.409 151.965 85.734  1.00 26.17  ? 83  DG  J "C4'" 1 
ATOM 3047 O "O4'" . DG  B 2 83  ? 124.024 151.775 85.381  1.00 26.17  ? 83  DG  J "O4'" 1 
ATOM 3048 C "C3'" . DG  B 2 83  ? 125.480 153.218 86.598  1.00 26.17  ? 83  DG  J "C3'" 1 
ATOM 3049 O "O3'" . DG  B 2 83  ? 126.025 154.290 85.819  1.00 26.17  ? 83  DG  J "O3'" 1 
ATOM 3050 C "C2'" . DG  B 2 83  ? 124.015 153.445 87.008  1.00 26.17  ? 83  DG  J "C2'" 1 
ATOM 3051 C "C1'" . DG  B 2 83  ? 123.276 152.880 85.807  1.00 26.17  ? 83  DG  J "C1'" 1 
ATOM 3052 N N9    . DG  B 2 83  ? 121.944 152.361 86.089  1.00 26.17  ? 83  DG  J N9    1 
ATOM 3053 C C8    . DG  B 2 83  ? 121.552 151.653 87.196  1.00 26.17  ? 83  DG  J C8    1 
ATOM 3054 N N7    . DG  B 2 83  ? 120.297 151.312 87.175  1.00 26.17  ? 83  DG  J N7    1 
ATOM 3055 C C5    . DG  B 2 83  ? 119.813 151.880 86.007  1.00 26.17  ? 83  DG  J C5    1 
ATOM 3056 C C6    . DG  B 2 83  ? 118.513 151.868 85.465  1.00 26.17  ? 83  DG  J C6    1 
ATOM 3057 O O6    . DG  B 2 83  ? 117.499 151.333 85.926  1.00 26.17  ? 83  DG  J O6    1 
ATOM 3058 N N1    . DG  B 2 83  ? 118.448 152.564 84.263  1.00 26.17  ? 83  DG  J N1    1 
ATOM 3059 C C2    . DG  B 2 83  ? 119.509 153.195 83.663  1.00 26.17  ? 83  DG  J C2    1 
ATOM 3060 N N2    . DG  B 2 83  ? 119.257 153.819 82.503  1.00 26.17  ? 83  DG  J N2    1 
ATOM 3061 N N3    . DG  B 2 83  ? 120.735 153.213 84.163  1.00 26.17  ? 83  DG  J N3    1 
ATOM 3062 C C4    . DG  B 2 83  ? 120.812 152.537 85.332  1.00 26.17  ? 83  DG  J C4    1 
ATOM 3063 P P     . DC  B 2 84  ? 126.452 155.676 86.506  1.00 28.17  ? 84  DC  J P     1 
ATOM 3064 O OP1   . DC  B 2 84  ? 127.790 156.031 85.986  1.00 28.17  ? 84  DC  J OP1   1 
ATOM 3065 O OP2   . DC  B 2 84  ? 126.247 155.534 87.962  1.00 28.17  ? 84  DC  J OP2   1 
ATOM 3066 O "O5'" . DC  B 2 84  ? 125.381 156.731 85.964  1.00 28.17  ? 84  DC  J "O5'" 1 
ATOM 3067 C "C5'" . DC  B 2 84  ? 125.124 156.818 84.557  1.00 28.17  ? 84  DC  J "C5'" 1 
ATOM 3068 C "C4'" . DC  B 2 84  ? 123.886 157.648 84.297  1.00 28.17  ? 84  DC  J "C4'" 1 
ATOM 3069 O "O4'" . DC  B 2 84  ? 122.734 156.845 84.622  1.00 28.17  ? 84  DC  J "O4'" 1 
ATOM 3070 C "C3'" . DC  B 2 84  ? 123.772 158.928 85.132  1.00 28.17  ? 84  DC  J "C3'" 1 
ATOM 3071 O "O3'" . DC  B 2 84  ? 123.565 160.070 84.275  1.00 28.17  ? 84  DC  J "O3'" 1 
ATOM 3072 C "C2'" . DC  B 2 84  ? 122.587 158.645 86.060  1.00 28.17  ? 84  DC  J "C2'" 1 
ATOM 3073 C "C1'" . DC  B 2 84  ? 121.782 157.650 85.242  1.00 28.17  ? 84  DC  J "C1'" 1 
ATOM 3074 N N1    . DC  B 2 84  ? 120.979 156.736 86.078  1.00 28.17  ? 84  DC  J N1    1 
ATOM 3075 C C2    . DC  B 2 84  ? 119.670 156.415 85.715  1.00 28.17  ? 84  DC  J C2    1 
ATOM 3076 O O2    . DC  B 2 84  ? 119.157 156.982 84.745  1.00 28.17  ? 84  DC  J O2    1 
ATOM 3077 N N3    . DC  B 2 84  ? 118.975 155.546 86.489  1.00 28.17  ? 84  DC  J N3    1 
ATOM 3078 C C4    . DC  B 2 84  ? 119.563 154.969 87.538  1.00 28.17  ? 84  DC  J C4    1 
ATOM 3079 N N4    . DC  B 2 84  ? 118.848 154.108 88.265  1.00 28.17  ? 84  DC  J N4    1 
ATOM 3080 C C5    . DC  B 2 84  ? 120.911 155.246 87.888  1.00 28.17  ? 84  DC  J C5    1 
ATOM 3081 C C6    . DC  B 2 84  ? 121.579 156.111 87.128  1.00 28.17  ? 84  DC  J C6    1 
ATOM 3082 P P     . DG  B 2 85  ? 123.857 161.553 84.826  1.00 29.40  ? 85  DG  J P     1 
ATOM 3083 O OP1   . DG  B 2 85  ? 124.133 162.418 83.658  1.00 29.40  ? 85  DG  J OP1   1 
ATOM 3084 O OP2   . DG  B 2 85  ? 124.852 161.430 85.912  1.00 29.40  ? 85  DG  J OP2   1 
ATOM 3085 O "O5'" . DG  B 2 85  ? 122.480 162.014 85.487  1.00 29.40  ? 85  DG  J "O5'" 1 
ATOM 3086 C "C5'" . DG  B 2 85  ? 121.673 163.013 84.845  1.00 29.40  ? 85  DG  J "C5'" 1 
ATOM 3087 C "C4'" . DG  B 2 85  ? 120.245 162.532 84.718  1.00 29.40  ? 85  DG  J "C4'" 1 
ATOM 3088 O "O4'" . DG  B 2 85  ? 120.116 161.279 85.368  1.00 29.40  ? 85  DG  J "O4'" 1 
ATOM 3089 C "C3'" . DG  B 2 85  ? 119.183 163.420 85.359  1.00 29.40  ? 85  DG  J "C3'" 1 
ATOM 3090 O "O3'" . DG  B 2 85  ? 118.646 164.308 84.387  1.00 29.40  ? 85  DG  J "O3'" 1 
ATOM 3091 C "C2'" . DG  B 2 85  ? 118.125 162.424 85.883  1.00 29.40  ? 85  DG  J "C2'" 1 
ATOM 3092 C "C1'" . DG  B 2 85  ? 118.764 161.056 85.628  1.00 29.40  ? 85  DG  J "C1'" 1 
ATOM 3093 N N9    . DG  B 2 85  ? 118.693 160.105 86.725  1.00 29.40  ? 85  DG  J N9    1 
ATOM 3094 C C8    . DG  B 2 85  ? 119.739 159.683 87.505  1.00 29.40  ? 85  DG  J C8    1 
ATOM 3095 N N7    . DG  B 2 85  ? 119.411 158.770 88.366  1.00 29.40  ? 85  DG  J N7    1 
ATOM 3096 C C5    . DG  B 2 85  ? 118.071 158.540 88.114  1.00 29.40  ? 85  DG  J C5    1 
ATOM 3097 C C6    . DG  B 2 85  ? 117.180 157.649 88.735  1.00 29.40  ? 85  DG  J C6    1 
ATOM 3098 O O6    . DG  B 2 85  ? 117.408 156.863 89.660  1.00 29.40  ? 85  DG  J O6    1 
ATOM 3099 N N1    . DG  B 2 85  ? 115.909 157.726 88.182  1.00 29.40  ? 85  DG  J N1    1 
ATOM 3100 C C2    . DG  B 2 85  ? 115.547 158.562 87.157  1.00 29.40  ? 85  DG  J C2    1 
ATOM 3101 N N2    . DG  B 2 85  ? 114.271 158.494 86.755  1.00 29.40  ? 85  DG  J N2    1 
ATOM 3102 N N3    . DG  B 2 85  ? 116.378 159.405 86.562  1.00 29.40  ? 85  DG  J N3    1 
ATOM 3103 C C4    . DG  B 2 85  ? 117.618 159.339 87.092  1.00 29.40  ? 85  DG  J C4    1 
ATOM 3104 P P     . DT  B 2 86  ? 118.378 165.845 84.760  1.00 29.91  ? 86  DT  J P     1 
ATOM 3105 O OP1   . DT  B 2 86  ? 117.540 166.438 83.695  1.00 29.91  ? 86  DT  J OP1   1 
ATOM 3106 O OP2   . DT  B 2 86  ? 119.681 166.459 85.094  1.00 29.91  ? 86  DT  J OP2   1 
ATOM 3107 O "O5'" . DT  B 2 86  ? 117.534 165.742 86.110  1.00 29.91  ? 86  DT  J "O5'" 1 
ATOM 3108 C "C5'" . DT  B 2 86  ? 116.312 166.452 86.252  1.00 29.91  ? 86  DT  J "C5'" 1 
ATOM 3109 C "C4'" . DT  B 2 86  ? 115.169 165.480 86.482  1.00 29.91  ? 86  DT  J "C4'" 1 
ATOM 3110 O "O4'" . DT  B 2 86  ? 115.694 164.234 86.943  1.00 29.91  ? 86  DT  J "O4'" 1 
ATOM 3111 C "C3'" . DT  B 2 86  ? 114.154 165.928 87.528  1.00 29.91  ? 86  DT  J "C3'" 1 
ATOM 3112 O "O3'" . DT  B 2 86  ? 112.923 166.221 86.904  1.00 29.91  ? 86  DT  J "O3'" 1 
ATOM 3113 C "C2'" . DT  B 2 86  ? 114.027 164.730 88.496  1.00 29.91  ? 86  DT  J "C2'" 1 
ATOM 3114 C "C1'" . DT  B 2 86  ? 114.756 163.606 87.771  1.00 29.91  ? 86  DT  J "C1'" 1 
ATOM 3115 N N1    . DT  B 2 86  ? 115.514 162.682 88.653  1.00 29.91  ? 86  DT  J N1    1 
ATOM 3116 C C2    . DT  B 2 86  ? 114.912 161.543 89.133  1.00 29.91  ? 86  DT  J C2    1 
ATOM 3117 O O2    . DT  B 2 86  ? 113.778 161.215 88.842  1.00 29.91  ? 86  DT  J O2    1 
ATOM 3118 N N3    . DT  B 2 86  ? 115.723 160.757 89.912  1.00 29.91  ? 86  DT  J N3    1 
ATOM 3119 C C4    . DT  B 2 86  ? 117.027 161.020 90.284  1.00 29.91  ? 86  DT  J C4    1 
ATOM 3120 O O4    . DT  B 2 86  ? 117.673 160.268 90.997  1.00 29.91  ? 86  DT  J O4    1 
ATOM 3121 C C5    . DT  B 2 86  ? 117.579 162.244 89.770  1.00 29.91  ? 86  DT  J C5    1 
ATOM 3122 C C7    . DT  B 2 86  ? 118.987 162.633 90.106  1.00 29.91  ? 86  DT  J C7    1 
ATOM 3123 C C6    . DT  B 2 86  ? 116.804 163.008 88.997  1.00 29.91  ? 86  DT  J C6    1 
ATOM 3124 P P     . DT  B 2 87  ? 111.918 167.255 87.597  1.00 28.93  ? 87  DT  J P     1 
ATOM 3125 O OP1   . DT  B 2 87  ? 110.920 167.661 86.582  1.00 28.93  ? 87  DT  J OP1   1 
ATOM 3126 O OP2   . DT  B 2 87  ? 112.740 168.276 88.281  1.00 28.93  ? 87  DT  J OP2   1 
ATOM 3127 O "O5'" . DT  B 2 87  ? 111.193 166.391 88.721  1.00 28.93  ? 87  DT  J "O5'" 1 
ATOM 3128 C "C5'" . DT  B 2 87  ? 110.383 165.284 88.378  1.00 28.93  ? 87  DT  J "C5'" 1 
ATOM 3129 C "C4'" . DT  B 2 87  ? 110.111 164.445 89.611  1.00 28.93  ? 87  DT  J "C4'" 1 
ATOM 3130 O "O4'" . DT  B 2 87  ? 111.344 163.883 90.125  1.00 28.93  ? 87  DT  J "O4'" 1 
ATOM 3131 C "C3'" . DT  B 2 87  ? 109.469 165.210 90.768  1.00 28.93  ? 87  DT  J "C3'" 1 
ATOM 3132 O "O3'" . DT  B 2 87  ? 108.425 164.455 91.318  1.00 28.93  ? 87  DT  J "O3'" 1 
ATOM 3133 C "C2'" . DT  B 2 87  ? 110.621 165.353 91.766  1.00 28.93  ? 87  DT  J "C2'" 1 
ATOM 3134 C "C1'" . DT  B 2 87  ? 111.376 164.060 91.520  1.00 28.93  ? 87  DT  J "C1'" 1 
ATOM 3135 N N1    . DT  B 2 87  ? 112.798 164.081 91.955  1.00 28.93  ? 87  DT  J N1    1 
ATOM 3136 C C2    . DT  B 2 87  ? 113.367 162.926 92.429  1.00 28.93  ? 87  DT  J C2    1 
ATOM 3137 O O2    . DT  B 2 87  ? 112.755 161.885 92.545  1.00 28.93  ? 87  DT  J O2    1 
ATOM 3138 N N3    . DT  B 2 87  ? 114.679 163.038 92.789  1.00 28.93  ? 87  DT  J N3    1 
ATOM 3139 C C4    . DT  B 2 87  ? 115.471 164.164 92.707  1.00 28.93  ? 87  DT  J C4    1 
ATOM 3140 O O4    . DT  B 2 87  ? 116.646 164.164 93.053  1.00 28.93  ? 87  DT  J O4    1 
ATOM 3141 C C5    . DT  B 2 87  ? 114.818 165.341 92.188  1.00 28.93  ? 87  DT  J C5    1 
ATOM 3142 C C7    . DT  B 2 87  ? 115.577 166.628 92.054  1.00 28.93  ? 87  DT  J C7    1 
ATOM 3143 C C6    . DT  B 2 87  ? 113.528 165.243 91.839  1.00 28.93  ? 87  DT  J C6    1 
ATOM 3144 P P     . DT  B 2 88  ? 107.202 165.193 92.044  1.00 27.57  ? 88  DT  J P     1 
ATOM 3145 O OP1   . DT  B 2 88  ? 106.032 165.106 91.144  1.00 27.57  ? 88  DT  J OP1   1 
ATOM 3146 O OP2   . DT  B 2 88  ? 107.678 166.510 92.524  1.00 27.57  ? 88  DT  J OP2   1 
ATOM 3147 O "O5'" . DT  B 2 88  ? 106.930 164.271 93.310  1.00 27.57  ? 88  DT  J "O5'" 1 
ATOM 3148 C "C5'" . DT  B 2 88  ? 106.890 162.871 93.153  1.00 27.57  ? 88  DT  J "C5'" 1 
ATOM 3149 C "C4'" . DT  B 2 88  ? 107.477 162.179 94.366  1.00 27.57  ? 88  DT  J "C4'" 1 
ATOM 3150 O "O4'" . DT  B 2 88  ? 108.896 162.431 94.438  1.00 27.57  ? 88  DT  J "O4'" 1 
ATOM 3151 C "C3'" . DT  B 2 88  ? 106.894 162.641 95.696  1.00 27.57  ? 88  DT  J "C3'" 1 
ATOM 3152 O "O3'" . DT  B 2 88  ? 106.386 161.546 96.398  1.00 27.57  ? 88  DT  J "O3'" 1 
ATOM 3153 C "C2'" . DT  B 2 88  ? 108.088 163.272 96.428  1.00 27.57  ? 88  DT  J "C2'" 1 
ATOM 3154 C "C1'" . DT  B 2 88  ? 109.270 162.575 95.782  1.00 27.57  ? 88  DT  J "C1'" 1 
ATOM 3155 N N1    . DT  B 2 88  ? 110.529 163.375 95.819  1.00 27.57  ? 88  DT  J N1    1 
ATOM 3156 C C2    . DT  B 2 88  ? 111.683 162.784 96.259  1.00 27.57  ? 88  DT  J C2    1 
ATOM 3157 O O2    . DT  B 2 88  ? 111.750 161.614 96.571  1.00 27.57  ? 88  DT  J O2    1 
ATOM 3158 N N3    . DT  B 2 88  ? 112.782 163.594 96.248  1.00 27.57  ? 88  DT  J N3    1 
ATOM 3159 C C4    . DT  B 2 88  ? 112.832 164.926 95.897  1.00 27.57  ? 88  DT  J C4    1 
ATOM 3160 O O4    . DT  B 2 88  ? 113.868 165.577 95.936  1.00 27.57  ? 88  DT  J O4    1 
ATOM 3161 C C5    . DT  B 2 88  ? 111.579 165.499 95.481  1.00 27.57  ? 88  DT  J C5    1 
ATOM 3162 C C7    . DT  B 2 88  ? 111.508 166.940 95.077  1.00 27.57  ? 88  DT  J C7    1 
ATOM 3163 C C6    . DT  B 2 88  ? 110.497 164.707 95.470  1.00 27.57  ? 88  DT  J C6    1 
ATOM 3164 P P     . DT  B 2 89  ? 105.205 161.765 97.458  1.00 27.26  ? 89  DT  J P     1 
ATOM 3165 O OP1   . DT  B 2 89  ? 104.071 160.917 97.035  1.00 27.26  ? 89  DT  J OP1   1 
ATOM 3166 O OP2   . DT  B 2 89  ? 105.005 163.217 97.649  1.00 27.26  ? 89  DT  J OP2   1 
ATOM 3167 O "O5'" . DT  B 2 89  ? 105.810 161.171 98.798  1.00 27.26  ? 89  DT  J "O5'" 1 
ATOM 3168 C "C5'" . DT  B 2 89  ? 106.172 159.816 98.853  1.00 27.26  ? 89  DT  J "C5'" 1 
ATOM 3169 C "C4'" . DT  B 2 89  ? 107.343 159.621 99.790  1.00 27.26  ? 89  DT  J "C4'" 1 
ATOM 3170 O "O4'" . DT  B 2 89  ? 108.489 160.324 99.293  1.00 27.26  ? 89  DT  J "O4'" 1 
ATOM 3171 C "C3'" . DT  B 2 89  ? 107.148 160.194 101.172 1.00 27.26  ? 89  DT  J "C3'" 1 
ATOM 3172 O "O3'" . DT  B 2 89  ? 106.387 159.292 102.002 1.00 27.26  ? 89  DT  J "O3'" 1 
ATOM 3173 C "C2'" . DT  B 2 89  ? 108.578 160.454 101.665 1.00 27.26  ? 89  DT  J "C2'" 1 
ATOM 3174 C "C1'" . DT  B 2 89  ? 109.383 160.571 100.363 1.00 27.26  ? 89  DT  J "C1'" 1 
ATOM 3175 N N1    . DT  B 2 89  ? 109.991 161.919 100.129 1.00 27.26  ? 89  DT  J N1    1 
ATOM 3176 C C2    . DT  B 2 89  ? 111.353 162.060 100.177 1.00 27.26  ? 89  DT  J C2    1 
ATOM 3177 O O2    . DT  B 2 89  ? 112.107 161.140 100.417 1.00 27.26  ? 89  DT  J O2    1 
ATOM 3178 N N3    . DT  B 2 89  ? 111.809 163.325 99.919  1.00 27.26  ? 89  DT  J N3    1 
ATOM 3179 C C4    . DT  B 2 89  ? 111.054 164.440 99.627  1.00 27.26  ? 89  DT  J C4    1 
ATOM 3180 O O4    . DT  B 2 89  ? 111.557 165.537 99.413  1.00 27.26  ? 89  DT  J O4    1 
ATOM 3181 C C5    . DT  B 2 89  ? 109.630 164.226 99.591  1.00 27.26  ? 89  DT  J C5    1 
ATOM 3182 C C7    . DT  B 2 89  ? 108.705 165.366 99.286  1.00 27.26  ? 89  DT  J C7    1 
ATOM 3183 C C6    . DT  B 2 89  ? 109.173 162.990 99.839  1.00 27.26  ? 89  DT  J C6    1 
ATOM 3184 P P     . DA  B 2 90  ? 106.943 157.860 102.486 1.00 27.39  ? 90  DA  J P     1 
ATOM 3185 O OP1   . DA  B 2 90  ? 107.648 157.151 101.400 1.00 27.39  ? 90  DA  J OP1   1 
ATOM 3186 O OP2   . DA  B 2 90  ? 105.809 157.187 103.146 1.00 27.39  ? 90  DA  J OP2   1 
ATOM 3187 O "O5'" . DA  B 2 90  ? 107.992 158.200 103.624 1.00 27.39  ? 90  DA  J "O5'" 1 
ATOM 3188 C "C5'" . DA  B 2 90  ? 109.244 157.555 103.613 1.00 27.39  ? 90  DA  J "C5'" 1 
ATOM 3189 C "C4'" . DA  B 2 90  ? 110.218 158.262 104.520 1.00 27.39  ? 90  DA  J "C4'" 1 
ATOM 3190 O "O4'" . DA  B 2 90  ? 110.491 159.599 104.027 1.00 27.39  ? 90  DA  J "O4'" 1 
ATOM 3191 C "C3'" . DA  B 2 90  ? 109.740 158.426 105.959 1.00 27.39  ? 90  DA  J "C3'" 1 
ATOM 3192 O "O3'" . DA  B 2 90  ? 110.798 158.154 106.809 1.00 27.39  ? 90  DA  J "O3'" 1 
ATOM 3193 C "C2'" . DA  B 2 90  ? 109.370 159.907 106.012 1.00 27.39  ? 90  DA  J "C2'" 1 
ATOM 3194 C "C1'" . DA  B 2 90  ? 110.447 160.480 105.114 1.00 27.39  ? 90  DA  J "C1'" 1 
ATOM 3195 N N9    . DA  B 2 90  ? 110.172 161.823 104.618 1.00 27.39  ? 90  DA  J N9    1 
ATOM 3196 C C8    . DA  B 2 90  ? 108.953 162.419 104.481 1.00 27.39  ? 90  DA  J C8    1 
ATOM 3197 N N7    . DA  B 2 90  ? 109.014 163.640 104.010 1.00 27.39  ? 90  DA  J N7    1 
ATOM 3198 C C5    . DA  B 2 90  ? 110.368 163.861 103.833 1.00 27.39  ? 90  DA  J C5    1 
ATOM 3199 C C6    . DA  B 2 90  ? 111.095 164.969 103.363 1.00 27.39  ? 90  DA  J C6    1 
ATOM 3200 N N6    . DA  B 2 90  ? 110.522 166.110 102.968 1.00 27.39  ? 90  DA  J N6    1 
ATOM 3201 N N1    . DA  B 2 90  ? 112.436 164.861 103.315 1.00 27.39  ? 90  DA  J N1    1 
ATOM 3202 C C2    . DA  B 2 90  ? 113.003 163.718 103.710 1.00 27.39  ? 90  DA  J C2    1 
ATOM 3203 N N3    . DA  B 2 90  ? 112.426 162.612 104.168 1.00 27.39  ? 90  DA  J N3    1 
ATOM 3204 C C4    . DA  B 2 90  ? 111.095 162.751 104.205 1.00 27.39  ? 90  DA  J C4    1 
ATOM 3205 P P     . DA  B 2 91  ? 110.889 156.731 107.537 1.00 27.31  ? 91  DA  J P     1 
ATOM 3206 O OP1   . DA  B 2 91  ? 110.673 155.670 106.534 1.00 27.31  ? 91  DA  J OP1   1 
ATOM 3207 O OP2   . DA  B 2 91  ? 110.055 156.807 108.749 1.00 27.31  ? 91  DA  J OP2   1 
ATOM 3208 O "O5'" . DA  B 2 91  ? 112.394 156.682 108.017 1.00 27.31  ? 91  DA  J "O5'" 1 
ATOM 3209 C "C5'" . DA  B 2 91  ? 113.419 156.442 107.088 1.00 27.31  ? 91  DA  J "C5'" 1 
ATOM 3210 C "C4'" . DA  B 2 91  ? 114.568 157.378 107.360 1.00 27.31  ? 91  DA  J "C4'" 1 
ATOM 3211 O "O4'" . DA  B 2 91  ? 114.227 158.726 106.962 1.00 27.31  ? 91  DA  J "O4'" 1 
ATOM 3212 C "C3'" . DA  B 2 91  ? 115.009 157.442 108.805 1.00 27.31  ? 91  DA  J "C3'" 1 
ATOM 3213 O "O3'" . DA  B 2 91  ? 116.398 157.391 108.826 1.00 27.31  ? 91  DA  J "O3'" 1 
ATOM 3214 C "C2'" . DA  B 2 91  ? 114.472 158.805 109.279 1.00 27.31  ? 91  DA  J "C2'" 1 
ATOM 3215 C "C1'" . DA  B 2 91  ? 114.536 159.624 108.000 1.00 27.31  ? 91  DA  J "C1'" 1 
ATOM 3216 N N9    . DA  B 2 91  ? 113.564 160.713 107.898 1.00 27.31  ? 91  DA  J N9    1 
ATOM 3217 C C8    . DA  B 2 91  ? 112.228 160.638 108.157 1.00 27.31  ? 91  DA  J C8    1 
ATOM 3218 N N7    . DA  B 2 91  ? 111.586 161.761 107.963 1.00 27.31  ? 91  DA  J N7    1 
ATOM 3219 C C5    . DA  B 2 91  ? 112.571 162.648 107.577 1.00 27.31  ? 91  DA  J C5    1 
ATOM 3220 C C6    . DA  B 2 91  ? 112.533 164.013 107.241 1.00 27.31  ? 91  DA  J C6    1 
ATOM 3221 N N6    . DA  B 2 91  ? 111.410 164.737 107.243 1.00 27.31  ? 91  DA  J N6    1 
ATOM 3222 N N1    . DA  B 2 91  ? 113.691 164.607 106.902 1.00 27.31  ? 91  DA  J N1    1 
ATOM 3223 C C2    . DA  B 2 91  ? 114.813 163.878 106.903 1.00 27.31  ? 91  DA  J C2    1 
ATOM 3224 N N3    . DA  B 2 91  ? 114.973 162.586 107.200 1.00 27.31  ? 91  DA  J N3    1 
ATOM 3225 C C4    . DA  B 2 91  ? 113.800 162.024 107.533 1.00 27.31  ? 91  DA  J C4    1 
ATOM 3226 P P     . DC  B 2 92  ? 117.192 157.090 110.178 1.00 28.96  ? 92  DC  J P     1 
ATOM 3227 O OP1   . DC  B 2 92  ? 118.363 156.253 109.844 1.00 28.96  ? 92  DC  J OP1   1 
ATOM 3228 O OP2   . DC  B 2 92  ? 116.219 156.626 111.187 1.00 28.96  ? 92  DC  J OP2   1 
ATOM 3229 O "O5'" . DC  B 2 92  ? 117.693 158.539 110.587 1.00 28.96  ? 92  DC  J "O5'" 1 
ATOM 3230 C "C5'" . DC  B 2 92  ? 118.531 159.254 109.702 1.00 28.96  ? 92  DC  J "C5'" 1 
ATOM 3231 C "C4'" . DC  B 2 92  ? 118.652 160.687 110.152 1.00 28.96  ? 92  DC  J "C4'" 1 
ATOM 3232 O "O4'" . DC  B 2 92  ? 117.417 161.393 109.889 1.00 28.96  ? 92  DC  J "O4'" 1 
ATOM 3233 C "C3'" . DC  B 2 92  ? 118.934 160.859 111.634 1.00 28.96  ? 92  DC  J "C3'" 1 
ATOM 3234 O "O3'" . DC  B 2 92  ? 120.157 161.550 111.753 1.00 28.96  ? 92  DC  J "O3'" 1 
ATOM 3235 C "C2'" . DC  B 2 92  ? 117.722 161.662 112.160 1.00 28.96  ? 92  DC  J "C2'" 1 
ATOM 3236 C "C1'" . DC  B 2 92  ? 117.225 162.345 110.898 1.00 28.96  ? 92  DC  J "C1'" 1 
ATOM 3237 N N1    . DC  B 2 92  ? 115.763 162.677 110.896 1.00 28.96  ? 92  DC  J N1    1 
ATOM 3238 C C2    . DC  B 2 92  ? 115.310 163.922 110.426 1.00 28.96  ? 92  DC  J C2    1 
ATOM 3239 O O2    . DC  B 2 92  ? 116.121 164.808 110.151 1.00 28.96  ? 92  DC  J O2    1 
ATOM 3240 N N3    . DC  B 2 92  ? 113.979 164.163 110.395 1.00 28.96  ? 92  DC  J N3    1 
ATOM 3241 C C4    . DC  B 2 92  ? 113.120 163.205 110.722 1.00 28.96  ? 92  DC  J C4    1 
ATOM 3242 N N4    . DC  B 2 92  ? 111.817 163.487 110.652 1.00 28.96  ? 92  DC  J N4    1 
ATOM 3243 C C5    . DC  B 2 92  ? 113.555 161.916 111.132 1.00 28.96  ? 92  DC  J C5    1 
ATOM 3244 C C6    . DC  B 2 92  ? 114.869 161.693 111.184 1.00 28.96  ? 92  DC  J C6    1 
ATOM 3245 P P     . DC  B 2 93  ? 120.903 161.685 113.160 1.00 33.73  ? 93  DC  J P     1 
ATOM 3246 O OP1   . DC  B 2 93  ? 122.348 161.489 112.921 1.00 33.73  ? 93  DC  J OP1   1 
ATOM 3247 O OP2   . DC  B 2 93  ? 120.200 160.823 114.133 1.00 33.73  ? 93  DC  J OP2   1 
ATOM 3248 O "O5'" . DC  B 2 93  ? 120.638 163.201 113.551 1.00 33.73  ? 93  DC  J "O5'" 1 
ATOM 3249 C "C5'" . DC  B 2 93  ? 120.737 164.214 112.546 1.00 33.73  ? 93  DC  J "C5'" 1 
ATOM 3250 C "C4'" . DC  B 2 93  ? 120.185 165.508 113.084 1.00 33.73  ? 93  DC  J "C4'" 1 
ATOM 3251 O "O4'" . DC  B 2 93  ? 118.760 165.553 112.866 1.00 33.73  ? 93  DC  J "O4'" 1 
ATOM 3252 C "C3'" . DC  B 2 93  ? 120.402 165.721 114.575 1.00 33.73  ? 93  DC  J "C3'" 1 
ATOM 3253 O "O3'" . DC  B 2 93  ? 121.013 166.987 114.765 1.00 33.73  ? 93  DC  J "O3'" 1 
ATOM 3254 C "C2'" . DC  B 2 93  ? 118.994 165.628 115.175 1.00 33.73  ? 93  DC  J "C2'" 1 
ATOM 3255 C "C1'" . DC  B 2 93  ? 118.152 166.089 114.008 1.00 33.73  ? 93  DC  J "C1'" 1 
ATOM 3256 N N1    . DC  B 2 93  ? 116.773 165.584 114.012 1.00 33.73  ? 93  DC  J N1    1 
ATOM 3257 C C2    . DC  B 2 93  ? 115.748 166.386 113.524 1.00 33.73  ? 93  DC  J C2    1 
ATOM 3258 O O2    . DC  B 2 93  ? 115.982 167.578 113.299 1.00 33.73  ? 93  DC  J O2    1 
ATOM 3259 N N3    . DC  B 2 93  ? 114.494 165.881 113.477 1.00 33.73  ? 93  DC  J N3    1 
ATOM 3260 C C4    . DC  B 2 93  ? 114.281 164.599 113.766 1.00 33.73  ? 93  DC  J C4    1 
ATOM 3261 N N4    . DC  B 2 93  ? 113.034 164.133 113.672 1.00 33.73  ? 93  DC  J N4    1 
ATOM 3262 C C5    . DC  B 2 93  ? 115.338 163.737 114.162 1.00 33.73  ? 93  DC  J C5    1 
ATOM 3263 C C6    . DC  B 2 93  ? 116.560 164.260 114.238 1.00 33.73  ? 93  DC  J C6    1 
ATOM 3264 P P     . DG  B 2 94  ? 121.803 167.304 116.120 1.00 37.64  ? 94  DG  J P     1 
ATOM 3265 O OP1   . DG  B 2 94  ? 123.126 167.850 115.747 1.00 37.64  ? 94  DG  J OP1   1 
ATOM 3266 O OP2   . DG  B 2 94  ? 121.715 166.109 116.988 1.00 37.64  ? 94  DG  J OP2   1 
ATOM 3267 O "O5'" . DG  B 2 94  ? 120.927 168.460 116.777 1.00 37.64  ? 94  DG  J "O5'" 1 
ATOM 3268 C "C5'" . DG  B 2 94  ? 120.381 169.494 115.947 1.00 37.64  ? 94  DG  J "C5'" 1 
ATOM 3269 C "C4'" . DG  B 2 94  ? 119.227 170.167 116.650 1.00 37.64  ? 94  DG  J "C4'" 1 
ATOM 3270 O "O4'" . DG  B 2 94  ? 118.000 169.473 116.321 1.00 37.64  ? 94  DG  J "O4'" 1 
ATOM 3271 C "C3'" . DG  B 2 94  ? 119.333 170.181 118.177 1.00 37.64  ? 94  DG  J "C3'" 1 
ATOM 3272 O "O3'" . DG  B 2 94  ? 118.999 171.475 118.681 1.00 37.64  ? 94  DG  J "O3'" 1 
ATOM 3273 C "C2'" . DG  B 2 94  ? 118.293 169.124 118.573 1.00 37.64  ? 94  DG  J "C2'" 1 
ATOM 3274 C "C1'" . DG  B 2 94  ? 117.253 169.348 117.488 1.00 37.64  ? 94  DG  J "C1'" 1 
ATOM 3275 N N9    . DG  B 2 94  ? 116.334 168.233 117.293 1.00 37.64  ? 94  DG  J N9    1 
ATOM 3276 C C8    . DG  B 2 94  ? 116.621 166.900 117.435 1.00 37.64  ? 94  DG  J C8    1 
ATOM 3277 N N7    . DG  B 2 94  ? 115.600 166.123 117.220 1.00 37.64  ? 94  DG  J N7    1 
ATOM 3278 C C5    . DG  B 2 94  ? 114.554 166.998 116.975 1.00 37.64  ? 94  DG  J C5    1 
ATOM 3279 C C6    . DG  B 2 94  ? 113.197 166.730 116.699 1.00 37.64  ? 94  DG  J C6    1 
ATOM 3280 O O6    . DG  B 2 94  ? 112.641 165.631 116.611 1.00 37.64  ? 94  DG  J O6    1 
ATOM 3281 N N1    . DG  B 2 94  ? 112.466 167.897 116.512 1.00 37.64  ? 94  DG  J N1    1 
ATOM 3282 C C2    . DG  B 2 94  ? 112.982 169.166 116.588 1.00 37.64  ? 94  DG  J C2    1 
ATOM 3283 N N2    . DG  B 2 94  ? 112.120 170.172 116.380 1.00 37.64  ? 94  DG  J N2    1 
ATOM 3284 N N3    . DG  B 2 94  ? 114.258 169.433 116.849 1.00 37.64  ? 94  DG  J N3    1 
ATOM 3285 C C4    . DG  B 2 94  ? 114.983 168.302 117.030 1.00 37.64  ? 94  DG  J C4    1 
ATOM 3286 P P     . DC  B 2 95  ? 119.549 171.942 120.117 1.00 39.75  ? 95  DC  J P     1 
ATOM 3287 O OP1   . DC  B 2 95  ? 120.531 173.022 119.885 1.00 39.75  ? 95  DC  J OP1   1 
ATOM 3288 O OP2   . DC  B 2 95  ? 119.951 170.723 120.850 1.00 39.75  ? 95  DC  J OP2   1 
ATOM 3289 O "O5'" . DC  B 2 95  ? 118.275 172.560 120.857 1.00 39.75  ? 95  DC  J "O5'" 1 
ATOM 3290 C "C5'" . DC  B 2 95  ? 117.353 171.691 121.471 1.00 39.75  ? 95  DC  J "C5'" 1 
ATOM 3291 C "C4'" . DC  B 2 95  ? 115.936 172.064 121.101 1.00 39.75  ? 95  DC  J "C4'" 1 
ATOM 3292 O "O4'" . DC  B 2 95  ? 115.444 171.124 120.150 1.00 39.75  ? 95  DC  J "O4'" 1 
ATOM 3293 C "C3'" . DC  B 2 95  ? 114.928 172.066 122.244 1.00 39.75  ? 95  DC  J "C3'" 1 
ATOM 3294 O "O3'" . DC  B 2 95  ? 114.904 173.358 122.829 1.00 39.75  ? 95  DC  J "O3'" 1 
ATOM 3295 C "C2'" . DC  B 2 95  ? 113.609 171.713 121.565 1.00 39.75  ? 95  DC  J "C2'" 1 
ATOM 3296 C "C1'" . DC  B 2 95  ? 114.059 170.948 120.316 1.00 39.75  ? 95  DC  J "C1'" 1 
ATOM 3297 N N1    . DC  B 2 95  ? 113.815 169.492 120.287 1.00 39.75  ? 95  DC  J N1    1 
ATOM 3298 C C2    . DC  B 2 95  ? 112.536 168.997 120.052 1.00 39.75  ? 95  DC  J C2    1 
ATOM 3299 O O2    . DC  B 2 95  ? 111.587 169.782 119.984 1.00 39.75  ? 95  DC  J O2    1 
ATOM 3300 N N3    . DC  B 2 95  ? 112.365 167.659 119.961 1.00 39.75  ? 95  DC  J N3    1 
ATOM 3301 C C4    . DC  B 2 95  ? 113.409 166.841 120.046 1.00 39.75  ? 95  DC  J C4    1 
ATOM 3302 N N4    . DC  B 2 95  ? 113.184 165.530 119.942 1.00 39.75  ? 95  DC  J N4    1 
ATOM 3303 C C5    . DC  B 2 95  ? 114.728 167.330 120.242 1.00 39.75  ? 95  DC  J C5    1 
ATOM 3304 C C6    . DC  B 2 95  ? 114.884 168.649 120.337 1.00 39.75  ? 95  DC  J C6    1 
ATOM 3305 P P     . DC  B 2 96  ? 114.881 173.526 124.421 1.00 41.48  ? 96  DC  J P     1 
ATOM 3306 O OP1   . DC  B 2 96  ? 114.854 174.974 124.722 1.00 41.48  ? 96  DC  J OP1   1 
ATOM 3307 O OP2   . DC  B 2 96  ? 115.961 172.681 124.971 1.00 41.48  ? 96  DC  J OP2   1 
ATOM 3308 O "O5'" . DC  B 2 96  ? 113.485 172.860 124.838 1.00 41.48  ? 96  DC  J "O5'" 1 
ATOM 3309 C "C5'" . DC  B 2 96  ? 112.262 173.505 124.434 1.00 41.48  ? 96  DC  J "C5'" 1 
ATOM 3310 C "C4'" . DC  B 2 96  ? 111.054 172.600 124.606 1.00 41.48  ? 96  DC  J "C4'" 1 
ATOM 3311 O "O4'" . DC  B 2 96  ? 111.259 171.332 123.930 1.00 41.48  ? 96  DC  J "O4'" 1 
ATOM 3312 C "C3'" . DC  B 2 96  ? 110.706 172.255 126.057 1.00 41.48  ? 96  DC  J "C3'" 1 
ATOM 3313 O "O3'" . DC  B 2 96  ? 109.286 172.200 126.210 1.00 41.48  ? 96  DC  J "O3'" 1 
ATOM 3314 C "C2'" . DC  B 2 96  ? 111.304 170.858 126.197 1.00 41.48  ? 96  DC  J "C2'" 1 
ATOM 3315 C "C1'" . DC  B 2 96  ? 110.935 170.308 124.835 1.00 41.48  ? 96  DC  J "C1'" 1 
ATOM 3316 N N1    . DC  B 2 96  ? 111.610 169.051 124.433 1.00 41.48  ? 96  DC  J N1    1 
ATOM 3317 C C2    . DC  B 2 96  ? 110.840 168.025 123.890 1.00 41.48  ? 96  DC  J C2    1 
ATOM 3318 O O2    . DC  B 2 96  ? 109.618 168.194 123.803 1.00 41.48  ? 96  DC  J O2    1 
ATOM 3319 N N3    . DC  B 2 96  ? 111.446 166.879 123.510 1.00 41.48  ? 96  DC  J N3    1 
ATOM 3320 C C4    . DC  B 2 96  ? 112.767 166.756 123.634 1.00 41.48  ? 96  DC  J C4    1 
ATOM 3321 N N4    . DC  B 2 96  ? 113.327 165.611 123.239 1.00 41.48  ? 96  DC  J N4    1 
ATOM 3322 C C5    . DC  B 2 96  ? 113.575 167.805 124.166 1.00 41.48  ? 96  DC  J C5    1 
ATOM 3323 C C6    . DC  B 2 96  ? 112.960 168.929 124.542 1.00 41.48  ? 96  DC  J C6    1 
ATOM 3324 P P     . DA  B 2 97  ? 108.544 173.094 127.319 1.00 41.05  ? 97  DA  J P     1 
ATOM 3325 O OP1   . DA  B 2 97  ? 107.148 173.283 126.869 1.00 41.05  ? 97  DA  J OP1   1 
ATOM 3326 O OP2   . DA  B 2 97  ? 109.389 174.281 127.568 1.00 41.05  ? 97  DA  J OP2   1 
ATOM 3327 O "O5'" . DA  B 2 97  ? 108.554 172.181 128.635 1.00 41.05  ? 97  DA  J "O5'" 1 
ATOM 3328 C "C5'" . DA  B 2 97  ? 108.562 170.754 128.546 1.00 41.05  ? 97  DA  J "C5'" 1 
ATOM 3329 C "C4'" . DA  B 2 97  ? 107.232 170.215 128.052 1.00 41.05  ? 97  DA  J "C4'" 1 
ATOM 3330 O "O4'" . DA  B 2 97  ? 107.456 169.239 127.011 1.00 41.05  ? 97  DA  J "O4'" 1 
ATOM 3331 C "C3'" . DA  B 2 97  ? 106.424 169.480 129.105 1.00 41.05  ? 97  DA  J "C3'" 1 
ATOM 3332 O "O3'" . DA  B 2 97  ? 105.039 169.533 128.805 1.00 41.05  ? 97  DA  J "O3'" 1 
ATOM 3333 C "C2'" . DA  B 2 97  ? 106.955 168.056 129.010 1.00 41.05  ? 97  DA  J "C2'" 1 
ATOM 3334 C "C1'" . DA  B 2 97  ? 107.278 167.927 127.525 1.00 41.05  ? 97  DA  J "C1'" 1 
ATOM 3335 N N9    . DA  B 2 97  ? 108.478 167.152 127.246 1.00 41.05  ? 97  DA  J N9    1 
ATOM 3336 C C8    . DA  B 2 97  ? 109.773 167.536 127.444 1.00 41.05  ? 97  DA  J C8    1 
ATOM 3337 N N7    . DA  B 2 97  ? 110.652 166.637 127.074 1.00 41.05  ? 97  DA  J N7    1 
ATOM 3338 C C5    . DA  B 2 97  ? 109.878 165.599 126.586 1.00 41.05  ? 97  DA  J C5    1 
ATOM 3339 C C6    . DA  B 2 97  ? 110.209 164.346 126.037 1.00 41.05  ? 97  DA  J C6    1 
ATOM 3340 N N6    . DA  B 2 97  ? 111.466 163.921 125.886 1.00 41.05  ? 97  DA  J N6    1 
ATOM 3341 N N1    . DA  B 2 97  ? 109.195 163.545 125.647 1.00 41.05  ? 97  DA  J N1    1 
ATOM 3342 C C2    . DA  B 2 97  ? 107.940 163.979 125.803 1.00 41.05  ? 97  DA  J C2    1 
ATOM 3343 N N3    . DA  B 2 97  ? 107.509 165.135 126.303 1.00 41.05  ? 97  DA  J N3    1 
ATOM 3344 C C4    . DA  B 2 97  ? 108.538 165.904 126.680 1.00 41.05  ? 97  DA  J C4    1 
ATOM 3345 P P     . DA  B 2 98  ? 103.982 169.466 130.008 1.00 42.01  ? 98  DA  J P     1 
ATOM 3346 O OP1   . DA  B 2 98  ? 102.694 169.994 129.506 1.00 42.01  ? 98  DA  J OP1   1 
ATOM 3347 O OP2   . DA  B 2 98  ? 104.616 170.072 131.199 1.00 42.01  ? 98  DA  J OP2   1 
ATOM 3348 O "O5'" . DA  B 2 98  ? 103.816 167.899 130.275 1.00 42.01  ? 98  DA  J "O5'" 1 
ATOM 3349 C "C5'" . DA  B 2 98  ? 103.351 167.038 129.241 1.00 42.01  ? 98  DA  J "C5'" 1 
ATOM 3350 C "C4'" . DA  B 2 98  ? 103.471 165.581 129.661 1.00 42.01  ? 98  DA  J "C4'" 1 
ATOM 3351 O "O4'" . DA  B 2 98  ? 104.763 165.036 129.323 1.00 42.01  ? 98  DA  J "O4'" 1 
ATOM 3352 C "C3'" . DA  B 2 98  ? 103.265 165.323 131.153 1.00 42.01  ? 98  DA  J "C3'" 1 
ATOM 3353 O "O3'" . DA  B 2 98  ? 102.447 164.201 131.319 1.00 42.01  ? 98  DA  J "O3'" 1 
ATOM 3354 C "C2'" . DA  B 2 98  ? 104.684 165.021 131.647 1.00 42.01  ? 98  DA  J "C2'" 1 
ATOM 3355 C "C1'" . DA  B 2 98  ? 105.259 164.323 130.429 1.00 42.01  ? 98  DA  J "C1'" 1 
ATOM 3356 N N9    . DA  B 2 98  ? 106.710 164.297 130.343 1.00 42.01  ? 98  DA  J N9    1 
ATOM 3357 C C8    . DA  B 2 98  ? 107.598 165.176 130.892 1.00 42.01  ? 98  DA  J C8    1 
ATOM 3358 N N7    . DA  B 2 98  ? 108.851 164.893 130.619 1.00 42.01  ? 98  DA  J N7    1 
ATOM 3359 C C5    . DA  B 2 98  ? 108.769 163.755 129.835 1.00 42.01  ? 98  DA  J C5    1 
ATOM 3360 C C6    . DA  B 2 98  ? 109.745 162.953 129.220 1.00 42.01  ? 98  DA  J C6    1 
ATOM 3361 N N6    . DA  B 2 98  ? 111.055 163.194 129.309 1.00 42.01  ? 98  DA  J N6    1 
ATOM 3362 N N1    . DA  B 2 98  ? 109.321 161.886 128.506 1.00 42.01  ? 98  DA  J N1    1 
ATOM 3363 C C2    . DA  B 2 98  ? 108.012 161.652 128.420 1.00 42.01  ? 98  DA  J C2    1 
ATOM 3364 N N3    . DA  B 2 98  ? 107.005 162.334 128.954 1.00 42.01  ? 98  DA  J N3    1 
ATOM 3365 C C4    . DA  B 2 98  ? 107.458 163.382 129.654 1.00 42.01  ? 98  DA  J C4    1 
ATOM 3366 P P     . DG  B 2 99  ? 101.471 164.075 132.583 1.00 43.22  ? 99  DG  J P     1 
ATOM 3367 O OP1   . DG  B 2 99  ? 100.148 164.597 132.176 1.00 43.22  ? 99  DG  J OP1   1 
ATOM 3368 O OP2   . DG  B 2 99  ? 102.168 164.650 133.754 1.00 43.22  ? 99  DG  J OP2   1 
ATOM 3369 O "O5'" . DG  B 2 99  ? 101.369 162.495 132.785 1.00 43.22  ? 99  DG  J "O5'" 1 
ATOM 3370 C "C5'" . DG  B 2 99  ? 101.289 161.645 131.656 1.00 43.22  ? 99  DG  J "C5'" 1 
ATOM 3371 C "C4'" . DG  B 2 99  ? 102.363 160.570 131.733 1.00 43.22  ? 99  DG  J "C4'" 1 
ATOM 3372 O "O4'" . DG  B 2 99  ? 103.676 161.175 131.760 1.00 43.22  ? 99  DG  J "O4'" 1 
ATOM 3373 C "C3'" . DG  B 2 99  ? 102.281 159.665 132.966 1.00 43.22  ? 99  DG  J "C3'" 1 
ATOM 3374 O "O3'" . DG  B 2 99  ? 102.226 158.317 132.563 1.00 43.22  ? 99  DG  J "O3'" 1 
ATOM 3375 C "C2'" . DG  B 2 99  ? 103.589 159.949 133.718 1.00 43.22  ? 99  DG  J "C2'" 1 
ATOM 3376 C "C1'" . DG  B 2 99  ? 104.498 160.401 132.591 1.00 43.22  ? 99  DG  J "C1'" 1 
ATOM 3377 N N9    . DG  B 2 99  ? 105.636 161.205 133.024 1.00 43.22  ? 99  DG  J N9    1 
ATOM 3378 C C8    . DG  B 2 99  ? 105.620 162.285 133.869 1.00 43.22  ? 99  DG  J C8    1 
ATOM 3379 N N7    . DG  B 2 99  ? 106.799 162.809 134.064 1.00 43.22  ? 99  DG  J N7    1 
ATOM 3380 C C5    . DG  B 2 99  ? 107.646 162.037 133.280 1.00 43.22  ? 99  DG  J C5    1 
ATOM 3381 C C6    . DG  B 2 99  ? 109.044 162.132 133.080 1.00 43.22  ? 99  DG  J C6    1 
ATOM 3382 O O6    . DG  B 2 99  ? 109.836 162.946 133.574 1.00 43.22  ? 99  DG  J O6    1 
ATOM 3383 N N1    . DG  B 2 99  ? 109.509 161.151 132.205 1.00 43.22  ? 99  DG  J N1    1 
ATOM 3384 C C2    . DG  B 2 99  ? 108.719 160.198 131.606 1.00 43.22  ? 99  DG  J C2    1 
ATOM 3385 N N2    . DG  B 2 99  ? 109.333 159.333 130.780 1.00 43.22  ? 99  DG  J N2    1 
ATOM 3386 N N3    . DG  B 2 99  ? 107.409 160.105 131.785 1.00 43.22  ? 99  DG  J N3    1 
ATOM 3387 C C4    . DG  B 2 99  ? 106.944 161.051 132.632 1.00 43.22  ? 99  DG  J C4    1 
ATOM 3388 P P     . DG  B 2 100 ? 101.336 157.262 133.379 1.00 42.85  ? 100 DG  J P     1 
ATOM 3389 O OP1   . DG  B 2 100 ? 99.969  157.306 132.816 1.00 42.85  ? 100 DG  J OP1   1 
ATOM 3390 O OP2   . DG  B 2 100 ? 101.547 157.507 134.823 1.00 42.85  ? 100 DG  J OP2   1 
ATOM 3391 O "O5'" . DG  B 2 100 ? 101.997 155.859 133.016 1.00 42.85  ? 100 DG  J "O5'" 1 
ATOM 3392 C "C5'" . DG  B 2 100 ? 102.353 155.552 131.678 1.00 42.85  ? 100 DG  J "C5'" 1 
ATOM 3393 C "C4'" . DG  B 2 100 ? 103.736 154.928 131.659 1.00 42.85  ? 100 DG  J "C4'" 1 
ATOM 3394 O "O4'" . DG  B 2 100 ? 104.719 155.895 132.085 1.00 42.85  ? 100 DG  J "O4'" 1 
ATOM 3395 C "C3'" . DG  B 2 100 ? 103.912 153.717 132.564 1.00 42.85  ? 100 DG  J "C3'" 1 
ATOM 3396 O "O3'" . DG  B 2 100 ? 104.558 152.699 131.830 1.00 42.85  ? 100 DG  J "O3'" 1 
ATOM 3397 C "C2'" . DG  B 2 100 ? 104.776 154.247 133.718 1.00 42.85  ? 100 DG  J "C2'" 1 
ATOM 3398 C "C1'" . DG  B 2 100 ? 105.600 155.297 133.007 1.00 42.85  ? 100 DG  J "C1'" 1 
ATOM 3399 N N9    . DG  B 2 100 ? 106.087 156.378 133.855 1.00 42.85  ? 100 DG  J N9    1 
ATOM 3400 C C8    . DG  B 2 100 ? 105.345 157.137 134.722 1.00 42.85  ? 100 DG  J C8    1 
ATOM 3401 N N7    . DG  B 2 100 ? 106.038 158.053 135.334 1.00 42.85  ? 100 DG  J N7    1 
ATOM 3402 C C5    . DG  B 2 100 ? 107.328 157.874 134.861 1.00 42.85  ? 100 DG  J C5    1 
ATOM 3403 C C6    . DG  B 2 100 ? 108.514 158.570 135.178 1.00 42.85  ? 100 DG  J C6    1 
ATOM 3404 O O6    . DG  B 2 100 ? 108.661 159.513 135.967 1.00 42.85  ? 100 DG  J O6    1 
ATOM 3405 N N1    . DG  B 2 100 ? 109.605 158.073 134.475 1.00 42.85  ? 100 DG  J N1    1 
ATOM 3406 C C2    . DG  B 2 100 ? 109.553 157.034 133.580 1.00 42.85  ? 100 DG  J C2    1 
ATOM 3407 N N2    . DG  B 2 100 ? 110.710 156.695 133.000 1.00 42.85  ? 100 DG  J N2    1 
ATOM 3408 N N3    . DG  B 2 100 ? 108.447 156.373 133.274 1.00 42.85  ? 100 DG  J N3    1 
ATOM 3409 C C4    . DG  B 2 100 ? 107.377 156.845 133.951 1.00 42.85  ? 100 DG  J C4    1 
ATOM 3410 P P     . DG  B 2 101 ? 104.512 151.177 132.325 1.00 43.77  ? 101 DG  J P     1 
ATOM 3411 O OP1   . DG  B 2 101 ? 104.252 150.327 131.144 1.00 43.77  ? 101 DG  J OP1   1 
ATOM 3412 O OP2   . DG  B 2 101 ? 103.628 151.108 133.509 1.00 43.77  ? 101 DG  J OP2   1 
ATOM 3413 O "O5'" . DG  B 2 101 ? 106.006 150.924 132.809 1.00 43.77  ? 101 DG  J "O5'" 1 
ATOM 3414 C "C5'" . DG  B 2 101 ? 107.056 151.681 132.242 1.00 43.77  ? 101 DG  J "C5'" 1 
ATOM 3415 C "C4'" . DG  B 2 101 ? 108.266 151.660 133.149 1.00 43.77  ? 101 DG  J "C4'" 1 
ATOM 3416 O "O4'" . DG  B 2 101 ? 108.335 152.878 133.927 1.00 43.77  ? 101 DG  J "O4'" 1 
ATOM 3417 C "C3'" . DG  B 2 101 ? 108.288 150.511 134.150 1.00 43.77  ? 101 DG  J "C3'" 1 
ATOM 3418 O "O3'" . DG  B 2 101 ? 109.588 150.008 134.220 1.00 43.77  ? 101 DG  J "O3'" 1 
ATOM 3419 C "C2'" . DG  B 2 101 ? 107.912 151.210 135.458 1.00 43.77  ? 101 DG  J "C2'" 1 
ATOM 3420 C "C1'" . DG  B 2 101 ? 108.608 152.540 135.260 1.00 43.77  ? 101 DG  J "C1'" 1 
ATOM 3421 N N9    . DG  B 2 101 ? 108.142 153.621 136.115 1.00 43.77  ? 101 DG  J N9    1 
ATOM 3422 C C8    . DG  B 2 101 ? 106.865 153.858 136.553 1.00 43.77  ? 101 DG  J C8    1 
ATOM 3423 N N7    . DG  B 2 101 ? 106.763 154.933 137.285 1.00 43.77  ? 101 DG  J N7    1 
ATOM 3424 C C5    . DG  B 2 101 ? 108.049 155.453 137.303 1.00 43.77  ? 101 DG  J C5    1 
ATOM 3425 C C6    . DG  B 2 101 ? 108.563 156.615 137.930 1.00 43.77  ? 101 DG  J C6    1 
ATOM 3426 O O6    . DG  B 2 101 ? 107.963 157.451 138.620 1.00 43.77  ? 101 DG  J O6    1 
ATOM 3427 N N1    . DG  B 2 101 ? 109.926 156.765 137.690 1.00 43.77  ? 101 DG  J N1    1 
ATOM 3428 C C2    . DG  B 2 101 ? 110.691 155.905 136.942 1.00 43.77  ? 101 DG  J C2    1 
ATOM 3429 N N2    . DG  B 2 101 ? 111.986 156.206 136.816 1.00 43.77  ? 101 DG  J N2    1 
ATOM 3430 N N3    . DG  B 2 101 ? 110.221 154.822 136.355 1.00 43.77  ? 101 DG  J N3    1 
ATOM 3431 C C4    . DG  B 2 101 ? 108.900 154.660 136.578 1.00 43.77  ? 101 DG  J C4    1 
ATOM 3432 P P     . DG  B 2 102 ? 109.942 148.595 133.558 1.00 43.93  ? 102 DG  J P     1 
ATOM 3433 O OP1   . DG  B 2 102 ? 109.454 148.610 132.166 1.00 43.93  ? 102 DG  J OP1   1 
ATOM 3434 O OP2   . DG  B 2 102 ? 109.504 147.535 134.487 1.00 43.93  ? 102 DG  J OP2   1 
ATOM 3435 O "O5'" . DG  B 2 102 ? 111.533 148.593 133.542 1.00 43.93  ? 102 DG  J "O5'" 1 
ATOM 3436 C "C5'" . DG  B 2 102 ? 112.248 148.459 134.760 1.00 43.93  ? 102 DG  J "C5'" 1 
ATOM 3437 C "C4'" . DG  B 2 102 ? 113.368 149.472 134.892 1.00 43.93  ? 102 DG  J "C4'" 1 
ATOM 3438 O "O4'" . DG  B 2 102 ? 112.852 150.681 135.552 1.00 43.93  ? 102 DG  J "O4'" 1 
ATOM 3439 C "C3'" . DG  B 2 102 ? 114.521 149.012 135.778 1.00 43.93  ? 102 DG  J "C3'" 1 
ATOM 3440 O "O3'" . DG  B 2 102 ? 115.740 149.462 135.217 1.00 43.93  ? 102 DG  J "O3'" 1 
ATOM 3441 C "C2'" . DG  B 2 102 ? 114.218 149.671 137.112 1.00 43.93  ? 102 DG  J "C2'" 1 
ATOM 3442 C "C1'" . DG  B 2 102 ? 113.719 151.001 136.626 1.00 43.93  ? 102 DG  J "C1'" 1 
ATOM 3443 N N9    . DG  B 2 102 ? 112.997 151.775 137.648 1.00 43.93  ? 102 DG  J N9    1 
ATOM 3444 C C8    . DG  B 2 102 ? 113.420 152.927 138.270 1.00 43.93  ? 102 DG  J C8    1 
ATOM 3445 N N7    . DG  B 2 102 ? 112.552 153.418 139.115 1.00 43.93  ? 102 DG  J N7    1 
ATOM 3446 C C5    . DG  B 2 102 ? 111.454 152.578 138.998 1.00 43.93  ? 102 DG  J C5    1 
ATOM 3447 C C6    . DG  B 2 102 ? 110.180 152.630 139.625 1.00 43.93  ? 102 DG  J C6    1 
ATOM 3448 O O6    . DG  B 2 102 ? 109.763 153.383 140.528 1.00 43.93  ? 102 DG  J O6    1 
ATOM 3449 N N1    . DG  B 2 102 ? 109.380 151.564 139.230 1.00 43.93  ? 102 DG  J N1    1 
ATOM 3450 C C2    . DG  B 2 102 ? 109.727 150.610 138.309 1.00 43.93  ? 102 DG  J C2    1 
ATOM 3451 N N2    . DG  B 2 102 ? 108.798 149.680 138.043 1.00 43.93  ? 102 DG  J N2    1 
ATOM 3452 N N3    . DG  B 2 102 ? 110.896 150.564 137.693 1.00 43.93  ? 102 DG  J N3    1 
ATOM 3453 C C4    . DG  B 2 102 ? 111.708 151.572 138.082 1.00 43.93  ? 102 DG  J C4    1 
ATOM 3454 P P     . DA  B 2 103 ? 117.099 148.680 135.548 1.00 50.24  ? 103 DA  J P     1 
ATOM 3455 O OP1   . DA  B 2 103 ? 118.157 149.233 134.676 1.00 50.24  ? 103 DA  J OP1   1 
ATOM 3456 O OP2   . DA  B 2 103 ? 116.797 147.233 135.519 1.00 50.24  ? 103 DA  J OP2   1 
ATOM 3457 O "O5'" . DA  B 2 103 ? 117.398 149.094 137.061 1.00 50.24  ? 103 DA  J "O5'" 1 
ATOM 3458 C "C5'" . DA  B 2 103 ? 117.803 150.430 137.335 1.00 50.24  ? 103 DA  J "C5'" 1 
ATOM 3459 C "C4'" . DA  B 2 103 ? 117.742 150.743 138.816 1.00 50.24  ? 103 DA  J "C4'" 1 
ATOM 3460 O "O4'" . DA  B 2 103 ? 116.412 151.152 139.192 1.00 50.24  ? 103 DA  J "O4'" 1 
ATOM 3461 C "C3'" . DA  B 2 103 ? 118.124 149.599 139.762 1.00 50.24  ? 103 DA  J "C3'" 1 
ATOM 3462 O "O3'" . DA  B 2 103 ? 119.301 149.965 140.480 1.00 50.24  ? 103 DA  J "O3'" 1 
ATOM 3463 C "C2'" . DA  B 2 103 ? 116.891 149.447 140.679 1.00 50.24  ? 103 DA  J "C2'" 1 
ATOM 3464 C "C1'" . DA  B 2 103 ? 116.233 150.806 140.534 1.00 50.24  ? 103 DA  J "C1'" 1 
ATOM 3465 N N9    . DA  B 2 103 ? 114.803 150.843 140.829 1.00 50.24  ? 103 DA  J N9    1 
ATOM 3466 C C8    . DA  B 2 103 ? 113.857 149.934 140.455 1.00 50.24  ? 103 DA  J C8    1 
ATOM 3467 N N7    . DA  B 2 103 ? 112.651 150.221 140.883 1.00 50.24  ? 103 DA  J N7    1 
ATOM 3468 C C5    . DA  B 2 103 ? 112.827 151.376 141.621 1.00 50.24  ? 103 DA  J C5    1 
ATOM 3469 C C6    . DA  B 2 103 ? 111.932 152.184 142.348 1.00 50.24  ? 103 DA  J C6    1 
ATOM 3470 N N6    . DA  B 2 103 ? 110.626 151.927 142.451 1.00 50.24  ? 103 DA  J N6    1 
ATOM 3471 N N1    . DA  B 2 103 ? 112.433 153.269 142.970 1.00 50.24  ? 103 DA  J N1    1 
ATOM 3472 C C2    . DA  B 2 103 ? 113.741 153.523 142.867 1.00 50.24  ? 103 DA  J C2    1 
ATOM 3473 N N3    . DA  B 2 103 ? 114.676 152.840 142.214 1.00 50.24  ? 103 DA  J N3    1 
ATOM 3474 C C4    . DA  B 2 103 ? 114.148 151.768 141.606 1.00 50.24  ? 103 DA  J C4    1 
ATOM 3475 P P     . DT  B 2 104 ? 119.880 149.046 141.663 1.00 55.75  ? 104 DT  J P     1 
ATOM 3476 O OP1   . DT  B 2 104 ? 121.342 149.267 141.715 1.00 55.75  ? 104 DT  J OP1   1 
ATOM 3477 O OP2   . DT  B 2 104 ? 119.353 147.675 141.493 1.00 55.75  ? 104 DT  J OP2   1 
ATOM 3478 O "O5'" . DT  B 2 104 ? 119.213 149.681 142.969 1.00 55.75  ? 104 DT  J "O5'" 1 
ATOM 3479 C "C5'" . DT  B 2 104 ? 119.341 151.083 143.192 1.00 55.75  ? 104 DT  J "C5'" 1 
ATOM 3480 C "C4'" . DT  B 2 104 ? 118.471 151.540 144.346 1.00 55.75  ? 104 DT  J "C4'" 1 
ATOM 3481 O "O4'" . DT  B 2 104 ? 117.101 151.337 144.021 1.00 55.75  ? 104 DT  J "O4'" 1 
ATOM 3482 C "C3'" . DT  B 2 104 ? 118.674 150.800 145.661 1.00 55.75  ? 104 DT  J "C3'" 1 
ATOM 3483 O "O3'" . DT  B 2 104 ? 119.520 151.569 146.501 1.00 55.75  ? 104 DT  J "O3'" 1 
ATOM 3484 C "C2'" . DT  B 2 104 ? 117.251 150.664 146.245 1.00 55.75  ? 104 DT  J "C2'" 1 
ATOM 3485 C "C1'" . DT  B 2 104 ? 116.376 151.371 145.212 1.00 55.75  ? 104 DT  J "C1'" 1 
ATOM 3486 N N1    . DT  B 2 104 ? 115.086 150.722 144.940 1.00 55.75  ? 104 DT  J N1    1 
ATOM 3487 C C2    . DT  B 2 104 ? 113.940 151.259 145.465 1.00 55.75  ? 104 DT  J C2    1 
ATOM 3488 O O2    . DT  B 2 104 ? 113.929 152.247 146.177 1.00 55.75  ? 104 DT  J O2    1 
ATOM 3489 N N3    . DT  B 2 104 ? 112.794 150.602 145.119 1.00 55.75  ? 104 DT  J N3    1 
ATOM 3490 C C4    . DT  B 2 104 ? 112.685 149.482 144.318 1.00 55.75  ? 104 DT  J C4    1 
ATOM 3491 O O4    . DT  B 2 104 ? 111.608 148.959 144.067 1.00 55.75  ? 104 DT  J O4    1 
ATOM 3492 C C5    . DT  B 2 104 ? 113.927 148.973 143.797 1.00 55.75  ? 104 DT  J C5    1 
ATOM 3493 C C7    . DT  B 2 104 ? 113.936 147.759 142.919 1.00 55.75  ? 104 DT  J C7    1 
ATOM 3494 C C6    . DT  B 2 104 ? 115.053 149.614 144.125 1.00 55.75  ? 104 DT  J C6    1 
ATOM 3495 P P     . DT  B 2 105 ? 120.146 150.923 147.827 1.00 61.03  ? 105 DT  J P     1 
ATOM 3496 O OP1   . DT  B 2 105 ? 121.382 151.677 148.132 1.00 61.03  ? 105 DT  J OP1   1 
ATOM 3497 O OP2   . DT  B 2 105 ? 120.199 149.460 147.614 1.00 61.03  ? 105 DT  J OP2   1 
ATOM 3498 O "O5'" . DT  B 2 105 ? 119.071 151.210 148.979 1.00 61.03  ? 105 DT  J "O5'" 1 
ATOM 3499 C "C5'" . DT  B 2 105 ? 118.654 152.547 149.286 1.00 61.03  ? 105 DT  J "C5'" 1 
ATOM 3500 C "C4'" . DT  B 2 105 ? 117.543 152.512 150.321 1.00 61.03  ? 105 DT  J "C4'" 1 
ATOM 3501 O "O4'" . DT  B 2 105 ? 116.317 152.064 149.693 1.00 61.03  ? 105 DT  J "O4'" 1 
ATOM 3502 C "C3'" . DT  B 2 105 ? 117.809 151.566 151.495 1.00 61.03  ? 105 DT  J "C3'" 1 
ATOM 3503 O "O3'" . DT  B 2 105 ? 117.612 152.234 152.745 1.00 61.03  ? 105 DT  J "O3'" 1 
ATOM 3504 C "C2'" . DT  B 2 105 ? 116.801 150.431 151.277 1.00 61.03  ? 105 DT  J "C2'" 1 
ATOM 3505 C "C1'" . DT  B 2 105 ? 115.678 151.142 150.535 1.00 61.03  ? 105 DT  J "C1'" 1 
ATOM 3506 N N1    . DT  B 2 105 ? 114.890 150.235 149.658 1.00 61.03  ? 105 DT  J N1    1 
ATOM 3507 C C2    . DT  B 2 105 ? 113.522 150.378 149.563 1.00 61.03  ? 105 DT  J C2    1 
ATOM 3508 O O2    . DT  B 2 105 ? 112.883 151.162 150.241 1.00 61.03  ? 105 DT  J O2    1 
ATOM 3509 N N3    . DT  B 2 105 ? 112.919 149.502 148.693 1.00 61.03  ? 105 DT  J N3    1 
ATOM 3510 C C4    . DT  B 2 105 ? 113.546 148.563 147.889 1.00 61.03  ? 105 DT  J C4    1 
ATOM 3511 O O4    . DT  B 2 105 ? 112.932 147.829 147.128 1.00 61.03  ? 105 DT  J O4    1 
ATOM 3512 C C5    . DT  B 2 105 ? 114.977 148.505 148.007 1.00 61.03  ? 105 DT  J C5    1 
ATOM 3513 C C7    . DT  B 2 105 ? 115.759 147.525 147.185 1.00 61.03  ? 105 DT  J C7    1 
ATOM 3514 C C6    . DT  B 2 105 ? 115.571 149.341 148.864 1.00 61.03  ? 105 DT  J C6    1 
ATOM 3515 P P     . DA  B 2 106 ? 117.907 151.451 154.118 1.00 63.85  ? 106 DA  J P     1 
ATOM 3516 O OP1   . DA  B 2 106 ? 118.418 152.439 155.093 1.00 63.85  ? 106 DA  J OP1   1 
ATOM 3517 O OP2   . DA  B 2 106 ? 118.725 150.263 153.791 1.00 63.85  ? 106 DA  J OP2   1 
ATOM 3518 O "O5'" . DA  B 2 106 ? 116.474 150.948 154.618 1.00 63.85  ? 106 DA  J "O5'" 1 
ATOM 3519 C "C5'" . DA  B 2 106 ? 115.466 151.902 154.935 1.00 63.85  ? 106 DA  J "C5'" 1 
ATOM 3520 C "C4'" . DA  B 2 106 ? 114.108 151.241 155.073 1.00 63.85  ? 106 DA  J "C4'" 1 
ATOM 3521 O "O4'" . DA  B 2 106 ? 113.748 150.649 153.830 1.00 63.85  ? 106 DA  J "O4'" 1 
ATOM 3522 C "C3'" . DA  B 2 106 ? 114.029 150.103 156.073 1.00 63.85  ? 106 DA  J "C3'" 1 
ATOM 3523 O "O3'" . DA  B 2 106 ? 113.728 150.637 157.367 1.00 63.85  ? 106 DA  J "O3'" 1 
ATOM 3524 C "C2'" . DA  B 2 106 ? 112.906 149.202 155.519 1.00 63.85  ? 106 DA  J "C2'" 1 
ATOM 3525 C "C1'" . DA  B 2 106 ? 112.798 149.629 154.044 1.00 63.85  ? 106 DA  J "C1'" 1 
ATOM 3526 N N9    . DA  B 2 106 ? 113.071 148.605 153.041 1.00 63.85  ? 106 DA  J N9    1 
ATOM 3527 C C8    . DA  B 2 106 ? 114.299 148.229 152.575 1.00 63.85  ? 106 DA  J C8    1 
ATOM 3528 N N7    . DA  B 2 106 ? 114.252 147.357 151.597 1.00 63.85  ? 106 DA  J N7    1 
ATOM 3529 C C5    . DA  B 2 106 ? 112.900 147.201 151.358 1.00 63.85  ? 106 DA  J C5    1 
ATOM 3530 C C6    . DA  B 2 106 ? 112.186 146.416 150.432 1.00 63.85  ? 106 DA  J C6    1 
ATOM 3531 N N6    . DA  B 2 106 ? 112.774 145.611 149.543 1.00 63.85  ? 106 DA  J N6    1 
ATOM 3532 N N1    . DA  B 2 106 ? 110.839 146.490 150.456 1.00 63.85  ? 106 DA  J N1    1 
ATOM 3533 C C2    . DA  B 2 106 ? 110.261 147.294 151.355 1.00 63.85  ? 106 DA  J C2    1 
ATOM 3534 N N3    . DA  B 2 106 ? 110.825 148.082 152.267 1.00 63.85  ? 106 DA  J N3    1 
ATOM 3535 C C4    . DA  B 2 106 ? 112.159 147.986 152.219 1.00 63.85  ? 106 DA  J C4    1 
ATOM 3536 P P     . DC  B 2 107 ? 113.830 149.701 158.665 1.00 66.85  ? 107 DC  J P     1 
ATOM 3537 O OP1   . DC  B 2 107 ? 114.268 150.554 159.794 1.00 66.85  ? 107 DC  J OP1   1 
ATOM 3538 O OP2   . DC  B 2 107 ? 114.608 148.497 158.301 1.00 66.85  ? 107 DC  J OP2   1 
ATOM 3539 O "O5'" . DC  B 2 107 ? 112.311 149.261 158.905 1.00 66.85  ? 107 DC  J "O5'" 1 
ATOM 3540 C "C5'" . DC  B 2 107 ? 111.934 147.906 158.857 1.00 66.85  ? 107 DC  J "C5'" 1 
ATOM 3541 C "C4'" . DC  B 2 107 ? 110.501 147.808 158.370 1.00 66.85  ? 107 DC  J "C4'" 1 
ATOM 3542 O "O4'" . DC  B 2 107 ? 110.484 147.571 156.949 1.00 66.85  ? 107 DC  J "O4'" 1 
ATOM 3543 C "C3'" . DC  B 2 107 ? 109.699 146.674 158.966 1.00 66.85  ? 107 DC  J "C3'" 1 
ATOM 3544 O "O3'" . DC  B 2 107 ? 108.311 146.970 158.872 1.00 66.85  ? 107 DC  J "O3'" 1 
ATOM 3545 C "C2'" . DC  B 2 107 ? 110.080 145.531 158.024 1.00 66.85  ? 107 DC  J "C2'" 1 
ATOM 3546 C "C1'" . DC  B 2 107 ? 110.047 146.254 156.679 1.00 66.85  ? 107 DC  J "C1'" 1 
ATOM 3547 N N1    . DC  B 2 107 ? 110.964 145.704 155.654 1.00 66.85  ? 107 DC  J N1    1 
ATOM 3548 C C2    . DC  B 2 107 ? 110.444 145.204 154.460 1.00 66.85  ? 107 DC  J C2    1 
ATOM 3549 O O2    . DC  B 2 107 ? 109.225 145.228 154.272 1.00 66.85  ? 107 DC  J O2    1 
ATOM 3550 N N3    . DC  B 2 107 ? 111.289 144.720 153.522 1.00 66.85  ? 107 DC  J N3    1 
ATOM 3551 C C4    . DC  B 2 107 ? 112.603 144.715 153.754 1.00 66.85  ? 107 DC  J C4    1 
ATOM 3552 N N4    . DC  B 2 107 ? 113.405 144.226 152.805 1.00 66.85  ? 107 DC  J N4    1 
ATOM 3553 C C5    . DC  B 2 107 ? 113.152 145.208 154.973 1.00 66.85  ? 107 DC  J C5    1 
ATOM 3554 C C6    . DC  B 2 107 ? 112.304 145.686 155.887 1.00 66.85  ? 107 DC  J C6    1 
ATOM 3555 P P     . DT  B 2 108 ? 107.287 146.312 159.916 1.00 68.40  ? 108 DT  J P     1 
ATOM 3556 O OP1   . DT  B 2 108 ? 106.712 147.410 160.723 1.00 68.40  ? 108 DT  J OP1   1 
ATOM 3557 O OP2   . DT  B 2 108 ? 107.971 145.186 160.587 1.00 68.40  ? 108 DT  J OP2   1 
ATOM 3558 O "O5'" . DT  B 2 108 ? 106.143 145.703 158.983 1.00 68.40  ? 108 DT  J "O5'" 1 
ATOM 3559 C "C5'" . DT  B 2 108 ? 106.479 145.255 157.678 1.00 68.40  ? 108 DT  J "C5'" 1 
ATOM 3560 C "C4'" . DT  B 2 108 ? 106.030 143.826 157.462 1.00 68.40  ? 108 DT  J "C4'" 1 
ATOM 3561 O "O4'" . DT  B 2 108 ? 106.996 143.153 156.613 1.00 68.40  ? 108 DT  J "O4'" 1 
ATOM 3562 C "C3'" . DT  B 2 108 ? 105.948 142.992 158.735 1.00 68.40  ? 108 DT  J "C3'" 1 
ATOM 3563 O "O3'" . DT  B 2 108 ? 104.976 141.968 158.610 1.00 68.40  ? 108 DT  J "O3'" 1 
ATOM 3564 C "C2'" . DT  B 2 108 ? 107.344 142.390 158.795 1.00 68.40  ? 108 DT  J "C2'" 1 
ATOM 3565 C "C1'" . DT  B 2 108 ? 107.576 142.081 157.323 1.00 68.40  ? 108 DT  J "C1'" 1 
ATOM 3566 N N1    . DT  B 2 108 ? 109.012 141.966 156.950 1.00 68.40  ? 108 DT  J N1    1 
ATOM 3567 C C2    . DT  B 2 108 ? 109.346 141.715 155.643 1.00 68.40  ? 108 DT  J C2    1 
ATOM 3568 O O2    . DT  B 2 108 ? 108.523 141.610 154.754 1.00 68.40  ? 108 DT  J O2    1 
ATOM 3569 N N3    . DT  B 2 108 ? 110.688 141.611 155.404 1.00 68.40  ? 108 DT  J N3    1 
ATOM 3570 C C4    . DT  B 2 108 ? 111.709 141.719 156.328 1.00 68.40  ? 108 DT  J C4    1 
ATOM 3571 O O4    . DT  B 2 108 ? 112.890 141.610 156.018 1.00 68.40  ? 108 DT  J O4    1 
ATOM 3572 C C5    . DT  B 2 108 ? 111.288 141.966 157.685 1.00 68.40  ? 108 DT  J C5    1 
ATOM 3573 C C7    . DT  B 2 108 ? 112.308 142.099 158.778 1.00 68.40  ? 108 DT  J C7    1 
ATOM 3574 C C6    . DT  B 2 108 ? 109.975 142.069 157.929 1.00 68.40  ? 108 DT  J C6    1 
ATOM 3575 P P     . DC  B 2 109 ? 104.254 141.388 159.922 1.00 70.39  ? 109 DC  J P     1 
ATOM 3576 O OP1   . DC  B 2 109 ? 103.131 142.294 160.247 1.00 70.39  ? 109 DC  J OP1   1 
ATOM 3577 O OP2   . DC  B 2 109 ? 105.302 141.125 160.932 1.00 70.39  ? 109 DC  J OP2   1 
ATOM 3578 O "O5'" . DC  B 2 109 ? 103.672 139.976 159.447 1.00 70.39  ? 109 DC  J "O5'" 1 
ATOM 3579 C "C5'" . DC  B 2 109 ? 102.521 139.888 158.624 1.00 70.39  ? 109 DC  J "C5'" 1 
ATOM 3580 C "C4'" . DC  B 2 109 ? 102.925 139.448 157.230 1.00 70.39  ? 109 DC  J "C4'" 1 
ATOM 3581 O "O4'" . DC  B 2 109 ? 104.337 139.684 157.044 1.00 70.39  ? 109 DC  J "O4'" 1 
ATOM 3582 C "C3'" . DC  B 2 109 ? 102.697 137.971 156.918 1.00 70.39  ? 109 DC  J "C3'" 1 
ATOM 3583 O "O3'" . DC  B 2 109 ? 102.207 137.824 155.601 1.00 70.39  ? 109 DC  J "O3'" 1 
ATOM 3584 C "C2'" . DC  B 2 109 ? 104.103 137.377 157.063 1.00 70.39  ? 109 DC  J "C2'" 1 
ATOM 3585 C "C1'" . DC  B 2 109 ? 104.963 138.523 156.552 1.00 70.39  ? 109 DC  J "C1'" 1 
ATOM 3586 N N1    . DC  B 2 109 ? 106.348 138.529 157.085 1.00 70.39  ? 109 DC  J N1    1 
ATOM 3587 C C2    . DC  B 2 109 ? 107.420 138.317 156.221 1.00 70.39  ? 109 DC  J C2    1 
ATOM 3588 O O2    . DC  B 2 109 ? 107.200 138.180 155.015 1.00 70.39  ? 109 DC  J O2    1 
ATOM 3589 N N3    . DC  B 2 109 ? 108.679 138.347 156.720 1.00 70.39  ? 109 DC  J N3    1 
ATOM 3590 C C4    . DC  B 2 109 ? 108.875 138.522 158.027 1.00 70.39  ? 109 DC  J C4    1 
ATOM 3591 N N4    . DC  B 2 109 ? 110.133 138.523 158.477 1.00 70.39  ? 109 DC  J N4    1 
ATOM 3592 C C5    . DC  B 2 109 ? 107.789 138.703 158.931 1.00 70.39  ? 109 DC  J C5    1 
ATOM 3593 C C6    . DC  B 2 109 ? 106.555 138.692 158.422 1.00 70.39  ? 109 DC  J C6    1 
ATOM 3594 P P     . DC  B 2 110 ? 101.129 136.684 155.263 1.00 70.59  ? 110 DC  J P     1 
ATOM 3595 O OP1   . DC  B 2 110 ? 100.144 137.259 154.323 1.00 70.59  ? 110 DC  J OP1   1 
ATOM 3596 O OP2   . DC  B 2 110 ? 100.673 136.098 156.543 1.00 70.59  ? 110 DC  J OP2   1 
ATOM 3597 O "O5'" . DC  B 2 110 ? 101.990 135.581 154.495 1.00 70.59  ? 110 DC  J "O5'" 1 
ATOM 3598 C "C5'" . DC  B 2 110 ? 102.710 135.928 153.327 1.00 70.59  ? 110 DC  J "C5'" 1 
ATOM 3599 C "C4'" . DC  B 2 110 ? 103.759 134.877 153.026 1.00 70.59  ? 110 DC  J "C4'" 1 
ATOM 3600 O "O4'" . DC  B 2 110 ? 104.861 135.041 153.960 1.00 70.59  ? 110 DC  J "O4'" 1 
ATOM 3601 C "C3'" . DC  B 2 110 ? 103.295 133.427 153.182 1.00 70.59  ? 110 DC  J "C3'" 1 
ATOM 3602 O "O3'" . DC  B 2 110 ? 103.770 132.635 152.097 1.00 70.59  ? 110 DC  J "O3'" 1 
ATOM 3603 C "C2'" . DC  B 2 110 ? 103.932 133.008 154.502 1.00 70.59  ? 110 DC  J "C2'" 1 
ATOM 3604 C "C1'" . DC  B 2 110 ? 105.236 133.783 154.464 1.00 70.59  ? 110 DC  J "C1'" 1 
ATOM 3605 N N1    . DC  B 2 110 ? 105.818 133.992 155.823 1.00 70.59  ? 110 DC  J N1    1 
ATOM 3606 C C2    . DC  B 2 110 ? 107.195 134.180 155.976 1.00 70.59  ? 110 DC  J C2    1 
ATOM 3607 O O2    . DC  B 2 110 ? 107.929 134.205 154.989 1.00 70.59  ? 110 DC  J O2    1 
ATOM 3608 N N3    . DC  B 2 110 ? 107.697 134.356 157.216 1.00 70.59  ? 110 DC  J N3    1 
ATOM 3609 C C4    . DC  B 2 110 ? 106.903 134.318 158.278 1.00 70.59  ? 110 DC  J C4    1 
ATOM 3610 N N4    . DC  B 2 110 ? 107.470 134.501 159.476 1.00 70.59  ? 110 DC  J N4    1 
ATOM 3611 C C5    . DC  B 2 110 ? 105.501 134.103 158.156 1.00 70.59  ? 110 DC  J C5    1 
ATOM 3612 C C6    . DC  B 2 110 ? 105.008 133.934 156.921 1.00 70.59  ? 110 DC  J C6    1 
ATOM 3613 P P     . DC  B 2 111 ? 102.980 131.305 151.656 1.00 69.28  ? 111 DC  J P     1 
ATOM 3614 O OP1   . DC  B 2 111 ? 102.264 131.606 150.398 1.00 69.28  ? 111 DC  J OP1   1 
ATOM 3615 O OP2   . DC  B 2 111 ? 102.229 130.800 152.825 1.00 69.28  ? 111 DC  J OP2   1 
ATOM 3616 O "O5'" . DC  B 2 111 ? 104.152 130.266 151.344 1.00 69.28  ? 111 DC  J "O5'" 1 
ATOM 3617 C "C5'" . DC  B 2 111 ? 105.041 130.494 150.261 1.00 69.28  ? 111 DC  J "C5'" 1 
ATOM 3618 C "C4'" . DC  B 2 111 ? 106.465 130.588 150.768 1.00 69.28  ? 111 DC  J "C4'" 1 
ATOM 3619 O "O4'" . DC  B 2 111 ? 106.477 131.254 152.023 1.00 69.28  ? 111 DC  J "O4'" 1 
ATOM 3620 C "C3'" . DC  B 2 111 ? 107.159 129.271 151.020 1.00 69.28  ? 111 DC  J "C3'" 1 
ATOM 3621 O "O3'" . DC  B 2 111 ? 107.746 128.848 149.802 1.00 69.28  ? 111 DC  J "O3'" 1 
ATOM 3622 C "C2'" . DC  B 2 111 ? 108.219 129.638 152.078 1.00 69.28  ? 111 DC  J "C2'" 1 
ATOM 3623 C "C1'" . DC  B 2 111 ? 107.603 130.862 152.779 1.00 69.28  ? 111 DC  J "C1'" 1 
ATOM 3624 N N1    . DC  B 2 111 ? 107.156 130.708 154.200 1.00 69.28  ? 111 DC  J N1    1 
ATOM 3625 C C2    . DC  B 2 111 ? 108.050 130.969 155.241 1.00 69.28  ? 111 DC  J C2    1 
ATOM 3626 O O2    . DC  B 2 111 ? 109.190 131.356 154.970 1.00 69.28  ? 111 DC  J O2    1 
ATOM 3627 N N3    . DC  B 2 111 ? 107.607 130.890 156.520 1.00 69.28  ? 111 DC  J N3    1 
ATOM 3628 C C4    . DC  B 2 111 ? 106.357 130.503 156.771 1.00 69.28  ? 111 DC  J C4    1 
ATOM 3629 N N4    . DC  B 2 111 ? 105.974 130.407 158.048 1.00 69.28  ? 111 DC  J N4    1 
ATOM 3630 C C5    . DC  B 2 111 ? 105.444 130.194 155.723 1.00 69.28  ? 111 DC  J C5    1 
ATOM 3631 C C6    . DC  B 2 111 ? 105.884 130.303 154.465 1.00 69.28  ? 111 DC  J C6    1 
ATOM 3632 P P     . DT  B 2 112 ? 107.745 127.305 149.380 1.00 64.86  ? 112 DT  J P     1 
ATOM 3633 O OP1   . DT  B 2 112 ? 107.757 127.240 147.904 1.00 64.86  ? 112 DT  J OP1   1 
ATOM 3634 O OP2   . DT  B 2 112 ? 106.691 126.605 150.146 1.00 64.86  ? 112 DT  J OP2   1 
ATOM 3635 O "O5'" . DT  B 2 112 ? 109.161 126.833 149.915 1.00 64.86  ? 112 DT  J "O5'" 1 
ATOM 3636 C "C5'" . DT  B 2 112 ? 110.347 127.367 149.355 1.00 64.86  ? 112 DT  J "C5'" 1 
ATOM 3637 C "C4'" . DT  B 2 112 ? 111.495 127.104 150.297 1.00 64.86  ? 112 DT  J "C4'" 1 
ATOM 3638 O "O4'" . DT  B 2 112 ? 111.180 127.684 151.589 1.00 64.86  ? 112 DT  J "O4'" 1 
ATOM 3639 C "C3'" . DT  B 2 112 ? 111.804 125.631 150.532 1.00 64.86  ? 112 DT  J "C3'" 1 
ATOM 3640 O "O3'" . DT  B 2 112 ? 113.205 125.397 150.510 1.00 64.86  ? 112 DT  J "O3'" 1 
ATOM 3641 C "C2'" . DT  B 2 112 ? 111.223 125.381 151.922 1.00 64.86  ? 112 DT  J "C2'" 1 
ATOM 3642 C "C1'" . DT  B 2 112 ? 111.414 126.735 152.588 1.00 64.86  ? 112 DT  J "C1'" 1 
ATOM 3643 N N1    . DT  B 2 112 ? 110.473 126.973 153.717 1.00 64.86  ? 112 DT  J N1    1 
ATOM 3644 C C2    . DT  B 2 112 ? 110.922 127.624 154.840 1.00 64.86  ? 112 DT  J C2    1 
ATOM 3645 O O2    . DT  B 2 112 ? 112.063 128.026 154.969 1.00 64.86  ? 112 DT  J O2    1 
ATOM 3646 N N3    . DT  B 2 112 ? 109.983 127.786 155.820 1.00 64.86  ? 112 DT  J N3    1 
ATOM 3647 C C4    . DT  B 2 112 ? 108.667 127.372 155.789 1.00 64.86  ? 112 DT  J C4    1 
ATOM 3648 O O4    . DT  B 2 112 ? 107.897 127.567 156.722 1.00 64.86  ? 112 DT  J O4    1 
ATOM 3649 C C5    . DT  B 2 112 ? 108.262 126.694 154.582 1.00 64.86  ? 112 DT  J C5    1 
ATOM 3650 C C7    . DT  B 2 112 ? 106.856 126.199 154.433 1.00 64.86  ? 112 DT  J C7    1 
ATOM 3651 C C6    . DT  B 2 112 ? 109.174 126.528 153.616 1.00 64.86  ? 112 DT  J C6    1 
ATOM 3652 P P     . DA  B 2 113 ? 113.739 123.884 150.546 1.00 72.74  ? 113 DA  J P     1 
ATOM 3653 O OP1   . DA  B 2 113 ? 114.746 123.772 149.473 1.00 72.74  ? 113 DA  J OP1   1 
ATOM 3654 O OP2   . DA  B 2 113 ? 112.578 122.971 150.529 1.00 72.74  ? 113 DA  J OP2   1 
ATOM 3655 O "O5'" . DA  B 2 113 ? 114.501 123.731 151.946 1.00 72.74  ? 113 DA  J "O5'" 1 
ATOM 3656 C "C5'" . DA  B 2 113 ? 115.654 124.515 152.261 1.00 72.74  ? 113 DA  J "C5'" 1 
ATOM 3657 C "C4'" . DA  B 2 113 ? 115.985 124.391 153.742 1.00 72.74  ? 113 DA  J "C4'" 1 
ATOM 3658 O "O4'" . DA  B 2 113 ? 114.883 124.877 154.547 1.00 72.74  ? 113 DA  J "O4'" 1 
ATOM 3659 C "C3'" . DA  B 2 113 ? 116.289 122.978 154.228 1.00 72.74  ? 113 DA  J "C3'" 1 
ATOM 3660 O "O3'" . DA  B 2 113 ? 117.449 123.038 155.075 1.00 72.74  ? 113 DA  J "O3'" 1 
ATOM 3661 C "C2'" . DA  B 2 113 ? 114.997 122.572 154.956 1.00 72.74  ? 113 DA  J "C2'" 1 
ATOM 3662 C "C1'" . DA  B 2 113 ? 114.565 123.909 155.519 1.00 72.74  ? 113 DA  J "C1'" 1 
ATOM 3663 N N9    . DA  B 2 113 ? 113.138 124.071 155.779 1.00 72.74  ? 113 DA  J N9    1 
ATOM 3664 C C8    . DA  B 2 113 ? 112.129 123.848 154.896 1.00 72.74  ? 113 DA  J C8    1 
ATOM 3665 N N7    . DA  B 2 113 ? 110.936 124.019 155.396 1.00 72.74  ? 113 DA  J N7    1 
ATOM 3666 C C5    . DA  B 2 113 ? 111.167 124.195 156.741 1.00 72.74  ? 113 DA  J C5    1 
ATOM 3667 C C6    . DA  B 2 113 ? 110.299 124.372 157.825 1.00 72.74  ? 113 DA  J C6    1 
ATOM 3668 N N6    . DA  B 2 113 ? 108.974 124.395 157.695 1.00 72.74  ? 113 DA  J N6    1 
ATOM 3669 N N1    . DA  B 2 113 ? 110.842 124.520 159.050 1.00 72.74  ? 113 DA  J N1    1 
ATOM 3670 C C2    . DA  B 2 113 ? 112.178 124.494 159.170 1.00 72.74  ? 113 DA  J C2    1 
ATOM 3671 N N3    . DA  B 2 113 ? 113.101 124.335 158.215 1.00 72.74  ? 113 DA  J N3    1 
ATOM 3672 C C4    . DA  B 2 113 ? 112.521 124.191 157.010 1.00 72.74  ? 113 DA  J C4    1 
ATOM 3673 P P     . DG  B 2 114 ? 118.085 121.731 155.759 1.00 82.77  ? 114 DG  J P     1 
ATOM 3674 O OP1   . DG  B 2 114 ? 119.540 121.965 155.878 1.00 82.77  ? 114 DG  J OP1   1 
ATOM 3675 O OP2   . DG  B 2 114 ? 117.591 120.567 154.993 1.00 82.77  ? 114 DG  J OP2   1 
ATOM 3676 O "O5'" . DG  B 2 114 ? 117.446 121.649 157.229 1.00 82.77  ? 114 DG  J "O5'" 1 
ATOM 3677 C "C5'" . DG  B 2 114 ? 117.495 120.416 157.931 1.00 82.77  ? 114 DG  J "C5'" 1 
ATOM 3678 C "C4'" . DG  B 2 114 ? 116.844 120.498 159.306 1.00 82.77  ? 114 DG  J "C4'" 1 
ATOM 3679 O "O4'" . DG  B 2 114 ? 115.580 121.197 159.230 1.00 82.77  ? 114 DG  J "O4'" 1 
ATOM 3680 C "C3'" . DG  B 2 114 ? 116.560 119.135 159.946 1.00 82.77  ? 114 DG  J "C3'" 1 
ATOM 3681 O "O3'" . DG  B 2 114 ? 116.950 119.143 161.320 1.00 82.77  ? 114 DG  J "O3'" 1 
ATOM 3682 C "C2'" . DG  B 2 114 ? 115.040 119.009 159.789 1.00 82.77  ? 114 DG  J "C2'" 1 
ATOM 3683 C "C1'" . DG  B 2 114 ? 114.616 120.460 159.933 1.00 82.77  ? 114 DG  J "C1'" 1 
ATOM 3684 N N9    . DG  B 2 114 ? 113.321 120.804 159.348 1.00 82.77  ? 114 DG  J N9    1 
ATOM 3685 C C8    . DG  B 2 114 ? 113.058 120.977 158.014 1.00 82.77  ? 114 DG  J C8    1 
ATOM 3686 N N7    . DG  B 2 114 ? 111.821 121.281 157.760 1.00 82.77  ? 114 DG  J N7    1 
ATOM 3687 C C5    . DG  B 2 114 ? 111.201 121.253 158.999 1.00 82.77  ? 114 DG  J C5    1 
ATOM 3688 C C6    . DG  B 2 114 ? 109.851 121.481 159.335 1.00 82.77  ? 114 DG  J C6    1 
ATOM 3689 O O6    . DG  B 2 114 ? 108.917 121.764 158.578 1.00 82.77  ? 114 DG  J O6    1 
ATOM 3690 N N1    . DG  B 2 114 ? 109.627 121.357 160.700 1.00 82.77  ? 114 DG  J N1    1 
ATOM 3691 C C2    . DG  B 2 114 ? 110.587 121.048 161.630 1.00 82.77  ? 114 DG  J C2    1 
ATOM 3692 N N2    . DG  B 2 114 ? 110.173 120.972 162.906 1.00 82.77  ? 114 DG  J N2    1 
ATOM 3693 N N3    . DG  B 2 114 ? 111.870 120.828 161.329 1.00 82.77  ? 114 DG  J N3    1 
ATOM 3694 C C4    . DG  B 2 114 ? 112.102 120.949 159.994 1.00 82.77  ? 114 DG  J C4    1 
ATOM 3695 P P     . DT  B 2 115 ? 117.031 117.764 162.145 1.00 88.50  ? 115 DT  J P     1 
ATOM 3696 O OP1   . DT  B 2 115 ? 117.974 117.964 163.268 1.00 88.50  ? 115 DT  J OP1   1 
ATOM 3697 O OP2   . DT  B 2 115 ? 117.273 116.682 161.166 1.00 88.50  ? 115 DT  J OP2   1 
ATOM 3698 O "O5'" . DT  B 2 115 ? 115.561 117.560 162.729 1.00 88.50  ? 115 DT  J "O5'" 1 
ATOM 3699 C "C5'" . DT  B 2 115 ? 115.131 116.278 163.195 1.00 88.50  ? 115 DT  J "C5'" 1 
ATOM 3700 C "C4'" . DT  B 2 115 ? 113.659 116.344 163.537 1.00 88.50  ? 115 DT  J "C4'" 1 
ATOM 3701 O "O4'" . DT  B 2 115 ? 112.968 117.121 162.558 1.00 88.50  ? 115 DT  J "O4'" 1 
ATOM 3702 C "C3'" . DT  B 2 115 ? 112.942 114.996 163.616 1.00 88.50  ? 115 DT  J "C3'" 1 
ATOM 3703 O "O3'" . DT  B 2 115 ? 112.109 114.976 164.770 1.00 88.50  ? 115 DT  J "O3'" 1 
ATOM 3704 C "C2'" . DT  B 2 115 ? 112.090 115.011 162.322 1.00 88.50  ? 115 DT  J "C2'" 1 
ATOM 3705 C "C1'" . DT  B 2 115 ? 111.763 116.498 162.230 1.00 88.50  ? 115 DT  J "C1'" 1 
ATOM 3706 N N1    . DT  B 2 115 ? 111.380 117.043 160.897 1.00 88.50  ? 115 DT  J N1    1 
ATOM 3707 C C2    . DT  B 2 115 ? 110.098 117.479 160.717 1.00 88.50  ? 115 DT  J C2    1 
ATOM 3708 O O2    . DT  B 2 115 ? 109.286 117.514 161.617 1.00 88.50  ? 115 DT  J O2    1 
ATOM 3709 N N3    . DT  B 2 115 ? 109.843 118.020 159.488 1.00 88.50  ? 115 DT  J N3    1 
ATOM 3710 C C4    . DT  B 2 115 ? 110.702 118.077 158.409 1.00 88.50  ? 115 DT  J C4    1 
ATOM 3711 O O4    . DT  B 2 115 ? 110.367 118.549 157.328 1.00 88.50  ? 115 DT  J O4    1 
ATOM 3712 C C5    . DT  B 2 115 ? 112.020 117.545 158.643 1.00 88.50  ? 115 DT  J C5    1 
ATOM 3713 C C7    . DT  B 2 115 ? 113.033 117.548 157.537 1.00 88.50  ? 115 DT  J C7    1 
ATOM 3714 C C6    . DT  B 2 115 ? 112.293 117.047 159.862 1.00 88.50  ? 115 DT  J C6    1 
ATOM 3715 P P     . DC  B 2 116 ? 111.742 113.595 165.503 1.00 95.29  ? 116 DC  J P     1 
ATOM 3716 O OP1   . DC  B 2 116 ? 112.130 113.726 166.924 1.00 95.29  ? 116 DC  J OP1   1 
ATOM 3717 O OP2   . DC  B 2 116 ? 112.305 112.497 164.689 1.00 95.29  ? 116 DC  J OP2   1 
ATOM 3718 O "O5'" . DC  B 2 116 ? 110.152 113.497 165.422 1.00 95.29  ? 116 DC  J "O5'" 1 
ATOM 3719 C "C5'" . DC  B 2 116 ? 109.532 112.306 165.864 1.00 95.29  ? 116 DC  J "C5'" 1 
ATOM 3720 C "C4'" . DC  B 2 116 ? 108.024 112.420 165.893 1.00 95.29  ? 116 DC  J "C4'" 1 
ATOM 3721 O "O4'" . DC  B 2 116 ? 107.585 113.112 164.682 1.00 95.29  ? 116 DC  J "O4'" 1 
ATOM 3722 C "C3'" . DC  B 2 116 ? 107.289 111.092 165.837 1.00 95.29  ? 116 DC  J "C3'" 1 
ATOM 3723 O "O3'" . DC  B 2 116 ? 105.988 111.220 166.458 1.00 95.29  ? 116 DC  J "O3'" 1 
ATOM 3724 C "C2'" . DC  B 2 116 ? 107.270 110.747 164.358 1.00 95.29  ? 116 DC  J "C2'" 1 
ATOM 3725 C "C1'" . DC  B 2 116 ? 107.300 112.117 163.705 1.00 95.29  ? 116 DC  J "C1'" 1 
ATOM 3726 N N1    . DC  B 2 116 ? 108.259 112.273 162.568 1.00 95.29  ? 116 DC  J N1    1 
ATOM 3727 C C2    . DC  B 2 116 ? 108.158 113.382 161.735 1.00 95.29  ? 116 DC  J C2    1 
ATOM 3728 O O2    . DC  B 2 116 ? 107.111 114.036 161.757 1.00 95.29  ? 116 DC  J O2    1 
ATOM 3729 N N3    . DC  B 2 116 ? 109.069 113.541 160.745 1.00 95.29  ? 116 DC  J N3    1 
ATOM 3730 C C4    . DC  B 2 116 ? 110.153 112.773 160.710 1.00 95.29  ? 116 DC  J C4    1 
ATOM 3731 N N4    . DC  B 2 116 ? 111.058 113.008 159.754 1.00 95.29  ? 116 DC  J N4    1 
ATOM 3732 C C5    . DC  B 2 116 ? 110.361 111.734 161.660 1.00 95.29  ? 116 DC  J C5    1 
ATOM 3733 C C6    . DC  B 2 116 ? 109.417 111.550 162.586 1.00 95.29  ? 116 DC  J C6    1 
ATOM 3734 P P     . DT  B 2 117 ? 104.650 110.586 165.819 1.00 101.22 ? 117 DT  J P     1 
ATOM 3735 O OP1   . DT  B 2 117 ? 104.289 111.385 164.627 1.00 101.22 ? 117 DT  J OP1   1 
ATOM 3736 O OP2   . DT  B 2 117 ? 103.673 110.510 166.927 1.00 101.22 ? 117 DT  J OP2   1 
ATOM 3737 O "O5'" . DT  B 2 117 ? 104.995 109.076 165.410 1.00 101.22 ? 117 DT  J "O5'" 1 
ATOM 3738 C "C5'" . DT  B 2 117 ? 103.923 108.151 165.237 1.00 101.22 ? 117 DT  J "C5'" 1 
ATOM 3739 C "C4'" . DT  B 2 117 ? 103.092 108.535 164.015 1.00 101.22 ? 117 DT  J "C4'" 1 
ATOM 3740 O "O4'" . DT  B 2 117 ? 103.939 109.118 163.000 1.00 101.22 ? 117 DT  J "O4'" 1 
ATOM 3741 C "C3'" . DT  B 2 117 ? 102.381 107.386 163.321 1.00 101.22 ? 117 DT  J "C3'" 1 
ATOM 3742 O "O3'" . DT  B 2 117 ? 101.267 107.868 162.596 1.00 101.22 ? 117 DT  J "O3'" 1 
ATOM 3743 C "C2'" . DT  B 2 117 ? 103.455 106.906 162.354 1.00 101.22 ? 117 DT  J "C2'" 1 
ATOM 3744 C "C1'" . DT  B 2 117 ? 104.085 108.229 161.909 1.00 101.22 ? 117 DT  J "C1'" 1 
ATOM 3745 N N1    . DT  B 2 117 ? 105.518 108.102 161.592 1.00 101.22 ? 117 DT  J N1    1 
ATOM 3746 C C2    . DT  B 2 117 ? 105.972 108.547 160.378 1.00 101.22 ? 117 DT  J C2    1 
ATOM 3747 O O2    . DT  B 2 117 ? 105.271 109.152 159.590 1.00 101.22 ? 117 DT  J O2    1 
ATOM 3748 N N3    . DT  B 2 117 ? 107.311 108.363 160.166 1.00 101.22 ? 117 DT  J N3    1 
ATOM 3749 C C4    . DT  B 2 117 ? 108.205 107.717 160.998 1.00 101.22 ? 117 DT  J C4    1 
ATOM 3750 O O4    . DT  B 2 117 ? 109.389 107.581 160.710 1.00 101.22 ? 117 DT  J O4    1 
ATOM 3751 C C5    . DT  B 2 117 ? 107.646 107.215 162.231 1.00 101.22 ? 117 DT  J C5    1 
ATOM 3752 C C7    . DT  B 2 117 ? 108.515 106.494 163.217 1.00 101.22 ? 117 DT  J C7    1 
ATOM 3753 C C6    . DT  B 2 117 ? 106.341 107.413 162.456 1.00 101.22 ? 117 DT  J C6    1 
ATOM 3754 P P     . DC  B 2 118 ? 99.823  107.975 163.287 1.00 107.63 ? 118 DC  J P     1 
ATOM 3755 O OP1   . DC  B 2 118 ? 99.336  109.355 163.075 1.00 107.63 ? 118 DC  J OP1   1 
ATOM 3756 O OP2   . DC  B 2 118 ? 99.941  107.442 164.662 1.00 107.63 ? 118 DC  J OP2   1 
ATOM 3757 O "O5'" . DC  B 2 118 ? 98.892  107.006 162.425 1.00 107.63 ? 118 DC  J "O5'" 1 
ATOM 3758 C "C5'" . DC  B 2 118 ? 99.446  106.144 161.431 1.00 107.63 ? 118 DC  J "C5'" 1 
ATOM 3759 C "C4'" . DC  B 2 118 ? 98.881  106.445 160.057 1.00 107.63 ? 118 DC  J "C4'" 1 
ATOM 3760 O "O4'" . DC  B 2 118 ? 99.963  106.717 159.127 1.00 107.63 ? 118 DC  J "O4'" 1 
ATOM 3761 C "C3'" . DC  B 2 118 ? 98.136  105.285 159.427 1.00 107.63 ? 118 DC  J "C3'" 1 
ATOM 3762 O "O3'" . DC  B 2 118 ? 97.309  105.763 158.392 1.00 107.63 ? 118 DC  J "O3'" 1 
ATOM 3763 C "C2'" . DC  B 2 118 ? 99.277  104.456 158.857 1.00 107.63 ? 118 DC  J "C2'" 1 
ATOM 3764 C "C1'" . DC  B 2 118 ? 100.227 105.547 158.366 1.00 107.63 ? 118 DC  J "C1'" 1 
ATOM 3765 N N1    . DC  B 2 118 ? 101.675 105.196 158.456 1.00 107.63 ? 118 DC  J N1    1 
ATOM 3766 C C2    . DC  B 2 118 ? 102.563 105.686 157.493 1.00 107.63 ? 118 DC  J C2    1 
ATOM 3767 O O2    . DC  B 2 118 ? 102.123 106.375 156.566 1.00 107.63 ? 118 DC  J O2    1 
ATOM 3768 N N3    . DC  B 2 118 ? 103.876 105.357 157.582 1.00 107.63 ? 118 DC  J N3    1 
ATOM 3769 C C4    . DC  B 2 118 ? 104.307 104.609 158.596 1.00 107.63 ? 118 DC  J C4    1 
ATOM 3770 N N4    . DC  B 2 118 ? 105.607 104.302 158.647 1.00 107.63 ? 118 DC  J N4    1 
ATOM 3771 C C5    . DC  B 2 118 ? 103.417 104.113 159.594 1.00 107.63 ? 118 DC  J C5    1 
ATOM 3772 C C6    . DC  B 2 118 ? 102.125 104.433 159.489 1.00 107.63 ? 118 DC  J C6    1 
ATOM 3773 P P     . DC  B 2 119 ? 95.905  105.053 158.070 1.00 112.10 ? 119 DC  J P     1 
ATOM 3774 O OP1   . DC  B 2 119 ? 94.853  105.774 158.823 1.00 112.10 ? 119 DC  J OP1   1 
ATOM 3775 O OP2   . DC  B 2 119 ? 96.082  103.599 158.279 1.00 112.10 ? 119 DC  J OP2   1 
ATOM 3776 O "O5'" . DC  B 2 119 ? 95.716  105.309 156.501 1.00 112.10 ? 119 DC  J "O5'" 1 
ATOM 3777 C "C5'" . DC  B 2 119 ? 96.849  105.673 155.708 1.00 112.10 ? 119 DC  J "C5'" 1 
ATOM 3778 C "C4'" . DC  B 2 119 ? 97.061  104.647 154.608 1.00 112.10 ? 119 DC  J "C4'" 1 
ATOM 3779 O "O4'" . DC  B 2 119 ? 98.456  104.186 154.634 1.00 112.10 ? 119 DC  J "O4'" 1 
ATOM 3780 C "C3'" . DC  B 2 119 ? 96.214  103.375 154.751 1.00 112.10 ? 119 DC  J "C3'" 1 
ATOM 3781 O "O3'" . DC  B 2 119 ? 95.810  102.886 153.464 1.00 112.10 ? 119 DC  J "O3'" 1 
ATOM 3782 C "C2'" . DC  B 2 119 ? 97.166  102.412 155.419 1.00 112.10 ? 119 DC  J "C2'" 1 
ATOM 3783 C "C1'" . DC  B 2 119 ? 98.442  102.775 154.696 1.00 112.10 ? 119 DC  J "C1'" 1 
ATOM 3784 N N1    . DC  B 2 119 ? 99.680  102.201 155.329 1.00 112.10 ? 119 DC  J N1    1 
ATOM 3785 C C2    . DC  B 2 119 ? 100.929 102.335 154.709 1.00 112.10 ? 119 DC  J C2    1 
ATOM 3786 O O2    . DC  B 2 119 ? 101.010 102.942 153.636 1.00 112.10 ? 119 DC  J O2    1 
ATOM 3787 N N3    . DC  B 2 119 ? 102.011 101.755 155.293 1.00 112.10 ? 119 DC  J N3    1 
ATOM 3788 C C4    . DC  B 2 119 ? 101.880 101.096 156.445 1.00 112.10 ? 119 DC  J C4    1 
ATOM 3789 N N4    . DC  B 2 119 ? 102.978 100.563 156.992 1.00 112.10 ? 119 DC  J N4    1 
ATOM 3790 C C5    . DC  B 2 119 ? 100.620 100.958 157.090 1.00 112.10 ? 119 DC  J C5    1 
ATOM 3791 C C6    . DC  B 2 119 ? 99.561  101.513 156.501 1.00 112.10 ? 119 DC  J C6    1 
ATOM 3792 P P     . DA  B 2 120 ? 94.871  101.582 153.374 1.00 113.92 ? 120 DA  J P     1 
ATOM 3793 O OP1   . DA  B 2 120 ? 94.097  101.680 152.118 1.00 113.92 ? 120 DA  J OP1   1 
ATOM 3794 O OP2   . DA  B 2 120 ? 94.158  101.446 154.664 1.00 113.92 ? 120 DA  J OP2   1 
ATOM 3795 O "O5'" . DA  B 2 120 ? 95.920  100.371 153.248 1.00 113.92 ? 120 DA  J "O5'" 1 
ATOM 3796 C "C5'" . DA  B 2 120 ? 96.071  99.665  152.004 1.00 113.92 ? 120 DA  J "C5'" 1 
ATOM 3797 C "C4'" . DA  B 2 120 ? 97.091  100.326 151.089 1.00 113.92 ? 120 DA  J "C4'" 1 
ATOM 3798 O "O4'" . DA  B 2 120 ? 98.186  100.869 151.863 1.00 113.92 ? 120 DA  J "O4'" 1 
ATOM 3799 C "C3'" . DA  B 2 120 ? 97.732  99.391  150.062 1.00 113.92 ? 120 DA  J "C3'" 1 
ATOM 3800 O "O3'" . DA  B 2 120 ? 96.990  99.415  148.850 1.00 113.92 ? 120 DA  J "O3'" 1 
ATOM 3801 C "C2'" . DA  B 2 120 ? 99.111  100.009 149.871 1.00 113.92 ? 120 DA  J "C2'" 1 
ATOM 3802 C "C1'" . DA  B 2 120 ? 99.422  100.503 151.277 1.00 113.92 ? 120 DA  J "C1'" 1 
ATOM 3803 N N9    . DA  B 2 120 ? 100.114 99.537  152.128 1.00 113.92 ? 120 DA  J N9    1 
ATOM 3804 C C8    . DA  B 2 120 ? 99.673  99.005  153.308 1.00 113.92 ? 120 DA  J C8    1 
ATOM 3805 N N7    . DA  B 2 120 ? 100.534 98.196  153.878 1.00 113.92 ? 120 DA  J N7    1 
ATOM 3806 C C5    . DA  B 2 120 ? 101.636 98.241  153.041 1.00 113.92 ? 120 DA  J C5    1 
ATOM 3807 C C6    . DA  B 2 120 ? 102.895 97.611  153.093 1.00 113.92 ? 120 DA  J C6    1 
ATOM 3808 N N6    . DA  B 2 120 ? 103.259 96.776  154.071 1.00 113.92 ? 120 DA  J N6    1 
ATOM 3809 N N1    . DA  B 2 120 ? 103.768 97.872  152.097 1.00 113.92 ? 120 DA  J N1    1 
ATOM 3810 C C2    . DA  B 2 120 ? 103.400 98.709  151.120 1.00 113.92 ? 120 DA  J C2    1 
ATOM 3811 N N3    . DA  B 2 120 ? 102.249 99.360  150.965 1.00 113.92 ? 120 DA  J N3    1 
ATOM 3812 C C4    . DA  B 2 120 ? 101.402 99.079  151.970 1.00 113.92 ? 120 DA  J C4    1 
ATOM 3813 N N     . LEU C 3 61  ? 123.717 98.920  110.203 1.00 20.45  ? 60  LEU A N     1 
ATOM 3814 C CA    . LEU C 3 61  ? 124.863 99.770  109.912 1.00 20.45  ? 60  LEU A CA    1 
ATOM 3815 C C     . LEU C 3 61  ? 125.290 99.545  108.465 1.00 20.45  ? 60  LEU A C     1 
ATOM 3816 O O     . LEU C 3 61  ? 124.925 98.539  107.859 1.00 20.45  ? 60  LEU A O     1 
ATOM 3817 C CB    . LEU C 3 61  ? 126.020 99.472  110.867 1.00 20.45  ? 60  LEU A CB    1 
ATOM 3818 C CG    . LEU C 3 61  ? 125.826 99.828  112.346 1.00 20.45  ? 60  LEU A CG    1 
ATOM 3819 C CD1   . LEU C 3 61  ? 127.008 99.336  113.169 1.00 20.45  ? 60  LEU A CD1   1 
ATOM 3820 C CD2   . LEU C 3 61  ? 125.573 101.307 112.577 1.00 20.45  ? 60  LEU A CD2   1 
ATOM 3821 N N     . LEU C 3 62  ? 126.062 100.478 107.909 1.00 19.42  ? 61  LEU A N     1 
ATOM 3822 C CA    . LEU C 3 62  ? 126.490 100.393 106.521 1.00 19.42  ? 61  LEU A CA    1 
ATOM 3823 C C     . LEU C 3 62  ? 127.995 100.285 106.352 1.00 19.42  ? 61  LEU A C     1 
ATOM 3824 O O     . LEU C 3 62  ? 128.447 99.819  105.301 1.00 19.42  ? 61  LEU A O     1 
ATOM 3825 C CB    . LEU C 3 62  ? 125.981 101.604 105.725 1.00 19.42  ? 61  LEU A CB    1 
ATOM 3826 C CG    . LEU C 3 62  ? 124.458 101.707 105.655 1.00 19.42  ? 61  LEU A CG    1 
ATOM 3827 C CD1   . LEU C 3 62  ? 124.028 102.954 104.915 1.00 19.42  ? 61  LEU A CD1   1 
ATOM 3828 C CD2   . LEU C 3 62  ? 123.879 100.473 104.994 1.00 19.42  ? 61  LEU A CD2   1 
ATOM 3829 N N     . ILE C 3 63  ? 128.769 100.697 107.334 1.00 20.13  ? 62  ILE A N     1 
ATOM 3830 C CA    . ILE C 3 63  ? 130.214 100.526 107.332 1.00 20.13  ? 62  ILE A CA    1 
ATOM 3831 C C     . ILE C 3 63  ? 130.534 99.251  108.093 1.00 20.13  ? 62  ILE A C     1 
ATOM 3832 O O     . ILE C 3 63  ? 129.872 98.924  109.083 1.00 20.13  ? 62  ILE A O     1 
ATOM 3833 C CB    . ILE C 3 63  ? 130.913 101.744 107.961 1.00 20.13  ? 62  ILE A CB    1 
ATOM 3834 C CG1   . ILE C 3 63  ? 130.490 103.026 107.250 1.00 20.13  ? 62  ILE A CG1   1 
ATOM 3835 C CG2   . ILE C 3 63  ? 132.417 101.591 107.896 1.00 20.13  ? 62  ILE A CG2   1 
ATOM 3836 C CD1   . ILE C 3 63  ? 130.929 104.284 107.959 1.00 20.13  ? 62  ILE A CD1   1 
ATOM 3837 N N     . ARG C 3 64  ? 131.540 98.518  107.632 1.00 21.73  ? 63  ARG A N     1 
ATOM 3838 C CA    . ARG C 3 64  ? 131.912 97.284  108.305 1.00 21.73  ? 63  ARG A CA    1 
ATOM 3839 C C     . ARG C 3 64  ? 132.556 97.608  109.645 1.00 21.73  ? 63  ARG A C     1 
ATOM 3840 O O     . ARG C 3 64  ? 133.306 98.577  109.776 1.00 21.73  ? 63  ARG A O     1 
ATOM 3841 C CB    . ARG C 3 64  ? 132.841 96.452  107.428 1.00 21.73  ? 63  ARG A CB    1 
ATOM 3842 C CG    . ARG C 3 64  ? 132.185 96.085  106.115 1.00 21.73  ? 63  ARG A CG    1 
ATOM 3843 C CD    . ARG C 3 64  ? 130.929 95.280  106.378 1.00 21.73  ? 63  ARG A CD    1 
ATOM 3844 N NE    . ARG C 3 64  ? 130.089 95.167  105.193 1.00 21.73  ? 63  ARG A NE    1 
ATOM 3845 C CZ    . ARG C 3 64  ? 128.837 94.726  105.212 1.00 21.73  ? 63  ARG A CZ    1 
ATOM 3846 N NH1   . ARG C 3 64  ? 128.283 94.359  106.359 1.00 21.73  ? 63  ARG A NH1   1 
ATOM 3847 N NH2   . ARG C 3 64  ? 128.135 94.655  104.089 1.00 21.73  ? 63  ARG A NH2   1 
ATOM 3848 N N     . LYS C 3 65  ? 132.258 96.781  110.647 1.00 22.45  ? 64  LYS A N     1 
ATOM 3849 C CA    . LYS C 3 65  ? 132.553 97.134  112.030 1.00 22.45  ? 64  LYS A CA    1 
ATOM 3850 C C     . LYS C 3 65  ? 134.034 97.025  112.351 1.00 22.45  ? 64  LYS A C     1 
ATOM 3851 O O     . LYS C 3 65  ? 134.567 97.850  113.102 1.00 22.45  ? 64  LYS A O     1 
ATOM 3852 C CB    . LYS C 3 65  ? 131.762 96.234  112.975 1.00 22.45  ? 64  LYS A CB    1 
ATOM 3853 C CG    . LYS C 3 65  ? 130.263 96.420  112.935 1.00 22.45  ? 64  LYS A CG    1 
ATOM 3854 C CD    . LYS C 3 65  ? 129.600 95.490  113.930 1.00 22.45  ? 64  LYS A CD    1 
ATOM 3855 C CE    . LYS C 3 65  ? 128.094 95.630  113.911 1.00 22.45  ? 64  LYS A CE    1 
ATOM 3856 N NZ    . LYS C 3 65  ? 127.456 94.697  114.878 1.00 22.45  ? 64  LYS A NZ    1 
ATOM 3857 N N     . LEU C 3 66  ? 134.719 96.044  111.792 1.00 22.69  ? 65  LEU A N     1 
ATOM 3858 C CA    . LEU C 3 66  ? 136.103 95.840  112.189 1.00 22.69  ? 65  LEU A CA    1 
ATOM 3859 C C     . LEU C 3 66  ? 137.034 96.881  111.570 1.00 22.69  ? 65  LEU A C     1 
ATOM 3860 O O     . LEU C 3 66  ? 137.938 97.369  112.263 1.00 22.69  ? 65  LEU A O     1 
ATOM 3861 C CB    . LEU C 3 66  ? 136.551 94.426  111.817 1.00 22.69  ? 65  LEU A CB    1 
ATOM 3862 C CG    . LEU C 3 66  ? 137.912 93.973  112.335 1.00 22.69  ? 65  LEU A CG    1 
ATOM 3863 C CD1   . LEU C 3 66  ? 137.950 94.044  113.847 1.00 22.69  ? 65  LEU A CD1   1 
ATOM 3864 C CD2   . LEU C 3 66  ? 138.209 92.566  111.856 1.00 22.69  ? 65  LEU A CD2   1 
ATOM 3865 N N     . PRO C 3 67  ? 136.847 97.295  110.310 1.00 22.14  ? 66  PRO A N     1 
ATOM 3866 C CA    . PRO C 3 67  ? 137.641 98.428  109.819 1.00 22.14  ? 66  PRO A CA    1 
ATOM 3867 C C     . PRO C 3 67  ? 137.285 99.747  110.477 1.00 22.14  ? 66  PRO A C     1 
ATOM 3868 O O     . PRO C 3 67  ? 138.167 100.601 110.626 1.00 22.14  ? 66  PRO A O     1 
ATOM 3869 C CB    . PRO C 3 67  ? 137.321 98.457  108.321 1.00 22.14  ? 66  PRO A CB    1 
ATOM 3870 C CG    . PRO C 3 67  ? 136.926 97.078  108.002 1.00 22.14  ? 66  PRO A CG    1 
ATOM 3871 C CD    . PRO C 3 67  ? 136.161 96.616  109.196 1.00 22.14  ? 66  PRO A CD    1 
ATOM 3872 N N     . PHE C 3 68  ? 136.061 99.905  110.979 1.00 21.73  ? 67  PHE A N     1 
ATOM 3873 C CA    . PHE C 3 68  ? 135.737 101.127 111.701 1.00 21.73  ? 67  PHE A CA    1 
ATOM 3874 C C     . PHE C 3 68  ? 136.357 101.121 113.087 1.00 21.73  ? 67  PHE A C     1 
ATOM 3875 O O     . PHE C 3 68  ? 136.753 102.176 113.598 1.00 21.73  ? 67  PHE A O     1 
ATOM 3876 C CB    . PHE C 3 68  ? 134.229 101.311 111.815 1.00 21.73  ? 67  PHE A CB    1 
ATOM 3877 C CG    . PHE C 3 68  ? 133.842 102.640 112.366 1.00 21.73  ? 67  PHE A CG    1 
ATOM 3878 C CD1   . PHE C 3 68  ? 133.879 103.762 111.565 1.00 21.73  ? 67  PHE A CD1   1 
ATOM 3879 C CD2   . PHE C 3 68  ? 133.515 102.786 113.697 1.00 21.73  ? 67  PHE A CD2   1 
ATOM 3880 C CE1   . PHE C 3 68  ? 133.544 104.991 112.064 1.00 21.73  ? 67  PHE A CE1   1 
ATOM 3881 C CE2   . PHE C 3 68  ? 133.191 104.017 114.204 1.00 21.73  ? 67  PHE A CE2   1 
ATOM 3882 C CZ    . PHE C 3 68  ? 133.202 105.121 113.385 1.00 21.73  ? 67  PHE A CZ    1 
ATOM 3883 N N     . GLN C 3 69  ? 136.521 99.937  113.675 1.00 23.51  ? 68  GLN A N     1 
ATOM 3884 C CA    . GLN C 3 69  ? 137.200 99.862  114.957 1.00 23.51  ? 68  GLN A CA    1 
ATOM 3885 C C     . GLN C 3 69  ? 138.690 100.081 114.776 1.00 23.51  ? 68  GLN A C     1 
ATOM 3886 O O     . GLN C 3 69  ? 139.336 100.697 115.631 1.00 23.51  ? 68  GLN A O     1 
ATOM 3887 C CB    . GLN C 3 69  ? 136.932 98.507  115.603 1.00 23.51  ? 68  GLN A CB    1 
ATOM 3888 C CG    . GLN C 3 69  ? 137.477 98.357  116.997 1.00 23.51  ? 68  GLN A CG    1 
ATOM 3889 C CD    . GLN C 3 69  ? 137.112 97.025  117.597 1.00 23.51  ? 68  GLN A CD    1 
ATOM 3890 O OE1   . GLN C 3 69  ? 136.467 96.203  116.951 1.00 23.51  ? 68  GLN A OE1   1 
ATOM 3891 N NE2   . GLN C 3 69  ? 137.526 96.798  118.834 1.00 23.51  ? 68  GLN A NE2   1 
ATOM 3892 N N     . ARG C 3 70  ? 139.244 99.629  113.652 1.00 24.02  ? 69  ARG A N     1 
ATOM 3893 C CA    . ARG C 3 70  ? 140.646 99.917  113.394 1.00 24.02  ? 69  ARG A CA    1 
ATOM 3894 C C     . ARG C 3 70  ? 140.840 101.405 113.159 1.00 24.02  ? 69  ARG A C     1 
ATOM 3895 O O     . ARG C 3 70  ? 141.842 101.984 113.594 1.00 24.02  ? 69  ARG A O     1 
ATOM 3896 C CB    . ARG C 3 70  ? 141.119 99.154  112.165 1.00 24.02  ? 69  ARG A CB    1 
ATOM 3897 C CG    . ARG C 3 70  ? 141.132 97.661  112.296 1.00 24.02  ? 69  ARG A CG    1 
ATOM 3898 C CD    . ARG C 3 70  ? 141.378 97.055  110.936 1.00 24.02  ? 69  ARG A CD    1 
ATOM 3899 N NE    . ARG C 3 70  ? 141.346 95.603  110.976 1.00 24.02  ? 69  ARG A NE    1 
ATOM 3900 C CZ    . ARG C 3 70  ? 141.345 94.836  109.895 1.00 24.02  ? 69  ARG A CZ    1 
ATOM 3901 N NH1   . ARG C 3 70  ? 141.360 95.389  108.691 1.00 24.02  ? 69  ARG A NH1   1 
ATOM 3902 N NH2   . ARG C 3 70  ? 141.318 93.517  110.017 1.00 24.02  ? 69  ARG A NH2   1 
ATOM 3903 N N     . LEU C 3 71  ? 139.847 102.055 112.548 1.00 23.19  ? 70  LEU A N     1 
ATOM 3904 C CA    . LEU C 3 71  ? 139.958 103.484 112.296 1.00 23.19  ? 70  LEU A CA    1 
ATOM 3905 C C     . LEU C 3 71  ? 139.881 104.278 113.591 1.00 23.19  ? 70  LEU A C     1 
ATOM 3906 O O     . LEU C 3 71  ? 140.648 105.226 113.788 1.00 23.19  ? 70  LEU A O     1 
ATOM 3907 C CB    . LEU C 3 71  ? 138.867 103.924 111.327 1.00 23.19  ? 70  LEU A CB    1 
ATOM 3908 C CG    . LEU C 3 71  ? 138.833 105.417 111.034 1.00 23.19  ? 70  LEU A CG    1 
ATOM 3909 C CD1   . LEU C 3 71  ? 140.161 105.841 110.439 1.00 23.19  ? 70  LEU A CD1   1 
ATOM 3910 C CD2   . LEU C 3 71  ? 137.688 105.741 110.102 1.00 23.19  ? 70  LEU A CD2   1 
ATOM 3911 N N     . VAL C 3 72  ? 138.989 103.886 114.505 1.00 24.49  ? 71  VAL A N     1 
ATOM 3912 C CA    . VAL C 3 72  ? 138.898 104.609 115.770 1.00 24.49  ? 71  VAL A CA    1 
ATOM 3913 C C     . VAL C 3 72  ? 140.148 104.362 116.604 1.00 24.49  ? 71  VAL A C     1 
ATOM 3914 O O     . VAL C 3 72  ? 140.650 105.273 117.269 1.00 24.49  ? 71  VAL A O     1 
ATOM 3915 C CB    . VAL C 3 72  ? 137.607 104.264 116.540 1.00 24.49  ? 71  VAL A CB    1 
ATOM 3916 C CG1   . VAL C 3 72  ? 136.394 104.586 115.699 1.00 24.49  ? 71  VAL A CG1   1 
ATOM 3917 C CG2   . VAL C 3 72  ? 137.575 102.823 117.002 1.00 24.49  ? 71  VAL A CG2   1 
ATOM 3918 N N     . ARG C 3 73  ? 140.685 103.140 116.571 1.00 27.02  ? 72  ARG A N     1 
ATOM 3919 C CA    . ARG C 3 73  ? 141.854 102.846 117.385 1.00 27.02  ? 72  ARG A CA    1 
ATOM 3920 C C     . ARG C 3 73  ? 143.148 103.332 116.754 1.00 27.02  ? 72  ARG A C     1 
ATOM 3921 O O     . ARG C 3 73  ? 144.197 103.259 117.402 1.00 27.02  ? 72  ARG A O     1 
ATOM 3922 C CB    . ARG C 3 73  ? 141.948 101.343 117.633 1.00 27.02  ? 72  ARG A CB    1 
ATOM 3923 C CG    . ARG C 3 73  ? 140.847 100.809 118.509 1.00 27.02  ? 72  ARG A CG    1 
ATOM 3924 C CD    . ARG C 3 73  ? 140.963 99.314  118.675 1.00 27.02  ? 72  ARG A CD    1 
ATOM 3925 N NE    . ARG C 3 73  ? 139.807 98.774  119.373 1.00 27.02  ? 72  ARG A NE    1 
ATOM 3926 C CZ    . ARG C 3 73  ? 139.728 98.648  120.691 1.00 27.02  ? 72  ARG A CZ    1 
ATOM 3927 N NH1   . ARG C 3 73  ? 140.746 99.019  121.454 1.00 27.02  ? 72  ARG A NH1   1 
ATOM 3928 N NH2   . ARG C 3 73  ? 138.635 98.148  121.246 1.00 27.02  ? 72  ARG A NH2   1 
ATOM 3929 N N     . GLU C 3 74  ? 143.105 103.826 115.518 1.00 26.93  ? 73  GLU A N     1 
ATOM 3930 C CA    . GLU C 3 74  ? 144.264 104.491 114.944 1.00 26.93  ? 73  GLU A CA    1 
ATOM 3931 C C     . GLU C 3 74  ? 144.120 106.005 114.932 1.00 26.93  ? 73  GLU A C     1 
ATOM 3932 O O     . GLU C 3 74  ? 145.122 106.706 114.763 1.00 26.93  ? 73  GLU A O     1 
ATOM 3933 C CB    . GLU C 3 74  ? 144.520 103.995 113.514 1.00 26.93  ? 73  GLU A CB    1 
ATOM 3934 C CG    . GLU C 3 74  ? 145.017 102.555 113.426 1.00 26.93  ? 73  GLU A CG    1 
ATOM 3935 C CD    . GLU C 3 74  ? 146.505 102.419 113.699 1.00 26.93  ? 73  GLU A CD    1 
ATOM 3936 O OE1   . GLU C 3 74  ? 147.143 103.429 114.060 1.00 26.93  ? 73  GLU A OE1   1 
ATOM 3937 O OE2   . GLU C 3 74  ? 147.038 101.300 113.550 1.00 26.93  ? 73  GLU A OE2   1 
ATOM 3938 N N     . ILE C 3 75  ? 142.903 106.521 115.110 1.00 25.56  ? 74  ILE A N     1 
ATOM 3939 C CA    . ILE C 3 75  ? 142.725 107.952 115.336 1.00 25.56  ? 74  ILE A CA    1 
ATOM 3940 C C     . ILE C 3 75  ? 142.958 108.309 116.795 1.00 25.56  ? 74  ILE A C     1 
ATOM 3941 O O     . ILE C 3 75  ? 143.623 109.304 117.100 1.00 25.56  ? 74  ILE A O     1 
ATOM 3942 C CB    . ILE C 3 75  ? 141.335 108.412 114.864 1.00 25.56  ? 74  ILE A CB    1 
ATOM 3943 C CG1   . ILE C 3 75  ? 141.236 108.328 113.344 1.00 25.56  ? 74  ILE A CG1   1 
ATOM 3944 C CG2   . ILE C 3 75  ? 141.045 109.823 115.343 1.00 25.56  ? 74  ILE A CG2   1 
ATOM 3945 C CD1   . ILE C 3 75  ? 139.849 108.552 112.822 1.00 25.56  ? 74  ILE A CD1   1 
ATOM 3946 N N     . ALA C 3 76  ? 142.429 107.511 117.724 1.00 26.70  ? 75  ALA A N     1 
ATOM 3947 C CA    . ALA C 3 76  ? 142.599 107.819 119.135 1.00 26.70  ? 75  ALA A CA    1 
ATOM 3948 C C     . ALA C 3 76  ? 144.021 107.610 119.621 1.00 26.70  ? 75  ALA A C     1 
ATOM 3949 O O     . ALA C 3 76  ? 144.342 108.048 120.730 1.00 26.70  ? 75  ALA A O     1 
ATOM 3950 C CB    . ALA C 3 76  ? 141.654 106.961 119.973 1.00 26.70  ? 75  ALA A CB    1 
ATOM 3951 N N     . GLN C 3 77  ? 144.876 106.954 118.836 1.00 29.59  ? 76  GLN A N     1 
ATOM 3952 C CA    . GLN C 3 77  ? 146.236 106.728 119.298 1.00 29.59  ? 76  GLN A CA    1 
ATOM 3953 C C     . GLN C 3 77  ? 147.026 108.026 119.363 1.00 29.59  ? 76  GLN A C     1 
ATOM 3954 O O     . GLN C 3 77  ? 147.990 108.117 120.128 1.00 29.59  ? 76  GLN A O     1 
ATOM 3955 C CB    . GLN C 3 77  ? 146.926 105.716 118.386 1.00 29.59  ? 76  GLN A CB    1 
ATOM 3956 C CG    . GLN C 3 77  ? 148.255 105.211 118.898 1.00 29.59  ? 76  GLN A CG    1 
ATOM 3957 C CD    . GLN C 3 77  ? 148.844 104.141 118.005 1.00 29.59  ? 76  GLN A CD    1 
ATOM 3958 O OE1   . GLN C 3 77  ? 148.274 103.796 116.971 1.00 29.59  ? 76  GLN A OE1   1 
ATOM 3959 N NE2   . GLN C 3 77  ? 149.992 103.605 118.403 1.00 29.59  ? 76  GLN A NE2   1 
ATOM 3960 N N     . ASP C 3 78  ? 146.631 109.032 118.580 1.00 30.35  ? 77  ASP A N     1 
ATOM 3961 C CA    . ASP C 3 78  ? 147.312 110.319 118.578 1.00 30.35  ? 77  ASP A CA    1 
ATOM 3962 C C     . ASP C 3 78  ? 146.987 111.147 119.812 1.00 30.35  ? 77  ASP A C     1 
ATOM 3963 O O     . ASP C 3 78  ? 147.661 112.150 120.062 1.00 30.35  ? 77  ASP A O     1 
ATOM 3964 C CB    . ASP C 3 78  ? 146.948 111.101 117.315 1.00 30.35  ? 77  ASP A CB    1 
ATOM 3965 C CG    . ASP C 3 78  ? 148.005 112.123 116.933 1.00 30.35  ? 77  ASP A CG    1 
ATOM 3966 O OD1   . ASP C 3 78  ? 148.087 113.178 117.594 1.00 30.35  ? 77  ASP A OD1   1 
ATOM 3967 O OD2   . ASP C 3 78  ? 148.755 111.872 115.967 1.00 30.35  ? 77  ASP A OD2   1 
ATOM 3968 N N     . PHE C 3 79  ? 145.980 110.750 120.587 1.00 28.82  ? 78  PHE A N     1 
ATOM 3969 C CA    . PHE C 3 79  ? 145.508 111.517 121.731 1.00 28.82  ? 78  PHE A CA    1 
ATOM 3970 C C     . PHE C 3 79  ? 146.000 110.945 123.051 1.00 28.82  ? 78  PHE A C     1 
ATOM 3971 O O     . PHE C 3 79  ? 146.478 111.688 123.912 1.00 28.82  ? 78  PHE A O     1 
ATOM 3972 C CB    . PHE C 3 79  ? 143.979 111.564 121.706 1.00 28.82  ? 78  PHE A CB    1 
ATOM 3973 C CG    . PHE C 3 79  ? 143.428 112.363 120.567 1.00 28.82  ? 78  PHE A CG    1 
ATOM 3974 C CD1   . PHE C 3 79  ? 144.186 113.353 119.972 1.00 28.82  ? 78  PHE A CD1   1 
ATOM 3975 C CD2   . PHE C 3 79  ? 142.181 112.085 120.051 1.00 28.82  ? 78  PHE A CD2   1 
ATOM 3976 C CE1   . PHE C 3 79  ? 143.690 114.080 118.913 1.00 28.82  ? 78  PHE A CE1   1 
ATOM 3977 C CE2   . PHE C 3 79  ? 141.684 112.803 118.987 1.00 28.82  ? 78  PHE A CE2   1 
ATOM 3978 C CZ    . PHE C 3 79  ? 142.438 113.803 118.420 1.00 28.82  ? 78  PHE A CZ    1 
ATOM 3979 N N     . LYS C 3 80  ? 145.892 109.632 123.224 1.00 30.56  ? 79  LYS A N     1 
ATOM 3980 C CA    . LYS C 3 80  ? 146.483 108.952 124.366 1.00 30.56  ? 79  LYS A CA    1 
ATOM 3981 C C     . LYS C 3 80  ? 146.846 107.544 123.929 1.00 30.56  ? 79  LYS A C     1 
ATOM 3982 O O     . LYS C 3 80  ? 145.992 106.818 123.413 1.00 30.56  ? 79  LYS A O     1 
ATOM 3983 C CB    . LYS C 3 80  ? 145.518 108.920 125.555 1.00 30.56  ? 79  LYS A CB    1 
ATOM 3984 C CG    . LYS C 3 80  ? 146.105 108.310 126.816 1.00 30.56  ? 79  LYS A CG    1 
ATOM 3985 C CD    . LYS C 3 80  ? 145.084 108.288 127.943 1.00 30.56  ? 79  LYS A CD    1 
ATOM 3986 C CE    . LYS C 3 80  ? 145.692 107.782 129.243 1.00 30.56  ? 79  LYS A CE    1 
ATOM 3987 N NZ    . LYS C 3 80  ? 146.109 106.355 129.144 1.00 30.56  ? 79  LYS A NZ    1 
ATOM 3988 N N     . THR C 3 81  ? 148.102 107.162 124.131 1.00 32.87  ? 80  THR A N     1 
ATOM 3989 C CA    . THR C 3 81  ? 148.542 105.853 123.683 1.00 32.87  ? 80  THR A CA    1 
ATOM 3990 C C     . THR C 3 81  ? 148.007 104.779 124.615 1.00 32.87  ? 80  THR A C     1 
ATOM 3991 O O     . THR C 3 81  ? 147.716 105.039 125.785 1.00 32.87  ? 80  THR A O     1 
ATOM 3992 C CB    . THR C 3 81  ? 150.066 105.779 123.634 1.00 32.87  ? 80  THR A CB    1 
ATOM 3993 O OG1   . THR C 3 81  ? 150.594 105.927 124.957 1.00 32.87  ? 80  THR A OG1   1 
ATOM 3994 C CG2   . THR C 3 81  ? 150.620 106.878 122.745 1.00 32.87  ? 80  THR A CG2   1 
ATOM 3995 N N     . ASP C 3 82  ? 147.801 103.585 124.055 1.00 34.50  ? 81  ASP A N     1 
ATOM 3996 C CA    . ASP C 3 82  ? 147.351 102.398 124.789 1.00 34.50  ? 81  ASP A CA    1 
ATOM 3997 C C     . ASP C 3 82  ? 146.027 102.690 125.501 1.00 34.50  ? 81  ASP A C     1 
ATOM 3998 O O     . ASP C 3 82  ? 145.921 102.650 126.728 1.00 34.50  ? 81  ASP A O     1 
ATOM 3999 C CB    . ASP C 3 82  ? 148.427 101.816 125.734 1.00 34.50  ? 81  ASP A CB    1 
ATOM 4000 C CG    . ASP C 3 82  ? 148.894 102.774 126.819 1.00 34.50  ? 81  ASP A CG    1 
ATOM 4001 O OD1   . ASP C 3 82  ? 149.822 103.571 126.560 1.00 34.50  ? 81  ASP A OD1   1 
ATOM 4002 O OD2   . ASP C 3 82  ? 148.373 102.693 127.951 1.00 34.50  ? 81  ASP A OD2   1 
ATOM 4003 N N     . LEU C 3 83  ? 145.008 102.982 124.702 1.00 32.04  ? 82  LEU A N     1 
ATOM 4004 C CA    . LEU C 3 83  ? 143.650 103.075 125.210 1.00 32.04  ? 82  LEU A CA    1 
ATOM 4005 C C     . LEU C 3 83  ? 142.847 101.827 124.878 1.00 32.04  ? 82  LEU A C     1 
ATOM 4006 O O     . LEU C 3 83  ? 143.141 101.090 123.934 1.00 32.04  ? 82  LEU A O     1 
ATOM 4007 C CB    . LEU C 3 83  ? 142.937 104.298 124.631 1.00 32.04  ? 82  LEU A CB    1 
ATOM 4008 C CG    . LEU C 3 83  ? 143.198 105.667 125.251 1.00 32.04  ? 82  LEU A CG    1 
ATOM 4009 C CD1   . LEU C 3 83  ? 142.540 106.733 124.406 1.00 32.04  ? 82  LEU A CD1   1 
ATOM 4010 C CD2   . LEU C 3 83  ? 142.668 105.717 126.670 1.00 32.04  ? 82  LEU A CD2   1 
ATOM 4011 N N     . ARG C 3 84  ? 141.821 101.602 125.688 1.00 33.90  ? 83  ARG A N     1 
ATOM 4012 C CA    . ARG C 3 84  ? 140.838 100.556 125.480 1.00 33.90  ? 83  ARG A CA    1 
ATOM 4013 C C     . ARG C 3 84  ? 139.471 101.180 125.257 1.00 33.90  ? 83  ARG A C     1 
ATOM 4014 O O     . ARG C 3 84  ? 139.164 102.243 125.799 1.00 33.90  ? 83  ARG A O     1 
ATOM 4015 C CB    . ARG C 3 84  ? 140.794 99.596  126.670 1.00 33.90  ? 83  ARG A CB    1 
ATOM 4016 C CG    . ARG C 3 84  ? 141.964 98.640  126.714 1.00 33.90  ? 83  ARG A CG    1 
ATOM 4017 C CD    . ARG C 3 84  ? 141.894 97.711  127.904 1.00 33.90  ? 83  ARG A CD    1 
ATOM 4018 N NE    . ARG C 3 84  ? 142.865 96.632  127.774 1.00 33.90  ? 83  ARG A NE    1 
ATOM 4019 C CZ    . ARG C 3 84  ? 144.126 96.708  128.183 1.00 33.90  ? 83  ARG A CZ    1 
ATOM 4020 N NH1   . ARG C 3 84  ? 144.573 97.812  128.762 1.00 33.90  ? 83  ARG A NH1   1 
ATOM 4021 N NH2   . ARG C 3 84  ? 144.938 95.675  128.019 1.00 33.90  ? 83  ARG A NH2   1 
ATOM 4022 N N     . PHE C 3 85  ? 138.662 100.533 124.431 1.00 29.82  ? 84  PHE A N     1 
ATOM 4023 C CA    . PHE C 3 85  ? 137.328 101.016 124.120 1.00 29.82  ? 84  PHE A CA    1 
ATOM 4024 C C     . PHE C 3 85  ? 136.309 99.972  124.543 1.00 29.82  ? 84  PHE A C     1 
ATOM 4025 O O     . PHE C 3 85  ? 136.539 98.771  124.382 1.00 29.82  ? 84  PHE A O     1 
ATOM 4026 C CB    . PHE C 3 85  ? 137.178 101.287 122.622 1.00 29.82  ? 84  PHE A CB    1 
ATOM 4027 C CG    . PHE C 3 85  ? 137.872 102.525 122.151 1.00 29.82  ? 84  PHE A CG    1 
ATOM 4028 C CD1   . PHE C 3 85  ? 137.231 103.745 122.193 1.00 29.82  ? 84  PHE A CD1   1 
ATOM 4029 C CD2   . PHE C 3 85  ? 139.163 102.470 121.667 1.00 29.82  ? 84  PHE A CD2   1 
ATOM 4030 C CE1   . PHE C 3 85  ? 137.862 104.885 121.760 1.00 29.82  ? 84  PHE A CE1   1 
ATOM 4031 C CE2   . PHE C 3 85  ? 139.800 103.609 121.234 1.00 29.82  ? 84  PHE A CE2   1 
ATOM 4032 C CZ    . PHE C 3 85  ? 139.149 104.817 121.281 1.00 29.82  ? 84  PHE A CZ    1 
ATOM 4033 N N     . GLN C 3 86  ? 135.179 100.427 125.073 1.00 28.30  ? 85  GLN A N     1 
ATOM 4034 C CA    . GLN C 3 86  ? 134.084 99.503  125.310 1.00 28.30  ? 85  GLN A CA    1 
ATOM 4035 C C     . GLN C 3 86  ? 133.509 99.034  123.982 1.00 28.30  ? 85  GLN A C     1 
ATOM 4036 O O     . GLN C 3 86  ? 133.678 99.676  122.943 1.00 28.30  ? 85  GLN A O     1 
ATOM 4037 C CB    . GLN C 3 86  ? 132.984 100.141 126.155 1.00 28.30  ? 85  GLN A CB    1 
ATOM 4038 C CG    . GLN C 3 86  ? 133.328 100.312 127.613 1.00 28.30  ? 85  GLN A CG    1 
ATOM 4039 C CD    . GLN C 3 86  ? 132.148 100.801 128.416 1.00 28.30  ? 85  GLN A CD    1 
ATOM 4040 O OE1   . GLN C 3 86  ? 131.090 101.095 127.865 1.00 28.30  ? 85  GLN A OE1   1 
ATOM 4041 N NE2   . GLN C 3 86  ? 132.306 100.847 129.730 1.00 28.30  ? 85  GLN A NE2   1 
ATOM 4042 N N     . SER C 3 87  ? 132.820 97.894  124.018 1.00 28.20  ? 86  SER A N     1 
ATOM 4043 C CA    . SER C 3 87  ? 132.256 97.383  122.780 1.00 28.20  ? 86  SER A CA    1 
ATOM 4044 C C     . SER C 3 87  ? 131.081 98.224  122.316 1.00 28.20  ? 86  SER A C     1 
ATOM 4045 O O     . SER C 3 87  ? 130.726 98.168  121.134 1.00 28.20  ? 86  SER A O     1 
ATOM 4046 C CB    . SER C 3 87  ? 131.818 95.928  122.954 1.00 28.20  ? 86  SER A CB    1 
ATOM 4047 O OG    . SER C 3 87  ? 130.623 95.839  123.709 1.00 28.20  ? 86  SER A OG    1 
ATOM 4048 N N     . SER C 3 88  ? 130.476 99.009  123.209 1.00 26.63  ? 87  SER A N     1 
ATOM 4049 C CA    . SER C 3 88  ? 129.371 99.864  122.810 1.00 26.63  ? 87  SER A CA    1 
ATOM 4050 C C     . SER C 3 88  ? 129.809 101.287 122.514 1.00 26.63  ? 87  SER A C     1 
ATOM 4051 O O     . SER C 3 88  ? 129.056 102.027 121.878 1.00 26.63  ? 87  SER A O     1 
ATOM 4052 C CB    . SER C 3 88  ? 128.293 99.885  123.897 1.00 26.63  ? 87  SER A CB    1 
ATOM 4053 O OG    . SER C 3 88  ? 128.795 100.432 125.102 1.00 26.63  ? 87  SER A OG    1 
ATOM 4054 N N     . ALA C 3 89  ? 131.042 101.654 122.863 1.00 25.47  ? 88  ALA A N     1 
ATOM 4055 C CA    . ALA C 3 89  ? 131.537 102.970 122.484 1.00 25.47  ? 88  ALA A CA    1 
ATOM 4056 C C     . ALA C 3 89  ? 131.833 103.006 120.997 1.00 25.47  ? 88  ALA A C     1 
ATOM 4057 O O     . ALA C 3 89  ? 131.557 104.002 120.321 1.00 25.47  ? 88  ALA A O     1 
ATOM 4058 C CB    . ALA C 3 89  ? 132.785 103.319 123.289 1.00 25.47  ? 88  ALA A CB    1 
ATOM 4059 N N     . VAL C 3 90  ? 132.355 101.902 120.465 1.00 24.71  ? 89  VAL A N     1 
ATOM 4060 C CA    . VAL C 3 90  ? 132.651 101.840 119.045 1.00 24.71  ? 89  VAL A CA    1 
ATOM 4061 C C     . VAL C 3 90  ? 131.356 101.783 118.250 1.00 24.71  ? 89  VAL A C     1 
ATOM 4062 O O     . VAL C 3 90  ? 131.266 102.361 117.165 1.00 24.71  ? 89  VAL A O     1 
ATOM 4063 C CB    . VAL C 3 90  ? 133.580 100.650 118.742 1.00 24.71  ? 89  VAL A CB    1 
ATOM 4064 C CG1   . VAL C 3 90  ? 133.914 100.599 117.264 1.00 24.71  ? 89  VAL A CG1   1 
ATOM 4065 C CG2   . VAL C 3 90  ? 134.840 100.737 119.580 1.00 24.71  ? 89  VAL A CG2   1 
ATOM 4066 N N     . MET C 3 91  ? 130.322 101.124 118.778 1.00 25.70  ? 90  MET A N     1 
ATOM 4067 C CA    . MET C 3 91  ? 129.052 101.131 118.065 1.00 25.70  ? 90  MET A CA    1 
ATOM 4068 C C     . MET C 3 91  ? 128.340 102.467 118.194 1.00 25.70  ? 90  MET A C     1 
ATOM 4069 O O     . MET C 3 91  ? 127.635 102.874 117.265 1.00 25.70  ? 90  MET A O     1 
ATOM 4070 C CB    . MET C 3 91  ? 128.143 100.017 118.577 1.00 25.70  ? 90  MET A CB    1 
ATOM 4071 C CG    . MET C 3 91  ? 128.596 98.598  118.260 1.00 25.70  ? 90  MET A CG    1 
ATOM 4072 S SD    . MET C 3 91  ? 128.667 98.236  116.496 1.00 25.70  ? 90  MET A SD    1 
ATOM 4073 C CE    . MET C 3 91  ? 130.421 98.404  116.177 1.00 25.70  ? 90  MET A CE    1 
ATOM 4074 N N     . ALA C 3 92  ? 128.587 103.216 119.270 1.00 24.36  ? 91  ALA A N     1 
ATOM 4075 C CA    . ALA C 3 92  ? 128.015 104.552 119.328 1.00 24.36  ? 91  ALA A CA    1 
ATOM 4076 C C     . ALA C 3 92  ? 128.735 105.479 118.364 1.00 24.36  ? 91  ALA A C     1 
ATOM 4077 O O     . ALA C 3 92  ? 128.102 106.308 117.700 1.00 24.36  ? 91  ALA A O     1 
ATOM 4078 C CB    . ALA C 3 92  ? 128.094 105.097 120.755 1.00 24.36  ? 91  ALA A CB    1 
ATOM 4079 N N     . LEU C 3 93  ? 130.052 105.300 118.215 1.00 22.74  ? 92  LEU A N     1 
ATOM 4080 C CA    . LEU C 3 93  ? 130.774 106.100 117.237 1.00 22.74  ? 92  LEU A CA    1 
ATOM 4081 C C     . LEU C 3 93  ? 130.418 105.710 115.813 1.00 22.74  ? 92  LEU A C     1 
ATOM 4082 O O     . LEU C 3 93  ? 130.294 106.580 114.952 1.00 22.74  ? 92  LEU A O     1 
ATOM 4083 C CB    . LEU C 3 93  ? 132.277 105.931 117.443 1.00 22.74  ? 92  LEU A CB    1 
ATOM 4084 C CG    . LEU C 3 93  ? 132.983 106.590 118.626 1.00 22.74  ? 92  LEU A CG    1 
ATOM 4085 C CD1   . LEU C 3 93  ? 134.396 106.064 118.696 1.00 22.74  ? 92  LEU A CD1   1 
ATOM 4086 C CD2   . LEU C 3 93  ? 133.009 108.090 118.480 1.00 22.74  ? 92  LEU A CD2   1 
ATOM 4087 N N     . GLN C 3 94  ? 130.131 104.438 115.568 1.00 22.04  ? 93  GLN A N     1 
ATOM 4088 C CA    . GLN C 3 94  ? 129.804 104.046 114.210 1.00 22.04  ? 93  GLN A CA    1 
ATOM 4089 C C     . GLN C 3 94  ? 128.385 104.464 113.861 1.00 22.04  ? 93  GLN A C     1 
ATOM 4090 O O     . GLN C 3 94  ? 128.138 104.929 112.747 1.00 22.04  ? 93  GLN A O     1 
ATOM 4091 C CB    . GLN C 3 94  ? 130.018 102.552 114.022 1.00 22.04  ? 93  GLN A CB    1 
ATOM 4092 C CG    . GLN C 3 94  ? 129.861 102.144 112.598 1.00 22.04  ? 93  GLN A CG    1 
ATOM 4093 C CD    . GLN C 3 94  ? 130.207 100.713 112.386 1.00 22.04  ? 93  GLN A CD    1 
ATOM 4094 O OE1   . GLN C 3 94  ? 130.526 99.993  113.330 1.00 22.04  ? 93  GLN A OE1   1 
ATOM 4095 N NE2   . GLN C 3 94  ? 130.110 100.269 111.151 1.00 22.04  ? 93  GLN A NE2   1 
ATOM 4096 N N     . GLU C 3 95  ? 127.469 104.411 114.839 1.00 23.80  ? 94  GLU A N     1 
ATOM 4097 C CA    . GLU C 3 95  ? 126.111 104.898 114.631 1.00 23.80  ? 94  GLU A CA    1 
ATOM 4098 C C     . GLU C 3 95  ? 126.106 106.398 114.428 1.00 23.80  ? 94  GLU A C     1 
ATOM 4099 O O     . GLU C 3 95  ? 125.418 106.905 113.532 1.00 23.80  ? 94  GLU A O     1 
ATOM 4100 C CB    . GLU C 3 95  ? 125.228 104.482 115.809 1.00 23.80  ? 94  GLU A CB    1 
ATOM 4101 C CG    . GLU C 3 95  ? 123.764 104.863 115.665 1.00 23.80  ? 94  GLU A CG    1 
ATOM 4102 C CD    . GLU C 3 95  ? 123.229 104.679 114.267 1.00 23.80  ? 94  GLU A CD    1 
ATOM 4103 O OE1   . GLU C 3 95  ? 123.201 103.528 113.755 1.00 23.80  ? 94  GLU A OE1   1 
ATOM 4104 O OE2   . GLU C 3 95  ? 122.810 105.715 113.712 1.00 23.80  ? 94  GLU A OE2   1 
ATOM 4105 N N     . ALA C 3 96  ? 126.993 107.105 115.120 1.00 22.38  ? 95  ALA A N     1 
ATOM 4106 C CA    . ALA C 3 96  ? 126.971 108.545 114.972 1.00 22.38  ? 95  ALA A CA    1 
ATOM 4107 C C     . ALA C 3 96  ? 127.655 108.938 113.677 1.00 22.38  ? 95  ALA A C     1 
ATOM 4108 O O     . ALA C 3 96  ? 127.231 109.894 113.029 1.00 22.38  ? 95  ALA A O     1 
ATOM 4109 C CB    . ALA C 3 96  ? 127.641 109.226 116.160 1.00 22.38  ? 95  ALA A CB    1 
ATOM 4110 N N     . CYS C 3 97  ? 128.654 108.170 113.235 1.00 21.36  ? 96  CYS A N     1 
ATOM 4111 C CA    . CYS C 3 97  ? 129.321 108.510 111.985 1.00 21.36  ? 96  CYS A CA    1 
ATOM 4112 C C     . CYS C 3 97  ? 128.469 108.185 110.773 1.00 21.36  ? 96  CYS A C     1 
ATOM 4113 O O     . CYS C 3 97  ? 128.502 108.932 109.790 1.00 21.36  ? 96  CYS A O     1 
ATOM 4114 C CB    . CYS C 3 97  ? 130.656 107.791 111.877 1.00 21.36  ? 96  CYS A CB    1 
ATOM 4115 S SG    . CYS C 3 97  ? 131.858 108.325 113.087 1.00 21.36  ? 96  CYS A SG    1 
ATOM 4116 N N     . GLU C 3 98  ? 127.673 107.119 110.805 1.00 21.20  ? 97  GLU A N     1 
ATOM 4117 C CA    . GLU C 3 98  ? 126.822 106.983 109.635 1.00 21.20  ? 97  GLU A CA    1 
ATOM 4118 C C     . GLU C 3 98  ? 125.665 107.958 109.719 1.00 21.20  ? 97  GLU A C     1 
ATOM 4119 O O     . GLU C 3 98  ? 125.235 108.472 108.687 1.00 21.20  ? 97  GLU A O     1 
ATOM 4120 C CB    . GLU C 3 98  ? 126.318 105.561 109.368 1.00 21.20  ? 97  GLU A CB    1 
ATOM 4121 C CG    . GLU C 3 98  ? 127.403 104.561 109.002 1.00 21.20  ? 97  GLU A CG    1 
ATOM 4122 C CD    . GLU C 3 98  ? 127.585 103.517 110.041 1.00 21.20  ? 97  GLU A CD    1 
ATOM 4123 O OE1   . GLU C 3 98  ? 126.873 103.608 111.051 1.00 21.20  ? 97  GLU A OE1   1 
ATOM 4124 O OE2   . GLU C 3 98  ? 128.444 102.629 109.865 1.00 21.20  ? 97  GLU A OE2   1 
ATOM 4125 N N     . ALA C 3 99  ? 125.199 108.305 110.922 1.00 20.61  ? 98  ALA A N     1 
ATOM 4126 C CA    . ALA C 3 99  ? 124.151 109.311 110.981 1.00 20.61  ? 98  ALA A CA    1 
ATOM 4127 C C     . ALA C 3 99  ? 124.682 110.694 110.638 1.00 20.61  ? 98  ALA A C     1 
ATOM 4128 O O     . ALA C 3 99  ? 123.893 111.594 110.341 1.00 20.61  ? 98  ALA A O     1 
ATOM 4129 C CB    . ALA C 3 99  ? 123.511 109.322 112.367 1.00 20.61  ? 98  ALA A CB    1 
ATOM 4130 N N     . TYR C 3 100 ? 126.001 110.871 110.659 1.00 19.82  ? 99  TYR A N     1 
ATOM 4131 C CA    . TYR C 3 100 ? 126.611 112.094 110.157 1.00 19.82  ? 99  TYR A CA    1 
ATOM 4132 C C     . TYR C 3 100 ? 126.758 112.054 108.644 1.00 19.82  ? 99  TYR A C     1 
ATOM 4133 O O     . TYR C 3 100 ? 126.456 113.036 107.960 1.00 19.82  ? 99  TYR A O     1 
ATOM 4134 C CB    . TYR C 3 100 ? 127.974 112.308 110.816 1.00 19.82  ? 99  TYR A CB    1 
ATOM 4135 C CG    . TYR C 3 100 ? 128.766 113.472 110.259 1.00 19.82  ? 99  TYR A CG    1 
ATOM 4136 C CD1   . TYR C 3 100 ? 128.414 114.783 110.550 1.00 19.82  ? 99  TYR A CD1   1 
ATOM 4137 C CD2   . TYR C 3 100 ? 129.868 113.258 109.447 1.00 19.82  ? 99  TYR A CD2   1 
ATOM 4138 C CE1   . TYR C 3 100 ? 129.137 115.845 110.042 1.00 19.82  ? 99  TYR A CE1   1 
ATOM 4139 C CE2   . TYR C 3 100 ? 130.593 114.311 108.938 1.00 19.82  ? 99  TYR A CE2   1 
ATOM 4140 C CZ    . TYR C 3 100 ? 130.225 115.600 109.237 1.00 19.82  ? 99  TYR A CZ    1 
ATOM 4141 O OH    . TYR C 3 100 ? 130.956 116.644 108.725 1.00 19.82  ? 99  TYR A OH    1 
ATOM 4142 N N     . LEU C 3 101 ? 127.231 110.931 108.103 1.00 18.48  ? 100 LEU A N     1 
ATOM 4143 C CA    . LEU C 3 101 ? 127.503 110.877 106.672 1.00 18.48  ? 100 LEU A CA    1 
ATOM 4144 C C     . LEU C 3 101 ? 126.219 110.883 105.847 1.00 18.48  ? 100 LEU A C     1 
ATOM 4145 O O     . LEU C 3 101 ? 126.186 111.478 104.768 1.00 18.48  ? 100 LEU A O     1 
ATOM 4146 C CB    . LEU C 3 101 ? 128.360 109.655 106.356 1.00 18.48  ? 100 LEU A CB    1 
ATOM 4147 C CG    . LEU C 3 101 ? 129.806 109.836 106.821 1.00 18.48  ? 100 LEU A CG    1 
ATOM 4148 C CD1   . LEU C 3 101 ? 130.616 108.570 106.658 1.00 18.48  ? 100 LEU A CD1   1 
ATOM 4149 C CD2   . LEU C 3 101 ? 130.463 110.978 106.068 1.00 18.48  ? 100 LEU A CD2   1 
ATOM 4150 N N     . VAL C 3 102 ? 125.155 110.220 106.311 1.00 18.08  ? 101 VAL A N     1 
ATOM 4151 C CA    . VAL C 3 102 ? 123.901 110.300 105.559 1.00 18.08  ? 101 VAL A CA    1 
ATOM 4152 C C     . VAL C 3 102 ? 123.349 111.721 105.586 1.00 18.08  ? 101 VAL A C     1 
ATOM 4153 O O     . VAL C 3 102 ? 122.871 112.237 104.567 1.00 18.08  ? 101 VAL A O     1 
ATOM 4154 C CB    . VAL C 3 102 ? 122.867 109.277 106.062 1.00 18.08  ? 101 VAL A CB    1 
ATOM 4155 C CG1   . VAL C 3 102 ? 121.909 108.945 104.959 1.00 18.08  ? 101 VAL A CG1   1 
ATOM 4156 C CG2   . VAL C 3 102 ? 123.538 107.995 106.425 1.00 18.08  ? 101 VAL A CG2   1 
ATOM 4157 N N     . GLY C 3 103 ? 123.439 112.393 106.736 1.00 17.53  ? 102 GLY A N     1 
ATOM 4158 C CA    . GLY C 3 103 ? 122.975 113.764 106.797 1.00 17.53  ? 102 GLY A CA    1 
ATOM 4159 C C     . GLY C 3 103 ? 123.866 114.714 106.039 1.00 17.53  ? 102 GLY A C     1 
ATOM 4160 O O     . GLY C 3 103 ? 123.442 115.827 105.714 1.00 17.53  ? 102 GLY A O     1 
ATOM 4161 N N     . LEU C 3 104 ? 125.098 114.297 105.754 1.00 17.02  ? 103 LEU A N     1 
ATOM 4162 C CA    . LEU C 3 104 ? 125.971 115.092 104.906 1.00 17.02  ? 103 LEU A CA    1 
ATOM 4163 C C     . LEU C 3 104 ? 125.656 114.863 103.437 1.00 17.02  ? 103 LEU A C     1 
ATOM 4164 O O     . LEU C 3 104 ? 125.600 115.819 102.660 1.00 17.02  ? 103 LEU A O     1 
ATOM 4165 C CB    . LEU C 3 104 ? 127.432 114.764 105.191 1.00 17.02  ? 103 LEU A CB    1 
ATOM 4166 C CG    . LEU C 3 104 ? 128.428 115.560 104.352 1.00 17.02  ? 103 LEU A CG    1 
ATOM 4167 C CD1   . LEU C 3 104 ? 128.334 117.043 104.657 1.00 17.02  ? 103 LEU A CD1   1 
ATOM 4168 C CD2   . LEU C 3 104 ? 129.828 115.054 104.594 1.00 17.02  ? 103 LEU A CD2   1 
ATOM 4169 N N     . PHE C 3 105 ? 125.378 113.619 103.047 1.00 16.70  ? 104 PHE A N     1 
ATOM 4170 C CA    . PHE C 3 105 ? 125.065 113.373 101.649 1.00 16.70  ? 104 PHE A CA    1 
ATOM 4171 C C     . PHE C 3 105 ? 123.660 113.807 101.289 1.00 16.70  ? 104 PHE A C     1 
ATOM 4172 O O     . PHE C 3 105 ? 123.383 114.016 100.105 1.00 16.70  ? 104 PHE A O     1 
ATOM 4173 C CB    . PHE C 3 105 ? 125.228 111.895 101.290 1.00 16.70  ? 104 PHE A CB    1 
ATOM 4174 C CG    . PHE C 3 105 ? 126.649 111.438 101.210 1.00 16.70  ? 104 PHE A CG    1 
ATOM 4175 C CD1   . PHE C 3 105 ? 127.476 111.898 100.206 1.00 16.70  ? 104 PHE A CD1   1 
ATOM 4176 C CD2   . PHE C 3 105 ? 127.146 110.515 102.106 1.00 16.70  ? 104 PHE A CD2   1 
ATOM 4177 C CE1   . PHE C 3 105 ? 128.778 111.471 100.118 1.00 16.70  ? 104 PHE A CE1   1 
ATOM 4178 C CE2   . PHE C 3 105 ? 128.446 110.084 102.022 1.00 16.70  ? 104 PHE A CE2   1 
ATOM 4179 C CZ    . PHE C 3 105 ? 129.263 110.562 101.027 1.00 16.70  ? 104 PHE A CZ    1 
ATOM 4180 N N     . GLU C 3 106 ? 122.831 114.122 102.279 1.00 17.52  ? 105 GLU A N     1 
ATOM 4181 C CA    . GLU C 3 106 ? 121.522 114.663 101.949 1.00 17.52  ? 105 GLU A CA    1 
ATOM 4182 C C     . GLU C 3 106 ? 121.633 116.129 101.568 1.00 17.52  ? 105 GLU A C     1 
ATOM 4183 O O     . GLU C 3 106 ? 120.838 116.610 100.755 1.00 17.52  ? 105 GLU A O     1 
ATOM 4184 C CB    . GLU C 3 106 ? 120.533 114.459 103.096 1.00 17.52  ? 105 GLU A CB    1 
ATOM 4185 C CG    . GLU C 3 106 ? 120.146 113.004 103.300 1.00 17.52  ? 105 GLU A CG    1 
ATOM 4186 C CD    . GLU C 3 106 ? 119.128 112.809 104.401 1.00 17.52  ? 105 GLU A CD    1 
ATOM 4187 O OE1   . GLU C 3 106 ? 119.483 112.227 105.447 1.00 17.52  ? 105 GLU A OE1   1 
ATOM 4188 O OE2   . GLU C 3 106 ? 117.968 113.233 104.217 1.00 17.52  ? 105 GLU A OE2   1 
ATOM 4189 N N     . ASP C 3 107 ? 122.601 116.854 102.134 1.00 17.27  ? 106 ASP A N     1 
ATOM 4190 C CA    . ASP C 3 107 ? 122.855 118.210 101.671 1.00 17.27  ? 106 ASP A CA    1 
ATOM 4191 C C     . ASP C 3 107 ? 123.798 118.252 100.478 1.00 17.27  ? 106 ASP A C     1 
ATOM 4192 O O     . ASP C 3 107 ? 123.719 119.192 99.677  1.00 17.27  ? 106 ASP A O     1 
ATOM 4193 C CB    . ASP C 3 107 ? 123.439 119.055 102.805 1.00 17.27  ? 106 ASP A CB    1 
ATOM 4194 C CG    . ASP C 3 107 ? 122.471 119.236 103.954 1.00 17.27  ? 106 ASP A CG    1 
ATOM 4195 O OD1   . ASP C 3 107 ? 121.246 119.196 103.716 1.00 17.27  ? 106 ASP A OD1   1 
ATOM 4196 O OD2   . ASP C 3 107 ? 122.935 119.419 105.098 1.00 17.27  ? 106 ASP A OD2   1 
ATOM 4197 N N     . THR C 3 108 ? 124.645 117.235 100.297 1.00 16.23  ? 107 THR A N     1 
ATOM 4198 C CA    . THR C 3 108 ? 125.451 117.188 99.080  1.00 16.23  ? 107 THR A CA    1 
ATOM 4199 C C     . THR C 3 108 ? 124.561 116.924 97.878  1.00 16.23  ? 107 THR A C     1 
ATOM 4200 O O     . THR C 3 108 ? 124.804 117.460 96.793  1.00 16.23  ? 107 THR A O     1 
ATOM 4201 C CB    . THR C 3 108 ? 126.566 116.143 99.155  1.00 16.23  ? 107 THR A CB    1 
ATOM 4202 O OG1   . THR C 3 108 ? 126.013 114.827 99.117  1.00 16.23  ? 107 THR A OG1   1 
ATOM 4203 C CG2   . THR C 3 108 ? 127.434 116.338 100.379 1.00 16.23  ? 107 THR A CG2   1 
ATOM 4204 N N     . ASN C 3 109 ? 123.524 116.099 98.047  1.00 15.76  ? 108 ASN A N     1 
ATOM 4205 C CA    . ASN C 3 109 ? 122.632 115.850 96.926  1.00 15.76  ? 108 ASN A CA    1 
ATOM 4206 C C     . ASN C 3 109 ? 121.800 117.085 96.623  1.00 15.76  ? 108 ASN A C     1 
ATOM 4207 O O     . ASN C 3 109 ? 121.444 117.320 95.465  1.00 15.76  ? 108 ASN A O     1 
ATOM 4208 C CB    . ASN C 3 109 ? 121.728 114.656 97.225  1.00 15.76  ? 108 ASN A CB    1 
ATOM 4209 C CG    . ASN C 3 109 ? 121.103 114.076 95.980  1.00 15.76  ? 108 ASN A CG    1 
ATOM 4210 O OD1   . ASN C 3 109 ? 121.426 114.483 94.867  1.00 15.76  ? 108 ASN A OD1   1 
ATOM 4211 N ND2   . ASN C 3 109 ? 120.197 113.126 96.158  1.00 15.76  ? 108 ASN A ND2   1 
ATOM 4212 N N     . LEU C 3 110 ? 121.548 117.924 97.629  1.00 15.30  ? 109 LEU A N     1 
ATOM 4213 C CA    . LEU C 3 110 ? 120.852 119.177 97.370  1.00 15.30  ? 109 LEU A CA    1 
ATOM 4214 C C     . LEU C 3 110 ? 121.767 120.146 96.641  1.00 15.30  ? 109 LEU A C     1 
ATOM 4215 O O     . LEU C 3 110 ? 121.324 120.882 95.752  1.00 15.30  ? 109 LEU A O     1 
ATOM 4216 C CB    . LEU C 3 110 ? 120.359 119.791 98.675  1.00 15.30  ? 109 LEU A CB    1 
ATOM 4217 C CG    . LEU C 3 110 ? 119.267 119.049 99.433  1.00 15.30  ? 109 LEU A CG    1 
ATOM 4218 C CD1   . LEU C 3 110 ? 119.028 119.730 100.759 1.00 15.30  ? 109 LEU A CD1   1 
ATOM 4219 C CD2   . LEU C 3 110 ? 117.988 119.003 98.621  1.00 15.30  ? 109 LEU A CD2   1 
ATOM 4220 N N     . CYS C 3 111 ? 123.058 120.128 96.973  1.00 15.92  ? 110 CYS A N     1 
ATOM 4221 C CA    . CYS C 3 111 ? 123.993 121.001 96.281  1.00 15.92  ? 110 CYS A CA    1 
ATOM 4222 C C     . CYS C 3 111 ? 124.305 120.501 94.884  1.00 15.92  ? 110 CYS A C     1 
ATOM 4223 O O     . CYS C 3 111 ? 124.718 121.293 94.034  1.00 15.92  ? 110 CYS A O     1 
ATOM 4224 C CB    . CYS C 3 111 ? 125.304 121.108 97.059  1.00 15.92  ? 110 CYS A CB    1 
ATOM 4225 S SG    . CYS C 3 111 ? 125.261 122.137 98.520  1.00 15.92  ? 110 CYS A SG    1 
ATOM 4226 N N     . ALA C 3 112 ? 124.115 119.208 94.628  1.00 14.99  ? 111 ALA A N     1 
ATOM 4227 C CA    . ALA C 3 112 ? 124.317 118.692 93.283  1.00 14.99  ? 111 ALA A CA    1 
ATOM 4228 C C     . ALA C 3 112 ? 123.085 118.906 92.418  1.00 14.99  ? 111 ALA A C     1 
ATOM 4229 O O     . ALA C 3 112 ? 123.208 119.172 91.219  1.00 14.99  ? 111 ALA A O     1 
ATOM 4230 C CB    . ALA C 3 112 ? 124.677 117.210 93.335  1.00 14.99  ? 111 ALA A CB    1 
ATOM 4231 N N     . ILE C 3 113 ? 121.889 118.802 93.004  1.00 14.73  ? 112 ILE A N     1 
ATOM 4232 C CA    . ILE C 3 113 ? 120.697 119.152 92.247  1.00 14.73  ? 112 ILE A CA    1 
ATOM 4233 C C     . ILE C 3 113 ? 120.670 120.646 91.981  1.00 14.73  ? 112 ILE A C     1 
ATOM 4234 O O     . ILE C 3 113 ? 120.149 121.094 90.952  1.00 14.73  ? 112 ILE A O     1 
ATOM 4235 C CB    . ILE C 3 113 ? 119.443 118.684 93.007  1.00 14.73  ? 112 ILE A CB    1 
ATOM 4236 C CG1   . ILE C 3 113 ? 119.397 117.160 93.064  1.00 14.73  ? 112 ILE A CG1   1 
ATOM 4237 C CG2   . ILE C 3 113 ? 118.179 119.213 92.357  1.00 14.73  ? 112 ILE A CG2   1 
ATOM 4238 C CD1   . ILE C 3 113 ? 118.341 116.627 93.997  1.00 14.73  ? 112 ILE A CD1   1 
ATOM 4239 N N     . HIS C 3 114 ? 121.243 121.443 92.885  1.00 15.23  ? 113 HIS A N     1 
ATOM 4240 C CA    . HIS C 3 114 ? 121.181 122.888 92.725  1.00 15.23  ? 113 HIS A CA    1 
ATOM 4241 C C     . HIS C 3 114 ? 121.952 123.356 91.502  1.00 15.23  ? 113 HIS A C     1 
ATOM 4242 O O     . HIS C 3 114 ? 121.612 124.385 90.909  1.00 15.23  ? 113 HIS A O     1 
ATOM 4243 C CB    . HIS C 3 114 ? 121.713 123.581 93.971  1.00 15.23  ? 113 HIS A CB    1 
ATOM 4244 C CG    . HIS C 3 114 ? 121.549 125.064 93.938  1.00 15.23  ? 113 HIS A CG    1 
ATOM 4245 N ND1   . HIS C 3 114 ? 122.500 125.899 93.398  1.00 15.23  ? 113 HIS A ND1   1 
ATOM 4246 C CD2   . HIS C 3 114 ? 120.542 125.862 94.360  1.00 15.23  ? 113 HIS A CD2   1 
ATOM 4247 C CE1   . HIS C 3 114 ? 122.090 127.149 93.493  1.00 15.23  ? 113 HIS A CE1   1 
ATOM 4248 N NE2   . HIS C 3 114 ? 120.906 127.155 94.077  1.00 15.23  ? 113 HIS A NE2   1 
ATOM 4249 N N     . ALA C 3 115 ? 122.980 122.613 91.104  1.00 15.48  ? 114 ALA A N     1 
ATOM 4250 C CA    . ALA C 3 115 ? 123.749 122.911 89.908  1.00 15.48  ? 114 ALA A CA    1 
ATOM 4251 C C     . ALA C 3 115 ? 123.203 122.224 88.669  1.00 15.48  ? 114 ALA A C     1 
ATOM 4252 O O     . ALA C 3 115 ? 123.887 122.198 87.641  1.00 15.48  ? 114 ALA A O     1 
ATOM 4253 C CB    . ALA C 3 115 ? 125.212 122.515 90.115  1.00 15.48  ? 114 ALA A CB    1 
ATOM 4254 N N     . LYS C 3 116 ? 122.002 121.654 88.753  1.00 16.01  ? 115 LYS A N     1 
ATOM 4255 C CA    . LYS C 3 116 ? 121.394 120.915 87.653  1.00 16.01  ? 115 LYS A CA    1 
ATOM 4256 C C     . LYS C 3 116 ? 122.289 119.741 87.259  1.00 16.01  ? 115 LYS A C     1 
ATOM 4257 O O     . LYS C 3 116 ? 122.692 119.583 86.106  1.00 16.01  ? 115 LYS A O     1 
ATOM 4258 C CB    . LYS C 3 116 ? 121.117 121.841 86.467  1.00 16.01  ? 115 LYS A CB    1 
ATOM 4259 C CG    . LYS C 3 116 ? 120.052 122.878 86.752  1.00 16.01  ? 115 LYS A CG    1 
ATOM 4260 C CD    . LYS C 3 116 ? 119.797 123.750 85.545  1.00 16.01  ? 115 LYS A CD    1 
ATOM 4261 C CE    . LYS C 3 116 ? 118.741 124.795 85.847  1.00 16.01  ? 115 LYS A CE    1 
ATOM 4262 N NZ    . LYS C 3 116 ? 118.485 125.653 84.662  1.00 16.01  ? 115 LYS A NZ    1 
ATOM 4263 N N     . ARG C 3 117 ? 122.594 118.915 88.256  1.00 16.48  ? 116 ARG A N     1 
ATOM 4264 C CA    . ARG C 3 117 ? 123.361 117.700 88.053  1.00 16.48  ? 116 ARG A CA    1 
ATOM 4265 C C     . ARG C 3 117 ? 122.729 116.567 88.843  1.00 16.48  ? 116 ARG A C     1 
ATOM 4266 O O     . ARG C 3 117 ? 121.835 116.770 89.668  1.00 16.48  ? 116 ARG A O     1 
ATOM 4267 C CB    . ARG C 3 117 ? 124.821 117.892 88.476  1.00 16.48  ? 116 ARG A CB    1 
ATOM 4268 C CG    . ARG C 3 117 ? 125.628 118.779 87.550  1.00 16.48  ? 116 ARG A CG    1 
ATOM 4269 C CD    . ARG C 3 117 ? 127.084 118.796 87.963  1.00 16.48  ? 116 ARG A CD    1 
ATOM 4270 N NE    . ARG C 3 117 ? 127.276 119.498 89.226  1.00 16.48  ? 116 ARG A NE    1 
ATOM 4271 C CZ    . ARG C 3 117 ? 127.695 118.919 90.344  1.00 16.48  ? 116 ARG A CZ    1 
ATOM 4272 N NH1   . ARG C 3 117 ? 127.973 117.625 90.354  1.00 16.48  ? 116 ARG A NH1   1 
ATOM 4273 N NH2   . ARG C 3 117 ? 127.846 119.633 91.450  1.00 16.48  ? 116 ARG A NH2   1 
ATOM 4274 N N     . VAL C 3 118 ? 123.207 115.358 88.571  1.00 17.63  ? 117 VAL A N     1 
ATOM 4275 C CA    . VAL C 3 118 ? 122.856 114.179 89.341  1.00 17.63  ? 117 VAL A CA    1 
ATOM 4276 C C     . VAL C 3 118 ? 124.063 113.623 90.084  1.00 17.63  ? 117 VAL A C     1 
ATOM 4277 O O     . VAL C 3 118 ? 123.953 113.212 91.240  1.00 17.63  ? 117 VAL A O     1 
ATOM 4278 C CB    . VAL C 3 118 ? 122.227 113.107 88.426  1.00 17.63  ? 117 VAL A CB    1 
ATOM 4279 C CG1   . VAL C 3 118 ? 121.913 111.855 89.212  1.00 17.63  ? 117 VAL A CG1   1 
ATOM 4280 C CG2   . VAL C 3 118 ? 120.982 113.652 87.758  1.00 17.63  ? 117 VAL A CG2   1 
ATOM 4281 N N     . THR C 3 119 ? 125.221 113.610 89.435  1.00 17.70  ? 118 THR A N     1 
ATOM 4282 C CA    . THR C 3 119 ? 126.438 113.135 90.071  1.00 17.70  ? 118 THR A CA    1 
ATOM 4283 C C     . THR C 3 119 ? 126.899 114.127 91.126  1.00 17.70  ? 118 THR A C     1 
ATOM 4284 O O     . THR C 3 119 ? 127.019 115.323 90.850  1.00 17.70  ? 118 THR A O     1 
ATOM 4285 C CB    . THR C 3 119 ? 127.533 112.959 89.022  1.00 17.70  ? 118 THR A CB    1 
ATOM 4286 O OG1   . THR C 3 119 ? 127.078 112.082 87.989  1.00 17.70  ? 118 THR A OG1   1 
ATOM 4287 C CG2   . THR C 3 119 ? 128.774 112.374 89.647  1.00 17.70  ? 118 THR A CG2   1 
ATOM 4288 N N     . ILE C 3 120 ? 127.156 113.642 92.333  1.00 17.13  ? 119 ILE A N     1 
ATOM 4289 C CA    . ILE C 3 120 ? 127.739 114.503 93.351  1.00 17.13  ? 119 ILE A CA    1 
ATOM 4290 C C     . ILE C 3 120 ? 129.246 114.548 93.150  1.00 17.13  ? 119 ILE A C     1 
ATOM 4291 O O     . ILE C 3 120 ? 129.873 113.557 92.769  1.00 17.13  ? 119 ILE A O     1 
ATOM 4292 C CB    . ILE C 3 120 ? 127.367 114.031 94.770  1.00 17.13  ? 119 ILE A CB    1 
ATOM 4293 C CG1   . ILE C 3 120 ? 127.935 112.641 95.053  1.00 17.13  ? 119 ILE A CG1   1 
ATOM 4294 C CG2   . ILE C 3 120 ? 125.866 114.070 94.969  1.00 17.13  ? 119 ILE A CG2   1 
ATOM 4295 C CD1   . ILE C 3 120 ? 127.834 112.226 96.502  1.00 17.13  ? 119 ILE A CD1   1 
ATOM 4296 N N     . MET C 3 121 ? 129.835 115.699 93.420  1.00 18.13  ? 120 MET A N     1 
ATOM 4297 C CA    . MET C 3 121 ? 131.250 115.958 93.203  1.00 18.13  ? 120 MET A CA    1 
ATOM 4298 C C     . MET C 3 121 ? 131.845 116.489 94.492  1.00 18.13  ? 120 MET A C     1 
ATOM 4299 O O     . MET C 3 121 ? 131.114 116.883 95.406  1.00 18.13  ? 120 MET A O     1 
ATOM 4300 C CB    . MET C 3 121 ? 131.443 116.951 92.046  1.00 18.13  ? 120 MET A CB    1 
ATOM 4301 C CG    . MET C 3 121 ? 131.180 116.320 90.694  1.00 18.13  ? 120 MET A CG    1 
ATOM 4302 S SD    . MET C 3 121 ? 131.466 117.427 89.310  1.00 18.13  ? 120 MET A SD    1 
ATOM 4303 C CE    . MET C 3 121 ? 131.041 116.349 87.947  1.00 18.13  ? 120 MET A CE    1 
ATOM 4304 N N     . PRO C 3 122 ? 133.177 116.509 94.615  1.00 17.50  ? 121 PRO A N     1 
ATOM 4305 C CA    . PRO C 3 122 ? 133.766 116.948 95.887  1.00 17.50  ? 121 PRO A CA    1 
ATOM 4306 C C     . PRO C 3 122 ? 133.494 118.402 96.190  1.00 17.50  ? 121 PRO A C     1 
ATOM 4307 O O     . PRO C 3 122 ? 133.524 118.794 97.365  1.00 17.50  ? 121 PRO A O     1 
ATOM 4308 C CB    . PRO C 3 122 ? 135.263 116.692 95.689  1.00 17.50  ? 121 PRO A CB    1 
ATOM 4309 C CG    . PRO C 3 122 ? 135.319 115.618 94.693  1.00 17.50  ? 121 PRO A CG    1 
ATOM 4310 C CD    . PRO C 3 122 ? 134.186 115.878 93.749  1.00 17.50  ? 121 PRO A CD    1 
ATOM 4311 N N     . LYS C 3 123 ? 133.150 119.202 95.185  1.00 17.16  ? 122 LYS A N     1 
ATOM 4312 C CA    . LYS C 3 123 ? 132.798 120.577 95.475  1.00 17.16  ? 122 LYS A CA    1 
ATOM 4313 C C     . LYS C 3 123 ? 131.419 120.671 96.097  1.00 17.16  ? 122 LYS A C     1 
ATOM 4314 O O     . LYS C 3 123 ? 131.120 121.667 96.761  1.00 17.16  ? 122 LYS A O     1 
ATOM 4315 C CB    . LYS C 3 123 ? 132.865 121.421 94.202  1.00 17.16  ? 122 LYS A CB    1 
ATOM 4316 C CG    . LYS C 3 123 ? 131.842 121.046 93.150  1.00 17.16  ? 122 LYS A CG    1 
ATOM 4317 C CD    . LYS C 3 123 ? 131.952 121.958 91.943  1.00 17.16  ? 122 LYS A CD    1 
ATOM 4318 C CE    . LYS C 3 123 ? 133.188 121.631 91.124  1.00 17.16  ? 122 LYS A CE    1 
ATOM 4319 N NZ    . LYS C 3 123 ? 133.241 122.404 89.854  1.00 17.16  ? 122 LYS A NZ    1 
ATOM 4320 N N     . ASP C 3 124 ? 130.636 119.594 96.036  1.00 17.05  ? 123 ASP A N     1 
ATOM 4321 C CA    . ASP C 3 124 ? 129.328 119.619 96.667  1.00 17.05  ? 123 ASP A CA    1 
ATOM 4322 C C     . ASP C 3 124 ? 129.455 119.306 98.145  1.00 17.05  ? 123 ASP A C     1 
ATOM 4323 O O     . ASP C 3 124 ? 128.769 119.918 98.970  1.00 17.05  ? 123 ASP A O     1 
ATOM 4324 C CB    . ASP C 3 124 ? 128.410 118.590 96.011  1.00 17.05  ? 123 ASP A CB    1 
ATOM 4325 C CG    . ASP C 3 124 ? 128.243 118.823 94.532  1.00 17.05  ? 123 ASP A CG    1 
ATOM 4326 O OD1   . ASP C 3 124 ? 128.425 119.968 94.090  1.00 17.05  ? 123 ASP A OD1   1 
ATOM 4327 O OD2   . ASP C 3 124 ? 127.937 117.856 93.807  1.00 17.05  ? 123 ASP A OD2   1 
ATOM 4328 N N     . ILE C 3 125 ? 130.390 118.424 98.501  1.00 16.87  ? 124 ILE A N     1 
ATOM 4329 C CA    . ILE C 3 125 ? 130.691 118.202 99.906  1.00 16.87  ? 124 ILE A CA    1 
ATOM 4330 C C     . ILE C 3 125 ? 131.363 119.432 100.488 1.00 16.87  ? 124 ILE A C     1 
ATOM 4331 O O     . ILE C 3 125 ? 131.089 119.829 101.627 1.00 16.87  ? 124 ILE A O     1 
ATOM 4332 C CB    . ILE C 3 125 ? 131.572 116.952 100.074 1.00 16.87  ? 124 ILE A CB    1 
ATOM 4333 C CG1   . ILE C 3 125 ? 130.863 115.713 99.538  1.00 16.87  ? 124 ILE A CG1   1 
ATOM 4334 C CG2   . ILE C 3 125 ? 131.931 116.747 101.528 1.00 16.87  ? 124 ILE A CG2   1 
ATOM 4335 C CD1   . ILE C 3 125 ? 131.747 114.496 99.479  1.00 16.87  ? 124 ILE A CD1   1 
ATOM 4336 N N     . GLN C 3 126 ? 132.225 120.082 99.702  1.00 17.15  ? 125 GLN A N     1 
ATOM 4337 C CA    . GLN C 3 126 ? 132.888 121.273 100.211 1.00 17.15  ? 125 GLN A CA    1 
ATOM 4338 C C     . GLN C 3 126 ? 131.916 122.432 100.383 1.00 17.15  ? 125 GLN A C     1 
ATOM 4339 O O     . GLN C 3 126 ? 132.042 123.199 101.344 1.00 17.15  ? 125 GLN A O     1 
ATOM 4340 C CB    . GLN C 3 126 ? 134.025 121.670 99.275  1.00 17.15  ? 125 GLN A CB    1 
ATOM 4341 C CG    . GLN C 3 126 ? 135.168 120.680 99.256  1.00 17.15  ? 125 GLN A CG    1 
ATOM 4342 C CD    . GLN C 3 126 ? 136.170 120.978 98.167  1.00 17.15  ? 125 GLN A CD    1 
ATOM 4343 O OE1   . GLN C 3 126 ? 135.980 121.895 97.370  1.00 17.15  ? 125 GLN A OE1   1 
ATOM 4344 N NE2   . GLN C 3 126 ? 137.240 120.195 98.118  1.00 17.15  ? 125 GLN A NE2   1 
ATOM 4345 N N     . LEU C 3 127 ? 130.885 122.522 99.540  1.00 16.14  ? 126 LEU A N     1 
ATOM 4346 C CA    . LEU C 3 127 ? 129.897 123.570 99.752  1.00 16.14  ? 126 LEU A CA    1 
ATOM 4347 C C     . LEU C 3 127 ? 128.984 123.233 100.921 1.00 16.14  ? 126 LEU A C     1 
ATOM 4348 O O     . LEU C 3 127 ? 128.649 124.110 101.728 1.00 16.14  ? 126 LEU A O     1 
ATOM 4349 C CB    . LEU C 3 127 ? 129.081 123.781 98.480  1.00 16.14  ? 126 LEU A CB    1 
ATOM 4350 C CG    . LEU C 3 127 ? 128.016 124.869 98.550  1.00 16.14  ? 126 LEU A CG    1 
ATOM 4351 C CD1   . LEU C 3 127 ? 128.672 126.214 98.772  1.00 16.14  ? 126 LEU A CD1   1 
ATOM 4352 C CD2   . LEU C 3 127 ? 127.171 124.884 97.299  1.00 16.14  ? 126 LEU A CD2   1 
ATOM 4353 N N     . ALA C 3 128 ? 128.595 121.962 101.053 1.00 17.23  ? 127 ALA A N     1 
ATOM 4354 C CA    . ALA C 3 128 ? 127.718 121.587 102.148 1.00 17.23  ? 127 ALA A CA    1 
ATOM 4355 C C     . ALA C 3 128 ? 128.424 121.661 103.490 1.00 17.23  ? 127 ALA A C     1 
ATOM 4356 O O     . ALA C 3 128 ? 127.755 121.758 104.523 1.00 17.23  ? 127 ALA A O     1 
ATOM 4357 C CB    . ALA C 3 128 ? 127.168 120.180 101.926 1.00 17.23  ? 127 ALA A CB    1 
ATOM 4358 N N     . ARG C 3 129 ? 129.755 121.626 103.501 1.00 18.36  ? 128 ARG A N     1 
ATOM 4359 C CA    . ARG C 3 129 ? 130.480 121.818 104.745 1.00 18.36  ? 128 ARG A CA    1 
ATOM 4360 C C     . ARG C 3 129 ? 130.878 123.261 104.991 1.00 18.36  ? 128 ARG A C     1 
ATOM 4361 O O     . ARG C 3 129 ? 131.053 123.644 106.152 1.00 18.36  ? 128 ARG A O     1 
ATOM 4362 C CB    . ARG C 3 129 ? 131.742 120.957 104.776 1.00 18.36  ? 128 ARG A CB    1 
ATOM 4363 C CG    . ARG C 3 129 ? 131.499 119.471 104.851 1.00 18.36  ? 128 ARG A CG    1 
ATOM 4364 C CD    . ARG C 3 129 ? 132.822 118.768 105.005 1.00 18.36  ? 128 ARG A CD    1 
ATOM 4365 N NE    . ARG C 3 129 ? 133.423 119.073 106.297 1.00 18.36  ? 128 ARG A NE    1 
ATOM 4366 C CZ    . ARG C 3 129 ? 134.681 118.799 106.620 1.00 18.36  ? 128 ARG A CZ    1 
ATOM 4367 N NH1   . ARG C 3 129 ? 135.483 118.220 105.741 1.00 18.36  ? 128 ARG A NH1   1 
ATOM 4368 N NH2   . ARG C 3 129 ? 135.140 119.113 107.821 1.00 18.36  ? 128 ARG A NH2   1 
ATOM 4369 N N     . ARG C 3 130 ? 131.026 124.076 103.945 1.00 18.85  ? 129 ARG A N     1 
ATOM 4370 C CA    . ARG C 3 130 ? 131.333 125.474 104.203 1.00 18.85  ? 129 ARG A CA    1 
ATOM 4371 C C     . ARG C 3 130 ? 130.087 126.239 104.620 1.00 18.85  ? 129 ARG A C     1 
ATOM 4372 O O     . ARG C 3 130 ? 130.177 127.156 105.443 1.00 18.85  ? 129 ARG A O     1 
ATOM 4373 C CB    . ARG C 3 130 ? 131.985 126.115 102.977 1.00 18.85  ? 129 ARG A CB    1 
ATOM 4374 C CG    . ARG C 3 130 ? 132.499 127.523 103.229 1.00 18.85  ? 129 ARG A CG    1 
ATOM 4375 C CD    . ARG C 3 130 ? 133.214 128.099 102.018 1.00 18.85  ? 129 ARG A CD    1 
ATOM 4376 N NE    . ARG C 3 130 ? 134.451 127.382 101.722 1.00 18.85  ? 129 ARG A NE    1 
ATOM 4377 C CZ    . ARG C 3 130 ? 134.671 126.703 100.600 1.00 18.85  ? 129 ARG A CZ    1 
ATOM 4378 N NH1   . ARG C 3 130 ? 133.736 126.645 99.661  1.00 18.85  ? 129 ARG A NH1   1 
ATOM 4379 N NH2   . ARG C 3 130 ? 135.826 126.078 100.417 1.00 18.85  ? 129 ARG A NH2   1 
ATOM 4380 N N     . ILE C 3 131 ? 128.924 125.884 104.072 1.00 17.61  ? 130 ILE A N     1 
ATOM 4381 C CA    . ILE C 3 131 ? 127.693 126.534 104.505 1.00 17.61  ? 130 ILE A CA    1 
ATOM 4382 C C     . ILE C 3 131 ? 127.344 126.120 105.924 1.00 17.61  ? 130 ILE A C     1 
ATOM 4383 O O     . ILE C 3 131 ? 126.868 126.929 106.728 1.00 17.61  ? 130 ILE A O     1 
ATOM 4384 C CB    . ILE C 3 131 ? 126.547 126.206 103.537 1.00 17.61  ? 130 ILE A CB    1 
ATOM 4385 C CG1   . ILE C 3 131 ? 126.843 126.757 102.153 1.00 17.61  ? 130 ILE A CG1   1 
ATOM 4386 C CG2   . ILE C 3 131 ? 125.237 126.771 104.046 1.00 17.61  ? 130 ILE A CG2   1 
ATOM 4387 C CD1   . ILE C 3 131 ? 125.885 126.255 101.141 1.00 17.61  ? 130 ILE A CD1   1 
ATOM 4388 N N     . ARG C 3 132 ? 127.591 124.854 106.259 1.00 18.84  ? 131 ARG A N     1 
ATOM 4389 C CA    . ARG C 3 132 ? 127.285 124.359 107.593 1.00 18.84  ? 131 ARG A CA    1 
ATOM 4390 C C     . ARG C 3 132 ? 128.226 124.931 108.643 1.00 18.84  ? 131 ARG A C     1 
ATOM 4391 O O     . ARG C 3 132 ? 127.844 125.055 109.812 1.00 18.84  ? 131 ARG A O     1 
ATOM 4392 C CB    . ARG C 3 132 ? 127.349 122.834 107.588 1.00 18.84  ? 131 ARG A CB    1 
ATOM 4393 C CG    . ARG C 3 132 ? 126.848 122.165 108.843 1.00 18.84  ? 131 ARG A CG    1 
ATOM 4394 C CD    . ARG C 3 132 ? 126.891 120.660 108.675 1.00 18.84  ? 131 ARG A CD    1 
ATOM 4395 N NE    . ARG C 3 132 ? 125.952 120.200 107.658 1.00 18.84  ? 131 ARG A NE    1 
ATOM 4396 C CZ    . ARG C 3 132 ? 125.845 118.938 107.260 1.00 18.84  ? 131 ARG A CZ    1 
ATOM 4397 N NH1   . ARG C 3 132 ? 126.616 118.005 107.797 1.00 18.84  ? 131 ARG A NH1   1 
ATOM 4398 N NH2   . ARG C 3 132 ? 124.963 118.609 106.329 1.00 18.84  ? 131 ARG A NH2   1 
ATOM 4399 N N     . GLY C 3 133 ? 129.445 125.292 108.255 1.00 19.09  ? 132 GLY A N     1 
ATOM 4400 C CA    . GLY C 3 133 ? 130.365 125.915 109.184 1.00 19.09  ? 132 GLY A CA    1 
ATOM 4401 C C     . GLY C 3 133 ? 131.439 124.950 109.634 1.00 19.09  ? 132 GLY A C     1 
ATOM 4402 O O     . GLY C 3 133 ? 131.789 124.906 110.817 1.00 19.09  ? 132 GLY A O     1 
ATOM 4403 N N     . GLU C 3 134 ? 131.970 124.172 108.698 1.00 19.95  ? 133 GLU A N     1 
ATOM 4404 C CA    . GLU C 3 134 ? 132.978 123.170 109.015 1.00 19.95  ? 133 GLU A CA    1 
ATOM 4405 C C     . GLU C 3 134 ? 134.272 123.414 108.252 1.00 19.95  ? 133 GLU A C     1 
ATOM 4406 O O     . GLU C 3 134 ? 135.287 122.772 108.517 1.00 19.95  ? 133 GLU A O     1 
ATOM 4407 C CB    . GLU C 3 134 ? 132.437 121.777 108.697 1.00 19.95  ? 133 GLU A CB    1 
ATOM 4408 C CG    . GLU C 3 134 ? 131.265 121.364 109.566 1.00 19.95  ? 133 GLU A CG    1 
ATOM 4409 C CD    . GLU C 3 134 ? 130.673 120.033 109.154 1.00 19.95  ? 133 GLU A CD    1 
ATOM 4410 O OE1   . GLU C 3 134 ? 131.081 119.499 108.102 1.00 19.95  ? 133 GLU A OE1   1 
ATOM 4411 O OE2   . GLU C 3 134 ? 129.792 119.522 109.876 1.00 19.95  ? 133 GLU A OE2   1 
ATOM 4412 N N     . ASN D 4 26  ? 143.960 101.701 109.064 1.00 21.76  ? 25  ASN B N     1 
ATOM 4413 C CA    . ASN D 4 26  ? 144.024 102.843 108.160 1.00 21.76  ? 25  ASN B CA    1 
ATOM 4414 C C     . ASN D 4 26  ? 142.639 103.406 107.893 1.00 21.76  ? 25  ASN B C     1 
ATOM 4415 O O     . ASN D 4 26  ? 141.634 102.805 108.266 1.00 21.76  ? 25  ASN B O     1 
ATOM 4416 C CB    . ASN D 4 26  ? 144.684 102.450 106.837 1.00 21.76  ? 25  ASN B CB    1 
ATOM 4417 C CG    . ASN D 4 26  ? 146.194 102.429 106.923 1.00 21.76  ? 25  ASN B CG    1 
ATOM 4418 O OD1   . ASN D 4 26  ? 146.803 103.302 107.538 1.00 21.76  ? 25  ASN B OD1   1 
ATOM 4419 N ND2   . ASN D 4 26  ? 146.809 101.431 106.301 1.00 21.76  ? 25  ASN B ND2   1 
ATOM 4420 N N     . ILE D 4 27  ? 142.593 104.571 107.242 1.00 21.29  ? 26  ILE B N     1 
ATOM 4421 C CA    . ILE D 4 27  ? 141.325 105.106 106.765 1.00 21.29  ? 26  ILE B CA    1 
ATOM 4422 C C     . ILE D 4 27  ? 140.793 104.335 105.569 1.00 21.29  ? 26  ILE B C     1 
ATOM 4423 O O     . ILE D 4 27  ? 139.618 104.477 105.219 1.00 21.29  ? 26  ILE B O     1 
ATOM 4424 C CB    . ILE D 4 27  ? 141.509 106.598 106.414 1.00 21.29  ? 26  ILE B CB    1 
ATOM 4425 C CG1   . ILE D 4 27  ? 140.167 107.309 106.243 1.00 21.29  ? 26  ILE B CG1   1 
ATOM 4426 C CG2   . ILE D 4 27  ? 142.358 106.750 105.164 1.00 21.29  ? 26  ILE B CG2   1 
ATOM 4427 C CD1   . ILE D 4 27  ? 139.355 107.425 107.491 1.00 21.29  ? 26  ILE B CD1   1 
ATOM 4428 N N     . GLN D 4 28  ? 141.627 103.502 104.943 1.00 21.23  ? 27  GLN B N     1 
ATOM 4429 C CA    . GLN D 4 28  ? 141.205 102.731 103.783 1.00 21.23  ? 27  GLN B CA    1 
ATOM 4430 C C     . GLN D 4 28  ? 140.178 101.660 104.119 1.00 21.23  ? 27  GLN B C     1 
ATOM 4431 O O     . GLN D 4 28  ? 139.648 101.031 103.198 1.00 21.23  ? 27  GLN B O     1 
ATOM 4432 C CB    . GLN D 4 28  ? 142.416 102.097 103.102 1.00 21.23  ? 27  GLN B CB    1 
ATOM 4433 C CG    . GLN D 4 28  ? 143.433 103.113 102.623 1.00 21.23  ? 27  GLN B CG    1 
ATOM 4434 C CD    . GLN D 4 28  ? 142.883 104.002 101.526 1.00 21.23  ? 27  GLN B CD    1 
ATOM 4435 O OE1   . GLN D 4 28  ? 142.145 103.546 100.654 1.00 21.23  ? 27  GLN B OE1   1 
ATOM 4436 N NE2   . GLN D 4 28  ? 143.234 105.281 101.570 1.00 21.23  ? 27  GLN B NE2   1 
ATOM 4437 N N     . GLY D 4 29  ? 139.885 101.429 105.401 1.00 20.32  ? 28  GLY B N     1 
ATOM 4438 C CA    . GLY D 4 29  ? 138.845 100.475 105.733 1.00 20.32  ? 28  GLY B CA    1 
ATOM 4439 C C     . GLY D 4 29  ? 137.455 100.979 105.431 1.00 20.32  ? 28  GLY B C     1 
ATOM 4440 O O     . GLY D 4 29  ? 136.520 100.178 105.339 1.00 20.32  ? 28  GLY B O     1 
ATOM 4441 N N     . ILE D 4 30  ? 137.299 102.291 105.279 1.00 19.71  ? 29  ILE B N     1 
ATOM 4442 C CA    . ILE D 4 30  ? 136.039 102.868 104.838 1.00 19.71  ? 29  ILE B CA    1 
ATOM 4443 C C     . ILE D 4 30  ? 136.011 102.682 103.332 1.00 19.71  ? 29  ILE B C     1 
ATOM 4444 O O     . ILE D 4 30  ? 136.502 103.530 102.580 1.00 19.71  ? 29  ILE B O     1 
ATOM 4445 C CB    . ILE D 4 30  ? 135.915 104.346 105.239 1.00 19.71  ? 29  ILE B CB    1 
ATOM 4446 C CG1   . ILE D 4 30  ? 136.255 104.511 106.718 1.00 19.71  ? 29  ILE B CG1   1 
ATOM 4447 C CG2   . ILE D 4 30  ? 134.517 104.850 104.958 1.00 19.71  ? 29  ILE B CG2   1 
ATOM 4448 C CD1   . ILE D 4 30  ? 135.343 103.749 107.639 1.00 19.71  ? 29  ILE B CD1   1 
ATOM 4449 N N     . THR D 4 31  ? 135.440 101.574 102.882 1.00 19.91  ? 30  THR B N     1 
ATOM 4450 C CA    . THR D 4 31  ? 135.654 101.111 101.523 1.00 19.91  ? 30  THR B CA    1 
ATOM 4451 C C     . THR D 4 31  ? 134.805 101.905 100.539 1.00 19.91  ? 30  THR B C     1 
ATOM 4452 O O     . THR D 4 31  ? 134.007 102.769 100.908 1.00 19.91  ? 30  THR B O     1 
ATOM 4453 C CB    . THR D 4 31  ? 135.348 99.621  101.417 1.00 19.91  ? 30  THR B CB    1 
ATOM 4454 O OG1   . THR D 4 31  ? 134.006 99.378  101.853 1.00 19.91  ? 30  THR B OG1   1 
ATOM 4455 C CG2   . THR D 4 31  ? 136.299 98.825  102.285 1.00 19.91  ? 30  THR B CG2   1 
ATOM 4456 N N     . LYS D 4 32  ? 135.001 101.610 99.258  1.00 19.88  ? 31  LYS B N     1 
ATOM 4457 C CA    . LYS D 4 32  ? 134.219 102.264 98.213  1.00 19.88  ? 31  LYS B CA    1 
ATOM 4458 C C     . LYS D 4 32  ? 132.737 101.929 98.301  1.00 19.88  ? 31  LYS B C     1 
ATOM 4459 O O     . LYS D 4 32  ? 131.913 102.861 98.243  1.00 19.88  ? 31  LYS B O     1 
ATOM 4460 C CB    . LYS D 4 32  ? 134.795 101.888 96.845  1.00 19.88  ? 31  LYS B CB    1 
ATOM 4461 C CG    . LYS D 4 32  ? 133.967 102.353 95.667  1.00 19.88  ? 31  LYS B CG    1 
ATOM 4462 C CD    . LYS D 4 32  ? 134.607 101.941 94.353  1.00 19.88  ? 31  LYS B CD    1 
ATOM 4463 C CE    . LYS D 4 32  ? 133.722 102.302 93.172  1.00 19.88  ? 31  LYS B CE    1 
ATOM 4464 N NZ    . LYS D 4 32  ? 134.363 101.963 91.871  1.00 19.88  ? 31  LYS B NZ    1 
ATOM 4465 N N     . PRO D 4 33  ? 132.316 100.671 98.477  1.00 19.47  ? 32  PRO B N     1 
ATOM 4466 C CA    . PRO D 4 33  ? 130.875 100.411 98.528  1.00 19.47  ? 32  PRO B CA    1 
ATOM 4467 C C     . PRO D 4 33  ? 130.228 100.769 99.850  1.00 19.47  ? 32  PRO B C     1 
ATOM 4468 O O     . PRO D 4 33  ? 129.004 100.925 99.881  1.00 19.47  ? 32  PRO B O     1 
ATOM 4469 C CB    . PRO D 4 33  ? 130.787 98.904  98.269  1.00 19.47  ? 32  PRO B CB    1 
ATOM 4470 C CG    . PRO D 4 33  ? 132.052 98.379  98.774  1.00 19.47  ? 32  PRO B CG    1 
ATOM 4471 C CD    . PRO D 4 33  ? 133.081 99.412  98.458  1.00 19.47  ? 32  PRO B CD    1 
ATOM 4472 N N     . ALA D 4 34  ? 130.990 101.012 100.915 1.00 18.51  ? 33  ALA B N     1 
ATOM 4473 C CA    . ALA D 4 34  ? 130.346 101.499 102.128 1.00 18.51  ? 33  ALA B CA    1 
ATOM 4474 C C     . ALA D 4 34  ? 130.022 102.981 102.017 1.00 18.51  ? 33  ALA B C     1 
ATOM 4475 O O     . ALA D 4 34  ? 128.950 103.426 102.449 1.00 18.51  ? 33  ALA B O     1 
ATOM 4476 C CB    . ALA D 4 34  ? 131.239 101.239 103.338 1.00 18.51  ? 33  ALA B CB    1 
ATOM 4477 N N     . ILE D 4 35  ? 130.892 103.744 101.354 1.00 17.96  ? 34  ILE B N     1 
ATOM 4478 C CA    . ILE D 4 35  ? 130.551 105.126 101.060 1.00 17.96  ? 34  ILE B CA    1 
ATOM 4479 C C     . ILE D 4 35  ? 129.436 105.168 100.035 1.00 17.96  ? 34  ILE B C     1 
ATOM 4480 O O     . ILE D 4 35  ? 128.561 106.041 100.089 1.00 17.96  ? 34  ILE B O     1 
ATOM 4481 C CB    . ILE D 4 35  ? 131.800 105.885 100.580 1.00 17.96  ? 34  ILE B CB    1 
ATOM 4482 C CG1   . ILE D 4 35  ? 132.864 105.892 101.673 1.00 17.96  ? 34  ILE B CG1   1 
ATOM 4483 C CG2   . ILE D 4 35  ? 131.450 107.302 100.174 1.00 17.96  ? 34  ILE B CG2   1 
ATOM 4484 C CD1   . ILE D 4 35  ? 134.203 106.385 101.207 1.00 17.96  ? 34  ILE B CD1   1 
ATOM 4485 N N     . ARG D 4 36  ? 129.411 104.203 99.114  1.00 18.94  ? 35  ARG B N     1 
ATOM 4486 C CA    . ARG D 4 36  ? 128.322 104.184 98.152  1.00 18.94  ? 35  ARG B CA    1 
ATOM 4487 C C     . ARG D 4 36  ? 126.996 103.848 98.822  1.00 18.94  ? 35  ARG B C     1 
ATOM 4488 O O     . ARG D 4 36  ? 125.961 104.394 98.437  1.00 18.94  ? 35  ARG B O     1 
ATOM 4489 C CB    . ARG D 4 36  ? 128.628 103.202 97.029  1.00 18.94  ? 35  ARG B CB    1 
ATOM 4490 C CG    . ARG D 4 36  ? 127.593 103.199 95.934  1.00 18.94  ? 35  ARG B CG    1 
ATOM 4491 C CD    . ARG D 4 36  ? 127.915 102.157 94.897  1.00 18.94  ? 35  ARG B CD    1 
ATOM 4492 N NE    . ARG D 4 36  ? 129.153 102.490 94.206  1.00 18.94  ? 35  ARG B NE    1 
ATOM 4493 C CZ    . ARG D 4 36  ? 129.218 103.294 93.153  1.00 18.94  ? 35  ARG B CZ    1 
ATOM 4494 N NH1   . ARG D 4 36  ? 128.112 103.842 92.671  1.00 18.94  ? 35  ARG B NH1   1 
ATOM 4495 N NH2   . ARG D 4 36  ? 130.385 103.547 92.580  1.00 18.94  ? 35  ARG B NH2   1 
ATOM 4496 N N     . ARG D 4 37  ? 127.004 102.984 99.842  1.00 18.35  ? 36  ARG B N     1 
ATOM 4497 C CA    . ARG D 4 37  ? 125.768 102.690 100.560 1.00 18.35  ? 36  ARG B CA    1 
ATOM 4498 C C     . ARG D 4 37  ? 125.327 103.869 101.410 1.00 18.35  ? 36  ARG B C     1 
ATOM 4499 O O     . ARG D 4 37  ? 124.123 104.131 101.533 1.00 18.35  ? 36  ARG B O     1 
ATOM 4500 C CB    . ARG D 4 37  ? 125.944 101.456 101.439 1.00 18.35  ? 36  ARG B CB    1 
ATOM 4501 C CG    . ARG D 4 37  ? 126.038 100.154 100.680 1.00 18.35  ? 36  ARG B CG    1 
ATOM 4502 C CD    . ARG D 4 37  ? 125.964 98.979  101.629 1.00 18.35  ? 36  ARG B CD    1 
ATOM 4503 N NE    . ARG D 4 37  ? 127.124 98.929  102.511 1.00 18.35  ? 36  ARG B NE    1 
ATOM 4504 C CZ    . ARG D 4 37  ? 128.232 98.249  102.245 1.00 18.35  ? 36  ARG B CZ    1 
ATOM 4505 N NH1   . ARG D 4 37  ? 128.330 97.557  101.121 1.00 18.35  ? 36  ARG B NH1   1 
ATOM 4506 N NH2   . ARG D 4 37  ? 129.240 98.259  103.102 1.00 18.35  ? 36  ARG B NH2   1 
ATOM 4507 N N     . LEU D 4 38  ? 126.280 104.646 101.925 1.00 17.68  ? 37  LEU B N     1 
ATOM 4508 C CA    . LEU D 4 38  ? 125.900 105.832 102.681 1.00 17.68  ? 37  LEU B CA    1 
ATOM 4509 C C     . LEU D 4 38  ? 125.340 106.902 101.760 1.00 17.68  ? 37  LEU B C     1 
ATOM 4510 O O     . LEU D 4 38  ? 124.449 107.660 102.158 1.00 17.68  ? 37  LEU B O     1 
ATOM 4511 C CB    . LEU D 4 38  ? 127.096 106.358 103.467 1.00 17.68  ? 37  LEU B CB    1 
ATOM 4512 C CG    . LEU D 4 38  ? 127.475 105.471 104.649 1.00 17.68  ? 37  LEU B CG    1 
ATOM 4513 C CD1   . LEU D 4 38  ? 128.819 105.862 105.206 1.00 17.68  ? 37  LEU B CD1   1 
ATOM 4514 C CD2   . LEU D 4 38  ? 126.410 105.582 105.711 1.00 17.68  ? 37  LEU B CD2   1 
ATOM 4515 N N     . ALA D 4 39  ? 125.805 106.943 100.514 1.00 17.80  ? 38  ALA B N     1 
ATOM 4516 C CA    . ALA D 4 39  ? 125.277 107.933 99.588  1.00 17.80  ? 38  ALA B CA    1 
ATOM 4517 C C     . ALA D 4 39  ? 123.938 107.481 99.023  1.00 17.80  ? 38  ALA B C     1 
ATOM 4518 O O     . ALA D 4 39  ? 123.070 108.316 98.757  1.00 17.80  ? 38  ALA B O     1 
ATOM 4519 C CB    . ALA D 4 39  ? 126.276 108.198 98.465  1.00 17.80  ? 38  ALA B CB    1 
ATOM 4520 N N     . ARG D 4 40  ? 123.752 106.171 98.842  1.00 18.94  ? 39  ARG B N     1 
ATOM 4521 C CA    . ARG D 4 40  ? 122.459 105.657 98.412  1.00 18.94  ? 39  ARG B CA    1 
ATOM 4522 C C     . ARG D 4 40  ? 121.408 105.855 99.493  1.00 18.94  ? 39  ARG B C     1 
ATOM 4523 O O     . ARG D 4 40  ? 120.234 106.075 99.178  1.00 18.94  ? 39  ARG B O     1 
ATOM 4524 C CB    . ARG D 4 40  ? 122.557 104.175 98.050  1.00 18.94  ? 39  ARG B CB    1 
ATOM 4525 C CG    . ARG D 4 40  ? 123.401 103.849 96.830  1.00 18.94  ? 39  ARG B CG    1 
ATOM 4526 C CD    . ARG D 4 40  ? 122.743 104.299 95.541  1.00 18.94  ? 39  ARG B CD    1 
ATOM 4527 N NE    . ARG D 4 40  ? 123.448 103.773 94.376  1.00 18.94  ? 39  ARG B NE    1 
ATOM 4528 C CZ    . ARG D 4 40  ? 124.460 104.386 93.770  1.00 18.94  ? 39  ARG B CZ    1 
ATOM 4529 N NH1   . ARG D 4 40  ? 124.896 105.554 94.219  1.00 18.94  ? 39  ARG B NH1   1 
ATOM 4530 N NH2   . ARG D 4 40  ? 125.041 103.827 92.718  1.00 18.94  ? 39  ARG B NH2   1 
ATOM 4531 N N     . ARG D 4 41  ? 121.805 105.795 100.766 1.00 17.80  ? 40  ARG B N     1 
ATOM 4532 C CA    . ARG D 4 41  ? 120.859 106.116 101.826 1.00 17.80  ? 40  ARG B CA    1 
ATOM 4533 C C     . ARG D 4 41  ? 120.666 107.619 101.942 1.00 17.80  ? 40  ARG B C     1 
ATOM 4534 O O     . ARG D 4 41  ? 119.604 108.074 102.379 1.00 17.80  ? 40  ARG B O     1 
ATOM 4535 C CB    . ARG D 4 41  ? 121.308 105.526 103.162 1.00 17.80  ? 40  ARG B CB    1 
ATOM 4536 C CG    . ARG D 4 41  ? 120.273 105.709 104.259 1.00 17.80  ? 40  ARG B CG    1 
ATOM 4537 C CD    . ARG D 4 41  ? 120.633 105.002 105.549 1.00 17.80  ? 40  ARG B CD    1 
ATOM 4538 N NE    . ARG D 4 41  ? 120.502 103.554 105.435 1.00 17.80  ? 40  ARG B NE    1 
ATOM 4539 C CZ    . ARG D 4 41  ? 120.859 102.698 106.386 1.00 17.80  ? 40  ARG B CZ    1 
ATOM 4540 N NH1   . ARG D 4 41  ? 121.371 103.147 107.522 1.00 17.80  ? 40  ARG B NH1   1 
ATOM 4541 N NH2   . ARG D 4 41  ? 120.703 101.395 106.202 1.00 17.80  ? 40  ARG B NH2   1 
ATOM 4542 N N     . GLY D 4 42  ? 121.670 108.400 101.551 1.00 17.78  ? 41  GLY B N     1 
ATOM 4543 C CA    . GLY D 4 42  ? 121.511 109.839 101.529 1.00 17.78  ? 41  GLY B CA    1 
ATOM 4544 C C     . GLY D 4 42  ? 120.661 110.344 100.384 1.00 17.78  ? 41  GLY B C     1 
ATOM 4545 O O     . GLY D 4 42  ? 120.261 111.512 100.398 1.00 17.78  ? 41  GLY B O     1 
ATOM 4546 N N     . GLY D 4 43  ? 120.379 109.497 99.400  1.00 17.49  ? 42  GLY B N     1 
ATOM 4547 C CA    . GLY D 4 43  ? 119.574 109.881 98.266  1.00 17.49  ? 42  GLY B CA    1 
ATOM 4548 C C     . GLY D 4 43  ? 120.357 110.222 97.023  1.00 17.49  ? 42  GLY B C     1 
ATOM 4549 O O     . GLY D 4 43  ? 119.777 110.770 96.080  1.00 17.49  ? 42  GLY B O     1 
ATOM 4550 N N     . VAL D 4 44  ? 121.647 109.917 96.987  1.00 17.25  ? 43  VAL B N     1 
ATOM 4551 C CA    . VAL D 4 44  ? 122.473 110.227 95.830  1.00 17.25  ? 43  VAL B CA    1 
ATOM 4552 C C     . VAL D 4 44  ? 122.317 109.131 94.788  1.00 17.25  ? 43  VAL B C     1 
ATOM 4553 O O     . VAL D 4 44  ? 122.389 107.939 95.104  1.00 17.25  ? 43  VAL B O     1 
ATOM 4554 C CB    . VAL D 4 44  ? 123.941 110.380 96.249  1.00 17.25  ? 43  VAL B CB    1 
ATOM 4555 C CG1   . VAL D 4 44  ? 124.813 110.630 95.039  1.00 17.25  ? 43  VAL B CG1   1 
ATOM 4556 C CG2   . VAL D 4 44  ? 124.085 111.497 97.264  1.00 17.25  ? 43  VAL B CG2   1 
ATOM 4557 N N     . LYS D 4 45  ? 122.101 109.535 93.538  1.00 18.31  ? 44  LYS B N     1 
ATOM 4558 C CA    . LYS D 4 45  ? 121.877 108.583 92.461  1.00 18.31  ? 44  LYS B CA    1 
ATOM 4559 C C     . LYS D 4 45  ? 123.183 108.122 91.831  1.00 18.31  ? 44  LYS B C     1 
ATOM 4560 O O     . LYS D 4 45  ? 123.325 106.944 91.490  1.00 18.31  ? 44  LYS B O     1 
ATOM 4561 C CB    . LYS D 4 45  ? 120.965 109.194 91.397  1.00 18.31  ? 44  LYS B CB    1 
ATOM 4562 C CG    . LYS D 4 45  ? 119.580 109.540 91.908  1.00 18.31  ? 44  LYS B CG    1 
ATOM 4563 C CD    . LYS D 4 45  ? 118.976 108.373 92.670  1.00 18.31  ? 44  LYS B CD    1 
ATOM 4564 C CE    . LYS D 4 45  ? 117.615 108.725 93.246  1.00 18.31  ? 44  LYS B CE    1 
ATOM 4565 N NZ    . LYS D 4 45  ? 117.040 107.588 94.016  1.00 18.31  ? 44  LYS B NZ    1 
ATOM 4566 N N     . ARG D 4 46  ? 124.138 109.032 91.668  1.00 19.32  ? 45  ARG B N     1 
ATOM 4567 C CA    . ARG D 4 46  ? 125.381 108.743 90.975  1.00 19.32  ? 45  ARG B CA    1 
ATOM 4568 C C     . ARG D 4 46  ? 126.514 109.452 91.701  1.00 19.32  ? 45  ARG B C     1 
ATOM 4569 O O     . ARG D 4 46  ? 126.346 110.579 92.172  1.00 19.32  ? 45  ARG B O     1 
ATOM 4570 C CB    . ARG D 4 46  ? 125.294 109.189 89.511  1.00 19.32  ? 45  ARG B CB    1 
ATOM 4571 C CG    . ARG D 4 46  ? 126.459 108.782 88.638  1.00 19.32  ? 45  ARG B CG    1 
ATOM 4572 C CD    . ARG D 4 46  ? 126.220 109.218 87.204  1.00 19.32  ? 45  ARG B CD    1 
ATOM 4573 N NE    . ARG D 4 46  ? 125.138 108.473 86.575  1.00 19.32  ? 45  ARG B NE    1 
ATOM 4574 C CZ    . ARG D 4 46  ? 125.313 107.382 85.839  1.00 19.32  ? 45  ARG B CZ    1 
ATOM 4575 N NH1   . ARG D 4 46  ? 126.533 106.917 85.618  1.00 19.32  ? 45  ARG B NH1   1 
ATOM 4576 N NH2   . ARG D 4 46  ? 124.267 106.766 85.308  1.00 19.32  ? 45  ARG B NH2   1 
ATOM 4577 N N     . ILE D 4 47  ? 127.661 108.786 91.800  1.00 18.69  ? 46  ILE B N     1 
ATOM 4578 C CA    . ILE D 4 47  ? 128.774 109.233 92.631  1.00 18.69  ? 46  ILE B CA    1 
ATOM 4579 C C     . ILE D 4 47  ? 130.006 109.380 91.752  1.00 18.69  ? 46  ILE B C     1 
ATOM 4580 O O     . ILE D 4 47  ? 130.318 108.480 90.965  1.00 18.69  ? 46  ILE B O     1 
ATOM 4581 C CB    . ILE D 4 47  ? 129.047 108.247 93.779  1.00 18.69  ? 46  ILE B CB    1 
ATOM 4582 C CG1   . ILE D 4 47  ? 127.789 108.050 94.616  1.00 18.69  ? 46  ILE B CG1   1 
ATOM 4583 C CG2   . ILE D 4 47  ? 130.178 108.744 94.649  1.00 18.69  ? 46  ILE B CG2   1 
ATOM 4584 C CD1   . ILE D 4 47  ? 127.873 106.882 95.545  1.00 18.69  ? 46  ILE B CD1   1 
ATOM 4585 N N     . SER D 4 48  ? 130.706 110.503 91.882  1.00 18.91  ? 47  SER B N     1 
ATOM 4586 C CA    . SER D 4 48  ? 131.932 110.662 91.118  1.00 18.91  ? 47  SER B CA    1 
ATOM 4587 C C     . SER D 4 48  ? 133.039 109.794 91.705  1.00 18.91  ? 47  SER B C     1 
ATOM 4588 O O     . SER D 4 48  ? 132.929 109.253 92.808  1.00 18.91  ? 47  SER B O     1 
ATOM 4589 C CB    . SER D 4 48  ? 132.370 112.123 91.093  1.00 18.91  ? 47  SER B CB    1 
ATOM 4590 O OG    . SER D 4 48  ? 133.631 112.258 90.466  1.00 18.91  ? 47  SER B OG    1 
ATOM 4591 N N     . GLY D 4 49  ? 134.125 109.664 90.951  1.00 19.38  ? 48  GLY B N     1 
ATOM 4592 C CA    . GLY D 4 49  ? 135.206 108.807 91.382  1.00 19.38  ? 48  GLY B CA    1 
ATOM 4593 C C     . GLY D 4 49  ? 136.157 109.423 92.375  1.00 19.38  ? 48  GLY B C     1 
ATOM 4594 O O     . GLY D 4 49  ? 137.131 108.779 92.770  1.00 19.38  ? 48  GLY B O     1 
ATOM 4595 N N     . LEU D 4 50  ? 135.899 110.656 92.800  1.00 17.89  ? 49  LEU B N     1 
ATOM 4596 C CA    . LEU D 4 50  ? 136.742 111.351 93.759  1.00 17.89  ? 49  LEU B CA    1 
ATOM 4597 C C     . LEU D 4 50  ? 136.038 111.624 95.077  1.00 17.89  ? 49  LEU B C     1 
ATOM 4598 O O     . LEU D 4 50  ? 136.656 112.174 95.992  1.00 17.89  ? 49  LEU B O     1 
ATOM 4599 C CB    . LEU D 4 50  ? 137.239 112.669 93.158  1.00 17.89  ? 49  LEU B CB    1 
ATOM 4600 C CG    . LEU D 4 50  ? 138.132 112.591 91.921  1.00 17.89  ? 49  LEU B CG    1 
ATOM 4601 C CD1   . LEU D 4 50  ? 138.342 113.978 91.355  1.00 17.89  ? 49  LEU B CD1   1 
ATOM 4602 C CD2   . LEU D 4 50  ? 139.463 111.949 92.259  1.00 17.89  ? 49  LEU B CD2   1 
ATOM 4603 N N     . ILE D 4 51  ? 134.759 111.267 95.195  1.00 18.12  ? 50  ILE B N     1 
ATOM 4604 C CA    . ILE D 4 51  ? 134.068 111.366 96.475  1.00 18.12  ? 50  ILE B CA    1 
ATOM 4605 C C     . ILE D 4 51  ? 134.690 110.443 97.506  1.00 18.12  ? 50  ILE B C     1 
ATOM 4606 O O     . ILE D 4 51  ? 134.646 110.722 98.708  1.00 18.12  ? 50  ILE B O     1 
ATOM 4607 C CB    . ILE D 4 51  ? 132.572 111.048 96.287  1.00 18.12  ? 50  ILE B CB    1 
ATOM 4608 C CG1   . ILE D 4 51  ? 131.942 112.025 95.310  1.00 18.12  ? 50  ILE B CG1   1 
ATOM 4609 C CG2   . ILE D 4 51  ? 131.827 111.117 97.604  1.00 18.12  ? 50  ILE B CG2   1 
ATOM 4610 C CD1   . ILE D 4 51  ? 131.990 113.419 95.816  1.00 18.12  ? 50  ILE B CD1   1 
ATOM 4611 N N     . TYR D 4 52  ? 135.268 109.329 97.065  1.00 18.60  ? 51  TYR B N     1 
ATOM 4612 C CA    . TYR D 4 52  ? 135.657 108.296 98.013  1.00 18.60  ? 51  TYR B CA    1 
ATOM 4613 C C     . TYR D 4 52  ? 136.784 108.751 98.932  1.00 18.60  ? 51  TYR B C     1 
ATOM 4614 O O     . TYR D 4 52  ? 136.770 108.445 100.128 1.00 18.60  ? 51  TYR B O     1 
ATOM 4615 C CB    . TYR D 4 52  ? 136.046 107.052 97.226  1.00 18.60  ? 51  TYR B CB    1 
ATOM 4616 C CG    . TYR D 4 52  ? 134.889 106.517 96.420  1.00 18.60  ? 51  TYR B CG    1 
ATOM 4617 C CD1   . TYR D 4 52  ? 133.590 106.619 96.887  1.00 18.60  ? 51  TYR B CD1   1 
ATOM 4618 C CD2   . TYR D 4 52  ? 135.088 105.998 95.155  1.00 18.60  ? 51  TYR B CD2   1 
ATOM 4619 C CE1   . TYR D 4 52  ? 132.531 106.157 96.146  1.00 18.60  ? 51  TYR B CE1   1 
ATOM 4620 C CE2   . TYR D 4 52  ? 134.035 105.543 94.403  1.00 18.60  ? 51  TYR B CE2   1 
ATOM 4621 C CZ    . TYR D 4 52  ? 132.759 105.622 94.903  1.00 18.60  ? 51  TYR B CZ    1 
ATOM 4622 O OH    . TYR D 4 52  ? 131.704 105.163 94.154  1.00 18.60  ? 51  TYR B OH    1 
ATOM 4623 N N     . GLU D 4 53  ? 137.766 109.490 98.407  1.00 20.66  ? 52  GLU B N     1 
ATOM 4624 C CA    . GLU D 4 53  ? 138.827 110.001 99.269  1.00 20.66  ? 52  GLU B CA    1 
ATOM 4625 C C     . GLU D 4 53  ? 138.441 111.276 100.003 1.00 20.66  ? 52  GLU B C     1 
ATOM 4626 O O     . GLU D 4 53  ? 139.079 111.608 101.007 1.00 20.66  ? 52  GLU B O     1 
ATOM 4627 C CB    . GLU D 4 53  ? 140.134 110.189 98.503  1.00 20.66  ? 52  GLU B CB    1 
ATOM 4628 C CG    . GLU D 4 53  ? 140.764 108.854 98.133  1.00 20.66  ? 52  GLU B CG    1 
ATOM 4629 C CD    . GLU D 4 53  ? 142.189 108.979 97.640  1.00 20.66  ? 52  GLU B CD    1 
ATOM 4630 O OE1   . GLU D 4 53  ? 142.883 107.943 97.571  1.00 20.66  ? 52  GLU B OE1   1 
ATOM 4631 O OE2   . GLU D 4 53  ? 142.622 110.111 97.343  1.00 20.66  ? 52  GLU B OE2   1 
ATOM 4632 N N     . GLU D 4 54  ? 137.417 111.993 99.541  1.00 19.32  ? 53  GLU B N     1 
ATOM 4633 C CA    . GLU D 4 54  ? 136.992 113.182 100.266 1.00 19.32  ? 53  GLU B CA    1 
ATOM 4634 C C     . GLU D 4 54  ? 136.129 112.784 101.450 1.00 19.32  ? 53  GLU B C     1 
ATOM 4635 O O     . GLU D 4 54  ? 136.180 113.427 102.504 1.00 19.32  ? 53  GLU B O     1 
ATOM 4636 C CB    . GLU D 4 54  ? 136.243 114.139 99.339  1.00 19.32  ? 53  GLU B CB    1 
ATOM 4637 C CG    . GLU D 4 54  ? 136.869 115.533 98.957  1.00 19.32  ? 53  GLU B CG    1 
ATOM 4638 C CD    . GLU D 4 54  ? 138.310 115.882 99.417  1.00 19.32  ? 53  GLU B CD    1 
ATOM 4639 O OE1   . GLU D 4 54  ? 139.009 115.128 100.131 1.00 19.32  ? 53  GLU B OE1   1 
ATOM 4640 O OE2   . GLU D 4 54  ? 138.779 116.959 98.981  1.00 19.32  ? 53  GLU B OE2   1 
ATOM 4641 N N     . THR D 4 55  ? 135.343 111.720 101.297 1.00 18.70  ? 54  THR B N     1 
ATOM 4642 C CA    . THR D 4 55  ? 134.435 111.322 102.358 1.00 18.70  ? 54  THR B CA    1 
ATOM 4643 C C     . THR D 4 55  ? 135.232 110.728 103.504 1.00 18.70  ? 54  THR B C     1 
ATOM 4644 O O     . THR D 4 55  ? 134.858 110.878 104.670 1.00 18.70  ? 54  THR B O     1 
ATOM 4645 C CB    . THR D 4 55  ? 133.412 110.319 101.836 1.00 18.70  ? 54  THR B CB    1 
ATOM 4646 O OG1   . THR D 4 55  ? 132.756 110.862 100.686 1.00 18.70  ? 54  THR B OG1   1 
ATOM 4647 C CG2   . THR D 4 55  ? 132.382 110.006 102.900 1.00 18.70  ? 54  THR B CG2   1 
ATOM 4648 N N     . ARG D 4 56  ? 136.351 110.073 103.184 1.00 19.00  ? 55  ARG B N     1 
ATOM 4649 C CA    . ARG D 4 56  ? 137.223 109.560 104.228 1.00 19.00  ? 55  ARG B CA    1 
ATOM 4650 C C     . ARG D 4 56  ? 137.899 110.707 104.959 1.00 19.00  ? 55  ARG B C     1 
ATOM 4651 O O     . ARG D 4 56  ? 138.126 110.627 106.169 1.00 19.00  ? 55  ARG B O     1 
ATOM 4652 C CB    . ARG D 4 56  ? 138.279 108.640 103.623 1.00 19.00  ? 55  ARG B CB    1 
ATOM 4653 C CG    . ARG D 4 56  ? 137.740 107.398 102.952 1.00 19.00  ? 55  ARG B CG    1 
ATOM 4654 C CD    . ARG D 4 56  ? 138.881 106.496 102.529 1.00 19.00  ? 55  ARG B CD    1 
ATOM 4655 N NE    . ARG D 4 56  ? 138.426 105.316 101.804 1.00 19.00  ? 55  ARG B NE    1 
ATOM 4656 C CZ    . ARG D 4 56  ? 138.427 105.218 100.480 1.00 19.00  ? 55  ARG B CZ    1 
ATOM 4657 N NH1   . ARG D 4 56  ? 138.868 106.226 99.745  1.00 19.00  ? 55  ARG B NH1   1 
ATOM 4658 N NH2   . ARG D 4 56  ? 138.000 104.112 99.891  1.00 19.00  ? 55  ARG B NH2   1 
ATOM 4659 N N     . GLY D 4 57  ? 138.145 111.814 104.256 1.00 18.58  ? 56  GLY B N     1 
ATOM 4660 C CA    . GLY D 4 57  ? 138.752 112.972 104.878 1.00 18.58  ? 56  GLY B CA    1 
ATOM 4661 C C     . GLY D 4 57  ? 137.774 113.789 105.683 1.00 18.58  ? 56  GLY B C     1 
ATOM 4662 O O     . GLY D 4 57  ? 138.189 114.581 106.533 1.00 18.58  ? 56  GLY B O     1 
ATOM 4663 N N     . VAL D 4 58  ? 136.482 113.612 105.422 1.00 18.80  ? 57  VAL B N     1 
ATOM 4664 C CA    . VAL D 4 58  ? 135.469 114.237 106.262 1.00 18.80  ? 57  VAL B CA    1 
ATOM 4665 C C     . VAL D 4 58  ? 135.198 113.364 107.478 1.00 18.80  ? 57  VAL B C     1 
ATOM 4666 O O     . VAL D 4 58  ? 135.036 113.863 108.599 1.00 18.80  ? 57  VAL B O     1 
ATOM 4667 C CB    . VAL D 4 58  ? 134.189 114.482 105.446 1.00 18.80  ? 57  VAL B CB    1 
ATOM 4668 C CG1   . VAL D 4 58  ? 133.097 115.033 106.334 1.00 18.80  ? 57  VAL B CG1   1 
ATOM 4669 C CG2   . VAL D 4 58  ? 134.465 115.408 104.281 1.00 18.80  ? 57  VAL B CG2   1 
ATOM 4670 N N     . LEU D 4 59  ? 135.172 112.045 107.280 1.00 19.68  ? 58  LEU B N     1 
ATOM 4671 C CA    . LEU D 4 59  ? 134.956 111.133 108.392 1.00 19.68  ? 58  LEU B CA    1 
ATOM 4672 C C     . LEU D 4 59  ? 136.124 111.177 109.363 1.00 19.68  ? 58  LEU B C     1 
ATOM 4673 O O     . LEU D 4 59  ? 135.925 111.064 110.578 1.00 19.68  ? 58  LEU B O     1 
ATOM 4674 C CB    . LEU D 4 59  ? 134.748 109.717 107.867 1.00 19.68  ? 58  LEU B CB    1 
ATOM 4675 C CG    . LEU D 4 59  ? 134.505 108.639 108.915 1.00 19.68  ? 58  LEU B CG    1 
ATOM 4676 C CD1   . LEU D 4 59  ? 133.246 108.946 109.688 1.00 19.68  ? 58  LEU B CD1   1 
ATOM 4677 C CD2   . LEU D 4 59  ? 134.405 107.289 108.249 1.00 19.68  ? 58  LEU B CD2   1 
ATOM 4678 N N     . LYS D 4 60  ? 137.342 111.377 108.856 1.00 20.74  ? 59  LYS B N     1 
ATOM 4679 C CA    . LYS D 4 60  ? 138.487 111.414 109.749 1.00 20.74  ? 59  LYS B CA    1 
ATOM 4680 C C     . LYS D 4 60  ? 138.485 112.697 110.559 1.00 20.74  ? 59  LYS B C     1 
ATOM 4681 O O     . LYS D 4 60  ? 138.877 112.686 111.726 1.00 20.74  ? 59  LYS B O     1 
ATOM 4682 C CB    . LYS D 4 60  ? 139.786 111.265 108.960 1.00 20.74  ? 59  LYS B CB    1 
ATOM 4683 C CG    . LYS D 4 60  ? 141.006 111.070 109.839 1.00 20.74  ? 59  LYS B CG    1 
ATOM 4684 C CD    . LYS D 4 60  ? 142.253 110.807 109.022 1.00 20.74  ? 59  LYS B CD    1 
ATOM 4685 C CE    . LYS D 4 60  ? 143.461 110.616 109.923 1.00 20.74  ? 59  LYS B CE    1 
ATOM 4686 N NZ    . LYS D 4 60  ? 144.706 110.369 109.146 1.00 20.74  ? 59  LYS B NZ    1 
ATOM 4687 N N     . VAL D 4 61  ? 138.000 113.797 109.981 1.00 20.39  ? 60  VAL B N     1 
ATOM 4688 C CA    . VAL D 4 61  ? 137.894 115.033 110.745 1.00 20.39  ? 60  VAL B CA    1 
ATOM 4689 C C     . VAL D 4 61  ? 136.796 114.910 111.792 1.00 20.39  ? 60  VAL B C     1 
ATOM 4690 O O     . VAL D 4 61  ? 136.941 115.386 112.925 1.00 20.39  ? 60  VAL B O     1 
ATOM 4691 C CB    . VAL D 4 61  ? 137.652 116.223 109.800 1.00 20.39  ? 60  VAL B CB    1 
ATOM 4692 C CG1   . VAL D 4 61  ? 137.284 117.461 110.586 1.00 20.39  ? 60  VAL B CG1   1 
ATOM 4693 C CG2   . VAL D 4 61  ? 138.889 116.488 108.968 1.00 20.39  ? 60  VAL B CG2   1 
ATOM 4694 N N     . PHE D 4 62  ? 135.698 114.230 111.452 1.00 21.11  ? 61  PHE B N     1 
ATOM 4695 C CA    . PHE D 4 62  ? 134.618 114.084 112.421 1.00 21.11  ? 61  PHE B CA    1 
ATOM 4696 C C     . PHE D 4 62  ? 135.058 113.206 113.587 1.00 21.11  ? 61  PHE B C     1 
ATOM 4697 O O     . PHE D 4 62  ? 134.778 113.515 114.755 1.00 21.11  ? 61  PHE B O     1 
ATOM 4698 C CB    . PHE D 4 62  ? 133.388 113.501 111.731 1.00 21.11  ? 61  PHE B CB    1 
ATOM 4699 C CG    . PHE D 4 62  ? 132.248 113.217 112.657 1.00 21.11  ? 61  PHE B CG    1 
ATOM 4700 C CD1   . PHE D 4 62  ? 131.527 114.250 113.222 1.00 21.11  ? 61  PHE B CD1   1 
ATOM 4701 C CD2   . PHE D 4 62  ? 131.898 111.918 112.964 1.00 21.11  ? 61  PHE B CD2   1 
ATOM 4702 C CE1   . PHE D 4 62  ? 130.479 113.991 114.071 1.00 21.11  ? 61  PHE B CE1   1 
ATOM 4703 C CE2   . PHE D 4 62  ? 130.854 111.655 113.814 1.00 21.11  ? 61  PHE B CE2   1 
ATOM 4704 C CZ    . PHE D 4 62  ? 130.143 112.692 114.368 1.00 21.11  ? 61  PHE B CZ    1 
ATOM 4705 N N     . LEU D 4 63  ? 135.805 112.140 113.295 1.00 22.09  ? 62  LEU B N     1 
ATOM 4706 C CA    . LEU D 4 63  ? 136.295 111.299 114.375 1.00 22.09  ? 62  LEU B CA    1 
ATOM 4707 C C     . LEU D 4 63  ? 137.404 111.977 115.155 1.00 22.09  ? 62  LEU B C     1 
ATOM 4708 O O     . LEU D 4 63  ? 137.490 111.802 116.370 1.00 22.09  ? 62  LEU B O     1 
ATOM 4709 C CB    . LEU D 4 63  ? 136.780 109.967 113.822 1.00 22.09  ? 62  LEU B CB    1 
ATOM 4710 C CG    . LEU D 4 63  ? 135.683 109.055 113.308 1.00 22.09  ? 62  LEU B CG    1 
ATOM 4711 C CD1   . LEU D 4 63  ? 136.271 107.834 112.668 1.00 22.09  ? 62  LEU B CD1   1 
ATOM 4712 C CD2   . LEU D 4 63  ? 134.894 108.650 114.519 1.00 22.09  ? 62  LEU B CD2   1 
ATOM 4713 N N     . GLU D 4 64  ? 138.227 112.797 114.504 1.00 23.15  ? 63  GLU B N     1 
ATOM 4714 C CA    . GLU D 4 64  ? 139.248 113.505 115.258 1.00 23.15  ? 63  GLU B CA    1 
ATOM 4715 C C     . GLU D 4 64  ? 138.648 114.598 116.116 1.00 23.15  ? 63  GLU B C     1 
ATOM 4716 O O     . GLU D 4 64  ? 139.292 115.046 117.069 1.00 23.15  ? 63  GLU B O     1 
ATOM 4717 C CB    . GLU D 4 64  ? 140.297 114.102 114.318 1.00 23.15  ? 63  GLU B CB    1 
ATOM 4718 C CG    . GLU D 4 64  ? 141.244 113.077 113.752 1.00 23.15  ? 63  GLU B CG    1 
ATOM 4719 C CD    . GLU D 4 64  ? 142.252 113.678 112.805 1.00 23.15  ? 63  GLU B CD    1 
ATOM 4720 O OE1   . GLU D 4 64  ? 142.124 114.878 112.484 1.00 23.15  ? 63  GLU B OE1   1 
ATOM 4721 O OE2   . GLU D 4 64  ? 143.182 112.955 112.392 1.00 23.15  ? 63  GLU B OE2   1 
ATOM 4722 N N     . ASN D 4 65  ? 137.439 115.042 115.799 1.00 24.01  ? 64  ASN B N     1 
ATOM 4723 C CA    . ASN D 4 65  ? 136.793 116.009 116.666 1.00 24.01  ? 64  ASN B CA    1 
ATOM 4724 C C     . ASN D 4 65  ? 136.003 115.366 117.791 1.00 24.01  ? 64  ASN B C     1 
ATOM 4725 O O     . ASN D 4 65  ? 135.880 115.963 118.866 1.00 24.01  ? 64  ASN B O     1 
ATOM 4726 C CB    . ASN D 4 65  ? 135.867 116.903 115.849 1.00 24.01  ? 64  ASN B CB    1 
ATOM 4727 C CG    . ASN D 4 65  ? 136.628 117.834 114.940 1.00 24.01  ? 64  ASN B CG    1 
ATOM 4728 O OD1   . ASN D 4 65  ? 137.677 118.357 115.313 1.00 24.01  ? 64  ASN B OD1   1 
ATOM 4729 N ND2   . ASN D 4 65  ? 136.097 118.065 113.744 1.00 24.01  ? 64  ASN B ND2   1 
ATOM 4730 N N     . VAL D 4 66  ? 135.481 114.161 117.589 1.00 25.23  ? 65  VAL B N     1 
ATOM 4731 C CA    . VAL D 4 66  ? 134.677 113.562 118.652 1.00 25.23  ? 65  VAL B CA    1 
ATOM 4732 C C     . VAL D 4 66  ? 135.525 112.713 119.591 1.00 25.23  ? 65  VAL B C     1 
ATOM 4733 O O     . VAL D 4 66  ? 135.334 112.756 120.812 1.00 25.23  ? 65  VAL B O     1 
ATOM 4734 C CB    . VAL D 4 66  ? 133.517 112.752 118.047 1.00 25.23  ? 65  VAL B CB    1 
ATOM 4735 C CG1   . VAL D 4 66  ? 133.245 111.514 118.884 1.00 25.23  ? 65  VAL B CG1   1 
ATOM 4736 C CG2   . VAL D 4 66  ? 132.299 113.623 117.905 1.00 25.23  ? 65  VAL B CG2   1 
ATOM 4737 N N     . ILE D 4 67  ? 136.510 111.987 119.051 1.00 25.22  ? 66  ILE B N     1 
ATOM 4738 C CA    . ILE D 4 67  ? 137.346 111.121 119.868 1.00 25.22  ? 66  ILE B CA    1 
ATOM 4739 C C     . ILE D 4 67  ? 138.251 111.955 120.758 1.00 25.22  ? 66  ILE B C     1 
ATOM 4740 O O     . ILE D 4 67  ? 138.642 111.511 121.839 1.00 25.22  ? 66  ILE B O     1 
ATOM 4741 C CB    . ILE D 4 67  ? 138.151 110.151 118.979 1.00 25.22  ? 66  ILE B CB    1 
ATOM 4742 C CG1   . ILE D 4 67  ? 137.219 109.214 118.209 1.00 25.22  ? 66  ILE B CG1   1 
ATOM 4743 C CG2   . ILE D 4 67  ? 139.093 109.305 119.798 1.00 25.22  ? 66  ILE B CG2   1 
ATOM 4744 C CD1   . ILE D 4 67  ? 137.913 108.387 117.162 1.00 25.22  ? 66  ILE B CD1   1 
ATOM 4745 N N     . ARG D 4 68  ? 138.586 113.178 120.341 1.00 26.99  ? 67  ARG B N     1 
ATOM 4746 C CA    . ARG D 4 68  ? 139.393 114.035 121.200 1.00 26.99  ? 67  ARG B CA    1 
ATOM 4747 C C     . ARG D 4 68  ? 138.631 114.375 122.471 1.00 26.99  ? 67  ARG B C     1 
ATOM 4748 O O     . ARG D 4 68  ? 139.182 114.315 123.576 1.00 26.99  ? 67  ARG B O     1 
ATOM 4749 C CB    . ARG D 4 68  ? 139.783 115.309 120.453 1.00 26.99  ? 67  ARG B CB    1 
ATOM 4750 C CG    . ARG D 4 68  ? 140.716 116.226 121.211 1.00 26.99  ? 67  ARG B CG    1 
ATOM 4751 C CD    . ARG D 4 68  ? 140.960 117.500 120.432 1.00 26.99  ? 67  ARG B CD    1 
ATOM 4752 N NE    . ARG D 4 68  ? 141.641 117.229 119.173 1.00 26.99  ? 67  ARG B NE    1 
ATOM 4753 C CZ    . ARG D 4 68  ? 141.129 117.469 117.972 1.00 26.99  ? 67  ARG B CZ    1 
ATOM 4754 N NH1   . ARG D 4 68  ? 139.920 118.000 117.856 1.00 26.99  ? 67  ARG B NH1   1 
ATOM 4755 N NH2   . ARG D 4 68  ? 141.835 117.190 116.885 1.00 26.99  ? 67  ARG B NH2   1 
ATOM 4756 N N     . ASP D 4 69  ? 137.328 114.615 122.344 1.00 27.46  ? 68  ASP B N     1 
ATOM 4757 C CA    . ASP D 4 69  ? 136.529 114.937 123.516 1.00 27.46  ? 68  ASP B CA    1 
ATOM 4758 C C     . ASP D 4 69  ? 136.205 113.692 124.323 1.00 27.46  ? 68  ASP B C     1 
ATOM 4759 O O     . ASP D 4 69  ? 136.113 113.762 125.553 1.00 27.46  ? 68  ASP B O     1 
ATOM 4760 C CB    . ASP D 4 69  ? 135.238 115.643 123.100 1.00 27.46  ? 68  ASP B CB    1 
ATOM 4761 C CG    . ASP D 4 69  ? 135.483 117.008 122.492 1.00 27.46  ? 68  ASP B CG    1 
ATOM 4762 O OD1   . ASP D 4 69  ? 136.649 117.446 122.454 1.00 27.46  ? 68  ASP B OD1   1 
ATOM 4763 O OD2   . ASP D 4 69  ? 134.504 117.651 122.056 1.00 27.46  ? 68  ASP B OD2   1 
ATOM 4764 N N     . ALA D 4 70  ? 136.098 112.537 123.668 1.00 27.47  ? 69  ALA B N     1 
ATOM 4765 C CA    . ALA D 4 70  ? 135.835 111.320 124.426 1.00 27.47  ? 69  ALA B CA    1 
ATOM 4766 C C     . ALA D 4 70  ? 137.068 110.918 125.222 1.00 27.47  ? 69  ALA B C     1 
ATOM 4767 O O     . ALA D 4 70  ? 136.962 110.512 126.385 1.00 27.47  ? 69  ALA B O     1 
ATOM 4768 C CB    . ALA D 4 70  ? 135.403 110.196 123.489 1.00 27.47  ? 69  ALA B CB    1 
ATOM 4769 N N     . VAL D 4 71  ? 138.254 111.128 124.650 1.00 27.92  ? 70  VAL B N     1 
ATOM 4770 C CA    . VAL D 4 71  ? 139.490 110.838 125.362 1.00 27.92  ? 70  VAL B CA    1 
ATOM 4771 C C     . VAL D 4 71  ? 139.708 111.879 126.446 1.00 27.92  ? 70  VAL B C     1 
ATOM 4772 O O     . VAL D 4 71  ? 140.289 111.582 127.495 1.00 27.92  ? 70  VAL B O     1 
ATOM 4773 C CB    . VAL D 4 71  ? 140.674 110.760 124.382 1.00 27.92  ? 70  VAL B CB    1 
ATOM 4774 C CG1   . VAL D 4 71  ? 141.978 110.612 125.131 1.00 27.92  ? 70  VAL B CG1   1 
ATOM 4775 C CG2   . VAL D 4 71  ? 140.493 109.588 123.443 1.00 27.92  ? 70  VAL B CG2   1 
ATOM 4776 N N     . THR D 4 72  ? 139.196 113.093 126.249 1.00 29.11  ? 71  THR B N     1 
ATOM 4777 C CA    . THR D 4 72  ? 139.317 114.095 127.298 1.00 29.11  ? 71  THR B CA    1 
ATOM 4778 C C     . THR D 4 72  ? 138.429 113.731 128.479 1.00 29.11  ? 71  THR B C     1 
ATOM 4779 O O     . THR D 4 72  ? 138.847 113.851 129.635 1.00 29.11  ? 71  THR B O     1 
ATOM 4780 C CB    . THR D 4 72  ? 138.968 115.477 126.753 1.00 29.11  ? 71  THR B CB    1 
ATOM 4781 O OG1   . THR D 4 72  ? 139.864 115.803 125.684 1.00 29.11  ? 71  THR B OG1   1 
ATOM 4782 C CG2   . THR D 4 72  ? 139.103 116.518 127.836 1.00 29.11  ? 71  THR B CG2   1 
ATOM 4783 N N     . TYR D 4 73  ? 137.223 113.224 128.213 1.00 30.26  ? 72  TYR B N     1 
ATOM 4784 C CA    . TYR D 4 73  ? 136.374 112.804 129.323 1.00 30.26  ? 72  TYR B CA    1 
ATOM 4785 C C     . TYR D 4 73  ? 136.927 111.559 130.004 1.00 30.26  ? 72  TYR B C     1 
ATOM 4786 O O     . TYR D 4 73  ? 136.776 111.405 131.222 1.00 30.26  ? 72  TYR B O     1 
ATOM 4787 C CB    . TYR D 4 73  ? 134.941 112.551 128.859 1.00 30.26  ? 72  TYR B CB    1 
ATOM 4788 C CG    . TYR D 4 73  ? 134.114 113.793 128.624 1.00 30.26  ? 72  TYR B CG    1 
ATOM 4789 C CD1   . TYR D 4 73  ? 133.597 114.508 129.691 1.00 30.26  ? 72  TYR B CD1   1 
ATOM 4790 C CD2   . TYR D 4 73  ? 133.820 114.230 127.346 1.00 30.26  ? 72  TYR B CD2   1 
ATOM 4791 C CE1   . TYR D 4 73  ? 132.832 115.634 129.493 1.00 30.26  ? 72  TYR B CE1   1 
ATOM 4792 C CE2   . TYR D 4 73  ? 133.056 115.358 127.137 1.00 30.26  ? 72  TYR B CE2   1 
ATOM 4793 C CZ    . TYR D 4 73  ? 132.564 116.055 128.215 1.00 30.26  ? 72  TYR B CZ    1 
ATOM 4794 O OH    . TYR D 4 73  ? 131.798 117.178 128.022 1.00 30.26  ? 72  TYR B OH    1 
ATOM 4795 N N     . THR D 4 74  ? 137.615 110.686 129.265 1.00 30.01  ? 73  THR B N     1 
ATOM 4796 C CA    . THR D 4 74  ? 138.163 109.503 129.923 1.00 30.01  ? 73  THR B CA    1 
ATOM 4797 C C     . THR D 4 74  ? 139.373 109.867 130.768 1.00 30.01  ? 73  THR B C     1 
ATOM 4798 O O     . THR D 4 74  ? 139.515 109.379 131.895 1.00 30.01  ? 73  THR B O     1 
ATOM 4799 C CB    . THR D 4 74  ? 138.557 108.431 128.911 1.00 30.01  ? 73  THR B CB    1 
ATOM 4800 O OG1   . THR D 4 74  ? 139.627 108.911 128.091 1.00 30.01  ? 73  THR B OG1   1 
ATOM 4801 C CG2   . THR D 4 74  ? 137.400 108.074 128.047 1.00 30.01  ? 73  THR B CG2   1 
ATOM 4802 N N     . GLU D 4 75  ? 140.257 110.722 130.251 1.00 32.03  ? 74  GLU B N     1 
ATOM 4803 C CA    . GLU D 4 75  ? 141.385 111.153 131.062 1.00 32.03  ? 74  GLU B CA    1 
ATOM 4804 C C     . GLU D 4 75  ? 140.929 111.998 132.241 1.00 32.03  ? 74  GLU B C     1 
ATOM 4805 O O     . GLU D 4 75  ? 141.591 112.008 133.285 1.00 32.03  ? 74  GLU B O     1 
ATOM 4806 C CB    . GLU D 4 75  ? 142.380 111.936 130.201 1.00 32.03  ? 74  GLU B CB    1 
ATOM 4807 C CG    . GLU D 4 75  ? 143.633 112.399 130.936 1.00 32.03  ? 74  GLU B CG    1 
ATOM 4808 C CD    . GLU D 4 75  ? 144.591 111.265 131.275 1.00 32.03  ? 74  GLU B CD    1 
ATOM 4809 O OE1   . GLU D 4 75  ? 144.249 110.088 131.042 1.00 32.03  ? 74  GLU B OE1   1 
ATOM 4810 O OE2   . GLU D 4 75  ? 145.686 111.556 131.796 1.00 32.03  ? 74  GLU B OE2   1 
ATOM 4811 N N     . HIS D 4 76  ? 139.789 112.678 132.120 1.00 33.37  ? 75  HIS B N     1 
ATOM 4812 C CA    . HIS D 4 76  ? 139.276 113.406 133.269 1.00 33.37  ? 75  HIS B CA    1 
ATOM 4813 C C     . HIS D 4 76  ? 138.649 112.476 134.291 1.00 33.37  ? 75  HIS B C     1 
ATOM 4814 O O     . HIS D 4 76  ? 138.653 112.783 135.486 1.00 33.37  ? 75  HIS B O     1 
ATOM 4815 C CB    . HIS D 4 76  ? 138.272 114.464 132.832 1.00 33.37  ? 75  HIS B CB    1 
ATOM 4816 C CG    . HIS D 4 76  ? 137.718 115.260 133.969 1.00 33.37  ? 75  HIS B CG    1 
ATOM 4817 N ND1   . HIS D 4 76  ? 136.505 114.977 134.556 1.00 33.37  ? 75  HIS B ND1   1 
ATOM 4818 C CD2   . HIS D 4 76  ? 138.242 116.292 134.669 1.00 33.37  ? 75  HIS B CD2   1 
ATOM 4819 C CE1   . HIS D 4 76  ? 136.287 115.832 135.539 1.00 33.37  ? 75  HIS B CE1   1 
ATOM 4820 N NE2   . HIS D 4 76  ? 137.328 116.637 135.631 1.00 33.37  ? 75  HIS B NE2   1 
ATOM 4821 N N     . ALA D 4 77  ? 138.108 111.349 133.850 1.00 32.67  ? 76  ALA B N     1 
ATOM 4822 C CA    . ALA D 4 77  ? 137.504 110.399 134.767 1.00 32.67  ? 76  ALA B CA    1 
ATOM 4823 C C     . ALA D 4 77  ? 138.517 109.392 135.285 1.00 32.67  ? 76  ALA B C     1 
ATOM 4824 O O     . ALA D 4 77  ? 138.128 108.422 135.942 1.00 32.67  ? 76  ALA B O     1 
ATOM 4825 C CB    . ALA D 4 77  ? 136.341 109.673 134.091 1.00 32.67  ? 76  ALA B CB    1 
ATOM 4826 N N     . LYS D 4 78  ? 139.802 109.607 135.002 1.00 33.41  ? 77  LYS B N     1 
ATOM 4827 C CA    . LYS D 4 78  ? 140.885 108.763 135.499 1.00 33.41  ? 77  LYS B CA    1 
ATOM 4828 C C     . LYS D 4 78  ? 140.679 107.310 135.096 1.00 33.41  ? 77  LYS B C     1 
ATOM 4829 O O     . LYS D 4 78  ? 141.030 106.389 135.837 1.00 33.41  ? 77  LYS B O     1 
ATOM 4830 C CB    . LYS D 4 78  ? 141.035 108.886 137.017 1.00 33.41  ? 77  LYS B CB    1 
ATOM 4831 C CG    . LYS D 4 78  ? 141.502 110.252 137.474 1.00 33.41  ? 77  LYS B CG    1 
ATOM 4832 C CD    . LYS D 4 78  ? 141.600 110.343 138.983 1.00 33.41  ? 77  LYS B CD    1 
ATOM 4833 C CE    . LYS D 4 78  ? 142.011 111.740 139.408 1.00 33.41  ? 77  LYS B CE    1 
ATOM 4834 N NZ    . LYS D 4 78  ? 142.121 111.873 140.884 1.00 33.41  ? 77  LYS B NZ    1 
ATOM 4835 N N     . ARG D 4 79  ? 140.102 107.100 133.920 1.00 32.78  ? 78  ARG B N     1 
ATOM 4836 C CA    . ARG D 4 79  ? 139.917 105.775 133.355 1.00 32.78  ? 78  ARG B CA    1 
ATOM 4837 C C     . ARG D 4 79  ? 140.861 105.554 132.183 1.00 32.78  ? 78  ARG B C     1 
ATOM 4838 O O     . ARG D 4 79  ? 141.540 106.467 131.709 1.00 32.78  ? 78  ARG B O     1 
ATOM 4839 C CB    . ARG D 4 79  ? 138.462 105.601 132.911 1.00 32.78  ? 78  ARG B CB    1 
ATOM 4840 C CG    . ARG D 4 79  ? 137.499 105.339 134.047 1.00 32.78  ? 78  ARG B CG    1 
ATOM 4841 C CD    . ARG D 4 79  ? 136.117 105.046 133.511 1.00 32.78  ? 78  ARG B CD    1 
ATOM 4842 N NE    . ARG D 4 79  ? 135.434 106.277 133.133 1.00 32.78  ? 78  ARG B NE    1 
ATOM 4843 C CZ    . ARG D 4 79  ? 135.214 106.660 131.881 1.00 32.78  ? 78  ARG B CZ    1 
ATOM 4844 N NH1   . ARG D 4 79  ? 135.646 105.919 130.874 1.00 32.78  ? 78  ARG B NH1   1 
ATOM 4845 N NH2   . ARG D 4 79  ? 134.579 107.797 131.638 1.00 32.78  ? 78  ARG B NH2   1 
ATOM 4846 N N     . LYS D 4 80  ? 140.898 104.307 131.723 1.00 35.82  ? 79  LYS B N     1 
ATOM 4847 C CA    . LYS D 4 80  ? 141.602 103.930 130.509 1.00 35.82  ? 79  LYS B CA    1 
ATOM 4848 C C     . LYS D 4 80  ? 140.681 103.304 129.476 1.00 35.82  ? 79  LYS B C     1 
ATOM 4849 O O     . LYS D 4 80  ? 141.148 102.937 128.392 1.00 35.82  ? 79  LYS B O     1 
ATOM 4850 C CB    . LYS D 4 80  ? 142.738 102.951 130.831 1.00 35.82  ? 79  LYS B CB    1 
ATOM 4851 C CG    . LYS D 4 80  ? 143.837 103.531 131.692 1.00 35.82  ? 79  LYS B CG    1 
ATOM 4852 C CD    . LYS D 4 80  ? 144.918 102.498 131.945 1.00 35.82  ? 79  LYS B CD    1 
ATOM 4853 C CE    . LYS D 4 80  ? 146.005 103.043 132.848 1.00 35.82  ? 79  LYS B CE    1 
ATOM 4854 N NZ    . LYS D 4 80  ? 147.062 102.025 133.092 1.00 35.82  ? 79  LYS B NZ    1 
ATOM 4855 N N     . THR D 4 81  ? 139.392 103.182 129.773 1.00 32.93  ? 80  THR B N     1 
ATOM 4856 C CA    . THR D 4 81  ? 138.412 102.614 128.859 1.00 32.93  ? 80  THR B CA    1 
ATOM 4857 C C     . THR D 4 81  ? 137.389 103.668 128.470 1.00 32.93  ? 80  THR B C     1 
ATOM 4858 O O     . THR D 4 81  ? 136.655 104.173 129.326 1.00 32.93  ? 80  THR B O     1 
ATOM 4859 C CB    . THR D 4 81  ? 137.714 101.409 129.488 1.00 32.93  ? 80  THR B CB    1 
ATOM 4860 O OG1   . THR D 4 81  ? 138.685 100.404 129.799 1.00 32.93  ? 80  THR B OG1   1 
ATOM 4861 C CG2   . THR D 4 81  ? 136.698 100.831 128.532 1.00 32.93  ? 80  THR B CG2   1 
ATOM 4862 N N     . VAL D 4 82  ? 137.355 104.007 127.185 1.00 28.67  ? 81  VAL B N     1 
ATOM 4863 C CA    . VAL D 4 82  ? 136.421 104.995 126.668 1.00 28.67  ? 81  VAL B CA    1 
ATOM 4864 C C     . VAL D 4 82  ? 135.039 104.364 126.659 1.00 28.67  ? 81  VAL B C     1 
ATOM 4865 O O     . VAL D 4 82  ? 134.741 103.521 125.808 1.00 28.67  ? 81  VAL B O     1 
ATOM 4866 C CB    . VAL D 4 82  ? 136.819 105.464 125.258 1.00 28.67  ? 81  VAL B CB    1 
ATOM 4867 C CG1   . VAL D 4 82  ? 135.841 106.503 124.745 1.00 28.67  ? 81  VAL B CG1   1 
ATOM 4868 C CG2   . VAL D 4 82  ? 138.238 105.990 125.246 1.00 28.67  ? 81  VAL B CG2   1 
ATOM 4869 N N     . THR D 4 83  ? 134.188 104.749 127.606 1.00 28.08  ? 82  THR B N     1 
ATOM 4870 C CA    . THR D 4 83  ? 132.863 104.159 127.668 1.00 28.08  ? 82  THR B CA    1 
ATOM 4871 C C     . THR D 4 83  ? 131.958 104.805 126.624 1.00 28.08  ? 82  THR B C     1 
ATOM 4872 O O     . THR D 4 83  ? 132.366 105.698 125.878 1.00 28.08  ? 82  THR B O     1 
ATOM 4873 C CB    . THR D 4 83  ? 132.272 104.331 129.063 1.00 28.08  ? 82  THR B CB    1 
ATOM 4874 O OG1   . THR D 4 83  ? 131.989 105.715 129.288 1.00 28.08  ? 82  THR B OG1   1 
ATOM 4875 C CG2   . THR D 4 83  ? 133.256 103.867 130.110 1.00 28.08  ? 82  THR B CG2   1 
ATOM 4876 N N     . ALA D 4 84  ? 130.706 104.355 126.562 1.00 27.08  ? 83  ALA B N     1 
ATOM 4877 C CA    . ALA D 4 84  ? 129.805 104.938 125.582 1.00 27.08  ? 83  ALA B CA    1 
ATOM 4878 C C     . ALA D 4 84  ? 129.205 106.251 126.051 1.00 27.08  ? 83  ALA B C     1 
ATOM 4879 O O     . ALA D 4 84  ? 128.730 107.031 125.217 1.00 27.08  ? 83  ALA B O     1 
ATOM 4880 C CB    . ALA D 4 84  ? 128.685 103.952 125.247 1.00 27.08  ? 83  ALA B CB    1 
ATOM 4881 N N     . MET D 4 85  ? 129.277 106.553 127.347 1.00 29.04  ? 84  MET B N     1 
ATOM 4882 C CA    . MET D 4 85  ? 128.763 107.829 127.817 1.00 29.04  ? 84  MET B CA    1 
ATOM 4883 C C     . MET D 4 85  ? 129.756 108.947 127.582 1.00 29.04  ? 84  MET B C     1 
ATOM 4884 O O     . MET D 4 85  ? 129.352 110.105 127.446 1.00 29.04  ? 84  MET B O     1 
ATOM 4885 C CB    . MET D 4 85  ? 128.404 107.747 129.300 1.00 29.04  ? 84  MET B CB    1 
ATOM 4886 C CG    . MET D 4 85  ? 127.176 106.907 129.571 1.00 29.04  ? 84  MET B CG    1 
ATOM 4887 S SD    . MET D 4 85  ? 125.740 107.551 128.698 1.00 29.04  ? 84  MET B SD    1 
ATOM 4888 C CE    . MET D 4 85  ? 125.508 109.113 129.539 1.00 29.04  ? 84  MET B CE    1 
ATOM 4889 N N     . ASP D 4 86  ? 131.033 108.609 127.429 1.00 29.64  ? 85  ASP B N     1 
ATOM 4890 C CA    . ASP D 4 86  ? 132.007 109.606 127.022 1.00 29.64  ? 85  ASP B CA    1 
ATOM 4891 C C     . ASP D 4 86  ? 131.794 109.974 125.565 1.00 29.64  ? 85  ASP B C     1 
ATOM 4892 O O     . ASP D 4 86  ? 131.948 111.139 125.185 1.00 29.64  ? 85  ASP B O     1 
ATOM 4893 C CB    . ASP D 4 86  ? 133.405 109.064 127.281 1.00 29.64  ? 85  ASP B CB    1 
ATOM 4894 C CG    . ASP D 4 86  ? 133.644 108.804 128.754 1.00 29.64  ? 85  ASP B CG    1 
ATOM 4895 O OD1   . ASP D 4 86  ? 132.871 109.334 129.578 1.00 29.64  ? 85  ASP B OD1   1 
ATOM 4896 O OD2   . ASP D 4 86  ? 134.589 108.073 129.097 1.00 29.64  ? 85  ASP B OD2   1 
ATOM 4897 N N     . VAL D 4 87  ? 131.333 109.015 124.766 1.00 27.96  ? 86  VAL B N     1 
ATOM 4898 C CA    . VAL D 4 87  ? 131.028 109.297 123.374 1.00 27.96  ? 86  VAL B CA    1 
ATOM 4899 C C     . VAL D 4 87  ? 129.734 110.086 123.283 1.00 27.96  ? 86  VAL B C     1 
ATOM 4900 O O     . VAL D 4 87  ? 129.598 110.982 122.445 1.00 27.96  ? 86  VAL B O     1 
ATOM 4901 C CB    . VAL D 4 87  ? 130.956 107.987 122.571 1.00 27.96  ? 86  VAL B CB    1 
ATOM 4902 C CG1   . VAL D 4 87  ? 130.569 108.265 121.136 1.00 27.96  ? 86  VAL B CG1   1 
ATOM 4903 C CG2   . VAL D 4 87  ? 132.278 107.255 122.637 1.00 27.96  ? 86  VAL B CG2   1 
ATOM 4904 N N     . VAL D 4 88  ? 128.769 109.788 124.155 1.00 28.68  ? 87  VAL B N     1 
ATOM 4905 C CA    . VAL D 4 88  ? 127.536 110.568 124.151 1.00 28.68  ? 87  VAL B CA    1 
ATOM 4906 C C     . VAL D 4 88  ? 127.808 112.003 124.591 1.00 28.68  ? 87  VAL B C     1 
ATOM 4907 O O     . VAL D 4 88  ? 127.241 112.949 124.038 1.00 28.68  ? 87  VAL B O     1 
ATOM 4908 C CB    . VAL D 4 88  ? 126.473 109.895 125.035 1.00 28.68  ? 87  VAL B CB    1 
ATOM 4909 C CG1   . VAL D 4 88  ? 125.245 110.771 125.142 1.00 28.68  ? 87  VAL B CG1   1 
ATOM 4910 C CG2   . VAL D 4 88  ? 126.093 108.551 124.457 1.00 28.68  ? 87  VAL B CG2   1 
ATOM 4911 N N     . TYR D 4 89  ? 128.717 112.197 125.549 1.00 31.84  ? 88  TYR B N     1 
ATOM 4912 C CA    . TYR D 4 89  ? 129.054 113.554 125.966 1.00 31.84  ? 88  TYR B CA    1 
ATOM 4913 C C     . TYR D 4 89  ? 129.853 114.287 124.898 1.00 31.84  ? 88  TYR B C     1 
ATOM 4914 O O     . TYR D 4 89  ? 129.648 115.492 124.679 1.00 31.84  ? 88  TYR B O     1 
ATOM 4915 C CB    . TYR D 4 89  ? 129.838 113.510 127.274 1.00 31.84  ? 88  TYR B CB    1 
ATOM 4916 C CG    . TYR D 4 89  ? 129.004 113.118 128.468 1.00 31.84  ? 88  TYR B CG    1 
ATOM 4917 C CD1   . TYR D 4 89  ? 127.622 113.224 128.438 1.00 31.84  ? 88  TYR B CD1   1 
ATOM 4918 C CD2   . TYR D 4 89  ? 129.598 112.620 129.618 1.00 31.84  ? 88  TYR B CD2   1 
ATOM 4919 C CE1   . TYR D 4 89  ? 126.856 112.863 129.525 1.00 31.84  ? 88  TYR B CE1   1 
ATOM 4920 C CE2   . TYR D 4 89  ? 128.840 112.252 130.708 1.00 31.84  ? 88  TYR B CE2   1 
ATOM 4921 C CZ    . TYR D 4 89  ? 127.470 112.376 130.657 1.00 31.84  ? 88  TYR B CZ    1 
ATOM 4922 O OH    . TYR D 4 89  ? 126.712 112.012 131.745 1.00 31.84  ? 88  TYR B OH    1 
ATOM 4923 N N     . ALA D 4 90  ? 130.685 113.560 124.150 1.00 28.70  ? 89  ALA B N     1 
ATOM 4924 C CA    . ALA D 4 90  ? 131.434 114.215 123.092 1.00 28.70  ? 89  ALA B CA    1 
ATOM 4925 C C     . ALA D 4 90  ? 130.519 114.592 121.945 1.00 28.70  ? 89  ALA B C     1 
ATOM 4926 O O     . ALA D 4 90  ? 130.722 115.630 121.308 1.00 28.70  ? 89  ALA B O     1 
ATOM 4927 C CB    . ALA D 4 90  ? 132.558 113.307 122.603 1.00 28.70  ? 89  ALA B CB    1 
ATOM 4928 N N     . LEU D 4 91  ? 129.507 113.774 121.665 1.00 29.46  ? 90  LEU B N     1 
ATOM 4929 C CA    . LEU D 4 91  ? 128.562 114.161 120.635 1.00 29.46  ? 90  LEU B CA    1 
ATOM 4930 C C     . LEU D 4 91  ? 127.611 115.234 121.133 1.00 29.46  ? 90  LEU B C     1 
ATOM 4931 O O     . LEU D 4 91  ? 127.049 115.974 120.321 1.00 29.46  ? 90  LEU B O     1 
ATOM 4932 C CB    . LEU D 4 91  ? 127.765 112.941 120.187 1.00 29.46  ? 90  LEU B CB    1 
ATOM 4933 C CG    . LEU D 4 91  ? 128.519 111.869 119.414 1.00 29.46  ? 90  LEU B CG    1 
ATOM 4934 C CD1   . LEU D 4 91  ? 127.635 110.657 119.300 1.00 29.46  ? 90  LEU B CD1   1 
ATOM 4935 C CD2   . LEU D 4 91  ? 128.905 112.380 118.043 1.00 29.46  ? 90  LEU B CD2   1 
ATOM 4936 N N     . LYS D 4 92  ? 127.419 115.333 122.452 1.00 31.75  ? 91  LYS B N     1 
ATOM 4937 C CA    . LYS D 4 92  ? 126.563 116.382 122.984 1.00 31.75  ? 91  LYS B CA    1 
ATOM 4938 C C     . LYS D 4 92  ? 127.264 117.724 122.906 1.00 31.75  ? 91  LYS B C     1 
ATOM 4939 O O     . LYS D 4 92  ? 126.607 118.768 122.823 1.00 31.75  ? 91  LYS B O     1 
ATOM 4940 C CB    . LYS D 4 92  ? 126.149 116.062 124.420 1.00 31.75  ? 91  LYS B CB    1 
ATOM 4941 C CG    . LYS D 4 92  ? 125.060 116.976 124.956 1.00 31.75  ? 91  LYS B CG    1 
ATOM 4942 C CD    . LYS D 4 92  ? 124.724 116.671 126.405 1.00 31.75  ? 91  LYS B CD    1 
ATOM 4943 C CE    . LYS D 4 92  ? 123.934 115.377 126.529 1.00 31.75  ? 91  LYS B CE    1 
ATOM 4944 N NZ    . LYS D 4 92  ? 123.506 115.122 127.933 1.00 31.75  ? 91  LYS B NZ    1 
ATOM 4945 N N     . ARG D 4 93  ? 128.595 117.712 122.915 1.00 31.79  ? 92  ARG B N     1 
ATOM 4946 C CA    . ARG D 4 93  ? 129.338 118.959 122.794 1.00 31.79  ? 92  ARG B CA    1 
ATOM 4947 C C     . ARG D 4 93  ? 129.462 119.432 121.356 1.00 31.79  ? 92  ARG B C     1 
ATOM 4948 O O     . ARG D 4 93  ? 130.188 120.395 121.095 1.00 31.79  ? 92  ARG B O     1 
ATOM 4949 C CB    . ARG D 4 93  ? 130.734 118.834 123.396 1.00 31.79  ? 92  ARG B CB    1 
ATOM 4950 C CG    . ARG D 4 93  ? 130.769 118.683 124.894 1.00 31.79  ? 92  ARG B CG    1 
ATOM 4951 C CD    . ARG D 4 93  ? 132.197 118.821 125.354 1.00 31.79  ? 92  ARG B CD    1 
ATOM 4952 N NE    . ARG D 4 93  ? 132.652 120.188 125.125 1.00 31.79  ? 92  ARG B NE    1 
ATOM 4953 C CZ    . ARG D 4 93  ? 133.520 120.540 124.183 1.00 31.79  ? 92  ARG B CZ    1 
ATOM 4954 N NH1   . ARG D 4 93  ? 134.026 119.624 123.371 1.00 31.79  ? 92  ARG B NH1   1 
ATOM 4955 N NH2   . ARG D 4 93  ? 133.869 121.810 124.043 1.00 31.79  ? 92  ARG B NH2   1 
ATOM 4956 N N     . GLN D 4 94  ? 128.784 118.772 120.422 1.00 30.62  ? 93  GLN B N     1 
ATOM 4957 C CA    . GLN D 4 94  ? 128.717 119.217 119.038 1.00 30.62  ? 93  GLN B CA    1 
ATOM 4958 C C     . GLN D 4 94  ? 127.286 119.435 118.573 1.00 30.62  ? 93  GLN B C     1 
ATOM 4959 O O     . GLN D 4 94  ? 127.064 119.672 117.381 1.00 30.62  ? 93  GLN B O     1 
ATOM 4960 C CB    . GLN D 4 94  ? 129.422 118.220 118.119 1.00 30.62  ? 93  GLN B CB    1 
ATOM 4961 C CG    . GLN D 4 94  ? 130.894 118.081 118.409 1.00 30.62  ? 93  GLN B CG    1 
ATOM 4962 C CD    . GLN D 4 94  ? 131.547 117.017 117.568 1.00 30.62  ? 93  GLN B CD    1 
ATOM 4963 O OE1   . GLN D 4 94  ? 130.888 116.345 116.779 1.00 30.62  ? 93  GLN B OE1   1 
ATOM 4964 N NE2   . GLN D 4 94  ? 132.854 116.861 117.724 1.00 30.62  ? 93  GLN B NE2   1 
ATOM 4965 N N     . GLY D 4 95  ? 126.314 119.363 119.475 1.00 31.94  ? 94  GLY B N     1 
ATOM 4966 C CA    . GLY D 4 95  ? 124.928 119.460 119.061 1.00 31.94  ? 94  GLY B CA    1 
ATOM 4967 C C     . GLY D 4 95  ? 124.478 118.243 118.287 1.00 31.94  ? 94  GLY B C     1 
ATOM 4968 O O     . GLY D 4 95  ? 123.813 118.381 117.255 1.00 31.94  ? 94  GLY B O     1 
ATOM 4969 N N     . ARG D 4 96  ? 124.846 117.054 118.753 1.00 32.91  ? 95  ARG B N     1 
ATOM 4970 C CA    . ARG D 4 96  ? 124.523 115.788 118.105 1.00 32.91  ? 95  ARG B CA    1 
ATOM 4971 C C     . ARG D 4 96  ? 124.091 114.776 119.160 1.00 32.91  ? 95  ARG B C     1 
ATOM 4972 O O     . ARG D 4 96  ? 124.621 113.667 119.235 1.00 32.91  ? 95  ARG B O     1 
ATOM 4973 C CB    . ARG D 4 96  ? 125.721 115.250 117.324 1.00 32.91  ? 95  ARG B CB    1 
ATOM 4974 C CG    . ARG D 4 96  ? 125.999 115.902 115.977 1.00 32.91  ? 95  ARG B CG    1 
ATOM 4975 C CD    . ARG D 4 96  ? 124.751 116.277 115.198 1.00 32.91  ? 95  ARG B CD    1 
ATOM 4976 N NE    . ARG D 4 96  ? 123.872 115.143 114.938 1.00 32.91  ? 95  ARG B NE    1 
ATOM 4977 C CZ    . ARG D 4 96  ? 122.649 115.258 114.436 1.00 32.91  ? 95  ARG B CZ    1 
ATOM 4978 N NH1   . ARG D 4 96  ? 122.164 116.458 114.148 1.00 32.91  ? 95  ARG B NH1   1 
ATOM 4979 N NH2   . ARG D 4 96  ? 121.908 114.180 114.226 1.00 32.91  ? 95  ARG B NH2   1 
ATOM 4980 N N     . THR D 4 97  ? 123.132 115.158 120.007 1.00 32.69  ? 96  THR B N     1 
ATOM 4981 C CA    . THR D 4 97  ? 122.712 114.289 121.102 1.00 32.69  ? 96  THR B CA    1 
ATOM 4982 C C     . THR D 4 97  ? 122.318 112.906 120.598 1.00 32.69  ? 96  THR B C     1 
ATOM 4983 O O     . THR D 4 97  ? 121.614 112.765 119.597 1.00 32.69  ? 96  THR B O     1 
ATOM 4984 C CB    . THR D 4 97  ? 121.533 114.927 121.838 1.00 32.69  ? 96  THR B CB    1 
ATOM 4985 O OG1   . THR D 4 97  ? 121.910 116.225 122.315 1.00 32.69  ? 96  THR B OG1   1 
ATOM 4986 C CG2   . THR D 4 97  ? 121.112 114.072 123.013 1.00 32.69  ? 96  THR B CG2   1 
ATOM 4987 N N     . LEU D 4 98  ? 122.793 111.882 121.305 1.00 30.96  ? 97  LEU B N     1 
ATOM 4988 C CA    . LEU D 4 98  ? 122.597 110.486 120.937 1.00 30.96  ? 97  LEU B CA    1 
ATOM 4989 C C     . LEU D 4 98  ? 121.808 109.749 122.012 1.00 30.96  ? 97  LEU B C     1 
ATOM 4990 O O     . LEU D 4 98  ? 122.273 109.636 123.150 1.00 30.96  ? 97  LEU B O     1 
ATOM 4991 C CB    . LEU D 4 98  ? 123.950 109.812 120.706 1.00 30.96  ? 97  LEU B CB    1 
ATOM 4992 C CG    . LEU D 4 98  ? 124.000 108.340 120.313 1.00 30.96  ? 97  LEU B CG    1 
ATOM 4993 C CD1   . LEU D 4 98  ? 123.356 108.131 118.963 1.00 30.96  ? 97  LEU B CD1   1 
ATOM 4994 C CD2   . LEU D 4 98  ? 125.438 107.875 120.292 1.00 30.96  ? 97  LEU B CD2   1 
ATOM 4995 N N     . TYR D 4 99  ? 120.623 109.253 121.662 1.00 32.49  ? 98  TYR B N     1 
ATOM 4996 C CA    . TYR D 4 99  ? 119.775 108.556 122.622 1.00 32.49  ? 98  TYR B CA    1 
ATOM 4997 C C     . TYR D 4 99  ? 120.013 107.056 122.518 1.00 32.49  ? 98  TYR B C     1 
ATOM 4998 O O     . TYR D 4 99  ? 120.203 106.523 121.423 1.00 32.49  ? 98  TYR B O     1 
ATOM 4999 C CB    . TYR D 4 99  ? 118.291 108.855 122.409 1.00 32.49  ? 98  TYR B CB    1 
ATOM 5000 C CG    . TYR D 4 99  ? 117.864 110.248 122.797 1.00 32.49  ? 98  TYR B CG    1 
ATOM 5001 C CD1   . TYR D 4 99  ? 118.677 111.051 123.579 1.00 32.49  ? 98  TYR B CD1   1 
ATOM 5002 C CD2   . TYR D 4 99  ? 116.625 110.739 122.425 1.00 32.49  ? 98  TYR B CD2   1 
ATOM 5003 C CE1   . TYR D 4 99  ? 118.282 112.316 123.946 1.00 32.49  ? 98  TYR B CE1   1 
ATOM 5004 C CE2   . TYR D 4 99  ? 116.223 112.003 122.790 1.00 32.49  ? 98  TYR B CE2   1 
ATOM 5005 C CZ    . TYR D 4 99  ? 117.057 112.788 123.548 1.00 32.49  ? 98  TYR B CZ    1 
ATOM 5006 O OH    . TYR D 4 99  ? 116.661 114.051 123.917 1.00 32.49  ? 98  TYR B OH    1 
ATOM 5007 N N     . GLY D 4 100 ? 119.991 106.379 123.656 1.00 31.14  ? 99  GLY B N     1 
ATOM 5008 C CA    . GLY D 4 100 ? 120.099 104.940 123.694 1.00 31.14  ? 99  GLY B CA    1 
ATOM 5009 C C     . GLY D 4 100 ? 121.360 104.366 124.320 1.00 31.14  ? 99  GLY B C     1 
ATOM 5010 O O     . GLY D 4 100 ? 121.709 103.220 124.012 1.00 31.14  ? 99  GLY B O     1 
ATOM 5011 N N     . PHE D 4 101 ? 122.052 105.120 125.167 1.00 28.76  ? 100 PHE B N     1 
ATOM 5012 C CA    . PHE D 4 101 ? 123.270 104.638 125.810 1.00 28.76  ? 100 PHE B CA    1 
ATOM 5013 C C     . PHE D 4 101 ? 123.312 105.060 127.274 1.00 28.76  ? 100 PHE B C     1 
ATOM 5014 O O     . PHE D 4 101 ? 122.307 104.987 127.980 1.00 28.76  ? 100 PHE B O     1 
ATOM 5015 C CB    . PHE D 4 101 ? 124.506 105.156 125.076 1.00 28.76  ? 100 PHE B CB    1 
ATOM 5016 C CG    . PHE D 4 101 ? 124.697 104.556 123.715 1.00 28.76  ? 100 PHE B CG    1 
ATOM 5017 C CD1   . PHE D 4 101 ? 125.320 103.330 123.568 1.00 28.76  ? 100 PHE B CD1   1 
ATOM 5018 C CD2   . PHE D 4 101 ? 124.244 105.209 122.586 1.00 28.76  ? 100 PHE B CD2   1 
ATOM 5019 C CE1   . PHE D 4 101 ? 125.495 102.774 122.318 1.00 28.76  ? 100 PHE B CE1   1 
ATOM 5020 C CE2   . PHE D 4 101 ? 124.417 104.656 121.336 1.00 28.76  ? 100 PHE B CE2   1 
ATOM 5021 C CZ    . PHE D 4 101 ? 125.040 103.436 121.202 1.00 28.76  ? 100 PHE B CZ    1 
ATOM 5022 N N     . SER E 5 37  ? 133.158 144.888 135.714 1.00 40.57  ? 36  SER D N     1 
ATOM 5023 C CA    . SER E 5 37  ? 133.733 144.145 136.827 1.00 40.57  ? 36  SER D CA    1 
ATOM 5024 C C     . SER E 5 37  ? 135.198 143.832 136.564 1.00 40.57  ? 36  SER D C     1 
ATOM 5025 O O     . SER E 5 37  ? 136.067 144.173 137.361 1.00 40.57  ? 36  SER D O     1 
ATOM 5026 C CB    . SER E 5 37  ? 132.954 142.851 137.072 1.00 40.57  ? 36  SER D CB    1 
ATOM 5027 O OG    . SER E 5 37  ? 133.592 142.045 138.048 1.00 40.57  ? 36  SER D OG    1 
ATOM 5028 N N     . TYR E 5 38  ? 135.465 143.188 135.432 1.00 39.48  ? 37  TYR D N     1 
ATOM 5029 C CA    . TYR E 5 38  ? 136.806 142.737 135.089 1.00 39.48  ? 37  TYR D CA    1 
ATOM 5030 C C     . TYR E 5 38  ? 137.572 143.760 134.267 1.00 39.48  ? 37  TYR D C     1 
ATOM 5031 O O     . TYR E 5 38  ? 138.651 143.446 133.755 1.00 39.48  ? 37  TYR D O     1 
ATOM 5032 C CB    . TYR E 5 38  ? 136.722 141.413 134.328 1.00 39.48  ? 37  TYR D CB    1 
ATOM 5033 C CG    . TYR E 5 38  ? 136.367 140.238 135.203 1.00 39.48  ? 37  TYR D CG    1 
ATOM 5034 C CD1   . TYR E 5 38  ? 136.754 140.193 136.532 1.00 39.48  ? 37  TYR D CD1   1 
ATOM 5035 C CD2   . TYR E 5 38  ? 135.595 139.198 134.712 1.00 39.48  ? 37  TYR D CD2   1 
ATOM 5036 C CE1   . TYR E 5 38  ? 136.418 139.126 137.333 1.00 39.48  ? 37  TYR D CE1   1 
ATOM 5037 C CE2   . TYR E 5 38  ? 135.253 138.129 135.504 1.00 39.48  ? 37  TYR D CE2   1 
ATOM 5038 C CZ    . TYR E 5 38  ? 135.664 138.098 136.814 1.00 39.48  ? 37  TYR D CZ    1 
ATOM 5039 O OH    . TYR E 5 38  ? 135.322 137.032 137.612 1.00 39.48  ? 37  TYR D OH    1 
ATOM 5040 N N     . SER E 5 39  ? 137.041 144.976 134.135 1.00 39.50  ? 38  SER D N     1 
ATOM 5041 C CA    . SER E 5 39  ? 137.638 145.969 133.253 1.00 39.50  ? 38  SER D CA    1 
ATOM 5042 C C     . SER E 5 39  ? 138.909 146.566 133.834 1.00 39.50  ? 38  SER D C     1 
ATOM 5043 O O     . SER E 5 39  ? 139.727 147.103 133.080 1.00 39.50  ? 38  SER D O     1 
ATOM 5044 C CB    . SER E 5 39  ? 136.629 147.077 132.954 1.00 39.50  ? 38  SER D CB    1 
ATOM 5045 O OG    . SER E 5 39  ? 136.209 147.718 134.143 1.00 39.50  ? 38  SER D OG    1 
ATOM 5046 N N     . ILE E 5 40  ? 139.095 146.479 135.153 1.00 39.30  ? 39  ILE D N     1 
ATOM 5047 C CA    . ILE E 5 40  ? 140.266 147.080 135.780 1.00 39.30  ? 39  ILE D CA    1 
ATOM 5048 C C     . ILE E 5 40  ? 141.504 146.226 135.559 1.00 39.30  ? 39  ILE D C     1 
ATOM 5049 O O     . ILE E 5 40  ? 142.627 146.742 135.595 1.00 39.30  ? 39  ILE D O     1 
ATOM 5050 C CB    . ILE E 5 40  ? 140.053 147.281 137.297 1.00 39.30  ? 39  ILE D CB    1 
ATOM 5051 C CG1   . ILE E 5 40  ? 138.890 148.235 137.625 1.00 39.30  ? 39  ILE D CG1   1 
ATOM 5052 C CG2   . ILE E 5 40  ? 141.307 147.813 137.982 1.00 39.30  ? 39  ILE D CG2   1 
ATOM 5053 C CD1   . ILE E 5 40  ? 137.480 147.741 137.306 1.00 39.30  ? 39  ILE D CD1   1 
ATOM 5054 N N     . TYR E 5 41  ? 141.324 144.945 135.247 1.00 39.53  ? 40  TYR D N     1 
ATOM 5055 C CA    . TYR E 5 41  ? 142.444 144.046 135.020 1.00 39.53  ? 40  TYR D CA    1 
ATOM 5056 C C     . TYR E 5 41  ? 142.787 143.881 133.548 1.00 39.53  ? 40  TYR D C     1 
ATOM 5057 O O     . TYR E 5 41  ? 143.919 143.507 133.227 1.00 39.53  ? 40  TYR D O     1 
ATOM 5058 C CB    . TYR E 5 41  ? 142.125 142.688 135.644 1.00 39.53  ? 40  TYR D CB    1 
ATOM 5059 C CG    . TYR E 5 41  ? 142.052 142.779 137.144 1.00 39.53  ? 40  TYR D CG    1 
ATOM 5060 C CD1   . TYR E 5 41  ? 143.199 142.899 137.912 1.00 39.53  ? 40  TYR D CD1   1 
ATOM 5061 C CD2   . TYR E 5 41  ? 140.826 142.799 137.788 1.00 39.53  ? 40  TYR D CD2   1 
ATOM 5062 C CE1   . TYR E 5 41  ? 143.125 143.008 139.285 1.00 39.53  ? 40  TYR D CE1   1 
ATOM 5063 C CE2   . TYR E 5 41  ? 140.742 142.907 139.155 1.00 39.53  ? 40  TYR D CE2   1 
ATOM 5064 C CZ    . TYR E 5 41  ? 141.891 143.014 139.899 1.00 39.53  ? 40  TYR D CZ    1 
ATOM 5065 O OH    . TYR E 5 41  ? 141.807 143.118 141.267 1.00 39.53  ? 40  TYR D OH    1 
ATOM 5066 N N     . VAL E 5 42  ? 141.847 144.174 132.652 1.00 39.44  ? 41  VAL D N     1 
ATOM 5067 C CA    . VAL E 5 42  ? 142.147 144.146 131.228 1.00 39.44  ? 41  VAL D CA    1 
ATOM 5068 C C     . VAL E 5 42  ? 143.159 145.231 130.890 1.00 39.44  ? 41  VAL D C     1 
ATOM 5069 O O     . VAL E 5 42  ? 144.123 144.999 130.152 1.00 39.44  ? 41  VAL D O     1 
ATOM 5070 C CB    . VAL E 5 42  ? 140.846 144.298 130.420 1.00 39.44  ? 41  VAL D CB    1 
ATOM 5071 C CG1   . VAL E 5 42  ? 141.138 144.408 128.942 1.00 39.44  ? 41  VAL D CG1   1 
ATOM 5072 C CG2   . VAL E 5 42  ? 139.913 143.134 130.700 1.00 39.44  ? 41  VAL D CG2   1 
ATOM 5073 N N     . TYR E 5 43  ? 142.993 146.415 131.476 1.00 41.18  ? 42  TYR D N     1 
ATOM 5074 C CA    . TYR E 5 43  ? 143.959 147.484 131.266 1.00 41.18  ? 42  TYR D CA    1 
ATOM 5075 C C     . TYR E 5 43  ? 145.276 147.187 131.968 1.00 41.18  ? 42  TYR D C     1 
ATOM 5076 O O     . TYR E 5 43  ? 146.343 147.587 131.484 1.00 41.18  ? 42  TYR D O     1 
ATOM 5077 C CB    . TYR E 5 43  ? 143.361 148.797 131.768 1.00 41.18  ? 42  TYR D CB    1 
ATOM 5078 C CG    . TYR E 5 43  ? 144.205 150.026 131.548 1.00 41.18  ? 42  TYR D CG    1 
ATOM 5079 C CD1   . TYR E 5 43  ? 144.370 150.565 130.281 1.00 41.18  ? 42  TYR D CD1   1 
ATOM 5080 C CD2   . TYR E 5 43  ? 144.813 150.667 132.617 1.00 41.18  ? 42  TYR D CD2   1 
ATOM 5081 C CE1   . TYR E 5 43  ? 145.137 151.698 130.085 1.00 41.18  ? 42  TYR D CE1   1 
ATOM 5082 C CE2   . TYR E 5 43  ? 145.579 151.797 132.433 1.00 41.18  ? 42  TYR D CE2   1 
ATOM 5083 C CZ    . TYR E 5 43  ? 145.738 152.310 131.165 1.00 41.18  ? 42  TYR D CZ    1 
ATOM 5084 O OH    . TYR E 5 43  ? 146.500 153.440 130.978 1.00 41.18  ? 42  TYR D OH    1 
ATOM 5085 N N     . LYS E 5 44  ? 145.232 146.409 133.050 1.00 39.69  ? 43  LYS D N     1 
ATOM 5086 C CA    . LYS E 5 44  ? 146.463 146.064 133.745 1.00 39.69  ? 43  LYS D CA    1 
ATOM 5087 C C     . LYS E 5 44  ? 147.275 145.033 132.975 1.00 39.69  ? 43  LYS D C     1 
ATOM 5088 O O     . LYS E 5 44  ? 148.509 145.078 133.005 1.00 39.69  ? 43  LYS D O     1 
ATOM 5089 C CB    . LYS E 5 44  ? 146.128 145.555 135.146 1.00 39.69  ? 43  LYS D CB    1 
ATOM 5090 C CG    . LYS E 5 44  ? 147.319 145.360 136.060 1.00 39.69  ? 43  LYS D CG    1 
ATOM 5091 C CD    . LYS E 5 44  ? 146.851 145.008 137.466 1.00 39.69  ? 43  LYS D CD    1 
ATOM 5092 C CE    . LYS E 5 44  ? 148.018 144.799 138.415 1.00 39.69  ? 43  LYS D CE    1 
ATOM 5093 N NZ    . LYS E 5 44  ? 147.551 144.445 139.785 1.00 39.69  ? 43  LYS D NZ    1 
ATOM 5094 N N     . VAL E 5 45  ? 146.617 144.095 132.290 1.00 39.99  ? 44  VAL D N     1 
ATOM 5095 C CA    . VAL E 5 45  ? 147.377 143.212 131.411 1.00 39.99  ? 44  VAL D CA    1 
ATOM 5096 C C     . VAL E 5 45  ? 147.817 143.957 130.155 1.00 39.99  ? 44  VAL D C     1 
ATOM 5097 O O     . VAL E 5 45  ? 148.885 143.668 129.593 1.00 39.99  ? 44  VAL D O     1 
ATOM 5098 C CB    . VAL E 5 45  ? 146.580 141.935 131.078 1.00 39.99  ? 44  VAL D CB    1 
ATOM 5099 C CG1   . VAL E 5 45  ? 145.455 142.217 130.106 1.00 39.99  ? 44  VAL D CG1   1 
ATOM 5100 C CG2   . VAL E 5 45  ? 147.504 140.870 130.521 1.00 39.99  ? 44  VAL D CG2   1 
ATOM 5101 N N     . LEU E 5 46  ? 147.017 144.924 129.691 1.00 40.07  ? 45  LEU D N     1 
ATOM 5102 C CA    . LEU E 5 46  ? 147.404 145.657 128.494 1.00 40.07  ? 45  LEU D CA    1 
ATOM 5103 C C     . LEU E 5 46  ? 148.617 146.537 128.748 1.00 40.07  ? 45  LEU D C     1 
ATOM 5104 O O     . LEU E 5 46  ? 149.393 146.799 127.825 1.00 40.07  ? 45  LEU D O     1 
ATOM 5105 C CB    . LEU E 5 46  ? 146.231 146.497 127.994 1.00 40.07  ? 45  LEU D CB    1 
ATOM 5106 C CG    . LEU E 5 46  ? 146.413 147.257 126.680 1.00 40.07  ? 45  LEU D CG    1 
ATOM 5107 C CD1   . LEU E 5 46  ? 146.723 146.305 125.544 1.00 40.07  ? 45  LEU D CD1   1 
ATOM 5108 C CD2   . LEU E 5 46  ? 145.169 148.056 126.369 1.00 40.07  ? 45  LEU D CD2   1 
ATOM 5109 N N     . LYS E 5 47  ? 148.812 146.979 129.992 1.00 40.86  ? 46  LYS D N     1 
ATOM 5110 C CA    . LYS E 5 47  ? 150.023 147.723 130.316 1.00 40.86  ? 46  LYS D CA    1 
ATOM 5111 C C     . LYS E 5 47  ? 151.267 146.847 130.264 1.00 40.86  ? 46  LYS D C     1 
ATOM 5112 O O     . LYS E 5 47  ? 152.373 147.373 130.109 1.00 40.86  ? 46  LYS D O     1 
ATOM 5113 C CB    . LYS E 5 47  ? 149.887 148.394 131.681 1.00 40.86  ? 46  LYS D CB    1 
ATOM 5114 C CG    . LYS E 5 47  ? 148.920 149.569 131.668 1.00 40.86  ? 46  LYS D CG    1 
ATOM 5115 C CD    . LYS E 5 47  ? 148.857 150.274 133.008 1.00 40.86  ? 46  LYS D CD    1 
ATOM 5116 C CE    . LYS E 5 47  ? 150.114 151.089 133.250 1.00 40.86  ? 46  LYS D CE    1 
ATOM 5117 N NZ    . LYS E 5 47  ? 150.304 152.124 132.199 1.00 40.86  ? 46  LYS D NZ    1 
ATOM 5118 N N     . GLN E 5 48  ? 151.114 145.530 130.398 1.00 41.11  ? 47  GLN D N     1 
ATOM 5119 C CA    . GLN E 5 48  ? 152.242 144.614 130.297 1.00 41.11  ? 47  GLN D CA    1 
ATOM 5120 C C     . GLN E 5 48  ? 152.505 144.198 128.859 1.00 41.11  ? 47  GLN D C     1 
ATOM 5121 O O     . GLN E 5 48  ? 153.663 144.110 128.437 1.00 41.11  ? 47  GLN D O     1 
ATOM 5122 C CB    . GLN E 5 48  ? 151.996 143.361 131.141 1.00 41.11  ? 47  GLN D CB    1 
ATOM 5123 C CG    . GLN E 5 48  ? 151.940 143.589 132.634 1.00 41.11  ? 47  GLN D CG    1 
ATOM 5124 C CD    . GLN E 5 48  ? 151.642 142.308 133.389 1.00 41.11  ? 47  GLN D CD    1 
ATOM 5125 O OE1   . GLN E 5 48  ? 151.430 141.257 132.786 1.00 41.11  ? 47  GLN D OE1   1 
ATOM 5126 N NE2   . GLN E 5 48  ? 151.630 142.388 134.715 1.00 41.11  ? 47  GLN D NE2   1 
ATOM 5127 N N     . VAL E 5 49  ? 151.443 143.939 128.101 1.00 40.80  ? 48  VAL D N     1 
ATOM 5128 C CA    . VAL E 5 49  ? 151.603 143.425 126.745 1.00 40.80  ? 48  VAL D CA    1 
ATOM 5129 C C     . VAL E 5 49  ? 151.899 144.554 125.763 1.00 40.80  ? 48  VAL D C     1 
ATOM 5130 O O     . VAL E 5 49  ? 152.664 144.377 124.810 1.00 40.80  ? 48  VAL D O     1 
ATOM 5131 C CB    . VAL E 5 49  ? 150.371 142.601 126.332 1.00 40.80  ? 48  VAL D CB    1 
ATOM 5132 C CG1   . VAL E 5 49  ? 149.154 143.486 126.133 1.00 40.80  ? 48  VAL D CG1   1 
ATOM 5133 C CG2   . VAL E 5 49  ? 150.674 141.809 125.084 1.00 40.80  ? 48  VAL D CG2   1 
ATOM 5134 N N     . HIS E 5 50  ? 151.315 145.730 125.987 1.00 42.07  ? 49  HIS D N     1 
ATOM 5135 C CA    . HIS E 5 50  ? 151.587 146.912 125.169 1.00 42.07  ? 49  HIS D CA    1 
ATOM 5136 C C     . HIS E 5 50  ? 151.482 148.140 126.052 1.00 42.07  ? 49  HIS D C     1 
ATOM 5137 O O     . HIS E 5 50  ? 150.417 148.761 126.166 1.00 42.07  ? 49  HIS D O     1 
ATOM 5138 C CB    . HIS E 5 50  ? 150.638 147.016 123.978 1.00 42.07  ? 49  HIS D CB    1 
ATOM 5139 C CG    . HIS E 5 50  ? 150.863 145.967 122.937 1.00 42.07  ? 49  HIS D CG    1 
ATOM 5140 N ND1   . HIS E 5 50  ? 151.982 145.949 122.132 1.00 42.07  ? 49  HIS D ND1   1 
ATOM 5141 C CD2   . HIS E 5 50  ? 150.119 144.898 122.570 1.00 42.07  ? 49  HIS D CD2   1 
ATOM 5142 C CE1   . HIS E 5 50  ? 151.916 144.915 121.313 1.00 42.07  ? 49  HIS D CE1   1 
ATOM 5143 N NE2   . HIS E 5 50  ? 150.796 144.261 121.558 1.00 42.07  ? 49  HIS D NE2   1 
ATOM 5144 N N     . PRO E 5 51  ? 152.588 148.539 126.685 1.00 42.63  ? 50  PRO D N     1 
ATOM 5145 C CA    . PRO E 5 51  ? 152.561 149.713 127.568 1.00 42.63  ? 50  PRO D CA    1 
ATOM 5146 C C     . PRO E 5 51  ? 152.404 151.023 126.827 1.00 42.63  ? 50  PRO D C     1 
ATOM 5147 O O     . PRO E 5 51  ? 152.176 152.053 127.473 1.00 42.63  ? 50  PRO D O     1 
ATOM 5148 C CB    . PRO E 5 51  ? 153.914 149.642 128.284 1.00 42.63  ? 50  PRO D CB    1 
ATOM 5149 C CG    . PRO E 5 51  ? 154.792 148.920 127.334 1.00 42.63  ? 50  PRO D CG    1 
ATOM 5150 C CD    . PRO E 5 51  ? 153.924 147.923 126.624 1.00 42.63  ? 50  PRO D CD    1 
ATOM 5151 N N     . ASP E 5 52  ? 152.517 151.021 125.502 1.00 45.06  ? 51  ASP D N     1 
ATOM 5152 C CA    . ASP E 5 52  ? 152.382 152.239 124.721 1.00 45.06  ? 51  ASP D CA    1 
ATOM 5153 C C     . ASP E 5 52  ? 151.017 152.358 124.072 1.00 45.06  ? 51  ASP D C     1 
ATOM 5154 O O     . ASP E 5 52  ? 150.535 153.476 123.868 1.00 45.06  ? 51  ASP D O     1 
ATOM 5155 C CB    . ASP E 5 52  ? 153.444 152.285 123.619 1.00 45.06  ? 51  ASP D CB    1 
ATOM 5156 C CG    . ASP E 5 52  ? 154.841 152.472 124.161 1.00 45.06  ? 51  ASP D CG    1 
ATOM 5157 O OD1   . ASP E 5 52  ? 155.147 151.887 125.220 1.00 45.06  ? 51  ASP D OD1   1 
ATOM 5158 O OD2   . ASP E 5 52  ? 155.636 153.189 123.521 1.00 45.06  ? 51  ASP D OD2   1 
ATOM 5159 N N     . THR E 5 53  ? 150.372 151.238 123.764 1.00 44.14  ? 52  THR D N     1 
ATOM 5160 C CA    . THR E 5 53  ? 149.097 151.263 123.066 1.00 44.14  ? 52  THR D CA    1 
ATOM 5161 C C     . THR E 5 53  ? 147.949 151.304 124.066 1.00 44.14  ? 52  THR D C     1 
ATOM 5162 O O     . THR E 5 53  ? 147.872 150.470 124.973 1.00 44.14  ? 52  THR D O     1 
ATOM 5163 C CB    . THR E 5 53  ? 148.960 150.040 122.160 1.00 44.14  ? 52  THR D CB    1 
ATOM 5164 O OG1   . THR E 5 53  ? 150.029 150.028 121.203 1.00 44.14  ? 52  THR D OG1   1 
ATOM 5165 C CG2   . THR E 5 53  ? 147.625 150.063 121.441 1.00 44.14  ? 52  THR D CG2   1 
ATOM 5166 N N     . GLY E 5 54  ? 147.061 152.277 123.885 1.00 43.36  ? 53  GLY D N     1 
ATOM 5167 C CA    . GLY E 5 54  ? 145.892 152.441 124.720 1.00 43.36  ? 53  GLY D CA    1 
ATOM 5168 C C     . GLY E 5 54  ? 144.695 151.702 124.156 1.00 43.36  ? 53  GLY D C     1 
ATOM 5169 O O     . GLY E 5 54  ? 144.757 151.065 123.106 1.00 43.36  ? 53  GLY D O     1 
ATOM 5170 N N     . ILE E 5 55  ? 143.582 151.780 124.887 1.00 42.42  ? 54  ILE D N     1 
ATOM 5171 C CA    . ILE E 5 55  ? 142.367 151.073 124.503 1.00 42.42  ? 54  ILE D CA    1 
ATOM 5172 C C     . ILE E 5 55  ? 141.190 152.028 124.649 1.00 42.42  ? 54  ILE D C     1 
ATOM 5173 O O     . ILE E 5 55  ? 141.223 152.970 125.446 1.00 42.42  ? 54  ILE D O     1 
ATOM 5174 C CB    . ILE E 5 55  ? 142.147 149.800 125.354 1.00 42.42  ? 54  ILE D CB    1 
ATOM 5175 C CG1   . ILE E 5 55  ? 141.067 148.913 124.735 1.00 42.42  ? 54  ILE D CG1   1 
ATOM 5176 C CG2   . ILE E 5 55  ? 141.780 150.168 126.783 1.00 42.42  ? 54  ILE D CG2   1 
ATOM 5177 C CD1   . ILE E 5 55  ? 140.999 147.523 125.319 1.00 42.42  ? 54  ILE D CD1   1 
ATOM 5178 N N     . SER E 5 56  ? 140.146 151.783 123.860 1.00 41.70  ? 55  SER D N     1 
ATOM 5179 C CA    . SER E 5 56  ? 138.968 152.639 123.843 1.00 41.70  ? 55  SER D CA    1 
ATOM 5180 C C     . SER E 5 56  ? 138.052 152.300 125.011 1.00 41.70  ? 55  SER D C     1 
ATOM 5181 O O     . SER E 5 56  ? 138.386 151.503 125.892 1.00 41.70  ? 55  SER D O     1 
ATOM 5182 C CB    . SER E 5 56  ? 138.234 152.513 122.513 1.00 41.70  ? 55  SER D CB    1 
ATOM 5183 O OG    . SER E 5 56  ? 137.038 153.270 122.528 1.00 41.70  ? 55  SER D OG    1 
ATOM 5184 N N     . SER E 5 57  ? 136.863 152.902 125.020 1.00 40.63  ? 56  SER D N     1 
ATOM 5185 C CA    . SER E 5 57  ? 135.906 152.646 126.082 1.00 40.63  ? 56  SER D CA    1 
ATOM 5186 C C     . SER E 5 57  ? 134.854 151.634 125.676 1.00 40.63  ? 56  SER D C     1 
ATOM 5187 O O     . SER E 5 57  ? 134.278 150.978 126.548 1.00 40.63  ? 56  SER D O     1 
ATOM 5188 C CB    . SER E 5 57  ? 135.212 153.945 126.502 1.00 40.63  ? 56  SER D CB    1 
ATOM 5189 O OG    . SER E 5 57  ? 136.003 154.664 127.429 1.00 40.63  ? 56  SER D OG    1 
ATOM 5190 N N     . LYS E 5 58  ? 134.586 151.493 124.377 1.00 39.77  ? 57  LYS D N     1 
ATOM 5191 C CA    . LYS E 5 58  ? 133.706 150.425 123.930 1.00 39.77  ? 57  LYS D CA    1 
ATOM 5192 C C     . LYS E 5 58  ? 134.459 149.107 123.853 1.00 39.77  ? 57  LYS D C     1 
ATOM 5193 O O     . LYS E 5 58  ? 133.887 148.045 124.126 1.00 39.77  ? 57  LYS D O     1 
ATOM 5194 C CB    . LYS E 5 58  ? 133.108 150.771 122.565 1.00 39.77  ? 57  LYS D CB    1 
ATOM 5195 C CG    . LYS E 5 58  ? 132.085 151.900 122.577 1.00 39.77  ? 57  LYS D CG    1 
ATOM 5196 C CD    . LYS E 5 58  ? 131.511 152.123 121.182 1.00 39.77  ? 57  LYS D CD    1 
ATOM 5197 C CE    . LYS E 5 58  ? 130.488 153.246 121.158 1.00 39.77  ? 57  LYS D CE    1 
ATOM 5198 N NZ    . LYS E 5 58  ? 129.939 153.450 119.787 1.00 39.77  ? 57  LYS D NZ    1 
ATOM 5199 N N     . ALA E 5 59  ? 135.754 149.165 123.531 1.00 39.37  ? 58  ALA D N     1 
ATOM 5200 C CA    . ALA E 5 59  ? 136.551 147.953 123.454 1.00 39.37  ? 58  ALA D CA    1 
ATOM 5201 C C     . ALA E 5 59  ? 136.802 147.374 124.832 1.00 39.37  ? 58  ALA D C     1 
ATOM 5202 O O     . ALA E 5 59  ? 136.977 146.159 124.962 1.00 39.37  ? 58  ALA D O     1 
ATOM 5203 C CB    . ALA E 5 59  ? 137.878 148.233 122.751 1.00 39.37  ? 58  ALA D CB    1 
ATOM 5204 N N     . MET E 5 60  ? 136.753 148.210 125.869 1.00 39.64  ? 59  MET D N     1 
ATOM 5205 C CA    . MET E 5 60  ? 136.860 147.695 127.226 1.00 39.64  ? 59  MET D CA    1 
ATOM 5206 C C     . MET E 5 60  ? 135.595 146.950 127.617 1.00 39.64  ? 59  MET D C     1 
ATOM 5207 O O     . MET E 5 60  ? 135.663 145.912 128.281 1.00 39.64  ? 59  MET D O     1 
ATOM 5208 C CB    . MET E 5 60  ? 137.146 148.829 128.205 1.00 39.64  ? 59  MET D CB    1 
ATOM 5209 C CG    . MET E 5 60  ? 137.314 148.367 129.638 1.00 39.64  ? 59  MET D CG    1 
ATOM 5210 S SD    . MET E 5 60  ? 138.666 147.189 129.809 1.00 39.64  ? 59  MET D SD    1 
ATOM 5211 C CE    . MET E 5 60  ? 140.075 148.275 129.624 1.00 39.64  ? 59  MET D CE    1 
ATOM 5212 N N     . GLY E 5 61  ? 134.434 147.427 127.168 1.00 37.63  ? 60  GLY D N     1 
ATOM 5213 C CA    . GLY E 5 61  ? 133.214 146.688 127.428 1.00 37.63  ? 60  GLY D CA    1 
ATOM 5214 C C     . GLY E 5 61  ? 133.139 145.419 126.610 1.00 37.63  ? 60  GLY D C     1 
ATOM 5215 O O     . GLY E 5 61  ? 132.585 144.414 127.065 1.00 37.63  ? 60  GLY D O     1 
ATOM 5216 N N     . ILE E 5 62  ? 133.785 145.408 125.444 1.00 36.55  ? 61  ILE D N     1 
ATOM 5217 C CA    . ILE E 5 62  ? 133.794 144.195 124.637 1.00 36.55  ? 61  ILE D CA    1 
ATOM 5218 C C     . ILE E 5 62  ? 134.715 143.164 125.265 1.00 36.55  ? 61  ILE D C     1 
ATOM 5219 O O     . ILE E 5 62  ? 134.375 141.980 125.352 1.00 36.55  ? 61  ILE D O     1 
ATOM 5220 C CB    . ILE E 5 62  ? 134.188 144.511 123.187 1.00 36.55  ? 61  ILE D CB    1 
ATOM 5221 C CG1   . ILE E 5 62  ? 133.130 145.410 122.563 1.00 36.55  ? 61  ILE D CG1   1 
ATOM 5222 C CG2   . ILE E 5 62  ? 134.349 143.235 122.385 1.00 36.55  ? 61  ILE D CG2   1 
ATOM 5223 C CD1   . ILE E 5 62  ? 133.547 146.003 121.276 1.00 36.55  ? 61  ILE D CD1   1 
ATOM 5224 N N     . MET E 5 63  ? 135.882 143.596 125.742 1.00 36.54  ? 62  MET D N     1 
ATOM 5225 C CA    . MET E 5 63  ? 136.777 142.656 126.395 1.00 36.54  ? 62  MET D CA    1 
ATOM 5226 C C     . MET E 5 63  ? 136.236 142.230 127.749 1.00 36.54  ? 62  MET D C     1 
ATOM 5227 O O     . MET E 5 63  ? 136.491 141.102 128.175 1.00 36.54  ? 62  MET D O     1 
ATOM 5228 C CB    . MET E 5 63  ? 138.167 143.266 126.559 1.00 36.54  ? 62  MET D CB    1 
ATOM 5229 C CG    . MET E 5 63  ? 138.897 143.515 125.259 1.00 36.54  ? 62  MET D CG    1 
ATOM 5230 S SD    . MET E 5 63  ? 139.133 141.990 124.337 1.00 36.54  ? 62  MET D SD    1 
ATOM 5231 C CE    . MET E 5 63  ? 140.281 141.139 125.412 1.00 36.54  ? 62  MET D CE    1 
ATOM 5232 N N     . ASN E 5 64  ? 135.395 143.053 128.378 1.00 36.78  ? 63  ASN D N     1 
ATOM 5233 C CA    . ASN E 5 64  ? 134.807 142.658 129.648 1.00 36.78  ? 63  ASN D CA    1 
ATOM 5234 C C     . ASN E 5 64  ? 133.650 141.692 129.448 1.00 36.78  ? 63  ASN D C     1 
ATOM 5235 O O     . ASN E 5 64  ? 133.472 140.772 130.255 1.00 36.78  ? 63  ASN D O     1 
ATOM 5236 C CB    . ASN E 5 64  ? 134.339 143.902 130.403 1.00 36.78  ? 63  ASN D CB    1 
ATOM 5237 C CG    . ASN E 5 64  ? 134.172 143.659 131.882 1.00 36.78  ? 63  ASN D CG    1 
ATOM 5238 O OD1   . ASN E 5 64  ? 134.408 142.557 132.371 1.00 36.78  ? 63  ASN D OD1   1 
ATOM 5239 N ND2   . ASN E 5 64  ? 133.761 144.691 132.608 1.00 36.78  ? 63  ASN D ND2   1 
ATOM 5240 N N     . SER E 5 65  ? 132.940 141.794 128.324 1.00 35.33  ? 64  SER D N     1 
ATOM 5241 C CA    . SER E 5 65  ? 131.917 140.795 128.058 1.00 35.33  ? 64  SER D CA    1 
ATOM 5242 C C     . SER E 5 65  ? 132.553 139.515 127.549 1.00 35.33  ? 64  SER D C     1 
ATOM 5243 O O     . SER E 5 65  ? 132.062 138.420 127.838 1.00 35.33  ? 64  SER D O     1 
ATOM 5244 C CB    . SER E 5 65  ? 130.903 141.323 127.046 1.00 35.33  ? 64  SER D CB    1 
ATOM 5245 O OG    . SER E 5 65  ? 131.502 141.483 125.775 1.00 35.33  ? 64  SER D OG    1 
ATOM 5246 N N     . PHE E 5 66  ? 133.703 139.633 126.891 1.00 34.97  ? 65  PHE D N     1 
ATOM 5247 C CA    . PHE E 5 66  ? 134.443 138.450 126.483 1.00 34.97  ? 65  PHE D CA    1 
ATOM 5248 C C     . PHE E 5 66  ? 134.963 137.694 127.694 1.00 34.97  ? 65  PHE D C     1 
ATOM 5249 O O     . PHE E 5 66  ? 134.885 136.461 127.745 1.00 34.97  ? 65  PHE D O     1 
ATOM 5250 C CB    . PHE E 5 66  ? 135.597 138.859 125.568 1.00 34.97  ? 65  PHE D CB    1 
ATOM 5251 C CG    . PHE E 5 66  ? 136.620 137.785 125.362 1.00 34.97  ? 65  PHE D CG    1 
ATOM 5252 C CD1   . PHE E 5 66  ? 136.328 136.653 124.628 1.00 34.97  ? 65  PHE D CD1   1 
ATOM 5253 C CD2   . PHE E 5 66  ? 137.882 137.911 125.912 1.00 34.97  ? 65  PHE D CD2   1 
ATOM 5254 C CE1   . PHE E 5 66  ? 137.278 135.669 124.447 1.00 34.97  ? 65  PHE D CE1   1 
ATOM 5255 C CE2   . PHE E 5 66  ? 138.832 136.934 125.733 1.00 34.97  ? 65  PHE D CE2   1 
ATOM 5256 C CZ    . PHE E 5 66  ? 138.531 135.813 125.000 1.00 34.97  ? 65  PHE D CZ    1 
ATOM 5257 N N     . VAL E 5 67  ? 135.486 138.416 128.687 1.00 35.57  ? 66  VAL D N     1 
ATOM 5258 C CA    . VAL E 5 67  ? 136.000 137.738 129.868 1.00 35.57  ? 66  VAL D CA    1 
ATOM 5259 C C     . VAL E 5 67  ? 134.874 137.160 130.714 1.00 35.57  ? 66  VAL D C     1 
ATOM 5260 O O     . VAL E 5 67  ? 134.967 136.017 131.178 1.00 35.57  ? 66  VAL D O     1 
ATOM 5261 C CB    . VAL E 5 67  ? 136.855 138.716 130.690 1.00 35.57  ? 66  VAL D CB    1 
ATOM 5262 C CG1   . VAL E 5 67  ? 137.242 138.101 132.006 1.00 35.57  ? 66  VAL D CG1   1 
ATOM 5263 C CG2   . VAL E 5 67  ? 138.070 139.133 129.921 1.00 35.57  ? 66  VAL D CG2   1 
ATOM 5264 N N     . ASN E 5 68  ? 133.765 137.893 130.885 1.00 36.35  ? 67  ASN D N     1 
ATOM 5265 C CA    . ASN E 5 68  ? 132.672 137.297 131.646 1.00 36.35  ? 67  ASN D CA    1 
ATOM 5266 C C     . ASN E 5 68  ? 131.989 136.164 130.896 1.00 36.35  ? 67  ASN D C     1 
ATOM 5267 O O     . ASN E 5 68  ? 131.493 135.230 131.538 1.00 36.35  ? 67  ASN D O     1 
ATOM 5268 C CB    . ASN E 5 68  ? 131.667 138.375 132.085 1.00 36.35  ? 67  ASN D CB    1 
ATOM 5269 C CG    . ASN E 5 68  ? 130.860 138.964 130.937 1.00 36.35  ? 67  ASN D CG    1 
ATOM 5270 O OD1   . ASN E 5 68  ? 130.478 138.277 129.994 1.00 36.35  ? 67  ASN D OD1   1 
ATOM 5271 N ND2   . ASN E 5 68  ? 130.586 140.260 131.029 1.00 36.35  ? 67  ASN D ND2   1 
ATOM 5272 N N     . ASP E 5 69  ? 132.188 136.078 129.584 1.00 36.10  ? 68  ASP D N     1 
ATOM 5273 C CA    . ASP E 5 69  ? 131.614 134.958 128.861 1.00 36.10  ? 68  ASP D CA    1 
ATOM 5274 C C     . ASP E 5 69  ? 132.517 133.743 128.909 1.00 36.10  ? 68  ASP D C     1 
ATOM 5275 O O     . ASP E 5 69  ? 132.035 132.635 129.160 1.00 36.10  ? 68  ASP D O     1 
ATOM 5276 C CB    . ASP E 5 69  ? 131.346 135.363 127.410 1.00 36.10  ? 68  ASP D CB    1 
ATOM 5277 C CG    . ASP E 5 69  ? 130.657 134.279 126.619 1.00 36.10  ? 68  ASP D CG    1 
ATOM 5278 O OD1   . ASP E 5 69  ? 129.450 134.052 126.845 1.00 36.10  ? 68  ASP D OD1   1 
ATOM 5279 O OD2   . ASP E 5 69  ? 131.320 133.660 125.762 1.00 36.10  ? 68  ASP D OD2   1 
ATOM 5280 N N     . ILE E 5 70  ? 133.823 133.911 128.706 1.00 35.92  ? 69  ILE D N     1 
ATOM 5281 C CA    . ILE E 5 70  ? 134.670 132.733 128.772 1.00 35.92  ? 69  ILE D CA    1 
ATOM 5282 C C     . ILE E 5 70  ? 134.847 132.273 130.208 1.00 35.92  ? 69  ILE D C     1 
ATOM 5283 O O     . ILE E 5 70  ? 135.055 131.077 130.440 1.00 35.92  ? 69  ILE D O     1 
ATOM 5284 C CB    . ILE E 5 70  ? 136.041 133.011 128.125 1.00 35.92  ? 69  ILE D CB    1 
ATOM 5285 C CG1   . ILE E 5 70  ? 136.666 131.712 127.619 1.00 35.92  ? 69  ILE D CG1   1 
ATOM 5286 C CG2   . ILE E 5 70  ? 136.968 133.694 129.110 1.00 35.92  ? 69  ILE D CG2   1 
ATOM 5287 C CD1   . ILE E 5 70  ? 135.904 131.069 126.487 1.00 35.92  ? 69  ILE D CD1   1 
ATOM 5288 N N     . PHE E 5 71  ? 134.517 133.132 131.176 1.00 36.74  ? 70  PHE D N     1 
ATOM 5289 C CA    . PHE E 5 71  ? 134.457 132.693 132.562 1.00 36.74  ? 70  PHE D CA    1 
ATOM 5290 C C     . PHE E 5 71  ? 133.193 131.896 132.833 1.00 36.74  ? 70  PHE D C     1 
ATOM 5291 O O     . PHE E 5 71  ? 133.255 130.813 133.428 1.00 36.74  ? 70  PHE D O     1 
ATOM 5292 C CB    . PHE E 5 71  ? 134.530 133.908 133.486 1.00 36.74  ? 70  PHE D CB    1 
ATOM 5293 C CG    . PHE E 5 71  ? 134.345 133.578 134.930 1.00 36.74  ? 70  PHE D CG    1 
ATOM 5294 C CD1   . PHE E 5 71  ? 135.371 133.025 135.665 1.00 36.74  ? 70  PHE D CD1   1 
ATOM 5295 C CD2   . PHE E 5 71  ? 133.129 133.802 135.549 1.00 36.74  ? 70  PHE D CD2   1 
ATOM 5296 C CE1   . PHE E 5 71  ? 135.193 132.718 136.993 1.00 36.74  ? 70  PHE D CE1   1 
ATOM 5297 C CE2   . PHE E 5 71  ? 132.947 133.491 136.874 1.00 36.74  ? 70  PHE D CE2   1 
ATOM 5298 C CZ    . PHE E 5 71  ? 133.981 132.947 137.596 1.00 36.74  ? 70  PHE D CZ    1 
ATOM 5299 N N     . GLU E 5 72  ? 132.036 132.386 132.378 1.00 38.11  ? 71  GLU D N     1 
ATOM 5300 C CA    . GLU E 5 72  ? 130.824 131.660 132.725 1.00 38.11  ? 71  GLU D CA    1 
ATOM 5301 C C     . GLU E 5 72  ? 130.630 130.450 131.823 1.00 38.11  ? 71  GLU D C     1 
ATOM 5302 O O     . GLU E 5 72  ? 129.715 129.654 132.060 1.00 38.11  ? 71  GLU D O     1 
ATOM 5303 C CB    . GLU E 5 72  ? 129.601 132.587 132.727 1.00 38.11  ? 71  GLU D CB    1 
ATOM 5304 C CG    . GLU E 5 72  ? 129.165 133.180 131.412 1.00 38.11  ? 71  GLU D CG    1 
ATOM 5305 C CD    . GLU E 5 72  ? 127.897 134.007 131.572 1.00 38.11  ? 71  GLU D CD    1 
ATOM 5306 O OE1   . GLU E 5 72  ? 127.318 133.992 132.682 1.00 38.11  ? 71  GLU D OE1   1 
ATOM 5307 O OE2   . GLU E 5 72  ? 127.483 134.677 130.602 1.00 38.11  ? 71  GLU D OE2   1 
ATOM 5308 N N     . ARG E 5 73  ? 131.477 130.299 130.802 1.00 36.51  ? 72  ARG D N     1 
ATOM 5309 C CA    . ARG E 5 73  ? 131.525 129.088 129.993 1.00 36.51  ? 72  ARG D CA    1 
ATOM 5310 C C     . ARG E 5 73  ? 132.483 128.063 130.583 1.00 36.51  ? 72  ARG D C     1 
ATOM 5311 O O     . ARG E 5 73  ? 132.137 126.879 130.668 1.00 36.51  ? 72  ARG D O     1 
ATOM 5312 C CB    . ARG E 5 73  ? 131.937 129.407 128.557 1.00 36.51  ? 72  ARG D CB    1 
ATOM 5313 C CG    . ARG E 5 73  ? 130.885 130.120 127.744 1.00 36.51  ? 72  ARG D CG    1 
ATOM 5314 C CD    . ARG E 5 73  ? 131.452 130.528 126.403 1.00 36.51  ? 72  ARG D CD    1 
ATOM 5315 N NE    . ARG E 5 73  ? 131.859 129.380 125.604 1.00 36.51  ? 72  ARG D NE    1 
ATOM 5316 C CZ    . ARG E 5 73  ? 132.557 129.473 124.478 1.00 36.51  ? 72  ARG D CZ    1 
ATOM 5317 N NH1   . ARG E 5 73  ? 132.923 130.662 124.023 1.00 36.51  ? 72  ARG D NH1   1 
ATOM 5318 N NH2   . ARG E 5 73  ? 132.890 128.379 123.809 1.00 36.51  ? 72  ARG D NH2   1 
ATOM 5319 N N     . ILE E 5 74  ? 133.659 128.490 131.054 1.00 35.51  ? 73  ILE D N     1 
ATOM 5320 C CA    . ILE E 5 74  ? 134.583 127.517 131.622 1.00 35.51  ? 73  ILE D CA    1 
ATOM 5321 C C     . ILE E 5 74  ? 134.041 127.007 132.947 1.00 35.51  ? 73  ILE D C     1 
ATOM 5322 O O     . ILE E 5 74  ? 134.114 125.809 133.240 1.00 35.51  ? 73  ILE D O     1 
ATOM 5323 C CB    . ILE E 5 74  ? 135.997 128.104 131.765 1.00 35.51  ? 73  ILE D CB    1 
ATOM 5324 C CG1   . ILE E 5 74  ? 136.583 128.404 130.388 1.00 35.51  ? 73  ILE D CG1   1 
ATOM 5325 C CG2   . ILE E 5 74  ? 136.898 127.134 132.496 1.00 35.51  ? 73  ILE D CG2   1 
ATOM 5326 C CD1   . ILE E 5 74  ? 137.893 129.141 130.431 1.00 35.51  ? 73  ILE D CD1   1 
ATOM 5327 N N     . ALA E 5 75  ? 133.474 127.896 133.765 1.00 37.66  ? 74  ALA D N     1 
ATOM 5328 C CA    . ALA E 5 75  ? 132.935 127.448 135.041 1.00 37.66  ? 74  ALA D CA    1 
ATOM 5329 C C     . ALA E 5 75  ? 131.696 126.582 134.852 1.00 37.66  ? 74  ALA D C     1 
ATOM 5330 O O     . ALA E 5 75  ? 131.459 125.665 135.644 1.00 37.66  ? 74  ALA D O     1 
ATOM 5331 C CB    . ALA E 5 75  ? 132.604 128.651 135.916 1.00 37.66  ? 74  ALA D CB    1 
ATOM 5332 N N     . GLY E 5 76  ? 130.953 126.781 133.769 1.00 38.43  ? 75  GLY D N     1 
ATOM 5333 C CA    . GLY E 5 76  ? 129.772 125.974 133.532 1.00 38.43  ? 75  GLY D CA    1 
ATOM 5334 C C     . GLY E 5 76  ? 130.176 124.601 133.043 1.00 38.43  ? 75  GLY D C     1 
ATOM 5335 O O     . GLY E 5 76  ? 129.589 123.579 133.430 1.00 38.43  ? 75  GLY D O     1 
ATOM 5336 N N     . GLU E 5 77  ? 131.244 124.559 132.247 1.00 38.12  ? 76  GLU D N     1 
ATOM 5337 C CA    . GLU E 5 77  ? 131.723 123.270 131.775 1.00 38.12  ? 76  GLU D CA    1 
ATOM 5338 C C     . GLU E 5 77  ? 132.340 122.496 132.927 1.00 38.12  ? 76  GLU D C     1 
ATOM 5339 O O     . GLU E 5 77  ? 132.147 121.280 133.042 1.00 38.12  ? 76  GLU D O     1 
ATOM 5340 C CB    . GLU E 5 77  ? 132.746 123.469 130.658 1.00 38.12  ? 76  GLU D CB    1 
ATOM 5341 C CG    . GLU E 5 77  ? 133.259 122.189 130.009 1.00 38.12  ? 76  GLU D CG    1 
ATOM 5342 C CD    . GLU E 5 77  ? 132.265 121.566 129.052 1.00 38.12  ? 76  GLU D CD    1 
ATOM 5343 O OE1   . GLU E 5 77  ? 131.474 122.316 128.450 1.00 38.12  ? 76  GLU D OE1   1 
ATOM 5344 O OE2   . GLU E 5 77  ? 132.277 120.329 128.891 1.00 38.12  ? 76  GLU D OE2   1 
ATOM 5345 N N     . ALA E 5 78  ? 133.017 123.195 133.840 1.00 38.20  ? 77  ALA D N     1 
ATOM 5346 C CA    . ALA E 5 78  ? 133.581 122.509 134.990 1.00 38.20  ? 77  ALA D CA    1 
ATOM 5347 C C     . ALA E 5 78  ? 132.521 122.118 136.007 1.00 38.20  ? 77  ALA D C     1 
ATOM 5348 O O     . ALA E 5 78  ? 132.713 121.131 136.721 1.00 38.20  ? 77  ALA D O     1 
ATOM 5349 C CB    . ALA E 5 78  ? 134.641 123.385 135.659 1.00 38.20  ? 77  ALA D CB    1 
ATOM 5350 N N     . SER E 5 79  ? 131.366 122.787 136.027 1.00 39.54  ? 78  SER D N     1 
ATOM 5351 C CA    . SER E 5 79  ? 130.310 122.287 136.897 1.00 39.54  ? 78  SER D CA    1 
ATOM 5352 C C     . SER E 5 79  ? 129.619 121.076 136.299 1.00 39.54  ? 78  SER D C     1 
ATOM 5353 O O     . SER E 5 79  ? 129.255 120.148 137.034 1.00 39.54  ? 78  SER D O     1 
ATOM 5354 C CB    . SER E 5 79  ? 129.280 123.381 137.148 1.00 39.54  ? 78  SER D CB    1 
ATOM 5355 O OG    . SER E 5 79  ? 129.889 124.472 137.790 1.00 39.54  ? 78  SER D OG    1 
ATOM 5356 N N     . ARG E 5 80  ? 129.523 121.009 134.971 1.00 40.17  ? 79  ARG D N     1 
ATOM 5357 C CA    . ARG E 5 80  ? 128.961 119.798 134.392 1.00 40.17  ? 79  ARG D CA    1 
ATOM 5358 C C     . ARG E 5 80  ? 129.928 118.635 134.551 1.00 40.17  ? 79  ARG D C     1 
ATOM 5359 O O     . ARG E 5 80  ? 129.495 117.490 134.716 1.00 40.17  ? 79  ARG D O     1 
ATOM 5360 C CB    . ARG E 5 80  ? 128.529 119.997 132.938 1.00 40.17  ? 79  ARG D CB    1 
ATOM 5361 C CG    . ARG E 5 80  ? 127.371 120.975 132.807 1.00 40.17  ? 79  ARG D CG    1 
ATOM 5362 C CD    . ARG E 5 80  ? 126.869 121.160 131.379 1.00 40.17  ? 79  ARG D CD    1 
ATOM 5363 N NE    . ARG E 5 80  ? 127.715 121.989 130.533 1.00 40.17  ? 79  ARG D NE    1 
ATOM 5364 C CZ    . ARG E 5 80  ? 128.669 121.521 129.739 1.00 40.17  ? 79  ARG D CZ    1 
ATOM 5365 N NH1   . ARG E 5 80  ? 128.904 120.218 129.672 1.00 40.17  ? 79  ARG D NH1   1 
ATOM 5366 N NH2   . ARG E 5 80  ? 129.376 122.361 129.000 1.00 40.17  ? 79  ARG D NH2   1 
ATOM 5367 N N     . LEU E 5 81  ? 131.233 118.906 134.502 1.00 38.73  ? 80  LEU D N     1 
ATOM 5368 C CA    . LEU E 5 81  ? 132.204 117.840 134.720 1.00 38.73  ? 80  LEU D CA    1 
ATOM 5369 C C     . LEU E 5 81  ? 132.293 117.429 136.185 1.00 38.73  ? 80  LEU D C     1 
ATOM 5370 O O     . LEU E 5 81  ? 132.619 116.274 136.479 1.00 38.73  ? 80  LEU D O     1 
ATOM 5371 C CB    . LEU E 5 81  ? 133.576 118.296 134.230 1.00 38.73  ? 80  LEU D CB    1 
ATOM 5372 C CG    . LEU E 5 81  ? 133.976 118.135 132.768 1.00 38.73  ? 80  LEU D CG    1 
ATOM 5373 C CD1   . LEU E 5 81  ? 132.865 118.519 131.822 1.00 38.73  ? 80  LEU D CD1   1 
ATOM 5374 C CD2   . LEU E 5 81  ? 135.166 119.033 132.532 1.00 38.73  ? 80  LEU D CD2   1 
ATOM 5375 N N     . ALA E 5 82  ? 132.002 118.340 137.116 1.00 42.31  ? 81  ALA D N     1 
ATOM 5376 C CA    . ALA E 5 82  ? 131.887 117.941 138.513 1.00 42.31  ? 81  ALA D CA    1 
ATOM 5377 C C     . ALA E 5 82  ? 130.598 117.181 138.793 1.00 42.31  ? 81  ALA D C     1 
ATOM 5378 O O     . ALA E 5 82  ? 130.528 116.443 139.780 1.00 42.31  ? 81  ALA D O     1 
ATOM 5379 C CB    . ALA E 5 82  ? 131.985 119.167 139.420 1.00 42.31  ? 81  ALA D CB    1 
ATOM 5380 N N     . HIS E 5 83  ? 129.579 117.348 137.950 1.00 42.86  ? 82  HIS D N     1 
ATOM 5381 C CA    . HIS E 5 83  ? 128.358 116.567 138.110 1.00 42.86  ? 82  HIS D CA    1 
ATOM 5382 C C     . HIS E 5 83  ? 128.445 115.200 137.443 1.00 42.86  ? 82  HIS D C     1 
ATOM 5383 O O     . HIS E 5 83  ? 127.877 114.230 137.957 1.00 42.86  ? 82  HIS D O     1 
ATOM 5384 C CB    . HIS E 5 83  ? 127.162 117.332 137.547 1.00 42.86  ? 82  HIS D CB    1 
ATOM 5385 C CG    . HIS E 5 83  ? 125.845 116.691 137.854 1.00 42.86  ? 82  HIS D CG    1 
ATOM 5386 N ND1   . HIS E 5 83  ? 125.282 115.730 137.043 1.00 42.86  ? 82  HIS D ND1   1 
ATOM 5387 C CD2   . HIS E 5 83  ? 124.989 116.861 138.888 1.00 42.86  ? 82  HIS D CD2   1 
ATOM 5388 C CE1   . HIS E 5 83  ? 124.131 115.340 137.561 1.00 42.86  ? 82  HIS D CE1   1 
ATOM 5389 N NE2   . HIS E 5 83  ? 123.930 116.011 138.681 1.00 42.86  ? 82  HIS D NE2   1 
ATOM 5390 N N     . TYR E 5 84  ? 129.142 115.103 136.311 1.00 40.54  ? 83  TYR D N     1 
ATOM 5391 C CA    . TYR E 5 84  ? 129.251 113.831 135.602 1.00 40.54  ? 83  TYR D CA    1 
ATOM 5392 C C     . TYR E 5 84  ? 130.055 112.801 136.390 1.00 40.54  ? 83  TYR D C     1 
ATOM 5393 O O     . TYR E 5 84  ? 129.830 111.596 136.237 1.00 40.54  ? 83  TYR D O     1 
ATOM 5394 C CB    . TYR E 5 84  ? 129.867 114.064 134.221 1.00 40.54  ? 83  TYR D CB    1 
ATOM 5395 C CG    . TYR E 5 84  ? 128.932 114.752 133.244 1.00 40.54  ? 83  TYR D CG    1 
ATOM 5396 C CD1   . TYR E 5 84  ? 127.570 114.845 133.502 1.00 40.54  ? 83  TYR D CD1   1 
ATOM 5397 C CD2   . TYR E 5 84  ? 129.415 115.318 132.071 1.00 40.54  ? 83  TYR D CD2   1 
ATOM 5398 C CE1   . TYR E 5 84  ? 126.715 115.474 132.615 1.00 40.54  ? 83  TYR D CE1   1 
ATOM 5399 C CE2   . TYR E 5 84  ? 128.568 115.949 131.178 1.00 40.54  ? 83  TYR D CE2   1 
ATOM 5400 C CZ    . TYR E 5 84  ? 127.219 116.024 131.457 1.00 40.54  ? 83  TYR D CZ    1 
ATOM 5401 O OH    . TYR E 5 84  ? 126.370 116.650 130.573 1.00 40.54  ? 83  TYR D OH    1 
ATOM 5402 N N     . ASN E 5 85  ? 130.995 113.250 137.216 1.00 41.68  ? 84  ASN D N     1 
ATOM 5403 C CA    . ASN E 5 85  ? 131.781 112.395 138.102 1.00 41.68  ? 84  ASN D CA    1 
ATOM 5404 C C     . ASN E 5 85  ? 131.253 112.367 139.527 1.00 41.68  ? 84  ASN D C     1 
ATOM 5405 O O     . ASN E 5 85  ? 131.903 111.784 140.401 1.00 41.68  ? 84  ASN D O     1 
ATOM 5406 C CB    . ASN E 5 85  ? 133.253 112.802 138.097 1.00 41.68  ? 84  ASN D CB    1 
ATOM 5407 C CG    . ASN E 5 85  ? 133.906 112.555 136.762 1.00 41.68  ? 84  ASN D CG    1 
ATOM 5408 O OD1   . ASN E 5 85  ? 133.600 111.577 136.079 1.00 41.68  ? 84  ASN D OD1   1 
ATOM 5409 N ND2   . ASN E 5 85  ? 134.821 113.421 136.389 1.00 41.68  ? 84  ASN D ND2   1 
ATOM 5410 N N     . LYS E 5 86  ? 130.111 113.004 139.783 1.00 45.52  ? 85  LYS D N     1 
ATOM 5411 C CA    . LYS E 5 86  ? 129.453 112.968 141.086 1.00 45.52  ? 85  LYS D CA    1 
ATOM 5412 C C     . LYS E 5 86  ? 130.356 113.520 142.181 1.00 45.52  ? 85  LYS D C     1 
ATOM 5413 O O     . LYS E 5 86  ? 130.249 113.125 143.345 1.00 45.52  ? 85  LYS D O     1 
ATOM 5414 C CB    . LYS E 5 86  ? 129.050 111.536 141.457 1.00 45.52  ? 85  LYS D CB    1 
ATOM 5415 C CG    . LYS E 5 86  ? 128.036 110.850 140.564 1.00 45.52  ? 85  LYS D CG    1 
ATOM 5416 C CD    . LYS E 5 86  ? 127.804 109.428 141.075 1.00 45.52  ? 85  LYS D CD    1 
ATOM 5417 C CE    . LYS E 5 86  ? 126.737 108.687 140.286 1.00 45.52  ? 85  LYS D CE    1 
ATOM 5418 N NZ    . LYS E 5 86  ? 126.601 107.283 140.771 1.00 45.52  ? 85  LYS D NZ    1 
ATOM 5419 N N     . ARG E 5 87  ? 131.260 114.428 141.819 1.00 49.68  ? 86  ARG D N     1 
ATOM 5420 C CA    . ARG E 5 87  ? 132.037 115.140 142.818 1.00 49.68  ? 86  ARG D CA    1 
ATOM 5421 C C     . ARG E 5 87  ? 131.250 116.337 143.345 1.00 49.68  ? 86  ARG D C     1 
ATOM 5422 O O     . ARG E 5 87  ? 130.129 116.623 142.916 1.00 49.68  ? 86  ARG D O     1 
ATOM 5423 C CB    . ARG E 5 87  ? 133.374 115.585 142.235 1.00 49.68  ? 86  ARG D CB    1 
ATOM 5424 C CG    . ARG E 5 87  ? 134.236 114.445 141.743 1.00 49.68  ? 86  ARG D CG    1 
ATOM 5425 C CD    . ARG E 5 87  ? 134.624 113.557 142.904 1.00 49.68  ? 86  ARG D CD    1 
ATOM 5426 N NE    . ARG E 5 87  ? 135.557 112.504 142.521 1.00 49.68  ? 86  ARG D NE    1 
ATOM 5427 C CZ    . ARG E 5 87  ? 135.933 111.523 143.333 1.00 49.68  ? 86  ARG D CZ    1 
ATOM 5428 N NH1   . ARG E 5 87  ? 135.440 111.460 144.562 1.00 49.68  ? 86  ARG D NH1   1 
ATOM 5429 N NH2   . ARG E 5 87  ? 136.789 110.600 142.918 1.00 49.68  ? 86  ARG D NH2   1 
ATOM 5430 N N     . SER E 5 88  ? 131.859 117.049 144.290 1.00 50.04  ? 87  SER D N     1 
ATOM 5431 C CA    . SER E 5 88  ? 131.303 118.280 144.835 1.00 50.04  ? 87  SER D CA    1 
ATOM 5432 C C     . SER E 5 88  ? 132.261 119.455 144.783 1.00 50.04  ? 87  SER D C     1 
ATOM 5433 O O     . SER E 5 88  ? 131.804 120.602 144.877 1.00 50.04  ? 87  SER D O     1 
ATOM 5434 C CB    . SER E 5 88  ? 130.861 118.076 146.292 1.00 50.04  ? 87  SER D CB    1 
ATOM 5435 O OG    . SER E 5 88  ? 129.835 117.106 146.379 1.00 50.04  ? 87  SER D OG    1 
ATOM 5436 N N     . THR E 5 89  ? 133.560 119.213 144.644 1.00 46.41  ? 88  THR D N     1 
ATOM 5437 C CA    . THR E 5 89  ? 134.580 120.250 144.624 1.00 46.41  ? 88  THR D CA    1 
ATOM 5438 C C     . THR E 5 89  ? 135.133 120.439 143.216 1.00 46.41  ? 88  THR D C     1 
ATOM 5439 O O     . THR E 5 89  ? 135.600 119.481 142.590 1.00 46.41  ? 88  THR D O     1 
ATOM 5440 C CB    . THR E 5 89  ? 135.705 119.933 145.615 1.00 46.41  ? 88  THR D CB    1 
ATOM 5441 O OG1   . THR E 5 89  ? 136.671 120.990 145.597 1.00 46.41  ? 88  THR D OG1   1 
ATOM 5442 C CG2   . THR E 5 89  ? 136.394 118.607 145.303 1.00 46.41  ? 88  THR D CG2   1 
ATOM 5443 N N     . ILE E 5 90  ? 135.024 121.660 142.700 1.00 41.75  ? 89  ILE D N     1 
ATOM 5444 C CA    . ILE E 5 90  ? 135.689 122.020 141.454 1.00 41.75  ? 89  ILE D CA    1 
ATOM 5445 C C     . ILE E 5 90  ? 137.155 122.226 141.808 1.00 41.75  ? 89  ILE D C     1 
ATOM 5446 O O     . ILE E 5 90  ? 137.512 123.198 142.477 1.00 41.75  ? 89  ILE D O     1 
ATOM 5447 C CB    . ILE E 5 90  ? 135.087 123.277 140.817 1.00 41.75  ? 89  ILE D CB    1 
ATOM 5448 C CG1   . ILE E 5 90  ? 133.678 123.000 140.297 1.00 41.75  ? 89  ILE D CG1   1 
ATOM 5449 C CG2   . ILE E 5 90  ? 135.975 123.785 139.699 1.00 41.75  ? 89  ILE D CG2   1 
ATOM 5450 C CD1   . ILE E 5 90  ? 132.985 124.218 139.734 1.00 41.75  ? 89  ILE D CD1   1 
ATOM 5451 N N     . THR E 5 91  ? 138.004 121.318 141.359 1.00 39.22  ? 90  THR D N     1 
ATOM 5452 C CA    . THR E 5 91  ? 139.430 121.430 141.578 1.00 39.22  ? 90  THR D CA    1 
ATOM 5453 C C     . THR E 5 91  ? 140.036 122.098 140.348 1.00 39.22  ? 90  THR D C     1 
ATOM 5454 O O     . THR E 5 91  ? 139.317 122.575 139.466 1.00 39.22  ? 90  THR D O     1 
ATOM 5455 C CB    . THR E 5 91  ? 140.004 120.037 141.870 1.00 39.22  ? 90  THR D CB    1 
ATOM 5456 O OG1   . THR E 5 91  ? 139.165 119.376 142.824 1.00 39.22  ? 90  THR D OG1   1 
ATOM 5457 C CG2   . THR E 5 91  ? 141.398 120.124 142.487 1.00 39.22  ? 90  THR D CG2   1 
ATOM 5458 N N     . SER E 5 92  ? 141.363 122.153 140.273 1.00 37.23  ? 91  SER D N     1 
ATOM 5459 C CA    . SER E 5 92  ? 141.969 122.679 139.063 1.00 37.23  ? 91  SER D CA    1 
ATOM 5460 C C     . SER E 5 92  ? 141.923 121.666 137.938 1.00 37.23  ? 91  SER D C     1 
ATOM 5461 O O     . SER E 5 92  ? 142.147 122.029 136.779 1.00 37.23  ? 91  SER D O     1 
ATOM 5462 C CB    . SER E 5 92  ? 143.417 123.087 139.331 1.00 37.23  ? 91  SER D CB    1 
ATOM 5463 O OG    . SER E 5 92  ? 144.169 123.099 138.133 1.00 37.23  ? 91  SER D OG    1 
ATOM 5464 N N     . ARG E 5 93  ? 141.589 120.417 138.249 1.00 35.71  ? 92  ARG D N     1 
ATOM 5465 C CA    . ARG E 5 93  ? 141.582 119.399 137.216 1.00 35.71  ? 92  ARG D CA    1 
ATOM 5466 C C     . ARG E 5 93  ? 140.311 119.484 136.382 1.00 35.71  ? 92  ARG D C     1 
ATOM 5467 O O     . ARG E 5 93  ? 140.352 119.265 135.163 1.00 35.71  ? 92  ARG D O     1 
ATOM 5468 C CB    . ARG E 5 93  ? 141.719 118.026 137.871 1.00 35.71  ? 92  ARG D CB    1 
ATOM 5469 C CG    . ARG E 5 93  ? 141.976 116.884 136.929 1.00 35.71  ? 92  ARG D CG    1 
ATOM 5470 C CD    . ARG E 5 93  ? 142.227 115.603 137.705 1.00 35.71  ? 92  ARG D CD    1 
ATOM 5471 N NE    . ARG E 5 93  ? 142.516 114.499 136.800 1.00 35.71  ? 92  ARG D NE    1 
ATOM 5472 C CZ    . ARG E 5 93  ? 141.587 113.715 136.270 1.00 35.71  ? 92  ARG D CZ    1 
ATOM 5473 N NH1   . ARG E 5 93  ? 140.310 113.915 136.560 1.00 35.71  ? 92  ARG D NH1   1 
ATOM 5474 N NH2   . ARG E 5 93  ? 141.934 112.738 135.447 1.00 35.71  ? 92  ARG D NH2   1 
ATOM 5475 N N     . GLU E 5 94  ? 139.197 119.897 136.993 1.00 36.55  ? 93  GLU D N     1 
ATOM 5476 C CA    . GLU E 5 94  ? 138.007 120.135 136.195 1.00 36.55  ? 93  GLU D CA    1 
ATOM 5477 C C     . GLU E 5 94  ? 138.121 121.413 135.383 1.00 36.55  ? 93  GLU D C     1 
ATOM 5478 O O     . GLU E 5 94  ? 137.530 121.501 134.302 1.00 36.55  ? 93  GLU D O     1 
ATOM 5479 C CB    . GLU E 5 94  ? 136.775 120.221 137.096 1.00 36.55  ? 93  GLU D CB    1 
ATOM 5480 C CG    . GLU E 5 94  ? 136.277 118.893 137.643 1.00 36.55  ? 93  GLU D CG    1 
ATOM 5481 C CD    . GLU E 5 94  ? 137.003 118.462 138.904 1.00 36.55  ? 93  GLU D CD    1 
ATOM 5482 O OE1   . GLU E 5 94  ? 137.181 117.241 139.104 1.00 36.55  ? 93  GLU D OE1   1 
ATOM 5483 O OE2   . GLU E 5 94  ? 137.397 119.344 139.695 1.00 36.55  ? 93  GLU D OE2   1 
ATOM 5484 N N     . ILE E 5 95  ? 138.979 122.342 135.799 1.00 35.05  ? 94  ILE D N     1 
ATOM 5485 C CA    . ILE E 5 95  ? 139.220 123.517 134.975 1.00 35.05  ? 94  ILE D CA    1 
ATOM 5486 C C     . ILE E 5 95  ? 140.129 123.160 133.813 1.00 35.05  ? 94  ILE D C     1 
ATOM 5487 O O     . ILE E 5 95  ? 139.933 123.634 132.691 1.00 35.05  ? 94  ILE D O     1 
ATOM 5488 C CB    . ILE E 5 95  ? 139.798 124.661 135.822 1.00 35.05  ? 94  ILE D CB    1 
ATOM 5489 C CG1   . ILE E 5 95  ? 138.893 124.959 137.013 1.00 35.05  ? 94  ILE D CG1   1 
ATOM 5490 C CG2   . ILE E 5 95  ? 139.884 125.913 134.990 1.00 35.05  ? 94  ILE D CG2   1 
ATOM 5491 C CD1   . ILE E 5 95  ? 137.535 125.474 136.631 1.00 35.05  ? 94  ILE D CD1   1 
ATOM 5492 N N     . GLN E 5 96  ? 141.116 122.293 134.049 1.00 34.78  ? 95  GLN D N     1 
ATOM 5493 C CA    . GLN E 5 96  ? 141.985 121.888 132.952 1.00 34.78  ? 95  GLN D CA    1 
ATOM 5494 C C     . GLN E 5 96  ? 141.225 121.067 131.926 1.00 34.78  ? 95  GLN D C     1 
ATOM 5495 O O     . GLN E 5 96  ? 141.448 121.215 130.718 1.00 34.78  ? 95  GLN D O     1 
ATOM 5496 C CB    . GLN E 5 96  ? 143.173 121.092 133.486 1.00 34.78  ? 95  GLN D CB    1 
ATOM 5497 C CG    . GLN E 5 96  ? 144.152 120.663 132.413 1.00 34.78  ? 95  GLN D CG    1 
ATOM 5498 C CD    . GLN E 5 96  ? 145.380 120.005 132.990 1.00 34.78  ? 95  GLN D CD    1 
ATOM 5499 O OE1   . GLN E 5 96  ? 145.513 119.880 134.205 1.00 34.78  ? 95  GLN D OE1   1 
ATOM 5500 N NE2   . GLN E 5 96  ? 146.288 119.580 132.122 1.00 34.78  ? 95  GLN D NE2   1 
ATOM 5501 N N     . THR E 5 97  ? 140.242 120.291 132.373 1.00 34.16  ? 96  THR D N     1 
ATOM 5502 C CA    . THR E 5 97  ? 139.456 119.538 131.408 1.00 34.16  ? 96  THR D CA    1 
ATOM 5503 C C     . THR E 5 97  ? 138.454 120.434 130.697 1.00 34.16  ? 96  THR D C     1 
ATOM 5504 O O     . THR E 5 97  ? 138.202 120.250 129.504 1.00 34.16  ? 96  THR D O     1 
ATOM 5505 C CB    . THR E 5 97  ? 138.768 118.366 132.092 1.00 34.16  ? 96  THR D CB    1 
ATOM 5506 O OG1   . THR E 5 97  ? 139.771 117.527 132.673 1.00 34.16  ? 96  THR D OG1   1 
ATOM 5507 C CG2   . THR E 5 97  ? 137.983 117.554 131.085 1.00 34.16  ? 96  THR D CG2   1 
ATOM 5508 N N     . ALA E 5 98  ? 137.867 121.409 131.394 1.00 34.71  ? 97  ALA D N     1 
ATOM 5509 C CA    . ALA E 5 98  ? 136.960 122.303 130.695 1.00 34.71  ? 97  ALA D CA    1 
ATOM 5510 C C     . ALA E 5 98  ? 137.699 123.210 129.721 1.00 34.71  ? 97  ALA D C     1 
ATOM 5511 O O     . ALA E 5 98  ? 137.118 123.618 128.710 1.00 34.71  ? 97  ALA D O     1 
ATOM 5512 C CB    . ALA E 5 98  ? 136.188 123.151 131.702 1.00 34.71  ? 97  ALA D CB    1 
ATOM 5513 N N     . VAL E 5 99  ? 138.984 123.477 129.964 1.00 34.96  ? 98  VAL D N     1 
ATOM 5514 C CA    . VAL E 5 99  ? 139.782 124.205 128.985 1.00 34.96  ? 98  VAL D CA    1 
ATOM 5515 C C     . VAL E 5 99  ? 140.123 123.309 127.805 1.00 34.96  ? 98  VAL D C     1 
ATOM 5516 O O     . VAL E 5 99  ? 140.128 123.755 126.653 1.00 34.96  ? 98  VAL D O     1 
ATOM 5517 C CB    . VAL E 5 99  ? 141.047 124.781 129.644 1.00 34.96  ? 98  VAL D CB    1 
ATOM 5518 C CG1   . VAL E 5 99  ? 141.967 125.360 128.598 1.00 34.96  ? 98  VAL D CG1   1 
ATOM 5519 C CG2   . VAL E 5 99  ? 140.672 125.855 130.644 1.00 34.96  ? 98  VAL D CG2   1 
ATOM 5520 N N     . ARG E 5 100 ? 140.403 122.028 128.064 1.00 34.97  ? 99  ARG D N     1 
ATOM 5521 C CA    . ARG E 5 100 ? 140.660 121.132 126.944 1.00 34.97  ? 99  ARG D CA    1 
ATOM 5522 C C     . ARG E 5 100 ? 139.415 120.954 126.088 1.00 34.97  ? 99  ARG D C     1 
ATOM 5523 O O     . ARG E 5 100 ? 139.518 120.823 124.864 1.00 34.97  ? 99  ARG D O     1 
ATOM 5524 C CB    . ARG E 5 100 ? 141.129 119.769 127.446 1.00 34.97  ? 99  ARG D CB    1 
ATOM 5525 C CG    . ARG E 5 100 ? 142.490 119.747 128.097 1.00 34.97  ? 99  ARG D CG    1 
ATOM 5526 C CD    . ARG E 5 100 ? 142.818 118.337 128.541 1.00 34.97  ? 99  ARG D CD    1 
ATOM 5527 N NE    . ARG E 5 100 ? 144.084 118.262 129.257 1.00 34.97  ? 99  ARG D NE    1 
ATOM 5528 C CZ    . ARG E 5 100 ? 144.560 117.147 129.799 1.00 34.97  ? 99  ARG D CZ    1 
ATOM 5529 N NH1   . ARG E 5 100 ? 143.869 116.020 129.703 1.00 34.97  ? 99  ARG D NH1   1 
ATOM 5530 N NH2   . ARG E 5 100 ? 145.721 117.158 130.438 1.00 34.97  ? 99  ARG D NH2   1 
ATOM 5531 N N     . LEU E 5 101 ? 138.237 120.951 126.713 1.00 33.42  ? 100 LEU D N     1 
ATOM 5532 C CA    . LEU E 5 101 ? 136.999 120.770 125.965 1.00 33.42  ? 100 LEU D CA    1 
ATOM 5533 C C     . LEU E 5 101 ? 136.601 122.028 125.205 1.00 33.42  ? 100 LEU D C     1 
ATOM 5534 O O     . LEU E 5 101 ? 136.202 121.950 124.039 1.00 33.42  ? 100 LEU D O     1 
ATOM 5535 C CB    . LEU E 5 101 ? 135.875 120.343 126.906 1.00 33.42  ? 100 LEU D CB    1 
ATOM 5536 C CG    . LEU E 5 101 ? 136.002 118.948 127.519 1.00 33.42  ? 100 LEU D CG    1 
ATOM 5537 C CD1   . LEU E 5 101 ? 134.904 118.701 128.525 1.00 33.42  ? 100 LEU D CD1   1 
ATOM 5538 C CD2   . LEU E 5 101 ? 135.968 117.886 126.440 1.00 33.42  ? 100 LEU D CD2   1 
ATOM 5539 N N     . LEU E 5 102 ? 136.693 123.198 125.842 1.00 34.66  ? 101 LEU D N     1 
ATOM 5540 C CA    . LEU E 5 102 ? 136.126 124.391 125.223 1.00 34.66  ? 101 LEU D CA    1 
ATOM 5541 C C     . LEU E 5 102 ? 137.045 124.969 124.155 1.00 34.66  ? 101 LEU D C     1 
ATOM 5542 O O     . LEU E 5 102 ? 136.605 125.258 123.038 1.00 34.66  ? 101 LEU D O     1 
ATOM 5543 C CB    . LEU E 5 102 ? 135.817 125.440 126.289 1.00 34.66  ? 101 LEU D CB    1 
ATOM 5544 C CG    . LEU E 5 102 ? 134.650 125.109 127.217 1.00 34.66  ? 101 LEU D CG    1 
ATOM 5545 C CD1   . LEU E 5 102 ? 134.504 126.170 128.285 1.00 34.66  ? 101 LEU D CD1   1 
ATOM 5546 C CD2   . LEU E 5 102 ? 133.365 124.966 126.428 1.00 34.66  ? 101 LEU D CD2   1 
ATOM 5547 N N     . LEU E 5 103 ? 138.311 125.146 124.475 1.00 36.08  ? 102 LEU D N     1 
ATOM 5548 C CA    . LEU E 5 103 ? 139.213 125.807 123.544 1.00 36.08  ? 102 LEU D CA    1 
ATOM 5549 C C     . LEU E 5 103 ? 139.730 124.794 122.531 1.00 36.08  ? 102 LEU D C     1 
ATOM 5550 O O     . LEU E 5 103 ? 140.126 123.691 122.916 1.00 36.08  ? 102 LEU D O     1 
ATOM 5551 C CB    . LEU E 5 103 ? 140.380 126.466 124.276 1.00 36.08  ? 102 LEU D CB    1 
ATOM 5552 C CG    . LEU E 5 103 ? 140.133 127.684 125.176 1.00 36.08  ? 102 LEU D CG    1 
ATOM 5553 C CD1   . LEU E 5 103 ? 139.287 127.379 126.406 1.00 36.08  ? 102 LEU D CD1   1 
ATOM 5554 C CD2   . LEU E 5 103 ? 141.463 128.287 125.587 1.00 36.08  ? 102 LEU D CD2   1 
ATOM 5555 N N     . PRO E 5 104 ? 139.725 125.115 121.246 1.00 37.75  ? 103 PRO D N     1 
ATOM 5556 C CA    . PRO E 5 104 ? 140.168 124.131 120.253 1.00 37.75  ? 103 PRO D CA    1 
ATOM 5557 C C     . PRO E 5 104 ? 141.666 124.168 120.011 1.00 37.75  ? 103 PRO D C     1 
ATOM 5558 O O     . PRO E 5 104 ? 142.214 125.204 119.622 1.00 37.75  ? 103 PRO D O     1 
ATOM 5559 C CB    . PRO E 5 104 ? 139.397 124.540 118.990 1.00 37.75  ? 103 PRO D CB    1 
ATOM 5560 C CG    . PRO E 5 104 ? 138.312 125.473 119.476 1.00 37.75  ? 103 PRO D CG    1 
ATOM 5561 C CD    . PRO E 5 104 ? 138.925 126.181 120.631 1.00 37.75  ? 103 PRO D CD    1 
ATOM 5562 N N     . GLY E 5 105 ? 142.337 123.042 120.235 1.00 39.03  ? 104 GLY D N     1 
ATOM 5563 C CA    . GLY E 5 105 ? 143.675 122.855 119.716 1.00 39.03  ? 104 GLY D CA    1 
ATOM 5564 C C     . GLY E 5 105 ? 144.785 123.587 120.439 1.00 39.03  ? 104 GLY D C     1 
ATOM 5565 O O     . GLY E 5 105 ? 145.009 123.405 121.644 1.00 39.03  ? 104 GLY D O     1 
ATOM 5566 N N     . GLU E 5 106 ? 145.497 124.427 119.687 1.00 39.27  ? 105 GLU D N     1 
ATOM 5567 C CA    . GLU E 5 106 ? 146.671 125.084 120.239 1.00 39.27  ? 105 GLU D CA    1 
ATOM 5568 C C     . GLU E 5 106 ? 146.294 126.076 121.330 1.00 39.27  ? 105 GLU D C     1 
ATOM 5569 O O     . GLU E 5 106 ? 147.071 126.285 122.271 1.00 39.27  ? 105 GLU D O     1 
ATOM 5570 C CB    . GLU E 5 106 ? 147.431 125.783 119.113 1.00 39.27  ? 105 GLU D CB    1 
ATOM 5571 C CG    . GLU E 5 106 ? 148.801 126.297 119.490 1.00 39.27  ? 105 GLU D CG    1 
ATOM 5572 C CD    . GLU E 5 106 ? 149.452 127.090 118.375 1.00 39.27  ? 105 GLU D CD    1 
ATOM 5573 O OE1   . GLU E 5 106 ? 148.788 127.324 117.344 1.00 39.27  ? 105 GLU D OE1   1 
ATOM 5574 O OE2   . GLU E 5 106 ? 150.630 127.476 118.529 1.00 39.27  ? 105 GLU D OE2   1 
ATOM 5575 N N     . LEU E 5 107 ? 145.091 126.652 121.262 1.00 38.78  ? 106 LEU D N     1 
ATOM 5576 C CA    . LEU E 5 107 ? 144.672 127.521 122.352 1.00 38.78  ? 106 LEU D CA    1 
ATOM 5577 C C     . LEU E 5 107 ? 144.435 126.728 123.625 1.00 38.78  ? 106 LEU D C     1 
ATOM 5578 O O     . LEU E 5 107 ? 144.752 127.209 124.719 1.00 38.78  ? 106 LEU D O     1 
ATOM 5579 C CB    . LEU E 5 107 ? 143.403 128.285 121.982 1.00 38.78  ? 106 LEU D CB    1 
ATOM 5580 C CG    . LEU E 5 107 ? 143.524 129.535 121.117 1.00 38.78  ? 106 LEU D CG    1 
ATOM 5581 C CD1   . LEU E 5 107 ? 142.152 129.942 120.619 1.00 38.78  ? 106 LEU D CD1   1 
ATOM 5582 C CD2   . LEU E 5 107 ? 144.165 130.660 121.901 1.00 38.78  ? 106 LEU D CD2   1 
ATOM 5583 N N     . ALA E 5 108 ? 143.985 125.477 123.501 1.00 37.64  ? 107 ALA D N     1 
ATOM 5584 C CA    . ALA E 5 108 ? 143.842 124.657 124.694 1.00 37.64  ? 107 ALA D CA    1 
ATOM 5585 C C     . ALA E 5 108 ? 145.191 124.205 125.216 1.00 37.64  ? 107 ALA D C     1 
ATOM 5586 O O     . ALA E 5 108 ? 145.392 124.158 126.434 1.00 37.64  ? 107 ALA D O     1 
ATOM 5587 C CB    . ALA E 5 108 ? 142.956 123.449 124.402 1.00 37.64  ? 107 ALA D CB    1 
ATOM 5588 N N     . LYS E 5 109 ? 146.160 123.983 124.325 1.00 37.64  ? 108 LYS D N     1 
ATOM 5589 C CA    . LYS E 5 109 ? 147.456 123.525 124.811 1.00 37.64  ? 108 LYS D CA    1 
ATOM 5590 C C     . LYS E 5 109 ? 148.187 124.657 125.515 1.00 37.64  ? 108 LYS D C     1 
ATOM 5591 O O     . LYS E 5 109 ? 148.821 124.441 126.557 1.00 37.64  ? 108 LYS D O     1 
ATOM 5592 C CB    . LYS E 5 109 ? 148.299 122.971 123.663 1.00 37.64  ? 108 LYS D CB    1 
ATOM 5593 C CG    . LYS E 5 109 ? 147.725 121.733 122.995 1.00 37.64  ? 108 LYS D CG    1 
ATOM 5594 C CD    . LYS E 5 109 ? 148.636 121.253 121.873 1.00 37.64  ? 108 LYS D CD    1 
ATOM 5595 C CE    . LYS E 5 109 ? 148.053 120.050 121.149 1.00 37.64  ? 108 LYS D CE    1 
ATOM 5596 N NZ    . LYS E 5 109 ? 147.023 120.449 120.152 1.00 37.64  ? 108 LYS D NZ    1 
ATOM 5597 N N     . HIS E 5 110 ? 148.007 125.887 125.044 1.00 37.49  ? 109 HIS D N     1 
ATOM 5598 C CA    . HIS E 5 110 ? 148.693 126.984 125.705 1.00 37.49  ? 109 HIS D CA    1 
ATOM 5599 C C     . HIS E 5 110 ? 147.950 127.439 126.950 1.00 37.49  ? 109 HIS D C     1 
ATOM 5600 O O     . HIS E 5 110 ? 148.591 127.838 127.928 1.00 37.49  ? 109 HIS D O     1 
ATOM 5601 C CB    . HIS E 5 110 ? 148.903 128.155 124.744 1.00 37.49  ? 109 HIS D CB    1 
ATOM 5602 C CG    . HIS E 5 110 ? 149.918 127.886 123.678 1.00 37.49  ? 109 HIS D CG    1 
ATOM 5603 N ND1   . HIS E 5 110 ? 151.274 127.904 123.924 1.00 37.49  ? 109 HIS D ND1   1 
ATOM 5604 C CD2   . HIS E 5 110 ? 149.778 127.596 122.365 1.00 37.49  ? 109 HIS D CD2   1 
ATOM 5605 C CE1   . HIS E 5 110 ? 151.926 127.635 122.807 1.00 37.49  ? 109 HIS D CE1   1 
ATOM 5606 N NE2   . HIS E 5 110 ? 151.041 127.443 121.846 1.00 37.49  ? 109 HIS D NE2   1 
ATOM 5607 N N     . ALA E 5 111 ? 146.617 127.353 126.972 1.00 36.50  ? 110 ALA D N     1 
ATOM 5608 C CA    . ALA E 5 111 ? 145.928 127.701 128.207 1.00 36.50  ? 110 ALA D CA    1 
ATOM 5609 C C     . ALA E 5 111 ? 146.172 126.670 129.304 1.00 36.50  ? 110 ALA D C     1 
ATOM 5610 O O     . ALA E 5 111 ? 146.322 127.046 130.474 1.00 36.50  ? 110 ALA D O     1 
ATOM 5611 C CB    . ALA E 5 111 ? 144.433 127.854 127.941 1.00 36.50  ? 110 ALA D CB    1 
ATOM 5612 N N     . VAL E 5 112 ? 146.308 125.385 128.953 1.00 36.34  ? 111 VAL D N     1 
ATOM 5613 C CA    . VAL E 5 112 ? 146.656 124.401 129.975 1.00 36.34  ? 111 VAL D CA    1 
ATOM 5614 C C     . VAL E 5 112 ? 148.089 124.609 130.434 1.00 36.34  ? 111 VAL D C     1 
ATOM 5615 O O     . VAL E 5 112 ? 148.388 124.513 131.628 1.00 36.34  ? 111 VAL D O     1 
ATOM 5616 C CB    . VAL E 5 112 ? 146.398 122.953 129.512 1.00 36.34  ? 111 VAL D CB    1 
ATOM 5617 C CG1   . VAL E 5 112 ? 144.928 122.744 129.201 1.00 36.34  ? 111 VAL D CG1   1 
ATOM 5618 C CG2   . VAL E 5 112 ? 147.256 122.564 128.339 1.00 36.34  ? 111 VAL D CG2   1 
ATOM 5619 N N     . SER E 5 113 ? 148.994 124.949 129.515 1.00 36.61  ? 112 SER D N     1 
ATOM 5620 C CA    . SER E 5 113 ? 150.371 125.142 129.950 1.00 36.61  ? 112 SER D CA    1 
ATOM 5621 C C     . SER E 5 113 ? 150.509 126.378 130.835 1.00 36.61  ? 112 SER D C     1 
ATOM 5622 O O     . SER E 5 113 ? 151.271 126.352 131.808 1.00 36.61  ? 112 SER D O     1 
ATOM 5623 C CB    . SER E 5 113 ? 151.287 125.244 128.732 1.00 36.61  ? 112 SER D CB    1 
ATOM 5624 O OG    . SER E 5 113 ? 152.577 125.706 129.090 1.00 36.61  ? 112 SER D OG    1 
ATOM 5625 N N     . GLU E 5 114 ? 149.710 127.422 130.587 1.00 37.76  ? 113 GLU D N     1 
ATOM 5626 C CA    . GLU E 5 114 ? 149.785 128.627 131.411 1.00 37.76  ? 113 GLU D CA    1 
ATOM 5627 C C     . GLU E 5 114 ? 149.108 128.432 132.759 1.00 37.76  ? 113 GLU D C     1 
ATOM 5628 O O     . GLU E 5 114 ? 149.600 128.933 133.778 1.00 37.76  ? 113 GLU D O     1 
ATOM 5629 C CB    . GLU E 5 114 ? 149.160 129.801 130.669 1.00 37.76  ? 113 GLU D CB    1 
ATOM 5630 C CG    . GLU E 5 114 ? 149.973 130.259 129.476 1.00 37.76  ? 113 GLU D CG    1 
ATOM 5631 C CD    . GLU E 5 114 ? 151.275 130.914 129.879 1.00 37.76  ? 113 GLU D CD    1 
ATOM 5632 O OE1   . GLU E 5 114 ? 151.302 131.558 130.946 1.00 37.76  ? 113 GLU D OE1   1 
ATOM 5633 O OE2   . GLU E 5 114 ? 152.267 130.786 129.129 1.00 37.76  ? 113 GLU D OE2   1 
ATOM 5634 N N     . GLY E 5 115 ? 148.061 127.610 132.812 1.00 36.63  ? 114 GLY D N     1 
ATOM 5635 C CA    . GLY E 5 115 ? 147.419 127.364 134.083 1.00 36.63  ? 114 GLY D CA    1 
ATOM 5636 C C     . GLY E 5 115 ? 148.275 126.452 134.928 1.00 36.63  ? 114 GLY D C     1 
ATOM 5637 O O     . GLY E 5 115 ? 148.346 126.622 136.146 1.00 36.63  ? 114 GLY D O     1 
ATOM 5638 N N     . THR E 5 116 ? 148.990 125.519 134.295 1.00 37.18  ? 115 THR D N     1 
ATOM 5639 C CA    . THR E 5 116 ? 149.838 124.600 135.046 1.00 37.18  ? 115 THR D CA    1 
ATOM 5640 C C     . THR E 5 116 ? 151.071 125.321 135.554 1.00 37.18  ? 115 THR D C     1 
ATOM 5641 O O     . THR E 5 116 ? 151.461 125.155 136.717 1.00 37.18  ? 115 THR D O     1 
ATOM 5642 C CB    . THR E 5 116 ? 150.255 123.393 134.202 1.00 37.18  ? 115 THR D CB    1 
ATOM 5643 O OG1   . THR E 5 116 ? 150.673 123.819 132.905 1.00 37.18  ? 115 THR D OG1   1 
ATOM 5644 C CG2   . THR E 5 116 ? 149.112 122.423 134.086 1.00 37.18  ? 115 THR D CG2   1 
ATOM 5645 N N     . LYS E 5 117 ? 151.665 126.173 134.727 1.00 38.01  ? 116 LYS D N     1 
ATOM 5646 C CA    . LYS E 5 117 ? 152.834 126.910 135.158 1.00 38.01  ? 116 LYS D CA    1 
ATOM 5647 C C     . LYS E 5 117 ? 152.442 128.170 135.915 1.00 38.01  ? 116 LYS D C     1 
ATOM 5648 O O     . LYS E 5 117 ? 153.310 128.951 136.311 1.00 38.01  ? 116 LYS D O     1 
ATOM 5649 C CB    . LYS E 5 117 ? 153.677 127.241 133.911 1.00 38.01  ? 116 LYS D CB    1 
ATOM 5650 C CG    . LYS E 5 117 ? 154.945 128.071 134.077 1.00 38.01  ? 116 LYS D CG    1 
ATOM 5651 C CD    . LYS E 5 117 ? 154.682 129.529 133.726 1.00 38.01  ? 116 LYS D CD    1 
ATOM 5652 C CE    . LYS E 5 117 ? 155.602 130.019 132.640 1.00 38.01  ? 116 LYS D CE    1 
ATOM 5653 N NZ    . LYS E 5 117 ? 155.308 131.450 132.388 1.00 38.01  ? 116 LYS D NZ    1 
ATOM 5654 N N     . ALA E 5 118 ? 151.158 128.331 136.222 1.00 38.11  ? 117 ALA D N     1 
ATOM 5655 C CA    . ALA E 5 118 ? 150.772 129.288 137.246 1.00 38.11  ? 117 ALA D CA    1 
ATOM 5656 C C     . ALA E 5 118 ? 150.384 128.636 138.565 1.00 38.11  ? 117 ALA D C     1 
ATOM 5657 O O     . ALA E 5 118 ? 150.686 129.194 139.624 1.00 38.11  ? 117 ALA D O     1 
ATOM 5658 C CB    . ALA E 5 118 ? 149.607 130.151 136.760 1.00 38.11  ? 117 ALA D CB    1 
ATOM 5659 N N     . VAL E 5 119 ? 149.792 127.437 138.539 1.00 38.29  ? 118 VAL D N     1 
ATOM 5660 C CA    . VAL E 5 119 ? 149.537 126.734 139.794 1.00 38.29  ? 118 VAL D CA    1 
ATOM 5661 C C     . VAL E 5 119 ? 150.834 126.237 140.418 1.00 38.29  ? 118 VAL D C     1 
ATOM 5662 O O     . VAL E 5 119 ? 150.995 126.278 141.645 1.00 38.29  ? 118 VAL D O     1 
ATOM 5663 C CB    . VAL E 5 119 ? 148.531 125.582 139.595 1.00 38.29  ? 118 VAL D CB    1 
ATOM 5664 C CG1   . VAL E 5 119 ? 147.217 126.110 139.091 1.00 38.29  ? 118 VAL D CG1   1 
ATOM 5665 C CG2   . VAL E 5 119 ? 149.068 124.527 138.641 1.00 38.29  ? 118 VAL D CG2   1 
ATOM 5666 N N     . THR E 5 120 ? 151.793 125.786 139.603 1.00 38.94  ? 119 THR D N     1 
ATOM 5667 C CA    . THR E 5 120 ? 153.049 125.344 140.201 1.00 38.94  ? 119 THR D CA    1 
ATOM 5668 C C     . THR E 5 120 ? 153.829 126.515 140.779 1.00 38.94  ? 119 THR D C     1 
ATOM 5669 O O     . THR E 5 120 ? 154.435 126.390 141.849 1.00 38.94  ? 119 THR D O     1 
ATOM 5670 C CB    . THR E 5 120 ? 153.893 124.579 139.182 1.00 38.94  ? 119 THR D CB    1 
ATOM 5671 O OG1   . THR E 5 120 ? 154.307 125.461 138.130 1.00 38.94  ? 119 THR D OG1   1 
ATOM 5672 C CG2   . THR E 5 120 ? 153.128 123.390 138.622 1.00 38.94  ? 119 THR D CG2   1 
ATOM 5673 N N     . LYS E 5 121 ? 153.843 127.655 140.087 1.00 39.94  ? 120 LYS D N     1 
ATOM 5674 C CA    . LYS E 5 121 ? 154.459 128.839 140.665 1.00 39.94  ? 120 LYS D CA    1 
ATOM 5675 C C     . LYS E 5 121 ? 153.686 129.350 141.874 1.00 39.94  ? 120 LYS D C     1 
ATOM 5676 O O     . LYS E 5 121 ? 154.264 130.044 142.717 1.00 39.94  ? 120 LYS D O     1 
ATOM 5677 C CB    . LYS E 5 121 ? 154.580 129.937 139.610 1.00 39.94  ? 120 LYS D CB    1 
ATOM 5678 C CG    . LYS E 5 121 ? 155.594 129.627 138.518 1.00 39.94  ? 120 LYS D CG    1 
ATOM 5679 C CD    . LYS E 5 121 ? 156.969 129.307 139.082 1.00 39.94  ? 120 LYS D CD    1 
ATOM 5680 C CE    . LYS E 5 121 ? 157.654 130.543 139.627 1.00 39.94  ? 120 LYS D CE    1 
ATOM 5681 N NZ    . LYS E 5 121 ? 158.984 130.212 140.202 1.00 39.94  ? 120 LYS D NZ    1 
ATOM 5682 N N     . TYR E 5 122 ? 152.391 129.036 141.972 1.00 41.11  ? 121 TYR D N     1 
ATOM 5683 C CA    . TYR E 5 122 ? 151.621 129.434 143.146 1.00 41.11  ? 121 TYR D CA    1 
ATOM 5684 C C     . TYR E 5 122 ? 151.968 128.598 144.368 1.00 41.11  ? 121 TYR D C     1 
ATOM 5685 O O     . TYR E 5 122 ? 152.142 129.141 145.465 1.00 41.11  ? 121 TYR D O     1 
ATOM 5686 C CB    . TYR E 5 122 ? 150.127 129.334 142.856 1.00 41.11  ? 121 TYR D CB    1 
ATOM 5687 C CG    . TYR E 5 122 ? 149.265 129.575 144.071 1.00 41.11  ? 121 TYR D CG    1 
ATOM 5688 C CD1   . TYR E 5 122 ? 149.119 130.840 144.614 1.00 41.11  ? 121 TYR D CD1   1 
ATOM 5689 C CD2   . TYR E 5 122 ? 148.606 128.521 144.683 1.00 41.11  ? 121 TYR D CD2   1 
ATOM 5690 C CE1   . TYR E 5 122 ? 148.332 131.046 145.728 1.00 41.11  ? 121 TYR D CE1   1 
ATOM 5691 C CE2   . TYR E 5 122 ? 147.821 128.717 145.792 1.00 41.11  ? 121 TYR D CE2   1 
ATOM 5692 C CZ    . TYR E 5 122 ? 147.686 129.980 146.312 1.00 41.11  ? 121 TYR D CZ    1 
ATOM 5693 O OH    . TYR E 5 122 ? 146.900 130.173 147.421 1.00 41.11  ? 121 TYR D OH    1 
ATOM 5694 N N     . THR E 5 123 ? 152.062 127.276 144.209 1.00 40.60  ? 122 THR D N     1 
ATOM 5695 C CA    . THR E 5 123 ? 152.293 126.428 145.375 1.00 40.60  ? 122 THR D CA    1 
ATOM 5696 C C     . THR E 5 123 ? 153.699 126.596 145.939 1.00 40.60  ? 122 THR D C     1 
ATOM 5697 O O     . THR E 5 123 ? 153.914 126.375 147.136 1.00 40.60  ? 122 THR D O     1 
ATOM 5698 C CB    . THR E 5 123 ? 152.036 124.963 145.031 1.00 40.60  ? 122 THR D CB    1 
ATOM 5699 O OG1   . THR E 5 123 ? 153.017 124.510 144.092 1.00 40.60  ? 122 THR D OG1   1 
ATOM 5700 C CG2   . THR E 5 123 ? 150.647 124.791 144.444 1.00 40.60  ? 122 THR D CG2   1 
ATOM 5701 N N     . SER E 5 124 ? 154.659 126.982 145.110 1.00 41.75  ? 123 SER D N     1 
ATOM 5702 C CA    . SER E 5 124 ? 156.024 127.174 145.574 1.00 41.75  ? 123 SER D CA    1 
ATOM 5703 C C     . SER E 5 124 ? 156.177 128.489 146.327 1.00 41.75  ? 123 SER D C     1 
ATOM 5704 O O     . SER E 5 124 ? 155.271 129.320 146.336 1.00 41.75  ? 123 SER D O     1 
ATOM 5705 C CB    . SER E 5 124 ? 156.994 127.129 144.395 1.00 41.75  ? 123 SER D CB    1 
ATOM 5706 O OG    . SER E 5 124 ? 156.987 125.853 143.779 1.00 41.75  ? 123 SER D OG    1 
ATOM 5707 N N     . LEU F 3 61  ? 125.869 150.710 110.132 1.00 20.50  ? 60  LEU E N     1 
ATOM 5708 C CA    . LEU F 3 61  ? 124.717 149.865 109.848 1.00 20.50  ? 60  LEU E CA    1 
ATOM 5709 C C     . LEU F 3 61  ? 124.284 150.091 108.403 1.00 20.50  ? 60  LEU E C     1 
ATOM 5710 O O     . LEU F 3 61  ? 124.651 151.095 107.794 1.00 20.50  ? 60  LEU E O     1 
ATOM 5711 C CB    . LEU F 3 61  ? 123.566 150.168 110.808 1.00 20.50  ? 60  LEU E CB    1 
ATOM 5712 C CG    . LEU F 3 61  ? 123.766 149.812 112.286 1.00 20.50  ? 60  LEU E CG    1 
ATOM 5713 C CD1   . LEU F 3 61  ? 122.589 150.309 113.115 1.00 20.50  ? 60  LEU E CD1   1 
ATOM 5714 C CD2   . LEU F 3 61  ? 124.013 148.332 112.516 1.00 20.50  ? 60  LEU E CD2   1 
ATOM 5715 N N     . LEU F 3 62  ? 123.506 149.161 107.850 1.00 19.27  ? 61  LEU E N     1 
ATOM 5716 C CA    . LEU F 3 62  ? 123.072 149.248 106.464 1.00 19.27  ? 61  LEU E CA    1 
ATOM 5717 C C     . LEU F 3 62  ? 121.566 149.361 106.302 1.00 19.27  ? 61  LEU E C     1 
ATOM 5718 O O     . LEU F 3 62  ? 121.111 149.829 105.253 1.00 19.27  ? 61  LEU E O     1 
ATOM 5719 C CB    . LEU F 3 62  ? 123.571 148.034 105.666 1.00 19.27  ? 61  LEU E CB    1 
ATOM 5720 C CG    . LEU F 3 62  ? 125.094 147.925 105.589 1.00 19.27  ? 61  LEU E CG    1 
ATOM 5721 C CD1   . LEU F 3 62  ? 125.515 146.675 104.848 1.00 19.27  ? 61  LEU E CD1   1 
ATOM 5722 C CD2   . LEU F 3 62  ? 125.675 149.156 104.925 1.00 19.27  ? 61  LEU E CD2   1 
ATOM 5723 N N     . ILE F 3 63  ? 120.795 148.953 107.288 1.00 19.91  ? 62  ILE E N     1 
ATOM 5724 C CA    . ILE F 3 63  ? 119.351 149.130 107.293 1.00 19.91  ? 62  ILE E CA    1 
ATOM 5725 C C     . ILE F 3 63  ? 119.040 150.407 108.055 1.00 19.91  ? 62  ILE E C     1 
ATOM 5726 O O     . ILE F 3 63  ? 119.708 150.731 109.042 1.00 19.91  ? 62  ILE E O     1 
ATOM 5727 C CB    . ILE F 3 63  ? 118.650 147.915 107.926 1.00 19.91  ? 62  ILE E CB    1 
ATOM 5728 C CG1   . ILE F 3 63  ? 119.064 146.631 107.213 1.00 19.91  ? 62  ILE E CG1   1 
ATOM 5729 C CG2   . ILE F 3 63  ? 117.147 148.075 107.868 1.00 19.91  ? 62  ILE E CG2   1 
ATOM 5730 C CD1   . ILE F 3 63  ? 118.623 145.375 107.925 1.00 19.91  ? 62  ILE E CD1   1 
ATOM 5731 N N     . ARG F 3 64  ? 118.035 151.144 107.599 1.00 21.83  ? 63  ARG E N     1 
ATOM 5732 C CA    . ARG F 3 64  ? 117.671 152.379 108.273 1.00 21.83  ? 63  ARG E CA    1 
ATOM 5733 C C     . ARG F 3 64  ? 117.033 152.059 109.616 1.00 21.83  ? 63  ARG E C     1 
ATOM 5734 O O     . ARG F 3 64  ? 116.279 151.093 109.750 1.00 21.83  ? 63  ARG E O     1 
ATOM 5735 C CB    . ARG F 3 64  ? 116.741 153.216 107.400 1.00 21.83  ? 63  ARG E CB    1 
ATOM 5736 C CG    . ARG F 3 64  ? 117.393 153.579 106.084 1.00 21.83  ? 63  ARG E CG    1 
ATOM 5737 C CD    . ARG F 3 64  ? 118.654 154.379 106.340 1.00 21.83  ? 63  ARG E CD    1 
ATOM 5738 N NE    . ARG F 3 64  ? 119.488 154.487 105.151 1.00 21.83  ? 63  ARG E NE    1 
ATOM 5739 C CZ    . ARG F 3 64  ? 120.742 154.924 105.164 1.00 21.83  ? 63  ARG E CZ    1 
ATOM 5740 N NH1   . ARG F 3 64  ? 121.303 155.289 106.308 1.00 21.83  ? 63  ARG E NH1   1 
ATOM 5741 N NH2   . ARG F 3 64  ? 121.439 154.992 104.038 1.00 21.83  ? 63  ARG E NH2   1 
ATOM 5742 N N     . LYS F 3 65  ? 117.339 152.885 110.616 1.00 22.19  ? 64  LYS E N     1 
ATOM 5743 C CA    . LYS F 3 65  ? 117.049 152.534 112.000 1.00 22.19  ? 64  LYS E CA    1 
ATOM 5744 C C     . LYS F 3 65  ? 115.569 152.649 112.329 1.00 22.19  ? 64  LYS E C     1 
ATOM 5745 O O     . LYS F 3 65  ? 115.037 151.826 113.082 1.00 22.19  ? 64  LYS E O     1 
ATOM 5746 C CB    . LYS F 3 65  ? 117.848 153.431 112.942 1.00 22.19  ? 64  LYS E CB    1 
ATOM 5747 C CG    . LYS F 3 65  ? 119.346 153.239 112.895 1.00 22.19  ? 64  LYS E CG    1 
ATOM 5748 C CD    . LYS F 3 65  ? 120.018 154.166 113.887 1.00 22.19  ? 64  LYS E CD    1 
ATOM 5749 C CE    . LYS F 3 65  ? 121.523 154.020 113.860 1.00 22.19  ? 64  LYS E CE    1 
ATOM 5750 N NZ    . LYS F 3 65  ? 122.169 154.950 114.824 1.00 22.19  ? 64  LYS E NZ    1 
ATOM 5751 N N     . LEU F 3 66  ? 114.886 153.632 111.773 1.00 22.76  ? 65  LEU E N     1 
ATOM 5752 C CA    . LEU F 3 66  ? 113.505 153.842 112.177 1.00 22.76  ? 65  LEU E CA    1 
ATOM 5753 C C     . LEU F 3 66  ? 112.567 152.805 111.562 1.00 22.76  ? 65  LEU E C     1 
ATOM 5754 O O     . LEU F 3 66  ? 111.664 152.321 112.259 1.00 22.76  ? 65  LEU E O     1 
ATOM 5755 C CB    . LEU F 3 66  ? 113.061 155.258 111.806 1.00 22.76  ? 65  LEU E CB    1 
ATOM 5756 C CG    . LEU F 3 66  ? 111.704 155.717 112.330 1.00 22.76  ? 65  LEU E CG    1 
ATOM 5757 C CD1   . LEU F 3 66  ? 111.673 155.647 113.842 1.00 22.76  ? 65  LEU E CD1   1 
ATOM 5758 C CD2   . LEU F 3 66  ? 111.411 157.125 111.852 1.00 22.76  ? 65  LEU E CD2   1 
ATOM 5759 N N     . PRO F 3 67  ? 112.746 152.390 110.301 1.00 22.15  ? 66  PRO E N     1 
ATOM 5760 C CA    . PRO F 3 67  ? 111.944 151.260 109.815 1.00 22.15  ? 66  PRO E CA    1 
ATOM 5761 C C     . PRO F 3 67  ? 112.299 149.940 110.471 1.00 22.15  ? 66  PRO E C     1 
ATOM 5762 O O     . PRO F 3 67  ? 111.413 149.090 110.624 1.00 22.15  ? 66  PRO E O     1 
ATOM 5763 C CB    . PRO F 3 67  ? 112.257 151.230 108.315 1.00 22.15  ? 66  PRO E CB    1 
ATOM 5764 C CG    . PRO F 3 67  ? 112.657 152.606 107.993 1.00 22.15  ? 66  PRO E CG    1 
ATOM 5765 C CD    . PRO F 3 67  ? 113.429 153.066 109.184 1.00 22.15  ? 66  PRO E CD    1 
ATOM 5766 N N     . PHE F 3 68  ? 113.524 149.777 110.968 1.00 21.53  ? 67  PHE E N     1 
ATOM 5767 C CA    . PHE F 3 68  ? 113.846 148.554 111.688 1.00 21.53  ? 67  PHE E CA    1 
ATOM 5768 C C     . PHE F 3 68  ? 113.233 148.563 113.077 1.00 21.53  ? 67  PHE E C     1 
ATOM 5769 O O     . PHE F 3 68  ? 112.835 147.509 113.590 1.00 21.53  ? 67  PHE E O     1 
ATOM 5770 C CB    . PHE F 3 68  ? 115.354 148.363 111.796 1.00 21.53  ? 67  PHE E CB    1 
ATOM 5771 C CG    . PHE F 3 68  ? 115.738 147.033 112.346 1.00 21.53  ? 67  PHE E CG    1 
ATOM 5772 C CD1   . PHE F 3 68  ? 115.693 145.911 111.544 1.00 21.53  ? 67  PHE E CD1   1 
ATOM 5773 C CD2   . PHE F 3 68  ? 116.071 146.886 113.675 1.00 21.53  ? 67  PHE E CD2   1 
ATOM 5774 C CE1   . PHE F 3 68  ? 116.025 144.681 112.042 1.00 21.53  ? 67  PHE E CE1   1 
ATOM 5775 C CE2   . PHE F 3 68  ? 116.392 145.654 114.180 1.00 21.53  ? 67  PHE E CE2   1 
ATOM 5776 C CZ    . PHE F 3 68  ? 116.372 144.550 113.362 1.00 21.53  ? 67  PHE E CZ    1 
ATOM 5777 N N     . GLN F 3 69  ? 113.077 149.748 113.665 1.00 23.25  ? 68  GLN E N     1 
ATOM 5778 C CA    . GLN F 3 69  ? 112.404 149.827 114.951 1.00 23.25  ? 68  GLN E CA    1 
ATOM 5779 C C     . GLN F 3 69  ? 110.913 149.614 114.777 1.00 23.25  ? 68  GLN E C     1 
ATOM 5780 O O     . GLN F 3 69  ? 110.268 149.000 115.635 1.00 23.25  ? 68  GLN E O     1 
ATOM 5781 C CB    . GLN F 3 69  ? 112.681 151.180 115.595 1.00 23.25  ? 68  GLN E CB    1 
ATOM 5782 C CG    . GLN F 3 69  ? 112.143 151.333 116.991 1.00 23.25  ? 68  GLN E CG    1 
ATOM 5783 C CD    . GLN F 3 69  ? 112.516 152.664 117.589 1.00 23.25  ? 68  GLN E CD    1 
ATOM 5784 O OE1   . GLN F 3 69  ? 113.162 153.483 116.940 1.00 23.25  ? 68  GLN E OE1   1 
ATOM 5785 N NE2   . GLN F 3 69  ? 112.109 152.893 118.828 1.00 23.25  ? 68  GLN E NE2   1 
ATOM 5786 N N     . ARG F 3 70  ? 110.355 150.067 113.655 1.00 23.79  ? 69  ARG E N     1 
ATOM 5787 C CA    . ARG F 3 70  ? 108.950 149.785 113.404 1.00 23.79  ? 69  ARG E CA    1 
ATOM 5788 C C     . ARG F 3 70  ? 108.749 148.297 113.171 1.00 23.79  ? 69  ARG E C     1 
ATOM 5789 O O     . ARG F 3 70  ? 107.746 147.723 113.611 1.00 23.79  ? 69  ARG E O     1 
ATOM 5790 C CB    . ARG F 3 70  ? 108.475 150.550 112.177 1.00 23.79  ? 69  ARG E CB    1 
ATOM 5791 C CG    . ARG F 3 70  ? 108.469 152.043 112.308 1.00 23.79  ? 69  ARG E CG    1 
ATOM 5792 C CD    . ARG F 3 70  ? 108.219 152.650 110.949 1.00 23.79  ? 69  ARG E CD    1 
ATOM 5793 N NE    . ARG F 3 70  ? 108.257 154.101 110.988 1.00 23.79  ? 69  ARG E NE    1 
ATOM 5794 C CZ    . ARG F 3 70  ? 108.256 154.868 109.906 1.00 23.79  ? 69  ARG E CZ    1 
ATOM 5795 N NH1   . ARG F 3 70  ? 108.233 154.314 108.703 1.00 23.79  ? 69  ARG E NH1   1 
ATOM 5796 N NH2   . ARG F 3 70  ? 108.289 156.186 110.028 1.00 23.79  ? 69  ARG E NH2   1 
ATOM 5797 N N     . LEU F 3 71  ? 109.736 147.644 112.556 1.00 22.86  ? 70  LEU E N     1 
ATOM 5798 C CA    . LEU F 3 71  ? 109.618 146.215 112.304 1.00 22.86  ? 70  LEU E CA    1 
ATOM 5799 C C     . LEU F 3 71  ? 109.698 145.421 113.600 1.00 22.86  ? 70  LEU E C     1 
ATOM 5800 O O     . LEU F 3 71  ? 108.928 144.476 113.801 1.00 22.86  ? 70  LEU E O     1 
ATOM 5801 C CB    . LEU F 3 71  ? 110.703 145.770 111.330 1.00 22.86  ? 70  LEU E CB    1 
ATOM 5802 C CG    . LEU F 3 71  ? 110.729 144.277 111.037 1.00 22.86  ? 70  LEU E CG    1 
ATOM 5803 C CD1   . LEU F 3 71  ? 109.397 143.858 110.449 1.00 22.86  ? 70  LEU E CD1   1 
ATOM 5804 C CD2   . LEU F 3 71  ? 111.869 143.947 110.100 1.00 22.86  ? 70  LEU E CD2   1 
ATOM 5805 N N     . VAL F 3 72  ? 110.596 145.810 114.509 1.00 24.22  ? 71  VAL E N     1 
ATOM 5806 C CA    . VAL F 3 72  ? 110.690 145.087 115.774 1.00 24.22  ? 71  VAL E CA    1 
ATOM 5807 C C     . VAL F 3 72  ? 109.445 145.339 116.613 1.00 24.22  ? 71  VAL E C     1 
ATOM 5808 O O     . VAL F 3 72  ? 108.942 144.430 117.282 1.00 24.22  ? 71  VAL E O     1 
ATOM 5809 C CB    . VAL F 3 72  ? 111.987 145.427 116.538 1.00 24.22  ? 71  VAL E CB    1 
ATOM 5810 C CG1   . VAL F 3 72  ? 113.194 145.099 115.691 1.00 24.22  ? 71  VAL E CG1   1 
ATOM 5811 C CG2   . VAL F 3 72  ? 112.027 146.868 116.999 1.00 24.22  ? 71  VAL E CG2   1 
ATOM 5812 N N     . ARG F 3 73  ? 108.913 146.563 116.583 1.00 26.00  ? 72  ARG E N     1 
ATOM 5813 C CA    . ARG F 3 73  ? 107.749 146.863 117.402 1.00 26.00  ? 72  ARG E CA    1 
ATOM 5814 C C     . ARG F 3 73  ? 106.450 146.382 116.778 1.00 26.00  ? 72  ARG E C     1 
ATOM 5815 O O     . ARG F 3 73  ? 105.405 146.460 117.430 1.00 26.00  ? 72  ARG E O     1 
ATOM 5816 C CB    . ARG F 3 73  ? 107.663 148.366 117.649 1.00 26.00  ? 72  ARG E CB    1 
ATOM 5817 C CG    . ARG F 3 73  ? 108.770 148.895 118.521 1.00 26.00  ? 72  ARG E CG    1 
ATOM 5818 C CD    . ARG F 3 73  ? 108.661 150.391 118.686 1.00 26.00  ? 72  ARG E CD    1 
ATOM 5819 N NE    . ARG F 3 73  ? 109.823 150.927 119.379 1.00 26.00  ? 72  ARG E NE    1 
ATOM 5820 C CZ    . ARG F 3 73  ? 109.908 151.053 120.696 1.00 26.00  ? 72  ARG E CZ    1 
ATOM 5821 N NH1   . ARG F 3 73  ? 108.892 150.686 121.464 1.00 26.00  ? 72  ARG E NH1   1 
ATOM 5822 N NH2   . ARG F 3 73  ? 111.007 151.548 121.246 1.00 26.00  ? 72  ARG E NH2   1 
ATOM 5823 N N     . GLU F 3 74  ? 106.486 145.887 115.542 1.00 25.97  ? 73  GLU E N     1 
ATOM 5824 C CA    . GLU F 3 74  ? 105.321 145.227 114.973 1.00 25.97  ? 73  GLU E CA    1 
ATOM 5825 C C     . GLU F 3 74  ? 105.458 143.712 114.961 1.00 25.97  ? 73  GLU E C     1 
ATOM 5826 O O     . GLU F 3 74  ? 104.453 143.015 114.797 1.00 25.97  ? 73  GLU E O     1 
ATOM 5827 C CB    . GLU F 3 74  ? 105.060 145.723 113.544 1.00 25.97  ? 73  GLU E CB    1 
ATOM 5828 C CG    . GLU F 3 74  ? 104.569 147.165 113.458 1.00 25.97  ? 73  GLU E CG    1 
ATOM 5829 C CD    . GLU F 3 74  ? 103.083 147.307 113.738 1.00 25.97  ? 73  GLU E CD    1 
ATOM 5830 O OE1   . GLU F 3 74  ? 102.442 146.300 114.103 1.00 25.97  ? 73  GLU E OE1   1 
ATOM 5831 O OE2   . GLU F 3 74  ? 102.553 148.429 113.591 1.00 25.97  ? 73  GLU E OE2   1 
ATOM 5832 N N     . ILE F 3 75  ? 106.674 143.191 115.133 1.00 24.90  ? 74  ILE E N     1 
ATOM 5833 C CA    . ILE F 3 75  ? 106.847 141.760 115.359 1.00 24.90  ? 74  ILE E CA    1 
ATOM 5834 C C     . ILE F 3 75  ? 106.620 141.404 116.820 1.00 24.90  ? 74  ILE E C     1 
ATOM 5835 O O     . ILE F 3 75  ? 105.952 140.412 117.128 1.00 24.90  ? 74  ILE E O     1 
ATOM 5836 C CB    . ILE F 3 75  ? 108.233 141.294 114.881 1.00 24.90  ? 74  ILE E CB    1 
ATOM 5837 C CG1   . ILE F 3 75  ? 108.326 141.377 113.360 1.00 24.90  ? 74  ILE E CG1   1 
ATOM 5838 C CG2   . ILE F 3 75  ? 108.519 139.882 115.359 1.00 24.90  ? 74  ILE E CG2   1 
ATOM 5839 C CD1   . ILE F 3 75  ? 109.709 141.147 112.832 1.00 24.90  ? 74  ILE E CD1   1 
ATOM 5840 N N     . ALA F 3 76  ? 107.157 142.200 117.745 1.00 26.08  ? 75  ALA E N     1 
ATOM 5841 C CA    . ALA F 3 76  ? 106.992 141.893 119.157 1.00 26.08  ? 75  ALA E CA    1 
ATOM 5842 C C     . ALA F 3 76  ? 105.573 142.109 119.650 1.00 26.08  ? 75  ALA E C     1 
ATOM 5843 O O     . ALA F 3 76  ? 105.256 141.672 120.760 1.00 26.08  ? 75  ALA E O     1 
ATOM 5844 C CB    . ALA F 3 76  ? 107.944 142.748 119.991 1.00 26.08  ? 75  ALA E CB    1 
ATOM 5845 N N     . GLN F 3 77  ? 104.717 142.767 118.869 1.00 28.70  ? 76  GLN E N     1 
ATOM 5846 C CA    . GLN F 3 77  ? 103.361 143.000 119.337 1.00 28.70  ? 76  GLN E CA    1 
ATOM 5847 C C     . GLN F 3 77  ? 102.566 141.705 119.406 1.00 28.70  ? 76  GLN E C     1 
ATOM 5848 O O     . GLN F 3 77  ? 101.604 141.618 120.176 1.00 28.70  ? 76  GLN E O     1 
ATOM 5849 C CB    . GLN F 3 77  ? 102.670 144.014 118.428 1.00 28.70  ? 76  GLN E CB    1 
ATOM 5850 C CG    . GLN F 3 77  ? 101.346 144.525 118.947 1.00 28.70  ? 76  GLN E CG    1 
ATOM 5851 C CD    . GLN F 3 77  ? 100.757 145.597 118.056 1.00 28.70  ? 76  GLN E CD    1 
ATOM 5852 O OE1   . GLN F 3 77  ? 101.324 145.939 117.018 1.00 28.70  ? 76  GLN E OE1   1 
ATOM 5853 N NE2   . GLN F 3 77  ? 99.613  146.138 118.459 1.00 28.70  ? 76  GLN E NE2   1 
ATOM 5854 N N     . ASP F 3 78  ? 102.952 140.697 118.622 1.00 29.76  ? 77  ASP E N     1 
ATOM 5855 C CA    . ASP F 3 78  ? 102.266 139.413 118.624 1.00 29.76  ? 77  ASP E CA    1 
ATOM 5856 C C     . ASP F 3 78  ? 102.593 138.584 119.857 1.00 29.76  ? 77  ASP E C     1 
ATOM 5857 O O     . ASP F 3 78  ? 101.916 137.584 120.110 1.00 29.76  ? 77  ASP E O     1 
ATOM 5858 C CB    . ASP F 3 78  ? 102.620 138.629 117.359 1.00 29.76  ? 77  ASP E CB    1 
ATOM 5859 C CG    . ASP F 3 78  ? 101.557 137.611 116.983 1.00 29.76  ? 77  ASP E CG    1 
ATOM 5860 O OD1   . ASP F 3 78  ? 101.474 136.557 117.645 1.00 29.76  ? 77  ASP E OD1   1 
ATOM 5861 O OD2   . ASP F 3 78  ? 100.804 137.865 116.020 1.00 29.76  ? 77  ASP E OD2   1 
ATOM 5862 N N     . PHE F 3 79  ? 103.606 138.977 120.626 1.00 28.32  ? 78  PHE E N     1 
ATOM 5863 C CA    . PHE F 3 79  ? 104.080 138.208 121.768 1.00 28.32  ? 78  PHE E CA    1 
ATOM 5864 C C     . PHE F 3 79  ? 103.596 138.783 123.091 1.00 28.32  ? 78  PHE E C     1 
ATOM 5865 O O     . PHE F 3 79  ? 103.120 138.043 123.954 1.00 28.32  ? 78  PHE E O     1 
ATOM 5866 C CB    . PHE F 3 79  ? 105.608 138.155 121.736 1.00 28.32  ? 78  PHE E CB    1 
ATOM 5867 C CG    . PHE F 3 79  ? 106.151 137.353 120.595 1.00 28.32  ? 78  PHE E CG    1 
ATOM 5868 C CD1   . PHE F 3 79  ? 105.386 136.366 120.004 1.00 28.32  ? 78  PHE E CD1   1 
ATOM 5869 C CD2   . PHE F 3 79  ? 107.397 137.626 120.073 1.00 28.32  ? 78  PHE E CD2   1 
ATOM 5870 C CE1   . PHE F 3 79  ? 105.874 135.637 118.943 1.00 28.32  ? 78  PHE E CE1   1 
ATOM 5871 C CE2   . PHE F 3 79  ? 107.885 136.905 119.007 1.00 28.32  ? 78  PHE E CE2   1 
ATOM 5872 C CZ    . PHE F 3 79  ? 107.124 135.908 118.444 1.00 28.32  ? 78  PHE E CZ    1 
ATOM 5873 N N     . LYS F 3 80  ? 103.711 140.095 123.263 1.00 30.18  ? 79  LYS E N     1 
ATOM 5874 C CA    . LYS F 3 80  ? 103.128 140.779 124.407 1.00 30.18  ? 79  LYS E CA    1 
ATOM 5875 C C     . LYS F 3 80  ? 102.769 142.188 123.972 1.00 30.18  ? 79  LYS E C     1 
ATOM 5876 O O     . LYS F 3 80  ? 103.623 142.910 123.451 1.00 30.18  ? 79  LYS E O     1 
ATOM 5877 C CB    . LYS F 3 80  ? 104.099 140.807 125.592 1.00 30.18  ? 79  LYS E CB    1 
ATOM 5878 C CG    . LYS F 3 80  ? 103.520 141.420 126.855 1.00 30.18  ? 79  LYS E CG    1 
ATOM 5879 C CD    . LYS F 3 80  ? 104.546 141.438 127.977 1.00 30.18  ? 79  LYS E CD    1 
ATOM 5880 C CE    . LYS F 3 80  ? 103.947 141.947 129.280 1.00 30.18  ? 79  LYS E CE    1 
ATOM 5881 N NZ    . LYS F 3 80  ? 103.535 143.376 129.182 1.00 30.18  ? 79  LYS E NZ    1 
ATOM 5882 N N     . THR F 3 81  ? 101.516 142.575 124.180 1.00 32.32  ? 80  THR E N     1 
ATOM 5883 C CA    . THR F 3 81  ? 101.079 143.886 123.733 1.00 32.32  ? 80  THR E CA    1 
ATOM 5884 C C     . THR F 3 81  ? 101.622 144.958 124.662 1.00 32.32  ? 80  THR E C     1 
ATOM 5885 O O     . THR F 3 81  ? 101.918 144.697 125.831 1.00 32.32  ? 80  THR E O     1 
ATOM 5886 C CB    . THR F 3 81  ? 99.555  143.966 123.691 1.00 32.32  ? 80  THR E CB    1 
ATOM 5887 O OG1   . THR F 3 81  ? 99.032  143.821 125.017 1.00 32.32  ? 80  THR E OG1   1 
ATOM 5888 C CG2   . THR F 3 81  ? 98.992  142.870 122.805 1.00 32.32  ? 80  THR E CG2   1 
ATOM 5889 N N     . ASP F 3 82  ? 101.831 146.151 124.101 1.00 33.72  ? 81  ASP E N     1 
ATOM 5890 C CA    . ASP F 3 82  ? 102.289 147.337 124.832 1.00 33.72  ? 81  ASP E CA    1 
ATOM 5891 C C     . ASP F 3 82  ? 103.615 147.039 125.538 1.00 33.72  ? 81  ASP E C     1 
ATOM 5892 O O     . ASP F 3 82  ? 103.727 147.079 126.764 1.00 33.72  ? 81  ASP E O     1 
ATOM 5893 C CB    . ASP F 3 82  ? 101.220 147.923 125.781 1.00 33.72  ? 81  ASP E CB    1 
ATOM 5894 C CG    . ASP F 3 82  ? 100.754 146.967 126.870 1.00 33.72  ? 81  ASP E CG    1 
ATOM 5895 O OD1   . ASP F 3 82  ? 99.822  146.174 126.615 1.00 33.72  ? 81  ASP E OD1   1 
ATOM 5896 O OD2   . ASP F 3 82  ? 101.281 147.046 127.999 1.00 33.72  ? 81  ASP E OD2   1 
ATOM 5897 N N     . LEU F 3 83  ? 104.629 146.742 124.734 1.00 31.38  ? 82  LEU E N     1 
ATOM 5898 C CA    . LEU F 3 83  ? 105.990 146.644 125.235 1.00 31.38  ? 82  LEU E CA    1 
ATOM 5899 C C     . LEU F 3 83  ? 106.796 147.889 124.900 1.00 31.38  ? 82  LEU E C     1 
ATOM 5900 O O     . LEU F 3 83  ? 106.501 148.627 123.957 1.00 31.38  ? 82  LEU E O     1 
ATOM 5901 C CB    . LEU F 3 83  ? 106.695 145.417 124.654 1.00 31.38  ? 82  LEU E CB    1 
ATOM 5902 C CG    . LEU F 3 83  ? 106.430 144.050 125.275 1.00 31.38  ? 82  LEU E CG    1 
ATOM 5903 C CD1   . LEU F 3 83  ? 107.080 142.981 124.427 1.00 31.38  ? 82  LEU E CD1   1 
ATOM 5904 C CD2   . LEU F 3 83  ? 106.967 143.998 126.692 1.00 31.38  ? 82  LEU E CD2   1 
ATOM 5905 N N     . ARG F 3 84  ? 107.826 148.110 125.704 1.00 32.23  ? 83  ARG E N     1 
ATOM 5906 C CA    . ARG F 3 84  ? 108.813 149.152 125.491 1.00 32.23  ? 83  ARG E CA    1 
ATOM 5907 C C     . ARG F 3 84  ? 110.176 148.521 125.262 1.00 32.23  ? 83  ARG E C     1 
ATOM 5908 O O     . ARG F 3 84  ? 110.481 147.457 125.803 1.00 32.23  ? 83  ARG E O     1 
ATOM 5909 C CB    . ARG F 3 84  ? 108.867 150.112 126.681 1.00 32.23  ? 83  ARG E CB    1 
ATOM 5910 C CG    . ARG F 3 84  ? 107.701 151.072 126.730 1.00 32.23  ? 83  ARG E CG    1 
ATOM 5911 C CD    . ARG F 3 84  ? 107.780 152.002 127.919 1.00 32.23  ? 83  ARG E CD    1 
ATOM 5912 N NE    . ARG F 3 84  ? 106.813 153.084 127.793 1.00 32.23  ? 83  ARG E NE    1 
ATOM 5913 C CZ    . ARG F 3 84  ? 105.555 153.014 128.208 1.00 32.23  ? 83  ARG E CZ    1 
ATOM 5914 N NH1   . ARG F 3 84  ? 105.106 151.912 128.790 1.00 32.23  ? 83  ARG E NH1   1 
ATOM 5915 N NH2   . ARG F 3 84  ? 104.745 154.050 128.048 1.00 32.23  ? 83  ARG E NH2   1 
ATOM 5916 N N     . PHE F 3 85  ? 110.984 149.165 124.431 1.00 28.10  ? 84  PHE E N     1 
ATOM 5917 C CA    . PHE F 3 85  ? 112.315 148.676 124.115 1.00 28.10  ? 84  PHE E CA    1 
ATOM 5918 C C     . PHE F 3 85  ? 113.340 149.716 124.532 1.00 28.10  ? 84  PHE E C     1 
ATOM 5919 O O     . PHE F 3 85  ? 113.115 150.918 124.372 1.00 28.10  ? 84  PHE E O     1 
ATOM 5920 C CB    . PHE F 3 85  ? 112.456 148.404 122.616 1.00 28.10  ? 84  PHE E CB    1 
ATOM 5921 C CG    . PHE F 3 85  ? 111.756 147.169 122.149 1.00 28.10  ? 84  PHE E CG    1 
ATOM 5922 C CD1   . PHE F 3 85  ? 112.391 145.946 122.189 1.00 28.10  ? 84  PHE E CD1   1 
ATOM 5923 C CD2   . PHE F 3 85  ? 110.462 147.229 121.671 1.00 28.10  ? 84  PHE E CD2   1 
ATOM 5924 C CE1   . PHE F 3 85  ? 111.753 144.809 121.759 1.00 28.10  ? 84  PHE E CE1   1 
ATOM 5925 C CE2   . PHE F 3 85  ? 109.818 146.093 121.242 1.00 28.10  ? 84  PHE E CE2   1 
ATOM 5926 C CZ    . PHE F 3 85  ? 110.465 144.881 121.286 1.00 28.10  ? 84  PHE E CZ    1 
ATOM 5927 N N     . GLN F 3 86  ? 114.471 149.257 125.057 1.00 26.93  ? 85  GLN E N     1 
ATOM 5928 C CA    . GLN F 3 86  ? 115.570 150.176 125.289 1.00 26.93  ? 85  GLN E CA    1 
ATOM 5929 C C     . GLN F 3 86  ? 116.141 150.642 123.958 1.00 26.93  ? 85  GLN E C     1 
ATOM 5930 O O     . GLN F 3 86  ? 115.965 150.000 122.920 1.00 26.93  ? 85  GLN E O     1 
ATOM 5931 C CB    . GLN F 3 86  ? 116.672 149.533 126.129 1.00 26.93  ? 85  GLN E CB    1 
ATOM 5932 C CG    . GLN F 3 86  ? 116.334 149.365 127.589 1.00 26.93  ? 85  GLN E CG    1 
ATOM 5933 C CD    . GLN F 3 86  ? 117.516 148.871 128.386 1.00 26.93  ? 85  GLN E CD    1 
ATOM 5934 O OE1   . GLN F 3 86  ? 118.570 148.573 127.830 1.00 26.93  ? 85  GLN E OE1   1 
ATOM 5935 N NE2   . GLN F 3 86  ? 117.364 148.826 129.701 1.00 26.93  ? 85  GLN E NE2   1 
ATOM 5936 N N     . SER F 3 87  ? 116.835 151.780 123.991 1.00 26.74  ? 86  SER E N     1 
ATOM 5937 C CA    . SER F 3 87  ? 117.395 152.287 122.749 1.00 26.74  ? 86  SER E CA    1 
ATOM 5938 C C     . SER F 3 87  ? 118.565 151.442 122.280 1.00 26.74  ? 86  SER E C     1 
ATOM 5939 O O     . SER F 3 87  ? 118.914 151.496 121.096 1.00 26.74  ? 86  SER E O     1 
ATOM 5940 C CB    . SER F 3 87  ? 117.840 153.741 122.921 1.00 26.74  ? 86  SER E CB    1 
ATOM 5941 O OG    . SER F 3 87  ? 119.039 153.825 123.670 1.00 26.74  ? 86  SER E OG    1 
ATOM 5942 N N     . SER F 3 88  ? 119.171 150.654 123.170 1.00 26.00  ? 87  SER E N     1 
ATOM 5943 C CA    . SER F 3 88  ? 120.270 149.794 122.767 1.00 26.00  ? 87  SER E CA    1 
ATOM 5944 C C     . SER F 3 88  ? 119.825 148.373 122.474 1.00 26.00  ? 87  SER E C     1 
ATOM 5945 O O     . SER F 3 88  ? 120.572 147.630 121.834 1.00 26.00  ? 87  SER E O     1 
ATOM 5946 C CB    . SER F 3 88  ? 121.353 149.769 123.849 1.00 26.00  ? 87  SER E CB    1 
ATOM 5947 O OG    . SER F 3 88  ? 120.854 149.225 125.056 1.00 26.00  ? 87  SER E OG    1 
ATOM 5948 N N     . ALA F 3 89  ? 118.592 148.011 122.829 1.00 24.86  ? 88  ALA E N     1 
ATOM 5949 C CA    . ALA F 3 89  ? 118.089 146.698 122.452 1.00 24.86  ? 88  ALA E CA    1 
ATOM 5950 C C     . ALA F 3 89  ? 117.787 146.662 120.967 1.00 24.86  ? 88  ALA E C     1 
ATOM 5951 O O     . ALA F 3 89  ? 118.055 145.664 120.289 1.00 24.86  ? 88  ALA E O     1 
ATOM 5952 C CB    . ALA F 3 89  ? 116.844 146.354 123.263 1.00 24.86  ? 88  ALA E CB    1 
ATOM 5953 N N     . VAL F 3 90  ? 117.266 147.768 120.437 1.00 24.27  ? 89  VAL E N     1 
ATOM 5954 C CA    . VAL F 3 90  ? 116.964 147.831 119.018 1.00 24.27  ? 89  VAL E CA    1 
ATOM 5955 C C     . VAL F 3 90  ? 118.255 147.882 118.217 1.00 24.27  ? 89  VAL E C     1 
ATOM 5956 O O     . VAL F 3 90  ? 118.338 147.303 117.131 1.00 24.27  ? 89  VAL E O     1 
ATOM 5957 C CB    . VAL F 3 90  ? 116.038 149.025 118.719 1.00 24.27  ? 89  VAL E CB    1 
ATOM 5958 C CG1   . VAL F 3 90  ? 115.698 149.076 117.242 1.00 24.27  ? 89  VAL E CG1   1 
ATOM 5959 C CG2   . VAL F 3 90  ? 114.782 148.943 119.563 1.00 24.27  ? 89  VAL E CG2   1 
ATOM 5960 N N     . MET F 3 91  ? 119.295 148.537 118.740 1.00 25.18  ? 90  MET E N     1 
ATOM 5961 C CA    . MET F 3 91  ? 120.562 148.524 118.020 1.00 25.18  ? 90  MET E CA    1 
ATOM 5962 C C     . MET F 3 91  ? 121.268 147.185 118.147 1.00 25.18  ? 90  MET E C     1 
ATOM 5963 O O     . MET F 3 91  ? 121.967 146.775 117.215 1.00 25.18  ? 90  MET E O     1 
ATOM 5964 C CB    . MET F 3 91  ? 121.477 149.634 118.528 1.00 25.18  ? 90  MET E CB    1 
ATOM 5965 C CG    . MET F 3 91  ? 121.028 151.055 118.213 1.00 25.18  ? 90  MET E CG    1 
ATOM 5966 S SD    . MET F 3 91  ? 120.951 151.417 116.449 1.00 25.18  ? 90  MET E SD    1 
ATOM 5967 C CE    . MET F 3 91  ? 119.195 151.257 116.138 1.00 25.18  ? 90  MET E CE    1 
ATOM 5968 N N     . ALA F 3 92  ? 121.023 146.438 119.224 1.00 24.16  ? 91  ALA E N     1 
ATOM 5969 C CA    . ALA F 3 92  ? 121.590 145.100 119.280 1.00 24.16  ? 91  ALA E CA    1 
ATOM 5970 C C     . ALA F 3 92  ? 120.862 144.176 118.320 1.00 24.16  ? 91  ALA E C     1 
ATOM 5971 O O     . ALA F 3 92  ? 121.488 143.343 117.653 1.00 24.16  ? 91  ALA E O     1 
ATOM 5972 C CB    . ALA F 3 92  ? 121.516 144.556 120.707 1.00 24.16  ? 91  ALA E CB    1 
ATOM 5973 N N     . LEU F 3 93  ? 119.545 144.359 118.177 1.00 22.53  ? 92  LEU E N     1 
ATOM 5974 C CA    . LEU F 3 93  ? 118.815 143.562 117.203 1.00 22.53  ? 92  LEU E CA    1 
ATOM 5975 C C     . LEU F 3 93  ? 119.166 143.950 115.777 1.00 22.53  ? 92  LEU E C     1 
ATOM 5976 O O     . LEU F 3 93  ? 119.282 143.080 114.915 1.00 22.53  ? 92  LEU E O     1 
ATOM 5977 C CB    . LEU F 3 93  ? 117.313 143.738 117.416 1.00 22.53  ? 92  LEU E CB    1 
ATOM 5978 C CG    . LEU F 3 93  ? 116.610 143.082 118.602 1.00 22.53  ? 92  LEU E CG    1 
ATOM 5979 C CD1   . LEU F 3 93  ? 115.200 143.614 118.679 1.00 22.53  ? 92  LEU E CD1   1 
ATOM 5980 C CD2   . LEU F 3 93  ? 116.577 141.582 118.457 1.00 22.53  ? 92  LEU E CD2   1 
ATOM 5981 N N     . GLN F 3 94  ? 119.457 145.221 115.530 1.00 21.72  ? 93  GLN E N     1 
ATOM 5982 C CA    . GLN F 3 94  ? 119.779 145.611 114.170 1.00 21.72  ? 93  GLN E CA    1 
ATOM 5983 C C     . GLN F 3 94  ? 121.194 145.187 113.815 1.00 21.72  ? 93  GLN E C     1 
ATOM 5984 O O     . GLN F 3 94  ? 121.435 144.720 112.700 1.00 21.72  ? 93  GLN E O     1 
ATOM 5985 C CB    . GLN F 3 94  ? 119.570 147.105 113.983 1.00 21.72  ? 93  GLN E CB    1 
ATOM 5986 C CG    . GLN F 3 94  ? 119.722 147.512 112.558 1.00 21.72  ? 93  GLN E CG    1 
ATOM 5987 C CD    . GLN F 3 94  ? 119.381 148.945 112.347 1.00 21.72  ? 93  GLN E CD    1 
ATOM 5988 O OE1   . GLN F 3 94  ? 119.070 149.667 113.292 1.00 21.72  ? 93  GLN E OE1   1 
ATOM 5989 N NE2   . GLN F 3 94  ? 119.474 149.388 111.111 1.00 21.72  ? 93  GLN E NE2   1 
ATOM 5990 N N     . GLU F 3 95  ? 122.115 145.237 114.788 1.00 23.84  ? 94  GLU E N     1 
ATOM 5991 C CA    . GLU F 3 95  ? 123.470 144.744 114.575 1.00 23.84  ? 94  GLU E CA    1 
ATOM 5992 C C     . GLU F 3 95  ? 123.468 143.244 114.372 1.00 23.84  ? 94  GLU E C     1 
ATOM 5993 O O     . GLU F 3 95  ? 124.150 142.734 113.473 1.00 23.84  ? 94  GLU E O     1 
ATOM 5994 C CB    . GLU F 3 95  ? 124.361 145.157 115.748 1.00 23.84  ? 94  GLU E CB    1 
ATOM 5995 C CG    . GLU F 3 95  ? 125.823 144.769 115.597 1.00 23.84  ? 94  GLU E CG    1 
ATOM 5996 C CD    . GLU F 3 95  ? 126.352 144.950 114.197 1.00 23.84  ? 94  GLU E CD    1 
ATOM 5997 O OE1   . GLU F 3 95  ? 126.382 146.101 113.684 1.00 23.84  ? 94  GLU E OE1   1 
ATOM 5998 O OE2   . GLU F 3 95  ? 126.764 143.913 113.640 1.00 23.84  ? 94  GLU E OE2   1 
ATOM 5999 N N     . ALA F 3 96  ? 122.582 142.541 115.068 1.00 22.00  ? 95  ALA E N     1 
ATOM 6000 C CA    . ALA F 3 96  ? 122.597 141.100 114.921 1.00 22.00  ? 95  ALA E CA    1 
ATOM 6001 C C     . ALA F 3 96  ? 121.904 140.710 113.629 1.00 22.00  ? 95  ALA E C     1 
ATOM 6002 O O     . ALA F 3 96  ? 122.322 139.752 112.979 1.00 22.00  ? 95  ALA E O     1 
ATOM 6003 C CB    . ALA F 3 96  ? 121.929 140.422 116.112 1.00 22.00  ? 95  ALA E CB    1 
ATOM 6004 N N     . CYS F 3 97  ? 120.907 141.482 113.191 1.00 21.27  ? 96  CYS E N     1 
ATOM 6005 C CA    . CYS F 3 97  ? 120.233 141.144 111.945 1.00 21.27  ? 96  CYS E CA    1 
ATOM 6006 C C     . CYS F 3 97  ? 121.081 141.465 110.728 1.00 21.27  ? 96  CYS E C     1 
ATOM 6007 O O     . CYS F 3 97  ? 121.040 140.718 109.746 1.00 21.27  ? 96  CYS E O     1 
ATOM 6008 C CB    . CYS F 3 97  ? 118.900 141.869 111.843 1.00 21.27  ? 96  CYS E CB    1 
ATOM 6009 S SG    . CYS F 3 97  ? 117.701 141.340 113.059 1.00 21.27  ? 96  CYS E SG    1 
ATOM 6010 N N     . GLU F 3 98  ? 121.881 142.528 110.757 1.00 20.58  ? 97  GLU E N     1 
ATOM 6011 C CA    . GLU F 3 98  ? 122.727 142.660 109.582 1.00 20.58  ? 97  GLU E CA    1 
ATOM 6012 C C     . GLU F 3 98  ? 123.880 141.680 109.662 1.00 20.58  ? 97  GLU E C     1 
ATOM 6013 O O     . GLU F 3 98  ? 124.304 141.164 108.628 1.00 20.58  ? 97  GLU E O     1 
ATOM 6014 C CB    . GLU F 3 98  ? 123.236 144.080 109.312 1.00 20.58  ? 97  GLU E CB    1 
ATOM 6015 C CG    . GLU F 3 98  ? 122.153 145.085 108.951 1.00 20.58  ? 97  GLU E CG    1 
ATOM 6016 C CD    . GLU F 3 98  ? 121.980 146.130 109.991 1.00 20.58  ? 97  GLU E CD    1 
ATOM 6017 O OE1   . GLU F 3 98  ? 122.697 146.035 110.998 1.00 20.58  ? 97  GLU E OE1   1 
ATOM 6018 O OE2   . GLU F 3 98  ? 121.124 147.021 109.818 1.00 20.58  ? 97  GLU E OE2   1 
ATOM 6019 N N     . ALA F 3 99  ? 124.350 141.332 110.863 1.00 20.14  ? 98  ALA E N     1 
ATOM 6020 C CA    . ALA F 3 99  ? 125.395 140.321 110.917 1.00 20.14  ? 98  ALA E CA    1 
ATOM 6021 C C     . ALA F 3 99  ? 124.856 138.941 110.577 1.00 20.14  ? 98  ALA E C     1 
ATOM 6022 O O     . ALA F 3 99  ? 125.640 138.037 110.276 1.00 20.14  ? 98  ALA E O     1 
ATOM 6023 C CB    . ALA F 3 99  ? 126.041 140.308 112.300 1.00 20.14  ? 98  ALA E CB    1 
ATOM 6024 N N     . TYR F 3 100 ? 123.536 138.769 110.604 1.00 19.30  ? 99  TYR E N     1 
ATOM 6025 C CA    . TYR F 3 100 ? 122.919 137.548 110.106 1.00 19.30  ? 99  TYR E CA    1 
ATOM 6026 C C     . TYR F 3 100 ? 122.765 137.588 108.593 1.00 19.30  ? 99  TYR E C     1 
ATOM 6027 O O     . TYR F 3 100 ? 123.060 136.605 107.908 1.00 19.30  ? 99  TYR E O     1 
ATOM 6028 C CB    . TYR F 3 100 ? 121.558 137.340 110.771 1.00 19.30  ? 99  TYR E CB    1 
ATOM 6029 C CG    . TYR F 3 100 ? 120.759 136.179 110.218 1.00 19.30  ? 99  TYR E CG    1 
ATOM 6030 C CD1   . TYR F 3 100 ? 121.107 134.867 110.508 1.00 19.30  ? 99  TYR E CD1   1 
ATOM 6031 C CD2   . TYR F 3 100 ? 119.653 136.397 109.412 1.00 19.30  ? 99  TYR E CD2   1 
ATOM 6032 C CE1   . TYR F 3 100 ? 120.377 133.808 110.004 1.00 19.30  ? 99  TYR E CE1   1 
ATOM 6033 C CE2   . TYR F 3 100 ? 118.922 135.348 108.906 1.00 19.30  ? 99  TYR E CE2   1 
ATOM 6034 C CZ    . TYR F 3 100 ? 119.287 134.057 109.204 1.00 19.30  ? 99  TYR E CZ    1 
ATOM 6035 O OH    . TYR F 3 100 ? 118.549 133.016 108.696 1.00 19.30  ? 99  TYR E OH    1 
ATOM 6036 N N     . LEU F 3 101 ? 122.294 138.713 108.054 1.00 18.22  ? 100 LEU E N     1 
ATOM 6037 C CA    . LEU F 3 101 ? 122.016 138.768 106.624 1.00 18.22  ? 100 LEU E CA    1 
ATOM 6038 C C     . LEU F 3 101 ? 123.295 138.756 105.794 1.00 18.22  ? 100 LEU E C     1 
ATOM 6039 O O     . LEU F 3 101 ? 123.321 138.160 104.715 1.00 18.22  ? 100 LEU E O     1 
ATOM 6040 C CB    . LEU F 3 101 ? 121.162 139.993 106.312 1.00 18.22  ? 100 LEU E CB    1 
ATOM 6041 C CG    . LEU F 3 101 ? 119.718 139.818 106.784 1.00 18.22  ? 100 LEU E CG    1 
ATOM 6042 C CD1   . LEU F 3 101 ? 118.912 141.088 106.624 1.00 18.22  ? 100 LEU E CD1   1 
ATOM 6043 C CD2   . LEU F 3 101 ? 119.052 138.679 106.034 1.00 18.22  ? 100 LEU E CD2   1 
ATOM 6044 N N     . VAL F 3 102 ? 124.365 139.415 106.252 1.00 17.73  ? 101 VAL E N     1 
ATOM 6045 C CA    . VAL F 3 102 ? 125.615 139.329 105.494 1.00 17.73  ? 101 VAL E CA    1 
ATOM 6046 C C     . VAL F 3 102 ? 126.161 137.906 105.519 1.00 17.73  ? 101 VAL E C     1 
ATOM 6047 O O     . VAL F 3 102 ? 126.632 137.388 104.498 1.00 17.73  ? 101 VAL E O     1 
ATOM 6048 C CB    . VAL F 3 102 ? 126.655 140.348 105.991 1.00 17.73  ? 101 VAL E CB    1 
ATOM 6049 C CG1   . VAL F 3 102 ? 127.609 140.676 104.884 1.00 17.73  ? 101 VAL E CG1   1 
ATOM 6050 C CG2   . VAL F 3 102 ? 125.991 141.633 106.357 1.00 17.73  ? 101 VAL E CG2   1 
ATOM 6051 N N     . GLY F 3 103 ? 126.073 137.235 106.669 1.00 17.48  ? 102 GLY E N     1 
ATOM 6052 C CA    . GLY F 3 103 ? 126.532 135.862 106.729 1.00 17.48  ? 102 GLY E CA    1 
ATOM 6053 C C     . GLY F 3 103 ? 125.633 134.915 105.975 1.00 17.48  ? 102 GLY E C     1 
ATOM 6054 O O     . GLY F 3 103 ? 126.051 133.800 105.649 1.00 17.48  ? 102 GLY E O     1 
ATOM 6055 N N     . LEU F 3 104 ? 124.402 135.337 105.697 1.00 17.15  ? 103 LEU E N     1 
ATOM 6056 C CA    . LEU F 3 104 ? 123.522 134.546 104.853 1.00 17.15  ? 103 LEU E CA    1 
ATOM 6057 C C     . LEU F 3 104 ? 123.831 134.773 103.382 1.00 17.15  ? 103 LEU E C     1 
ATOM 6058 O O     . LEU F 3 104 ? 123.878 133.816 102.605 1.00 17.15  ? 103 LEU E O     1 
ATOM 6059 C CB    . LEU F 3 104 ? 122.063 134.880 105.144 1.00 17.15  ? 103 LEU E CB    1 
ATOM 6060 C CG    . LEU F 3 104 ? 121.060 134.088 104.311 1.00 17.15  ? 103 LEU E CG    1 
ATOM 6061 C CD1   . LEU F 3 104 ? 121.150 132.604 104.615 1.00 17.15  ? 103 LEU E CD1   1 
ATOM 6062 C CD2   . LEU F 3 104 ? 119.663 134.600 104.559 1.00 17.15  ? 103 LEU E CD2   1 
ATOM 6063 N N     . PHE F 3 105 ? 124.112 136.016 102.991 1.00 16.72  ? 104 PHE E N     1 
ATOM 6064 C CA    . PHE F 3 105 ? 124.419 136.260 101.590 1.00 16.72  ? 104 PHE E CA    1 
ATOM 6065 C C     . PHE F 3 105 ? 125.821 135.819 101.224 1.00 16.72  ? 104 PHE E C     1 
ATOM 6066 O O     . PHE F 3 105 ? 126.091 135.609 100.039 1.00 16.72  ? 104 PHE E O     1 
ATOM 6067 C CB    . PHE F 3 105 ? 124.261 137.738 101.232 1.00 16.72  ? 104 PHE E CB    1 
ATOM 6068 C CG    . PHE F 3 105 ? 122.841 138.201 101.159 1.00 16.72  ? 104 PHE E CG    1 
ATOM 6069 C CD1   . PHE F 3 105 ? 122.008 137.744 100.158 1.00 16.72  ? 104 PHE E CD1   1 
ATOM 6070 C CD2   . PHE F 3 105 ? 122.353 139.126 102.056 1.00 16.72  ? 104 PHE E CD2   1 
ATOM 6071 C CE1   . PHE F 3 105 ? 120.707 138.177 100.077 1.00 16.72  ? 104 PHE E CE1   1 
ATOM 6072 C CE2   . PHE F 3 105 ? 121.054 139.563 101.978 1.00 16.72  ? 104 PHE E CE2   1 
ATOM 6073 C CZ    . PHE F 3 105 ? 120.230 139.088 100.988 1.00 16.72  ? 104 PHE E CZ    1 
ATOM 6074 N N     . GLU F 3 106 ? 126.653 135.501 102.210 1.00 17.64  ? 105 GLU E N     1 
ATOM 6075 C CA    . GLU F 3 106 ? 127.958 134.955 101.874 1.00 17.64  ? 105 GLU E CA    1 
ATOM 6076 C C     . GLU F 3 106 ? 127.840 133.489 101.495 1.00 17.64  ? 105 GLU E C     1 
ATOM 6077 O O     . GLU F 3 106 ? 128.628 133.005 100.678 1.00 17.64  ? 105 GLU E O     1 
ATOM 6078 C CB    . GLU F 3 106 ? 128.954 135.155 103.016 1.00 17.64  ? 105 GLU E CB    1 
ATOM 6079 C CG    . GLU F 3 106 ? 129.347 136.608 103.218 1.00 17.64  ? 105 GLU E CG    1 
ATOM 6080 C CD    . GLU F 3 106 ? 130.372 136.799 104.315 1.00 17.64  ? 105 GLU E CD    1 
ATOM 6081 O OE1   . GLU F 3 106 ? 130.024 137.384 105.362 1.00 17.64  ? 105 GLU E OE1   1 
ATOM 6082 O OE2   . GLU F 3 106 ? 131.529 136.371 104.125 1.00 17.64  ? 105 GLU E OE2   1 
ATOM 6083 N N     . ASP F 3 107 ? 126.871 132.768 102.065 1.00 17.15  ? 106 ASP E N     1 
ATOM 6084 C CA    . ASP F 3 107 ? 126.609 131.413 101.605 1.00 17.15  ? 106 ASP E CA    1 
ATOM 6085 C C     . ASP F 3 107 ? 125.660 131.375 100.415 1.00 17.15  ? 106 ASP E C     1 
ATOM 6086 O O     . ASP F 3 107 ? 125.732 130.434 99.615  1.00 17.15  ? 106 ASP E O     1 
ATOM 6087 C CB    . ASP F 3 107 ? 126.027 130.572 102.741 1.00 17.15  ? 106 ASP E CB    1 
ATOM 6088 C CG    . ASP F 3 107 ? 127.000 130.387 103.886 1.00 17.15  ? 106 ASP E CG    1 
ATOM 6089 O OD1   . ASP F 3 107 ? 128.224 130.421 103.642 1.00 17.15  ? 106 ASP E OD1   1 
ATOM 6090 O OD2   . ASP F 3 107 ? 126.540 130.206 105.032 1.00 17.15  ? 106 ASP E OD2   1 
ATOM 6091 N N     . THR F 3 108 ? 124.816 132.396 100.238 1.00 16.27  ? 107 THR E N     1 
ATOM 6092 C CA    . THR F 3 108 ? 124.006 132.446 99.025  1.00 16.27  ? 107 THR E CA    1 
ATOM 6093 C C     . THR F 3 108 ? 124.890 132.705 97.819  1.00 16.27  ? 107 THR E C     1 
ATOM 6094 O O     . THR F 3 108 ? 124.640 132.170 96.735  1.00 16.27  ? 107 THR E O     1 
ATOM 6095 C CB    . THR F 3 108 ? 122.895 133.495 99.105  1.00 16.27  ? 107 THR E CB    1 
ATOM 6096 O OG1   . THR F 3 108 ? 123.453 134.809 99.064  1.00 16.27  ? 107 THR E OG1   1 
ATOM 6097 C CG2   . THR F 3 108 ? 122.032 133.304 100.334 1.00 16.27  ? 107 THR E CG2   1 
ATOM 6098 N N     . ASN F 3 109 ? 125.932 133.526 97.982  1.00 15.70  ? 108 ASN E N     1 
ATOM 6099 C CA    . ASN F 3 109 ? 126.819 133.771 96.857  1.00 15.70  ? 108 ASN E CA    1 
ATOM 6100 C C     . ASN F 3 109 ? 127.645 132.533 96.550  1.00 15.70  ? 108 ASN E C     1 
ATOM 6101 O O     . ASN F 3 109 ? 127.994 132.295 95.391  1.00 15.70  ? 108 ASN E O     1 
ATOM 6102 C CB    . ASN F 3 109 ? 127.730 134.961 97.152  1.00 15.70  ? 108 ASN E CB    1 
ATOM 6103 C CG    . ASN F 3 109 ? 128.351 135.538 95.903  1.00 15.70  ? 108 ASN E CG    1 
ATOM 6104 O OD1   . ASN F 3 109 ? 128.022 135.132 94.792  1.00 15.70  ? 108 ASN E OD1   1 
ATOM 6105 N ND2   . ASN F 3 109 ? 129.262 136.484 96.076  1.00 15.70  ? 108 ASN E ND2   1 
ATOM 6106 N N     . LEU F 3 110 ? 127.898 131.693 97.556  1.00 15.35  ? 109 LEU E N     1 
ATOM 6107 C CA    . LEU F 3 110 ? 128.588 130.437 97.294  1.00 15.35  ? 109 LEU E CA    1 
ATOM 6108 C C     . LEU F 3 110 ? 127.665 129.471 96.570  1.00 15.35  ? 109 LEU E C     1 
ATOM 6109 O O     . LEU F 3 110 ? 128.101 128.733 95.679  1.00 15.35  ? 109 LEU E O     1 
ATOM 6110 C CB    . LEU F 3 110 ? 129.084 129.821 98.597  1.00 15.35  ? 109 LEU E CB    1 
ATOM 6111 C CG    . LEU F 3 110 ? 130.183 130.559 99.350  1.00 15.35  ? 109 LEU E CG    1 
ATOM 6112 C CD1   . LEU F 3 110 ? 130.426 129.877 100.674 1.00 15.35  ? 109 LEU E CD1   1 
ATOM 6113 C CD2   . LEU F 3 110 ? 131.458 130.599 98.532  1.00 15.35  ? 109 LEU E CD2   1 
ATOM 6114 N N     . CYS F 3 111 ? 126.376 129.495 96.908  1.00 15.60  ? 110 CYS E N     1 
ATOM 6115 C CA    . CYS F 3 111 ? 125.434 128.625 96.221  1.00 15.60  ? 110 CYS E CA    1 
ATOM 6116 C C     . CYS F 3 111 ? 125.118 129.127 94.825  1.00 15.60  ? 110 CYS E C     1 
ATOM 6117 O O     . CYS F 3 111 ? 124.697 128.336 93.977  1.00 15.60  ? 110 CYS E O     1 
ATOM 6118 C CB    . CYS F 3 111 ? 124.126 128.524 97.005  1.00 15.60  ? 110 CYS E CB    1 
ATOM 6119 S SG    . CYS F 3 111 ? 124.172 127.496 98.466  1.00 15.60  ? 110 CYS E SG    1 
ATOM 6120 N N     . ALA F 3 112 ? 125.312 130.418 94.568  1.00 14.81  ? 111 ALA E N     1 
ATOM 6121 C CA    . ALA F 3 112 ? 125.105 130.935 93.224  1.00 14.81  ? 111 ALA E CA    1 
ATOM 6122 C C     . ALA F 3 112 ? 126.332 130.715 92.353  1.00 14.81  ? 111 ALA E C     1 
ATOM 6123 O O     . ALA F 3 112 ? 126.202 130.449 91.154  1.00 14.81  ? 111 ALA E O     1 
ATOM 6124 C CB    . ALA F 3 112 ? 124.752 132.418 93.277  1.00 14.81  ? 111 ALA E CB    1 
ATOM 6125 N N     . ILE F 3 113 ? 127.531 130.814 92.933  1.00 14.81  ? 112 ILE E N     1 
ATOM 6126 C CA    . ILE F 3 113 ? 128.719 130.459 92.170  1.00 14.81  ? 112 ILE E CA    1 
ATOM 6127 C C     . ILE F 3 113 ? 128.738 128.964 91.904  1.00 14.81  ? 112 ILE E C     1 
ATOM 6128 O O     . ILE F 3 113 ? 129.252 128.515 90.874  1.00 14.81  ? 112 ILE E O     1 
ATOM 6129 C CB    . ILE F 3 113 ? 129.978 130.922 92.924  1.00 14.81  ? 112 ILE E CB    1 
ATOM 6130 C CG1   . ILE F 3 113 ? 130.031 132.446 92.980  1.00 14.81  ? 112 ILE E CG1   1 
ATOM 6131 C CG2   . ILE F 3 113 ? 131.237 130.387 92.268  1.00 14.81  ? 112 ILE E CG2   1 
ATOM 6132 C CD1   . ILE F 3 113 ? 131.094 132.975 93.908  1.00 14.81  ? 112 ILE E CD1   1 
ATOM 6133 N N     . HIS F 3 114 ? 128.165 128.171 92.812  1.00 15.16  ? 113 HIS E N     1 
ATOM 6134 C CA    . HIS F 3 114 ? 128.221 126.725 92.652  1.00 15.16  ? 113 HIS E CA    1 
ATOM 6135 C C     . HIS F 3 114 ? 127.442 126.260 91.433  1.00 15.16  ? 113 HIS E C     1 
ATOM 6136 O O     . HIS F 3 114 ? 127.775 125.230 90.839  1.00 15.16  ? 113 HIS E O     1 
ATOM 6137 C CB    . HIS F 3 114 ? 127.692 126.035 93.901  1.00 15.16  ? 113 HIS E CB    1 
ATOM 6138 C CG    . HIS F 3 114 ? 127.850 124.551 93.868  1.00 15.16  ? 113 HIS E CG    1 
ATOM 6139 N ND1   . HIS F 3 114 ? 126.892 123.720 93.332  1.00 15.16  ? 113 HIS E ND1   1 
ATOM 6140 C CD2   . HIS F 3 114 ? 128.855 123.749 94.286  1.00 15.16  ? 113 HIS E CD2   1 
ATOM 6141 C CE1   . HIS F 3 114 ? 127.298 122.469 93.426  1.00 15.16  ? 113 HIS E CE1   1 
ATOM 6142 N NE2   . HIS F 3 114 ? 128.485 122.457 94.004  1.00 15.16  ? 113 HIS E NE2   1 
ATOM 6143 N N     . ALA F 3 115 ? 126.416 127.008 91.039  1.00 15.68  ? 114 ALA E N     1 
ATOM 6144 C CA    . ALA F 3 115 ? 125.639 126.712 89.847  1.00 15.68  ? 114 ALA E CA    1 
ATOM 6145 C C     . ALA F 3 115 ? 126.183 127.396 88.606  1.00 15.68  ? 114 ALA E C     1 
ATOM 6146 O O     . ALA F 3 115 ? 125.494 127.425 87.581  1.00 15.68  ? 114 ALA E O     1 
ATOM 6147 C CB    . ALA F 3 115 ? 124.180 127.114 90.061  1.00 15.68  ? 114 ALA E CB    1 
ATOM 6148 N N     . LYS F 3 116 ? 127.387 127.961 88.684  1.00 16.40  ? 115 LYS E N     1 
ATOM 6149 C CA    . LYS F 3 116 ? 127.992 128.697 87.581  1.00 16.40  ? 115 LYS E CA    1 
ATOM 6150 C C     . LYS F 3 116 ? 127.100 129.875 87.190  1.00 16.40  ? 115 LYS E C     1 
ATOM 6151 O O     . LYS F 3 116 ? 126.693 130.034 86.039  1.00 16.40  ? 115 LYS E O     1 
ATOM 6152 C CB    . LYS F 3 116 ? 128.260 127.770 86.393  1.00 16.40  ? 115 LYS E CB    1 
ATOM 6153 C CG    . LYS F 3 116 ? 129.321 126.729 86.674  1.00 16.40  ? 115 LYS E CG    1 
ATOM 6154 C CD    . LYS F 3 116 ? 129.568 125.855 85.466  1.00 16.40  ? 115 LYS E CD    1 
ATOM 6155 C CE    . LYS F 3 116 ? 130.620 124.806 85.763  1.00 16.40  ? 115 LYS E CE    1 
ATOM 6156 N NZ    . LYS F 3 116 ? 130.867 123.946 84.578  1.00 16.40  ? 115 LYS E NZ    1 
ATOM 6157 N N     . ARG F 3 117 ? 126.804 130.703 88.188  1.00 16.45  ? 116 ARG E N     1 
ATOM 6158 C CA    . ARG F 3 117 ? 126.040 131.921 87.988  1.00 16.45  ? 116 ARG E CA    1 
ATOM 6159 C C     . ARG F 3 117 ? 126.681 133.052 88.775  1.00 16.45  ? 116 ARG E C     1 
ATOM 6160 O O     . ARG F 3 117 ? 127.578 132.845 89.595  1.00 16.45  ? 116 ARG E O     1 
ATOM 6161 C CB    . ARG F 3 117 ? 124.582 131.735 88.418  1.00 16.45  ? 116 ARG E CB    1 
ATOM 6162 C CG    . ARG F 3 117 ? 123.766 130.851 87.497  1.00 16.45  ? 116 ARG E CG    1 
ATOM 6163 C CD    . ARG F 3 117 ? 122.313 130.841 87.916  1.00 16.45  ? 116 ARG E CD    1 
ATOM 6164 N NE    . ARG F 3 117 ? 122.124 130.140 89.181  1.00 16.45  ? 116 ARG E NE    1 
ATOM 6165 C CZ    . ARG F 3 117 ? 121.712 130.721 90.301  1.00 16.45  ? 116 ARG E CZ    1 
ATOM 6166 N NH1   . ARG F 3 117 ? 121.440 132.016 90.312  1.00 16.45  ? 116 ARG E NH1   1 
ATOM 6167 N NH2   . ARG F 3 117 ? 121.564 130.008 91.408  1.00 16.45  ? 116 ARG E NH2   1 
ATOM 6168 N N     . VAL F 3 118 ? 126.207 134.262 88.505  1.00 16.81  ? 117 VAL E N     1 
ATOM 6169 C CA    . VAL F 3 118 ? 126.566 135.440 89.273  1.00 16.81  ? 117 VAL E CA    1 
ATOM 6170 C C     . VAL F 3 118 ? 125.365 136.001 90.021  1.00 16.81  ? 117 VAL E C     1 
ATOM 6171 O O     . VAL F 3 118 ? 125.483 136.412 91.176  1.00 16.81  ? 117 VAL E O     1 
ATOM 6172 C CB    . VAL F 3 118 ? 127.195 136.509 88.354  1.00 16.81  ? 117 VAL E CB    1 
ATOM 6173 C CG1   . VAL F 3 118 ? 127.519 137.760 89.138  1.00 16.81  ? 117 VAL E CG1   1 
ATOM 6174 C CG2   . VAL F 3 118 ? 128.435 135.959 87.681  1.00 16.81  ? 117 VAL E CG2   1 
ATOM 6175 N N     . THR F 3 119 ? 124.204 136.019 89.377  1.00 16.84  ? 118 THR E N     1 
ATOM 6176 C CA    . THR F 3 119 ? 122.992 136.500 90.019  1.00 16.84  ? 118 THR E CA    1 
ATOM 6177 C C     . THR F 3 119 ? 122.533 135.510 91.077  1.00 16.84  ? 118 THR E C     1 
ATOM 6178 O O     . THR F 3 119 ? 122.406 134.314 90.802  1.00 16.84  ? 118 THR E O     1 
ATOM 6179 C CB    . THR F 3 119 ? 121.893 136.680 88.976  1.00 16.84  ? 118 THR E CB    1 
ATOM 6180 O OG1   . THR F 3 119 ? 122.347 137.554 87.940  1.00 16.84  ? 118 THR E OG1   1 
ATOM 6181 C CG2   . THR F 3 119 ? 120.658 137.269 89.606  1.00 16.84  ? 118 THR E CG2   1 
ATOM 6182 N N     . ILE F 3 120 ? 122.283 135.996 92.285  1.00 16.52  ? 119 ILE E N     1 
ATOM 6183 C CA    . ILE F 3 120 ? 121.701 135.138 93.306  1.00 16.52  ? 119 ILE E CA    1 
ATOM 6184 C C     . ILE F 3 120 ? 120.193 135.100 93.112  1.00 16.52  ? 119 ILE E C     1 
ATOM 6185 O O     . ILE F 3 120 ? 119.568 136.093 92.734  1.00 16.52  ? 119 ILE E O     1 
ATOM 6186 C CB    . ILE F 3 120 ? 122.082 135.609 94.723  1.00 16.52  ? 119 ILE E CB    1 
ATOM 6187 C CG1   . ILE F 3 120 ? 121.521 137.002 95.008  1.00 16.52  ? 119 ILE E CG1   1 
ATOM 6188 C CG2   . ILE F 3 120 ? 123.584 135.563 94.915  1.00 16.52  ? 119 ILE E CG2   1 
ATOM 6189 C CD1   . ILE F 3 120 ? 121.631 137.417 96.457  1.00 16.52  ? 119 ILE E CD1   1 
ATOM 6190 N N     . MET F 3 121 ? 119.601 133.950 93.385  1.00 17.52  ? 120 MET E N     1 
ATOM 6191 C CA    . MET F 3 121 ? 118.184 133.697 93.175  1.00 17.52  ? 120 MET E CA    1 
ATOM 6192 C C     . MET F 3 121 ? 117.592 133.170 94.467  1.00 17.52  ? 120 MET E C     1 
ATOM 6193 O O     . MET F 3 121 ? 118.326 132.773 95.378  1.00 17.52  ? 120 MET E O     1 
ATOM 6194 C CB    . MET F 3 121 ? 117.981 132.705 92.020  1.00 17.52  ? 120 MET E CB    1 
ATOM 6195 C CG    . MET F 3 121 ? 118.240 133.334 90.666  1.00 17.52  ? 120 MET E CG    1 
ATOM 6196 S SD    . MET F 3 121 ? 117.943 132.228 89.284  1.00 17.52  ? 120 MET E SD    1 
ATOM 6197 C CE    . MET F 3 121 ? 118.366 133.303 87.919  1.00 17.52  ? 120 MET E CE    1 
ATOM 6198 N N     . PRO F 3 122 ? 116.261 133.155 94.597  1.00 17.19  ? 121 PRO E N     1 
ATOM 6199 C CA    . PRO F 3 122 ? 115.676 132.719 95.872  1.00 17.19  ? 121 PRO E CA    1 
ATOM 6200 C C     . PRO F 3 122 ? 115.944 131.264 96.174  1.00 17.19  ? 121 PRO E C     1 
ATOM 6201 O O     . PRO F 3 122 ? 115.917 130.873 97.349  1.00 17.19  ? 121 PRO E O     1 
ATOM 6202 C CB    . PRO F 3 122 ? 114.179 132.982 95.680  1.00 17.19  ? 121 PRO E CB    1 
ATOM 6203 C CG    . PRO F 3 122 ? 114.123 134.055 94.684  1.00 17.19  ? 121 PRO E CG    1 
ATOM 6204 C CD    . PRO F 3 122 ? 115.250 133.790 93.735  1.00 17.19  ? 121 PRO E CD    1 
ATOM 6205 N N     . LYS F 3 123 ? 116.279 130.462 95.168  1.00 17.09  ? 122 LYS E N     1 
ATOM 6206 C CA    . LYS F 3 123 ? 116.627 129.086 95.456  1.00 17.09  ? 122 LYS E CA    1 
ATOM 6207 C C     . LYS F 3 123 ? 118.009 128.986 96.071  1.00 17.09  ? 122 LYS E C     1 
ATOM 6208 O O     . LYS F 3 123 ? 118.306 127.989 96.734  1.00 17.09  ? 122 LYS E O     1 
ATOM 6209 C CB    . LYS F 3 123 ? 116.551 128.242 94.184  1.00 17.09  ? 122 LYS E CB    1 
ATOM 6210 C CG    . LYS F 3 123 ? 117.570 128.612 93.127  1.00 17.09  ? 122 LYS E CG    1 
ATOM 6211 C CD    . LYS F 3 123 ? 117.450 127.700 91.921  1.00 17.09  ? 122 LYS E CD    1 
ATOM 6212 C CE    . LYS F 3 123 ? 116.212 128.032 91.108  1.00 17.09  ? 122 LYS E CE    1 
ATOM 6213 N NZ    . LYS F 3 123 ? 116.149 127.259 89.838  1.00 17.09  ? 122 LYS E NZ    1 
ATOM 6214 N N     . ASP F 3 124 ? 118.796 130.060 96.006  1.00 16.89  ? 123 ASP E N     1 
ATOM 6215 C CA    . ASP F 3 124 ? 120.107 130.030 96.631  1.00 16.89  ? 123 ASP E CA    1 
ATOM 6216 C C     . ASP F 3 124 ? 119.988 130.344 98.110  1.00 16.89  ? 123 ASP E C     1 
ATOM 6217 O O     . ASP F 3 124 ? 120.675 129.729 98.932  1.00 16.89  ? 123 ASP E O     1 
ATOM 6218 C CB    . ASP F 3 124 ? 121.026 131.054 95.970  1.00 16.89  ? 123 ASP E CB    1 
ATOM 6219 C CG    . ASP F 3 124 ? 121.185 130.821 94.491  1.00 16.89  ? 123 ASP E CG    1 
ATOM 6220 O OD1   . ASP F 3 124 ? 120.996 129.676 94.050  1.00 16.89  ? 123 ASP E OD1   1 
ATOM 6221 O OD2   . ASP F 3 124 ? 121.491 131.786 93.764  1.00 16.89  ? 123 ASP E OD2   1 
ATOM 6222 N N     . ILE F 3 125 ? 119.059 131.230 98.470  1.00 16.92  ? 124 ILE E N     1 
ATOM 6223 C CA    . ILE F 3 125 ? 118.765 131.454 99.876  1.00 16.92  ? 124 ILE E CA    1 
ATOM 6224 C C     . ILE F 3 125 ? 118.091 130.227 100.462 1.00 16.92  ? 124 ILE E C     1 
ATOM 6225 O O     . ILE F 3 125 ? 118.369 129.829 101.600 1.00 16.92  ? 124 ILE E O     1 
ATOM 6226 C CB    . ILE F 3 125 ? 117.890 132.707 100.048 1.00 16.92  ? 124 ILE E CB    1 
ATOM 6227 C CG1   . ILE F 3 125 ? 118.602 133.943 99.508  1.00 16.92  ? 124 ILE E CG1   1 
ATOM 6228 C CG2   . ILE F 3 125 ? 117.539 132.914 101.504 1.00 16.92  ? 124 ILE E CG2   1 
ATOM 6229 C CD1   . ILE F 3 125 ? 117.722 135.163 99.453  1.00 16.92  ? 124 ILE E CD1   1 
ATOM 6230 N N     . GLN F 3 126 ? 117.222 129.580 99.681  1.00 17.20  ? 125 GLN E N     1 
ATOM 6231 C CA    . GLN F 3 126 ? 116.557 128.391 100.193 1.00 17.20  ? 125 GLN E CA    1 
ATOM 6232 C C     . GLN F 3 126 ? 117.524 127.229 100.361 1.00 17.20  ? 125 GLN E C     1 
ATOM 6233 O O     . GLN F 3 126 ? 117.400 126.463 101.323 1.00 17.20  ? 125 GLN E O     1 
ATOM 6234 C CB    . GLN F 3 126 ? 115.414 127.999 99.263  1.00 17.20  ? 125 GLN E CB    1 
ATOM 6235 C CG    . GLN F 3 126 ? 114.274 128.994 99.248  1.00 17.20  ? 125 GLN E CG    1 
ATOM 6236 C CD    . GLN F 3 126 ? 113.266 128.700 98.165  1.00 17.20  ? 125 GLN E CD    1 
ATOM 6237 O OE1   . GLN F 3 126 ? 113.448 127.782 97.367  1.00 17.20  ? 125 GLN E OE1   1 
ATOM 6238 N NE2   . GLN F 3 126 ? 112.199 129.487 98.120  1.00 17.20  ? 125 GLN E NE2   1 
ATOM 6239 N N     . LEU F 3 127 ? 118.551 127.134 99.513  1.00 16.18  ? 126 LEU E N     1 
ATOM 6240 C CA    . LEU F 3 127 ? 119.536 126.082 99.720  1.00 16.18  ? 126 LEU E CA    1 
ATOM 6241 C C     . LEU F 3 127 ? 120.456 126.416 100.885 1.00 16.18  ? 126 LEU E C     1 
ATOM 6242 O O     . LEU F 3 127 ? 120.791 125.538 101.691 1.00 16.18  ? 126 LEU E O     1 
ATOM 6243 C CB    . LEU F 3 127 ? 120.344 125.867 98.444  1.00 16.18  ? 126 LEU E CB    1 
ATOM 6244 C CG    . LEU F 3 127 ? 121.406 124.775 98.510  1.00 16.18  ? 126 LEU E CG    1 
ATOM 6245 C CD1   . LEU F 3 127 ? 120.745 123.433 98.736  1.00 16.18  ? 126 LEU E CD1   1 
ATOM 6246 C CD2   . LEU F 3 127 ? 122.245 124.756 97.255  1.00 16.18  ? 126 LEU E CD2   1 
ATOM 6247 N N     . ALA F 3 128 ? 120.850 127.685 101.015 1.00 17.03  ? 127 ALA E N     1 
ATOM 6248 C CA    . ALA F 3 128 ? 121.735 128.057 102.106 1.00 17.03  ? 127 ALA E CA    1 
ATOM 6249 C C     . ALA F 3 128 ? 121.035 127.987 103.451 1.00 17.03  ? 127 ALA E C     1 
ATOM 6250 O O     . ALA F 3 128 ? 121.708 127.887 104.481 1.00 17.03  ? 127 ALA E O     1 
ATOM 6251 C CB    . ALA F 3 128 ? 122.289 129.462 101.880 1.00 17.03  ? 127 ALA E CB    1 
ATOM 6252 N N     . ARG F 3 129 ? 119.703 128.027 103.468 1.00 18.31  ? 128 ARG E N     1 
ATOM 6253 C CA    . ARG F 3 129 ? 118.983 127.839 104.715 1.00 18.31  ? 128 ARG E CA    1 
ATOM 6254 C C     . ARG F 3 129 ? 118.581 126.397 104.964 1.00 18.31  ? 128 ARG E C     1 
ATOM 6255 O O     . ARG F 3 129 ? 118.410 126.015 106.126 1.00 18.31  ? 128 ARG E O     1 
ATOM 6256 C CB    . ARG F 3 129 ? 117.726 128.705 104.752 1.00 18.31  ? 128 ARG E CB    1 
ATOM 6257 C CG    . ARG F 3 129 ? 117.975 130.190 104.826 1.00 18.31  ? 128 ARG E CG    1 
ATOM 6258 C CD    . ARG F 3 129 ? 116.656 130.899 104.985 1.00 18.31  ? 128 ARG E CD    1 
ATOM 6259 N NE    . ARG F 3 129 ? 116.060 130.597 106.281 1.00 18.31  ? 128 ARG E NE    1 
ATOM 6260 C CZ    . ARG F 3 129 ? 114.805 130.876 106.610 1.00 18.31  ? 128 ARG E CZ    1 
ATOM 6261 N NH1   . ARG F 3 129 ? 114.001 131.458 105.734 1.00 18.31  ? 128 ARG E NH1   1 
ATOM 6262 N NH2   . ARG F 3 129 ? 114.350 130.564 107.813 1.00 18.31  ? 128 ARG E NH2   1 
ATOM 6263 N N     . ARG F 3 130 ? 118.425 125.582 103.919 1.00 18.61  ? 129 ARG E N     1 
ATOM 6264 C CA    . ARG F 3 130 ? 118.113 124.186 104.180 1.00 18.61  ? 129 ARG E CA    1 
ATOM 6265 C C     . ARG F 3 130 ? 119.357 123.416 104.591 1.00 18.61  ? 129 ARG E C     1 
ATOM 6266 O O     . ARG F 3 130 ? 119.268 122.500 105.415 1.00 18.61  ? 129 ARG E O     1 
ATOM 6267 C CB    . ARG F 3 130 ? 117.453 123.547 102.956 1.00 18.61  ? 129 ARG E CB    1 
ATOM 6268 C CG    . ARG F 3 130 ? 116.934 122.141 103.211 1.00 18.61  ? 129 ARG E CG    1 
ATOM 6269 C CD    . ARG F 3 130 ? 116.210 121.569 102.004 1.00 18.61  ? 129 ARG E CD    1 
ATOM 6270 N NE    . ARG F 3 130 ? 114.976 122.290 101.713 1.00 18.61  ? 129 ARG E NE    1 
ATOM 6271 C CZ    . ARG F 3 130 ? 114.753 122.970 100.593 1.00 18.61  ? 129 ARG E CZ    1 
ATOM 6272 N NH1   . ARG F 3 130 ? 115.684 123.023 99.650  1.00 18.61  ? 129 ARG E NH1   1 
ATOM 6273 N NH2   . ARG F 3 130 ? 113.599 123.599 100.415 1.00 18.61  ? 129 ARG E NH2   1 
ATOM 6274 N N     . ILE F 3 131 ? 120.520 123.766 104.037 1.00 17.47  ? 130 ILE E N     1 
ATOM 6275 C CA    . ILE F 3 131 ? 121.750 123.110 104.464 1.00 17.47  ? 130 ILE E CA    1 
ATOM 6276 C C     . ILE F 3 131 ? 122.107 123.524 105.882 1.00 17.47  ? 130 ILE E C     1 
ATOM 6277 O O     . ILE F 3 131 ? 122.583 122.713 106.683 1.00 17.47  ? 130 ILE E O     1 
ATOM 6278 C CB    . ILE F 3 131 ? 122.893 123.434 103.490 1.00 17.47  ? 130 ILE E CB    1 
ATOM 6279 C CG1   . ILE F 3 131 ? 122.587 122.883 102.108 1.00 17.47  ? 130 ILE E CG1   1 
ATOM 6280 C CG2   . ILE F 3 131 ? 124.203 122.864 103.993 1.00 17.47  ? 130 ILE E CG2   1 
ATOM 6281 C CD1   . ILE F 3 131 ? 123.543 123.382 101.091 1.00 17.47  ? 130 ILE E CD1   1 
ATOM 6282 N N     . ARG F 3 132 ? 121.867 124.791 106.217 1.00 18.85  ? 131 ARG E N     1 
ATOM 6283 C CA    . ARG F 3 132 ? 122.181 125.285 107.550 1.00 18.85  ? 131 ARG E CA    1 
ATOM 6284 C C     . ARG F 3 132 ? 121.243 124.717 108.605 1.00 18.85  ? 131 ARG E C     1 
ATOM 6285 O O     . ARG F 3 132 ? 121.630 124.593 109.771 1.00 18.85  ? 131 ARG E O     1 
ATOM 6286 C CB    . ARG F 3 132 ? 122.124 126.811 107.544 1.00 18.85  ? 131 ARG E CB    1 
ATOM 6287 C CG    . ARG F 3 132 ? 122.634 127.478 108.796 1.00 18.85  ? 131 ARG E CG    1 
ATOM 6288 C CD    . ARG F 3 132 ? 122.597 128.983 108.628 1.00 18.85  ? 131 ARG E CD    1 
ATOM 6289 N NE    . ARG F 3 132 ? 123.532 129.438 107.607 1.00 18.85  ? 131 ARG E NE    1 
ATOM 6290 C CZ    . ARG F 3 132 ? 123.643 130.700 107.207 1.00 18.85  ? 131 ARG E CZ    1 
ATOM 6291 N NH1   . ARG F 3 132 ? 122.878 131.637 107.747 1.00 18.85  ? 131 ARG E NH1   1 
ATOM 6292 N NH2   . ARG F 3 132 ? 124.521 131.025 106.272 1.00 18.85  ? 131 ARG E NH2   1 
ATOM 6293 N N     . GLY F 3 133 ? 120.021 124.361 108.222 1.00 19.19  ? 132 GLY E N     1 
ATOM 6294 C CA    . GLY F 3 133 ? 119.103 123.743 109.156 1.00 19.19  ? 132 GLY E CA    1 
ATOM 6295 C C     . GLY F 3 133 ? 118.035 124.713 109.611 1.00 19.19  ? 132 GLY E C     1 
ATOM 6296 O O     . GLY F 3 133 ? 117.691 124.759 110.795 1.00 19.19  ? 132 GLY E O     1 
ATOM 6297 N N     . GLU F 3 134 ? 117.503 125.492 108.677 1.00 20.09  ? 133 GLU E N     1 
ATOM 6298 C CA    . GLU F 3 134 ? 116.501 126.499 108.998 1.00 20.09  ? 133 GLU E CA    1 
ATOM 6299 C C     . GLU F 3 134 ? 115.202 126.259 108.241 1.00 20.09  ? 133 GLU E C     1 
ATOM 6300 O O     . GLU F 3 134 ? 114.190 126.906 108.510 1.00 20.09  ? 133 GLU E O     1 
ATOM 6301 C CB    . GLU F 3 134 ? 117.046 127.889 108.677 1.00 20.09  ? 133 GLU E CB    1 
ATOM 6302 C CG    . GLU F 3 134 ? 118.224 128.298 109.540 1.00 20.09  ? 133 GLU E CG    1 
ATOM 6303 C CD    . GLU F 3 134 ? 118.819 129.626 109.125 1.00 20.09  ? 133 GLU E CD    1 
ATOM 6304 O OE1   . GLU F 3 134 ? 118.408 130.161 108.075 1.00 20.09  ? 133 GLU E OE1   1 
ATOM 6305 O OE2   . GLU F 3 134 ? 119.706 130.134 109.842 1.00 20.09  ? 133 GLU E OE2   1 
ATOM 6306 N N     . ASN G 4 26  ? 105.492 147.644 108.930 1.00 20.79  ? 25  ASN F N     1 
ATOM 6307 C CA    . ASN G 4 26  ? 105.456 146.491 108.038 1.00 20.79  ? 25  ASN F CA    1 
ATOM 6308 C C     . ASN G 4 26  ? 106.853 145.955 107.781 1.00 20.79  ? 25  ASN F C     1 
ATOM 6309 O O     . ASN G 4 26  ? 107.844 146.581 108.151 1.00 20.79  ? 25  ASN F O     1 
ATOM 6310 C CB    . ASN G 4 26  ? 104.793 146.858 106.708 1.00 20.79  ? 25  ASN F CB    1 
ATOM 6311 C CG    . ASN G 4 26  ? 103.282 146.847 106.788 1.00 20.79  ? 25  ASN F CG    1 
ATOM 6312 O OD1   . ASN G 4 26  ? 102.689 145.967 107.409 1.00 20.79  ? 25  ASN F OD1   1 
ATOM 6313 N ND2   . ASN G 4 26  ? 102.649 147.826 106.154 1.00 20.79  ? 25  ASN F ND2   1 
ATOM 6314 N N     . ILE G 4 27  ? 106.927 144.786 107.141 1.00 20.39  ? 26  ILE F N     1 
ATOM 6315 C CA    . ILE G 4 27  ? 108.208 144.273 106.674 1.00 20.39  ? 26  ILE F CA    1 
ATOM 6316 C C     . ILE G 4 27  ? 108.728 145.044 105.473 1.00 20.39  ? 26  ILE F C     1 
ATOM 6317 O O     . ILE G 4 27  ? 109.907 144.923 105.129 1.00 20.39  ? 26  ILE F O     1 
ATOM 6318 C CB    . ILE G 4 27  ? 108.057 142.774 106.337 1.00 20.39  ? 26  ILE F CB    1 
ATOM 6319 C CG1   . ILE G 4 27  ? 109.414 142.090 106.178 1.00 20.39  ? 26  ILE F CG1   1 
ATOM 6320 C CG2   . ILE G 4 27  ? 107.217 142.591 105.086 1.00 20.39  ? 26  ILE F CG2   1 
ATOM 6321 C CD1   . ILE G 4 27  ? 110.224 142.004 107.431 1.00 20.39  ? 26  ILE F CD1   1 
ATOM 6322 N N     . GLN G 4 28  ? 107.879 145.852 104.836 1.00 20.17  ? 27  GLN F N     1 
ATOM 6323 C CA    . GLN G 4 28  ? 108.289 146.621 103.669 1.00 20.17  ? 27  GLN F CA    1 
ATOM 6324 C C     . GLN G 4 28  ? 109.292 147.716 103.999 1.00 20.17  ? 27  GLN F C     1 
ATOM 6325 O O     . GLN G 4 28  ? 109.812 148.347 103.074 1.00 20.17  ? 27  GLN F O     1 
ATOM 6326 C CB    . GLN G 4 28  ? 107.067 147.222 102.978 1.00 20.17  ? 27  GLN F CB    1 
ATOM 6327 C CG    . GLN G 4 28  ? 106.074 146.180 102.506 1.00 20.17  ? 27  GLN F CG    1 
ATOM 6328 C CD    . GLN G 4 28  ? 106.647 145.292 101.419 1.00 20.17  ? 27  GLN F CD    1 
ATOM 6329 O OE1   . GLN G 4 28  ? 107.378 145.755 100.545 1.00 20.17  ? 27  GLN F OE1   1 
ATOM 6330 N NE2   . GLN G 4 28  ? 106.323 144.007 101.475 1.00 20.17  ? 27  GLN F NE2   1 
ATOM 6331 N N     . GLY G 4 29  ? 109.575 147.966 105.279 1.00 19.47  ? 28  GLY F N     1 
ATOM 6332 C CA    . GLY G 4 29  ? 110.593 148.945 105.606 1.00 19.47  ? 28  GLY F CA    1 
ATOM 6333 C C     . GLY G 4 29  ? 111.994 148.468 105.314 1.00 19.47  ? 28  GLY F C     1 
ATOM 6334 O O     . GLY G 4 29  ? 112.913 149.287 105.218 1.00 19.47  ? 28  GLY F O     1 
ATOM 6335 N N     . ILE G 4 30  ? 112.179 147.158 105.175 1.00 18.81  ? 29  ILE F N     1 
ATOM 6336 C CA    . ILE G 4 30  ? 113.452 146.603 104.745 1.00 18.81  ? 29  ILE F CA    1 
ATOM 6337 C C     . ILE G 4 30  ? 113.483 146.775 103.237 1.00 18.81  ? 29  ILE F C     1 
ATOM 6338 O O     . ILE G 4 30  ? 113.013 145.909 102.492 1.00 18.81  ? 29  ILE F O     1 
ATOM 6339 C CB    . ILE G 4 30  ? 113.606 145.133 105.161 1.00 18.81  ? 29  ILE F CB    1 
ATOM 6340 C CG1   . ILE G 4 30  ? 113.265 144.975 106.640 1.00 18.81  ? 29  ILE F CG1   1 
ATOM 6341 C CG2   . ILE G 4 30  ? 115.016 144.655 104.890 1.00 18.81  ? 29  ILE F CG2   1 
ATOM 6342 C CD1   . ILE G 4 30  ? 114.157 145.765 107.557 1.00 18.81  ? 29  ILE F CD1   1 
ATOM 6343 N N     . THR G 4 31  ? 114.032 147.891 102.778 1.00 19.21  ? 30  THR F N     1 
ATOM 6344 C CA    . THR G 4 31  ? 113.813 148.336 101.414 1.00 19.21  ? 30  THR F CA    1 
ATOM 6345 C C     . THR G 4 31  ? 114.683 147.550 100.441 1.00 19.21  ? 30  THR F C     1 
ATOM 6346 O O     . THR G 4 31  ? 115.498 146.707 100.821 1.00 19.21  ? 30  THR F O     1 
ATOM 6347 C CB    . THR G 4 31  ? 114.088 149.831 101.295 1.00 19.21  ? 30  THR F CB    1 
ATOM 6348 O OG1   . THR G 4 31  ? 115.423 150.106 101.733 1.00 19.21  ? 30  THR F OG1   1 
ATOM 6349 C CG2   . THR G 4 31  ? 113.117 150.615 102.151 1.00 19.21  ? 30  THR F CG2   1 
ATOM 6350 N N     . LYS G 4 32  ? 114.485 147.828 99.157  1.00 19.09  ? 31  LYS F N     1 
ATOM 6351 C CA    . LYS G 4 32  ? 115.286 147.181 98.121  1.00 19.09  ? 31  LYS F CA    1 
ATOM 6352 C C     . LYS G 4 32  ? 116.760 147.548 98.211  1.00 19.09  ? 31  LYS F C     1 
ATOM 6353 O O     . LYS G 4 32  ? 117.603 146.633 98.165  1.00 19.09  ? 31  LYS F O     1 
ATOM 6354 C CB    . LYS G 4 32  ? 114.706 147.531 96.747  1.00 19.09  ? 31  LYS F CB    1 
ATOM 6355 C CG    . LYS G 4 32  ? 115.549 147.072 95.577  1.00 19.09  ? 31  LYS F CG    1 
ATOM 6356 C CD    . LYS G 4 32  ? 114.906 147.457 94.257  1.00 19.09  ? 31  LYS F CD    1 
ATOM 6357 C CE    . LYS G 4 32  ? 115.802 147.104 93.082  1.00 19.09  ? 31  LYS F CE    1 
ATOM 6358 N NZ    . LYS G 4 32  ? 115.159 147.416 91.776  1.00 19.09  ? 31  LYS F NZ    1 
ATOM 6359 N N     . PRO G 4 33  ? 117.153 148.817 98.376  1.00 19.14  ? 32  PRO F N     1 
ATOM 6360 C CA    . PRO G 4 33  ? 118.588 149.108 98.429  1.00 19.14  ? 32  PRO F CA    1 
ATOM 6361 C C     . PRO G 4 33  ? 119.237 148.776 99.757  1.00 19.14  ? 32  PRO F C     1 
ATOM 6362 O O     . PRO G 4 33  ? 120.464 148.647 99.794  1.00 19.14  ? 32  PRO F O     1 
ATOM 6363 C CB    . PRO G 4 33  ? 118.644 150.614 98.156  1.00 19.14  ? 32  PRO F CB    1 
ATOM 6364 C CG    . PRO G 4 33  ? 117.368 151.116 98.652  1.00 19.14  ? 32  PRO F CG    1 
ATOM 6365 C CD    . PRO G 4 33  ? 116.361 150.059 98.342  1.00 19.14  ? 32  PRO F CD    1 
ATOM 6366 N N     . ALA G 4 34  ? 118.476 148.528 100.822 1.00 18.27  ? 33  ALA F N     1 
ATOM 6367 C CA    . ALA G 4 34  ? 119.125 148.066 102.042 1.00 18.27  ? 33  ALA F CA    1 
ATOM 6368 C C     . ALA G 4 34  ? 119.481 146.590 101.948 1.00 18.27  ? 33  ALA F C     1 
ATOM 6369 O O     . ALA G 4 34  ? 120.561 146.173 102.387 1.00 18.27  ? 33  ALA F O     1 
ATOM 6370 C CB    . ALA G 4 34  ? 118.222 148.320 103.247 1.00 18.27  ? 33  ALA F CB    1 
ATOM 6371 N N     . ILE G 4 35  ? 118.631 145.803 101.288 1.00 17.58  ? 34  ILE F N     1 
ATOM 6372 C CA    . ILE G 4 35  ? 119.002 144.426 101.010 1.00 17.58  ? 34  ILE F CA    1 
ATOM 6373 C C     . ILE G 4 35  ? 120.121 144.397 99.989  1.00 17.58  ? 34  ILE F C     1 
ATOM 6374 O O     . ILE G 4 35  ? 121.015 143.543 100.055 1.00 17.58  ? 34  ILE F O     1 
ATOM 6375 C CB    . ILE G 4 35  ? 117.771 143.635 100.533 1.00 17.58  ? 34  ILE F CB    1 
ATOM 6376 C CG1   . ILE G 4 35  ? 116.703 143.617 101.622 1.00 17.58  ? 34  ILE F CG1   1 
ATOM 6377 C CG2   . ILE G 4 35  ? 118.153 142.223 100.142 1.00 17.58  ? 34  ILE F CG2   1 
ATOM 6378 C CD1   . ILE G 4 35  ? 115.377 143.091 101.156 1.00 17.58  ? 34  ILE F CD1   1 
ATOM 6379 N N     . ARG G 4 36  ? 120.129 145.353 99.059  1.00 18.44  ? 35  ARG F N     1 
ATOM 6380 C CA    . ARG G 4 36  ? 121.222 145.387 98.100  1.00 18.44  ? 35  ARG F CA    1 
ATOM 6381 C C     . ARG G 4 36  ? 122.538 145.757 98.772  1.00 18.44  ? 35  ARG F C     1 
ATOM 6382 O O     . ARG G 4 36  ? 123.585 145.229 98.396  1.00 18.44  ? 35  ARG F O     1 
ATOM 6383 C CB    . ARG G 4 36  ? 120.899 146.350 96.966  1.00 18.44  ? 35  ARG F CB    1 
ATOM 6384 C CG    . ARG G 4 36  ? 121.939 146.365 95.876  1.00 18.44  ? 35  ARG F CG    1 
ATOM 6385 C CD    . ARG G 4 36  ? 121.598 147.389 94.827  1.00 18.44  ? 35  ARG F CD    1 
ATOM 6386 N NE    . ARG G 4 36  ? 120.371 147.024 94.135  1.00 18.44  ? 35  ARG F NE    1 
ATOM 6387 C CZ    . ARG G 4 36  ? 120.327 146.208 93.090  1.00 18.44  ? 35  ARG F CZ    1 
ATOM 6388 N NH1   . ARG G 4 36  ? 121.446 145.679 92.618  1.00 18.44  ? 35  ARG F NH1   1 
ATOM 6389 N NH2   . ARG G 4 36  ? 119.167 145.924 92.515  1.00 18.44  ? 35  ARG F NH2   1 
ATOM 6390 N N     . ARG G 4 37  ? 122.507 146.630 99.784  1.00 18.40  ? 36  ARG F N     1 
ATOM 6391 C CA    . ARG G 4 37  ? 123.734 146.957 100.502 1.00 18.40  ? 36  ARG F CA    1 
ATOM 6392 C C     . ARG G 4 37  ? 124.197 145.796 101.366 1.00 18.40  ? 36  ARG F C     1 
ATOM 6393 O O     . ARG G 4 37  ? 125.405 145.561 101.496 1.00 18.40  ? 36  ARG F O     1 
ATOM 6394 C CB    . ARG G 4 37  ? 123.529 148.196 101.369 1.00 18.40  ? 36  ARG F CB    1 
ATOM 6395 C CG    . ARG G 4 37  ? 123.410 149.488 100.597 1.00 18.40  ? 36  ARG F CG    1 
ATOM 6396 C CD    . ARG G 4 37  ? 123.455 150.674 101.534 1.00 18.40  ? 36  ARG F CD    1 
ATOM 6397 N NE    . ARG G 4 37  ? 122.291 150.708 102.412 1.00 18.40  ? 36  ARG F NE    1 
ATOM 6398 C CZ    . ARG G 4 37  ? 121.171 151.362 102.135 1.00 18.40  ? 36  ARG F CZ    1 
ATOM 6399 N NH1   . ARG G 4 37  ? 121.062 152.040 101.003 1.00 18.40  ? 36  ARG F NH1   1 
ATOM 6400 N NH2   . ARG G 4 37  ? 120.159 151.338 102.988 1.00 18.40  ? 36  ARG F NH2   1 
ATOM 6401 N N     . LEU G 4 38  ? 123.258 145.004 101.885 1.00 17.60  ? 37  LEU F N     1 
ATOM 6402 C CA    . LEU G 4 38  ? 123.660 143.835 102.654 1.00 17.60  ? 37  LEU F CA    1 
ATOM 6403 C C     . LEU G 4 38  ? 124.246 142.768 101.747 1.00 17.60  ? 37  LEU F C     1 
ATOM 6404 O O     . LEU G 4 38  ? 125.152 142.032 102.155 1.00 17.60  ? 37  LEU F O     1 
ATOM 6405 C CB    . LEU G 4 38  ? 122.473 143.291 103.442 1.00 17.60  ? 37  LEU F CB    1 
ATOM 6406 C CG    . LEU G 4 38  ? 122.071 144.181 104.613 1.00 17.60  ? 37  LEU F CG    1 
ATOM 6407 C CD1   . LEU G 4 38  ? 120.733 143.767 105.169 1.00 17.60  ? 37  LEU F CD1   1 
ATOM 6408 C CD2   . LEU G 4 38  ? 123.134 144.104 105.680 1.00 17.60  ? 37  LEU F CD2   1 
ATOM 6409 N N     . ALA G 4 39  ? 123.788 142.705 100.499 1.00 17.55  ? 38  ALA F N     1 
ATOM 6410 C CA    . ALA G 4 39  ? 124.340 141.717 99.585  1.00 17.55  ? 38  ALA F CA    1 
ATOM 6411 C C     . ALA G 4 39  ? 125.671 142.192 99.020  1.00 17.55  ? 38  ALA F C     1 
ATOM 6412 O O     . ALA G 4 39  ? 126.558 141.372 98.766  1.00 17.55  ? 38  ALA F O     1 
ATOM 6413 C CB    . ALA G 4 39  ? 123.352 141.420 98.461  1.00 17.55  ? 38  ALA F CB    1 
ATOM 6414 N N     . ARG G 4 40  ? 125.830 143.504 98.827  1.00 18.26  ? 39  ARG F N     1 
ATOM 6415 C CA    . ARG G 4 40  ? 127.114 144.041 98.397  1.00 18.26  ? 39  ARG F CA    1 
ATOM 6416 C C     . ARG G 4 40  ? 128.165 143.875 99.483  1.00 18.26  ? 39  ARG F C     1 
ATOM 6417 O O     . ARG G 4 40  ? 129.344 143.678 99.175  1.00 18.26  ? 39  ARG F O     1 
ATOM 6418 C CB    . ARG G 4 40  ? 126.985 145.517 98.020  1.00 18.26  ? 39  ARG F CB    1 
ATOM 6419 C CG    . ARG G 4 40  ? 126.140 145.813 96.793  1.00 18.26  ? 39  ARG F CG    1 
ATOM 6420 C CD    . ARG G 4 40  ? 126.812 145.363 95.511  1.00 18.26  ? 39  ARG F CD    1 
ATOM 6421 N NE    . ARG G 4 40  ? 126.100 145.863 94.338  1.00 18.26  ? 39  ARG F NE    1 
ATOM 6422 C CZ    . ARG G 4 40  ? 125.104 145.223 93.735  1.00 18.26  ? 39  ARG F CZ    1 
ATOM 6423 N NH1   . ARG G 4 40  ? 124.691 144.051 94.194  1.00 18.26  ? 39  ARG F NH1   1 
ATOM 6424 N NH2   . ARG G 4 40  ? 124.516 145.759 92.675  1.00 18.26  ? 39  ARG F NH2   1 
ATOM 6425 N N     . ARG G 4 41  ? 127.761 143.940 100.754 1.00 17.79  ? 40  ARG F N     1 
ATOM 6426 C CA    . ARG G 4 41  ? 128.710 143.649 101.820 1.00 17.79  ? 40  ARG F CA    1 
ATOM 6427 C C     . ARG G 4 41  ? 128.934 142.152 101.953 1.00 17.79  ? 40  ARG F C     1 
ATOM 6428 O O     . ARG G 4 41  ? 130.003 141.724 102.398 1.00 17.79  ? 40  ARG F O     1 
ATOM 6429 C CB    . ARG G 4 41  ? 128.243 144.243 103.149 1.00 17.79  ? 40  ARG F CB    1 
ATOM 6430 C CG    . ARG G 4 41  ? 129.278 144.093 104.252 1.00 17.79  ? 40  ARG F CG    1 
ATOM 6431 C CD    . ARG G 4 41  ? 128.897 144.805 105.533 1.00 17.79  ? 40  ARG F CD    1 
ATOM 6432 N NE    . ARG G 4 41  ? 128.998 146.254 105.405 1.00 17.79  ? 40  ARG F NE    1 
ATOM 6433 C CZ    . ARG G 4 41  ? 128.620 147.111 106.346 1.00 17.79  ? 40  ARG F CZ    1 
ATOM 6434 N NH1   . ARG G 4 41  ? 128.113 146.663 107.486 1.00 17.79  ? 40  ARG F NH1   1 
ATOM 6435 N NH2   . ARG G 4 41  ? 128.749 148.415 106.150 1.00 17.79  ? 40  ARG F NH2   1 
ATOM 6436 N N     . GLY G 4 42  ? 127.949 141.346 101.566 1.00 17.49  ? 41  GLY F N     1 
ATOM 6437 C CA    . GLY G 4 42  ? 128.138 139.910 101.558 1.00 17.49  ? 41  GLY F CA    1 
ATOM 6438 C C     . GLY G 4 42  ? 129.003 139.412 100.421 1.00 17.49  ? 41  GLY F C     1 
ATOM 6439 O O     . GLY G 4 42  ? 129.428 138.253 100.448 1.00 17.49  ? 41  GLY F O     1 
ATOM 6440 N N     . GLY G 4 43  ? 129.271 140.255 99.430  1.00 17.13  ? 42  GLY F N     1 
ATOM 6441 C CA    . GLY G 4 43  ? 130.088 139.877 98.303  1.00 17.13  ? 42  GLY F CA    1 
ATOM 6442 C C     . GLY G 4 43  ? 129.318 139.507 97.060  1.00 17.13  ? 42  GLY F C     1 
ATOM 6443 O O     . GLY G 4 43  ? 129.913 138.963 96.125  1.00 17.13  ? 42  GLY F O     1 
ATOM 6444 N N     . VAL G 4 44  ? 128.022 139.785 97.017  1.00 16.50  ? 43  VAL F N     1 
ATOM 6445 C CA    . VAL G 4 44  ? 127.207 139.446 95.860  1.00 16.50  ? 43  VAL F CA    1 
ATOM 6446 C C     . VAL G 4 44  ? 127.344 140.535 94.808  1.00 16.50  ? 43  VAL F C     1 
ATOM 6447 O O     . VAL G 4 44  ? 127.245 141.728 95.112  1.00 16.50  ? 43  VAL F O     1 
ATOM 6448 C CB    . VAL G 4 44  ? 125.740 139.266 96.275  1.00 16.50  ? 43  VAL F CB    1 
ATOM 6449 C CG1   . VAL G 4 44  ? 124.879 138.986 95.064  1.00 16.50  ? 43  VAL F CG1   1 
ATOM 6450 C CG2   . VAL G 4 44  ? 125.616 138.157 97.301  1.00 16.50  ? 43  VAL F CG2   1 
ATOM 6451 N N     . LYS G 4 45  ? 127.573 140.123 93.563  1.00 17.16  ? 44  LYS F N     1 
ATOM 6452 C CA    . LYS G 4 45  ? 127.781 141.070 92.477  1.00 17.16  ? 44  LYS F CA    1 
ATOM 6453 C C     . LYS G 4 45  ? 126.468 141.497 91.838  1.00 17.16  ? 44  LYS F C     1 
ATOM 6454 O O     . LYS G 4 45  ? 126.302 142.668 91.484  1.00 17.16  ? 44  LYS F O     1 
ATOM 6455 C CB    . LYS G 4 45  ? 128.709 140.467 91.423  1.00 17.16  ? 44  LYS F CB    1 
ATOM 6456 C CG    . LYS G 4 45  ? 130.099 140.155 91.942  1.00 17.16  ? 44  LYS F CG    1 
ATOM 6457 C CD    . LYS G 4 45  ? 130.676 141.343 92.695  1.00 17.16  ? 44  LYS F CD    1 
ATOM 6458 C CE    . LYS G 4 45  ? 132.041 141.025 93.279  1.00 17.16  ? 44  LYS F CE    1 
ATOM 6459 N NZ    . LYS G 4 45  ? 132.589 142.182 94.040  1.00 17.16  ? 44  LYS F NZ    1 
ATOM 6460 N N     . ARG G 4 46  ? 125.533 140.564 91.681  1.00 18.36  ? 45  ARG F N     1 
ATOM 6461 C CA    . ARG G 4 46  ? 124.286 140.820 90.980  1.00 18.36  ? 45  ARG F CA    1 
ATOM 6462 C C     . ARG G 4 46  ? 123.166 140.095 91.709  1.00 18.36  ? 45  ARG F C     1 
ATOM 6463 O O     . ARG G 4 46  ? 123.356 138.976 92.191  1.00 18.36  ? 45  ARG F O     1 
ATOM 6464 C CB    . ARG G 4 46  ? 124.389 140.362 89.521  1.00 18.36  ? 45  ARG F CB    1 
ATOM 6465 C CG    . ARG G 4 46  ? 123.219 140.736 88.639  1.00 18.36  ? 45  ARG F CG    1 
ATOM 6466 C CD    . ARG G 4 46  ? 123.472 140.290 87.211  1.00 18.36  ? 45  ARG F CD    1 
ATOM 6467 N NE    . ARG G 4 46  ? 124.540 141.052 86.578  1.00 18.36  ? 45  ARG F NE    1 
ATOM 6468 C CZ    . ARG G 4 46  ? 124.345 142.132 85.831  1.00 18.36  ? 45  ARG F CZ    1 
ATOM 6469 N NH1   . ARG G 4 46  ? 123.116 142.568 85.601  1.00 18.36  ? 45  ARG F NH1   1 
ATOM 6470 N NH2   . ARG G 4 46  ? 125.380 142.765 85.298  1.00 18.36  ? 45  ARG F NH2   1 
ATOM 6471 N N     . ILE G 4 47  ? 122.004 140.737 91.797  1.00 17.75  ? 46  ILE F N     1 
ATOM 6472 C CA    . ILE G 4 47  ? 120.898 140.275 92.628  1.00 17.75  ? 46  ILE F CA    1 
ATOM 6473 C C     . ILE G 4 47  ? 119.673 140.093 91.746  1.00 17.75  ? 46  ILE F C     1 
ATOM 6474 O O     . ILE G 4 47  ? 119.345 140.978 90.949  1.00 17.75  ? 46  ILE F O     1 
ATOM 6475 C CB    . ILE G 4 47  ? 120.599 141.266 93.765  1.00 17.75  ? 46  ILE F CB    1 
ATOM 6476 C CG1   . ILE G 4 47  ? 121.850 141.498 94.605  1.00 17.75  ? 46  ILE F CG1   1 
ATOM 6477 C CG2   . ILE G 4 47  ? 119.477 140.754 94.636  1.00 17.75  ? 46  ILE F CG2   1 
ATOM 6478 C CD1   . ILE G 4 47  ? 121.738 142.672 95.522  1.00 17.75  ? 46  ILE F CD1   1 
ATOM 6479 N N     . SER G 4 48  ? 118.996 138.956 91.885  1.00 17.95  ? 47  SER F N     1 
ATOM 6480 C CA    . SER G 4 48  ? 117.778 138.764 91.118  1.00 17.95  ? 47  SER F CA    1 
ATOM 6481 C C     . SER G 4 48  ? 116.649 139.614 91.693  1.00 17.95  ? 47  SER F C     1 
ATOM 6482 O O     . SER G 4 48  ? 116.744 140.168 92.790  1.00 17.95  ? 47  SER F O     1 
ATOM 6483 C CB    . SER G 4 48  ? 117.370 137.294 91.106  1.00 17.95  ? 47  SER F CB    1 
ATOM 6484 O OG    . SER G 4 48  ? 116.115 137.126 90.476  1.00 17.95  ? 47  SER F OG    1 
ATOM 6485 N N     . GLY G 4 49  ? 115.564 139.714 90.933  1.00 18.15  ? 48  GLY F N     1 
ATOM 6486 C CA    . GLY G 4 49  ? 114.463 140.551 91.351  1.00 18.15  ? 48  GLY F CA    1 
ATOM 6487 C C     . GLY G 4 49  ? 113.522 139.925 92.347  1.00 18.15  ? 48  GLY F C     1 
ATOM 6488 O O     . GLY G 4 49  ? 112.533 140.553 92.732  1.00 18.15  ? 48  GLY F O     1 
ATOM 6489 N N     . LEU G 4 50  ? 113.804 138.702 92.786  1.00 17.02  ? 49  LEU F N     1 
ATOM 6490 C CA    . LEU G 4 50  ? 112.972 137.999 93.748  1.00 17.02  ? 49  LEU F CA    1 
ATOM 6491 C C     . LEU G 4 50  ? 113.677 137.754 95.071  1.00 17.02  ? 49  LEU F C     1 
ATOM 6492 O O     . LEU G 4 50  ? 113.067 137.200 95.989  1.00 17.02  ? 49  LEU F O     1 
ATOM 6493 C CB    . LEU G 4 50  ? 112.506 136.665 93.158  1.00 17.02  ? 49  LEU F CB    1 
ATOM 6494 C CG    . LEU G 4 50  ? 111.617 136.711 91.918  1.00 17.02  ? 49  LEU F CG    1 
ATOM 6495 C CD1   . LEU G 4 50  ? 111.438 135.315 91.364  1.00 17.02  ? 49  LEU F CD1   1 
ATOM 6496 C CD2   . LEU G 4 50  ? 110.271 137.329 92.244  1.00 17.02  ? 49  LEU F CD2   1 
ATOM 6497 N N     . ILE G 4 51  ? 114.948 138.139 95.190  1.00 17.21  ? 50  ILE F N     1 
ATOM 6498 C CA    . ILE G 4 51  ? 115.636 138.068 96.474  1.00 17.21  ? 50  ILE F CA    1 
ATOM 6499 C C     . ILE G 4 51  ? 114.990 138.988 97.493  1.00 17.21  ? 50  ILE F C     1 
ATOM 6500 O O     . ILE G 4 51  ? 115.036 138.721 98.698  1.00 17.21  ? 50  ILE F O     1 
ATOM 6501 C CB    . ILE G 4 51  ? 117.126 138.415 96.288  1.00 17.21  ? 50  ILE F CB    1 
ATOM 6502 C CG1   . ILE G 4 51  ? 117.780 137.442 95.324  1.00 17.21  ? 50  ILE F CG1   1 
ATOM 6503 C CG2   . ILE G 4 51  ? 117.867 138.375 97.608  1.00 17.21  ? 50  ILE F CG2   1 
ATOM 6504 C CD1   . ILE G 4 51  ? 117.760 136.052 95.843  1.00 17.21  ? 50  ILE F CD1   1 
ATOM 6505 N N     . TYR G 4 52  ? 114.390 140.084 97.039  1.00 17.70  ? 51  TYR F N     1 
ATOM 6506 C CA    . TYR G 4 52  ? 113.977 141.119 97.975  1.00 17.70  ? 51  TYR F CA    1 
ATOM 6507 C C     . TYR G 4 52  ? 112.855 140.648 98.894  1.00 17.70  ? 51  TYR F C     1 
ATOM 6508 O O     . TYR G 4 52  ? 112.858 140.967 100.087 1.00 17.70  ? 51  TYR F O     1 
ATOM 6509 C CB    . TYR G 4 52  ? 113.564 142.346 97.175  1.00 17.70  ? 51  TYR F CB    1 
ATOM 6510 C CG    . TYR G 4 52  ? 114.712 142.897 96.368  1.00 17.70  ? 51  TYR F CG    1 
ATOM 6511 C CD1   . TYR G 4 52  ? 116.012 142.828 96.841  1.00 17.70  ? 51  TYR F CD1   1 
ATOM 6512 C CD2   . TYR G 4 52  ? 114.507 143.400 95.097  1.00 17.70  ? 51  TYR F CD2   1 
ATOM 6513 C CE1   . TYR G 4 52  ? 117.063 143.304 96.099  1.00 17.70  ? 51  TYR F CE1   1 
ATOM 6514 C CE2   . TYR G 4 52  ? 115.554 143.870 94.344  1.00 17.70  ? 51  TYR F CE2   1 
ATOM 6515 C CZ    . TYR G 4 52  ? 116.829 143.822 94.850  1.00 17.70  ? 51  TYR F CZ    1 
ATOM 6516 O OH    . TYR G 4 52  ? 117.877 144.296 94.100  1.00 17.70  ? 51  TYR F OH    1 
ATOM 6517 N N     . GLU G 4 53  ? 111.892 139.884 98.373  1.00 18.73  ? 52  GLU F N     1 
ATOM 6518 C CA    . GLU G 4 53  ? 110.838 139.358 99.236  1.00 18.73  ? 52  GLU F CA    1 
ATOM 6519 C C     . GLU G 4 53  ? 111.248 138.100 99.985  1.00 18.73  ? 52  GLU F C     1 
ATOM 6520 O O     . GLU G 4 53  ? 110.614 137.764 100.989 1.00 18.73  ? 52  GLU F O     1 
ATOM 6521 C CB    . GLU G 4 53  ? 109.538 139.136 98.468  1.00 18.73  ? 52  GLU F CB    1 
ATOM 6522 C CG    . GLU G 4 53  ? 108.882 140.453 98.082  1.00 18.73  ? 52  GLU F CG    1 
ATOM 6523 C CD    . GLU G 4 53  ? 107.462 140.293 97.586  1.00 18.73  ? 52  GLU F CD    1 
ATOM 6524 O OE1   . GLU G 4 53  ? 106.746 141.314 97.503  1.00 18.73  ? 52  GLU F OE1   1 
ATOM 6525 O OE2   . GLU G 4 53  ? 107.054 139.150 97.298  1.00 18.73  ? 52  GLU F OE2   1 
ATOM 6526 N N     . GLU G 4 54  ? 112.289 137.400 99.533  1.00 17.85  ? 53  GLU F N     1 
ATOM 6527 C CA    . GLU G 4 54  ? 112.736 136.227 100.272 1.00 17.85  ? 53  GLU F CA    1 
ATOM 6528 C C     . GLU G 4 54  ? 113.586 136.656 101.455 1.00 17.85  ? 53  GLU F C     1 
ATOM 6529 O O     . GLU G 4 54  ? 113.544 136.022 102.515 1.00 17.85  ? 53  GLU F O     1 
ATOM 6530 C CB    . GLU G 4 54  ? 113.509 135.277 99.357  1.00 17.85  ? 53  GLU F CB    1 
ATOM 6531 C CG    . GLU G 4 54  ? 112.914 133.867 98.987  1.00 17.85  ? 53  GLU F CG    1 
ATOM 6532 C CD    . GLU G 4 54  ? 111.479 133.492 99.445  1.00 17.85  ? 53  GLU F CD    1 
ATOM 6533 O OE1   . GLU G 4 54  ? 110.761 134.238 100.149 1.00 17.85  ? 53  GLU F OE1   1 
ATOM 6534 O OE2   . GLU G 4 54  ? 111.035 132.401 99.017  1.00 17.85  ? 53  GLU F OE2   1 
ATOM 6535 N N     . THR G 4 55  ? 114.350 137.734 101.294 1.00 17.60  ? 54  THR F N     1 
ATOM 6536 C CA    . THR G 4 55  ? 115.246 138.162 102.354 1.00 17.60  ? 54  THR F CA    1 
ATOM 6537 C C     . THR G 4 55  ? 114.431 138.750 103.491 1.00 17.60  ? 54  THR F C     1 
ATOM 6538 O O     . THR G 4 55  ? 114.804 138.619 104.661 1.00 17.60  ? 54  THR F O     1 
ATOM 6539 C CB    . THR G 4 55  ? 116.249 139.181 101.827 1.00 17.60  ? 54  THR F CB    1 
ATOM 6540 O OG1   . THR G 4 55  ? 116.920 138.641 100.684 1.00 17.60  ? 54  THR F OG1   1 
ATOM 6541 C CG2   . THR G 4 55  ? 117.268 139.526 102.892 1.00 17.60  ? 54  THR F CG2   1 
ATOM 6542 N N     . ARG G 4 56  ? 113.300 139.377 103.162 1.00 17.94  ? 55  ARG F N     1 
ATOM 6543 C CA    . ARG G 4 56  ? 112.413 139.883 104.197 1.00 17.94  ? 55  ARG F CA    1 
ATOM 6544 C C     . ARG G 4 56  ? 111.759 138.729 104.936 1.00 17.94  ? 55  ARG F C     1 
ATOM 6545 O O     . ARG G 4 56  ? 111.526 138.815 106.145 1.00 17.94  ? 55  ARG F O     1 
ATOM 6546 C CB    . ARG G 4 56  ? 111.340 140.774 103.579 1.00 17.94  ? 55  ARG F CB    1 
ATOM 6547 C CG    . ARG G 4 56  ? 111.855 142.020 102.897 1.00 17.94  ? 55  ARG F CG    1 
ATOM 6548 C CD    . ARG G 4 56  ? 110.697 142.894 102.462 1.00 17.94  ? 55  ARG F CD    1 
ATOM 6549 N NE    . ARG G 4 56  ? 111.130 144.076 101.727 1.00 17.94  ? 55  ARG F NE    1 
ATOM 6550 C CZ    . ARG G 4 56  ? 111.132 144.161 100.402 1.00 17.94  ? 55  ARG F CZ    1 
ATOM 6551 N NH1   . ARG G 4 56  ? 110.716 143.137 99.675  1.00 17.94  ? 55  ARG F NH1   1 
ATOM 6552 N NH2   . ARG G 4 56  ? 111.538 145.269 99.803  1.00 17.94  ? 55  ARG F NH2   1 
ATOM 6553 N N     . GLY G 4 57  ? 111.539 137.610 104.244 1.00 17.89  ? 56  GLY F N     1 
ATOM 6554 C CA    . GLY G 4 57  ? 110.954 136.445 104.875 1.00 17.89  ? 56  GLY F CA    1 
ATOM 6555 C C     . GLY G 4 57  ? 111.946 135.657 105.692 1.00 17.89  ? 56  GLY F C     1 
ATOM 6556 O O     . GLY G 4 57  ? 111.545 134.865 106.548 1.00 17.89  ? 56  GLY F O     1 
ATOM 6557 N N     . VAL G 4 58  ? 113.235 135.859 105.434 1.00 18.36  ? 57  VAL F N     1 
ATOM 6558 C CA    . VAL G 4 58  ? 114.258 135.264 106.283 1.00 18.36  ? 57  VAL F CA    1 
ATOM 6559 C C     . VAL G 4 58  ? 114.505 136.155 107.492 1.00 18.36  ? 57  VAL F C     1 
ATOM 6560 O O     . VAL G 4 58  ? 114.674 135.670 108.618 1.00 18.36  ? 57  VAL F O     1 
ATOM 6561 C CB    . VAL G 4 58  ? 115.546 135.038 105.475 1.00 18.36  ? 57  VAL F CB    1 
ATOM 6562 C CG1   . VAL G 4 58  ? 116.646 134.519 106.373 1.00 18.36  ? 57  VAL F CG1   1 
ATOM 6563 C CG2   . VAL G 4 58  ? 115.295 134.095 104.318 1.00 18.36  ? 57  VAL F CG2   1 
ATOM 6564 N N     . LEU G 4 59  ? 114.504 137.472 107.281 1.00 18.90  ? 58  LEU F N     1 
ATOM 6565 C CA    . LEU G 4 59  ? 114.696 138.399 108.385 1.00 18.90  ? 58  LEU F CA    1 
ATOM 6566 C C     . LEU G 4 59  ? 113.527 138.340 109.352 1.00 18.90  ? 58  LEU F C     1 
ATOM 6567 O O     . LEU G 4 59  ? 113.718 138.469 110.566 1.00 18.90  ? 58  LEU F O     1 
ATOM 6568 C CB    . LEU G 4 59  ? 114.877 139.814 107.846 1.00 18.90  ? 58  LEU F CB    1 
ATOM 6569 C CG    . LEU G 4 59  ? 115.093 140.907 108.884 1.00 18.90  ? 58  LEU F CG    1 
ATOM 6570 C CD1   . LEU G 4 59  ? 116.355 140.634 109.665 1.00 18.90  ? 58  LEU F CD1   1 
ATOM 6571 C CD2   . LEU G 4 59  ? 115.167 142.252 108.206 1.00 18.90  ? 58  LEU F CD2   1 
ATOM 6572 N N     . LYS G 4 60  ? 112.315 138.109 108.842 1.00 20.25  ? 59  LYS F N     1 
ATOM 6573 C CA    . LYS G 4 60  ? 111.168 138.056 109.731 1.00 20.25  ? 59  LYS F CA    1 
ATOM 6574 C C     . LYS G 4 60  ? 111.194 136.782 110.554 1.00 20.25  ? 59  LYS F C     1 
ATOM 6575 O O     . LYS G 4 60  ? 110.797 136.795 111.720 1.00 20.25  ? 59  LYS F O     1 
ATOM 6576 C CB    . LYS G 4 60  ? 109.869 138.170 108.936 1.00 20.25  ? 59  LYS F CB    1 
ATOM 6577 C CG    . LYS G 4 60  ? 108.641 138.348 109.809 1.00 20.25  ? 59  LYS F CG    1 
ATOM 6578 C CD    . LYS G 4 60  ? 107.392 138.576 108.985 1.00 20.25  ? 59  LYS F CD    1 
ATOM 6579 C CE    . LYS G 4 60  ? 106.177 138.751 109.879 1.00 20.25  ? 59  LYS F CE    1 
ATOM 6580 N NZ    . LYS G 4 60  ? 104.930 138.963 109.096 1.00 20.25  ? 59  LYS F NZ    1 
ATOM 6581 N N     . VAL G 4 61  ? 111.704 135.687 109.989 1.00 19.78  ? 60  VAL F N     1 
ATOM 6582 C CA    . VAL G 4 61  ? 111.833 134.460 110.765 1.00 19.78  ? 60  VAL F CA    1 
ATOM 6583 C C     . VAL G 4 61  ? 112.924 134.618 111.815 1.00 19.78  ? 60  VAL F C     1 
ATOM 6584 O O     . VAL G 4 61  ? 112.785 134.150 112.952 1.00 19.78  ? 60  VAL F O     1 
ATOM 6585 C CB    . VAL G 4 61  ? 112.104 133.266 109.833 1.00 19.78  ? 60  VAL F CB    1 
ATOM 6586 C CG1   . VAL G 4 61  ? 112.495 132.045 110.633 1.00 19.78  ? 60  VAL F CG1   1 
ATOM 6587 C CG2   . VAL G 4 61  ? 110.876 132.968 108.999 1.00 19.78  ? 60  VAL F CG2   1 
ATOM 6588 N N     . PHE G 4 62  ? 114.009 135.317 111.472 1.00 20.22  ? 61  PHE F N     1 
ATOM 6589 C CA    . PHE G 4 62  ? 115.082 135.496 112.444 1.00 20.22  ? 61  PHE F CA    1 
ATOM 6590 C C     . PHE G 4 62  ? 114.619 136.375 113.599 1.00 20.22  ? 61  PHE F C     1 
ATOM 6591 O O     . PHE G 4 62  ? 114.900 136.084 114.771 1.00 20.22  ? 61  PHE F O     1 
ATOM 6592 C CB    . PHE G 4 62  ? 116.302 136.098 111.753 1.00 20.22  ? 61  PHE F CB    1 
ATOM 6593 C CG    . PHE G 4 62  ? 117.432 136.414 112.680 1.00 20.22  ? 61  PHE F CG    1 
ATOM 6594 C CD1   . PHE G 4 62  ? 118.172 135.403 113.258 1.00 20.22  ? 61  PHE F CD1   1 
ATOM 6595 C CD2   . PHE G 4 62  ? 117.753 137.724 112.975 1.00 20.22  ? 61  PHE F CD2   1 
ATOM 6596 C CE1   . PHE G 4 62  ? 119.211 135.693 114.108 1.00 20.22  ? 61  PHE F CE1   1 
ATOM 6597 C CE2   . PHE G 4 62  ? 118.788 138.017 113.827 1.00 20.22  ? 61  PHE F CE2   1 
ATOM 6598 C CZ    . PHE G 4 62  ? 119.518 137.001 114.393 1.00 20.22  ? 61  PHE F CZ    1 
ATOM 6599 N N     . LEU G 4 63  ? 113.851 137.423 113.294 1.00 21.16  ? 62  LEU F N     1 
ATOM 6600 C CA    . LEU G 4 63  ? 113.339 138.263 114.364 1.00 21.16  ? 62  LEU F CA    1 
ATOM 6601 C C     . LEU G 4 63  ? 112.241 137.569 115.146 1.00 21.16  ? 62  LEU F C     1 
ATOM 6602 O O     . LEU G 4 63  ? 112.147 137.755 116.360 1.00 21.16  ? 62  LEU F O     1 
ATOM 6603 C CB    . LEU G 4 63  ? 112.828 139.580 113.796 1.00 21.16  ? 62  LEU F CB    1 
ATOM 6604 C CG    . LEU G 4 63  ? 113.907 140.509 113.277 1.00 21.16  ? 62  LEU F CG    1 
ATOM 6605 C CD1   . LEU G 4 63  ? 113.296 141.711 112.622 1.00 21.16  ? 62  LEU F CD1   1 
ATOM 6606 C CD2   . LEU G 4 63  ? 114.683 140.943 114.487 1.00 21.16  ? 62  LEU F CD2   1 
ATOM 6607 N N     . GLU G 4 64  ? 111.438 136.726 114.501 1.00 22.67  ? 63  GLU F N     1 
ATOM 6608 C CA    . GLU G 4 64  ? 110.430 136.004 115.258 1.00 22.67  ? 63  GLU F CA    1 
ATOM 6609 C C     . GLU G 4 64  ? 111.049 134.932 116.129 1.00 22.67  ? 63  GLU F C     1 
ATOM 6610 O O     . GLU G 4 64  ? 110.411 134.480 117.084 1.00 22.67  ? 63  GLU F O     1 
ATOM 6611 C CB    . GLU G 4 64  ? 109.398 135.376 114.320 1.00 22.67  ? 63  GLU F CB    1 
ATOM 6612 C CG    . GLU G 4 64  ? 108.431 136.375 113.740 1.00 22.67  ? 63  GLU F CG    1 
ATOM 6613 C CD    . GLU G 4 64  ? 107.440 135.743 112.796 1.00 22.67  ? 63  GLU F CD    1 
ATOM 6614 O OE1   . GLU G 4 64  ? 107.595 134.543 112.487 1.00 22.67  ? 63  GLU F OE1   1 
ATOM 6615 O OE2   . GLU G 4 64  ? 106.496 136.442 112.372 1.00 22.67  ? 63  GLU F OE2   1 
ATOM 6616 N N     . ASN G 4 65  ? 112.268 134.511 115.820 1.00 23.26  ? 64  ASN F N     1 
ATOM 6617 C CA    . ASN G 4 65  ? 112.932 133.567 116.700 1.00 23.26  ? 64  ASN F CA    1 
ATOM 6618 C C     . ASN G 4 65  ? 113.703 134.237 117.821 1.00 23.26  ? 64  ASN F C     1 
ATOM 6619 O O     . ASN G 4 65  ? 113.835 133.654 118.903 1.00 23.26  ? 64  ASN F O     1 
ATOM 6620 C CB    . ASN G 4 65  ? 113.879 132.684 115.895 1.00 23.26  ? 64  ASN F CB    1 
ATOM 6621 C CG    . ASN G 4 65  ? 113.141 131.728 114.992 1.00 23.26  ? 64  ASN F CG    1 
ATOM 6622 O OD1   . ASN G 4 65  ? 112.103 131.187 115.367 1.00 23.26  ? 64  ASN F OD1   1 
ATOM 6623 N ND2   . ASN G 4 65  ? 113.682 131.497 113.801 1.00 23.26  ? 64  ASN F ND2   1 
ATOM 6624 N N     . VAL G 4 66  ? 114.200 135.451 117.609 1.00 24.35  ? 65  VAL F N     1 
ATOM 6625 C CA    . VAL G 4 66  ? 114.988 136.078 118.669 1.00 24.35  ? 65  VAL F CA    1 
ATOM 6626 C C     . VAL G 4 66  ? 114.118 136.918 119.596 1.00 24.35  ? 65  VAL F C     1 
ATOM 6627 O O     . VAL G 4 66  ? 114.305 136.890 120.819 1.00 24.35  ? 65  VAL F O     1 
ATOM 6628 C CB    . VAL G 4 66  ? 116.133 136.906 118.061 1.00 24.35  ? 65  VAL F CB    1 
ATOM 6629 C CG1   . VAL G 4 66  ? 116.375 138.157 118.886 1.00 24.35  ? 65  VAL F CG1   1 
ATOM 6630 C CG2   . VAL G 4 66  ? 117.369 136.060 117.931 1.00 24.35  ? 65  VAL F CG2   1 
ATOM 6631 N N     . ILE G 4 67  ? 113.120 137.617 119.045 1.00 24.39  ? 66  ILE F N     1 
ATOM 6632 C CA    . ILE G 4 67  ? 112.263 138.473 119.851 1.00 24.39  ? 66  ILE F CA    1 
ATOM 6633 C C     . ILE G 4 67  ? 111.373 137.628 120.746 1.00 24.39  ? 66  ILE F C     1 
ATOM 6634 O O     . ILE G 4 67  ? 110.967 138.075 121.821 1.00 24.39  ? 66  ILE F O     1 
ATOM 6635 C CB    . ILE G 4 67  ? 111.441 139.417 118.949 1.00 24.39  ? 66  ILE F CB    1 
ATOM 6636 C CG1   . ILE G 4 67  ? 112.356 140.366 118.174 1.00 24.39  ? 66  ILE F CG1   1 
ATOM 6637 C CG2   . ILE G 4 67  ? 110.478 140.251 119.757 1.00 24.39  ? 66  ILE F CG2   1 
ATOM 6638 C CD1   . ILE G 4 67  ? 111.648 141.167 117.115 1.00 24.39  ? 66  ILE F CD1   1 
ATOM 6639 N N     . ARG G 4 68  ? 111.064 136.395 120.340 1.00 26.30  ? 67  ARG F N     1 
ATOM 6640 C CA    . ARG G 4 68  ? 110.273 135.529 121.205 1.00 26.30  ? 67  ARG F CA    1 
ATOM 6641 C C     . ARG G 4 68  ? 111.036 135.218 122.481 1.00 26.30  ? 67  ARG F C     1 
ATOM 6642 O O     . ARG G 4 68  ? 110.480 135.277 123.584 1.00 26.30  ? 67  ARG F O     1 
ATOM 6643 C CB    . ARG G 4 68  ? 109.913 134.240 120.468 1.00 26.30  ? 67  ARG F CB    1 
ATOM 6644 C CG    . ARG G 4 68  ? 108.996 133.311 121.232 1.00 26.30  ? 67  ARG F CG    1 
ATOM 6645 C CD    . ARG G 4 68  ? 108.782 132.024 120.465 1.00 26.30  ? 67  ARG F CD    1 
ATOM 6646 N NE    . ARG G 4 68  ? 108.101 132.268 119.200 1.00 26.30  ? 67  ARG F NE    1 
ATOM 6647 C CZ    . ARG G 4 68  ? 108.623 132.027 118.004 1.00 26.30  ? 67  ARG F CZ    1 
ATOM 6648 N NH1   . ARG G 4 68  ? 109.843 131.521 117.897 1.00 26.30  ? 67  ARG F NH1   1 
ATOM 6649 N NH2   . ARG G 4 68  ? 107.915 132.281 116.912 1.00 26.30  ? 67  ARG F NH2   1 
ATOM 6650 N N     . ASP G 4 69  ? 112.345 135.005 122.362 1.00 26.88  ? 68  ASP F N     1 
ATOM 6651 C CA    . ASP G 4 69  ? 113.146 134.711 123.539 1.00 26.88  ? 68  ASP F CA    1 
ATOM 6652 C C     . ASP G 4 69  ? 113.440 135.971 124.335 1.00 26.88  ? 68  ASP F C     1 
ATOM 6653 O O     . ASP G 4 69  ? 113.530 135.915 125.567 1.00 26.88  ? 68  ASP F O     1 
ATOM 6654 C CB    . ASP G 4 69  ? 114.454 134.028 123.136 1.00 26.88  ? 68  ASP F CB    1 
ATOM 6655 C CG    . ASP G 4 69  ? 114.240 132.653 122.540 1.00 26.88  ? 68  ASP F CG    1 
ATOM 6656 O OD1   . ASP G 4 69  ? 113.084 132.190 122.502 1.00 26.88  ? 68  ASP F OD1   1 
ATOM 6657 O OD2   . ASP G 4 69  ? 115.234 132.027 122.114 1.00 26.88  ? 68  ASP F OD2   1 
ATOM 6658 N N     . ALA G 4 70  ? 113.526 137.121 123.669 1.00 26.73  ? 69  ALA F N     1 
ATOM 6659 C CA    . ALA G 4 70  ? 113.760 138.351 124.416 1.00 26.73  ? 69  ALA F CA    1 
ATOM 6660 C C     . ALA G 4 70  ? 112.515 138.734 125.204 1.00 26.73  ? 69  ALA F C     1 
ATOM 6661 O O     . ALA G 4 70  ? 112.609 139.154 126.363 1.00 26.73  ? 69  ALA F O     1 
ATOM 6662 C CB    . ALA G 4 70  ? 114.172 139.475 123.470 1.00 26.73  ? 69  ALA F CB    1 
ATOM 6663 N N     . VAL G 4 71  ? 111.336 138.494 124.629 1.00 27.03  ? 70  VAL F N     1 
ATOM 6664 C CA    . VAL G 4 71  ? 110.092 138.764 125.334 1.00 27.03  ? 70  VAL F CA    1 
ATOM 6665 C C     . VAL G 4 71  ? 109.891 137.730 126.427 1.00 27.03  ? 70  VAL F C     1 
ATOM 6666 O O     . VAL G 4 71  ? 109.301 138.025 127.471 1.00 27.03  ? 70  VAL F O     1 
ATOM 6667 C CB    . VAL G 4 71  ? 108.911 138.808 124.348 1.00 27.03  ? 70  VAL F CB    1 
ATOM 6668 C CG1   . VAL G 4 71  ? 107.600 138.935 125.092 1.00 27.03  ? 70  VAL F CG1   1 
ATOM 6669 C CG2   . VAL G 4 71  ? 109.070 139.974 123.399 1.00 27.03  ? 70  VAL F CG2   1 
ATOM 6670 N N     . THR G 4 72  ? 110.431 136.525 126.245 1.00 28.43  ? 71  THR F N     1 
ATOM 6671 C CA    . THR G 4 72  ? 110.327 135.531 127.303 1.00 28.43  ? 71  THR F CA    1 
ATOM 6672 C C     . THR G 4 72  ? 111.202 135.926 128.483 1.00 28.43  ? 71  THR F C     1 
ATOM 6673 O O     . THR G 4 72  ? 110.782 135.808 129.639 1.00 28.43  ? 71  THR F O     1 
ATOM 6674 C CB    . THR G 4 72  ? 110.707 134.152 126.772 1.00 28.43  ? 71  THR F CB    1 
ATOM 6675 O OG1   . THR G 4 72  ? 109.822 133.796 125.704 1.00 28.43  ? 71  THR F OG1   1 
ATOM 6676 C CG2   . THR G 4 72  ? 110.589 133.118 127.866 1.00 28.43  ? 71  THR F CG2   1 
ATOM 6677 N N     . TYR G 4 73  ? 112.398 136.455 128.217 1.00 29.43  ? 72  TYR F N     1 
ATOM 6678 C CA    . TYR G 4 73  ? 113.234 136.904 129.326 1.00 29.43  ? 72  TYR F CA    1 
ATOM 6679 C C     . TYR G 4 73  ? 112.651 138.144 129.992 1.00 29.43  ? 72  TYR F C     1 
ATOM 6680 O O     . TYR G 4 73  ? 112.794 138.313 131.209 1.00 29.43  ? 72  TYR F O     1 
ATOM 6681 C CB    . TYR G 4 73  ? 114.663 137.183 128.864 1.00 29.43  ? 72  TYR F CB    1 
ATOM 6682 C CG    . TYR G 4 73  ? 115.516 135.956 128.644 1.00 29.43  ? 72  TYR F CG    1 
ATOM 6683 C CD1   . TYR G 4 73  ? 116.044 135.263 129.721 1.00 29.43  ? 72  TYR F CD1   1 
ATOM 6684 C CD2   . TYR G 4 73  ? 115.825 135.514 127.372 1.00 29.43  ? 72  TYR F CD2   1 
ATOM 6685 C CE1   . TYR G 4 73  ? 116.834 134.152 129.537 1.00 29.43  ? 72  TYR F CE1   1 
ATOM 6686 C CE2   . TYR G 4 73  ? 116.613 134.400 127.177 1.00 29.43  ? 72  TYR F CE2   1 
ATOM 6687 C CZ    . TYR G 4 73  ? 117.116 133.724 128.264 1.00 29.43  ? 72  TYR F CZ    1 
ATOM 6688 O OH    . TYR G 4 73  ? 117.906 132.615 128.085 1.00 29.43  ? 72  TYR F OH    1 
ATOM 6689 N N     . THR G 4 74  ? 111.948 138.995 129.242 1.00 29.11  ? 73  THR F N     1 
ATOM 6690 C CA    . THR G 4 74  ? 111.373 140.172 129.887 1.00 29.11  ? 73  THR F CA    1 
ATOM 6691 C C     . THR G 4 74  ? 110.167 139.791 130.731 1.00 29.11  ? 73  THR F C     1 
ATOM 6692 O O     . THR G 4 74  ? 110.011 140.286 131.852 1.00 29.11  ? 73  THR F O     1 
ATOM 6693 C CB    . THR G 4 74  ? 110.959 141.226 128.863 1.00 29.11  ? 73  THR F CB    1 
ATOM 6694 O OG1   . THR G 4 74  ? 109.904 140.715 128.043 1.00 29.11  ? 73  THR F OG1   1 
ATOM 6695 C CG2   . THR G 4 74  ? 112.112 141.599 127.999 1.00 29.11  ? 73  THR F CG2   1 
ATOM 6696 N N     . GLU G 4 75  ? 109.303 138.912 130.218 1.00 31.54  ? 74  GLU F N     1 
ATOM 6697 C CA    . GLU G 4 75  ? 108.182 138.465 131.030 1.00 31.54  ? 74  GLU F CA    1 
ATOM 6698 C C     . GLU G 4 75  ? 108.651 137.642 132.219 1.00 31.54  ? 74  GLU F C     1 
ATOM 6699 O O     . GLU G 4 75  ? 107.986 137.628 133.261 1.00 31.54  ? 74  GLU F O     1 
ATOM 6700 C CB    . GLU G 4 75  ? 107.207 137.653 130.173 1.00 31.54  ? 74  GLU F CB    1 
ATOM 6701 C CG    . GLU G 4 75  ? 105.961 137.171 130.908 1.00 31.54  ? 74  GLU F CG    1 
ATOM 6702 C CD    . GLU G 4 75  ? 104.978 138.288 131.233 1.00 31.54  ? 74  GLU F CD    1 
ATOM 6703 O OE1   . GLU G 4 75  ? 105.296 139.469 130.989 1.00 31.54  ? 74  GLU F OE1   1 
ATOM 6704 O OE2   . GLU G 4 75  ? 103.888 137.979 131.752 1.00 31.54  ? 74  GLU F OE2   1 
ATOM 6705 N N     . HIS G 4 76  ? 109.806 136.985 132.109 1.00 32.57  ? 75  HIS F N     1 
ATOM 6706 C CA    . HIS G 4 76  ? 110.330 136.280 133.267 1.00 32.57  ? 75  HIS F CA    1 
ATOM 6707 C C     . HIS G 4 76  ? 110.932 137.232 134.281 1.00 32.57  ? 75  HIS F C     1 
ATOM 6708 O O     . HIS G 4 76  ? 110.930 136.938 135.480 1.00 32.57  ? 75  HIS F O     1 
ATOM 6709 C CB    . HIS G 4 76  ? 111.358 135.239 132.844 1.00 32.57  ? 75  HIS F CB    1 
ATOM 6710 C CG    . HIS G 4 76  ? 111.924 134.466 133.991 1.00 32.57  ? 75  HIS F CG    1 
ATOM 6711 N ND1   . HIS G 4 76  ? 113.128 134.780 134.579 1.00 32.57  ? 75  HIS F ND1   1 
ATOM 6712 C CD2   . HIS G 4 76  ? 111.419 133.430 134.699 1.00 32.57  ? 75  HIS F CD2   1 
ATOM 6713 C CE1   . HIS G 4 76  ? 113.361 133.940 135.571 1.00 32.57  ? 75  HIS F CE1   1 
ATOM 6714 N NE2   . HIS G 4 76  ? 112.337 133.114 135.668 1.00 32.57  ? 75  HIS F NE2   1 
ATOM 6715 N N     . ALA G 4 77  ? 111.451 138.367 133.832 1.00 31.55  ? 76  ALA F N     1 
ATOM 6716 C CA    . ALA G 4 77  ? 112.031 139.338 134.741 1.00 31.55  ? 76  ALA F CA    1 
ATOM 6717 C C     . ALA G 4 77  ? 110.996 140.328 135.246 1.00 31.55  ? 76  ALA F C     1 
ATOM 6718 O O     . ALA G 4 77  ? 111.361 141.312 135.895 1.00 31.55  ? 76  ALA F O     1 
ATOM 6719 C CB    . ALA G 4 77  ? 113.182 140.082 134.062 1.00 31.55  ? 76  ALA F CB    1 
ATOM 6720 N N     . LYS G 4 78  ? 109.716 140.083 134.960 1.00 32.24  ? 77  LYS F N     1 
ATOM 6721 C CA    . LYS G 4 78  ? 108.614 140.909 135.445 1.00 32.24  ? 77  LYS F CA    1 
ATOM 6722 C C     . LYS G 4 78  ? 108.791 142.362 135.028 1.00 32.24  ? 77  LYS F C     1 
ATOM 6723 O O     . LYS G 4 78  ? 108.417 143.282 135.759 1.00 32.24  ? 77  LYS F O     1 
ATOM 6724 C CB    . LYS G 4 78  ? 108.461 140.798 136.963 1.00 32.24  ? 77  LYS F CB    1 
ATOM 6725 C CG    . LYS G 4 78  ? 108.021 139.426 137.432 1.00 32.24  ? 77  LYS F CG    1 
ATOM 6726 C CD    . LYS G 4 78  ? 107.919 139.349 138.942 1.00 32.24  ? 77  LYS F CD    1 
ATOM 6727 C CE    . LYS G 4 78  ? 107.536 137.947 139.379 1.00 32.24  ? 77  LYS F CE    1 
ATOM 6728 N NZ    . LYS G 4 78  ? 107.423 137.826 140.856 1.00 32.24  ? 77  LYS F NZ    1 
ATOM 6729 N N     . ARG G 4 79  ? 109.367 142.573 133.852 1.00 31.40  ? 78  ARG F N     1 
ATOM 6730 C CA    . ARG G 4 79  ? 109.527 143.895 133.275 1.00 31.40  ? 78  ARG F CA    1 
ATOM 6731 C C     . ARG G 4 79  ? 108.583 144.085 132.097 1.00 31.40  ? 78  ARG F C     1 
ATOM 6732 O O     . ARG G 4 79  ? 107.925 143.153 131.630 1.00 31.40  ? 78  ARG F O     1 
ATOM 6733 C CB    . ARG G 4 79  ? 110.979 144.096 132.834 1.00 31.40  ? 78  ARG F CB    1 
ATOM 6734 C CG    . ARG G 4 79  ? 111.932 144.390 133.971 1.00 31.40  ? 78  ARG F CG    1 
ATOM 6735 C CD    . ARG G 4 79  ? 113.310 144.707 133.437 1.00 31.40  ? 78  ARG F CD    1 
ATOM 6736 N NE    . ARG G 4 79  ? 114.021 143.486 133.074 1.00 31.40  ? 78  ARG F NE    1 
ATOM 6737 C CZ    . ARG G 4 79  ? 114.253 143.096 131.827 1.00 31.40  ? 78  ARG F CZ    1 
ATOM 6738 N NH1   . ARG G 4 79  ? 113.809 143.818 130.811 1.00 31.40  ? 78  ARG F NH1   1 
ATOM 6739 N NH2   . ARG G 4 79  ? 114.913 141.971 131.597 1.00 31.40  ? 78  ARG F NH2   1 
ATOM 6740 N N     . LYS G 4 80  ? 108.521 145.326 131.625 1.00 33.49  ? 79  LYS F N     1 
ATOM 6741 C CA    . LYS G 4 80  ? 107.814 145.676 130.405 1.00 33.49  ? 79  LYS F CA    1 
ATOM 6742 C C     . LYS G 4 80  ? 108.725 146.311 129.368 1.00 33.49  ? 79  LYS F C     1 
ATOM 6743 O O     . LYS G 4 80  ? 108.255 146.658 128.280 1.00 33.49  ? 79  LYS F O     1 
ATOM 6744 C CB    . LYS G 4 80  ? 106.656 146.634 130.712 1.00 33.49  ? 79  LYS F CB    1 
ATOM 6745 C CG    . LYS G 4 80  ? 105.566 146.040 131.575 1.00 33.49  ? 79  LYS F CG    1 
ATOM 6746 C CD    . LYS G 4 80  ? 104.463 147.052 131.814 1.00 33.49  ? 79  LYS F CD    1 
ATOM 6747 C CE    . LYS G 4 80  ? 103.384 146.493 132.718 1.00 33.49  ? 79  LYS F CE    1 
ATOM 6748 N NZ    . LYS G 4 80  ? 102.305 147.490 132.948 1.00 33.49  ? 79  LYS F NZ    1 
ATOM 6749 N N     . THR G 4 81  ? 110.011 146.464 129.670 1.00 31.23  ? 80  THR F N     1 
ATOM 6750 C CA    . THR G 4 81  ? 110.982 147.043 128.753 1.00 31.23  ? 80  THR F CA    1 
ATOM 6751 C C     . THR G 4 81  ? 112.028 146.007 128.379 1.00 31.23  ? 80  THR F C     1 
ATOM 6752 O O     . THR G 4 81  ? 112.769 145.527 129.242 1.00 31.23  ? 80  THR F O     1 
ATOM 6753 C CB    . THR G 4 81  ? 111.651 148.269 129.373 1.00 31.23  ? 80  THR F CB    1 
ATOM 6754 O OG1   . THR G 4 81  ? 110.658 149.257 129.670 1.00 31.23  ? 80  THR F OG1   1 
ATOM 6755 C CG2   . THR G 4 81  ? 112.659 148.859 128.415 1.00 31.23  ? 80  THR F CG2   1 
ATOM 6756 N N     . VAL G 4 82  ? 112.074 145.657 127.097 1.00 27.76  ? 81  VAL F N     1 
ATOM 6757 C CA    . VAL G 4 82  ? 113.032 144.684 126.594 1.00 27.76  ? 81  VAL F CA    1 
ATOM 6758 C C     . VAL G 4 82  ? 114.400 145.344 126.583 1.00 27.76  ? 81  VAL F C     1 
ATOM 6759 O O     . VAL G 4 82  ? 114.683 146.185 125.725 1.00 27.76  ? 81  VAL F O     1 
ATOM 6760 C CB    . VAL G 4 82  ? 112.648 144.193 125.187 1.00 27.76  ? 81  VAL F CB    1 
ATOM 6761 C CG1   . VAL G 4 82  ? 113.651 143.170 124.688 1.00 27.76  ? 81  VAL F CG1   1 
ATOM 6762 C CG2   . VAL G 4 82  ? 111.241 143.637 125.174 1.00 27.76  ? 81  VAL F CG2   1 
ATOM 6763 N N     . THR G 4 83  ? 115.254 144.987 127.537 1.00 27.45  ? 82  THR F N     1 
ATOM 6764 C CA    . THR G 4 83  ? 116.567 145.605 127.598 1.00 27.45  ? 82  THR F CA    1 
ATOM 6765 C C     . THR G 4 83  ? 117.489 144.968 126.564 1.00 27.45  ? 82  THR F C     1 
ATOM 6766 O O     . THR G 4 83  ? 117.104 144.060 125.826 1.00 27.45  ? 82  THR F O     1 
ATOM 6767 C CB    . THR G 4 83  ? 117.156 145.460 128.996 1.00 27.45  ? 82  THR F CB    1 
ATOM 6768 O OG1   . THR G 4 83  ? 117.467 144.084 129.237 1.00 27.45  ? 82  THR F OG1   1 
ATOM 6769 C CG2   . THR G 4 83  ? 116.158 145.912 130.036 1.00 27.45  ? 82  THR F CG2   1 
ATOM 6770 N N     . ALA G 4 84  ? 118.732 145.444 126.502 1.00 26.21  ? 83  ALA F N     1 
ATOM 6771 C CA    . ALA G 4 84  ? 119.649 144.871 125.531 1.00 26.21  ? 83  ALA F CA    1 
ATOM 6772 C C     . ALA G 4 84  ? 120.275 143.575 126.015 1.00 26.21  ? 83  ALA F C     1 
ATOM 6773 O O     . ALA G 4 84  ? 120.770 142.798 125.191 1.00 26.21  ? 83  ALA F O     1 
ATOM 6774 C CB    . ALA G 4 84  ? 120.748 145.876 125.190 1.00 26.21  ? 83  ALA F CB    1 
ATOM 6775 N N     . MET G 4 85  ? 120.204 143.284 127.314 1.00 28.13  ? 84  MET F N     1 
ATOM 6776 C CA    . MET G 4 85  ? 120.743 142.025 127.798 1.00 28.13  ? 84  MET F CA    1 
ATOM 6777 C C     . MET G 4 85  ? 119.775 140.884 127.571 1.00 28.13  ? 84  MET F C     1 
ATOM 6778 O O     . MET G 4 85  ? 120.204 139.733 127.448 1.00 28.13  ? 84  MET F O     1 
ATOM 6779 C CB    . MET G 4 85  ? 121.095 142.129 129.282 1.00 28.13  ? 84  MET F CB    1 
ATOM 6780 C CG    . MET G 4 85  ? 122.303 142.997 129.549 1.00 28.13  ? 84  MET F CG    1 
ATOM 6781 S SD    . MET G 4 85  ? 123.756 142.375 128.687 1.00 28.13  ? 84  MET F SD    1 
ATOM 6782 C CE    . MET G 4 85  ? 124.018 140.827 129.545 1.00 28.13  ? 84  MET F CE    1 
ATOM 6783 N N     . ASP G 4 86  ? 118.492 141.193 127.409 1.00 28.37  ? 85  ASP F N     1 
ATOM 6784 C CA    . ASP G 4 86  ? 117.541 140.171 127.009 1.00 28.37  ? 85  ASP F CA    1 
ATOM 6785 C C     . ASP G 4 86  ? 117.767 139.794 125.557 1.00 28.37  ? 85  ASP F C     1 
ATOM 6786 O O     . ASP G 4 86  ? 117.639 138.621 125.187 1.00 28.37  ? 85  ASP F O     1 
ATOM 6787 C CB    . ASP G 4 86  ? 116.131 140.686 127.258 1.00 28.37  ? 85  ASP F CB    1 
ATOM 6788 C CG    . ASP G 4 86  ? 115.881 140.955 128.727 1.00 28.37  ? 85  ASP F CG    1 
ATOM 6789 O OD1   . ASP G 4 86  ? 116.661 140.450 129.559 1.00 28.37  ? 85  ASP F OD1   1 
ATOM 6790 O OD2   . ASP G 4 86  ? 114.918 141.670 129.059 1.00 28.37  ? 85  ASP F OD2   1 
ATOM 6791 N N     . VAL G 4 87  ? 118.210 140.754 124.750 1.00 26.80  ? 86  VAL F N     1 
ATOM 6792 C CA    . VAL G 4 87  ? 118.527 140.465 123.362 1.00 26.80  ? 86  VAL F CA    1 
ATOM 6793 C C     . VAL G 4 87  ? 119.838 139.703 123.284 1.00 26.80  ? 86  VAL F C     1 
ATOM 6794 O O     . VAL G 4 87  ? 119.996 138.802 122.455 1.00 26.80  ? 86  VAL F O     1 
ATOM 6795 C CB    . VAL G 4 87  ? 118.574 141.768 122.546 1.00 26.80  ? 86  VAL F CB    1 
ATOM 6796 C CG1   . VAL G 4 87  ? 118.973 141.484 121.115 1.00 26.80  ? 86  VAL F CG1   1 
ATOM 6797 C CG2   . VAL G 4 87  ? 117.236 142.473 122.600 1.00 26.80  ? 86  VAL F CG2   1 
ATOM 6798 N N     . VAL G 4 88  ? 120.793 140.030 124.156 1.00 27.66  ? 87  VAL F N     1 
ATOM 6799 C CA    . VAL G 4 88  ? 122.042 139.276 124.164 1.00 27.66  ? 87  VAL F CA    1 
ATOM 6800 C C     . VAL G 4 88  ? 121.799 137.841 124.617 1.00 27.66  ? 87  VAL F C     1 
ATOM 6801 O O     . VAL G 4 88  ? 122.388 136.901 124.076 1.00 27.66  ? 87  VAL F O     1 
ATOM 6802 C CB    . VAL G 4 88  ? 123.087 139.980 125.045 1.00 27.66  ? 87  VAL F CB    1 
ATOM 6803 C CG1   . VAL G 4 88  ? 124.333 139.132 125.166 1.00 27.66  ? 87  VAL F CG1   1 
ATOM 6804 C CG2   . VAL G 4 88  ? 123.440 141.327 124.455 1.00 27.66  ? 87  VAL F CG2   1 
ATOM 6805 N N     . TYR G 4 89  ? 120.891 137.637 125.574 1.00 31.16  ? 88  TYR F N     1 
ATOM 6806 C CA    . TYR G 4 89  ? 120.580 136.276 126.003 1.00 31.16  ? 88  TYR F CA    1 
ATOM 6807 C C     . TYR G 4 89  ? 119.802 135.516 124.939 1.00 31.16  ? 88  TYR F C     1 
ATOM 6808 O O     . TYR G 4 89  ? 120.032 134.314 124.733 1.00 31.16  ? 88  TYR F O     1 
ATOM 6809 C CB    . TYR G 4 89  ? 119.791 136.317 127.308 1.00 31.16  ? 88  TYR F CB    1 
ATOM 6810 C CG    . TYR G 4 89  ? 120.611 136.738 128.501 1.00 31.16  ? 88  TYR F CG    1 
ATOM 6811 C CD1   . TYR G 4 89  ? 121.995 136.661 128.477 1.00 31.16  ? 88  TYR F CD1   1 
ATOM 6812 C CD2   . TYR G 4 89  ? 120.003 137.235 129.643 1.00 31.16  ? 88  TYR F CD2   1 
ATOM 6813 C CE1   . TYR G 4 89  ? 122.749 137.049 129.563 1.00 31.16  ? 88  TYR F CE1   1 
ATOM 6814 C CE2   . TYR G 4 89  ? 120.749 137.630 130.733 1.00 31.16  ? 88  TYR F CE2   1 
ATOM 6815 C CZ    . TYR G 4 89  ? 122.121 137.534 130.688 1.00 31.16  ? 88  TYR F CZ    1 
ATOM 6816 O OH    . TYR G 4 89  ? 122.867 137.925 131.775 1.00 31.16  ? 88  TYR F OH    1 
ATOM 6817 N N     . ALA G 4 90  ? 118.957 136.218 124.181 1.00 28.41  ? 89  ALA F N     1 
ATOM 6818 C CA    . ALA G 4 90  ? 118.226 135.537 123.127 1.00 28.41  ? 89  ALA F CA    1 
ATOM 6819 C C     . ALA G 4 90  ? 119.154 135.168 121.987 1.00 28.41  ? 89  ALA F C     1 
ATOM 6820 O O     . ALA G 4 90  ? 118.975 134.120 121.360 1.00 28.41  ? 89  ALA F O     1 
ATOM 6821 C CB    . ALA G 4 90  ? 117.085 136.416 122.625 1.00 28.41  ? 89  ALA F CB    1 
ATOM 6822 N N     . LEU G 4 91  ? 120.149 136.005 121.703 1.00 28.60  ? 90  LEU F N     1 
ATOM 6823 C CA    . LEU G 4 91  ? 121.106 135.628 120.680 1.00 28.60  ? 90  LEU F CA    1 
ATOM 6824 C C     . LEU G 4 91  ? 122.078 134.580 121.192 1.00 28.60  ? 90  LEU F C     1 
ATOM 6825 O O     . LEU G 4 91  ? 122.659 133.845 120.390 1.00 28.60  ? 90  LEU F O     1 
ATOM 6826 C CB    . LEU G 4 91  ? 121.879 136.860 120.223 1.00 28.60  ? 90  LEU F CB    1 
ATOM 6827 C CG    . LEU G 4 91  ? 121.105 137.908 119.436 1.00 28.60  ? 90  LEU F CG    1 
ATOM 6828 C CD1   . LEU G 4 91  ? 121.963 139.138 119.314 1.00 28.60  ? 90  LEU F CD1   1 
ATOM 6829 C CD2   . LEU G 4 91  ? 120.735 137.376 118.069 1.00 28.60  ? 90  LEU F CD2   1 
ATOM 6830 N N     . LYS G 4 92  ? 122.267 134.498 122.513 1.00 31.40  ? 91  LYS F N     1 
ATOM 6831 C CA    . LYS G 4 92  ? 123.143 133.473 123.059 1.00 31.40  ? 91  LYS F CA    1 
ATOM 6832 C C     . LYS G 4 92  ? 122.471 132.116 122.992 1.00 31.40  ? 91  LYS F C     1 
ATOM 6833 O O     . LYS G 4 92  ? 123.149 131.086 122.921 1.00 31.40  ? 91  LYS F O     1 
ATOM 6834 C CB    . LYS G 4 92  ? 123.544 133.815 124.493 1.00 31.40  ? 91  LYS F CB    1 
ATOM 6835 C CG    . LYS G 4 92  ? 124.650 132.931 125.042 1.00 31.40  ? 91  LYS F CG    1 
ATOM 6836 C CD    . LYS G 4 92  ? 124.974 133.257 126.489 1.00 31.40  ? 91  LYS F CD    1 
ATOM 6837 C CE    . LYS G 4 92  ? 125.736 134.568 126.603 1.00 31.40  ? 91  LYS F CE    1 
ATOM 6838 N NZ    . LYS G 4 92  ? 126.153 134.846 128.006 1.00 31.40  ? 91  LYS F NZ    1 
ATOM 6839 N N     . ARG G 4 93  ? 121.139 132.100 122.995 1.00 30.86  ? 92  ARG F N     1 
ATOM 6840 C CA    . ARG G 4 93  ? 120.424 130.836 122.884 1.00 30.86  ? 92  ARG F CA    1 
ATOM 6841 C C     . ARG G 4 93  ? 120.315 130.347 121.450 1.00 30.86  ? 92  ARG F C     1 
ATOM 6842 O O     . ARG G 4 93  ? 119.611 129.365 121.196 1.00 30.86  ? 92  ARG F O     1 
ATOM 6843 C CB    . ARG G 4 93  ? 119.023 130.937 123.479 1.00 30.86  ? 92  ARG F CB    1 
ATOM 6844 C CG    . ARG G 4 93  ? 118.979 131.102 124.976 1.00 30.86  ? 92  ARG F CG    1 
ATOM 6845 C CD    . ARG G 4 93  ? 117.553 130.939 125.432 1.00 30.86  ? 92  ARG F CD    1 
ATOM 6846 N NE    . ARG G 4 93  ? 117.127 129.560 125.215 1.00 30.86  ? 92  ARG F NE    1 
ATOM 6847 C CZ    . ARG G 4 93  ? 116.270 129.181 124.273 1.00 30.86  ? 92  ARG F CZ    1 
ATOM 6848 N NH1   . ARG G 4 93  ? 115.749 130.078 123.450 1.00 30.86  ? 92  ARG F NH1   1 
ATOM 6849 N NH2   . ARG G 4 93  ? 115.949 127.902 124.144 1.00 30.86  ? 92  ARG F NH2   1 
ATOM 6850 N N     . GLN G 4 94  ? 120.983 131.012 120.512 1.00 30.36  ? 93  GLN F N     1 
ATOM 6851 C CA    . GLN G 4 94  ? 121.064 130.555 119.133 1.00 30.36  ? 93  GLN F CA    1 
ATOM 6852 C C     . GLN G 4 94  ? 122.501 130.362 118.675 1.00 30.36  ? 93  GLN F C     1 
ATOM 6853 O O     . GLN G 4 94  ? 122.733 130.118 117.486 1.00 30.36  ? 93  GLN F O     1 
ATOM 6854 C CB    . GLN G 4 94  ? 120.343 131.527 118.201 1.00 30.36  ? 93  GLN F CB    1 
ATOM 6855 C CG    . GLN G 4 94  ? 118.866 131.638 118.485 1.00 30.36  ? 93  GLN F CG    1 
ATOM 6856 C CD    . GLN G 4 94  ? 118.194 132.679 117.631 1.00 30.36  ? 93  GLN F CD    1 
ATOM 6857 O OE1   . GLN G 4 94  ? 118.842 133.357 116.837 1.00 30.36  ? 93  GLN F OE1   1 
ATOM 6858 N NE2   . GLN G 4 94  ? 116.883 132.809 117.780 1.00 30.36  ? 93  GLN F NE2   1 
ATOM 6859 N N     . GLY G 4 95  ? 123.468 130.464 119.580 1.00 31.80  ? 94  GLY F N     1 
ATOM 6860 C CA    . GLY G 4 95  ? 124.857 130.392 119.173 1.00 31.80  ? 94  GLY F CA    1 
ATOM 6861 C C     . GLY G 4 95  ? 125.285 131.610 118.388 1.00 31.80  ? 94  GLY F C     1 
ATOM 6862 O O     . GLY G 4 95  ? 125.956 131.476 117.360 1.00 31.80  ? 94  GLY F O     1 
ATOM 6863 N N     . ARG G 4 96  ? 124.890 132.796 118.841 1.00 33.03  ? 95  ARG F N     1 
ATOM 6864 C CA    . ARG G 4 96  ? 125.188 134.062 118.181 1.00 33.03  ? 95  ARG F CA    1 
ATOM 6865 C C     . ARG G 4 96  ? 125.595 135.094 119.228 1.00 33.03  ? 95  ARG F C     1 
ATOM 6866 O O     . ARG G 4 96  ? 125.041 136.191 119.290 1.00 33.03  ? 95  ARG F O     1 
ATOM 6867 C CB    . ARG G 4 96  ? 123.982 134.567 117.391 1.00 33.03  ? 95  ARG F CB    1 
ATOM 6868 C CG    . ARG G 4 96  ? 123.723 133.896 116.049 1.00 33.03  ? 95  ARG F CG    1 
ATOM 6869 C CD    . ARG G 4 96  ? 124.982 133.540 115.278 1.00 33.03  ? 95  ARG F CD    1 
ATOM 6870 N NE    . ARG G 4 96  ? 125.838 134.690 115.011 1.00 33.03  ? 95  ARG F NE    1 
ATOM 6871 C CZ    . ARG G 4 96  ? 127.065 134.595 114.514 1.00 33.03  ? 95  ARG F CZ    1 
ATOM 6872 N NH1   . ARG G 4 96  ? 127.576 133.404 114.240 1.00 33.03  ? 95  ARG F NH1   1 
ATOM 6873 N NH2   . ARG G 4 96  ? 127.784 135.687 114.296 1.00 33.03  ? 95  ARG F NH2   1 
ATOM 6874 N N     . THR G 4 97  ? 126.558 134.740 120.082 1.00 32.46  ? 96  THR F N     1 
ATOM 6875 C CA    . THR G 4 97  ? 126.956 135.629 121.170 1.00 32.46  ? 96  THR F CA    1 
ATOM 6876 C C     . THR G 4 97  ? 127.322 137.015 120.654 1.00 32.46  ? 96  THR F C     1 
ATOM 6877 O O     . THR G 4 97  ? 128.027 137.161 119.654 1.00 32.46  ? 96  THR F O     1 
ATOM 6878 C CB    . THR G 4 97  ? 128.145 135.023 121.917 1.00 32.46  ? 96  THR F CB    1 
ATOM 6879 O OG1   . THR G 4 97  ? 127.794 133.723 122.405 1.00 32.46  ? 96  THR F OG1   1 
ATOM 6880 C CG2   . THR G 4 97  ? 128.543 135.898 123.084 1.00 32.46  ? 96  THR F CG2   1 
ATOM 6881 N N     . LEU G 4 98  ? 126.822 138.035 121.349 1.00 30.91  ? 97  LEU F N     1 
ATOM 6882 C CA    . LEU G 4 98  ? 126.991 139.432 120.967 1.00 30.91  ? 97  LEU F CA    1 
ATOM 6883 C C     . LEU G 4 98  ? 127.760 140.195 122.038 1.00 30.91  ? 97  LEU F C     1 
ATOM 6884 O O     . LEU G 4 98  ? 127.288 140.310 123.174 1.00 30.91  ? 97  LEU F O     1 
ATOM 6885 C CB    . LEU G 4 98  ? 125.625 140.074 120.725 1.00 30.91  ? 97  LEU F CB    1 
ATOM 6886 C CG    . LEU G 4 98  ? 125.545 141.541 120.317 1.00 30.91  ? 97  LEU F CG    1 
ATOM 6887 C CD1   . LEU G 4 98  ? 126.190 141.750 118.967 1.00 30.91  ? 97  LEU F CD1   1 
ATOM 6888 C CD2   . LEU G 4 98  ? 124.097 141.975 120.286 1.00 30.91  ? 97  LEU F CD2   1 
ATOM 6889 N N     . TYR G 4 99  ? 128.935 140.714 121.688 1.00 32.72  ? 98  TYR F N     1 
ATOM 6890 C CA    . TYR G 4 99  ? 129.765 141.438 122.644 1.00 32.72  ? 98  TYR F CA    1 
ATOM 6891 C C     . TYR G 4 99  ? 129.496 142.931 122.524 1.00 32.72  ? 98  TYR F C     1 
ATOM 6892 O O     . TYR G 4 99  ? 129.298 143.449 121.423 1.00 32.72  ? 98  TYR F O     1 
ATOM 6893 C CB    . TYR G 4 99  ? 131.255 141.168 122.439 1.00 32.72  ? 98  TYR F CB    1 
ATOM 6894 C CG    . TYR G 4 99  ? 131.710 139.789 122.843 1.00 32.72  ? 98  TYR F CG    1 
ATOM 6895 C CD1   . TYR G 4 99  ? 130.912 138.976 123.630 1.00 32.72  ? 98  TYR F CD1   1 
ATOM 6896 C CD2   . TYR G 4 99  ? 132.961 139.320 122.480 1.00 32.72  ? 98  TYR F CD2   1 
ATOM 6897 C CE1   . TYR G 4 99  ? 131.331 137.723 124.010 1.00 32.72  ? 98  TYR F CE1   1 
ATOM 6898 C CE2   . TYR G 4 99  ? 133.388 138.068 122.859 1.00 32.72  ? 98  TYR F CE2   1 
ATOM 6899 C CZ    . TYR G 4 99  ? 132.568 137.273 123.621 1.00 32.72  ? 98  TYR F CZ    1 
ATOM 6900 O OH    . TYR G 4 99  ? 132.990 136.023 124.005 1.00 32.72  ? 98  TYR F OH    1 
ATOM 6901 N N     . GLY G 4 100 ? 129.498 143.620 123.655 1.00 31.35  ? 99  GLY F N     1 
ATOM 6902 C CA    . GLY G 4 100 ? 129.360 145.056 123.679 1.00 31.35  ? 99  GLY F CA    1 
ATOM 6903 C C     . GLY G 4 100 ? 128.084 145.609 124.294 1.00 31.35  ? 99  GLY F C     1 
ATOM 6904 O O     . GLY G 4 100 ? 127.712 146.744 123.974 1.00 31.35  ? 99  GLY F O     1 
ATOM 6905 N N     . PHE G 4 101 ? 127.405 144.849 125.147 1.00 28.86  ? 100 PHE F N     1 
ATOM 6906 C CA    . PHE G 4 101 ? 126.175 145.312 125.780 1.00 28.86  ? 100 PHE F CA    1 
ATOM 6907 C C     . PHE G 4 101 ? 126.136 144.903 127.248 1.00 28.86  ? 100 PHE F C     1 
ATOM 6908 O O     . PHE G 4 101 ? 127.137 145.005 127.956 1.00 28.86  ? 100 PHE F O     1 
ATOM 6909 C CB    . PHE G 4 101 ? 124.953 144.760 125.046 1.00 28.86  ? 100 PHE F CB    1 
ATOM 6910 C CG    . PHE G 4 101 ? 124.754 145.343 123.679 1.00 28.86  ? 100 PHE F CG    1 
ATOM 6911 C CD1   . PHE G 4 101 ? 124.106 146.553 123.517 1.00 28.86  ? 100 PHE F CD1   1 
ATOM 6912 C CD2   . PHE G 4 101 ? 125.225 144.688 122.558 1.00 28.86  ? 100 PHE F CD2   1 
ATOM 6913 C CE1   . PHE G 4 101 ? 123.924 147.094 122.261 1.00 28.86  ? 100 PHE F CE1   1 
ATOM 6914 C CE2   . PHE G 4 101 ? 125.046 145.225 121.302 1.00 28.86  ? 100 PHE F CE2   1 
ATOM 6915 C CZ    . PHE G 4 101 ? 124.397 146.430 121.154 1.00 28.86  ? 100 PHE F CZ    1 
ATOM 6916 N N     . SER H 5 37  ? 116.295 104.705 135.733 1.00 39.09  ? 36  SER H N     1 
ATOM 6917 C CA    . SER H 5 37  ? 115.721 105.452 136.844 1.00 39.09  ? 36  SER H CA    1 
ATOM 6918 C C     . SER H 5 37  ? 114.260 105.776 136.575 1.00 39.09  ? 36  SER H C     1 
ATOM 6919 O O     . SER H 5 37  ? 113.384 105.441 137.369 1.00 39.09  ? 36  SER H O     1 
ATOM 6920 C CB    . SER H 5 37  ? 116.509 106.741 137.092 1.00 39.09  ? 36  SER H CB    1 
ATOM 6921 O OG    . SER H 5 37  ? 115.872 107.551 138.066 1.00 39.09  ? 36  SER H OG    1 
ATOM 6922 N N     . TYR H 5 38  ? 114.001 106.421 135.441 1.00 38.23  ? 37  TYR H N     1 
ATOM 6923 C CA    . TYR H 5 38  ? 112.666 106.882 135.093 1.00 38.23  ? 37  TYR H CA    1 
ATOM 6924 C C     . TYR H 5 38  ? 111.895 105.864 134.268 1.00 38.23  ? 37  TYR H C     1 
ATOM 6925 O O     . TYR H 5 38  ? 110.821 106.186 133.752 1.00 38.23  ? 37  TYR H O     1 
ATOM 6926 C CB    . TYR H 5 38  ? 112.762 108.205 134.332 1.00 38.23  ? 37  TYR H CB    1 
ATOM 6927 C CG    . TYR H 5 38  ? 113.122 109.378 135.208 1.00 38.23  ? 37  TYR H CG    1 
ATOM 6928 C CD1   . TYR H 5 38  ? 112.729 109.426 136.535 1.00 38.23  ? 37  TYR H CD1   1 
ATOM 6929 C CD2   . TYR H 5 38  ? 113.903 110.412 134.721 1.00 38.23  ? 37  TYR H CD2   1 
ATOM 6930 C CE1   . TYR H 5 38  ? 113.070 110.491 137.338 1.00 38.23  ? 37  TYR H CE1   1 
ATOM 6931 C CE2   . TYR H 5 38  ? 114.250 111.479 135.513 1.00 38.23  ? 37  TYR H CE2   1 
ATOM 6932 C CZ    . TYR H 5 38  ? 113.834 111.513 136.822 1.00 38.23  ? 37  TYR H CZ    1 
ATOM 6933 O OH    . TYR H 5 38  ? 114.180 112.576 137.621 1.00 38.23  ? 37  TYR H OH    1 
ATOM 6934 N N     . SER H 5 39  ? 112.418 104.644 134.139 1.00 38.55  ? 38  SER H N     1 
ATOM 6935 C CA    . SER H 5 39  ? 111.818 103.656 133.254 1.00 38.55  ? 38  SER H CA    1 
ATOM 6936 C C     . SER H 5 39  ? 110.540 103.068 133.831 1.00 38.55  ? 38  SER H C     1 
ATOM 6937 O O     . SER H 5 39  ? 109.721 102.537 133.073 1.00 38.55  ? 38  SER H O     1 
ATOM 6938 C CB    . SER H 5 39  ? 112.820 102.541 132.959 1.00 38.55  ? 38  SER H CB    1 
ATOM 6939 O OG    . SER H 5 39  ? 113.230 101.896 134.151 1.00 38.55  ? 38  SER H OG    1 
ATOM 6940 N N     . ILE H 5 40  ? 110.349 103.156 135.148 1.00 38.06  ? 39  ILE H N     1 
ATOM 6941 C CA    . ILE H 5 40  ? 109.171 102.564 135.771 1.00 38.06  ? 39  ILE H CA    1 
ATOM 6942 C C     . ILE H 5 40  ? 107.941 103.427 135.544 1.00 38.06  ? 39  ILE H C     1 
ATOM 6943 O O     . ILE H 5 40  ? 106.813 102.919 135.576 1.00 38.06  ? 39  ILE H O     1 
ATOM 6944 C CB    . ILE H 5 40  ? 109.376 102.362 137.289 1.00 38.06  ? 39  ILE H CB    1 
ATOM 6945 C CG1   . ILE H 5 40  ? 110.532 101.399 137.622 1.00 38.06  ? 39  ILE H CG1   1 
ATOM 6946 C CG2   . ILE H 5 40  ? 108.116 101.839 137.969 1.00 38.06  ? 39  ILE H CG2   1 
ATOM 6947 C CD1   . ILE H 5 40  ? 111.946 101.884 137.308 1.00 38.06  ? 39  ILE H CD1   1 
ATOM 6948 N N     . TYR H 5 41  ? 108.130 104.706 135.233 1.00 38.41  ? 40  TYR H N     1 
ATOM 6949 C CA    . TYR H 5 41  ? 107.018 105.613 135.001 1.00 38.41  ? 40  TYR H CA    1 
ATOM 6950 C C     . TYR H 5 41  ? 106.683 105.781 133.528 1.00 38.41  ? 40  TYR H C     1 
ATOM 6951 O O     . TYR H 5 41  ? 105.554 106.163 133.202 1.00 38.41  ? 40  TYR H O     1 
ATOM 6952 C CB    . TYR H 5 41  ? 107.344 106.969 135.626 1.00 38.41  ? 40  TYR H CB    1 
ATOM 6953 C CG    . TYR H 5 41  ? 107.410 106.878 137.127 1.00 38.41  ? 40  TYR H CG    1 
ATOM 6954 C CD1   . TYR H 5 41  ? 106.260 106.767 137.890 1.00 38.41  ? 40  TYR H CD1   1 
ATOM 6955 C CD2   . TYR H 5 41  ? 108.634 106.849 137.776 1.00 38.41  ? 40  TYR H CD2   1 
ATOM 6956 C CE1   . TYR H 5 41  ? 106.327 106.658 139.263 1.00 38.41  ? 40  TYR H CE1   1 
ATOM 6957 C CE2   . TYR H 5 41  ? 108.712 106.741 139.143 1.00 38.41  ? 40  TYR H CE2   1 
ATOM 6958 C CZ    . TYR H 5 41  ? 107.558 106.643 139.882 1.00 38.41  ? 40  TYR H CZ    1 
ATOM 6959 O OH    . TYR H 5 41  ? 107.636 106.538 141.251 1.00 38.41  ? 40  TYR H OH    1 
ATOM 6960 N N     . VAL H 5 42  ? 107.624 105.481 132.636 1.00 38.80  ? 41  VAL H N     1 
ATOM 6961 C CA    . VAL H 5 42  ? 107.330 105.511 131.211 1.00 38.80  ? 41  VAL H CA    1 
ATOM 6962 C C     . VAL H 5 42  ? 106.312 104.433 130.868 1.00 38.80  ? 41  VAL H C     1 
ATOM 6963 O O     . VAL H 5 42  ? 105.352 104.672 130.126 1.00 38.80  ? 41  VAL H O     1 
ATOM 6964 C CB    . VAL H 5 42  ? 108.633 105.349 130.408 1.00 38.80  ? 41  VAL H CB    1 
ATOM 6965 C CG1   . VAL H 5 42  ? 108.346 105.241 128.929 1.00 38.80  ? 41  VAL H CG1   1 
ATOM 6966 C CG2   . VAL H 5 42  ? 109.573 106.507 130.691 1.00 38.80  ? 41  VAL H CG2   1 
ATOM 6967 N N     . TYR H 5 43  ? 106.467 103.248 131.456 1.00 40.84  ? 42  TYR H N     1 
ATOM 6968 C CA    . TYR H 5 43  ? 105.494 102.186 131.242 1.00 40.84  ? 42  TYR H CA    1 
ATOM 6969 C C     . TYR H 5 43  ? 104.177 102.492 131.938 1.00 40.84  ? 42  TYR H C     1 
ATOM 6970 O O     . TYR H 5 43  ? 103.109 102.100 131.450 1.00 40.84  ? 42  TYR H O     1 
ATOM 6971 C CB    . TYR H 5 43  ? 106.081 100.868 131.746 1.00 40.84  ? 42  TYR H CB    1 
ATOM 6972 C CG    . TYR H 5 43  ? 105.229 99.645  131.523 1.00 40.84  ? 42  TYR H CG    1 
ATOM 6973 C CD1   . TYR H 5 43  ? 105.065 99.108  130.255 1.00 40.84  ? 42  TYR H CD1   1 
ATOM 6974 C CD2   . TYR H 5 43  ? 104.611 99.009  132.590 1.00 40.84  ? 42  TYR H CD2   1 
ATOM 6975 C CE1   . TYR H 5 43  ? 104.291 97.980  130.056 1.00 40.84  ? 42  TYR H CE1   1 
ATOM 6976 C CE2   . TYR H 5 43  ? 103.839 97.884  132.403 1.00 40.84  ? 42  TYR H CE2   1 
ATOM 6977 C CZ    . TYR H 5 43  ? 103.681 97.373  131.134 1.00 40.84  ? 42  TYR H CZ    1 
ATOM 6978 O OH    . TYR H 5 43  ? 102.911 96.248  130.944 1.00 40.84  ? 42  TYR H OH    1 
ATOM 6979 N N     . LYS H 5 44  ? 104.222 103.270 133.020 1.00 39.55  ? 43  LYS H N     1 
ATOM 6980 C CA    . LYS H 5 44  ? 102.990 103.624 133.710 1.00 39.55  ? 43  LYS H CA    1 
ATOM 6981 C C     . LYS H 5 44  ? 102.188 104.661 132.937 1.00 39.55  ? 43  LYS H C     1 
ATOM 6982 O O     . LYS H 5 44  ? 100.954 104.625 132.961 1.00 39.55  ? 43  LYS H O     1 
ATOM 6983 C CB    . LYS H 5 44  ? 103.323 104.131 135.112 1.00 39.55  ? 43  LYS H CB    1 
ATOM 6984 C CG    . LYS H 5 44  ? 102.130 104.335 136.022 1.00 39.55  ? 43  LYS H CG    1 
ATOM 6985 C CD    . LYS H 5 44  ? 102.594 104.684 137.429 1.00 39.55  ? 43  LYS H CD    1 
ATOM 6986 C CE    . LYS H 5 44  ? 101.425 104.902 138.374 1.00 39.55  ? 43  LYS H CE    1 
ATOM 6987 N NZ    . LYS H 5 44  ? 101.889 105.252 139.745 1.00 39.55  ? 43  LYS H NZ    1 
ATOM 6988 N N     . VAL H 5 45  ? 102.856 105.594 132.254 1.00 39.90  ? 44  VAL H N     1 
ATOM 6989 C CA    . VAL H 5 45  ? 102.106 106.482 131.372 1.00 39.90  ? 44  VAL H CA    1 
ATOM 6990 C C     . VAL H 5 45  ? 101.666 105.740 130.115 1.00 39.90  ? 44  VAL H C     1 
ATOM 6991 O O     . VAL H 5 45  ? 100.602 106.037 129.547 1.00 39.90  ? 44  VAL H O     1 
ATOM 6992 C CB    . VAL H 5 45  ? 102.914 107.753 131.042 1.00 39.90  ? 44  VAL H CB    1 
ATOM 6993 C CG1   . VAL H 5 45  ? 104.041 107.463 130.075 1.00 39.90  ? 44  VAL H CG1   1 
ATOM 6994 C CG2   . VAL H 5 45  ? 101.999 108.825 130.481 1.00 39.90  ? 44  VAL H CG2   1 
ATOM 6995 N N     . LEU H 5 46  ? 102.461 104.767 129.654 1.00 39.96  ? 45  LEU H N     1 
ATOM 6996 C CA    . LEU H 5 46  ? 102.074 104.037 128.455 1.00 39.96  ? 45  LEU H CA    1 
ATOM 6997 C C     . LEU H 5 46  ? 100.853 103.166 128.705 1.00 39.96  ? 45  LEU H C     1 
ATOM 6998 O O     . LEU H 5 46  ? 100.079 102.909 127.778 1.00 39.96  ? 45  LEU H O     1 
ATOM 6999 C CB    . LEU H 5 46  ? 103.243 103.188 127.960 1.00 39.96  ? 45  LEU H CB    1 
ATOM 7000 C CG    . LEU H 5 46  ? 103.061 102.430 126.645 1.00 39.96  ? 45  LEU H CG    1 
ATOM 7001 C CD1   . LEU H 5 46  ? 102.762 103.383 125.508 1.00 39.96  ? 45  LEU H CD1   1 
ATOM 7002 C CD2   . LEU H 5 46  ? 104.300 101.621 126.340 1.00 39.96  ? 45  LEU H CD2   1 
ATOM 7003 N N     . LYS H 5 47  ? 100.650 102.725 129.948 1.00 40.30  ? 46  LYS H N     1 
ATOM 7004 C CA    . LYS H 5 47  ? 99.432  101.991 130.267 1.00 40.30  ? 46  LYS H CA    1 
ATOM 7005 C C     . LYS H 5 47  ? 98.195  102.875 130.210 1.00 40.30  ? 46  LYS H C     1 
ATOM 7006 O O     . LYS H 5 47  ? 97.086  102.357 130.051 1.00 40.30  ? 46  LYS H O     1 
ATOM 7007 C CB    . LYS H 5 47  ? 99.558  101.319 131.633 1.00 40.30  ? 46  LYS H CB    1 
ATOM 7008 C CG    . LYS H 5 47  ? 100.516 100.136 131.624 1.00 40.30  ? 46  LYS H CG    1 
ATOM 7009 C CD    . LYS H 5 47  ? 100.569 99.432  132.964 1.00 40.30  ? 46  LYS H CD    1 
ATOM 7010 C CE    . LYS H 5 47  ? 99.305  98.626  133.201 1.00 40.30  ? 46  LYS H CE    1 
ATOM 7011 N NZ    . LYS H 5 47  ? 99.112  97.592  132.149 1.00 40.30  ? 46  LYS H NZ    1 
ATOM 7012 N N     . GLN H 5 48  ? 98.357  104.191 130.344 1.00 40.63  ? 47  GLN H N     1 
ATOM 7013 C CA    . GLN H 5 48  ? 97.236  105.115 130.238 1.00 40.63  ? 47  GLN H CA    1 
ATOM 7014 C C     . GLN H 5 48  ? 96.981  105.533 128.799 1.00 40.63  ? 47  GLN H C     1 
ATOM 7015 O O     . GLN H 5 48  ? 95.826  105.629 128.372 1.00 40.63  ? 47  GLN H O     1 
ATOM 7016 C CB    . GLN H 5 48  ? 97.487  106.366 131.083 1.00 40.63  ? 47  GLN H CB    1 
ATOM 7017 C CG    . GLN H 5 48  ? 97.536  106.139 132.576 1.00 40.63  ? 47  GLN H CG    1 
ATOM 7018 C CD    . GLN H 5 48  ? 97.840  107.417 133.332 1.00 40.63  ? 47  GLN H CD    1 
ATOM 7019 O OE1   . GLN H 5 48  ? 98.062  108.467 132.730 1.00 40.63  ? 47  GLN H OE1   1 
ATOM 7020 N NE2   . GLN H 5 48  ? 97.845  107.337 134.658 1.00 40.63  ? 47  GLN H NE2   1 
ATOM 7021 N N     . VAL H 5 49  ? 98.049  105.784 128.045 1.00 40.73  ? 48  VAL H N     1 
ATOM 7022 C CA    . VAL H 5 49  ? 97.898  106.298 126.689 1.00 40.73  ? 48  VAL H CA    1 
ATOM 7023 C C     . VAL H 5 49  ? 97.598  105.171 125.706 1.00 40.73  ? 48  VAL H C     1 
ATOM 7024 O O     . VAL H 5 49  ? 96.838  105.354 124.749 1.00 40.73  ? 48  VAL H O     1 
ATOM 7025 C CB    . VAL H 5 49  ? 99.138  107.114 126.281 1.00 40.73  ? 48  VAL H CB    1 
ATOM 7026 C CG1   . VAL H 5 49  ? 100.349 106.220 126.087 1.00 40.73  ? 48  VAL H CG1   1 
ATOM 7027 C CG2   . VAL H 5 49  ? 98.845  107.907 125.031 1.00 40.73  ? 48  VAL H CG2   1 
ATOM 7028 N N     . HIS H 5 50  ? 98.172  103.992 125.932 1.00 41.80  ? 49  HIS H N     1 
ATOM 7029 C CA    . HIS H 5 50  ? 97.895  102.812 125.114 1.00 41.80  ? 49  HIS H CA    1 
ATOM 7030 C C     . HIS H 5 50  ? 97.988  101.583 125.997 1.00 41.80  ? 49  HIS H C     1 
ATOM 7031 O O     . HIS H 5 50  ? 99.048  100.955 126.115 1.00 41.80  ? 49  HIS H O     1 
ATOM 7032 C CB    . HIS H 5 50  ? 98.848  102.700 123.926 1.00 41.80  ? 49  HIS H CB    1 
ATOM 7033 C CG    . HIS H 5 50  ? 98.635  103.751 122.884 1.00 41.80  ? 49  HIS H CG    1 
ATOM 7034 N ND1   . HIS H 5 50  ? 97.520  103.777 122.075 1.00 41.80  ? 49  HIS H ND1   1 
ATOM 7035 C CD2   . HIS H 5 50  ? 99.388  104.814 122.520 1.00 41.80  ? 49  HIS H CD2   1 
ATOM 7036 C CE1   . HIS H 5 50  ? 97.596  104.809 121.256 1.00 41.80  ? 49  HIS H CE1   1 
ATOM 7037 N NE2   . HIS H 5 50  ? 98.720  105.456 121.505 1.00 41.80  ? 49  HIS H NE2   1 
ATOM 7038 N N     . PRO H 5 51  ? 96.877  101.192 126.625 1.00 42.88  ? 50  PRO H N     1 
ATOM 7039 C CA    . PRO H 5 51  ? 96.891  100.018 127.509 1.00 42.88  ? 50  PRO H CA    1 
ATOM 7040 C C     . PRO H 5 51  ? 97.041  98.707  126.768 1.00 42.88  ? 50  PRO H C     1 
ATOM 7041 O O     . PRO H 5 51  ? 97.260  97.675  127.416 1.00 42.88  ? 50  PRO H O     1 
ATOM 7042 C CB    . PRO H 5 51  ? 95.536  100.099 128.219 1.00 42.88  ? 50  PRO H CB    1 
ATOM 7043 C CG    . PRO H 5 51  ? 94.667  100.827 127.266 1.00 42.88  ? 50  PRO H CG    1 
ATOM 7044 C CD    . PRO H 5 51  ? 95.545  101.817 126.559 1.00 42.88  ? 50  PRO H CD    1 
ATOM 7045 N N     . ASP H 5 52  ? 96.934  98.710  125.443 1.00 45.84  ? 51  ASP H N     1 
ATOM 7046 C CA    . ASP H 5 52  ? 97.064  97.490  124.664 1.00 45.84  ? 51  ASP H CA    1 
ATOM 7047 C C     . ASP H 5 52  ? 98.431  97.361  124.020 1.00 45.84  ? 51  ASP H C     1 
ATOM 7048 O O     . ASP H 5 52  ? 98.906  96.240  123.818 1.00 45.84  ? 51  ASP H O     1 
ATOM 7049 C CB    . ASP H 5 52  ? 96.006  97.452  123.557 1.00 45.84  ? 51  ASP H CB    1 
ATOM 7050 C CG    . ASP H 5 52  ? 94.606  97.275  124.093 1.00 45.84  ? 51  ASP H CG    1 
ATOM 7051 O OD1   . ASP H 5 52  ? 94.300  97.862  125.151 1.00 45.84  ? 51  ASP H OD1   1 
ATOM 7052 O OD2   . ASP H 5 52  ? 93.807  96.564  123.450 1.00 45.84  ? 51  ASP H OD2   1 
ATOM 7053 N N     . THR H 5 53  ? 99.085  98.477  123.714 1.00 44.47  ? 52  THR H N     1 
ATOM 7054 C CA    . THR H 5 53  ? 100.362 98.442  123.021 1.00 44.47  ? 52  THR H CA    1 
ATOM 7055 C C     . THR H 5 53  ? 101.506 98.394  124.026 1.00 44.47  ? 52  THR H C     1 
ATOM 7056 O O     . THR H 5 53  ? 101.586 99.227  124.934 1.00 44.47  ? 52  THR H O     1 
ATOM 7057 C CB    . THR H 5 53  ? 100.512 99.664  122.116 1.00 44.47  ? 52  THR H CB    1 
ATOM 7058 O OG1   . THR H 5 53  ? 99.447  99.684  121.154 1.00 44.47  ? 52  THR H OG1   1 
ATOM 7059 C CG2   . THR H 5 53  ? 101.850 99.632  121.403 1.00 44.47  ? 52  THR H CG2   1 
ATOM 7060 N N     . GLY H 5 54  ? 102.388 97.413  123.849 1.00 43.19  ? 53  GLY H N     1 
ATOM 7061 C CA    . GLY H 5 54  ? 103.552 97.241  124.689 1.00 43.19  ? 53  GLY H CA    1 
ATOM 7062 C C     . GLY H 5 54  ? 104.757 97.972  124.130 1.00 43.19  ? 53  GLY H C     1 
ATOM 7063 O O     . GLY H 5 54  ? 104.704 98.609  123.079 1.00 43.19  ? 53  GLY H O     1 
ATOM 7064 N N     . ILE H 5 55  ? 105.866 97.886  124.865 1.00 42.31  ? 54  ILE H N     1 
ATOM 7065 C CA    . ILE H 5 55  ? 107.087 98.584  124.486 1.00 42.31  ? 54  ILE H CA    1 
ATOM 7066 C C     . ILE H 5 55  ? 108.257 97.620  124.637 1.00 42.31  ? 54  ILE H C     1 
ATOM 7067 O O     . ILE H 5 55  ? 108.214 96.679  125.434 1.00 42.31  ? 54  ILE H O     1 
ATOM 7068 C CB    . ILE H 5 55  ? 107.313 99.855  125.337 1.00 42.31  ? 54  ILE H CB    1 
ATOM 7069 C CG1   . ILE H 5 55  ? 108.403 100.735 124.723 1.00 42.31  ? 54  ILE H CG1   1 
ATOM 7070 C CG2   . ILE H 5 55  ? 107.672 99.485  126.768 1.00 42.31  ? 54  ILE H CG2   1 
ATOM 7071 C CD1   . ILE H 5 55  ? 108.478 102.125 125.307 1.00 42.31  ? 54  ILE H CD1   1 
ATOM 7072 N N     . SER H 5 56  ? 109.306 97.858  123.852 1.00 41.60  ? 55  SER H N     1 
ATOM 7073 C CA    . SER H 5 56  ? 110.478 96.993  123.840 1.00 41.60  ? 55  SER H CA    1 
ATOM 7074 C C     . SER H 5 56  ? 111.392 97.326  125.012 1.00 41.60  ? 55  SER H C     1 
ATOM 7075 O O     . SER H 5 56  ? 111.060 98.126  125.891 1.00 41.60  ? 55  SER H O     1 
ATOM 7076 C CB    . SER H 5 56  ? 111.218 97.113  122.513 1.00 41.60  ? 55  SER H CB    1 
ATOM 7077 O OG    . SER H 5 56  ? 112.409 96.348  122.533 1.00 41.60  ? 55  SER H OG    1 
ATOM 7078 N N     . SER H 5 57  ? 112.576 96.715  125.026 1.00 40.27  ? 56  SER H N     1 
ATOM 7079 C CA    . SER H 5 57  ? 113.530 96.964  126.092 1.00 40.27  ? 56  SER H CA    1 
ATOM 7080 C C     . SER H 5 57  ? 114.592 97.970  125.689 1.00 40.27  ? 56  SER H C     1 
ATOM 7081 O O     . SER H 5 57  ? 115.169 98.622  126.564 1.00 40.27  ? 56  SER H O     1 
ATOM 7082 C CB    . SER H 5 57  ? 114.214 95.661  126.515 1.00 40.27  ? 56  SER H CB    1 
ATOM 7083 O OG    . SER H 5 57  ? 113.414 94.948  127.439 1.00 40.27  ? 56  SER H OG    1 
ATOM 7084 N N     . LYS H 5 58  ? 114.865 98.108  124.392 1.00 39.52  ? 57  LYS H N     1 
ATOM 7085 C CA    . LYS H 5 58  ? 115.756 99.170  123.948 1.00 39.52  ? 57  LYS H CA    1 
ATOM 7086 C C     . LYS H 5 58  ? 115.012 100.493 123.868 1.00 39.52  ? 57  LYS H C     1 
ATOM 7087 O O     . LYS H 5 58  ? 115.591 101.551 124.144 1.00 39.52  ? 57  LYS H O     1 
ATOM 7088 C CB    . LYS H 5 58  ? 116.357 98.819  122.585 1.00 39.52  ? 57  LYS H CB    1 
ATOM 7089 C CG    . LYS H 5 58  ? 117.372 97.683  122.602 1.00 39.52  ? 57  LYS H CG    1 
ATOM 7090 C CD    . LYS H 5 58  ? 117.950 97.455  121.210 1.00 39.52  ? 57  LYS H CD    1 
ATOM 7091 C CE    . LYS H 5 58  ? 118.965 96.324  121.190 1.00 39.52  ? 57  LYS H CE    1 
ATOM 7092 N NZ    . LYS H 5 58  ? 119.517 96.117  119.822 1.00 39.52  ? 57  LYS H NZ    1 
ATOM 7093 N N     . ALA H 5 59  ? 113.718 100.444 123.541 1.00 39.42  ? 58  ALA H N     1 
ATOM 7094 C CA    . ALA H 5 59  ? 112.930 101.662 123.460 1.00 39.42  ? 58  ALA H CA    1 
ATOM 7095 C C     . ALA H 5 59  ? 112.677 102.243 124.837 1.00 39.42  ? 58  ALA H C     1 
ATOM 7096 O O     . ALA H 5 59  ? 112.511 103.459 124.966 1.00 39.42  ? 58  ALA H O     1 
ATOM 7097 C CB    . ALA H 5 59  ? 111.604 101.391 122.752 1.00 39.42  ? 58  ALA H CB    1 
ATOM 7098 N N     . MET H 5 60  ? 112.717 101.407 125.875 1.00 40.21  ? 59  MET H N     1 
ATOM 7099 C CA    . MET H 5 60  ? 112.608 101.923 127.231 1.00 40.21  ? 59  MET H CA    1 
ATOM 7100 C C     . MET H 5 60  ? 113.876 102.658 127.627 1.00 40.21  ? 59  MET H C     1 
ATOM 7101 O O     . MET H 5 60  ? 113.813 103.697 128.290 1.00 40.21  ? 59  MET H O     1 
ATOM 7102 C CB    . MET H 5 60  ? 112.310 100.791 128.209 1.00 40.21  ? 59  MET H CB    1 
ATOM 7103 C CG    . MET H 5 60  ? 112.139 101.254 129.641 1.00 40.21  ? 59  MET H CG    1 
ATOM 7104 S SD    . MET H 5 60  ? 110.795 102.442 129.807 1.00 40.21  ? 59  MET H SD    1 
ATOM 7105 C CE    . MET H 5 60  ? 109.379 101.367 129.615 1.00 40.21  ? 59  MET H CE    1 
ATOM 7106 N N     . GLY H 5 61  ? 115.036 102.173 127.183 1.00 37.78  ? 60  GLY H N     1 
ATOM 7107 C CA    . GLY H 5 61  ? 116.260 102.904 127.448 1.00 37.78  ? 60  GLY H CA    1 
ATOM 7108 C C     . GLY H 5 61  ? 116.348 104.172 126.629 1.00 37.78  ? 60  GLY H C     1 
ATOM 7109 O O     . GLY H 5 61  ? 116.907 105.173 127.086 1.00 37.78  ? 60  GLY H O     1 
ATOM 7110 N N     . ILE H 5 62  ? 115.707 104.187 125.461 1.00 36.62  ? 61  ILE H N     1 
ATOM 7111 C CA    . ILE H 5 62  ? 115.710 105.400 124.654 1.00 36.62  ? 61  ILE H CA    1 
ATOM 7112 C C     . ILE H 5 62  ? 114.793 106.437 125.278 1.00 36.62  ? 61  ILE H C     1 
ATOM 7113 O O     . ILE H 5 62  ? 115.142 107.619 125.366 1.00 36.62  ? 61  ILE H O     1 
ATOM 7114 C CB    . ILE H 5 62  ? 115.319 105.087 123.203 1.00 36.62  ? 61  ILE H CB    1 
ATOM 7115 C CG1   . ILE H 5 62  ? 116.373 104.180 122.583 1.00 36.62  ? 61  ILE H CG1   1 
ATOM 7116 C CG2   . ILE H 5 62  ? 115.170 106.364 122.400 1.00 36.62  ? 61  ILE H CG2   1 
ATOM 7117 C CD1   . ILE H 5 62  ? 115.957 103.589 121.295 1.00 36.62  ? 61  ILE H CD1   1 
ATOM 7118 N N     . MET H 5 63  ? 113.621 106.014 125.750 1.00 36.48  ? 62  MET H N     1 
ATOM 7119 C CA    . MET H 5 63  ? 112.731 106.961 126.400 1.00 36.48  ? 62  MET H CA    1 
ATOM 7120 C C     . MET H 5 63  ? 113.269 107.383 127.756 1.00 36.48  ? 62  MET H C     1 
ATOM 7121 O O     . MET H 5 63  ? 113.020 108.513 128.180 1.00 36.48  ? 62  MET H O     1 
ATOM 7122 C CB    . MET H 5 63  ? 111.335 106.361 126.558 1.00 36.48  ? 62  MET H CB    1 
ATOM 7123 C CG    . MET H 5 63  ? 110.609 106.117 125.255 1.00 36.48  ? 62  MET H CG    1 
ATOM 7124 S SD    . MET H 5 63  ? 110.387 107.643 124.332 1.00 36.48  ? 62  MET H SD    1 
ATOM 7125 C CE    . MET H 5 63  ? 109.241 108.503 125.402 1.00 36.48  ? 62  MET H CE    1 
ATOM 7126 N N     . ASN H 5 64  ? 114.101 106.554 128.388 1.00 36.56  ? 63  ASN H N     1 
ATOM 7127 C CA    . ASN H 5 64  ? 114.687 106.945 129.660 1.00 36.56  ? 63  ASN H CA    1 
ATOM 7128 C C     . ASN H 5 64  ? 115.851 107.903 129.465 1.00 36.56  ? 63  ASN H C     1 
ATOM 7129 O O     . ASN H 5 64  ? 116.033 108.822 130.273 1.00 36.56  ? 63  ASN H O     1 
ATOM 7130 C CB    . ASN H 5 64  ? 115.143 105.698 130.417 1.00 36.56  ? 63  ASN H CB    1 
ATOM 7131 C CG    . ASN H 5 64  ? 115.306 105.940 131.898 1.00 36.56  ? 63  ASN H CG    1 
ATOM 7132 O OD1   . ASN H 5 64  ? 115.076 107.045 132.385 1.00 36.56  ? 63  ASN H OD1   1 
ATOM 7133 N ND2   . ASN H 5 64  ? 115.706 104.906 132.626 1.00 36.56  ? 63  ASN H ND2   1 
ATOM 7134 N N     . SER H 5 65  ? 116.565 107.795 128.344 1.00 35.04  ? 64  SER H N     1 
ATOM 7135 C CA    . SER H 5 65  ? 117.597 108.787 128.082 1.00 35.04  ? 64  SER H CA    1 
ATOM 7136 C C     . SER H 5 65  ? 116.972 110.071 127.570 1.00 35.04  ? 64  SER H C     1 
ATOM 7137 O O     . SER H 5 65  ? 117.469 111.163 127.861 1.00 35.04  ? 64  SER H O     1 
ATOM 7138 C CB    . SER H 5 65  ? 118.612 108.251 127.074 1.00 35.04  ? 64  SER H CB    1 
ATOM 7139 O OG    . SER H 5 65  ? 118.017 108.096 125.801 1.00 35.04  ? 64  SER H OG    1 
ATOM 7140 N N     . PHE H 5 66  ? 115.824 109.962 126.908 1.00 35.00  ? 65  PHE H N     1 
ATOM 7141 C CA    . PHE H 5 66  ? 115.094 111.150 126.496 1.00 35.00  ? 65  PHE H CA    1 
ATOM 7142 C C     . PHE H 5 66  ? 114.574 111.910 127.705 1.00 35.00  ? 65  PHE H C     1 
ATOM 7143 O O     . PHE H 5 66  ? 114.661 113.143 127.756 1.00 35.00  ? 65  PHE H O     1 
ATOM 7144 C CB    . PHE H 5 66  ? 113.941 110.749 125.576 1.00 35.00  ? 65  PHE H CB    1 
ATOM 7145 C CG    . PHE H 5 66  ? 112.927 111.831 125.366 1.00 35.00  ? 65  PHE H CG    1 
ATOM 7146 C CD1   . PHE H 5 66  ? 113.230 112.961 124.633 1.00 35.00  ? 65  PHE H CD1   1 
ATOM 7147 C CD2   . PHE H 5 66  ? 111.662 111.714 125.911 1.00 35.00  ? 65  PHE H CD2   1 
ATOM 7148 C CE1   . PHE H 5 66  ? 112.287 113.950 124.448 1.00 35.00  ? 65  PHE H CE1   1 
ATOM 7149 C CE2   . PHE H 5 66  ? 110.720 112.697 125.728 1.00 35.00  ? 65  PHE H CE2   1 
ATOM 7150 C CZ    . PHE H 5 66  ? 111.031 113.816 124.996 1.00 35.00  ? 65  PHE H CZ    1 
ATOM 7151 N N     . VAL H 5 67  ? 114.043 111.192 128.696 1.00 35.62  ? 66  VAL H N     1 
ATOM 7152 C CA    . VAL H 5 67  ? 113.528 111.874 129.874 1.00 35.62  ? 66  VAL H CA    1 
ATOM 7153 C C     . VAL H 5 67  ? 114.655 112.444 130.725 1.00 35.62  ? 66  VAL H C     1 
ATOM 7154 O O     . VAL H 5 67  ? 114.569 113.588 131.189 1.00 35.62  ? 66  VAL H O     1 
ATOM 7155 C CB    . VAL H 5 67  ? 112.663 110.902 130.693 1.00 35.62  ? 66  VAL H CB    1 
ATOM 7156 C CG1   . VAL H 5 67  ? 112.275 111.520 132.008 1.00 35.62  ? 66  VAL H CG1   1 
ATOM 7157 C CG2   . VAL H 5 67  ? 111.448 110.494 129.919 1.00 35.62  ? 66  VAL H CG2   1 
ATOM 7158 N N     . ASN H 5 68  ? 115.758 111.703 130.900 1.00 36.04  ? 67  ASN H N     1 
ATOM 7159 C CA    . ASN H 5 68  ? 116.852 112.291 131.667 1.00 36.04  ? 67  ASN H CA    1 
ATOM 7160 C C     . ASN H 5 68  ? 117.546 113.419 130.919 1.00 36.04  ? 67  ASN H C     1 
ATOM 7161 O O     . ASN H 5 68  ? 118.047 114.349 131.563 1.00 36.04  ? 67  ASN H O     1 
ATOM 7162 C CB    . ASN H 5 68  ? 117.848 111.206 132.110 1.00 36.04  ? 67  ASN H CB    1 
ATOM 7163 C CG    . ASN H 5 68  ? 118.655 110.611 130.965 1.00 36.04  ? 67  ASN H CG    1 
ATOM 7164 O OD1   . ASN H 5 68  ? 119.046 111.295 130.023 1.00 36.04  ? 67  ASN H OD1   1 
ATOM 7165 N ND2   . ASN H 5 68  ? 118.919 109.313 131.058 1.00 36.04  ? 67  ASN H ND2   1 
ATOM 7166 N N     . ASP H 5 69  ? 117.354 113.506 129.606 1.00 36.21  ? 68  ASP H N     1 
ATOM 7167 C CA    . ASP H 5 69  ? 117.939 114.622 128.885 1.00 36.21  ? 68  ASP H CA    1 
ATOM 7168 C C     . ASP H 5 69  ? 117.045 115.843 128.929 1.00 36.21  ? 68  ASP H C     1 
ATOM 7169 O O     . ASP H 5 69  ? 117.533 116.948 129.182 1.00 36.21  ? 68  ASP H O     1 
ATOM 7170 C CB    . ASP H 5 69  ? 118.209 114.215 127.435 1.00 36.21  ? 68  ASP H CB    1 
ATOM 7171 C CG    . ASP H 5 69  ? 118.910 115.294 126.647 1.00 36.21  ? 68  ASP H CG    1 
ATOM 7172 O OD1   . ASP H 5 69  ? 120.117 115.512 126.878 1.00 36.21  ? 68  ASP H OD1   1 
ATOM 7173 O OD2   . ASP H 5 69  ? 118.254 115.918 125.787 1.00 36.21  ? 68  ASP H OD2   1 
ATOM 7174 N N     . ILE H 5 70  ? 115.738 115.685 128.721 1.00 36.15  ? 69  ILE H N     1 
ATOM 7175 C CA    . ILE H 5 70  ? 114.899 116.869 128.784 1.00 36.15  ? 69  ILE H CA    1 
ATOM 7176 C C     . ILE H 5 70  ? 114.720 117.331 130.218 1.00 36.15  ? 69  ILE H C     1 
ATOM 7177 O O     . ILE H 5 70  ? 114.519 118.529 130.449 1.00 36.15  ? 69  ILE H O     1 
ATOM 7178 C CB    . ILE H 5 70  ? 113.529 116.601 128.131 1.00 36.15  ? 69  ILE H CB    1 
ATOM 7179 C CG1   . ILE H 5 70  ? 112.916 117.904 127.622 1.00 36.15  ? 69  ILE H CG1   1 
ATOM 7180 C CG2   . ILE H 5 70  ? 112.593 115.925 129.112 1.00 36.15  ? 69  ILE H CG2   1 
ATOM 7181 C CD1   . ILE H 5 70  ? 113.686 118.541 126.493 1.00 36.15  ? 69  ILE H CD1   1 
ATOM 7182 N N     . PHE H 5 71  ? 115.040 116.469 131.188 1.00 36.95  ? 70  PHE H N     1 
ATOM 7183 C CA    . PHE H 5 71  ? 115.096 116.908 132.574 1.00 36.95  ? 70  PHE H CA    1 
ATOM 7184 C C     . PHE H 5 71  ? 116.366 117.696 132.850 1.00 36.95  ? 70  PHE H C     1 
ATOM 7185 O O     . PHE H 5 71  ? 116.308 118.780 133.445 1.00 36.95  ? 70  PHE H O     1 
ATOM 7186 C CB    . PHE H 5 71  ? 115.012 115.694 133.498 1.00 36.95  ? 70  PHE H CB    1 
ATOM 7187 C CG    . PHE H 5 71  ? 115.193 116.023 134.943 1.00 36.95  ? 70  PHE H CG    1 
ATOM 7188 C CD1   . PHE H 5 71  ? 114.168 116.584 135.673 1.00 36.95  ? 70  PHE H CD1   1 
ATOM 7189 C CD2   . PHE H 5 71  ? 116.404 115.790 135.567 1.00 36.95  ? 70  PHE H CD2   1 
ATOM 7190 C CE1   . PHE H 5 71  ? 114.343 116.890 137.002 1.00 36.95  ? 70  PHE H CE1   1 
ATOM 7191 C CE2   . PHE H 5 71  ? 116.583 116.100 136.893 1.00 36.95  ? 70  PHE H CE2   1 
ATOM 7192 C CZ    . PHE H 5 71  ? 115.550 116.652 137.610 1.00 36.95  ? 70  PHE H CZ    1 
ATOM 7193 N N     . GLU H 5 72  ? 117.521 117.198 132.400 1.00 38.23  ? 71  GLU H N     1 
ATOM 7194 C CA    . GLU H 5 72  ? 118.736 117.915 132.752 1.00 38.23  ? 71  GLU H CA    1 
ATOM 7195 C C     . GLU H 5 72  ? 118.943 119.124 131.851 1.00 38.23  ? 71  GLU H C     1 
ATOM 7196 O O     . GLU H 5 72  ? 119.863 119.913 132.091 1.00 38.23  ? 71  GLU H O     1 
ATOM 7197 C CB    . GLU H 5 72  ? 119.952 116.979 132.759 1.00 38.23  ? 71  GLU H CB    1 
ATOM 7198 C CG    . GLU H 5 72  ? 120.390 116.382 131.445 1.00 38.23  ? 71  GLU H CG    1 
ATOM 7199 C CD    . GLU H 5 72  ? 121.651 115.547 131.612 1.00 38.23  ? 71  GLU H CD    1 
ATOM 7200 O OE1   . GLU H 5 72  ? 122.226 115.558 132.723 1.00 38.23  ? 71  GLU H OE1   1 
ATOM 7201 O OE2   . GLU H 5 72  ? 122.064 114.874 130.643 1.00 38.23  ? 71  GLU H OE2   1 
ATOM 7202 N N     . ARG H 5 73  ? 118.101 119.280 130.825 1.00 36.75  ? 72  ARG H N     1 
ATOM 7203 C CA    . ARG H 5 73  ? 118.065 120.492 130.017 1.00 36.75  ? 72  ARG H CA    1 
ATOM 7204 C C     . ARG H 5 73  ? 117.113 121.523 130.603 1.00 36.75  ? 72  ARG H C     1 
ATOM 7205 O O     . ARG H 5 73  ? 117.467 122.705 130.688 1.00 36.75  ? 72  ARG H O     1 
ATOM 7206 C CB    . ARG H 5 73  ? 117.657 120.176 128.579 1.00 36.75  ? 72  ARG H CB    1 
ATOM 7207 C CG    . ARG H 5 73  ? 118.707 119.455 127.770 1.00 36.75  ? 72  ARG H CG    1 
ATOM 7208 C CD    . ARG H 5 73  ? 118.142 119.050 126.427 1.00 36.75  ? 72  ARG H CD    1 
ATOM 7209 N NE    . ARG H 5 73  ? 117.747 120.201 125.626 1.00 36.75  ? 72  ARG H NE    1 
ATOM 7210 C CZ    . ARG H 5 73  ? 117.054 120.113 124.497 1.00 36.75  ? 72  ARG H CZ    1 
ATOM 7211 N NH1   . ARG H 5 73  ? 116.680 118.926 124.041 1.00 36.75  ? 72  ARG H NH1   1 
ATOM 7212 N NH2   . ARG H 5 73  ? 116.730 121.209 123.826 1.00 36.75  ? 72  ARG H NH2   1 
ATOM 7213 N N     . ILE H 5 74  ? 115.931 121.105 131.069 1.00 35.78  ? 73  ILE H N     1 
ATOM 7214 C CA    . ILE H 5 74  ? 115.011 122.085 131.633 1.00 35.78  ? 73  ILE H CA    1 
ATOM 7215 C C     . ILE H 5 74  ? 115.552 122.591 132.960 1.00 35.78  ? 73  ILE H C     1 
ATOM 7216 O O     . ILE H 5 74  ? 115.487 123.790 133.253 1.00 35.78  ? 73  ILE H O     1 
ATOM 7217 C CB    . ILE H 5 74  ? 113.593 121.508 131.770 1.00 35.78  ? 73  ILE H CB    1 
ATOM 7218 C CG1   . ILE H 5 74  ? 113.011 121.212 130.391 1.00 35.78  ? 73  ILE H CG1   1 
ATOM 7219 C CG2   . ILE H 5 74  ? 112.696 122.485 132.497 1.00 35.78  ? 73  ILE H CG2   1 
ATOM 7220 C CD1   . ILE H 5 74  ? 111.695 120.485 130.428 1.00 35.78  ? 73  ILE H CD1   1 
ATOM 7221 N N     . ALA H 5 75  ? 116.109 121.698 133.780 1.00 37.57  ? 74  ALA H N     1 
ATOM 7222 C CA    . ALA H 5 75  ? 116.646 122.143 135.058 1.00 37.57  ? 74  ALA H CA    1 
ATOM 7223 C C     . ALA H 5 75  ? 117.892 123.000 134.874 1.00 37.57  ? 74  ALA H C     1 
ATOM 7224 O O     . ALA H 5 75  ? 118.132 123.915 135.667 1.00 37.57  ? 74  ALA H O     1 
ATOM 7225 C CB    . ALA H 5 75  ? 116.965 120.937 135.935 1.00 37.57  ? 74  ALA H CB    1 
ATOM 7226 N N     . GLY H 5 76  ? 118.638 122.795 133.794 1.00 38.62  ? 75  GLY H N     1 
ATOM 7227 C CA    . GLY H 5 76  ? 119.826 123.593 133.562 1.00 38.62  ? 75  GLY H CA    1 
ATOM 7228 C C     . GLY H 5 76  ? 119.434 124.969 133.071 1.00 38.62  ? 75  GLY H C     1 
ATOM 7229 O O     . GLY H 5 76  ? 120.026 125.987 133.461 1.00 38.62  ? 75  GLY H O     1 
ATOM 7230 N N     . GLU H 5 77  ? 118.369 125.019 132.271 1.00 37.77  ? 76  GLU H N     1 
ATOM 7231 C CA    . GLU H 5 77  ? 117.902 126.311 131.797 1.00 37.77  ? 76  GLU H CA    1 
ATOM 7232 C C     . GLU H 5 77  ? 117.286 127.090 132.946 1.00 37.77  ? 76  GLU H C     1 
ATOM 7233 O O     . GLU H 5 77  ? 117.487 128.304 133.061 1.00 37.77  ? 76  GLU H O     1 
ATOM 7234 C CB    . GLU H 5 77  ? 116.882 126.119 130.676 1.00 37.77  ? 76  GLU H CB    1 
ATOM 7235 C CG    . GLU H 5 77  ? 116.381 127.403 130.024 1.00 37.77  ? 76  GLU H CG    1 
ATOM 7236 C CD    . GLU H 5 77  ? 117.383 128.019 129.071 1.00 37.77  ? 76  GLU H CD    1 
ATOM 7237 O OE1   . GLU H 5 77  ? 118.171 127.262 128.473 1.00 37.77  ? 76  GLU H OE1   1 
ATOM 7238 O OE2   . GLU H 5 77  ? 117.381 129.255 128.910 1.00 37.77  ? 76  GLU H OE2   1 
ATOM 7239 N N     . ALA H 5 78  ? 116.600 126.396 133.856 1.00 38.00  ? 77  ALA H N     1 
ATOM 7240 C CA    . ALA H 5 78  ? 116.036 127.086 135.004 1.00 38.00  ? 77  ALA H CA    1 
ATOM 7241 C C     . ALA H 5 78  ? 117.094 127.470 136.025 1.00 38.00  ? 77  ALA H C     1 
ATOM 7242 O O     . ALA H 5 78  ? 116.907 128.458 136.738 1.00 38.00  ? 77  ALA H O     1 
ATOM 7243 C CB    . ALA H 5 78  ? 114.967 126.218 135.668 1.00 38.00  ? 77  ALA H CB    1 
ATOM 7244 N N     . SER H 5 79  ? 118.245 126.792 136.050 1.00 39.85  ? 78  SER H N     1 
ATOM 7245 C CA    . SER H 5 79  ? 119.301 127.285 136.924 1.00 39.85  ? 78  SER H CA    1 
ATOM 7246 C C     . SER H 5 79  ? 120.002 128.491 136.329 1.00 39.85  ? 78  SER H C     1 
ATOM 7247 O O     . SER H 5 79  ? 120.371 129.416 137.065 1.00 39.85  ? 78  SER H O     1 
ATOM 7248 C CB    . SER H 5 79  ? 120.322 126.184 137.179 1.00 39.85  ? 78  SER H CB    1 
ATOM 7249 O OG    . SER H 5 79  ? 119.702 125.097 137.819 1.00 39.85  ? 78  SER H OG    1 
ATOM 7250 N N     . ARG H 5 80  ? 120.105 128.557 135.002 1.00 39.66  ? 79  ARG H N     1 
ATOM 7251 C CA    . ARG H 5 80  ? 120.678 129.764 134.425 1.00 39.66  ? 79  ARG H CA    1 
ATOM 7252 C C     . ARG H 5 80  ? 119.719 130.934 134.579 1.00 39.66  ? 79  ARG H C     1 
ATOM 7253 O O     . ARG H 5 80  ? 120.159 132.076 134.745 1.00 39.66  ? 79  ARG H O     1 
ATOM 7254 C CB    . ARG H 5 80  ? 121.114 129.562 132.972 1.00 39.66  ? 79  ARG H CB    1 
ATOM 7255 C CG    . ARG H 5 80  ? 122.266 128.575 132.846 1.00 39.66  ? 79  ARG H CG    1 
ATOM 7256 C CD    . ARG H 5 80  ? 122.773 128.386 131.420 1.00 39.66  ? 79  ARG H CD    1 
ATOM 7257 N NE    . ARG H 5 80  ? 121.924 127.563 130.571 1.00 39.66  ? 79  ARG H NE    1 
ATOM 7258 C CZ    . ARG H 5 80  ? 120.976 128.038 129.773 1.00 39.66  ? 79  ARG H CZ    1 
ATOM 7259 N NH1   . ARG H 5 80  ? 120.751 129.343 129.704 1.00 39.66  ? 79  ARG H NH1   1 
ATOM 7260 N NH2   . ARG H 5 80  ? 120.267 127.203 129.031 1.00 39.66  ? 79  ARG H NH2   1 
ATOM 7261 N N     . LEU H 5 81  ? 118.412 130.672 134.525 1.00 38.38  ? 80  LEU H N     1 
ATOM 7262 C CA    . LEU H 5 81  ? 117.448 131.745 134.738 1.00 38.38  ? 80  LEU H CA    1 
ATOM 7263 C C     . LEU H 5 81  ? 117.356 132.157 136.203 1.00 38.38  ? 80  LEU H C     1 
ATOM 7264 O O     . LEU H 5 81  ? 117.037 133.314 136.496 1.00 38.38  ? 80  LEU H O     1 
ATOM 7265 C CB    . LEU H 5 81  ? 116.074 131.299 134.243 1.00 38.38  ? 80  LEU H CB    1 
ATOM 7266 C CG    . LEU H 5 81  ? 115.681 131.462 132.780 1.00 38.38  ? 80  LEU H CG    1 
ATOM 7267 C CD1   . LEU H 5 81  ? 116.794 131.070 131.838 1.00 38.38  ? 80  LEU H CD1   1 
ATOM 7268 C CD2   . LEU H 5 81  ? 114.486 130.573 132.539 1.00 38.38  ? 80  LEU H CD2   1 
ATOM 7269 N N     . ALA H 5 82  ? 117.637 131.244 137.135 1.00 41.88  ? 81  ALA H N     1 
ATOM 7270 C CA    . ALA H 5 82  ? 117.748 131.643 138.533 1.00 41.88  ? 81  ALA H CA    1 
ATOM 7271 C C     . ALA H 5 82  ? 119.042 132.393 138.817 1.00 41.88  ? 81  ALA H C     1 
ATOM 7272 O O     . ALA H 5 82  ? 119.113 133.131 139.805 1.00 41.88  ? 81  ALA H O     1 
ATOM 7273 C CB    . ALA H 5 82  ? 117.638 130.418 139.439 1.00 41.88  ? 81  ALA H CB    1 
ATOM 7274 N N     . HIS H 5 83  ? 120.063 132.219 137.979 1.00 42.33  ? 82  HIS H N     1 
ATOM 7275 C CA    . HIS H 5 83  ? 121.289 132.991 138.144 1.00 42.33  ? 82  HIS H CA    1 
ATOM 7276 C C     . HIS H 5 83  ? 121.215 134.359 137.477 1.00 42.33  ? 82  HIS H C     1 
ATOM 7277 O O     . HIS H 5 83  ? 121.787 135.325 137.993 1.00 42.33  ? 82  HIS H O     1 
ATOM 7278 C CB    . HIS H 5 83  ? 122.482 132.217 137.586 1.00 42.33  ? 82  HIS H CB    1 
ATOM 7279 C CG    . HIS H 5 83  ? 123.802 132.849 137.898 1.00 42.33  ? 82  HIS H CG    1 
ATOM 7280 N ND1   . HIS H 5 83  ? 124.375 133.806 137.090 1.00 42.33  ? 82  HIS H ND1   1 
ATOM 7281 C CD2   . HIS H 5 83  ? 124.653 132.673 138.936 1.00 42.33  ? 82  HIS H CD2   1 
ATOM 7282 C CE1   . HIS H 5 83  ? 125.527 134.187 137.612 1.00 42.33  ? 82  HIS H CE1   1 
ATOM 7283 N NE2   . HIS H 5 83  ? 125.719 133.515 138.733 1.00 42.33  ? 82  HIS H NE2   1 
ATOM 7284 N N     . TYR H 5 84  ? 120.523 134.460 136.341 1.00 40.69  ? 83  TYR H N     1 
ATOM 7285 C CA    . TYR H 5 84  ? 120.426 135.733 135.632 1.00 40.69  ? 83  TYR H CA    1 
ATOM 7286 C C     . TYR H 5 84  ? 119.627 136.769 136.416 1.00 40.69  ? 83  TYR H C     1 
ATOM 7287 O O     . TYR H 5 84  ? 119.860 137.973 136.264 1.00 40.69  ? 83  TYR H O     1 
ATOM 7288 C CB    . TYR H 5 84  ? 119.814 135.504 134.249 1.00 40.69  ? 83  TYR H CB    1 
ATOM 7289 C CG    . TYR H 5 84  ? 120.748 134.810 133.275 1.00 40.69  ? 83  TYR H CG    1 
ATOM 7290 C CD1   . TYR H 5 84  ? 122.108 134.706 133.539 1.00 40.69  ? 83  TYR H CD1   1 
ATOM 7291 C CD2   . TYR H 5 84  ? 120.266 134.247 132.100 1.00 40.69  ? 83  TYR H CD2   1 
ATOM 7292 C CE1   . TYR H 5 84  ? 122.962 134.071 132.656 1.00 40.69  ? 83  TYR H CE1   1 
ATOM 7293 C CE2   . TYR H 5 84  ? 121.112 133.609 131.211 1.00 40.69  ? 83  TYR H CE2   1 
ATOM 7294 C CZ    . TYR H 5 84  ? 122.459 133.524 131.495 1.00 40.69  ? 83  TYR H CZ    1 
ATOM 7295 O OH    . TYR H 5 84  ? 123.307 132.892 130.615 1.00 40.69  ? 83  TYR H OH    1 
ATOM 7296 N N     . ASN H 5 85  ? 118.679 136.327 137.239 1.00 41.91  ? 84  ASN H N     1 
ATOM 7297 C CA    . ASN H 5 85  ? 117.896 137.187 138.121 1.00 41.91  ? 84  ASN H CA    1 
ATOM 7298 C C     . ASN H 5 85  ? 118.418 137.212 139.548 1.00 41.91  ? 84  ASN H C     1 
ATOM 7299 O O     . ASN H 5 85  ? 117.769 137.800 140.420 1.00 41.91  ? 84  ASN H O     1 
ATOM 7300 C CB    . ASN H 5 85  ? 116.422 136.791 138.110 1.00 41.91  ? 84  ASN H CB    1 
ATOM 7301 C CG    . ASN H 5 85  ? 115.776 137.042 136.773 1.00 41.91  ? 84  ASN H CG    1 
ATOM 7302 O OD1   . ASN H 5 85  ? 116.091 138.018 136.091 1.00 41.91  ? 84  ASN H OD1   1 
ATOM 7303 N ND2   . ASN H 5 85  ? 114.856 136.183 136.396 1.00 41.91  ? 84  ASN H ND2   1 
ATOM 7304 N N     . LYS H 5 86  ? 119.555 136.567 139.809 1.00 46.05  ? 85  LYS H N     1 
ATOM 7305 C CA    . LYS H 5 86  ? 120.208 136.598 141.115 1.00 46.05  ? 85  LYS H CA    1 
ATOM 7306 C C     . LYS H 5 86  ? 119.296 136.054 142.207 1.00 46.05  ? 85  LYS H C     1 
ATOM 7307 O O     . LYS H 5 86  ? 119.402 136.447 143.371 1.00 46.05  ? 85  LYS H O     1 
ATOM 7308 C CB    . LYS H 5 86  ? 120.619 138.028 141.487 1.00 46.05  ? 85  LYS H CB    1 
ATOM 7309 C CG    . LYS H 5 86  ? 121.642 138.706 140.599 1.00 46.05  ? 85  LYS H CG    1 
ATOM 7310 C CD    . LYS H 5 86  ? 121.882 140.126 141.110 1.00 46.05  ? 85  LYS H CD    1 
ATOM 7311 C CE    . LYS H 5 86  ? 122.958 140.860 140.326 1.00 46.05  ? 85  LYS H CE    1 
ATOM 7312 N NZ    . LYS H 5 86  ? 123.102 142.263 140.811 1.00 46.05  ? 85  LYS H NZ    1 
ATOM 7313 N N     . ARG H 5 87  ? 118.388 135.152 141.841 1.00 50.36  ? 86  ARG H N     1 
ATOM 7314 C CA    . ARG H 5 87  ? 117.601 134.445 142.836 1.00 50.36  ? 86  ARG H CA    1 
ATOM 7315 C C     . ARG H 5 87  ? 118.377 133.243 143.367 1.00 50.36  ? 86  ARG H C     1 
ATOM 7316 O O     . ARG H 5 87  ? 119.498 132.949 142.943 1.00 50.36  ? 86  ARG H O     1 
ATOM 7317 C CB    . ARG H 5 87  ? 116.263 134.010 142.248 1.00 50.36  ? 86  ARG H CB    1 
ATOM 7318 C CG    . ARG H 5 87  ? 115.412 135.156 141.753 1.00 50.36  ? 86  ARG H CG    1 
ATOM 7319 C CD    . ARG H 5 87  ? 115.025 136.047 142.912 1.00 50.36  ? 86  ARG H CD    1 
ATOM 7320 N NE    . ARG H 5 87  ? 114.101 137.107 142.524 1.00 50.36  ? 86  ARG H NE    1 
ATOM 7321 C CZ    . ARG H 5 87  ? 113.729 138.090 143.335 1.00 50.36  ? 86  ARG H CZ    1 
ATOM 7322 N NH1   . ARG H 5 87  ? 114.218 138.150 144.566 1.00 50.36  ? 86  ARG H NH1   1 
ATOM 7323 N NH2   . ARG H 5 87  ? 112.882 139.019 142.916 1.00 50.36  ? 86  ARG H NH2   1 
ATOM 7324 N N     . SER H 5 88  ? 117.760 132.536 144.310 1.00 51.28  ? 87  SER H N     1 
ATOM 7325 C CA    . SER H 5 88  ? 118.305 131.301 144.858 1.00 51.28  ? 87  SER H CA    1 
ATOM 7326 C C     . SER H 5 88  ? 117.338 130.132 144.801 1.00 51.28  ? 87  SER H C     1 
ATOM 7327 O O     . SER H 5 88  ? 117.786 128.982 144.898 1.00 51.28  ? 87  SER H O     1 
ATOM 7328 C CB    . SER H 5 88  ? 118.742 131.502 146.316 1.00 51.28  ? 87  SER H CB    1 
ATOM 7329 O OG    . SER H 5 88  ? 119.774 132.465 146.407 1.00 51.28  ? 87  SER H OG    1 
ATOM 7330 N N     . THR H 5 89  ? 116.042 130.384 144.657 1.00 47.37  ? 88  THR H N     1 
ATOM 7331 C CA    . THR H 5 89  ? 115.014 129.355 144.633 1.00 47.37  ? 88  THR H CA    1 
ATOM 7332 C C     . THR H 5 89  ? 114.465 129.169 143.223 1.00 47.37  ? 88  THR H C     1 
ATOM 7333 O O     . THR H 5 89  ? 114.008 130.131 142.595 1.00 47.37  ? 88  THR H O     1 
ATOM 7334 C CB    . THR H 5 89  ? 113.887 129.680 145.620 1.00 47.37  ? 88  THR H CB    1 
ATOM 7335 O OG1   . THR H 5 89  ? 112.914 128.630 145.598 1.00 47.37  ? 88  THR H OG1   1 
ATOM 7336 C CG2   . THR H 5 89  ? 113.209 131.010 145.304 1.00 47.37  ? 88  THR H CG2   1 
ATOM 7337 N N     . ILE H 5 90  ? 114.567 127.947 142.708 1.00 42.29  ? 89  ILE H N     1 
ATOM 7338 C CA    . ILE H 5 90  ? 113.905 127.592 141.459 1.00 42.29  ? 89  ILE H CA    1 
ATOM 7339 C C     . ILE H 5 90  ? 112.436 127.396 141.807 1.00 42.29  ? 89  ILE H C     1 
ATOM 7340 O O     . ILE H 5 90  ? 112.070 126.427 142.475 1.00 42.29  ? 89  ILE H O     1 
ATOM 7341 C CB    . ILE H 5 90  ? 114.501 126.331 140.825 1.00 42.29  ? 89  ILE H CB    1 
ATOM 7342 C CG1   . ILE H 5 90  ? 115.914 126.597 140.311 1.00 42.29  ? 89  ILE H CG1   1 
ATOM 7343 C CG2   . ILE H 5 90  ? 113.614 125.829 139.703 1.00 42.29  ? 89  ILE H CG2   1 
ATOM 7344 C CD1   . ILE H 5 90  ? 116.601 125.374 139.750 1.00 42.29  ? 89  ILE H CD1   1 
ATOM 7345 N N     . THR H 5 91  ? 111.596 128.311 141.354 1.00 38.91  ? 90  THR H N     1 
ATOM 7346 C CA    . THR H 5 91  ? 110.168 128.209 141.568 1.00 38.91  ? 90  THR H CA    1 
ATOM 7347 C C     . THR H 5 91  ? 109.563 127.545 140.335 1.00 38.91  ? 90  THR H C     1 
ATOM 7348 O O     . THR H 5 91  ? 110.281 127.062 139.456 1.00 38.91  ? 90  THR H O     1 
ATOM 7349 C CB    . THR H 5 91  ? 109.603 129.605 141.856 1.00 38.91  ? 90  THR H CB    1 
ATOM 7350 O OG1   . THR H 5 91  ? 110.443 130.261 142.814 1.00 38.91  ? 90  THR H OG1   1 
ATOM 7351 C CG2   . THR H 5 91  ? 108.206 129.529 142.468 1.00 38.91  ? 90  THR H CG2   1 
ATOM 7352 N N     . SER H 5 92  ? 108.235 127.499 140.255 1.00 36.52  ? 91  SER H N     1 
ATOM 7353 C CA    . SER H 5 92  ? 107.630 126.978 139.043 1.00 36.52  ? 91  SER H CA    1 
ATOM 7354 C C     . SER H 5 92  ? 107.689 127.990 137.918 1.00 36.52  ? 91  SER H C     1 
ATOM 7355 O O     . SER H 5 92  ? 107.467 127.628 136.758 1.00 36.52  ? 91  SER H O     1 
ATOM 7356 C CB    . SER H 5 92  ? 106.179 126.580 139.304 1.00 36.52  ? 91  SER H CB    1 
ATOM 7357 O OG    . SER H 5 92  ? 105.432 126.573 138.103 1.00 36.52  ? 91  SER H OG    1 
ATOM 7358 N N     . ARG H 5 93  ? 108.030 129.237 138.229 1.00 34.67  ? 92  ARG H N     1 
ATOM 7359 C CA    . ARG H 5 93  ? 108.049 130.254 137.196 1.00 34.67  ? 92  ARG H CA    1 
ATOM 7360 C C     . ARG H 5 93  ? 109.322 130.160 136.368 1.00 34.67  ? 92  ARG H C     1 
ATOM 7361 O O     . ARG H 5 93  ? 109.288 130.379 135.149 1.00 34.67  ? 92  ARG H O     1 
ATOM 7362 C CB    . ARG H 5 93  ? 107.919 131.628 137.850 1.00 34.67  ? 92  ARG H CB    1 
ATOM 7363 C CG    . ARG H 5 93  ? 107.674 132.772 136.908 1.00 34.67  ? 92  ARG H CG    1 
ATOM 7364 C CD    . ARG H 5 93  ? 107.429 134.055 137.682 1.00 34.67  ? 92  ARG H CD    1 
ATOM 7365 N NE    . ARG H 5 93  ? 107.151 135.160 136.776 1.00 34.67  ? 92  ARG H NE    1 
ATOM 7366 C CZ    . ARG H 5 93  ? 108.088 135.938 136.250 1.00 34.67  ? 92  ARG H CZ    1 
ATOM 7367 N NH1   . ARG H 5 93  ? 109.363 135.729 136.545 1.00 34.67  ? 92  ARG H NH1   1 
ATOM 7368 N NH2   . ARG H 5 93  ? 107.752 136.918 135.424 1.00 34.67  ? 92  ARG H NH2   1 
ATOM 7369 N N     . GLU H 5 94  ? 110.431 129.739 136.983 1.00 35.92  ? 93  GLU H N     1 
ATOM 7370 C CA    . GLU H 5 94  ? 111.623 129.492 136.190 1.00 35.92  ? 93  GLU H CA    1 
ATOM 7371 C C     . GLU H 5 94  ? 111.503 128.215 135.378 1.00 35.92  ? 93  GLU H C     1 
ATOM 7372 O O     . GLU H 5 94  ? 112.097 128.122 134.299 1.00 35.92  ? 93  GLU H O     1 
ATOM 7373 C CB    . GLU H 5 94  ? 112.850 129.398 137.096 1.00 35.92  ? 93  GLU H CB    1 
ATOM 7374 C CG    . GLU H 5 94  ? 113.355 130.722 137.645 1.00 35.92  ? 93  GLU H CG    1 
ATOM 7375 C CD    . GLU H 5 94  ? 112.627 131.158 138.903 1.00 35.92  ? 93  GLU H CD    1 
ATOM 7376 O OE1   . GLU H 5 94  ? 112.457 132.381 139.102 1.00 35.92  ? 93  GLU H OE1   1 
ATOM 7377 O OE2   . GLU H 5 94  ? 112.224 130.280 139.692 1.00 35.92  ? 93  GLU H OE2   1 
ATOM 7378 N N     . ILE H 5 95  ? 110.636 127.292 135.791 1.00 34.28  ? 94  ILE H N     1 
ATOM 7379 C CA    . ILE H 5 95  ? 110.390 126.119 134.966 1.00 34.28  ? 94  ILE H CA    1 
ATOM 7380 C C     . ILE H 5 95  ? 109.488 126.482 133.800 1.00 34.28  ? 94  ILE H C     1 
ATOM 7381 O O     . ILE H 5 95  ? 109.685 126.006 132.679 1.00 34.28  ? 94  ILE H O     1 
ATOM 7382 C CB    . ILE H 5 95  ? 109.801 124.979 135.811 1.00 34.28  ? 94  ILE H CB    1 
ATOM 7383 C CG1   . ILE H 5 95  ? 110.699 124.675 137.006 1.00 34.28  ? 94  ILE H CG1   1 
ATOM 7384 C CG2   . ILE H 5 95  ? 109.709 123.727 134.979 1.00 34.28  ? 94  ILE H CG2   1 
ATOM 7385 C CD1   . ILE H 5 95  ? 112.054 124.150 136.629 1.00 34.28  ? 94  ILE H CD1   1 
ATOM 7386 N N     . GLN H 5 96  ? 108.507 127.357 134.031 1.00 33.99  ? 95  GLN H N     1 
ATOM 7387 C CA    . GLN H 5 96  ? 107.645 127.767 132.932 1.00 33.99  ? 95  GLN H CA    1 
ATOM 7388 C C     . GLN H 5 96  ? 108.415 128.583 131.908 1.00 33.99  ? 95  GLN H C     1 
ATOM 7389 O O     . GLN H 5 96  ? 108.196 128.436 130.699 1.00 33.99  ? 95  GLN H O     1 
ATOM 7390 C CB    . GLN H 5 96  ? 106.461 128.571 133.460 1.00 33.99  ? 95  GLN H CB    1 
ATOM 7391 C CG    . GLN H 5 96  ? 105.489 129.008 132.384 1.00 33.99  ? 95  GLN H CG    1 
ATOM 7392 C CD    . GLN H 5 96  ? 104.264 129.674 132.955 1.00 33.99  ? 95  GLN H CD    1 
ATOM 7393 O OE1   . GLN H 5 96  ? 104.126 129.801 134.169 1.00 33.99  ? 95  GLN H OE1   1 
ATOM 7394 N NE2   . GLN H 5 96  ? 103.363 130.106 132.083 1.00 33.99  ? 95  GLN H NE2   1 
ATOM 7395 N N     . THR H 5 97  ? 109.402 129.351 132.359 1.00 33.40  ? 96  THR H N     1 
ATOM 7396 C CA    . THR H 5 97  ? 110.198 130.098 131.398 1.00 33.40  ? 96  THR H CA    1 
ATOM 7397 C C     . THR H 5 97  ? 111.196 129.195 130.691 1.00 33.40  ? 96  THR H C     1 
ATOM 7398 O O     . THR H 5 97  ? 111.455 129.377 129.498 1.00 33.40  ? 96  THR H O     1 
ATOM 7399 C CB    . THR H 5 97  ? 110.891 131.266 132.083 1.00 33.40  ? 96  THR H CB    1 
ATOM 7400 O OG1   . THR H 5 97  ? 109.892 132.112 132.660 1.00 33.40  ? 96  THR H OG1   1 
ATOM 7401 C CG2   . THR H 5 97  ? 111.686 132.072 131.079 1.00 33.40  ? 96  THR H CG2   1 
ATOM 7402 N N     . ALA H 5 98  ? 111.773 128.216 131.390 1.00 34.11  ? 97  ALA H N     1 
ATOM 7403 C CA    . ALA H 5 98  ? 112.676 127.315 130.695 1.00 34.11  ? 97  ALA H CA    1 
ATOM 7404 C C     . ALA H 5 98  ? 111.935 126.414 129.718 1.00 34.11  ? 97  ALA H C     1 
ATOM 7405 O O     . ALA H 5 98  ? 112.518 126.002 128.710 1.00 34.11  ? 97  ALA H O     1 
ATOM 7406 C CB    . ALA H 5 98  ? 113.438 126.462 131.705 1.00 34.11  ? 97  ALA H CB    1 
ATOM 7407 N N     . VAL H 5 99  ? 110.647 126.156 129.956 1.00 33.92  ? 98  VAL H N     1 
ATOM 7408 C CA    . VAL H 5 99  ? 109.848 125.434 128.973 1.00 33.92  ? 98  VAL H CA    1 
ATOM 7409 C C     . VAL H 5 99  ? 109.518 126.332 127.793 1.00 33.92  ? 98  VAL H C     1 
ATOM 7410 O O     . VAL H 5 99  ? 109.515 125.886 126.640 1.00 33.92  ? 98  VAL H O     1 
ATOM 7411 C CB    . VAL H 5 99  ? 108.576 124.867 129.628 1.00 33.92  ? 98  VAL H CB    1 
ATOM 7412 C CG1   . VAL H 5 99  ? 107.656 124.294 128.578 1.00 33.92  ? 98  VAL H CG1   1 
ATOM 7413 C CG2   . VAL H 5 99  ? 108.940 123.790 130.629 1.00 33.92  ? 98  VAL H CG2   1 
ATOM 7414 N N     . ARG H 5 100 ? 109.246 127.615 128.049 1.00 33.81  ? 99  ARG H N     1 
ATOM 7415 C CA    . ARG H 5 100 ? 109.000 128.512 126.928 1.00 33.81  ? 99  ARG H CA    1 
ATOM 7416 C C     . ARG H 5 100 ? 110.250 128.682 126.077 1.00 33.81  ? 99  ARG H C     1 
ATOM 7417 O O     . ARG H 5 100 ? 110.153 128.812 124.853 1.00 33.81  ? 99  ARG H O     1 
ATOM 7418 C CB    . ARG H 5 100 ? 108.539 129.879 127.428 1.00 33.81  ? 99  ARG H CB    1 
ATOM 7419 C CG    . ARG H 5 100 ? 107.176 129.911 128.074 1.00 33.81  ? 99  ARG H CG    1 
ATOM 7420 C CD    . ARG H 5 100 ? 106.856 131.323 128.517 1.00 33.81  ? 99  ARG H CD    1 
ATOM 7421 N NE    . ARG H 5 100 ? 105.587 131.408 129.227 1.00 33.81  ? 99  ARG H NE    1 
ATOM 7422 C CZ    . ARG H 5 100 ? 105.117 132.526 129.767 1.00 33.81  ? 99  ARG H CZ    1 
ATOM 7423 N NH1   . ARG H 5 100 ? 105.817 133.648 129.674 1.00 33.81  ? 99  ARG H NH1   1 
ATOM 7424 N NH2   . ARG H 5 100 ? 103.954 132.523 130.401 1.00 33.81  ? 99  ARG H NH2   1 
ATOM 7425 N N     . LEU H 5 101 ? 111.425 128.676 126.708 1.00 32.82  ? 100 LEU H N     1 
ATOM 7426 C CA    . LEU H 5 101 ? 112.668 128.847 125.965 1.00 32.82  ? 100 LEU H CA    1 
ATOM 7427 C C     . LEU H 5 101 ? 113.060 127.586 125.207 1.00 32.82  ? 100 LEU H C     1 
ATOM 7428 O O     . LEU H 5 101 ? 113.464 127.662 124.042 1.00 32.82  ? 100 LEU H O     1 
ATOM 7429 C CB    . LEU H 5 101 ? 113.791 129.267 126.910 1.00 32.82  ? 100 LEU H CB    1 
ATOM 7430 C CG    . LEU H 5 101 ? 113.671 130.663 127.522 1.00 32.82  ? 100 LEU H CG    1 
ATOM 7431 C CD1   . LEU H 5 101 ? 114.767 130.902 128.532 1.00 32.82  ? 100 LEU H CD1   1 
ATOM 7432 C CD2   . LEU H 5 101 ? 113.718 131.725 126.443 1.00 32.82  ? 100 LEU H CD2   1 
ATOM 7433 N N     . LEU H 5 102 ? 112.957 126.418 125.844 1.00 33.98  ? 101 LEU H N     1 
ATOM 7434 C CA    . LEU H 5 102 ? 113.518 125.220 125.226 1.00 33.98  ? 101 LEU H CA    1 
ATOM 7435 C C     . LEU H 5 102 ? 112.599 124.649 124.155 1.00 33.98  ? 101 LEU H C     1 
ATOM 7436 O O     . LEU H 5 102 ? 113.041 124.357 123.040 1.00 33.98  ? 101 LEU H O     1 
ATOM 7437 C CB    . LEU H 5 102 ? 113.815 124.169 126.294 1.00 33.98  ? 101 LEU H CB    1 
ATOM 7438 C CG    . LEU H 5 102 ? 114.980 124.493 127.227 1.00 33.98  ? 101 LEU H CG    1 
ATOM 7439 C CD1   . LEU H 5 102 ? 115.114 123.430 128.295 1.00 33.98  ? 101 LEU H CD1   1 
ATOM 7440 C CD2   . LEU H 5 102 ? 116.270 124.626 126.443 1.00 33.98  ? 101 LEU H CD2   1 
ATOM 7441 N N     . LEU H 5 103 ? 111.330 124.482 124.470 1.00 35.01  ? 102 LEU H N     1 
ATOM 7442 C CA    . LEU H 5 103 ? 110.427 123.826 123.535 1.00 35.01  ? 102 LEU H CA    1 
ATOM 7443 C C     . LEU H 5 103 ? 109.922 124.843 122.520 1.00 35.01  ? 102 LEU H C     1 
ATOM 7444 O O     . LEU H 5 103 ? 109.532 125.949 122.903 1.00 35.01  ? 102 LEU H O     1 
ATOM 7445 C CB    . LEU H 5 103 ? 109.253 123.176 124.263 1.00 35.01  ? 102 LEU H CB    1 
ATOM 7446 C CG    . LEU H 5 103 ? 109.488 121.956 125.164 1.00 35.01  ? 102 LEU H CG    1 
ATOM 7447 C CD1   . LEU H 5 103 ? 110.331 122.255 126.398 1.00 35.01  ? 102 LEU H CD1   1 
ATOM 7448 C CD2   . LEU H 5 103 ? 108.151 121.363 125.569 1.00 35.01  ? 102 LEU H CD2   1 
ATOM 7449 N N     . PRO H 5 104 ? 109.930 124.522 121.236 1.00 36.64  ? 103 PRO H N     1 
ATOM 7450 C CA    . PRO H 5 104 ? 109.498 125.508 120.240 1.00 36.64  ? 103 PRO H CA    1 
ATOM 7451 C C     . PRO H 5 104 ? 108.001 125.482 119.992 1.00 36.64  ? 103 PRO H C     1 
ATOM 7452 O O     . PRO H 5 104 ? 107.447 124.450 119.601 1.00 36.64  ? 103 PRO H O     1 
ATOM 7453 C CB    . PRO H 5 104 ? 110.272 125.093 118.980 1.00 36.64  ? 103 PRO H CB    1 
ATOM 7454 C CG    . PRO H 5 104 ? 111.348 124.153 119.471 1.00 36.64  ? 103 PRO H CG    1 
ATOM 7455 C CD    . PRO H 5 104 ? 110.724 123.449 120.624 1.00 36.64  ? 103 PRO H CD    1 
ATOM 7456 N N     . GLY H 5 105 ? 107.337 126.613 120.214 1.00 37.51  ? 104 GLY H N     1 
ATOM 7457 C CA    . GLY H 5 105 ? 106.003 126.810 119.688 1.00 37.51  ? 104 GLY H CA    1 
ATOM 7458 C C     . GLY H 5 105 ? 104.885 126.086 120.407 1.00 37.51  ? 104 GLY H C     1 
ATOM 7459 O O     . GLY H 5 105 ? 104.657 126.270 121.611 1.00 37.51  ? 104 GLY H O     1 
ATOM 7460 N N     . GLU H 5 106 ? 104.169 125.251 119.652 1.00 38.14  ? 105 GLU H N     1 
ATOM 7461 C CA    . GLU H 5 106 ? 102.989 124.602 120.200 1.00 38.14  ? 105 GLU H CA    1 
ATOM 7462 C C     . GLU H 5 106 ? 103.354 123.608 121.292 1.00 38.14  ? 105 GLU H C     1 
ATOM 7463 O O     . GLU H 5 106 ? 102.572 123.405 122.230 1.00 38.14  ? 105 GLU H O     1 
ATOM 7464 C CB    . GLU H 5 106 ? 102.228 123.908 119.070 1.00 38.14  ? 105 GLU H CB    1 
ATOM 7465 C CG    . GLU H 5 106 ? 100.853 123.405 119.442 1.00 38.14  ? 105 GLU H CG    1 
ATOM 7466 C CD    . GLU H 5 106 ? 100.201 122.616 118.325 1.00 38.14  ? 105 GLU H CD    1 
ATOM 7467 O OE1   . GLU H 5 106 ? 100.867 122.377 117.296 1.00 38.14  ? 105 GLU H OE1   1 
ATOM 7468 O OE2   . GLU H 5 106 ? 99.020  122.239 118.473 1.00 38.14  ? 105 GLU H OE2   1 
ATOM 7469 N N     . LEU H 5 107 ? 104.552 123.023 121.229 1.00 38.12  ? 106 LEU H N     1 
ATOM 7470 C CA    . LEU H 5 107 ? 104.961 122.152 122.321 1.00 38.12  ? 106 LEU H CA    1 
ATOM 7471 C C     . LEU H 5 107 ? 105.199 122.943 123.595 1.00 38.12  ? 106 LEU H C     1 
ATOM 7472 O O     . LEU H 5 107 ? 104.874 122.465 124.687 1.00 38.12  ? 106 LEU H O     1 
ATOM 7473 C CB    . LEU H 5 107 ? 106.226 121.378 121.957 1.00 38.12  ? 106 LEU H CB    1 
ATOM 7474 C CG    . LEU H 5 107 ? 106.100 120.129 121.092 1.00 38.12  ? 106 LEU H CG    1 
ATOM 7475 C CD1   . LEU H 5 107 ? 107.471 119.712 120.599 1.00 38.12  ? 106 LEU H CD1   1 
ATOM 7476 C CD2   . LEU H 5 107 ? 105.448 119.008 121.873 1.00 38.12  ? 106 LEU H CD2   1 
ATOM 7477 N N     . ALA H 5 108 ? 105.658 124.191 123.472 1.00 36.97  ? 107 ALA H N     1 
ATOM 7478 C CA    . ALA H 5 108 ? 105.802 125.010 124.666 1.00 36.97  ? 107 ALA H CA    1 
ATOM 7479 C C     . ALA H 5 108 ? 104.454 125.472 125.182 1.00 36.97  ? 107 ALA H C     1 
ATOM 7480 O O     . ALA H 5 108 ? 104.249 125.520 126.399 1.00 36.97  ? 107 ALA H O     1 
ATOM 7481 C CB    . ALA H 5 108 ? 106.698 126.211 124.378 1.00 36.97  ? 107 ALA H CB    1 
ATOM 7482 N N     . LYS H 5 109 ? 103.490 125.700 124.288 1.00 36.84  ? 108 LYS H N     1 
ATOM 7483 C CA    . LYS H 5 109 ? 102.196 126.168 124.768 1.00 36.84  ? 108 LYS H CA    1 
ATOM 7484 C C     . LYS H 5 109 ? 101.454 125.042 125.470 1.00 36.84  ? 108 LYS H C     1 
ATOM 7485 O O     . LYS H 5 109 ? 100.817 125.263 126.509 1.00 36.84  ? 108 LYS H O     1 
ATOM 7486 C CB    . LYS H 5 109 ? 101.361 126.728 123.616 1.00 36.84  ? 108 LYS H CB    1 
ATOM 7487 C CG    . LYS H 5 109 ? 101.947 127.961 122.950 1.00 36.84  ? 108 LYS H CG    1 
ATOM 7488 C CD    . LYS H 5 109 ? 101.045 128.448 121.825 1.00 36.84  ? 108 LYS H CD    1 
ATOM 7489 C CE    . LYS H 5 109 ? 101.640 129.647 121.103 1.00 36.84  ? 108 LYS H CE    1 
ATOM 7490 N NZ    . LYS H 5 109 ? 102.670 129.240 120.111 1.00 36.84  ? 108 LYS H NZ    1 
ATOM 7491 N N     . HIS H 5 110 ? 101.628 123.810 125.000 1.00 37.09  ? 109 HIS H N     1 
ATOM 7492 C CA    . HIS H 5 110 ? 100.930 122.718 125.658 1.00 37.09  ? 109 HIS H CA    1 
ATOM 7493 C C     . HIS H 5 110 ? 101.665 122.258 126.906 1.00 37.09  ? 109 HIS H C     1 
ATOM 7494 O O     . HIS H 5 110 ? 101.017 121.864 127.881 1.00 37.09  ? 109 HIS H O     1 
ATOM 7495 C CB    . HIS H 5 110 ? 100.716 121.549 124.696 1.00 37.09  ? 109 HIS H CB    1 
ATOM 7496 C CG    . HIS H 5 110 ? 99.707  121.825 123.626 1.00 37.09  ? 109 HIS H CG    1 
ATOM 7497 N ND1   . HIS H 5 110 ? 98.350  121.816 123.866 1.00 37.09  ? 109 HIS H ND1   1 
ATOM 7498 C CD2   . HIS H 5 110 ? 99.855  122.113 122.313 1.00 37.09  ? 109 HIS H CD2   1 
ATOM 7499 C CE1   . HIS H 5 110 ? 97.705  122.090 122.746 1.00 37.09  ? 109 HIS H CE1   1 
ATOM 7500 N NE2   . HIS H 5 110 ? 98.595  122.276 121.789 1.00 37.09  ? 109 HIS H NE2   1 
ATOM 7501 N N     . ALA H 5 111 ? 102.999 122.334 126.934 1.00 36.17  ? 110 ALA H N     1 
ATOM 7502 C CA    . ALA H 5 111 ? 103.680 121.982 128.171 1.00 36.17  ? 110 ALA H CA    1 
ATOM 7503 C C     . ALA H 5 111 ? 103.439 123.015 129.267 1.00 36.17  ? 110 ALA H C     1 
ATOM 7504 O O     . ALA H 5 111 ? 103.281 122.641 130.436 1.00 36.17  ? 110 ALA H O     1 
ATOM 7505 C CB    . ALA H 5 111 ? 105.175 121.818 127.911 1.00 36.17  ? 110 ALA H CB    1 
ATOM 7506 N N     . VAL H 5 112 ? 103.314 124.300 128.915 1.00 35.66  ? 111 VAL H N     1 
ATOM 7507 C CA    . VAL H 5 112 ? 102.968 125.287 129.935 1.00 35.66  ? 111 VAL H CA    1 
ATOM 7508 C C     . VAL H 5 112 ? 101.532 125.090 130.389 1.00 35.66  ? 111 VAL H C     1 
ATOM 7509 O O     . VAL H 5 112 ? 101.229 125.188 131.582 1.00 35.66  ? 111 VAL H O     1 
ATOM 7510 C CB    . VAL H 5 112 ? 103.239 126.733 129.473 1.00 35.66  ? 111 VAL H CB    1 
ATOM 7511 C CG1   . VAL H 5 112 ? 104.712 126.931 129.168 1.00 35.66  ? 111 VAL H CG1   1 
ATOM 7512 C CG2   . VAL H 5 112 ? 102.388 127.128 128.297 1.00 35.66  ? 111 VAL H CG2   1 
ATOM 7513 N N     . SER H 5 113 ? 100.629 124.756 129.466 1.00 36.61  ? 112 SER H N     1 
ATOM 7514 C CA    . SER H 5 113 ? 99.249  124.573 129.895 1.00 36.61  ? 112 SER H CA    1 
ATOM 7515 C C     . SER H 5 113 ? 99.098  123.338 130.780 1.00 36.61  ? 112 SER H C     1 
ATOM 7516 O O     . SER H 5 113 ? 98.332  123.370 131.750 1.00 36.61  ? 112 SER H O     1 
ATOM 7517 C CB    . SER H 5 113 ? 98.337  124.477 128.674 1.00 36.61  ? 112 SER H CB    1 
ATOM 7518 O OG    . SER H 5 113 ? 97.042  124.025 129.026 1.00 36.61  ? 112 SER H OG    1 
ATOM 7519 N N     . GLU H 5 114 ? 99.890  122.288 130.536 1.00 37.90  ? 113 GLU H N     1 
ATOM 7520 C CA    . GLU H 5 114 ? 99.804  121.085 131.359 1.00 37.90  ? 113 GLU H CA    1 
ATOM 7521 C C     . GLU H 5 114 ? 100.476 121.275 132.710 1.00 37.90  ? 113 GLU H C     1 
ATOM 7522 O O     . GLU H 5 114 ? 99.976  120.778 133.727 1.00 37.90  ? 113 GLU H O     1 
ATOM 7523 C CB    . GLU H 5 114 ? 100.423 119.906 130.620 1.00 37.90  ? 113 GLU H CB    1 
ATOM 7524 C CG    . GLU H 5 114 ? 99.612  119.453 129.424 1.00 37.90  ? 113 GLU H CG    1 
ATOM 7525 C CD    . GLU H 5 114 ? 98.304  118.808 129.822 1.00 37.90  ? 113 GLU H CD    1 
ATOM 7526 O OE1   . GLU H 5 114 ? 98.267  118.164 130.889 1.00 37.90  ? 113 GLU H OE1   1 
ATOM 7527 O OE2   . GLU H 5 114 ? 97.316  118.943 129.068 1.00 37.90  ? 113 GLU H OE2   1 
ATOM 7528 N N     . GLY H 5 115 ? 101.529 122.090 132.767 1.00 36.36  ? 114 GLY H N     1 
ATOM 7529 C CA    . GLY H 5 115 ? 102.168 122.331 134.041 1.00 36.36  ? 114 GLY H CA    1 
ATOM 7530 C C     . GLY H 5 115 ? 101.315 123.249 134.882 1.00 36.36  ? 114 GLY H C     1 
ATOM 7531 O O     . GLY H 5 115 ? 101.237 123.080 136.100 1.00 36.36  ? 114 GLY H O     1 
ATOM 7532 N N     . THR H 5 116 ? 100.609 124.187 134.246 1.00 37.26  ? 115 THR H N     1 
ATOM 7533 C CA    . THR H 5 116 ? 99.765  125.113 134.993 1.00 37.26  ? 115 THR H CA    1 
ATOM 7534 C C     . THR H 5 116 ? 98.524  124.400 135.497 1.00 37.26  ? 115 THR H C     1 
ATOM 7535 O O     . THR H 5 116 ? 98.131  124.569 136.658 1.00 37.26  ? 115 THR H O     1 
ATOM 7536 C CB    . THR H 5 116 ? 99.360  126.322 134.148 1.00 37.26  ? 115 THR H CB    1 
ATOM 7537 O OG1   . THR H 5 116 ? 98.944  125.899 132.849 1.00 37.26  ? 115 THR H OG1   1 
ATOM 7538 C CG2   . THR H 5 116 ? 100.510 127.284 134.037 1.00 37.26  ? 115 THR H CG2   1 
ATOM 7539 N N     . LYS H 5 117 ? 97.928  123.552 134.668 1.00 37.98  ? 116 LYS H N     1 
ATOM 7540 C CA    . LYS H 5 117 ? 96.751  122.824 135.093 1.00 37.98  ? 116 LYS H CA    1 
ATOM 7541 C C     . LYS H 5 117 ? 97.131  121.562 135.853 1.00 37.98  ? 116 LYS H C     1 
ATOM 7542 O O     . LYS H 5 117 ? 96.256  120.786 136.245 1.00 37.98  ? 116 LYS H O     1 
ATOM 7543 C CB    . LYS H 5 117 ? 95.912  122.498 133.843 1.00 37.98  ? 116 LYS H CB    1 
ATOM 7544 C CG    . LYS H 5 117 ? 94.637  121.678 134.004 1.00 37.98  ? 116 LYS H CG    1 
ATOM 7545 C CD    . LYS H 5 117 ? 94.890  120.219 133.655 1.00 37.98  ? 116 LYS H CD    1 
ATOM 7546 C CE    . LYS H 5 117 ? 93.972  119.734 132.565 1.00 37.98  ? 116 LYS H CE    1 
ATOM 7547 N NZ    . LYS H 5 117 ? 94.256  118.302 132.314 1.00 37.98  ? 116 LYS H NZ    1 
ATOM 7548 N N     . ALA H 5 118 ? 98.413  121.392 136.165 1.00 37.89  ? 117 ALA H N     1 
ATOM 7549 C CA    . ALA H 5 118 ? 98.788  120.432 137.191 1.00 37.89  ? 117 ALA H CA    1 
ATOM 7550 C C     . ALA H 5 118 ? 99.175  121.081 138.511 1.00 37.89  ? 117 ALA H C     1 
ATOM 7551 O O     . ALA H 5 118 ? 98.864  120.526 139.569 1.00 37.89  ? 117 ALA H O     1 
ATOM 7552 C CB    . ALA H 5 118 ? 99.948  119.561 136.710 1.00 37.89  ? 117 ALA H CB    1 
ATOM 7553 N N     . VAL H 5 119 ? 99.776  122.276 138.487 1.00 37.81  ? 118 VAL H N     1 
ATOM 7554 C CA    . VAL H 5 119 ? 100.031 122.977 139.743 1.00 37.81  ? 118 VAL H CA    1 
ATOM 7555 C C     . VAL H 5 119 ? 98.735  123.483 140.362 1.00 37.81  ? 118 VAL H C     1 
ATOM 7556 O O     . VAL H 5 119 ? 98.568  123.444 141.588 1.00 37.81  ? 118 VAL H O     1 
ATOM 7557 C CB    . VAL H 5 119 ? 101.046 124.122 139.548 1.00 37.81  ? 118 VAL H CB    1 
ATOM 7558 C CG1   . VAL H 5 119 ? 102.358 123.585 139.050 1.00 37.81  ? 118 VAL H CG1   1 
ATOM 7559 C CG2   . VAL H 5 119 ? 100.520 125.181 138.592 1.00 37.81  ? 118 VAL H CG2   1 
ATOM 7560 N N     . THR H 5 120 ? 97.782  123.941 139.543 1.00 38.37  ? 119 THR H N     1 
ATOM 7561 C CA    . THR H 5 120 ? 96.527  124.392 140.135 1.00 38.37  ? 119 THR H CA    1 
ATOM 7562 C C     . THR H 5 120 ? 95.736  123.228 140.711 1.00 38.37  ? 119 THR H C     1 
ATOM 7563 O O     . THR H 5 120 ? 95.127  123.357 141.777 1.00 38.37  ? 119 THR H O     1 
ATOM 7564 C CB    . THR H 5 120 ? 95.693  125.163 139.113 1.00 38.37  ? 119 THR H CB    1 
ATOM 7565 O OG1   . THR H 5 120 ? 95.276  124.284 138.060 1.00 38.37  ? 119 THR H OG1   1 
ATOM 7566 C CG2   . THR H 5 120 ? 96.469  126.347 138.556 1.00 38.37  ? 119 THR H CG2   1 
ATOM 7567 N N     . LYS H 5 121 ? 95.717  122.088 140.018 1.00 39.26  ? 120 LYS H N     1 
ATOM 7568 C CA    . LYS H 5 121 ? 95.090  120.908 140.594 1.00 39.26  ? 120 LYS H CA    1 
ATOM 7569 C C     . LYS H 5 121 ? 95.854  120.391 141.807 1.00 39.26  ? 120 LYS H C     1 
ATOM 7570 O O     . LYS H 5 121 ? 95.268  119.702 142.647 1.00 39.26  ? 120 LYS H O     1 
ATOM 7571 C CB    . LYS H 5 121 ? 94.965  119.811 139.539 1.00 39.26  ? 120 LYS H CB    1 
ATOM 7572 C CG    . LYS H 5 121 ? 93.958  120.128 138.443 1.00 39.26  ? 120 LYS H CG    1 
ATOM 7573 C CD    . LYS H 5 121 ? 92.583  120.457 139.001 1.00 39.26  ? 120 LYS H CD    1 
ATOM 7574 C CE    . LYS H 5 121 ? 91.887  119.227 139.543 1.00 39.26  ? 120 LYS H CE    1 
ATOM 7575 N NZ    . LYS H 5 121 ? 90.557  119.568 140.113 1.00 39.26  ? 120 LYS H NZ    1 
ATOM 7576 N N     . TYR H 5 122 ? 97.151  120.696 141.910 1.00 40.19  ? 121 TYR H N     1 
ATOM 7577 C CA    . TYR H 5 122 ? 97.913  120.293 143.087 1.00 40.19  ? 121 TYR H CA    1 
ATOM 7578 C C     . TYR H 5 122 ? 97.568  121.132 144.308 1.00 40.19  ? 121 TYR H C     1 
ATOM 7579 O O     . TYR H 5 122 ? 97.385  120.591 145.403 1.00 40.19  ? 121 TYR H O     1 
ATOM 7580 C CB    . TYR H 5 122 ? 99.410  120.382 142.804 1.00 40.19  ? 121 TYR H CB    1 
ATOM 7581 C CG    . TYR H 5 122 ? 100.265 120.135 144.022 1.00 40.19  ? 121 TYR H CG    1 
ATOM 7582 C CD1   . TYR H 5 122 ? 100.400 118.869 144.566 1.00 40.19  ? 121 TYR H CD1   1 
ATOM 7583 C CD2   . TYR H 5 122 ? 100.929 121.184 144.636 1.00 40.19  ? 121 TYR H CD2   1 
ATOM 7584 C CE1   . TYR H 5 122 ? 101.180 118.657 145.683 1.00 40.19  ? 121 TYR H CE1   1 
ATOM 7585 C CE2   . TYR H 5 122 ? 101.708 120.983 145.748 1.00 40.19  ? 121 TYR H CE2   1 
ATOM 7586 C CZ    . TYR H 5 122 ? 101.831 119.720 146.269 1.00 40.19  ? 121 TYR H CZ    1 
ATOM 7587 O OH    . TYR H 5 122 ? 102.611 119.521 147.381 1.00 40.19  ? 121 TYR H OH    1 
ATOM 7588 N N     . THR H 5 123 ? 97.483  122.455 144.147 1.00 39.96  ? 122 THR H N     1 
ATOM 7589 C CA    . THR H 5 123 ? 97.254  123.304 145.313 1.00 39.96  ? 122 THR H CA    1 
ATOM 7590 C C     . THR H 5 123 ? 95.845  123.147 145.871 1.00 39.96  ? 122 THR H C     1 
ATOM 7591 O O     . THR H 5 123 ? 95.626  123.369 147.067 1.00 39.96  ? 122 THR H O     1 
ATOM 7592 C CB    . THR H 5 123 ? 97.523  124.767 144.970 1.00 39.96  ? 122 THR H CB    1 
ATOM 7593 O OG1   . THR H 5 123 ? 96.549  125.228 144.026 1.00 39.96  ? 122 THR H OG1   1 
ATOM 7594 C CG2   . THR H 5 123 ? 98.916  124.929 144.388 1.00 39.96  ? 122 THR H CG2   1 
ATOM 7595 N N     . SER H 5 124 ? 94.886  122.768 145.038 1.00 40.74  ? 123 SER H N     1 
ATOM 7596 C CA    . SER H 5 124 ? 93.517  122.585 145.496 1.00 40.74  ? 123 SER H CA    1 
ATOM 7597 C C     . SER H 5 124 ? 93.352  121.271 146.250 1.00 40.74  ? 123 SER H C     1 
ATOM 7598 O O     . SER H 5 124 ? 94.252  120.434 146.262 1.00 40.74  ? 123 SER H O     1 
ATOM 7599 C CB    . SER H 5 124 ? 92.552  122.637 144.313 1.00 40.74  ? 123 SER H CB    1 
ATOM 7600 O OG    . SER H 5 124 ? 92.571  123.912 143.697 1.00 40.74  ? 123 SER H OG    1 
ATOM 7601 N N     . SER I 6 21  ? 150.111 139.101 148.565 1.00 155.89 ? 20  SER C N     1 
ATOM 7602 C CA    . SER I 6 21  ? 149.040 138.879 147.601 1.00 155.89 ? 20  SER C CA    1 
ATOM 7603 C C     . SER I 6 21  ? 149.416 137.789 146.608 1.00 155.89 ? 20  SER C C     1 
ATOM 7604 O O     . SER I 6 21  ? 150.484 137.815 146.001 1.00 155.89 ? 20  SER C O     1 
ATOM 7605 C CB    . SER I 6 21  ? 148.675 140.178 146.882 1.00 155.89 ? 20  SER C CB    1 
ATOM 7606 O OG    . SER I 6 21  ? 149.756 140.685 146.134 1.00 155.89 ? 20  SER C OG    1 
ATOM 7607 N N     . ARG I 6 22  ? 148.495 136.841 146.435 1.00 151.65 ? 21  ARG C N     1 
ATOM 7608 C CA    . ARG I 6 22  ? 148.745 135.661 145.621 1.00 151.65 ? 21  ARG C CA    1 
ATOM 7609 C C     . ARG I 6 22  ? 148.857 135.964 144.136 1.00 151.65 ? 21  ARG C C     1 
ATOM 7610 O O     . ARG I 6 22  ? 149.510 135.200 143.420 1.00 151.65 ? 21  ARG C O     1 
ATOM 7611 C CB    . ARG I 6 22  ? 147.628 134.640 145.820 1.00 151.65 ? 21  ARG C CB    1 
ATOM 7612 C CG    . ARG I 6 22  ? 147.582 133.995 147.189 1.00 151.65 ? 21  ARG C CG    1 
ATOM 7613 C CD    . ARG I 6 22  ? 146.455 132.974 147.251 1.00 151.65 ? 21  ARG C CD    1 
ATOM 7614 N NE    . ARG I 6 22  ? 145.137 133.596 147.223 1.00 151.65 ? 21  ARG C NE    1 
ATOM 7615 C CZ    . ARG I 6 22  ? 144.005 132.918 147.098 1.00 151.65 ? 21  ARG C CZ    1 
ATOM 7616 N NH1   . ARG I 6 22  ? 142.846 133.558 147.081 1.00 151.65 ? 21  ARG C NH1   1 
ATOM 7617 N NH2   . ARG I 6 22  ? 144.034 131.598 146.984 1.00 151.65 ? 21  ARG C NH2   1 
ATOM 7618 N N     . THR I 6 23  ? 148.277 137.061 143.652 1.00 147.28 ? 22  THR C N     1 
ATOM 7619 C CA    . THR I 6 23  ? 148.451 137.386 142.241 1.00 147.28 ? 22  THR C CA    1 
ATOM 7620 C C     . THR I 6 23  ? 149.879 137.823 141.945 1.00 147.28 ? 22  THR C C     1 
ATOM 7621 O O     . THR I 6 23  ? 150.480 137.363 140.966 1.00 147.28 ? 22  THR C O     1 
ATOM 7622 C CB    . THR I 6 23  ? 147.457 138.465 141.830 1.00 147.28 ? 22  THR C CB    1 
ATOM 7623 O OG1   . THR I 6 23  ? 146.122 137.986 142.035 1.00 147.28 ? 22  THR C OG1   1 
ATOM 7624 C CG2   . THR I 6 23  ? 147.646 138.823 140.371 1.00 147.28 ? 22  THR C CG2   1 
ATOM 7625 N N     . VAL I 6 24  ? 150.453 138.696 142.773 1.00 155.50 ? 23  VAL C N     1 
ATOM 7626 C CA    . VAL I 6 24  ? 151.847 139.051 142.532 1.00 155.50 ? 23  VAL C CA    1 
ATOM 7627 C C     . VAL I 6 24  ? 152.729 137.879 142.921 1.00 155.50 ? 23  VAL C C     1 
ATOM 7628 O O     . VAL I 6 24  ? 153.774 137.638 142.307 1.00 155.50 ? 23  VAL C O     1 
ATOM 7629 C CB    . VAL I 6 24  ? 152.243 140.342 143.267 1.00 155.50 ? 23  VAL C CB    1 
ATOM 7630 C CG1   . VAL I 6 24  ? 151.263 141.468 142.925 1.00 155.50 ? 23  VAL C CG1   1 
ATOM 7631 C CG2   . VAL I 6 24  ? 152.357 140.109 144.782 1.00 155.50 ? 23  VAL C CG2   1 
ATOM 7632 N N     . ARG I 6 25  ? 152.313 137.130 143.939 1.00 151.43 ? 24  ARG C N     1 
ATOM 7633 C CA    . ARG I 6 25  ? 153.080 135.983 144.396 1.00 151.43 ? 24  ARG C CA    1 
ATOM 7634 C C     . ARG I 6 25  ? 153.113 134.908 143.323 1.00 151.43 ? 24  ARG C C     1 
ATOM 7635 O O     . ARG I 6 25  ? 154.151 134.276 143.099 1.00 151.43 ? 24  ARG C O     1 
ATOM 7636 C CB    . ARG I 6 25  ? 152.493 135.497 145.716 1.00 151.43 ? 24  ARG C CB    1 
ATOM 7637 C CG    . ARG I 6 25  ? 153.267 134.440 146.432 1.00 151.43 ? 24  ARG C CG    1 
ATOM 7638 C CD    . ARG I 6 25  ? 152.546 134.156 147.722 1.00 151.43 ? 24  ARG C CD    1 
ATOM 7639 N NE    . ARG I 6 25  ? 152.548 135.388 148.511 1.00 151.43 ? 24  ARG C NE    1 
ATOM 7640 C CZ    . ARG I 6 25  ? 151.824 135.596 149.604 1.00 151.43 ? 24  ARG C CZ    1 
ATOM 7641 N NH1   . ARG I 6 25  ? 151.017 134.648 150.057 1.00 151.43 ? 24  ARG C NH1   1 
ATOM 7642 N NH2   . ARG I 6 25  ? 151.910 136.754 150.243 1.00 151.43 ? 24  ARG C NH2   1 
ATOM 7643 N N     . ALA I 6 26  ? 151.986 134.687 142.652 1.00 145.05 ? 25  ALA C N     1 
ATOM 7644 C CA    . ALA I 6 26  ? 151.973 133.803 141.500 1.00 145.05 ? 25  ALA C CA    1 
ATOM 7645 C C     . ALA I 6 26  ? 152.481 134.510 140.255 1.00 145.05 ? 25  ALA C C     1 
ATOM 7646 O O     . ALA I 6 26  ? 152.619 133.869 139.207 1.00 145.05 ? 25  ALA C O     1 
ATOM 7647 C CB    . ALA I 6 26  ? 150.567 133.260 141.248 1.00 145.05 ? 25  ALA C CB    1 
ATOM 7648 N N     . GLU I 6 27  ? 152.747 135.814 140.351 1.00 146.83 ? 26  GLU C N     1 
ATOM 7649 C CA    . GLU I 6 27  ? 153.219 136.636 139.240 1.00 146.83 ? 26  GLU C CA    1 
ATOM 7650 C C     . GLU I 6 27  ? 152.245 136.571 138.062 1.00 146.83 ? 26  GLU C C     1 
ATOM 7651 O O     . GLU I 6 27  ? 152.584 136.195 136.938 1.00 146.83 ? 26  GLU C O     1 
ATOM 7652 C CB    . GLU I 6 27  ? 154.637 136.222 138.834 1.00 146.83 ? 26  GLU C CB    1 
ATOM 7653 C CG    . GLU I 6 27  ? 155.677 136.556 139.895 1.00 146.83 ? 26  GLU C CG    1 
ATOM 7654 C CD    . GLU I 6 27  ? 157.059 136.047 139.547 1.00 146.83 ? 26  GLU C CD    1 
ATOM 7655 O OE1   . GLU I 6 27  ? 157.187 135.301 138.554 1.00 146.83 ? 26  GLU C OE1   1 
ATOM 7656 O OE2   . GLU I 6 27  ? 158.018 136.389 140.269 1.00 146.83 ? 26  GLU C OE2   1 
ATOM 7657 N N     . LEU I 6 28  ? 151.008 136.943 138.364 1.00 141.03 ? 27  LEU C N     1 
ATOM 7658 C CA    . LEU I 6 28  ? 149.904 137.017 137.424 1.00 141.03 ? 27  LEU C CA    1 
ATOM 7659 C C     . LEU I 6 28  ? 149.387 138.448 137.393 1.00 141.03 ? 27  LEU C C     1 
ATOM 7660 O O     . LEU I 6 28  ? 149.837 139.306 138.155 1.00 141.03 ? 27  LEU C O     1 
ATOM 7661 C CB    . LEU I 6 28  ? 148.800 136.031 137.799 1.00 141.03 ? 27  LEU C CB    1 
ATOM 7662 C CG    . LEU I 6 28  ? 149.328 134.602 137.739 1.00 141.03 ? 27  LEU C CG    1 
ATOM 7663 C CD1   . LEU I 6 28  ? 148.271 133.603 138.179 1.00 141.03 ? 27  LEU C CD1   1 
ATOM 7664 C CD2   . LEU I 6 28  ? 149.843 134.300 136.339 1.00 141.03 ? 27  LEU C CD2   1 
ATOM 7665 N N     . SER I 6 29  ? 148.444 138.719 136.493 1.00 137.05 ? 28  SER C N     1 
ATOM 7666 C CA    . SER I 6 29  ? 147.846 140.041 136.462 1.00 137.05 ? 28  SER C CA    1 
ATOM 7667 C C     . SER I 6 29  ? 146.381 140.094 136.862 1.00 137.05 ? 28  SER C C     1 
ATOM 7668 O O     . SER I 6 29  ? 145.916 141.166 137.258 1.00 137.05 ? 28  SER C O     1 
ATOM 7669 C CB    . SER I 6 29  ? 147.983 140.638 135.058 1.00 137.05 ? 28  SER C CB    1 
ATOM 7670 O OG    . SER I 6 29  ? 149.346 140.795 134.719 1.00 137.05 ? 28  SER C OG    1 
ATOM 7671 N N     . PHE I 6 30  ? 145.648 138.990 136.794 1.00 133.93 ? 29  PHE C N     1 
ATOM 7672 C CA    . PHE I 6 30  ? 144.273 138.988 137.270 1.00 133.93 ? 29  PHE C CA    1 
ATOM 7673 C C     . PHE I 6 30  ? 144.208 138.612 138.740 1.00 133.93 ? 29  PHE C C     1 
ATOM 7674 O O     . PHE I 6 30  ? 145.027 137.841 139.241 1.00 133.93 ? 29  PHE C O     1 
ATOM 7675 C CB    . PHE I 6 30  ? 143.412 138.024 136.460 1.00 133.93 ? 29  PHE C CB    1 
ATOM 7676 C CG    . PHE I 6 30  ? 143.015 138.554 135.123 1.00 133.93 ? 29  PHE C CG    1 
ATOM 7677 C CD1   . PHE I 6 30  ? 143.341 139.843 134.755 1.00 133.93 ? 29  PHE C CD1   1 
ATOM 7678 C CD2   . PHE I 6 30  ? 142.315 137.767 134.234 1.00 133.93 ? 29  PHE C CD2   1 
ATOM 7679 C CE1   . PHE I 6 30  ? 142.980 140.331 133.524 1.00 133.93 ? 29  PHE C CE1   1 
ATOM 7680 C CE2   . PHE I 6 30  ? 141.951 138.251 133.003 1.00 133.93 ? 29  PHE C CE2   1 
ATOM 7681 C CZ    . PHE I 6 30  ? 142.283 139.534 132.647 1.00 133.93 ? 29  PHE C CZ    1 
ATOM 7682 N N     . SER I 6 31  ? 143.192 139.125 139.418 1.00 134.23 ? 30  SER C N     1 
ATOM 7683 C CA    . SER I 6 31  ? 143.005 138.822 140.828 1.00 134.23 ? 30  SER C CA    1 
ATOM 7684 C C     . SER I 6 31  ? 142.364 137.455 140.978 1.00 134.23 ? 30  SER C C     1 
ATOM 7685 O O     . SER I 6 31  ? 141.281 137.206 140.439 1.00 134.23 ? 30  SER C O     1 
ATOM 7686 C CB    . SER I 6 31  ? 142.138 139.879 141.497 1.00 134.23 ? 30  SER C CB    1 
ATOM 7687 O OG    . SER I 6 31  ? 140.777 139.543 141.357 1.00 134.23 ? 30  SER C OG    1 
ATOM 7688 N N     . VAL I 6 32  ? 143.017 136.577 141.730 1.00 133.72 ? 31  VAL C N     1 
ATOM 7689 C CA    . VAL I 6 32  ? 142.419 135.280 141.999 1.00 133.72 ? 31  VAL C CA    1 
ATOM 7690 C C     . VAL I 6 32  ? 141.190 135.443 142.878 1.00 133.72 ? 31  VAL C C     1 
ATOM 7691 O O     . VAL I 6 32  ? 140.197 134.724 142.720 1.00 133.72 ? 31  VAL C O     1 
ATOM 7692 C CB    . VAL I 6 32  ? 143.459 134.331 142.614 1.00 133.72 ? 31  VAL C CB    1 
ATOM 7693 C CG1   . VAL I 6 32  ? 144.690 134.306 141.740 1.00 133.72 ? 31  VAL C CG1   1 
ATOM 7694 C CG2   . VAL I 6 32  ? 143.823 134.754 144.022 1.00 133.72 ? 31  VAL C CG2   1 
ATOM 7695 N N     . SER I 6 33  ? 141.222 136.390 143.811 1.00 134.93 ? 32  SER C N     1 
ATOM 7696 C CA    . SER I 6 33  ? 140.124 136.448 144.759 1.00 134.93 ? 32  SER C CA    1 
ATOM 7697 C C     . SER I 6 33  ? 138.836 136.944 144.121 1.00 134.93 ? 32  SER C C     1 
ATOM 7698 O O     . SER I 6 33  ? 137.760 136.528 144.553 1.00 134.93 ? 32  SER C O     1 
ATOM 7699 C CB    . SER I 6 33  ? 140.499 137.338 145.943 1.00 134.93 ? 32  SER C CB    1 
ATOM 7700 O OG    . SER I 6 33  ? 141.727 136.932 146.525 1.00 134.93 ? 32  SER C OG    1 
ATOM 7701 N N     . GLN I 6 34  ? 138.904 137.705 143.026 1.00 135.91 ? 33  GLN C N     1 
ATOM 7702 C CA    . GLN I 6 34  ? 137.648 138.113 142.404 1.00 135.91 ? 33  GLN C CA    1 
ATOM 7703 C C     . GLN I 6 34  ? 137.070 137.010 141.531 1.00 135.91 ? 33  GLN C C     1 
ATOM 7704 O O     . GLN I 6 34  ? 135.846 136.871 141.452 1.00 135.91 ? 33  GLN C O     1 
ATOM 7705 C CB    . GLN I 6 34  ? 137.810 139.393 141.588 1.00 135.91 ? 33  GLN C CB    1 
ATOM 7706 C CG    . GLN I 6 34  ? 136.472 139.941 141.119 1.00 135.91 ? 33  GLN C CG    1 
ATOM 7707 C CD    . GLN I 6 34  ? 136.594 141.233 140.346 1.00 135.91 ? 33  GLN C CD    1 
ATOM 7708 O OE1   . GLN I 6 34  ? 137.695 141.707 140.073 1.00 135.91 ? 33  GLN C OE1   1 
ATOM 7709 N NE2   . GLN I 6 34  ? 135.456 141.831 140.016 1.00 135.91 ? 33  GLN C NE2   1 
ATOM 7710 N N     . VAL I 6 35  ? 137.913 136.214 140.876 1.00 130.19 ? 34  VAL C N     1 
ATOM 7711 C CA    . VAL I 6 35  ? 137.370 135.086 140.133 1.00 130.19 ? 34  VAL C CA    1 
ATOM 7712 C C     . VAL I 6 35  ? 136.778 134.072 141.100 1.00 130.19 ? 34  VAL C C     1 
ATOM 7713 O O     . VAL I 6 35  ? 135.719 133.489 140.841 1.00 130.19 ? 34  VAL C O     1 
ATOM 7714 C CB    . VAL I 6 35  ? 138.429 134.463 139.204 1.00 130.19 ? 34  VAL C CB    1 
ATOM 7715 C CG1   . VAL I 6 35  ? 139.117 135.541 138.413 1.00 130.19 ? 34  VAL C CG1   1 
ATOM 7716 C CG2   . VAL I 6 35  ? 139.439 133.649 139.975 1.00 130.19 ? 34  VAL C CG2   1 
ATOM 7717 N N     . GLU I 6 36  ? 137.419 133.877 142.253 1.00 130.32 ? 35  GLU C N     1 
ATOM 7718 C CA    . GLU I 6 36  ? 136.840 132.978 143.241 1.00 130.32 ? 35  GLU C CA    1 
ATOM 7719 C C     . GLU I 6 36  ? 135.537 133.541 143.792 1.00 130.32 ? 35  GLU C C     1 
ATOM 7720 O O     . GLU I 6 36  ? 134.572 132.798 143.994 1.00 130.32 ? 35  GLU C O     1 
ATOM 7721 C CB    . GLU I 6 36  ? 137.842 132.720 144.366 1.00 130.32 ? 35  GLU C CB    1 
ATOM 7722 C CG    . GLU I 6 36  ? 137.386 131.688 145.374 1.00 130.32 ? 35  GLU C CG    1 
ATOM 7723 C CD    . GLU I 6 36  ? 138.431 131.414 146.437 1.00 130.32 ? 35  GLU C CD    1 
ATOM 7724 O OE1   . GLU I 6 36  ? 139.493 132.065 146.402 1.00 130.32 ? 35  GLU C OE1   1 
ATOM 7725 O OE2   . GLU I 6 36  ? 138.195 130.549 147.305 1.00 130.32 ? 35  GLU C OE2   1 
ATOM 7726 N N     . ARG I 6 37  ? 135.467 134.858 143.970 1.00 130.31 ? 36  ARG C N     1 
ATOM 7727 C CA    . ARG I 6 37  ? 134.248 135.481 144.465 1.00 130.31 ? 36  ARG C CA    1 
ATOM 7728 C C     . ARG I 6 37  ? 133.140 135.429 143.439 1.00 130.31 ? 36  ARG C C     1 
ATOM 7729 O O     . ARG I 6 37  ? 131.957 135.418 143.800 1.00 130.31 ? 36  ARG C O     1 
ATOM 7730 C CB    . ARG I 6 37  ? 134.516 136.941 144.816 1.00 130.31 ? 36  ARG C CB    1 
ATOM 7731 C CG    . ARG I 6 37  ? 133.397 137.620 145.560 1.00 130.31 ? 36  ARG C CG    1 
ATOM 7732 C CD    . ARG I 6 37  ? 133.801 139.034 145.917 1.00 130.31 ? 36  ARG C CD    1 
ATOM 7733 N NE    . ARG I 6 37  ? 133.952 139.910 144.758 1.00 130.31 ? 36  ARG C NE    1 
ATOM 7734 C CZ    . ARG I 6 37  ? 134.525 141.107 144.828 1.00 130.31 ? 36  ARG C CZ    1 
ATOM 7735 N NH1   . ARG I 6 37  ? 134.991 141.531 145.993 1.00 130.31 ? 36  ARG C NH1   1 
ATOM 7736 N NH2   . ARG I 6 37  ? 134.639 141.879 143.751 1.00 130.31 ? 36  ARG C NH2   1 
ATOM 7737 N N     . SER I 6 38  ? 133.500 135.398 142.163 1.00 130.84 ? 37  SER C N     1 
ATOM 7738 C CA    . SER I 6 38  ? 132.494 135.249 141.132 1.00 130.84 ? 37  SER C CA    1 
ATOM 7739 C C     . SER I 6 38  ? 132.088 133.800 140.964 1.00 130.84 ? 37  SER C C     1 
ATOM 7740 O O     . SER I 6 38  ? 131.004 133.523 140.445 1.00 130.84 ? 37  SER C O     1 
ATOM 7741 C CB    . SER I 6 38  ? 132.995 135.811 139.808 1.00 130.84 ? 37  SER C CB    1 
ATOM 7742 O OG    . SER I 6 38  ? 134.290 135.331 139.530 1.00 130.84 ? 37  SER C OG    1 
ATOM 7743 N N     . LEU I 6 39  ? 132.942 132.872 141.383 1.00 126.22 ? 38  LEU C N     1 
ATOM 7744 C CA    . LEU I 6 39  ? 132.529 131.476 141.389 1.00 126.22 ? 38  LEU C CA    1 
ATOM 7745 C C     . LEU I 6 39  ? 131.626 131.181 142.569 1.00 126.22 ? 38  LEU C C     1 
ATOM 7746 O O     . LEU I 6 39  ? 130.804 130.259 142.509 1.00 126.22 ? 38  LEU C O     1 
ATOM 7747 C CB    . LEU I 6 39  ? 133.744 130.548 141.453 1.00 126.22 ? 38  LEU C CB    1 
ATOM 7748 C CG    . LEU I 6 39  ? 134.590 130.408 140.204 1.00 126.22 ? 38  LEU C CG    1 
ATOM 7749 C CD1   . LEU I 6 39  ? 135.844 129.640 140.507 1.00 126.22 ? 38  LEU C CD1   1 
ATOM 7750 C CD2   . LEU I 6 39  ? 133.781 129.666 139.198 1.00 126.22 ? 38  LEU C CD2   1 
ATOM 7751 N N     . ARG I 6 40  ? 131.802 131.924 143.658 1.00 130.67 ? 39  ARG C N     1 
ATOM 7752 C CA    . ARG I 6 40  ? 130.920 131.761 144.800 1.00 130.67 ? 39  ARG C CA    1 
ATOM 7753 C C     . ARG I 6 40  ? 129.556 132.375 144.516 1.00 130.67 ? 39  ARG C C     1 
ATOM 7754 O O     . ARG I 6 40  ? 128.522 131.796 144.866 1.00 130.67 ? 39  ARG C O     1 
ATOM 7755 C CB    . ARG I 6 40  ? 131.573 132.382 146.022 1.00 130.67 ? 39  ARG C CB    1 
ATOM 7756 C CG    . ARG I 6 40  ? 132.854 131.678 146.418 1.00 130.67 ? 39  ARG C CG    1 
ATOM 7757 C CD    . ARG I 6 40  ? 132.576 130.329 147.026 1.00 130.67 ? 39  ARG C CD    1 
ATOM 7758 N NE    . ARG I 6 40  ? 133.812 129.605 147.282 1.00 130.67 ? 39  ARG C NE    1 
ATOM 7759 C CZ    . ARG I 6 40  ? 134.537 129.737 148.385 1.00 130.67 ? 39  ARG C CZ    1 
ATOM 7760 N NH1   . ARG I 6 40  ? 134.155 130.577 149.334 1.00 130.67 ? 39  ARG C NH1   1 
ATOM 7761 N NH2   . ARG I 6 40  ? 135.648 129.030 148.535 1.00 130.67 ? 39  ARG C NH2   1 
ATOM 7762 N N     . GLU I 6 41  ? 129.532 133.557 143.890 1.00 134.72 ? 40  GLU C N     1 
ATOM 7763 C CA    . GLU I 6 41  ? 128.254 134.187 143.587 1.00 134.72 ? 40  GLU C CA    1 
ATOM 7764 C C     . GLU I 6 41  ? 127.586 133.569 142.372 1.00 134.72 ? 40  GLU C C     1 
ATOM 7765 O O     . GLU I 6 41  ? 126.417 133.871 142.105 1.00 134.72 ? 40  GLU C O     1 
ATOM 7766 C CB    . GLU I 6 41  ? 128.404 135.696 143.355 1.00 134.72 ? 40  GLU C CB    1 
ATOM 7767 C CG    . GLU I 6 41  ? 128.851 136.509 144.553 1.00 134.72 ? 40  GLU C CG    1 
ATOM 7768 C CD    . GLU I 6 41  ? 129.018 137.984 144.220 1.00 134.72 ? 40  GLU C CD    1 
ATOM 7769 O OE1   . GLU I 6 41  ? 128.873 138.350 143.034 1.00 134.72 ? 40  GLU C OE1   1 
ATOM 7770 O OE2   . GLU I 6 41  ? 129.268 138.783 145.147 1.00 134.72 ? 40  GLU C OE2   1 
ATOM 7771 N N     . GLY I 6 42  ? 128.297 132.728 141.631 1.00 129.54 ? 41  GLY C N     1 
ATOM 7772 C CA    . GLY I 6 42  ? 127.690 132.020 140.528 1.00 129.54 ? 41  GLY C CA    1 
ATOM 7773 C C     . GLY I 6 42  ? 127.147 130.696 141.007 1.00 129.54 ? 41  GLY C C     1 
ATOM 7774 O O     . GLY I 6 42  ? 126.283 130.092 140.365 1.00 129.54 ? 41  GLY C O     1 
ATOM 7775 N N     . HIS I 6 43  ? 127.654 130.250 142.156 1.00 130.18 ? 42  HIS C N     1 
ATOM 7776 C CA    . HIS I 6 43  ? 127.258 128.985 142.765 1.00 130.18 ? 42  HIS C CA    1 
ATOM 7777 C C     . HIS I 6 43  ? 127.441 127.845 141.768 1.00 130.18 ? 42  HIS C C     1 
ATOM 7778 O O     . HIS I 6 43  ? 126.554 127.018 141.555 1.00 130.18 ? 42  HIS C O     1 
ATOM 7779 C CB    . HIS I 6 43  ? 125.820 129.049 143.279 1.00 130.18 ? 42  HIS C CB    1 
ATOM 7780 C CG    . HIS I 6 43  ? 125.615 130.046 144.376 1.00 130.18 ? 42  HIS C CG    1 
ATOM 7781 N ND1   . HIS I 6 43  ? 125.235 131.349 144.133 1.00 130.18 ? 42  HIS C ND1   1 
ATOM 7782 C CD2   . HIS I 6 43  ? 125.747 129.939 145.720 1.00 130.18 ? 42  HIS C CD2   1 
ATOM 7783 C CE1   . HIS I 6 43  ? 125.133 131.998 145.278 1.00 130.18 ? 42  HIS C CE1   1 
ATOM 7784 N NE2   . HIS I 6 43  ? 125.439 131.166 146.257 1.00 130.18 ? 42  HIS C NE2   1 
ATOM 7785 N N     . TYR I 6 44  ? 128.627 127.800 141.163 1.00 126.76 ? 43  TYR C N     1 
ATOM 7786 C CA    . TYR I 6 44  ? 128.926 126.763 140.187 1.00 126.76 ? 43  TYR C CA    1 
ATOM 7787 C C     . TYR I 6 44  ? 129.180 125.417 140.838 1.00 126.76 ? 43  TYR C C     1 
ATOM 7788 O O     . TYR I 6 44  ? 129.088 124.389 140.162 1.00 126.76 ? 43  TYR C O     1 
ATOM 7789 C CB    . TYR I 6 44  ? 130.124 127.177 139.343 1.00 126.76 ? 43  TYR C CB    1 
ATOM 7790 C CG    . TYR I 6 44  ? 129.822 128.382 138.505 1.00 126.76 ? 43  TYR C CG    1 
ATOM 7791 C CD1   . TYR I 6 44  ? 129.129 128.263 137.314 1.00 126.76 ? 43  TYR C CD1   1 
ATOM 7792 C CD2   . TYR I 6 44  ? 130.186 129.649 138.929 1.00 126.76 ? 43  TYR C CD2   1 
ATOM 7793 C CE1   . TYR I 6 44  ? 128.834 129.368 136.553 1.00 126.76 ? 43  TYR C CE1   1 
ATOM 7794 C CE2   . TYR I 6 44  ? 129.896 130.759 138.175 1.00 126.76 ? 43  TYR C CE2   1 
ATOM 7795 C CZ    . TYR I 6 44  ? 129.219 130.614 136.989 1.00 126.76 ? 43  TYR C CZ    1 
ATOM 7796 O OH    . TYR I 6 44  ? 128.927 131.724 136.235 1.00 126.76 ? 43  TYR C OH    1 
ATOM 7797 N N     . ALA I 6 45  ? 129.498 125.403 142.126 1.00 129.30 ? 44  ALA C N     1 
ATOM 7798 C CA    . ALA I 6 45  ? 129.600 124.166 142.880 1.00 129.30 ? 44  ALA C CA    1 
ATOM 7799 C C     . ALA I 6 45  ? 129.280 124.480 144.333 1.00 129.30 ? 44  ALA C C     1 
ATOM 7800 O O     . ALA I 6 45  ? 128.803 125.570 144.660 1.00 129.30 ? 44  ALA C O     1 
ATOM 7801 C CB    . ALA I 6 45  ? 130.989 123.538 142.725 1.00 129.30 ? 44  ALA C CB    1 
ATOM 7802 N N     . GLN I 6 46  ? 129.549 123.520 145.210 1.00 134.16 ? 45  GLN C N     1 
ATOM 7803 C CA    . GLN I 6 46  ? 129.369 123.738 146.637 1.00 134.16 ? 45  GLN C CA    1 
ATOM 7804 C C     . GLN I 6 46  ? 130.655 124.170 147.310 1.00 134.16 ? 45  GLN C C     1 
ATOM 7805 O O     . GLN I 6 46  ? 130.612 124.845 148.342 1.00 134.16 ? 45  GLN C O     1 
ATOM 7806 C CB    . GLN I 6 46  ? 128.845 122.474 147.316 1.00 134.16 ? 45  GLN C CB    1 
ATOM 7807 C CG    . GLN I 6 46  ? 127.448 122.082 146.901 1.00 134.16 ? 45  GLN C CG    1 
ATOM 7808 C CD    . GLN I 6 46  ? 126.992 120.816 147.588 1.00 134.16 ? 45  GLN C CD    1 
ATOM 7809 O OE1   . GLN I 6 46  ? 127.761 120.183 148.310 1.00 134.16 ? 45  GLN C OE1   1 
ATOM 7810 N NE2   . GLN I 6 46  ? 125.734 120.446 147.381 1.00 134.16 ? 45  GLN C NE2   1 
ATOM 7811 N N     . ARG I 6 47  ? 131.792 123.767 146.759 1.00 135.22 ? 46  ARG C N     1 
ATOM 7812 C CA    . ARG I 6 47  ? 133.078 124.031 147.379 1.00 135.22 ? 46  ARG C CA    1 
ATOM 7813 C C     . ARG I 6 47  ? 134.123 124.019 146.281 1.00 135.22 ? 46  ARG C C     1 
ATOM 7814 O O     . ARG I 6 47  ? 134.118 123.124 145.432 1.00 135.22 ? 46  ARG C O     1 
ATOM 7815 C CB    . ARG I 6 47  ? 133.406 122.987 148.438 1.00 135.22 ? 46  ARG C CB    1 
ATOM 7816 C CG    . ARG I 6 47  ? 133.203 121.580 147.954 1.00 135.22 ? 46  ARG C CG    1 
ATOM 7817 C CD    . ARG I 6 47  ? 133.384 120.626 149.090 1.00 135.22 ? 46  ARG C CD    1 
ATOM 7818 N NE    . ARG I 6 47  ? 134.787 120.559 149.472 1.00 135.22 ? 46  ARG C NE    1 
ATOM 7819 C CZ    . ARG I 6 47  ? 135.212 120.042 150.615 1.00 135.22 ? 46  ARG C CZ    1 
ATOM 7820 N NH1   . ARG I 6 47  ? 134.336 119.554 151.480 1.00 135.22 ? 46  ARG C NH1   1 
ATOM 7821 N NH2   . ARG I 6 47  ? 136.504 120.020 150.898 1.00 135.22 ? 46  ARG C NH2   1 
ATOM 7822 N N     . LEU I 6 48  ? 134.996 125.012 146.284 1.00 127.23 ? 47  LEU C N     1 
ATOM 7823 C CA    . LEU I 6 48  ? 136.028 125.119 145.271 1.00 127.23 ? 47  LEU C CA    1 
ATOM 7824 C C     . LEU I 6 48  ? 137.237 124.321 145.726 1.00 127.23 ? 47  LEU C C     1 
ATOM 7825 O O     . LEU I 6 48  ? 137.173 123.530 146.667 1.00 127.23 ? 47  LEU C O     1 
ATOM 7826 C CB    . LEU I 6 48  ? 136.389 126.571 144.987 1.00 127.23 ? 47  LEU C CB    1 
ATOM 7827 C CG    . LEU I 6 48  ? 135.278 127.365 144.310 1.00 127.23 ? 47  LEU C CG    1 
ATOM 7828 C CD1   . LEU I 6 48  ? 135.682 128.810 144.136 1.00 127.23 ? 47  LEU C CD1   1 
ATOM 7829 C CD2   . LEU I 6 48  ? 134.962 126.734 142.976 1.00 127.23 ? 47  LEU C CD2   1 
ATOM 7830 N N     . SER I 6 49  ? 138.352 124.524 145.064 1.00 122.37 ? 48  SER C N     1 
ATOM 7831 C CA    . SER I 6 49  ? 139.586 123.881 145.447 1.00 122.37 ? 48  SER C CA    1 
ATOM 7832 C C     . SER I 6 49  ? 140.545 124.936 145.946 1.00 122.37 ? 48  SER C C     1 
ATOM 7833 O O     . SER I 6 49  ? 140.222 126.124 146.008 1.00 122.37 ? 48  SER C O     1 
ATOM 7834 C CB    . SER I 6 49  ? 140.198 123.147 144.264 1.00 122.37 ? 48  SER C CB    1 
ATOM 7835 O OG    . SER I 6 49  ? 141.409 123.781 143.881 1.00 122.37 ? 48  SER C OG    1 
ATOM 7836 N N     . ARG I 6 50  ? 141.743 124.502 146.307 1.00 123.82 ? 49  ARG C N     1 
ATOM 7837 C CA    . ARG I 6 50  ? 142.679 125.501 146.780 1.00 123.82 ? 49  ARG C CA    1 
ATOM 7838 C C     . ARG I 6 50  ? 143.287 126.242 145.604 1.00 123.82 ? 49  ARG C C     1 
ATOM 7839 O O     . ARG I 6 50  ? 143.423 127.466 145.643 1.00 123.82 ? 49  ARG C O     1 
ATOM 7840 C CB    . ARG I 6 50  ? 143.765 124.848 147.635 1.00 123.82 ? 49  ARG C CB    1 
ATOM 7841 C CG    . ARG I 6 50  ? 144.701 125.850 148.267 1.00 123.82 ? 49  ARG C CG    1 
ATOM 7842 C CD    . ARG I 6 50  ? 143.962 126.671 149.307 1.00 123.82 ? 49  ARG C CD    1 
ATOM 7843 N NE    . ARG I 6 50  ? 144.853 127.581 150.011 1.00 123.82 ? 49  ARG C NE    1 
ATOM 7844 C CZ    . ARG I 6 50  ? 144.440 128.540 150.830 1.00 123.82 ? 49  ARG C CZ    1 
ATOM 7845 N NH1   . ARG I 6 50  ? 143.143 128.711 151.047 1.00 123.82 ? 49  ARG C NH1   1 
ATOM 7846 N NH2   . ARG I 6 50  ? 145.322 129.331 151.423 1.00 123.82 ? 49  ARG C NH2   1 
ATOM 7847 N N     . THR I 6 51  ? 143.593 125.527 144.523 1.00 117.57 ? 50  THR C N     1 
ATOM 7848 C CA    . THR I 6 51  ? 144.296 126.101 143.388 1.00 117.57 ? 50  THR C CA    1 
ATOM 7849 C C     . THR I 6 51  ? 143.441 126.139 142.131 1.00 117.57 ? 50  THR C C     1 
ATOM 7850 O O     . THR I 6 51  ? 143.975 126.284 141.030 1.00 117.57 ? 50  THR C O     1 
ATOM 7851 C CB    . THR I 6 51  ? 145.572 125.318 143.113 1.00 117.57 ? 50  THR C CB    1 
ATOM 7852 O OG1   . THR I 6 51  ? 145.234 123.959 142.824 1.00 117.57 ? 50  THR C OG1   1 
ATOM 7853 C CG2   . THR I 6 51  ? 146.449 125.338 144.339 1.00 117.57 ? 50  THR C CG2   1 
ATOM 7854 N N     . ALA I 6 52  ? 142.141 125.997 142.258 1.00 119.83 ? 51  ALA C N     1 
ATOM 7855 C CA    . ALA I 6 52  ? 141.345 126.066 141.043 1.00 119.83 ? 51  ALA C CA    1 
ATOM 7856 C C     . ALA I 6 52  ? 141.177 127.488 140.517 1.00 119.83 ? 51  ALA C C     1 
ATOM 7857 O O     . ALA I 6 52  ? 141.252 127.700 139.296 1.00 119.83 ? 51  ALA C O     1 
ATOM 7858 C CB    . ALA I 6 52  ? 139.973 125.439 141.277 1.00 119.83 ? 51  ALA C CB    1 
ATOM 7859 N N     . PRO I 6 53  ? 140.988 128.502 141.366 1.00 120.78 ? 52  PRO C N     1 
ATOM 7860 C CA    . PRO I 6 53  ? 140.903 129.852 140.816 1.00 120.78 ? 52  PRO C CA    1 
ATOM 7861 C C     . PRO I 6 53  ? 142.231 130.394 140.347 1.00 120.78 ? 52  PRO C C     1 
ATOM 7862 O O     . PRO I 6 53  ? 142.234 131.251 139.461 1.00 120.78 ? 52  PRO C O     1 
ATOM 7863 C CB    . PRO I 6 53  ? 140.338 130.672 141.978 1.00 120.78 ? 52  PRO C CB    1 
ATOM 7864 C CG    . PRO I 6 53  ? 140.757 129.948 143.167 1.00 120.78 ? 52  PRO C CG    1 
ATOM 7865 C CD    . PRO I 6 53  ? 140.666 128.502 142.803 1.00 120.78 ? 52  PRO C CD    1 
ATOM 7866 N N     . VAL I 6 54  ? 143.363 129.884 140.831 1.00 118.59 ? 53  VAL C N     1 
ATOM 7867 C CA    . VAL I 6 54  ? 144.624 130.359 140.280 1.00 118.59 ? 53  VAL C CA    1 
ATOM 7868 C C     . VAL I 6 54  ? 144.787 129.847 138.858 1.00 118.59 ? 53  VAL C C     1 
ATOM 7869 O O     . VAL I 6 54  ? 145.206 130.584 137.959 1.00 118.59 ? 53  VAL C O     1 
ATOM 7870 C CB    . VAL I 6 54  ? 145.806 129.975 141.187 1.00 118.59 ? 53  VAL C CB    1 
ATOM 7871 C CG1   . VAL I 6 54  ? 145.538 130.431 142.600 1.00 118.59 ? 53  VAL C CG1   1 
ATOM 7872 C CG2   . VAL I 6 54  ? 146.069 128.493 141.159 1.00 118.59 ? 53  VAL C CG2   1 
ATOM 7873 N N     . TYR I 6 55  ? 144.354 128.612 138.609 1.00 119.20 ? 54  TYR C N     1 
ATOM 7874 C CA    . TYR I 6 55  ? 144.442 128.059 137.267 1.00 119.20 ? 54  TYR C CA    1 
ATOM 7875 C C     . TYR I 6 55  ? 143.469 128.772 136.347 1.00 119.20 ? 54  TYR C C     1 
ATOM 7876 O O     . TYR I 6 55  ? 143.800 129.084 135.194 1.00 119.20 ? 54  TYR C O     1 
ATOM 7877 C CB    . TYR I 6 55  ? 144.123 126.571 137.311 1.00 119.20 ? 54  TYR C CB    1 
ATOM 7878 C CG    . TYR I 6 55  ? 144.433 125.792 136.060 1.00 119.20 ? 54  TYR C CG    1 
ATOM 7879 C CD1   . TYR I 6 55  ? 145.691 125.258 135.846 1.00 119.20 ? 54  TYR C CD1   1 
ATOM 7880 C CD2   . TYR I 6 55  ? 143.472 125.607 135.084 1.00 119.20 ? 54  TYR C CD2   1 
ATOM 7881 C CE1   . TYR I 6 55  ? 145.969 124.534 134.710 1.00 119.20 ? 54  TYR C CE1   1 
ATOM 7882 C CE2   . TYR I 6 55  ? 143.742 124.896 133.943 1.00 119.20 ? 54  TYR C CE2   1 
ATOM 7883 C CZ    . TYR I 6 55  ? 144.993 124.364 133.759 1.00 119.20 ? 54  TYR C CZ    1 
ATOM 7884 O OH    . TYR I 6 55  ? 145.264 123.652 132.619 1.00 119.20 ? 54  TYR C OH    1 
ATOM 7885 N N     . LEU I 6 56  ? 142.279 129.094 136.855 1.00 119.74 ? 55  LEU C N     1 
ATOM 7886 C CA    . LEU I 6 56  ? 141.306 129.724 135.979 1.00 119.74 ? 55  LEU C CA    1 
ATOM 7887 C C     . LEU I 6 56  ? 141.684 131.167 135.698 1.00 119.74 ? 55  LEU C C     1 
ATOM 7888 O O     . LEU I 6 56  ? 141.475 131.661 134.582 1.00 119.74 ? 55  LEU C O     1 
ATOM 7889 C CB    . LEU I 6 56  ? 139.918 129.664 136.600 1.00 119.74 ? 55  LEU C CB    1 
ATOM 7890 C CG    . LEU I 6 56  ? 138.841 130.289 135.724 1.00 119.74 ? 55  LEU C CG    1 
ATOM 7891 C CD1   . LEU I 6 56  ? 138.836 129.624 134.373 1.00 119.74 ? 55  LEU C CD1   1 
ATOM 7892 C CD2   . LEU I 6 56  ? 137.488 130.180 136.382 1.00 119.74 ? 55  LEU C CD2   1 
ATOM 7893 N N     . ALA I 6 57  ? 142.314 131.836 136.657 1.00 123.35 ? 56  ALA C N     1 
ATOM 7894 C CA    . ALA I 6 57  ? 142.744 133.188 136.384 1.00 123.35 ? 56  ALA C CA    1 
ATOM 7895 C C     . ALA I 6 57  ? 143.971 133.203 135.503 1.00 123.35 ? 56  ALA C C     1 
ATOM 7896 O O     . ALA I 6 57  ? 144.128 134.129 134.707 1.00 123.35 ? 56  ALA C O     1 
ATOM 7897 C CB    . ALA I 6 57  ? 143.027 133.933 137.685 1.00 123.35 ? 56  ALA C CB    1 
ATOM 7898 N N     . ALA I 6 58  ? 144.760 132.132 135.501 1.00 119.19 ? 57  ALA C N     1 
ATOM 7899 C CA    . ALA I 6 58  ? 145.890 132.150 134.593 1.00 119.19 ? 57  ALA C CA    1 
ATOM 7900 C C     . ALA I 6 58  ? 145.465 131.796 133.183 1.00 119.19 ? 57  ALA C C     1 
ATOM 7901 O O     . ALA I 6 58  ? 146.037 132.321 132.223 1.00 119.19 ? 57  ALA C O     1 
ATOM 7902 C CB    . ALA I 6 58  ? 146.965 131.180 135.064 1.00 119.19 ? 57  ALA C CB    1 
ATOM 7903 N N     . VAL I 6 59  ? 144.386 131.032 133.026 1.00 122.20 ? 58  VAL C N     1 
ATOM 7904 C CA    . VAL I 6 59  ? 143.945 130.771 131.660 1.00 122.20 ? 58  VAL C CA    1 
ATOM 7905 C C     . VAL I 6 59  ? 143.215 131.984 131.100 1.00 122.20 ? 58  VAL C C     1 
ATOM 7906 O O     . VAL I 6 59  ? 143.408 132.351 129.934 1.00 122.20 ? 58  VAL C O     1 
ATOM 7907 C CB    . VAL I 6 59  ? 143.090 129.496 131.569 1.00 122.20 ? 58  VAL C CB    1 
ATOM 7908 C CG1   . VAL I 6 59  ? 141.871 129.588 132.435 1.00 122.20 ? 58  VAL C CG1   1 
ATOM 7909 C CG2   . VAL I 6 59  ? 142.689 129.252 130.134 1.00 122.20 ? 58  VAL C CG2   1 
ATOM 7910 N N     . ILE I 6 60  ? 142.375 132.640 131.903 1.00 123.22 ? 59  ILE C N     1 
ATOM 7911 C CA    . ILE I 6 60  ? 141.713 133.812 131.349 1.00 123.22 ? 59  ILE C CA    1 
ATOM 7912 C C     . ILE I 6 60  ? 142.729 134.919 131.138 1.00 123.22 ? 59  ILE C C     1 
ATOM 7913 O O     . ILE I 6 60  ? 142.617 135.708 130.188 1.00 123.22 ? 59  ILE C O     1 
ATOM 7914 C CB    . ILE I 6 60  ? 140.547 134.264 132.242 1.00 123.22 ? 59  ILE C CB    1 
ATOM 7915 C CG1   . ILE I 6 60  ? 139.563 133.122 132.431 1.00 123.22 ? 59  ILE C CG1   1 
ATOM 7916 C CG2   . ILE I 6 60  ? 139.838 135.432 131.623 1.00 123.22 ? 59  ILE C CG2   1 
ATOM 7917 C CD1   . ILE I 6 60  ? 138.500 133.408 133.453 1.00 123.22 ? 59  ILE C CD1   1 
ATOM 7918 N N     . GLU I 6 61  ? 143.783 134.950 131.954 1.00 128.21 ? 60  GLU C N     1 
ATOM 7919 C CA    . GLU I 6 61  ? 144.827 135.931 131.735 1.00 128.21 ? 60  GLU C CA    1 
ATOM 7920 C C     . GLU I 6 61  ? 145.565 135.629 130.448 1.00 128.21 ? 60  GLU C C     1 
ATOM 7921 O O     . GLU I 6 61  ? 145.922 136.545 129.702 1.00 128.21 ? 60  GLU C O     1 
ATOM 7922 C CB    . GLU I 6 61  ? 145.781 135.934 132.923 1.00 128.21 ? 60  GLU C CB    1 
ATOM 7923 C CG    . GLU I 6 61  ? 146.903 136.935 132.835 1.00 128.21 ? 60  GLU C CG    1 
ATOM 7924 C CD    . GLU I 6 61  ? 147.777 136.914 134.071 1.00 128.21 ? 60  GLU C CD    1 
ATOM 7925 O OE1   . GLU I 6 61  ? 147.446 136.165 135.011 1.00 128.21 ? 60  GLU C OE1   1 
ATOM 7926 O OE2   . GLU I 6 61  ? 148.786 137.643 134.108 1.00 128.21 ? 60  GLU C OE2   1 
ATOM 7927 N N     . TYR I 6 62  ? 145.752 134.347 130.140 1.00 125.98 ? 61  TYR C N     1 
ATOM 7928 C CA    . TYR I 6 62  ? 146.414 134.020 128.890 1.00 125.98 ? 61  TYR C CA    1 
ATOM 7929 C C     . TYR I 6 62  ? 145.551 134.403 127.703 1.00 125.98 ? 61  TYR C C     1 
ATOM 7930 O O     . TYR I 6 62  ? 146.061 134.897 126.694 1.00 125.98 ? 61  TYR C O     1 
ATOM 7931 C CB    . TYR I 6 62  ? 146.753 132.541 128.812 1.00 125.98 ? 61  TYR C CB    1 
ATOM 7932 C CG    . TYR I 6 62  ? 147.241 132.204 127.437 1.00 125.98 ? 61  TYR C CG    1 
ATOM 7933 C CD1   . TYR I 6 62  ? 148.483 132.627 127.005 1.00 125.98 ? 61  TYR C CD1   1 
ATOM 7934 C CD2   . TYR I 6 62  ? 146.434 131.521 126.546 1.00 125.98 ? 61  TYR C CD2   1 
ATOM 7935 C CE1   . TYR I 6 62  ? 148.926 132.344 125.738 1.00 125.98 ? 61  TYR C CE1   1 
ATOM 7936 C CE2   . TYR I 6 62  ? 146.865 131.235 125.278 1.00 125.98 ? 61  TYR C CE2   1 
ATOM 7937 C CZ    . TYR I 6 62  ? 148.112 131.648 124.876 1.00 125.98 ? 61  TYR C CZ    1 
ATOM 7938 O OH    . TYR I 6 62  ? 148.546 131.362 123.602 1.00 125.98 ? 61  TYR C OH    1 
ATOM 7939 N N     . LEU I 6 63  ? 144.241 134.193 127.800 1.00 131.86 ? 62  LEU C N     1 
ATOM 7940 C CA    . LEU I 6 63  ? 143.413 134.539 126.651 1.00 131.86 ? 62  LEU C CA    1 
ATOM 7941 C C     . LEU I 6 63  ? 143.314 136.042 126.459 1.00 131.86 ? 62  LEU C C     1 
ATOM 7942 O O     . LEU I 6 63  ? 143.304 136.520 125.316 1.00 131.86 ? 62  LEU C O     1 
ATOM 7943 C CB    . LEU I 6 63  ? 142.016 133.953 126.790 1.00 131.86 ? 62  LEU C CB    1 
ATOM 7944 C CG    . LEU I 6 63  ? 141.991 132.442 126.734 1.00 131.86 ? 62  LEU C CG    1 
ATOM 7945 C CD1   . LEU I 6 63  ? 140.581 131.958 126.978 1.00 131.86 ? 62  LEU C CD1   1 
ATOM 7946 C CD2   . LEU I 6 63  ? 142.510 131.992 125.387 1.00 131.86 ? 62  LEU C CD2   1 
ATOM 7947 N N     . THR I 6 64  ? 143.326 136.809 127.546 1.00 132.32 ? 63  THR C N     1 
ATOM 7948 C CA    . THR I 6 64  ? 143.295 138.252 127.371 1.00 132.32 ? 63  THR C CA    1 
ATOM 7949 C C     . THR I 6 64  ? 144.631 138.766 126.866 1.00 132.32 ? 63  THR C C     1 
ATOM 7950 O O     . THR I 6 64  ? 144.672 139.658 126.014 1.00 132.32 ? 63  THR C O     1 
ATOM 7951 C CB    . THR I 6 64  ? 142.928 138.930 128.682 1.00 132.32 ? 63  THR C CB    1 
ATOM 7952 O OG1   . THR I 6 64  ? 143.798 138.445 129.715 1.00 132.32 ? 63  THR C OG1   1 
ATOM 7953 C CG2   . THR I 6 64  ? 141.498 138.630 129.039 1.00 132.32 ? 63  THR C CG2   1 
ATOM 7954 N N     . ALA I 6 65  ? 145.731 138.192 127.342 1.00 135.93 ? 64  ALA C N     1 
ATOM 7955 C CA    . ALA I 6 65  ? 147.040 138.599 126.865 1.00 135.93 ? 64  ALA C CA    1 
ATOM 7956 C C     . ALA I 6 65  ? 147.388 137.973 125.527 1.00 135.93 ? 64  ALA C C     1 
ATOM 7957 O O     . ALA I 6 65  ? 148.490 138.200 125.020 1.00 135.93 ? 64  ALA C O     1 
ATOM 7958 C CB    . ALA I 6 65  ? 148.110 138.245 127.896 1.00 135.93 ? 64  ALA C CB    1 
ATOM 7959 N N     . LYS I 6 66  ? 146.503 137.159 124.969 1.00 136.70 ? 65  LYS C N     1 
ATOM 7960 C CA    . LYS I 6 66  ? 146.670 136.728 123.594 1.00 136.70 ? 65  LYS C CA    1 
ATOM 7961 C C     . LYS I 6 66  ? 145.783 137.501 122.638 1.00 136.70 ? 65  LYS C C     1 
ATOM 7962 O O     . LYS I 6 66  ? 146.173 137.714 121.487 1.00 136.70 ? 65  LYS C O     1 
ATOM 7963 C CB    . LYS I 6 66  ? 146.382 135.233 123.465 1.00 136.70 ? 65  LYS C CB    1 
ATOM 7964 C CG    . LYS I 6 66  ? 146.834 134.637 122.149 1.00 136.70 ? 65  LYS C CG    1 
ATOM 7965 C CD    . LYS I 6 66  ? 148.342 134.733 122.025 1.00 136.70 ? 65  LYS C CD    1 
ATOM 7966 C CE    . LYS I 6 66  ? 148.830 134.150 120.716 1.00 136.70 ? 65  LYS C CE    1 
ATOM 7967 N NZ    . LYS I 6 66  ? 148.649 132.676 120.692 1.00 136.70 ? 65  LYS C NZ    1 
ATOM 7968 N N     . VAL I 6 67  ? 144.601 137.929 123.083 1.00 138.99 ? 66  VAL C N     1 
ATOM 7969 C CA    . VAL I 6 67  ? 143.781 138.764 122.216 1.00 138.99 ? 66  VAL C CA    1 
ATOM 7970 C C     . VAL I 6 67  ? 144.295 140.199 122.197 1.00 138.99 ? 66  VAL C C     1 
ATOM 7971 O O     . VAL I 6 67  ? 144.408 140.815 121.130 1.00 138.99 ? 66  VAL C O     1 
ATOM 7972 C CB    . VAL I 6 67  ? 142.303 138.689 122.632 1.00 138.99 ? 66  VAL C CB    1 
ATOM 7973 C CG1   . VAL I 6 67  ? 142.137 139.077 124.072 1.00 138.99 ? 66  VAL C CG1   1 
ATOM 7974 C CG2   . VAL I 6 67  ? 141.469 139.605 121.755 1.00 138.99 ? 66  VAL C CG2   1 
ATOM 7975 N N     . LEU I 6 68  ? 144.621 140.765 123.359 1.00 145.67 ? 67  LEU C N     1 
ATOM 7976 C CA    . LEU I 6 68  ? 145.075 142.141 123.358 1.00 145.67 ? 67  LEU C CA    1 
ATOM 7977 C C     . LEU I 6 68  ? 146.504 142.256 122.873 1.00 145.67 ? 67  LEU C C     1 
ATOM 7978 O O     . LEU I 6 68  ? 146.898 143.329 122.415 1.00 145.67 ? 67  LEU C O     1 
ATOM 7979 C CB    . LEU I 6 68  ? 144.951 142.743 124.754 1.00 145.67 ? 67  LEU C CB    1 
ATOM 7980 C CG    . LEU I 6 68  ? 143.512 142.897 125.238 1.00 145.67 ? 67  LEU C CG    1 
ATOM 7981 C CD1   . LEU I 6 68  ? 143.484 143.430 126.653 1.00 145.67 ? 67  LEU C CD1   1 
ATOM 7982 C CD2   . LEU I 6 68  ? 142.730 143.790 124.305 1.00 145.67 ? 67  LEU C CD2   1 
ATOM 7983 N N     . GLU I 6 69  ? 147.250 141.153 122.854 1.00 154.84 ? 68  GLU C N     1 
ATOM 7984 C CA    . GLU I 6 69  ? 148.567 141.209 122.243 1.00 154.84 ? 68  GLU C CA    1 
ATOM 7985 C C     . GLU I 6 69  ? 148.429 141.399 120.747 1.00 154.84 ? 68  GLU C C     1 
ATOM 7986 O O     . GLU I 6 69  ? 149.213 142.131 120.134 1.00 154.84 ? 68  GLU C O     1 
ATOM 7987 C CB    . GLU I 6 69  ? 149.355 139.945 122.563 1.00 154.84 ? 68  GLU C CB    1 
ATOM 7988 C CG    . GLU I 6 69  ? 150.783 139.956 122.056 1.00 154.84 ? 68  GLU C CG    1 
ATOM 7989 C CD    . GLU I 6 69  ? 150.917 139.367 120.668 1.00 154.84 ? 68  GLU C CD    1 
ATOM 7990 O OE1   . GLU I 6 69  ? 149.896 138.909 120.117 1.00 154.84 ? 68  GLU C OE1   1 
ATOM 7991 O OE2   . GLU I 6 69  ? 152.044 139.354 120.131 1.00 154.84 ? 68  GLU C OE2   1 
ATOM 7992 N N     . LEU I 6 70  ? 147.375 140.843 120.166 1.00 155.84 ? 69  LEU C N     1 
ATOM 7993 C CA    . LEU I 6 70  ? 147.178 140.954 118.735 1.00 155.84 ? 69  LEU C CA    1 
ATOM 7994 C C     . LEU I 6 70  ? 146.481 142.252 118.392 1.00 155.84 ? 69  LEU C C     1 
ATOM 7995 O O     . LEU I 6 70  ? 146.742 142.828 117.334 1.00 155.84 ? 69  LEU C O     1 
ATOM 7996 C CB    . LEU I 6 70  ? 146.364 139.773 118.211 1.00 155.84 ? 69  LEU C CB    1 
ATOM 7997 C CG    . LEU I 6 70  ? 147.011 138.406 118.395 1.00 155.84 ? 69  LEU C CG    1 
ATOM 7998 C CD1   . LEU I 6 70  ? 146.035 137.318 118.021 1.00 155.84 ? 69  LEU C CD1   1 
ATOM 7999 C CD2   . LEU I 6 70  ? 148.255 138.319 117.535 1.00 155.84 ? 69  LEU C CD2   1 
ATOM 8000 N N     . ALA I 6 71  ? 145.632 142.749 119.288 1.00 160.11 ? 70  ALA C N     1 
ATOM 8001 C CA    . ALA I 6 71  ? 145.038 144.056 119.049 1.00 160.11 ? 70  ALA C CA    1 
ATOM 8002 C C     . ALA I 6 71  ? 146.091 145.151 119.150 1.00 160.11 ? 70  ALA C C     1 
ATOM 8003 O O     . ALA I 6 71  ? 146.088 146.098 118.355 1.00 160.11 ? 70  ALA C O     1 
ATOM 8004 C CB    . ALA I 6 71  ? 143.900 144.307 120.034 1.00 160.11 ? 70  ALA C CB    1 
ATOM 8005 N N     . GLY I 6 72  ? 147.044 145.005 120.075 1.00 165.14 ? 71  GLY C N     1 
ATOM 8006 C CA    . GLY I 6 72  ? 148.148 145.941 120.133 1.00 165.14 ? 71  GLY C CA    1 
ATOM 8007 C C     . GLY I 6 72  ? 149.184 145.734 119.058 1.00 165.14 ? 71  GLY C C     1 
ATOM 8008 O O     . GLY I 6 72  ? 149.926 146.669 118.743 1.00 165.14 ? 71  GLY C O     1 
ATOM 8009 N N     . ASN I 6 73  ? 149.257 144.533 118.483 1.00 170.83 ? 72  ASN C N     1 
ATOM 8010 C CA    . ASN I 6 73  ? 150.120 144.350 117.328 1.00 170.83 ? 72  ASN C CA    1 
ATOM 8011 C C     . ASN I 6 73  ? 149.493 144.932 116.073 1.00 170.83 ? 72  ASN C C     1 
ATOM 8012 O O     . ASN I 6 73  ? 150.200 145.487 115.226 1.00 170.83 ? 72  ASN C O     1 
ATOM 8013 C CB    . ASN I 6 73  ? 150.424 142.869 117.124 1.00 170.83 ? 72  ASN C CB    1 
ATOM 8014 C CG    . ASN I 6 73  ? 151.535 142.379 118.022 1.00 170.83 ? 72  ASN C CG    1 
ATOM 8015 O OD1   . ASN I 6 73  ? 151.852 141.192 118.046 1.00 170.83 ? 72  ASN C OD1   1 
ATOM 8016 N ND2   . ASN I 6 73  ? 152.130 143.295 118.780 1.00 170.83 ? 72  ASN C ND2   1 
ATOM 8017 N N     . GLU I 6 74  ? 148.167 144.876 115.967 1.00 176.82 ? 73  GLU C N     1 
ATOM 8018 C CA    . GLU I 6 74  ? 147.492 145.375 114.781 1.00 176.82 ? 73  GLU C CA    1 
ATOM 8019 C C     . GLU I 6 74  ? 147.273 146.873 114.832 1.00 176.82 ? 73  GLU C C     1 
ATOM 8020 O O     . GLU I 6 74  ? 147.156 147.502 113.774 1.00 176.82 ? 73  GLU C O     1 
ATOM 8021 C CB    . GLU I 6 74  ? 146.161 144.656 114.590 1.00 176.82 ? 73  GLU C CB    1 
ATOM 8022 C CG    . GLU I 6 74  ? 146.316 143.175 114.324 1.00 176.82 ? 73  GLU C CG    1 
ATOM 8023 C CD    . GLU I 6 74  ? 146.965 142.887 112.991 1.00 176.82 ? 73  GLU C CD    1 
ATOM 8024 O OE1   . GLU I 6 74  ? 146.752 143.672 112.044 1.00 176.82 ? 73  GLU C OE1   1 
ATOM 8025 O OE2   . GLU I 6 74  ? 147.686 141.872 112.891 1.00 176.82 ? 73  GLU C OE2   1 
ATOM 8026 N N     . ALA I 6 75  ? 147.236 147.464 116.026 1.00 177.19 ? 74  ALA C N     1 
ATOM 8027 C CA    . ALA I 6 75  ? 147.092 148.910 116.090 1.00 177.19 ? 74  ALA C CA    1 
ATOM 8028 C C     . ALA I 6 75  ? 148.371 149.590 115.631 1.00 177.19 ? 74  ALA C C     1 
ATOM 8029 O O     . ALA I 6 75  ? 148.320 150.650 115.000 1.00 177.19 ? 74  ALA C O     1 
ATOM 8030 C CB    . ALA I 6 75  ? 146.731 149.348 117.507 1.00 177.19 ? 74  ALA C CB    1 
ATOM 8031 N N     . GLN I 6 76  ? 149.522 148.982 115.912 1.00 182.47 ? 75  GLN C N     1 
ATOM 8032 C CA    . GLN I 6 76  ? 150.790 149.530 115.459 1.00 182.47 ? 75  GLN C CA    1 
ATOM 8033 C C     . GLN I 6 76  ? 151.177 149.028 114.076 1.00 182.47 ? 75  GLN C C     1 
ATOM 8034 O O     . GLN I 6 76  ? 151.984 149.676 113.401 1.00 182.47 ? 75  GLN C O     1 
ATOM 8035 C CB    . GLN I 6 76  ? 151.905 149.179 116.443 1.00 182.47 ? 75  GLN C CB    1 
ATOM 8036 C CG    . GLN I 6 76  ? 152.090 147.690 116.631 1.00 182.47 ? 75  GLN C CG    1 
ATOM 8037 C CD    . GLN I 6 76  ? 152.931 147.361 117.844 1.00 182.47 ? 75  GLN C CD    1 
ATOM 8038 O OE1   . GLN I 6 76  ? 153.442 148.255 118.519 1.00 182.47 ? 75  GLN C OE1   1 
ATOM 8039 N NE2   . GLN I 6 76  ? 153.078 146.074 118.128 1.00 182.47 ? 75  GLN C NE2   1 
ATOM 8040 N N     . ASN I 6 77  ? 150.613 147.902 113.632 1.00 187.17 ? 76  ASN C N     1 
ATOM 8041 C CA    . ASN I 6 77  ? 150.832 147.479 112.255 1.00 187.17 ? 76  ASN C CA    1 
ATOM 8042 C C     . ASN I 6 77  ? 150.038 148.357 111.301 1.00 187.17 ? 76  ASN C C     1 
ATOM 8043 O O     . ASN I 6 77  ? 150.553 148.780 110.260 1.00 187.17 ? 76  ASN C O     1 
ATOM 8044 C CB    . ASN I 6 77  ? 150.444 146.009 112.093 1.00 187.17 ? 76  ASN C CB    1 
ATOM 8045 C CG    . ASN I 6 77  ? 150.726 145.473 110.700 1.00 187.17 ? 76  ASN C CG    1 
ATOM 8046 O OD1   . ASN I 6 77  ? 151.212 146.189 109.825 1.00 187.17 ? 76  ASN C OD1   1 
ATOM 8047 N ND2   . ASN I 6 77  ? 150.428 144.197 110.492 1.00 187.17 ? 76  ASN C ND2   1 
ATOM 8048 N N     . SER I 6 78  ? 148.785 148.652 111.648 1.00 181.31 ? 77  SER C N     1 
ATOM 8049 C CA    . SER I 6 78  ? 148.005 149.575 110.839 1.00 181.31 ? 77  SER C CA    1 
ATOM 8050 C C     . SER I 6 78  ? 148.496 151.001 111.032 1.00 181.31 ? 77  SER C C     1 
ATOM 8051 O O     . SER I 6 78  ? 148.554 151.782 110.077 1.00 181.31 ? 77  SER C O     1 
ATOM 8052 C CB    . SER I 6 78  ? 146.527 149.462 111.194 1.00 181.31 ? 77  SER C CB    1 
ATOM 8053 O OG    . SER I 6 78  ? 146.208 150.320 112.273 1.00 181.31 ? 77  SER C OG    1 
ATOM 8054 N N     . GLY I 6 79  ? 148.848 151.356 112.262 1.00 180.86 ? 78  GLY C N     1 
ATOM 8055 C CA    . GLY I 6 79  ? 149.265 152.706 112.573 1.00 180.86 ? 78  GLY C CA    1 
ATOM 8056 C C     . GLY I 6 79  ? 148.317 153.403 113.524 1.00 180.86 ? 78  GLY C C     1 
ATOM 8057 O O     . GLY I 6 79  ? 148.455 154.601 113.785 1.00 180.86 ? 78  GLY C O     1 
ATOM 8058 N N     . GLU I 6 80  ? 147.350 152.663 114.052 1.00 178.89 ? 79  GLU C N     1 
ATOM 8059 C CA    . GLU I 6 80  ? 146.418 153.252 114.995 1.00 178.89 ? 79  GLU C CA    1 
ATOM 8060 C C     . GLU I 6 80  ? 147.080 153.459 116.352 1.00 178.89 ? 79  GLU C C     1 
ATOM 8061 O O     . GLU I 6 80  ? 148.059 152.798 116.708 1.00 178.89 ? 79  GLU C O     1 
ATOM 8062 C CB    . GLU I 6 80  ? 145.175 152.383 115.134 1.00 178.89 ? 79  GLU C CB    1 
ATOM 8063 C CG    . GLU I 6 80  ? 144.359 152.357 113.868 1.00 178.89 ? 79  GLU C CG    1 
ATOM 8064 C CD    . GLU I 6 80  ? 143.718 153.697 113.589 1.00 178.89 ? 79  GLU C CD    1 
ATOM 8065 O OE1   . GLU I 6 80  ? 143.387 154.410 114.560 1.00 178.89 ? 79  GLU C OE1   1 
ATOM 8066 O OE2   . GLU I 6 80  ? 143.557 154.044 112.401 1.00 178.89 ? 79  GLU C OE2   1 
ATOM 8067 N N     . ARG I 6 81  ? 146.533 154.406 117.109 1.00 174.82 ? 80  ARG C N     1 
ATOM 8068 C CA    . ARG I 6 81  ? 147.039 154.694 118.446 1.00 174.82 ? 80  ARG C CA    1 
ATOM 8069 C C     . ARG I 6 81  ? 146.283 153.923 119.524 1.00 174.82 ? 80  ARG C C     1 
ATOM 8070 O O     . ARG I 6 81  ? 146.877 153.131 120.260 1.00 174.82 ? 80  ARG C O     1 
ATOM 8071 C CB    . ARG I 6 81  ? 146.958 156.198 118.711 1.00 174.82 ? 80  ARG C CB    1 
ATOM 8072 C CG    . ARG I 6 81  ? 147.562 156.622 120.028 1.00 174.82 ? 80  ARG C CG    1 
ATOM 8073 C CD    . ARG I 6 81  ? 147.517 158.129 120.167 1.00 174.82 ? 80  ARG C CD    1 
ATOM 8074 N NE    . ARG I 6 81  ? 148.042 158.579 121.450 1.00 174.82 ? 80  ARG C NE    1 
ATOM 8075 C CZ    . ARG I 6 81  ? 149.327 158.832 121.678 1.00 174.82 ? 80  ARG C CZ    1 
ATOM 8076 N NH1   . ARG I 6 81  ? 150.215 158.677 120.705 1.00 174.82 ? 80  ARG C NH1   1 
ATOM 8077 N NH2   . ARG I 6 81  ? 149.724 159.240 122.875 1.00 174.82 ? 80  ARG C NH2   1 
ATOM 8078 N N     . ASN I 6 82  ? 144.976 154.146 119.625 1.00 169.74 ? 81  ASN C N     1 
ATOM 8079 C CA    . ASN I 6 82  ? 144.144 153.420 120.572 1.00 169.74 ? 81  ASN C CA    1 
ATOM 8080 C C     . ASN I 6 82  ? 143.725 152.071 119.997 1.00 169.74 ? 81  ASN C C     1 
ATOM 8081 O O     . ASN I 6 82  ? 144.133 151.675 118.901 1.00 169.74 ? 81  ASN C O     1 
ATOM 8082 C CB    . ASN I 6 82  ? 142.928 154.253 120.957 1.00 169.74 ? 81  ASN C CB    1 
ATOM 8083 C CG    . ASN I 6 82  ? 143.282 155.381 121.892 1.00 169.74 ? 81  ASN C CG    1 
ATOM 8084 O OD1   . ASN I 6 82  ? 144.073 155.208 122.818 1.00 169.74 ? 81  ASN C OD1   1 
ATOM 8085 N ND2   . ASN I 6 82  ? 142.705 156.551 121.654 1.00 169.74 ? 81  ASN C ND2   1 
ATOM 8086 N N     . ILE I 6 83  ? 142.901 151.350 120.753 1.00 159.42 ? 82  ILE C N     1 
ATOM 8087 C CA    . ILE I 6 83  ? 142.285 150.115 120.284 1.00 159.42 ? 82  ILE C CA    1 
ATOM 8088 C C     . ILE I 6 83  ? 140.778 150.320 120.213 1.00 159.42 ? 82  ILE C C     1 
ATOM 8089 O O     . ILE I 6 83  ? 140.114 150.477 121.244 1.00 159.42 ? 82  ILE C O     1 
ATOM 8090 C CB    . ILE I 6 83  ? 142.642 148.923 121.178 1.00 159.42 ? 82  ILE C CB    1 
ATOM 8091 C CG1   . ILE I 6 83  ? 144.135 148.622 121.075 1.00 159.42 ? 82  ILE C CG1   1 
ATOM 8092 C CG2   . ILE I 6 83  ? 141.839 147.712 120.784 1.00 159.42 ? 82  ILE C CG2   1 
ATOM 8093 C CD1   . ILE I 6 83  ? 144.614 147.587 122.050 1.00 159.42 ? 82  ILE C CD1   1 
ATOM 8094 N N     . THR I 6 84  ? 140.245 150.329 118.995 1.00 157.66 ? 83  THR C N     1 
ATOM 8095 C CA    . THR I 6 84  ? 138.835 150.470 118.676 1.00 157.66 ? 83  THR C CA    1 
ATOM 8096 C C     . THR I 6 84  ? 138.187 149.099 118.549 1.00 157.66 ? 83  THR C C     1 
ATOM 8097 O O     . THR I 6 84  ? 138.874 148.097 118.337 1.00 157.66 ? 83  THR C O     1 
ATOM 8098 C CB    . THR I 6 84  ? 138.673 151.252 117.373 1.00 157.66 ? 83  THR C CB    1 
ATOM 8099 O OG1   . THR I 6 84  ? 137.284 151.445 117.084 1.00 157.66 ? 83  THR C OG1   1 
ATOM 8100 C CG2   . THR I 6 84  ? 139.308 150.496 116.224 1.00 157.66 ? 83  THR C CG2   1 
ATOM 8101 N N     . PRO I 6 85  ? 136.856 149.018 118.641 1.00 149.64 ? 84  PRO C N     1 
ATOM 8102 C CA    . PRO I 6 85  ? 136.192 147.736 118.365 1.00 149.64 ? 84  PRO C CA    1 
ATOM 8103 C C     . PRO I 6 85  ? 136.332 147.271 116.930 1.00 149.64 ? 84  PRO C C     1 
ATOM 8104 O O     . PRO I 6 85  ? 136.178 146.070 116.670 1.00 149.64 ? 84  PRO C O     1 
ATOM 8105 C CB    . PRO I 6 85  ? 134.727 148.023 118.713 1.00 149.64 ? 84  PRO C CB    1 
ATOM 8106 C CG    . PRO I 6 85  ? 134.805 149.089 119.735 1.00 149.64 ? 84  PRO C CG    1 
ATOM 8107 C CD    . PRO I 6 85  ? 135.956 149.957 119.331 1.00 149.64 ? 84  PRO C CD    1 
ATOM 8108 N N     . LEU I 6 86  ? 136.657 148.160 115.993 1.00 152.57 ? 85  LEU C N     1 
ATOM 8109 C CA    . LEU I 6 86  ? 136.918 147.687 114.644 1.00 152.57 ? 85  LEU C CA    1 
ATOM 8110 C C     . LEU I 6 86  ? 138.197 146.870 114.604 1.00 152.57 ? 85  LEU C C     1 
ATOM 8111 O O     . LEU I 6 86  ? 138.293 145.900 113.842 1.00 152.57 ? 85  LEU C O     1 
ATOM 8112 C CB    . LEU I 6 86  ? 137.010 148.864 113.677 1.00 152.57 ? 85  LEU C CB    1 
ATOM 8113 C CG    . LEU I 6 86  ? 137.149 148.483 112.206 1.00 152.57 ? 85  LEU C CG    1 
ATOM 8114 C CD1   . LEU I 6 86  ? 135.922 147.726 111.733 1.00 152.57 ? 85  LEU C CD1   1 
ATOM 8115 C CD2   . LEU I 6 86  ? 137.392 149.715 111.354 1.00 152.57 ? 85  LEU C CD2   1 
ATOM 8116 N N     . LEU I 6 87  ? 139.140 147.175 115.494 1.00 159.48 ? 86  LEU C N     1 
ATOM 8117 C CA    . LEU I 6 87  ? 140.360 146.388 115.540 1.00 159.48 ? 86  LEU C CA    1 
ATOM 8118 C C     . LEU I 6 87  ? 140.069 145.014 116.112 1.00 159.48 ? 86  LEU C C     1 
ATOM 8119 O O     . LEU I 6 87  ? 140.593 144.007 115.624 1.00 159.48 ? 86  LEU C O     1 
ATOM 8120 C CB    . LEU I 6 87  ? 141.415 147.099 116.384 1.00 159.48 ? 86  LEU C CB    1 
ATOM 8121 C CG    . LEU I 6 87  ? 142.074 148.360 115.829 1.00 159.48 ? 86  LEU C CG    1 
ATOM 8122 C CD1   . LEU I 6 87  ? 142.930 149.028 116.888 1.00 159.48 ? 86  LEU C CD1   1 
ATOM 8123 C CD2   . LEU I 6 87  ? 142.907 148.037 114.612 1.00 159.48 ? 86  LEU C CD2   1 
ATOM 8124 N N     . LEU I 6 88  ? 139.165 144.946 117.090 1.00 157.23 ? 87  LEU C N     1 
ATOM 8125 C CA    . LEU I 6 88  ? 138.824 143.657 117.675 1.00 157.23 ? 87  LEU C CA    1 
ATOM 8126 C C     . LEU I 6 88  ? 138.074 142.798 116.674 1.00 157.23 ? 87  LEU C C     1 
ATOM 8127 O O     . LEU I 6 88  ? 138.345 141.596 116.544 1.00 157.23 ? 87  LEU C O     1 
ATOM 8128 C CB    . LEU I 6 88  ? 137.970 143.855 118.923 1.00 157.23 ? 87  LEU C CB    1 
ATOM 8129 C CG    . LEU I 6 88  ? 138.652 144.166 120.249 1.00 157.23 ? 87  LEU C CG    1 
ATOM 8130 C CD1   . LEU I 6 88  ? 139.044 145.616 120.298 1.00 157.23 ? 87  LEU C CD1   1 
ATOM 8131 C CD2   . LEU I 6 88  ? 137.713 143.843 121.389 1.00 157.23 ? 87  LEU C CD2   1 
ATOM 8132 N N     . ASP I 6 89  ? 137.158 143.405 115.925 1.00 156.32 ? 88  ASP C N     1 
ATOM 8133 C CA    . ASP I 6 89  ? 136.410 142.627 114.951 1.00 156.32 ? 88  ASP C CA    1 
ATOM 8134 C C     . ASP I 6 89  ? 137.303 142.169 113.810 1.00 156.32 ? 88  ASP C C     1 
ATOM 8135 O O     . ASP I 6 89  ? 137.130 141.060 113.292 1.00 156.32 ? 88  ASP C O     1 
ATOM 8136 C CB    . ASP I 6 89  ? 135.237 143.439 114.418 1.00 156.32 ? 88  ASP C CB    1 
ATOM 8137 C CG    . ASP I 6 89  ? 134.194 142.572 113.749 1.00 156.32 ? 88  ASP C CG    1 
ATOM 8138 O OD1   . ASP I 6 89  ? 134.367 141.336 113.734 1.00 156.32 ? 88  ASP C OD1   1 
ATOM 8139 O OD2   . ASP I 6 89  ? 133.201 143.126 113.232 1.00 156.32 ? 88  ASP C OD2   1 
ATOM 8140 N N     . MET I 6 90  ? 138.276 142.989 113.409 1.00 157.83 ? 89  MET C N     1 
ATOM 8141 C CA    . MET I 6 90  ? 139.150 142.527 112.340 1.00 157.83 ? 89  MET C CA    1 
ATOM 8142 C C     . MET I 6 90  ? 140.107 141.450 112.829 1.00 157.83 ? 89  MET C C     1 
ATOM 8143 O O     . MET I 6 90  ? 140.447 140.542 112.064 1.00 157.83 ? 89  MET C O     1 
ATOM 8144 C CB    . MET I 6 90  ? 139.916 143.693 111.716 1.00 157.83 ? 89  MET C CB    1 
ATOM 8145 C CG    . MET I 6 90  ? 141.024 144.279 112.555 1.00 157.83 ? 89  MET C CG    1 
ATOM 8146 S SD    . MET I 6 90  ? 141.892 145.552 111.625 1.00 157.83 ? 89  MET C SD    1 
ATOM 8147 C CE    . MET I 6 90  ? 143.522 145.443 112.349 1.00 157.83 ? 89  MET C CE    1 
ATOM 8148 N N     . VAL I 6 91  ? 140.540 141.505 114.090 1.00 155.19 ? 90  VAL C N     1 
ATOM 8149 C CA    . VAL I 6 91  ? 141.515 140.518 114.539 1.00 155.19 ? 90  VAL C CA    1 
ATOM 8150 C C     . VAL I 6 91  ? 140.841 139.183 114.820 1.00 155.19 ? 90  VAL C C     1 
ATOM 8151 O O     . VAL I 6 91  ? 141.295 138.137 114.343 1.00 155.19 ? 90  VAL C O     1 
ATOM 8152 C CB    . VAL I 6 91  ? 142.311 141.022 115.759 1.00 155.19 ? 90  VAL C CB    1 
ATOM 8153 C CG1   . VAL I 6 91  ? 143.145 142.221 115.379 1.00 155.19 ? 90  VAL C CG1   1 
ATOM 8154 C CG2   . VAL I 6 91  ? 141.416 141.339 116.935 1.00 155.19 ? 90  VAL C CG2   1 
ATOM 8155 N N     . VAL I 6 92  ? 139.744 139.185 115.583 1.00 154.75 ? 91  VAL C N     1 
ATOM 8156 C CA    . VAL I 6 92  ? 139.262 137.915 116.110 1.00 154.75 ? 91  VAL C CA    1 
ATOM 8157 C C     . VAL I 6 92  ? 138.624 137.066 115.027 1.00 154.75 ? 91  VAL C C     1 
ATOM 8158 O O     . VAL I 6 92  ? 138.479 135.852 115.202 1.00 154.75 ? 91  VAL C O     1 
ATOM 8159 C CB    . VAL I 6 92  ? 138.268 138.131 117.263 1.00 154.75 ? 91  VAL C CB    1 
ATOM 8160 C CG1   . VAL I 6 92  ? 138.894 138.985 118.345 1.00 154.75 ? 91  VAL C CG1   1 
ATOM 8161 C CG2   . VAL I 6 92  ? 136.988 138.743 116.745 1.00 154.75 ? 91  VAL C CG2   1 
ATOM 8162 N N     . HIS I 6 93  ? 138.240 137.665 113.904 1.00 149.86 ? 92  HIS C N     1 
ATOM 8163 C CA    . HIS I 6 93  ? 137.723 136.899 112.784 1.00 149.86 ? 92  HIS C CA    1 
ATOM 8164 C C     . HIS I 6 93  ? 138.792 136.607 111.747 1.00 149.86 ? 92  HIS C C     1 
ATOM 8165 O O     . HIS I 6 93  ? 138.593 135.734 110.898 1.00 149.86 ? 92  HIS C O     1 
ATOM 8166 C CB    . HIS I 6 93  ? 136.549 137.637 112.144 1.00 149.86 ? 92  HIS C CB    1 
ATOM 8167 C CG    . HIS I 6 93  ? 135.326 137.661 113.003 1.00 149.86 ? 92  HIS C CG    1 
ATOM 8168 N ND1   . HIS I 6 93  ? 135.083 138.655 113.926 1.00 149.86 ? 92  HIS C ND1   1 
ATOM 8169 C CD2   . HIS I 6 93  ? 134.282 136.804 113.091 1.00 149.86 ? 92  HIS C CD2   1 
ATOM 8170 C CE1   . HIS I 6 93  ? 133.940 138.413 114.540 1.00 149.86 ? 92  HIS C CE1   1 
ATOM 8171 N NE2   . HIS I 6 93  ? 133.433 137.296 114.051 1.00 149.86 ? 92  HIS C NE2   1 
ATOM 8172 N N     . ASN I 6 94  ? 139.913 137.306 111.807 1.00 153.54 ? 93  ASN C N     1 
ATOM 8173 C CA    . ASN I 6 94  ? 141.141 136.872 111.170 1.00 153.54 ? 93  ASN C CA    1 
ATOM 8174 C C     . ASN I 6 94  ? 141.902 136.020 112.180 1.00 153.54 ? 93  ASN C C     1 
ATOM 8175 O O     . ASN I 6 94  ? 141.344 135.595 113.196 1.00 153.54 ? 93  ASN C O     1 
ATOM 8176 C CB    . ASN I 6 94  ? 141.950 138.076 110.700 1.00 153.54 ? 93  ASN C CB    1 
ATOM 8177 C CG    . ASN I 6 94  ? 141.201 138.912 109.686 1.00 153.54 ? 93  ASN C CG    1 
ATOM 8178 O OD1   . ASN I 6 94  ? 140.489 138.383 108.834 1.00 153.54 ? 93  ASN C OD1   1 
ATOM 8179 N ND2   . ASN I 6 94  ? 141.352 140.228 109.777 1.00 153.54 ? 93  ASN C ND2   1 
ATOM 8180 N N     . ASP I 6 95  ? 143.180 135.756 111.913 1.00 152.97 ? 94  ASP C N     1 
ATOM 8181 C CA    . ASP I 6 95  ? 144.058 135.121 112.893 1.00 152.97 ? 94  ASP C CA    1 
ATOM 8182 C C     . ASP I 6 95  ? 143.533 133.740 113.290 1.00 152.97 ? 94  ASP C C     1 
ATOM 8183 O O     . ASP I 6 95  ? 143.031 133.521 114.395 1.00 152.97 ? 94  ASP C O     1 
ATOM 8184 C CB    . ASP I 6 95  ? 144.240 136.005 114.130 1.00 152.97 ? 94  ASP C CB    1 
ATOM 8185 C CG    . ASP I 6 95  ? 145.288 135.464 115.073 1.00 152.97 ? 94  ASP C CG    1 
ATOM 8186 O OD1   . ASP I 6 95  ? 146.489 135.617 114.776 1.00 152.97 ? 94  ASP C OD1   1 
ATOM 8187 O OD2   . ASP I 6 95  ? 144.912 134.873 116.106 1.00 152.97 ? 94  ASP C OD2   1 
ATOM 8188 N N     . ARG I 6 96  ? 143.662 132.811 112.347 1.00 155.57 ? 95  ARG C N     1 
ATOM 8189 C CA    . ARG I 6 96  ? 143.079 131.484 112.491 1.00 155.57 ? 95  ARG C CA    1 
ATOM 8190 C C     . ARG I 6 96  ? 143.508 130.817 113.789 1.00 155.57 ? 95  ARG C C     1 
ATOM 8191 O O     . ARG I 6 96  ? 142.973 129.767 114.159 1.00 155.57 ? 95  ARG C O     1 
ATOM 8192 C CB    . ARG I 6 96  ? 143.498 130.592 111.325 1.00 155.57 ? 95  ARG C CB    1 
ATOM 8193 C CG    . ARG I 6 96  ? 144.967 130.227 111.380 1.00 155.57 ? 95  ARG C CG    1 
ATOM 8194 C CD    . ARG I 6 96  ? 145.398 129.453 110.154 1.00 155.57 ? 95  ARG C CD    1 
ATOM 8195 N NE    . ARG I 6 96  ? 146.785 129.015 110.264 1.00 155.57 ? 95  ARG C NE    1 
ATOM 8196 C CZ    . ARG I 6 96  ? 147.832 129.756 109.923 1.00 155.57 ? 95  ARG C CZ    1 
ATOM 8197 N NH1   . ARG I 6 96  ? 149.060 129.275 110.059 1.00 155.57 ? 95  ARG C NH1   1 
ATOM 8198 N NH2   . ARG I 6 96  ? 147.651 130.979 109.446 1.00 155.57 ? 95  ARG C NH2   1 
ATOM 8199 N N     . LEU I 6 97  ? 144.470 131.420 114.489 1.00 149.59 ? 96  LEU C N     1 
ATOM 8200 C CA    . LEU I 6 97  ? 144.840 130.938 115.811 1.00 149.59 ? 96  LEU C CA    1 
ATOM 8201 C C     . LEU I 6 97  ? 143.644 130.969 116.751 1.00 149.59 ? 96  LEU C C     1 
ATOM 8202 O O     . LEU I 6 97  ? 143.356 129.982 117.434 1.00 149.59 ? 96  LEU C O     1 
ATOM 8203 C CB    . LEU I 6 97  ? 145.991 131.778 116.355 1.00 149.59 ? 96  LEU C CB    1 
ATOM 8204 C CG    . LEU I 6 97  ? 146.670 131.296 117.638 1.00 149.59 ? 96  LEU C CG    1 
ATOM 8205 C CD1   . LEU I 6 97  ? 148.161 131.573 117.585 1.00 149.59 ? 96  LEU C CD1   1 
ATOM 8206 C CD2   . LEU I 6 97  ? 146.047 131.996 118.828 1.00 149.59 ? 96  LEU C CD2   1 
ATOM 8207 N N     . LEU I 6 98  ? 142.916 132.085 116.781 1.00 146.04 ? 97  LEU C N     1 
ATOM 8208 C CA    . LEU I 6 98  ? 141.762 132.214 117.660 1.00 146.04 ? 97  LEU C CA    1 
ATOM 8209 C C     . LEU I 6 98  ? 140.498 132.572 116.893 1.00 146.04 ? 97  LEU C C     1 
ATOM 8210 O O     . LEU I 6 98  ? 139.495 132.953 117.499 1.00 146.04 ? 97  LEU C O     1 
ATOM 8211 C CB    . LEU I 6 98  ? 142.030 133.237 118.760 1.00 146.04 ? 97  LEU C CB    1 
ATOM 8212 C CG    . LEU I 6 98  ? 142.423 134.653 118.343 1.00 146.04 ? 97  LEU C CG    1 
ATOM 8213 C CD1   . LEU I 6 98  ? 141.199 135.541 118.188 1.00 146.04 ? 97  LEU C CD1   1 
ATOM 8214 C CD2   . LEU I 6 98  ? 143.384 135.229 119.358 1.00 146.04 ? 97  LEU C CD2   1 
ATOM 8215 N N     . SER I 6 99  ? 140.507 132.420 115.571 1.00 147.90 ? 98  SER C N     1 
ATOM 8216 C CA    . SER I 6 99  ? 139.287 132.663 114.816 1.00 147.90 ? 98  SER C CA    1 
ATOM 8217 C C     . SER I 6 99  ? 138.284 131.553 115.026 1.00 147.90 ? 98  SER C C     1 
ATOM 8218 O O     . SER I 6 99  ? 137.091 131.750 114.805 1.00 147.90 ? 98  SER C O     1 
ATOM 8219 C CB    . SER I 6 99  ? 139.590 132.785 113.329 1.00 147.90 ? 98  SER C CB    1 
ATOM 8220 O OG    . SER I 6 99  ? 140.052 131.544 112.828 1.00 147.90 ? 98  SER C OG    1 
ATOM 8221 N N     . THR I 6 100 ? 138.743 130.412 115.511 1.00 146.63 ? 99  THR C N     1 
ATOM 8222 C CA    . THR I 6 100 ? 137.852 129.304 115.815 1.00 146.63 ? 99  THR C CA    1 
ATOM 8223 C C     . THR I 6 100 ? 137.060 129.575 117.079 1.00 146.63 ? 99  THR C C     1 
ATOM 8224 O O     . THR I 6 100 ? 135.923 129.121 117.210 1.00 146.63 ? 99  THR C O     1 
ATOM 8225 C CB    . THR I 6 100 ? 138.656 128.019 115.951 1.00 146.63 ? 99  THR C CB    1 
ATOM 8226 O OG1   . THR I 6 100 ? 137.798 126.971 116.423 1.00 146.63 ? 99  THR C OG1   1 
ATOM 8227 C CG2   . THR I 6 100 ? 139.820 128.220 116.909 1.00 146.63 ? 99  THR C CG2   1 
ATOM 8228 N N     . LEU I 6 101 ? 137.631 130.333 118.005 1.00 144.36 ? 100 LEU C N     1 
ATOM 8229 C CA    . LEU I 6 101 ? 136.901 130.677 119.212 1.00 144.36 ? 100 LEU C CA    1 
ATOM 8230 C C     . LEU I 6 101 ? 135.767 131.639 118.915 1.00 144.36 ? 100 LEU C C     1 
ATOM 8231 O O     . LEU I 6 101 ? 134.784 131.673 119.659 1.00 144.36 ? 100 LEU C O     1 
ATOM 8232 C CB    . LEU I 6 101 ? 137.849 131.283 120.239 1.00 144.36 ? 100 LEU C CB    1 
ATOM 8233 C CG    . LEU I 6 101 ? 137.240 131.604 121.598 1.00 144.36 ? 100 LEU C CG    1 
ATOM 8234 C CD1   . LEU I 6 101 ? 136.731 130.355 122.284 1.00 144.36 ? 100 LEU C CD1   1 
ATOM 8235 C CD2   . LEU I 6 101 ? 138.278 132.298 122.439 1.00 144.36 ? 100 LEU C CD2   1 
ATOM 8236 N N     . PHE I 6 102 ? 135.874 132.403 117.837 1.00 147.08 ? 101 PHE C N     1 
ATOM 8237 C CA    . PHE I 6 102 ? 134.891 133.413 117.491 1.00 147.08 ? 101 PHE C CA    1 
ATOM 8238 C C     . PHE I 6 102 ? 134.224 133.077 116.172 1.00 147.08 ? 101 PHE C C     1 
ATOM 8239 O O     . PHE I 6 102 ? 133.989 133.951 115.336 1.00 147.08 ? 101 PHE C O     1 
ATOM 8240 C CB    . PHE I 6 102 ? 135.522 134.792 117.415 1.00 147.08 ? 101 PHE C CB    1 
ATOM 8241 C CG    . PHE I 6 102 ? 136.018 135.292 118.722 1.00 147.08 ? 101 PHE C CG    1 
ATOM 8242 C CD1   . PHE I 6 102 ? 135.156 135.892 119.614 1.00 147.08 ? 101 PHE C CD1   1 
ATOM 8243 C CD2   . PHE I 6 102 ? 137.345 135.159 119.062 1.00 147.08 ? 101 PHE C CD2   1 
ATOM 8244 C CE1   . PHE I 6 102 ? 135.615 136.350 120.824 1.00 147.08 ? 101 PHE C CE1   1 
ATOM 8245 C CE2   . PHE I 6 102 ? 137.809 135.614 120.268 1.00 147.08 ? 101 PHE C CE2   1 
ATOM 8246 C CZ    . PHE I 6 102 ? 136.944 136.212 121.150 1.00 147.08 ? 101 PHE C CZ    1 
ATOM 8247 N N     . ASN I 6 103 ? 133.880 131.808 115.973 1.00 148.73 ? 102 ASN C N     1 
ATOM 8248 C CA    . ASN I 6 103 ? 133.128 131.472 114.772 1.00 148.73 ? 102 ASN C CA    1 
ATOM 8249 C C     . ASN I 6 103 ? 131.716 132.023 114.853 1.00 148.73 ? 102 ASN C C     1 
ATOM 8250 O O     . ASN I 6 103 ? 131.125 132.379 113.832 1.00 148.73 ? 102 ASN C O     1 
ATOM 8251 C CB    . ASN I 6 103 ? 133.103 129.956 114.544 1.00 148.73 ? 102 ASN C CB    1 
ATOM 8252 C CG    . ASN I 6 103 ? 134.413 129.423 113.997 1.00 148.73 ? 102 ASN C CG    1 
ATOM 8253 O OD1   . ASN I 6 103 ? 135.088 128.620 114.636 1.00 148.73 ? 102 ASN C OD1   1 
ATOM 8254 N ND2   . ASN I 6 103 ? 134.781 129.880 112.807 1.00 148.73 ? 102 ASN C ND2   1 
ATOM 8255 N N     . THR I 6 104 ? 131.138 132.038 116.044 1.00 139.31 ? 103 THR C N     1 
ATOM 8256 C CA    . THR I 6 104 ? 129.736 132.365 116.232 1.00 139.31 ? 103 THR C CA    1 
ATOM 8257 C C     . THR I 6 104 ? 129.542 133.618 117.077 1.00 139.31 ? 103 THR C C     1 
ATOM 8258 O O     . THR I 6 104 ? 128.499 133.796 117.707 1.00 139.31 ? 103 THR C O     1 
ATOM 8259 C CB    . THR I 6 104 ? 128.999 131.180 116.828 1.00 139.31 ? 103 THR C CB    1 
ATOM 8260 O OG1   . THR I 6 104 ? 129.586 130.815 118.076 1.00 139.31 ? 103 THR C OG1   1 
ATOM 8261 C CG2   . THR I 6 104 ? 129.031 130.021 115.852 1.00 139.31 ? 103 THR C CG2   1 
ATOM 8262 N N     . THR I 6 105 ? 130.518 134.508 117.080 1.00 138.15 ? 104 THR C N     1 
ATOM 8263 C CA    . THR I 6 105 ? 130.401 135.746 117.822 1.00 138.15 ? 104 THR C CA    1 
ATOM 8264 C C     . THR I 6 105 ? 130.235 136.907 116.853 1.00 138.15 ? 104 THR C C     1 
ATOM 8265 O O     . THR I 6 105 ? 130.534 136.795 115.663 1.00 138.15 ? 104 THR C O     1 
ATOM 8266 C CB    . THR I 6 105 ? 131.632 135.944 118.707 1.00 138.15 ? 104 THR C CB    1 
ATOM 8267 O OG1   . THR I 6 105 ? 132.079 134.667 119.194 1.00 138.15 ? 104 THR C OG1   1 
ATOM 8268 C CG2   . THR I 6 105 ? 131.316 136.853 119.860 1.00 138.15 ? 104 THR C CG2   1 
ATOM 8269 N N     . THR I 6 106 ? 129.703 138.011 117.365 1.00 133.68 ? 105 THR C N     1 
ATOM 8270 C CA    . THR I 6 106 ? 129.471 139.212 116.571 1.00 133.68 ? 105 THR C CA    1 
ATOM 8271 C C     . THR I 6 106 ? 129.785 140.408 117.453 1.00 133.68 ? 105 THR C C     1 
ATOM 8272 O O     . THR I 6 106 ? 129.039 140.700 118.388 1.00 133.68 ? 105 THR C O     1 
ATOM 8273 C CB    . THR I 6 106 ? 128.032 139.305 116.057 1.00 133.68 ? 105 THR C CB    1 
ATOM 8274 O OG1   . THR I 6 106 ? 127.133 139.405 117.161 1.00 133.68 ? 105 THR C OG1   1 
ATOM 8275 C CG2   . THR I 6 106 ? 127.658 138.121 115.179 1.00 133.68 ? 105 THR C CG2   1 
ATOM 8276 N N     . ILE I 6 107 ? 130.868 141.103 117.150 1.00 140.29 ? 106 ILE C N     1 
ATOM 8277 C CA    . ILE I 6 107 ? 131.183 142.342 117.845 1.00 140.29 ? 106 ILE C CA    1 
ATOM 8278 C C     . ILE I 6 107 ? 130.265 143.424 117.305 1.00 140.29 ? 106 ILE C C     1 
ATOM 8279 O O     . ILE I 6 107 ? 130.129 143.589 116.090 1.00 140.29 ? 106 ILE C O     1 
ATOM 8280 C CB    . ILE I 6 107 ? 132.658 142.735 117.682 1.00 140.29 ? 106 ILE C CB    1 
ATOM 8281 C CG1   . ILE I 6 107 ? 133.559 141.817 118.501 1.00 140.29 ? 106 ILE C CG1   1 
ATOM 8282 C CG2   . ILE I 6 107 ? 132.860 144.146 118.175 1.00 140.29 ? 106 ILE C CG2   1 
ATOM 8283 C CD1   . ILE I 6 107 ? 134.077 140.647 117.743 1.00 140.29 ? 106 ILE C CD1   1 
ATOM 8284 N N     . SER I 6 108 ? 129.655 144.184 118.207 1.00 132.66 ? 107 SER C N     1 
ATOM 8285 C CA    . SER I 6 108 ? 128.496 144.991 117.849 1.00 132.66 ? 107 SER C CA    1 
ATOM 8286 C C     . SER I 6 108 ? 128.889 146.218 117.028 1.00 132.66 ? 107 SER C C     1 
ATOM 8287 O O     . SER I 6 108 ? 128.135 146.639 116.145 1.00 132.66 ? 107 SER C O     1 
ATOM 8288 C CB    . SER I 6 108 ? 127.737 145.387 119.120 1.00 132.66 ? 107 SER C CB    1 
ATOM 8289 O OG    . SER I 6 108 ? 128.396 146.426 119.819 1.00 132.66 ? 107 SER C OG    1 
ATOM 8290 N N     . GLN I 6 109 ? 130.050 146.813 117.308 1.00 135.51 ? 108 GLN C N     1 
ATOM 8291 C CA    . GLN I 6 109 ? 130.556 147.979 116.577 1.00 135.51 ? 108 GLN C CA    1 
ATOM 8292 C C     . GLN I 6 109 ? 129.658 149.206 116.701 1.00 135.51 ? 108 GLN C C     1 
ATOM 8293 O O     . GLN I 6 109 ? 129.781 150.148 115.908 1.00 135.51 ? 108 GLN C O     1 
ATOM 8294 C CB    . GLN I 6 109 ? 130.841 147.666 115.100 1.00 135.51 ? 108 GLN C CB    1 
ATOM 8295 C CG    . GLN I 6 109 ? 131.946 146.636 114.892 1.00 135.51 ? 108 GLN C CG    1 
ATOM 8296 C CD    . GLN I 6 109 ? 132.203 146.321 113.430 1.00 135.51 ? 108 GLN C CD    1 
ATOM 8297 O OE1   . GLN I 6 109 ? 131.538 146.850 112.542 1.00 135.51 ? 108 GLN C OE1   1 
ATOM 8298 N NE2   . GLN I 6 109 ? 133.204 145.493 113.174 1.00 135.51 ? 108 GLN C NE2   1 
ATOM 8299 N N     . VAL I 6 110 ? 128.743 149.220 117.663 1.00 127.38 ? 109 VAL C N     1 
ATOM 8300 C CA    . VAL I 6 110 ? 127.957 150.423 117.908 1.00 127.38 ? 109 VAL C CA    1 
ATOM 8301 C C     . VAL I 6 110 ? 127.956 150.693 119.408 1.00 127.38 ? 109 VAL C C     1 
ATOM 8302 O O     . VAL I 6 110 ? 127.853 149.766 120.212 1.00 127.38 ? 109 VAL C O     1 
ATOM 8303 C CB    . VAL I 6 110 ? 126.517 150.297 117.388 1.00 127.38 ? 109 VAL C CB    1 
ATOM 8304 C CG1   . VAL I 6 110 ? 126.152 148.841 117.186 1.00 127.38 ? 109 VAL C CG1   1 
ATOM 8305 C CG2   . VAL I 6 110 ? 125.551 151.004 118.311 1.00 127.38 ? 109 VAL C CG2   1 
ATOM 8306 N N     . SER J 6 21  ? 99.485  110.502 148.563 1.00 154.41 ? 20  SER G N     1 
ATOM 8307 C CA    . SER J 6 21  ? 100.556 110.724 147.599 1.00 154.41 ? 20  SER G CA    1 
ATOM 8308 C C     . SER J 6 21  ? 100.180 111.815 146.605 1.00 154.41 ? 20  SER G C     1 
ATOM 8309 O O     . SER J 6 21  ? 99.113  111.788 145.998 1.00 154.41 ? 20  SER G O     1 
ATOM 8310 C CB    . SER J 6 21  ? 100.921 109.425 146.880 1.00 154.41 ? 20  SER G CB    1 
ATOM 8311 O OG    . SER J 6 21  ? 99.838  108.918 146.132 1.00 154.41 ? 20  SER G OG    1 
ATOM 8312 N N     . ARG J 6 22  ? 101.102 112.762 146.433 1.00 144.50 ? 21  ARG G N     1 
ATOM 8313 C CA    . ARG J 6 22  ? 100.852 113.943 145.619 1.00 144.50 ? 21  ARG G CA    1 
ATOM 8314 C C     . ARG J 6 22  ? 100.740 113.639 144.133 1.00 144.50 ? 21  ARG G C     1 
ATOM 8315 O O     . ARG J 6 22  ? 100.088 114.404 143.417 1.00 144.50 ? 21  ARG G O     1 
ATOM 8316 C CB    . ARG J 6 22  ? 101.969 114.963 145.818 1.00 144.50 ? 21  ARG G CB    1 
ATOM 8317 C CG    . ARG J 6 22  ? 102.015 115.609 147.185 1.00 144.50 ? 21  ARG G CG    1 
ATOM 8318 C CD    . ARG J 6 22  ? 103.143 116.627 147.249 1.00 144.50 ? 21  ARG G CD    1 
ATOM 8319 N NE    . ARG J 6 22  ? 104.460 116.006 147.221 1.00 144.50 ? 21  ARG G NE    1 
ATOM 8320 C CZ    . ARG J 6 22  ? 105.593 116.683 147.096 1.00 144.50 ? 21  ARG G CZ    1 
ATOM 8321 N NH1   . ARG J 6 22  ? 106.752 116.044 147.078 1.00 144.50 ? 21  ARG G NH1   1 
ATOM 8322 N NH2   . ARG J 6 22  ? 105.564 118.003 146.981 1.00 144.50 ? 21  ARG G NH2   1 
ATOM 8323 N N     . THR J 6 23  ? 101.320 112.541 143.650 1.00 144.71 ? 22  THR G N     1 
ATOM 8324 C CA    . THR J 6 23  ? 101.147 112.217 142.239 1.00 144.71 ? 22  THR G CA    1 
ATOM 8325 C C     . THR J 6 23  ? 99.718  111.780 141.941 1.00 144.71 ? 22  THR G C     1 
ATOM 8326 O O     . THR J 6 23  ? 99.117  112.240 140.963 1.00 144.71 ? 22  THR G O     1 
ATOM 8327 C CB    . THR J 6 23  ? 102.140 111.137 141.827 1.00 144.71 ? 22  THR G CB    1 
ATOM 8328 O OG1   . THR J 6 23  ? 103.475 111.615 142.034 1.00 144.71 ? 22  THR G OG1   1 
ATOM 8329 C CG2   . THR J 6 23  ? 101.950 110.779 140.369 1.00 144.71 ? 22  THR G CG2   1 
ATOM 8330 N N     . VAL J 6 24  ? 99.144  110.907 142.770 1.00 153.55 ? 23  VAL G N     1 
ATOM 8331 C CA    . VAL J 6 24  ? 97.750  110.554 142.529 1.00 153.55 ? 23  VAL G CA    1 
ATOM 8332 C C     . VAL J 6 24  ? 96.869  111.724 142.918 1.00 153.55 ? 23  VAL G C     1 
ATOM 8333 O O     . VAL J 6 24  ? 95.824  111.966 142.304 1.00 153.55 ? 23  VAL G O     1 
ATOM 8334 C CB    . VAL J 6 24  ? 97.354  109.262 143.264 1.00 153.55 ? 23  VAL G CB    1 
ATOM 8335 C CG1   . VAL J 6 24  ? 98.334  108.135 142.922 1.00 153.55 ? 23  VAL G CG1   1 
ATOM 8336 C CG2   . VAL J 6 24  ? 97.239  109.495 144.779 1.00 153.55 ? 23  VAL G CG2   1 
ATOM 8337 N N     . ARG J 6 25  ? 97.285  112.474 143.935 1.00 152.73 ? 24  ARG G N     1 
ATOM 8338 C CA    . ARG J 6 25  ? 96.518  113.621 144.393 1.00 152.73 ? 24  ARG G CA    1 
ATOM 8339 C C     . ARG J 6 25  ? 96.485  114.696 143.319 1.00 152.73 ? 24  ARG G C     1 
ATOM 8340 O O     . ARG J 6 25  ? 95.448  115.329 143.095 1.00 152.73 ? 24  ARG G O     1 
ATOM 8341 C CB    . ARG J 6 25  ? 97.104  114.108 145.713 1.00 152.73 ? 24  ARG G CB    1 
ATOM 8342 C CG    . ARG J 6 25  ? 96.330  115.164 146.429 1.00 152.73 ? 24  ARG G CG    1 
ATOM 8343 C CD    . ARG J 6 25  ? 97.051  115.449 147.718 1.00 152.73 ? 24  ARG G CD    1 
ATOM 8344 N NE    . ARG J 6 25  ? 97.049  114.216 148.509 1.00 152.73 ? 24  ARG G NE    1 
ATOM 8345 C CZ    . ARG J 6 25  ? 97.773  114.009 149.601 1.00 152.73 ? 24  ARG G CZ    1 
ATOM 8346 N NH1   . ARG J 6 25  ? 98.580  114.956 150.054 1.00 152.73 ? 24  ARG G NH1   1 
ATOM 8347 N NH2   . ARG J 6 25  ? 97.686  112.851 150.239 1.00 152.73 ? 24  ARG G NH2   1 
ATOM 8348 N N     . ALA J 6 26  ? 97.611  114.917 142.650 1.00 145.54 ? 25  ALA G N     1 
ATOM 8349 C CA    . ALA J 6 26  ? 97.626  115.800 141.497 1.00 145.54 ? 25  ALA G CA    1 
ATOM 8350 C C     . ALA J 6 26  ? 97.118  115.094 140.251 1.00 145.54 ? 25  ALA G C     1 
ATOM 8351 O O     . ALA J 6 26  ? 96.979  115.734 139.204 1.00 145.54 ? 25  ALA G O     1 
ATOM 8352 C CB    . ALA J 6 26  ? 99.031  116.343 141.245 1.00 145.54 ? 25  ALA G CB    1 
ATOM 8353 N N     . GLU J 6 27  ? 96.851  113.791 140.348 1.00 146.20 ? 26  GLU G N     1 
ATOM 8354 C CA    . GLU J 6 27  ? 96.379  112.968 139.236 1.00 146.20 ? 26  GLU G CA    1 
ATOM 8355 C C     . GLU J 6 27  ? 97.354  113.032 138.059 1.00 146.20 ? 26  GLU G C     1 
ATOM 8356 O O     . GLU J 6 27  ? 97.015  113.409 136.935 1.00 146.20 ? 26  GLU G O     1 
ATOM 8357 C CB    . GLU J 6 27  ? 94.961  113.383 138.831 1.00 146.20 ? 26  GLU G CB    1 
ATOM 8358 C CG    . GLU J 6 27  ? 93.920  113.049 139.890 1.00 146.20 ? 26  GLU G CG    1 
ATOM 8359 C CD    . GLU J 6 27  ? 92.539  113.558 139.542 1.00 146.20 ? 26  GLU G CD    1 
ATOM 8360 O OE1   . GLU J 6 27  ? 92.412  114.305 138.549 1.00 146.20 ? 26  GLU G OE1   1 
ATOM 8361 O OE2   . GLU J 6 27  ? 91.580  113.217 140.264 1.00 146.20 ? 26  GLU G OE2   1 
ATOM 8362 N N     . LEU J 6 28  ? 98.590  112.661 138.361 1.00 141.04 ? 27  LEU G N     1 
ATOM 8363 C CA    . LEU J 6 28  ? 99.694  112.585 137.421 1.00 141.04 ? 27  LEU G CA    1 
ATOM 8364 C C     . LEU J 6 28  ? 100.211 111.155 137.391 1.00 141.04 ? 27  LEU G C     1 
ATOM 8365 O O     . LEU J 6 28  ? 99.761  110.297 138.153 1.00 141.04 ? 27  LEU G O     1 
ATOM 8366 C CB    . LEU J 6 28  ? 100.799 113.572 137.796 1.00 141.04 ? 27  LEU G CB    1 
ATOM 8367 C CG    . LEU J 6 28  ? 100.271 115.000 137.736 1.00 141.04 ? 27  LEU G CG    1 
ATOM 8368 C CD1   . LEU J 6 28  ? 101.328 115.999 138.176 1.00 141.04 ? 27  LEU G CD1   1 
ATOM 8369 C CD2   . LEU J 6 28  ? 99.756  115.303 136.337 1.00 141.04 ? 27  LEU G CD2   1 
ATOM 8370 N N     . SER J 6 29  ? 101.153 110.883 136.491 1.00 135.33 ? 28  SER G N     1 
ATOM 8371 C CA    . SER J 6 29  ? 101.751 109.561 136.461 1.00 135.33 ? 28  SER G CA    1 
ATOM 8372 C C     . SER J 6 29  ? 103.216 109.506 136.861 1.00 135.33 ? 28  SER G C     1 
ATOM 8373 O O     . SER J 6 29  ? 103.681 108.435 137.256 1.00 135.33 ? 28  SER G O     1 
ATOM 8374 C CB    . SER J 6 29  ? 101.615 108.965 135.056 1.00 135.33 ? 28  SER G CB    1 
ATOM 8375 O OG    . SER J 6 29  ? 100.251 108.808 134.716 1.00 135.33 ? 28  SER G OG    1 
ATOM 8376 N N     . PHE J 6 30  ? 103.950 110.612 136.791 1.00 134.93 ? 29  PHE G N     1 
ATOM 8377 C CA    . PHE J 6 30  ? 105.325 110.613 137.268 1.00 134.93 ? 29  PHE G CA    1 
ATOM 8378 C C     . PHE J 6 30  ? 105.389 110.989 138.738 1.00 134.93 ? 29  PHE G C     1 
ATOM 8379 O O     . PHE J 6 30  ? 104.570 111.760 139.239 1.00 134.93 ? 29  PHE G O     1 
ATOM 8380 C CB    . PHE J 6 30  ? 106.187 111.576 136.459 1.00 134.93 ? 29  PHE G CB    1 
ATOM 8381 C CG    . PHE J 6 30  ? 106.582 111.046 135.121 1.00 134.93 ? 29  PHE G CG    1 
ATOM 8382 C CD1   . PHE J 6 30  ? 106.257 109.757 134.754 1.00 134.93 ? 29  PHE G CD1   1 
ATOM 8383 C CD2   . PHE J 6 30  ? 107.284 111.833 134.233 1.00 134.93 ? 29  PHE G CD2   1 
ATOM 8384 C CE1   . PHE J 6 30  ? 106.617 109.268 133.522 1.00 134.93 ? 29  PHE G CE1   1 
ATOM 8385 C CE2   . PHE J 6 30  ? 107.648 111.349 133.002 1.00 134.93 ? 29  PHE G CE2   1 
ATOM 8386 C CZ    . PHE J 6 30  ? 107.315 110.065 132.646 1.00 134.93 ? 29  PHE G CZ    1 
ATOM 8387 N N     . SER J 6 31  ? 106.405 110.476 139.417 1.00 131.54 ? 30  SER G N     1 
ATOM 8388 C CA    . SER J 6 31  ? 106.593 110.778 140.826 1.00 131.54 ? 30  SER G CA    1 
ATOM 8389 C C     . SER J 6 31  ? 107.233 112.146 140.977 1.00 131.54 ? 30  SER G C     1 
ATOM 8390 O O     . SER J 6 31  ? 108.317 112.394 140.437 1.00 131.54 ? 30  SER G O     1 
ATOM 8391 C CB    . SER J 6 31  ? 107.458 109.722 141.496 1.00 131.54 ? 30  SER G CB    1 
ATOM 8392 O OG    . SER J 6 31  ? 108.820 110.057 141.355 1.00 131.54 ? 30  SER G OG    1 
ATOM 8393 N N     . VAL J 6 32  ? 106.581 113.024 141.728 1.00 129.30 ? 31  VAL G N     1 
ATOM 8394 C CA    . VAL J 6 32  ? 107.179 114.320 141.998 1.00 129.30 ? 31  VAL G CA    1 
ATOM 8395 C C     . VAL J 6 32  ? 108.408 114.158 142.877 1.00 129.30 ? 31  VAL G C     1 
ATOM 8396 O O     . VAL J 6 32  ? 109.402 114.875 142.718 1.00 129.30 ? 31  VAL G O     1 
ATOM 8397 C CB    . VAL J 6 32  ? 106.139 115.270 142.612 1.00 129.30 ? 31  VAL G CB    1 
ATOM 8398 C CG1   . VAL J 6 32  ? 104.908 115.295 141.738 1.00 129.30 ? 31  VAL G CG1   1 
ATOM 8399 C CG2   . VAL J 6 32  ? 105.774 114.846 144.019 1.00 129.30 ? 31  VAL G CG2   1 
ATOM 8400 N N     . SER J 6 33  ? 108.376 113.210 143.810 1.00 122.64 ? 32  SER G N     1 
ATOM 8401 C CA    . SER J 6 33  ? 109.473 113.152 144.757 1.00 122.64 ? 32  SER G CA    1 
ATOM 8402 C C     . SER J 6 33  ? 110.761 112.656 144.120 1.00 122.64 ? 32  SER G C     1 
ATOM 8403 O O     . SER J 6 33  ? 111.837 113.072 144.552 1.00 122.64 ? 32  SER G O     1 
ATOM 8404 C CB    . SER J 6 33  ? 109.098 112.261 145.942 1.00 122.64 ? 32  SER G CB    1 
ATOM 8405 O OG    . SER J 6 33  ? 107.869 112.669 146.523 1.00 122.64 ? 32  SER G OG    1 
ATOM 8406 N N     . GLN J 6 34  ? 110.693 111.894 143.025 1.00 131.04 ? 33  GLN G N     1 
ATOM 8407 C CA    . GLN J 6 34  ? 111.949 111.487 142.403 1.00 131.04 ? 33  GLN G CA    1 
ATOM 8408 C C     . GLN J 6 34  ? 112.527 112.588 141.531 1.00 131.04 ? 33  GLN G C     1 
ATOM 8409 O O     . GLN J 6 34  ? 113.752 112.726 141.452 1.00 131.04 ? 33  GLN G O     1 
ATOM 8410 C CB    . GLN J 6 34  ? 111.787 110.206 141.588 1.00 131.04 ? 33  GLN G CB    1 
ATOM 8411 C CG    . GLN J 6 34  ? 113.124 109.657 141.119 1.00 131.04 ? 33  GLN G CG    1 
ATOM 8412 C CD    . GLN J 6 34  ? 113.002 108.366 140.346 1.00 131.04 ? 33  GLN G CD    1 
ATOM 8413 O OE1   . GLN J 6 34  ? 111.901 107.892 140.073 1.00 131.04 ? 33  GLN G OE1   1 
ATOM 8414 N NE2   . GLN J 6 34  ? 114.141 107.767 140.017 1.00 131.04 ? 33  GLN G NE2   1 
ATOM 8415 N N     . VAL J 6 35  ? 111.685 113.385 140.875 1.00 125.87 ? 34  VAL G N     1 
ATOM 8416 C CA    . VAL J 6 35  ? 112.228 114.512 140.132 1.00 125.87 ? 34  VAL G CA    1 
ATOM 8417 C C     . VAL J 6 35  ? 112.821 115.526 141.100 1.00 125.87 ? 34  VAL G C     1 
ATOM 8418 O O     . VAL J 6 35  ? 113.880 116.108 140.840 1.00 125.87 ? 34  VAL G O     1 
ATOM 8419 C CB    . VAL J 6 35  ? 111.169 115.136 139.204 1.00 125.87 ? 34  VAL G CB    1 
ATOM 8420 C CG1   . VAL J 6 35  ? 110.481 114.058 138.412 1.00 125.87 ? 34  VAL G CG1   1 
ATOM 8421 C CG2   . VAL J 6 35  ? 110.160 115.950 139.974 1.00 125.87 ? 34  VAL G CG2   1 
ATOM 8422 N N     . GLU J 6 36  ? 112.179 115.722 142.252 1.00 125.13 ? 35  GLU G N     1 
ATOM 8423 C CA    . GLU J 6 36  ? 112.759 116.620 143.241 1.00 125.13 ? 35  GLU G CA    1 
ATOM 8424 C C     . GLU J 6 36  ? 114.061 116.058 143.791 1.00 125.13 ? 35  GLU G C     1 
ATOM 8425 O O     . GLU J 6 36  ? 115.027 116.800 143.993 1.00 125.13 ? 35  GLU G O     1 
ATOM 8426 C CB    . GLU J 6 36  ? 111.756 116.878 144.365 1.00 125.13 ? 35  GLU G CB    1 
ATOM 8427 C CG    . GLU J 6 36  ? 112.212 117.911 145.374 1.00 125.13 ? 35  GLU G CG    1 
ATOM 8428 C CD    . GLU J 6 36  ? 111.168 118.186 146.436 1.00 125.13 ? 35  GLU G CD    1 
ATOM 8429 O OE1   . GLU J 6 36  ? 110.105 117.534 146.401 1.00 125.13 ? 35  GLU G OE1   1 
ATOM 8430 O OE2   . GLU J 6 36  ? 111.404 119.050 147.303 1.00 125.13 ? 35  GLU G OE2   1 
ATOM 8431 N N     . ARG J 6 37  ? 114.131 114.740 143.970 1.00 125.13 ? 36  ARG G N     1 
ATOM 8432 C CA    . ARG J 6 37  ? 115.349 114.117 144.465 1.00 125.13 ? 36  ARG G CA    1 
ATOM 8433 C C     . ARG J 6 37  ? 116.457 114.169 143.439 1.00 125.13 ? 36  ARG G C     1 
ATOM 8434 O O     . ARG J 6 37  ? 117.640 114.179 143.800 1.00 125.13 ? 36  ARG G O     1 
ATOM 8435 C CB    . ARG J 6 37  ? 115.080 112.657 144.815 1.00 125.13 ? 36  ARG G CB    1 
ATOM 8436 C CG    . ARG J 6 37  ? 116.200 111.978 145.560 1.00 125.13 ? 36  ARG G CG    1 
ATOM 8437 C CD    . ARG J 6 37  ? 115.795 110.563 145.917 1.00 125.13 ? 36  ARG G CD    1 
ATOM 8438 N NE    . ARG J 6 37  ? 115.644 109.688 144.759 1.00 125.13 ? 36  ARG G NE    1 
ATOM 8439 C CZ    . ARG J 6 37  ? 115.071 108.490 144.828 1.00 125.13 ? 36  ARG G CZ    1 
ATOM 8440 N NH1   . ARG J 6 37  ? 114.605 108.067 145.993 1.00 125.13 ? 36  ARG G NH1   1 
ATOM 8441 N NH2   . ARG J 6 37  ? 114.956 107.718 143.751 1.00 125.13 ? 36  ARG G NH2   1 
ATOM 8442 N N     . SER J 6 38  ? 116.098 114.199 142.163 1.00 126.37 ? 37  SER G N     1 
ATOM 8443 C CA    . SER J 6 38  ? 117.104 114.348 141.132 1.00 126.37 ? 37  SER G CA    1 
ATOM 8444 C C     . SER J 6 38  ? 117.511 115.797 140.964 1.00 126.37 ? 37  SER G C     1 
ATOM 8445 O O     . SER J 6 38  ? 118.596 116.073 140.446 1.00 126.37 ? 37  SER G O     1 
ATOM 8446 C CB    . SER J 6 38  ? 116.603 113.785 139.807 1.00 126.37 ? 37  SER G CB    1 
ATOM 8447 O OG    . SER J 6 38  ? 115.308 114.266 139.529 1.00 126.37 ? 37  SER G OG    1 
ATOM 8448 N N     . LEU J 6 39  ? 116.657 116.725 141.383 1.00 124.76 ? 38  LEU G N     1 
ATOM 8449 C CA    . LEU J 6 39  ? 117.070 118.121 141.389 1.00 124.76 ? 38  LEU G CA    1 
ATOM 8450 C C     . LEU J 6 39  ? 117.973 118.415 142.569 1.00 124.76 ? 38  LEU G C     1 
ATOM 8451 O O     . LEU J 6 39  ? 118.795 119.337 142.508 1.00 124.76 ? 38  LEU G O     1 
ATOM 8452 C CB    . LEU J 6 39  ? 115.856 119.049 141.452 1.00 124.76 ? 38  LEU G CB    1 
ATOM 8453 C CG    . LEU J 6 39  ? 115.010 119.189 140.204 1.00 124.76 ? 38  LEU G CG    1 
ATOM 8454 C CD1   . LEU J 6 39  ? 113.756 119.958 140.506 1.00 124.76 ? 38  LEU G CD1   1 
ATOM 8455 C CD2   . LEU J 6 39  ? 115.820 119.931 139.198 1.00 124.76 ? 38  LEU G CD2   1 
ATOM 8456 N N     . ARG J 6 40  ? 117.797 117.674 143.657 1.00 127.89 ? 39  ARG G N     1 
ATOM 8457 C CA    . ARG J 6 40  ? 118.680 117.836 144.800 1.00 127.89 ? 39  ARG G CA    1 
ATOM 8458 C C     . ARG J 6 40  ? 120.043 117.221 144.516 1.00 127.89 ? 39  ARG G C     1 
ATOM 8459 O O     . ARG J 6 40  ? 121.077 117.800 144.867 1.00 127.89 ? 39  ARG G O     1 
ATOM 8460 C CB    . ARG J 6 40  ? 118.025 117.215 146.023 1.00 127.89 ? 39  ARG G CB    1 
ATOM 8461 C CG    . ARG J 6 40  ? 116.744 117.918 146.417 1.00 127.89 ? 39  ARG G CG    1 
ATOM 8462 C CD    . ARG J 6 40  ? 117.023 119.268 147.026 1.00 127.89 ? 39  ARG G CD    1 
ATOM 8463 N NE    . ARG J 6 40  ? 115.787 119.993 147.281 1.00 127.89 ? 39  ARG G NE    1 
ATOM 8464 C CZ    . ARG J 6 40  ? 115.061 119.862 148.384 1.00 127.89 ? 39  ARG G CZ    1 
ATOM 8465 N NH1   . ARG J 6 40  ? 115.444 119.022 149.333 1.00 127.89 ? 39  ARG G NH1   1 
ATOM 8466 N NH2   . ARG J 6 40  ? 113.952 120.568 148.534 1.00 127.89 ? 39  ARG G NH2   1 
ATOM 8467 N N     . GLU J 6 41  ? 120.067 116.040 143.890 1.00 130.61 ? 40  GLU G N     1 
ATOM 8468 C CA    . GLU J 6 41  ? 121.344 115.408 143.589 1.00 130.61 ? 40  GLU G CA    1 
ATOM 8469 C C     . GLU J 6 41  ? 122.013 116.025 142.372 1.00 130.61 ? 40  GLU G C     1 
ATOM 8470 O O     . GLU J 6 41  ? 123.181 115.725 142.107 1.00 130.61 ? 40  GLU G O     1 
ATOM 8471 C CB    . GLU J 6 41  ? 121.194 113.899 143.357 1.00 130.61 ? 40  GLU G CB    1 
ATOM 8472 C CG    . GLU J 6 41  ? 120.746 113.087 144.555 1.00 130.61 ? 40  GLU G CG    1 
ATOM 8473 C CD    . GLU J 6 41  ? 120.579 111.612 144.220 1.00 130.61 ? 40  GLU G CD    1 
ATOM 8474 O OE1   . GLU J 6 41  ? 120.724 111.246 143.035 1.00 130.61 ? 40  GLU G OE1   1 
ATOM 8475 O OE2   . GLU J 6 41  ? 120.328 110.813 145.148 1.00 130.61 ? 40  GLU G OE2   1 
ATOM 8476 N N     . GLY J 6 42  ? 121.303 116.868 141.632 1.00 127.86 ? 41  GLY G N     1 
ATOM 8477 C CA    . GLY J 6 42  ? 121.910 117.574 140.529 1.00 127.86 ? 41  GLY G CA    1 
ATOM 8478 C C     . GLY J 6 42  ? 122.452 118.900 141.007 1.00 127.86 ? 41  GLY G C     1 
ATOM 8479 O O     . GLY J 6 42  ? 123.317 119.502 140.366 1.00 127.86 ? 41  GLY G O     1 
ATOM 8480 N N     . HIS J 6 43  ? 121.946 119.345 142.156 1.00 130.81 ? 42  HIS G N     1 
ATOM 8481 C CA    . HIS J 6 43  ? 122.341 120.610 142.766 1.00 130.81 ? 42  HIS G CA    1 
ATOM 8482 C C     . HIS J 6 43  ? 122.160 121.750 141.769 1.00 130.81 ? 42  HIS G C     1 
ATOM 8483 O O     . HIS J 6 43  ? 123.047 122.577 141.555 1.00 130.81 ? 42  HIS G O     1 
ATOM 8484 C CB    . HIS J 6 43  ? 123.779 120.545 143.279 1.00 130.81 ? 42  HIS G CB    1 
ATOM 8485 C CG    . HIS J 6 43  ? 123.984 119.548 144.377 1.00 130.81 ? 42  HIS G CG    1 
ATOM 8486 N ND1   . HIS J 6 43  ? 124.363 118.246 144.133 1.00 130.81 ? 42  HIS G ND1   1 
ATOM 8487 C CD2   . HIS J 6 43  ? 123.852 119.656 145.721 1.00 130.81 ? 42  HIS G CD2   1 
ATOM 8488 C CE1   . HIS J 6 43  ? 124.465 117.596 145.279 1.00 130.81 ? 42  HIS G CE1   1 
ATOM 8489 N NE2   . HIS J 6 43  ? 124.159 118.429 146.257 1.00 130.81 ? 42  HIS G NE2   1 
ATOM 8490 N N     . TYR J 6 44  ? 120.973 121.795 141.162 1.00 127.76 ? 43  TYR G N     1 
ATOM 8491 C CA    . TYR J 6 44  ? 120.677 122.834 140.186 1.00 127.76 ? 43  TYR G CA    1 
ATOM 8492 C C     . TYR J 6 44  ? 120.421 124.178 140.838 1.00 127.76 ? 43  TYR G C     1 
ATOM 8493 O O     . TYR J 6 44  ? 120.514 125.206 140.162 1.00 127.76 ? 43  TYR G O     1 
ATOM 8494 C CB    . TYR J 6 44  ? 119.478 122.419 139.342 1.00 127.76 ? 43  TYR G CB    1 
ATOM 8495 C CG    . TYR J 6 44  ? 119.779 121.213 138.504 1.00 127.76 ? 43  TYR G CG    1 
ATOM 8496 C CD1   . TYR J 6 44  ? 120.473 121.332 137.313 1.00 127.76 ? 43  TYR G CD1   1 
ATOM 8497 C CD2   . TYR J 6 44  ? 119.415 119.947 138.929 1.00 127.76 ? 43  TYR G CD2   1 
ATOM 8498 C CE1   . TYR J 6 44  ? 120.767 120.228 136.553 1.00 127.76 ? 43  TYR G CE1   1 
ATOM 8499 C CE2   . TYR J 6 44  ? 119.704 118.836 138.175 1.00 127.76 ? 43  TYR G CE2   1 
ATOM 8500 C CZ    . TYR J 6 44  ? 120.382 118.981 136.989 1.00 127.76 ? 43  TYR G CZ    1 
ATOM 8501 O OH    . TYR J 6 44  ? 120.673 117.871 136.236 1.00 127.76 ? 43  TYR G OH    1 
ATOM 8502 N N     . ALA J 6 45  ? 120.103 124.193 142.126 1.00 131.97 ? 44  ALA G N     1 
ATOM 8503 C CA    . ALA J 6 45  ? 120.002 125.429 142.880 1.00 131.97 ? 44  ALA G CA    1 
ATOM 8504 C C     . ALA J 6 45  ? 120.321 125.116 144.332 1.00 131.97 ? 44  ALA G C     1 
ATOM 8505 O O     . ALA J 6 45  ? 120.798 124.025 144.660 1.00 131.97 ? 44  ALA G O     1 
ATOM 8506 C CB    . ALA J 6 45  ? 118.613 126.058 142.723 1.00 131.97 ? 44  ALA G CB    1 
ATOM 8507 N N     . GLN J 6 46  ? 120.053 126.077 145.210 1.00 137.35 ? 45  GLN G N     1 
ATOM 8508 C CA    . GLN J 6 46  ? 120.232 125.859 146.636 1.00 137.35 ? 45  GLN G CA    1 
ATOM 8509 C C     . GLN J 6 46  ? 118.946 125.426 147.310 1.00 137.35 ? 45  GLN G C     1 
ATOM 8510 O O     . GLN J 6 46  ? 118.989 124.751 148.342 1.00 137.35 ? 45  GLN G O     1 
ATOM 8511 C CB    . GLN J 6 46  ? 120.757 127.123 147.315 1.00 137.35 ? 45  GLN G CB    1 
ATOM 8512 C CG    . GLN J 6 46  ? 122.154 127.513 146.900 1.00 137.35 ? 45  GLN G CG    1 
ATOM 8513 C CD    . GLN J 6 46  ? 122.609 128.779 147.587 1.00 137.35 ? 45  GLN G CD    1 
ATOM 8514 O OE1   . GLN J 6 46  ? 121.841 129.412 148.309 1.00 137.35 ? 45  GLN G OE1   1 
ATOM 8515 N NE2   . GLN J 6 46  ? 123.869 129.149 147.382 1.00 137.35 ? 45  GLN G NE2   1 
ATOM 8516 N N     . ARG J 6 47  ? 117.809 125.831 146.758 1.00 140.09 ? 46  ARG G N     1 
ATOM 8517 C CA    . ARG J 6 47  ? 116.523 125.567 147.378 1.00 140.09 ? 46  ARG G CA    1 
ATOM 8518 C C     . ARG J 6 47  ? 115.478 125.579 146.280 1.00 140.09 ? 46  ARG G C     1 
ATOM 8519 O O     . ARG J 6 47  ? 115.485 126.474 145.431 1.00 140.09 ? 46  ARG G O     1 
ATOM 8520 C CB    . ARG J 6 47  ? 116.195 126.611 148.436 1.00 140.09 ? 46  ARG G CB    1 
ATOM 8521 C CG    . ARG J 6 47  ? 116.399 128.017 147.952 1.00 140.09 ? 46  ARG G CG    1 
ATOM 8522 C CD    . ARG J 6 47  ? 116.218 128.971 149.089 1.00 140.09 ? 46  ARG G CD    1 
ATOM 8523 N NE    . ARG J 6 47  ? 114.815 129.039 149.470 1.00 140.09 ? 46  ARG G NE    1 
ATOM 8524 C CZ    . ARG J 6 47  ? 114.390 129.557 150.613 1.00 140.09 ? 46  ARG G CZ    1 
ATOM 8525 N NH1   . ARG J 6 47  ? 115.265 130.045 151.478 1.00 140.09 ? 46  ARG G NH1   1 
ATOM 8526 N NH2   . ARG J 6 47  ? 113.098 129.578 150.896 1.00 140.09 ? 46  ARG G NH2   1 
ATOM 8527 N N     . LEU J 6 48  ? 114.605 124.585 146.283 1.00 129.29 ? 47  LEU G N     1 
ATOM 8528 C CA    . LEU J 6 48  ? 113.573 124.480 145.269 1.00 129.29 ? 47  LEU G CA    1 
ATOM 8529 C C     . LEU J 6 48  ? 112.364 125.278 145.723 1.00 129.29 ? 47  LEU G C     1 
ATOM 8530 O O     . LEU J 6 48  ? 112.429 126.069 146.665 1.00 129.29 ? 47  LEU G O     1 
ATOM 8531 C CB    . LEU J 6 48  ? 113.211 123.028 144.985 1.00 129.29 ? 47  LEU G CB    1 
ATOM 8532 C CG    . LEU J 6 48  ? 114.322 122.233 144.309 1.00 129.29 ? 47  LEU G CG    1 
ATOM 8533 C CD1   . LEU J 6 48  ? 113.917 120.788 144.135 1.00 129.29 ? 47  LEU G CD1   1 
ATOM 8534 C CD2   . LEU J 6 48  ? 114.640 122.864 142.975 1.00 129.29 ? 47  LEU G CD2   1 
ATOM 8535 N N     . SER J 6 49  ? 111.249 125.075 145.061 1.00 124.09 ? 48  SER G N     1 
ATOM 8536 C CA    . SER J 6 49  ? 110.016 125.719 145.444 1.00 124.09 ? 48  SER G CA    1 
ATOM 8537 C C     . SER J 6 49  ? 109.057 124.664 145.944 1.00 124.09 ? 48  SER G C     1 
ATOM 8538 O O     . SER J 6 49  ? 109.379 123.477 146.006 1.00 124.09 ? 48  SER G O     1 
ATOM 8539 C CB    . SER J 6 49  ? 109.404 126.452 144.262 1.00 124.09 ? 48  SER G CB    1 
ATOM 8540 O OG    . SER J 6 49  ? 108.193 125.819 143.878 1.00 124.09 ? 48  SER G OG    1 
ATOM 8541 N N     . ARG J 6 50  ? 107.859 125.098 146.304 1.00 127.00 ? 49  ARG G N     1 
ATOM 8542 C CA    . ARG J 6 50  ? 106.922 124.100 146.778 1.00 127.00 ? 49  ARG G CA    1 
ATOM 8543 C C     . ARG J 6 50  ? 106.313 123.359 145.601 1.00 127.00 ? 49  ARG G C     1 
ATOM 8544 O O     . ARG J 6 50  ? 106.177 122.134 145.640 1.00 127.00 ? 49  ARG G O     1 
ATOM 8545 C CB    . ARG J 6 50  ? 105.836 124.753 147.632 1.00 127.00 ? 49  ARG G CB    1 
ATOM 8546 C CG    . ARG J 6 50  ? 104.899 123.753 148.265 1.00 127.00 ? 49  ARG G CG    1 
ATOM 8547 C CD    . ARG J 6 50  ? 105.639 122.931 149.304 1.00 127.00 ? 49  ARG G CD    1 
ATOM 8548 N NE    . ARG J 6 50  ? 104.746 122.021 150.008 1.00 127.00 ? 49  ARG G NE    1 
ATOM 8549 C CZ    . ARG J 6 50  ? 105.159 121.062 150.827 1.00 127.00 ? 49  ARG G CZ    1 
ATOM 8550 N NH1   . ARG J 6 50  ? 106.456 120.890 151.044 1.00 127.00 ? 49  ARG G NH1   1 
ATOM 8551 N NH2   . ARG J 6 50  ? 104.277 120.271 151.420 1.00 127.00 ? 49  ARG G NH2   1 
ATOM 8552 N N     . THR J 6 51  ? 106.009 124.074 144.521 1.00 123.78 ? 50  THR G N     1 
ATOM 8553 C CA    . THR J 6 51  ? 105.306 123.501 143.384 1.00 123.78 ? 50  THR G CA    1 
ATOM 8554 C C     . THR J 6 51  ? 106.160 123.462 142.129 1.00 123.78 ? 50  THR G C     1 
ATOM 8555 O O     . THR J 6 51  ? 105.626 123.318 141.027 1.00 123.78 ? 50  THR G O     1 
ATOM 8556 C CB    . THR J 6 51  ? 104.029 124.283 143.109 1.00 123.78 ? 50  THR G CB    1 
ATOM 8557 O OG1   . THR J 6 51  ? 104.368 125.642 142.821 1.00 123.78 ? 50  THR G OG1   1 
ATOM 8558 C CG2   . THR J 6 51  ? 103.152 124.264 144.336 1.00 123.78 ? 50  THR G CG2   1 
ATOM 8559 N N     . ALA J 6 52  ? 107.461 123.603 142.255 1.00 123.53 ? 51  ALA G N     1 
ATOM 8560 C CA    . ALA J 6 52  ? 108.257 123.534 141.040 1.00 123.53 ? 51  ALA G CA    1 
ATOM 8561 C C     . ALA J 6 52  ? 108.423 122.111 140.514 1.00 123.53 ? 51  ALA G C     1 
ATOM 8562 O O     . ALA J 6 52  ? 108.349 121.900 139.294 1.00 123.53 ? 51  ALA G O     1 
ATOM 8563 C CB    . ALA J 6 52  ? 109.629 124.161 141.275 1.00 123.53 ? 51  ALA G CB    1 
ATOM 8564 N N     . PRO J 6 53  ? 108.612 121.099 141.364 1.00 121.81 ? 52  PRO G N     1 
ATOM 8565 C CA    . PRO J 6 53  ? 108.696 119.748 140.814 1.00 121.81 ? 52  PRO G CA    1 
ATOM 8566 C C     . PRO J 6 53  ? 107.369 119.206 140.345 1.00 121.81 ? 52  PRO G C     1 
ATOM 8567 O O     . PRO J 6 53  ? 107.366 118.349 139.460 1.00 121.81 ? 52  PRO G O     1 
ATOM 8568 C CB    . PRO J 6 53  ? 109.262 118.928 141.977 1.00 121.81 ? 52  PRO G CB    1 
ATOM 8569 C CG    . PRO J 6 53  ? 108.842 119.652 143.165 1.00 121.81 ? 52  PRO G CG    1 
ATOM 8570 C CD    . PRO J 6 53  ? 108.934 121.098 142.800 1.00 121.81 ? 52  PRO G CD    1 
ATOM 8571 N N     . VAL J 6 54  ? 106.238 119.716 140.829 1.00 119.87 ? 53  VAL G N     1 
ATOM 8572 C CA    . VAL J 6 54  ? 104.976 119.241 140.278 1.00 119.87 ? 53  VAL G CA    1 
ATOM 8573 C C     . VAL J 6 54  ? 104.814 119.754 138.856 1.00 119.87 ? 53  VAL G C     1 
ATOM 8574 O O     . VAL J 6 54  ? 104.395 119.016 137.956 1.00 119.87 ? 53  VAL G O     1 
ATOM 8575 C CB    . VAL J 6 54  ? 103.794 119.627 141.185 1.00 119.87 ? 53  VAL G CB    1 
ATOM 8576 C CG1   . VAL J 6 54  ? 104.061 119.171 142.598 1.00 119.87 ? 53  VAL G CG1   1 
ATOM 8577 C CG2   . VAL J 6 54  ? 103.531 121.108 141.157 1.00 119.87 ? 53  VAL G CG2   1 
ATOM 8578 N N     . TYR J 6 55  ? 105.248 120.989 138.606 1.00 121.13 ? 54  TYR G N     1 
ATOM 8579 C CA    . TYR J 6 55  ? 105.159 121.541 137.264 1.00 121.13 ? 54  TYR G CA    1 
ATOM 8580 C C     . TYR J 6 55  ? 106.132 120.828 136.344 1.00 121.13 ? 54  TYR G C     1 
ATOM 8581 O O     . TYR J 6 55  ? 105.802 120.516 135.192 1.00 121.13 ? 54  TYR G O     1 
ATOM 8582 C CB    . TYR J 6 55  ? 105.479 123.029 137.308 1.00 121.13 ? 54  TYR G CB    1 
ATOM 8583 C CG    . TYR J 6 55  ? 105.169 123.809 136.058 1.00 121.13 ? 54  TYR G CG    1 
ATOM 8584 C CD1   . TYR J 6 55  ? 103.911 124.342 135.843 1.00 121.13 ? 54  TYR G CD1   1 
ATOM 8585 C CD2   . TYR J 6 55  ? 106.131 123.992 135.082 1.00 121.13 ? 54  TYR G CD2   1 
ATOM 8586 C CE1   . TYR J 6 55  ? 103.634 125.066 134.706 1.00 121.13 ? 54  TYR G CE1   1 
ATOM 8587 C CE2   . TYR J 6 55  ? 105.861 124.705 133.940 1.00 121.13 ? 54  TYR G CE2   1 
ATOM 8588 C CZ    . TYR J 6 55  ? 104.611 125.236 133.756 1.00 121.13 ? 54  TYR G CZ    1 
ATOM 8589 O OH    . TYR J 6 55  ? 104.340 125.948 132.615 1.00 121.13 ? 54  TYR G OH    1 
ATOM 8590 N N     . LEU J 6 56  ? 107.322 120.505 136.853 1.00 120.81 ? 55  LEU G N     1 
ATOM 8591 C CA    . LEU J 6 56  ? 108.295 119.875 135.977 1.00 120.81 ? 55  LEU G CA    1 
ATOM 8592 C C     . LEU J 6 56  ? 107.917 118.433 135.696 1.00 120.81 ? 55  LEU G C     1 
ATOM 8593 O O     . LEU J 6 56  ? 108.126 117.938 134.580 1.00 120.81 ? 55  LEU G O     1 
ATOM 8594 C CB    . LEU J 6 56  ? 109.682 119.934 136.598 1.00 120.81 ? 55  LEU G CB    1 
ATOM 8595 C CG    . LEU J 6 56  ? 110.759 119.309 135.722 1.00 120.81 ? 55  LEU G CG    1 
ATOM 8596 C CD1   . LEU J 6 56  ? 110.765 119.975 134.371 1.00 120.81 ? 55  LEU G CD1   1 
ATOM 8597 C CD2   . LEU J 6 56  ? 112.114 119.419 136.381 1.00 120.81 ? 55  LEU G CD2   1 
ATOM 8598 N N     . ALA J 6 57  ? 107.287 117.764 136.655 1.00 121.37 ? 56  ALA G N     1 
ATOM 8599 C CA    . ALA J 6 57  ? 106.856 116.412 136.382 1.00 121.37 ? 56  ALA G CA    1 
ATOM 8600 C C     . ALA J 6 57  ? 105.628 116.397 135.501 1.00 121.37 ? 56  ALA G C     1 
ATOM 8601 O O     . ALA J 6 57  ? 105.472 115.472 134.706 1.00 121.37 ? 56  ALA G O     1 
ATOM 8602 C CB    . ALA J 6 57  ? 106.573 115.668 137.683 1.00 121.37 ? 56  ALA G CB    1 
ATOM 8603 N N     . ALA J 6 58  ? 104.840 117.468 135.499 1.00 118.78 ? 57  ALA G N     1 
ATOM 8604 C CA    . ALA J 6 58  ? 103.710 117.451 134.590 1.00 118.78 ? 57  ALA G CA    1 
ATOM 8605 C C     . ALA J 6 58  ? 104.135 117.805 133.180 1.00 118.78 ? 57  ALA G C     1 
ATOM 8606 O O     . ALA J 6 58  ? 103.563 117.280 132.221 1.00 118.78 ? 57  ALA G O     1 
ATOM 8607 C CB    . ALA J 6 58  ? 102.635 118.422 135.061 1.00 118.78 ? 57  ALA G CB    1 
ATOM 8608 N N     . VAL J 6 59  ? 105.215 118.568 133.023 1.00 121.12 ? 58  VAL G N     1 
ATOM 8609 C CA    . VAL J 6 59  ? 105.657 118.829 131.658 1.00 121.12 ? 58  VAL G CA    1 
ATOM 8610 C C     . VAL J 6 59  ? 106.387 117.617 131.098 1.00 121.12 ? 58  VAL G C     1 
ATOM 8611 O O     . VAL J 6 59  ? 106.193 117.250 129.931 1.00 121.12 ? 58  VAL G O     1 
ATOM 8612 C CB    . VAL J 6 59  ? 106.511 120.104 131.567 1.00 121.12 ? 58  VAL G CB    1 
ATOM 8613 C CG1   . VAL J 6 59  ? 107.730 120.011 132.433 1.00 121.12 ? 58  VAL G CG1   1 
ATOM 8614 C CG2   . VAL J 6 59  ? 106.914 120.347 130.132 1.00 121.12 ? 58  VAL G CG2   1 
ATOM 8615 N N     . ILE J 6 60  ? 107.226 116.959 131.902 1.00 122.48 ? 59  ILE G N     1 
ATOM 8616 C CA    . ILE J 6 60  ? 107.888 115.787 131.348 1.00 122.48 ? 59  ILE G CA    1 
ATOM 8617 C C     . ILE J 6 60  ? 106.871 114.680 131.137 1.00 122.48 ? 59  ILE G C     1 
ATOM 8618 O O     . ILE J 6 60  ? 106.983 113.892 130.187 1.00 122.48 ? 59  ILE G O     1 
ATOM 8619 C CB    . ILE J 6 60  ? 109.052 115.335 132.240 1.00 122.48 ? 59  ILE G CB    1 
ATOM 8620 C CG1   . ILE J 6 60  ? 110.038 116.477 132.429 1.00 122.48 ? 59  ILE G CG1   1 
ATOM 8621 C CG2   . ILE J 6 60  ? 109.763 114.167 131.622 1.00 122.48 ? 59  ILE G CG2   1 
ATOM 8622 C CD1   . ILE J 6 60  ? 111.100 116.190 133.453 1.00 122.48 ? 59  ILE G CD1   1 
ATOM 8623 N N     . GLU J 6 61  ? 105.817 114.650 131.952 1.00 128.39 ? 60  GLU G N     1 
ATOM 8624 C CA    . GLU J 6 61  ? 104.772 113.669 131.733 1.00 128.39 ? 60  GLU G CA    1 
ATOM 8625 C C     . GLU J 6 61  ? 104.035 113.972 130.445 1.00 128.39 ? 60  GLU G C     1 
ATOM 8626 O O     . GLU J 6 61  ? 103.677 113.056 129.700 1.00 128.39 ? 60  GLU G O     1 
ATOM 8627 C CB    . GLU J 6 61  ? 103.819 113.667 132.921 1.00 128.39 ? 60  GLU G CB    1 
ATOM 8628 C CG    . GLU J 6 61  ? 102.696 112.666 132.832 1.00 128.39 ? 60  GLU G CG    1 
ATOM 8629 C CD    . GLU J 6 61  ? 101.822 112.688 134.068 1.00 128.39 ? 60  GLU G CD    1 
ATOM 8630 O OE1   . GLU J 6 61  ? 102.153 113.436 135.008 1.00 128.39 ? 60  GLU G OE1   1 
ATOM 8631 O OE2   . GLU J 6 61  ? 100.811 111.959 134.106 1.00 128.39 ? 60  GLU G OE2   1 
ATOM 8632 N N     . TYR J 6 62  ? 103.848 115.254 130.137 1.00 123.97 ? 61  TYR G N     1 
ATOM 8633 C CA    . TYR J 6 62  ? 103.187 115.581 128.887 1.00 123.97 ? 61  TYR G CA    1 
ATOM 8634 C C     . TYR J 6 62  ? 104.050 115.197 127.701 1.00 123.97 ? 61  TYR G C     1 
ATOM 8635 O O     . TYR J 6 62  ? 103.540 114.703 126.691 1.00 123.97 ? 61  TYR G O     1 
ATOM 8636 C CB    . TYR J 6 62  ? 102.848 117.060 128.809 1.00 123.97 ? 61  TYR G CB    1 
ATOM 8637 C CG    . TYR J 6 62  ? 102.361 117.397 127.434 1.00 123.97 ? 61  TYR G CG    1 
ATOM 8638 C CD1   . TYR J 6 62  ? 101.118 116.974 127.001 1.00 123.97 ? 61  TYR G CD1   1 
ATOM 8639 C CD2   . TYR J 6 62  ? 103.169 118.078 126.544 1.00 123.97 ? 61  TYR G CD2   1 
ATOM 8640 C CE1   . TYR J 6 62  ? 100.676 117.257 125.734 1.00 123.97 ? 61  TYR G CE1   1 
ATOM 8641 C CE2   . TYR J 6 62  ? 102.738 118.366 125.275 1.00 123.97 ? 61  TYR G CE2   1 
ATOM 8642 C CZ    . TYR J 6 62  ? 101.491 117.953 124.873 1.00 123.97 ? 61  TYR G CZ    1 
ATOM 8643 O OH    . TYR J 6 62  ? 101.057 118.239 123.599 1.00 123.97 ? 61  TYR G OH    1 
ATOM 8644 N N     . LEU J 6 63  ? 105.360 115.406 127.798 1.00 129.80 ? 62  LEU G N     1 
ATOM 8645 C CA    . LEU J 6 63  ? 106.188 115.060 126.649 1.00 129.80 ? 62  LEU G CA    1 
ATOM 8646 C C     . LEU J 6 63  ? 106.286 113.558 126.457 1.00 129.80 ? 62  LEU G C     1 
ATOM 8647 O O     . LEU J 6 63  ? 106.297 113.079 125.314 1.00 129.80 ? 62  LEU G O     1 
ATOM 8648 C CB    . LEU J 6 63  ? 107.585 115.644 126.788 1.00 129.80 ? 62  LEU G CB    1 
ATOM 8649 C CG    . LEU J 6 63  ? 107.611 117.157 126.732 1.00 129.80 ? 62  LEU G CG    1 
ATOM 8650 C CD1   . LEU J 6 63  ? 109.021 117.641 126.976 1.00 129.80 ? 62  LEU G CD1   1 
ATOM 8651 C CD2   . LEU J 6 63  ? 107.092 117.606 125.385 1.00 129.80 ? 62  LEU G CD2   1 
ATOM 8652 N N     . THR J 6 64  ? 106.274 112.790 127.544 1.00 130.13 ? 63  THR G N     1 
ATOM 8653 C CA    . THR J 6 64  ? 106.305 111.348 127.369 1.00 130.13 ? 63  THR G CA    1 
ATOM 8654 C C     . THR J 6 64  ? 104.969 110.834 126.864 1.00 130.13 ? 63  THR G C     1 
ATOM 8655 O O     . THR J 6 64  ? 104.927 109.942 126.013 1.00 130.13 ? 63  THR G O     1 
ATOM 8656 C CB    . THR J 6 64  ? 106.671 110.670 128.680 1.00 130.13 ? 63  THR G CB    1 
ATOM 8657 O OG1   . THR J 6 64  ? 105.801 111.155 129.712 1.00 130.13 ? 63  THR G OG1   1 
ATOM 8658 C CG2   . THR J 6 64  ? 108.101 110.969 129.038 1.00 130.13 ? 63  THR G CG2   1 
ATOM 8659 N N     . ALA J 6 65  ? 103.869 111.408 127.339 1.00 131.30 ? 64  ALA G N     1 
ATOM 8660 C CA    . ALA J 6 65  ? 102.560 111.002 126.862 1.00 131.30 ? 64  ALA G CA    1 
ATOM 8661 C C     . ALA J 6 65  ? 102.212 111.628 125.525 1.00 131.30 ? 64  ALA G C     1 
ATOM 8662 O O     . ALA J 6 65  ? 101.111 111.401 125.017 1.00 131.30 ? 64  ALA G O     1 
ATOM 8663 C CB    . ALA J 6 65  ? 101.490 111.356 127.894 1.00 131.30 ? 64  ALA G CB    1 
ATOM 8664 N N     . LYS J 6 66  ? 103.097 112.442 124.966 1.00 130.78 ? 65  LYS G N     1 
ATOM 8665 C CA    . LYS J 6 66  ? 102.930 112.872 123.591 1.00 130.78 ? 65  LYS G CA    1 
ATOM 8666 C C     . LYS J 6 66  ? 103.818 112.100 122.636 1.00 130.78 ? 65  LYS G C     1 
ATOM 8667 O O     . LYS J 6 66  ? 103.428 111.886 121.485 1.00 130.78 ? 65  LYS G O     1 
ATOM 8668 C CB    . LYS J 6 66  ? 103.219 114.367 123.462 1.00 130.78 ? 65  LYS G CB    1 
ATOM 8669 C CG    . LYS J 6 66  ? 102.767 114.964 122.146 1.00 130.78 ? 65  LYS G CG    1 
ATOM 8670 C CD    . LYS J 6 66  ? 101.260 114.868 122.022 1.00 130.78 ? 65  LYS G CD    1 
ATOM 8671 C CE    . LYS J 6 66  ? 100.772 115.451 120.714 1.00 130.78 ? 65  LYS G CE    1 
ATOM 8672 N NZ    . LYS J 6 66  ? 100.954 116.925 120.689 1.00 130.78 ? 65  LYS G NZ    1 
ATOM 8673 N N     . VAL J 6 67  ? 104.999 111.671 123.081 1.00 133.90 ? 66  VAL G N     1 
ATOM 8674 C CA    . VAL J 6 67  ? 105.819 110.835 122.215 1.00 133.90 ? 66  VAL G CA    1 
ATOM 8675 C C     . VAL J 6 67  ? 105.304 109.401 122.196 1.00 133.90 ? 66  VAL G C     1 
ATOM 8676 O O     . VAL J 6 67  ? 105.192 108.784 121.129 1.00 133.90 ? 66  VAL G O     1 
ATOM 8677 C CB    . VAL J 6 67  ? 107.297 110.910 122.631 1.00 133.90 ? 66  VAL G CB    1 
ATOM 8678 C CG1   . VAL J 6 67  ? 107.462 110.521 124.071 1.00 133.90 ? 66  VAL G CG1   1 
ATOM 8679 C CG2   . VAL J 6 67  ? 108.131 109.993 121.754 1.00 133.90 ? 66  VAL G CG2   1 
ATOM 8680 N N     . LEU J 6 68  ? 104.979 108.834 123.358 1.00 143.38 ? 67  LEU G N     1 
ATOM 8681 C CA    . LEU J 6 68  ? 104.524 107.459 123.356 1.00 143.38 ? 67  LEU G CA    1 
ATOM 8682 C C     . LEU J 6 68  ? 103.095 107.344 122.871 1.00 143.38 ? 67  LEU G C     1 
ATOM 8683 O O     . LEU J 6 68  ? 102.701 106.271 122.414 1.00 143.38 ? 67  LEU G O     1 
ATOM 8684 C CB    . LEU J 6 68  ? 104.649 106.856 124.752 1.00 143.38 ? 67  LEU G CB    1 
ATOM 8685 C CG    . LEU J 6 68  ? 106.086 106.702 125.237 1.00 143.38 ? 67  LEU G CG    1 
ATOM 8686 C CD1   . LEU J 6 68  ? 106.114 106.169 126.652 1.00 143.38 ? 67  LEU G CD1   1 
ATOM 8687 C CD2   . LEU J 6 68  ? 106.868 105.809 124.304 1.00 143.38 ? 67  LEU G CD2   1 
ATOM 8688 N N     . GLU J 6 69  ? 102.349 108.447 122.853 1.00 147.78 ? 68  GLU G N     1 
ATOM 8689 C CA    . GLU J 6 69  ? 101.032 108.392 122.241 1.00 147.78 ? 68  GLU G CA    1 
ATOM 8690 C C     . GLU J 6 69  ? 101.171 108.202 120.744 1.00 147.78 ? 68  GLU G C     1 
ATOM 8691 O O     . GLU J 6 69  ? 100.387 107.470 120.131 1.00 147.78 ? 68  GLU G O     1 
ATOM 8692 C CB    . GLU J 6 69  ? 100.244 109.658 122.561 1.00 147.78 ? 68  GLU G CB    1 
ATOM 8693 C CG    . GLU J 6 69  ? 98.817  109.645 122.054 1.00 147.78 ? 68  GLU G CG    1 
ATOM 8694 C CD    . GLU J 6 69  ? 98.683  110.235 120.665 1.00 147.78 ? 68  GLU G CD    1 
ATOM 8695 O OE1   . GLU J 6 69  ? 99.705  110.692 120.114 1.00 147.78 ? 68  GLU G OE1   1 
ATOM 8696 O OE2   . GLU J 6 69  ? 97.557  110.247 120.128 1.00 147.78 ? 68  GLU G OE2   1 
ATOM 8697 N N     . LEU J 6 70  ? 102.225 108.757 120.164 1.00 148.28 ? 69  LEU G N     1 
ATOM 8698 C CA    . LEU J 6 70  ? 102.421 108.645 118.733 1.00 148.28 ? 69  LEU G CA    1 
ATOM 8699 C C     . LEU J 6 70  ? 103.119 107.348 118.391 1.00 148.28 ? 69  LEU G C     1 
ATOM 8700 O O     . LEU J 6 70  ? 102.857 106.772 117.332 1.00 148.28 ? 69  LEU G O     1 
ATOM 8701 C CB    . LEU J 6 70  ? 103.237 109.827 118.208 1.00 148.28 ? 69  LEU G CB    1 
ATOM 8702 C CG    . LEU J 6 70  ? 102.590 111.193 118.392 1.00 148.28 ? 69  LEU G CG    1 
ATOM 8703 C CD1   . LEU J 6 70  ? 103.567 112.281 118.018 1.00 148.28 ? 69  LEU G CD1   1 
ATOM 8704 C CD2   . LEU J 6 70  ? 101.347 111.281 117.533 1.00 148.28 ? 69  LEU G CD2   1 
ATOM 8705 N N     . ALA J 6 71  ? 103.968 106.851 119.287 1.00 153.16 ? 70  ALA G N     1 
ATOM 8706 C CA    . ALA J 6 71  ? 104.561 105.544 119.047 1.00 153.16 ? 70  ALA G CA    1 
ATOM 8707 C C     . ALA J 6 71  ? 103.508 104.448 119.149 1.00 153.16 ? 70  ALA G C     1 
ATOM 8708 O O     . ALA J 6 71  ? 103.510 103.501 118.354 1.00 153.16 ? 70  ALA G O     1 
ATOM 8709 C CB    . ALA J 6 71  ? 105.699 105.293 120.033 1.00 153.16 ? 70  ALA G CB    1 
ATOM 8710 N N     . GLY J 6 72  ? 102.555 104.595 120.074 1.00 158.25 ? 71  GLY G N     1 
ATOM 8711 C CA    . GLY J 6 72  ? 101.451 103.660 120.132 1.00 158.25 ? 71  GLY G CA    1 
ATOM 8712 C C     . GLY J 6 72  ? 100.414 103.866 119.056 1.00 158.25 ? 71  GLY G C     1 
ATOM 8713 O O     . GLY J 6 72  ? 99.672  102.933 118.741 1.00 158.25 ? 71  GLY G O     1 
ATOM 8714 N N     . ASN J 6 73  ? 100.342 105.067 118.482 1.00 159.36 ? 72  ASN G N     1 
ATOM 8715 C CA    . ASN J 6 73  ? 99.479  105.251 117.326 1.00 159.36 ? 72  ASN G CA    1 
ATOM 8716 C C     . ASN J 6 73  ? 100.106 104.668 116.071 1.00 159.36 ? 72  ASN G C     1 
ATOM 8717 O O     . ASN J 6 73  ? 99.399  104.113 115.225 1.00 159.36 ? 72  ASN G O     1 
ATOM 8718 C CB    . ASN J 6 73  ? 99.176  106.733 117.122 1.00 159.36 ? 72  ASN G CB    1 
ATOM 8719 C CG    . ASN J 6 73  ? 98.064  107.222 118.019 1.00 159.36 ? 72  ASN G CG    1 
ATOM 8720 O OD1   . ASN J 6 73  ? 97.748  108.410 118.043 1.00 159.36 ? 72  ASN G OD1   1 
ATOM 8721 N ND2   . ASN J 6 73  ? 97.470  106.307 118.777 1.00 159.36 ? 72  ASN G ND2   1 
ATOM 8722 N N     . GLU J 6 74  ? 101.432 104.723 115.966 1.00 163.68 ? 73  GLU G N     1 
ATOM 8723 C CA    . GLU J 6 74  ? 102.108 104.225 114.780 1.00 163.68 ? 73  GLU G CA    1 
ATOM 8724 C C     . GLU J 6 74  ? 102.326 102.726 114.830 1.00 163.68 ? 73  GLU G C     1 
ATOM 8725 O O     . GLU J 6 74  ? 102.443 102.098 113.773 1.00 163.68 ? 73  GLU G O     1 
ATOM 8726 C CB    . GLU J 6 74  ? 103.439 104.944 114.588 1.00 163.68 ? 73  GLU G CB    1 
ATOM 8727 C CG    . GLU J 6 74  ? 103.284 106.425 114.322 1.00 163.68 ? 73  GLU G CG    1 
ATOM 8728 C CD    . GLU J 6 74  ? 102.636 106.713 112.989 1.00 163.68 ? 73  GLU G CD    1 
ATOM 8729 O OE1   . GLU J 6 74  ? 102.848 105.927 112.042 1.00 163.68 ? 73  GLU G OE1   1 
ATOM 8730 O OE2   . GLU J 6 74  ? 101.915 107.727 112.888 1.00 163.68 ? 73  GLU G OE2   1 
ATOM 8731 N N     . ALA J 6 75  ? 102.363 102.135 116.024 1.00 165.45 ? 74  ALA G N     1 
ATOM 8732 C CA    . ALA J 6 75  ? 102.506 100.690 116.089 1.00 165.45 ? 74  ALA G CA    1 
ATOM 8733 C C     . ALA J 6 75  ? 101.226 100.010 115.630 1.00 165.45 ? 74  ALA G C     1 
ATOM 8734 O O     . ALA J 6 75  ? 101.277 98.950  114.999 1.00 165.45 ? 74  ALA G O     1 
ATOM 8735 C CB    . ALA J 6 75  ? 102.866 100.252 117.506 1.00 165.45 ? 74  ALA G CB    1 
ATOM 8736 N N     . GLN J 6 76  ? 100.075 100.618 115.910 1.00 170.08 ? 75  GLN G N     1 
ATOM 8737 C CA    . GLN J 6 76  ? 98.808  100.072 115.457 1.00 170.08 ? 75  GLN G CA    1 
ATOM 8738 C C     . GLN J 6 76  ? 98.422  100.573 114.074 1.00 170.08 ? 75  GLN G C     1 
ATOM 8739 O O     . GLN J 6 76  ? 97.616  99.925  113.399 1.00 170.08 ? 75  GLN G O     1 
ATOM 8740 C CB    . GLN J 6 76  ? 97.694  100.423 116.440 1.00 170.08 ? 75  GLN G CB    1 
ATOM 8741 C CG    . GLN J 6 76  ? 97.507  101.912 116.629 1.00 170.08 ? 75  GLN G CG    1 
ATOM 8742 C CD    . GLN J 6 76  ? 96.668  102.241 117.841 1.00 170.08 ? 75  GLN G CD    1 
ATOM 8743 O OE1   . GLN J 6 76  ? 96.157  101.348 118.517 1.00 170.08 ? 75  GLN G OE1   1 
ATOM 8744 N NE2   . GLN J 6 76  ? 96.521  103.528 118.126 1.00 170.08 ? 75  GLN G NE2   1 
ATOM 8745 N N     . ASN J 6 77  ? 98.986  101.699 113.630 1.00 173.41 ? 76  ASN G N     1 
ATOM 8746 C CA    . ASN J 6 77  ? 98.767  102.122 112.253 1.00 173.41 ? 76  ASN G CA    1 
ATOM 8747 C C     . ASN J 6 77  ? 99.561  101.243 111.299 1.00 173.41 ? 76  ASN G C     1 
ATOM 8748 O O     . ASN J 6 77  ? 99.046  100.820 110.258 1.00 173.41 ? 76  ASN G O     1 
ATOM 8749 C CB    . ASN J 6 77  ? 99.156  103.592 112.091 1.00 173.41 ? 76  ASN G CB    1 
ATOM 8750 C CG    . ASN J 6 77  ? 98.873  104.127 110.698 1.00 173.41 ? 76  ASN G CG    1 
ATOM 8751 O OD1   . ASN J 6 77  ? 98.388  103.412 109.822 1.00 173.41 ? 76  ASN G OD1   1 
ATOM 8752 N ND2   . ASN J 6 77  ? 99.173  105.402 110.490 1.00 173.41 ? 76  ASN G ND2   1 
ATOM 8753 N N     . SER J 6 78  ? 100.813 100.948 111.647 1.00 170.97 ? 77  SER G N     1 
ATOM 8754 C CA    . SER J 6 78  ? 101.594 100.024 110.837 1.00 170.97 ? 77  SER G CA    1 
ATOM 8755 C C     . SER J 6 78  ? 101.101 98.599  111.031 1.00 170.97 ? 77  SER G C     1 
ATOM 8756 O O     . SER J 6 78  ? 101.045 97.818  110.075 1.00 170.97 ? 77  SER G O     1 
ATOM 8757 C CB    . SER J 6 78  ? 103.072 100.137 111.193 1.00 170.97 ? 77  SER G CB    1 
ATOM 8758 O OG    . SER J 6 78  ? 103.390 99.279  112.272 1.00 170.97 ? 77  SER G OG    1 
ATOM 8759 N N     . GLY J 6 79  ? 100.749 98.244  112.261 1.00 171.18 ? 78  GLY G N     1 
ATOM 8760 C CA    . GLY J 6 79  ? 100.333 96.894  112.573 1.00 171.18 ? 78  GLY G CA    1 
ATOM 8761 C C     . GLY J 6 79  ? 101.278 96.197  113.524 1.00 171.18 ? 78  GLY G C     1 
ATOM 8762 O O     . GLY J 6 79  ? 101.141 94.999  113.784 1.00 171.18 ? 78  GLY G O     1 
ATOM 8763 N N     . GLU J 6 80  ? 102.246 96.937  114.052 1.00 170.27 ? 79  GLU G N     1 
ATOM 8764 C CA    . GLU J 6 80  ? 103.179 96.347  114.995 1.00 170.27 ? 79  GLU G CA    1 
ATOM 8765 C C     . GLU J 6 80  ? 102.516 96.141  116.350 1.00 170.27 ? 79  GLU G C     1 
ATOM 8766 O O     . GLU J 6 80  ? 101.537 96.802  116.708 1.00 170.27 ? 79  GLU G O     1 
ATOM 8767 C CB    . GLU J 6 80  ? 104.422 97.216  115.133 1.00 170.27 ? 79  GLU G CB    1 
ATOM 8768 C CG    . GLU J 6 80  ? 105.238 97.241  113.868 1.00 170.27 ? 79  GLU G CG    1 
ATOM 8769 C CD    . GLU J 6 80  ? 105.879 95.902  113.589 1.00 170.27 ? 79  GLU G CD    1 
ATOM 8770 O OE1   . GLU J 6 80  ? 106.208 95.189  114.560 1.00 170.27 ? 79  GLU G OE1   1 
ATOM 8771 O OE2   . GLU J 6 80  ? 106.039 95.553  112.401 1.00 170.27 ? 79  GLU G OE2   1 
ATOM 8772 N N     . ARG J 6 81  ? 103.063 95.194  117.109 1.00 169.05 ? 80  ARG G N     1 
ATOM 8773 C CA    . ARG J 6 81  ? 102.555 94.906  118.444 1.00 169.05 ? 80  ARG G CA    1 
ATOM 8774 C C     . ARG J 6 81  ? 103.313 95.676  119.523 1.00 169.05 ? 80  ARG G C     1 
ATOM 8775 O O     . ARG J 6 81  ? 102.719 96.468  120.260 1.00 169.05 ? 80  ARG G O     1 
ATOM 8776 C CB    . ARG J 6 81  ? 102.637 93.402  118.711 1.00 169.05 ? 80  ARG G CB    1 
ATOM 8777 C CG    . ARG J 6 81  ? 102.032 92.978  120.029 1.00 169.05 ? 80  ARG G CG    1 
ATOM 8778 C CD    . ARG J 6 81  ? 102.076 91.471  120.167 1.00 169.05 ? 80  ARG G CD    1 
ATOM 8779 N NE    . ARG J 6 81  ? 101.551 91.022  121.450 1.00 169.05 ? 80  ARG G NE    1 
ATOM 8780 C CZ    . ARG J 6 81  ? 100.266 90.770  121.677 1.00 169.05 ? 80  ARG G CZ    1 
ATOM 8781 N NH1   . ARG J 6 81  ? 99.378  90.924  120.705 1.00 169.05 ? 80  ARG G NH1   1 
ATOM 8782 N NH2   . ARG J 6 81  ? 99.869  90.361  122.874 1.00 169.05 ? 80  ARG G NH2   1 
ATOM 8783 N N     . ASN J 6 82  ? 104.619 95.453  119.625 1.00 163.78 ? 81  ASN G N     1 
ATOM 8784 C CA    . ASN J 6 82  ? 105.451 96.179  120.572 1.00 163.78 ? 81  ASN G CA    1 
ATOM 8785 C C     . ASN J 6 82  ? 105.871 97.527  119.996 1.00 163.78 ? 81  ASN G C     1 
ATOM 8786 O O     . ASN J 6 82  ? 105.463 97.924  118.901 1.00 163.78 ? 81  ASN G O     1 
ATOM 8787 C CB    . ASN J 6 82  ? 106.667 95.345  120.957 1.00 163.78 ? 81  ASN G CB    1 
ATOM 8788 C CG    . ASN J 6 82  ? 106.314 94.217  121.892 1.00 163.78 ? 81  ASN G CG    1 
ATOM 8789 O OD1   . ASN J 6 82  ? 105.521 94.392  122.818 1.00 163.78 ? 81  ASN G OD1   1 
ATOM 8790 N ND2   . ASN J 6 82  ? 106.889 93.047  121.654 1.00 163.78 ? 81  ASN G ND2   1 
ATOM 8791 N N     . ILE J 6 83  ? 106.694 98.249  120.753 1.00 152.47 ? 82  ILE G N     1 
ATOM 8792 C CA    . ILE J 6 83  ? 107.312 99.483  120.283 1.00 152.47 ? 82  ILE G CA    1 
ATOM 8793 C C     . ILE J 6 83  ? 108.818 99.278  120.213 1.00 152.47 ? 82  ILE G C     1 
ATOM 8794 O O     . ILE J 6 83  ? 109.483 99.121  121.244 1.00 152.47 ? 82  ILE G O     1 
ATOM 8795 C CB    . ILE J 6 83  ? 106.955 100.676 121.178 1.00 152.47 ? 82  ILE G CB    1 
ATOM 8796 C CG1   . ILE J 6 83  ? 105.462 100.977 121.074 1.00 152.47 ? 82  ILE G CG1   1 
ATOM 8797 C CG2   . ILE J 6 83  ? 107.758 101.887 120.783 1.00 152.47 ? 82  ILE G CG2   1 
ATOM 8798 C CD1   . ILE J 6 83  ? 104.983 102.013 122.050 1.00 152.47 ? 82  ILE G CD1   1 
ATOM 8799 N N     . THR J 6 84  ? 109.352 99.268  118.995 1.00 150.79 ? 83  THR G N     1 
ATOM 8800 C CA    . THR J 6 84  ? 110.762 99.127  118.676 1.00 150.79 ? 83  THR G CA    1 
ATOM 8801 C C     . THR J 6 84  ? 111.410 100.497 118.550 1.00 150.79 ? 83  THR G C     1 
ATOM 8802 O O     . THR J 6 84  ? 110.724 101.500 118.336 1.00 150.79 ? 83  THR G O     1 
ATOM 8803 C CB    . THR J 6 84  ? 110.924 98.345  117.374 1.00 150.79 ? 83  THR G CB    1 
ATOM 8804 O OG1   . THR J 6 84  ? 112.313 98.151  117.085 1.00 150.79 ? 83  THR G OG1   1 
ATOM 8805 C CG2   . THR J 6 84  ? 110.290 99.101  116.224 1.00 150.79 ? 83  THR G CG2   1 
ATOM 8806 N N     . PRO J 6 85  ? 112.742 100.578 118.641 1.00 143.27 ? 84  PRO G N     1 
ATOM 8807 C CA    . PRO J 6 85  ? 113.406 101.860 118.366 1.00 143.27 ? 84  PRO G CA    1 
ATOM 8808 C C     . PRO J 6 85  ? 113.266 102.325 116.930 1.00 143.27 ? 84  PRO G C     1 
ATOM 8809 O O     . PRO J 6 85  ? 113.420 103.526 116.671 1.00 143.27 ? 84  PRO G O     1 
ATOM 8810 C CB    . PRO J 6 85  ? 114.871 101.573 118.714 1.00 143.27 ? 84  PRO G CB    1 
ATOM 8811 C CG    . PRO J 6 85  ? 114.793 100.507 119.736 1.00 143.27 ? 84  PRO G CG    1 
ATOM 8812 C CD    . PRO J 6 85  ? 113.641 99.639  119.332 1.00 143.27 ? 84  PRO G CD    1 
ATOM 8813 N N     . LEU J 6 86  ? 112.942 101.436 115.994 1.00 142.76 ? 85  LEU G N     1 
ATOM 8814 C CA    . LEU J 6 86  ? 112.681 101.910 114.644 1.00 142.76 ? 85  LEU G CA    1 
ATOM 8815 C C     . LEU J 6 86  ? 111.403 102.726 114.604 1.00 142.76 ? 85  LEU G C     1 
ATOM 8816 O O     . LEU J 6 86  ? 111.306 103.696 113.842 1.00 142.76 ? 85  LEU G O     1 
ATOM 8817 C CB    . LEU J 6 86  ? 112.589 100.733 113.678 1.00 142.76 ? 85  LEU G CB    1 
ATOM 8818 C CG    . LEU J 6 86  ? 112.450 101.114 112.208 1.00 142.76 ? 85  LEU G CG    1 
ATOM 8819 C CD1   . LEU J 6 86  ? 113.678 101.869 111.733 1.00 142.76 ? 85  LEU G CD1   1 
ATOM 8820 C CD2   . LEU J 6 86  ? 112.207 99.881  111.356 1.00 142.76 ? 85  LEU G CD2   1 
ATOM 8821 N N     . LEU J 6 87  ? 110.459 102.422 115.494 1.00 148.79 ? 86  LEU G N     1 
ATOM 8822 C CA    . LEU J 6 87  ? 109.238 103.209 115.541 1.00 148.79 ? 86  LEU G CA    1 
ATOM 8823 C C     . LEU J 6 87  ? 109.530 104.583 116.112 1.00 148.79 ? 86  LEU G C     1 
ATOM 8824 O O     . LEU J 6 87  ? 109.007 105.590 115.623 1.00 148.79 ? 86  LEU G O     1 
ATOM 8825 C CB    . LEU J 6 87  ? 108.184 102.498 116.384 1.00 148.79 ? 86  LEU G CB    1 
ATOM 8826 C CG    . LEU J 6 87  ? 107.524 101.238 115.828 1.00 148.79 ? 86  LEU G CG    1 
ATOM 8827 C CD1   . LEU J 6 87  ? 106.669 100.571 116.888 1.00 148.79 ? 86  LEU G CD1   1 
ATOM 8828 C CD2   . LEU J 6 87  ? 106.691 101.561 114.611 1.00 148.79 ? 86  LEU G CD2   1 
ATOM 8829 N N     . LEU J 6 88  ? 110.434 104.652 117.090 1.00 148.88 ? 87  LEU G N     1 
ATOM 8830 C CA    . LEU J 6 88  ? 110.776 105.940 117.674 1.00 148.88 ? 87  LEU G CA    1 
ATOM 8831 C C     . LEU J 6 88  ? 111.526 106.799 116.674 1.00 148.88 ? 87  LEU G C     1 
ATOM 8832 O O     . LEU J 6 88  ? 111.255 108.000 116.543 1.00 148.88 ? 87  LEU G O     1 
ATOM 8833 C CB    . LEU J 6 88  ? 111.629 105.743 118.923 1.00 148.88 ? 87  LEU G CB    1 
ATOM 8834 C CG    . LEU J 6 88  ? 110.947 105.430 120.249 1.00 148.88 ? 87  LEU G CG    1 
ATOM 8835 C CD1   . LEU J 6 88  ? 110.554 103.982 120.298 1.00 148.88 ? 87  LEU G CD1   1 
ATOM 8836 C CD2   . LEU J 6 88  ? 111.885 105.754 121.388 1.00 148.88 ? 87  LEU G CD2   1 
ATOM 8837 N N     . ASP J 6 89  ? 112.442 106.191 115.924 1.00 147.27 ? 88  ASP G N     1 
ATOM 8838 C CA    . ASP J 6 89  ? 113.190 106.969 114.951 1.00 147.27 ? 88  ASP G CA    1 
ATOM 8839 C C     . ASP J 6 89  ? 112.298 107.427 113.810 1.00 147.27 ? 88  ASP G C     1 
ATOM 8840 O O     . ASP J 6 89  ? 112.472 108.536 113.292 1.00 147.27 ? 88  ASP G O     1 
ATOM 8841 C CB    . ASP J 6 89  ? 114.363 106.156 114.419 1.00 147.27 ? 88  ASP G CB    1 
ATOM 8842 C CG    . ASP J 6 89  ? 115.408 107.023 113.749 1.00 147.27 ? 88  ASP G CG    1 
ATOM 8843 O OD1   . ASP J 6 89  ? 115.234 108.259 113.735 1.00 147.27 ? 88  ASP G OD1   1 
ATOM 8844 O OD2   . ASP J 6 89  ? 116.399 106.469 113.232 1.00 147.27 ? 88  ASP G OD2   1 
ATOM 8845 N N     . MET J 6 90  ? 111.324 106.608 113.408 1.00 147.22 ? 89  MET G N     1 
ATOM 8846 C CA    . MET J 6 90  ? 110.450 107.069 112.340 1.00 147.22 ? 89  MET G CA    1 
ATOM 8847 C C     . MET J 6 90  ? 109.494 108.147 112.828 1.00 147.22 ? 89  MET G C     1 
ATOM 8848 O O     . MET J 6 90  ? 109.154 109.056 112.064 1.00 147.22 ? 89  MET G O     1 
ATOM 8849 C CB    . MET J 6 90  ? 109.684 105.904 111.715 1.00 147.22 ? 89  MET G CB    1 
ATOM 8850 C CG    . MET J 6 90  ? 108.577 105.318 112.554 1.00 147.22 ? 89  MET G CG    1 
ATOM 8851 S SD    . MET J 6 90  ? 107.708 104.046 111.625 1.00 147.22 ? 89  MET G SD    1 
ATOM 8852 C CE    . MET J 6 90  ? 106.078 104.155 112.348 1.00 147.22 ? 89  MET G CE    1 
ATOM 8853 N N     . VAL J 6 91  ? 109.061 108.092 114.089 1.00 145.24 ? 90  VAL G N     1 
ATOM 8854 C CA    . VAL J 6 91  ? 108.087 109.080 114.539 1.00 145.24 ? 90  VAL G CA    1 
ATOM 8855 C C     . VAL J 6 91  ? 108.761 110.415 114.819 1.00 145.24 ? 90  VAL G C     1 
ATOM 8856 O O     . VAL J 6 91  ? 108.307 111.460 114.342 1.00 145.24 ? 90  VAL G O     1 
ATOM 8857 C CB    . VAL J 6 91  ? 107.290 108.576 115.758 1.00 145.24 ? 90  VAL G CB    1 
ATOM 8858 C CG1   . VAL J 6 91  ? 106.456 107.378 115.378 1.00 145.24 ? 90  VAL G CG1   1 
ATOM 8859 C CG2   . VAL J 6 91  ? 108.185 108.259 116.935 1.00 145.24 ? 90  VAL G CG2   1 
ATOM 8860 N N     . VAL J 6 92  ? 109.857 110.413 115.582 1.00 145.15 ? 91  VAL G N     1 
ATOM 8861 C CA    . VAL J 6 92  ? 110.339 111.682 116.110 1.00 145.15 ? 91  VAL G CA    1 
ATOM 8862 C C     . VAL J 6 92  ? 110.979 112.531 115.025 1.00 145.15 ? 91  VAL G C     1 
ATOM 8863 O O     . VAL J 6 92  ? 111.124 113.745 115.201 1.00 145.15 ? 91  VAL G O     1 
ATOM 8864 C CB    . VAL J 6 92  ? 111.334 111.466 117.262 1.00 145.15 ? 91  VAL G CB    1 
ATOM 8865 C CG1   . VAL J 6 92  ? 110.707 110.611 118.344 1.00 145.15 ? 91  VAL G CG1   1 
ATOM 8866 C CG2   . VAL J 6 92  ? 112.614 110.852 116.744 1.00 145.15 ? 91  VAL G CG2   1 
ATOM 8867 N N     . HIS J 6 93  ? 111.363 111.931 113.904 1.00 141.34 ? 92  HIS G N     1 
ATOM 8868 C CA    . HIS J 6 93  ? 111.879 112.697 112.784 1.00 141.34 ? 92  HIS G CA    1 
ATOM 8869 C C     . HIS J 6 93  ? 110.811 112.990 111.747 1.00 141.34 ? 92  HIS G C     1 
ATOM 8870 O O     . HIS J 6 93  ? 111.011 113.862 110.897 1.00 141.34 ? 92  HIS G O     1 
ATOM 8871 C CB    . HIS J 6 93  ? 113.053 111.958 112.143 1.00 141.34 ? 92  HIS G CB    1 
ATOM 8872 C CG    . HIS J 6 93  ? 114.277 111.935 113.004 1.00 141.34 ? 92  HIS G CG    1 
ATOM 8873 N ND1   . HIS J 6 93  ? 114.518 110.940 113.925 1.00 141.34 ? 92  HIS G ND1   1 
ATOM 8874 C CD2   . HIS J 6 93  ? 115.320 112.791 113.091 1.00 141.34 ? 92  HIS G CD2   1 
ATOM 8875 C CE1   . HIS J 6 93  ? 115.662 111.182 114.541 1.00 141.34 ? 92  HIS G CE1   1 
ATOM 8876 N NE2   . HIS J 6 93  ? 116.170 112.299 114.051 1.00 141.34 ? 92  HIS G NE2   1 
ATOM 8877 N N     . ASN J 6 94  ? 109.689 112.291 111.806 1.00 144.52 ? 93  ASN G N     1 
ATOM 8878 C CA    . ASN J 6 94  ? 108.462 112.725 111.169 1.00 144.52 ? 93  ASN G CA    1 
ATOM 8879 C C     . ASN J 6 94  ? 107.702 113.578 112.178 1.00 144.52 ? 93  ASN G C     1 
ATOM 8880 O O     . ASN J 6 94  ? 108.259 114.002 113.194 1.00 144.52 ? 93  ASN G O     1 
ATOM 8881 C CB    . ASN J 6 94  ? 107.653 111.521 110.699 1.00 144.52 ? 93  ASN G CB    1 
ATOM 8882 C CG    . ASN J 6 94  ? 108.401 110.684 109.685 1.00 144.52 ? 93  ASN G CG    1 
ATOM 8883 O OD1   . ASN J 6 94  ? 109.114 111.214 108.833 1.00 144.52 ? 93  ASN G OD1   1 
ATOM 8884 N ND2   . ASN J 6 94  ? 108.251 109.369 109.776 1.00 144.52 ? 93  ASN G ND2   1 
ATOM 8885 N N     . ASP J 6 95  ? 106.423 113.843 111.911 1.00 147.53 ? 94  ASP G N     1 
ATOM 8886 C CA    . ASP J 6 95  ? 105.545 114.477 112.891 1.00 147.53 ? 94  ASP G CA    1 
ATOM 8887 C C     . ASP J 6 95  ? 106.071 115.858 113.289 1.00 147.53 ? 94  ASP G C     1 
ATOM 8888 O O     . ASP J 6 95  ? 106.572 116.077 114.392 1.00 147.53 ? 94  ASP G O     1 
ATOM 8889 C CB    . ASP J 6 95  ? 105.364 113.594 114.129 1.00 147.53 ? 94  ASP G CB    1 
ATOM 8890 C CG    . ASP J 6 95  ? 104.315 114.135 115.071 1.00 147.53 ? 94  ASP G CG    1 
ATOM 8891 O OD1   . ASP J 6 95  ? 103.114 113.982 114.772 1.00 147.53 ? 94  ASP G OD1   1 
ATOM 8892 O OD2   . ASP J 6 95  ? 104.691 114.727 116.104 1.00 147.53 ? 94  ASP G OD2   1 
ATOM 8893 N N     . ARG J 6 96  ? 105.943 116.787 112.344 1.00 148.67 ? 95  ARG G N     1 
ATOM 8894 C CA    . ARG J 6 96  ? 106.526 118.114 112.488 1.00 148.67 ? 95  ARG G CA    1 
ATOM 8895 C C     . ARG J 6 96  ? 106.097 118.782 113.788 1.00 148.67 ? 95  ARG G C     1 
ATOM 8896 O O     . ARG J 6 96  ? 106.632 119.830 114.156 1.00 148.67 ? 95  ARG G O     1 
ATOM 8897 C CB    . ARG J 6 96  ? 106.108 119.006 111.322 1.00 148.67 ? 95  ARG G CB    1 
ATOM 8898 C CG    . ARG J 6 96  ? 104.639 119.372 111.378 1.00 148.67 ? 95  ARG G CG    1 
ATOM 8899 C CD    . ARG J 6 96  ? 104.208 120.146 110.152 1.00 148.67 ? 95  ARG G CD    1 
ATOM 8900 N NE    . ARG J 6 96  ? 102.821 120.585 110.261 1.00 148.67 ? 95  ARG G NE    1 
ATOM 8901 C CZ    . ARG J 6 96  ? 101.774 119.843 109.920 1.00 148.67 ? 95  ARG G CZ    1 
ATOM 8902 N NH1   . ARG J 6 96  ? 100.546 120.326 110.056 1.00 148.67 ? 95  ARG G NH1   1 
ATOM 8903 N NH2   . ARG J 6 96  ? 101.955 118.619 109.443 1.00 148.67 ? 95  ARG G NH2   1 
ATOM 8904 N N     . LEU J 6 97  ? 105.134 118.178 114.486 1.00 143.54 ? 96  LEU G N     1 
ATOM 8905 C CA    . LEU J 6 97  ? 104.764 118.661 115.808 1.00 143.54 ? 96  LEU G CA    1 
ATOM 8906 C C     . LEU J 6 97  ? 105.960 118.630 116.749 1.00 143.54 ? 96  LEU G C     1 
ATOM 8907 O O     . LEU J 6 97  ? 106.249 119.615 117.432 1.00 143.54 ? 96  LEU G O     1 
ATOM 8908 C CB    . LEU J 6 97  ? 103.613 117.821 116.353 1.00 143.54 ? 96  LEU G CB    1 
ATOM 8909 C CG    . LEU J 6 97  ? 102.933 118.304 117.635 1.00 143.54 ? 96  LEU G CG    1 
ATOM 8910 C CD1   . LEU J 6 97  ? 101.443 118.027 117.581 1.00 143.54 ? 96  LEU G CD1   1 
ATOM 8911 C CD2   . LEU J 6 97  ? 103.557 117.604 118.826 1.00 143.54 ? 96  LEU G CD2   1 
ATOM 8912 N N     . LEU J 6 98  ? 106.688 117.514 116.779 1.00 141.38 ? 97  LEU G N     1 
ATOM 8913 C CA    . LEU J 6 98  ? 107.843 117.384 117.658 1.00 141.38 ? 97  LEU G CA    1 
ATOM 8914 C C     . LEU J 6 98  ? 109.106 117.026 116.890 1.00 141.38 ? 97  LEU G C     1 
ATOM 8915 O O     . LEU J 6 98  ? 110.108 116.644 117.497 1.00 141.38 ? 97  LEU G O     1 
ATOM 8916 C CB    . LEU J 6 98  ? 107.573 116.360 118.758 1.00 141.38 ? 97  LEU G CB    1 
ATOM 8917 C CG    . LEU J 6 98  ? 107.180 114.945 118.342 1.00 141.38 ? 97  LEU G CG    1 
ATOM 8918 C CD1   . LEU J 6 98  ? 108.403 114.057 118.186 1.00 141.38 ? 97  LEU G CD1   1 
ATOM 8919 C CD2   . LEU J 6 98  ? 106.218 114.369 119.356 1.00 141.38 ? 97  LEU G CD2   1 
ATOM 8920 N N     . SER J 6 99  ? 109.096 117.177 115.569 1.00 143.76 ? 98  SER G N     1 
ATOM 8921 C CA    . SER J 6 99  ? 110.318 116.934 114.814 1.00 143.76 ? 98  SER G CA    1 
ATOM 8922 C C     . SER J 6 99  ? 111.320 118.044 115.025 1.00 143.76 ? 98  SER G C     1 
ATOM 8923 O O     . SER J 6 99  ? 112.513 117.846 114.804 1.00 143.76 ? 98  SER G O     1 
ATOM 8924 C CB    . SER J 6 99  ? 110.014 116.811 113.328 1.00 143.76 ? 98  SER G CB    1 
ATOM 8925 O OG    . SER J 6 99  ? 109.553 118.053 112.827 1.00 143.76 ? 98  SER G OG    1 
ATOM 8926 N N     . THR J 6 100 ? 110.862 119.185 115.510 1.00 141.65 ? 99  THR G N     1 
ATOM 8927 C CA    . THR J 6 100 ? 111.752 120.291 115.814 1.00 141.65 ? 99  THR G CA    1 
ATOM 8928 C C     . THR J 6 100 ? 112.544 120.021 117.078 1.00 141.65 ? 99  THR G C     1 
ATOM 8929 O O     . THR J 6 100 ? 113.682 120.475 117.210 1.00 141.65 ? 99  THR G O     1 
ATOM 8930 C CB    . THR J 6 100 ? 110.950 121.578 115.950 1.00 141.65 ? 99  THR G CB    1 
ATOM 8931 O OG1   . THR J 6 100 ? 111.807 122.625 116.422 1.00 141.65 ? 99  THR G OG1   1 
ATOM 8932 C CG2   . THR J 6 100 ? 109.785 121.377 116.907 1.00 141.65 ? 99  THR G CG2   1 
ATOM 8933 N N     . LEU J 6 101 ? 111.973 119.263 118.004 1.00 143.19 ? 100 LEU G N     1 
ATOM 8934 C CA    . LEU J 6 101 ? 112.703 118.920 119.210 1.00 143.19 ? 100 LEU G CA    1 
ATOM 8935 C C     . LEU J 6 101 ? 113.836 117.957 118.914 1.00 143.19 ? 100 LEU G C     1 
ATOM 8936 O O     . LEU J 6 101 ? 114.819 117.923 119.659 1.00 143.19 ? 100 LEU G O     1 
ATOM 8937 C CB    . LEU J 6 101 ? 111.754 118.313 120.238 1.00 143.19 ? 100 LEU G CB    1 
ATOM 8938 C CG    . LEU J 6 101 ? 112.363 117.993 121.597 1.00 143.19 ? 100 LEU G CG    1 
ATOM 8939 C CD1   . LEU J 6 101 ? 112.872 119.241 122.283 1.00 143.19 ? 100 LEU G CD1   1 
ATOM 8940 C CD2   . LEU J 6 101 ? 111.325 117.299 122.438 1.00 143.19 ? 100 LEU G CD2   1 
ATOM 8941 N N     . PHE J 6 102 ? 113.730 117.193 117.837 1.00 142.82 ? 101 PHE G N     1 
ATOM 8942 C CA    . PHE J 6 102 ? 114.712 116.182 117.491 1.00 142.82 ? 101 PHE G CA    1 
ATOM 8943 C C     . PHE J 6 102 ? 115.379 116.517 116.172 1.00 142.82 ? 101 PHE G C     1 
ATOM 8944 O O     . PHE J 6 102 ? 115.614 115.644 115.336 1.00 142.82 ? 101 PHE G O     1 
ATOM 8945 C CB    . PHE J 6 102 ? 114.080 114.803 117.414 1.00 142.82 ? 101 PHE G CB    1 
ATOM 8946 C CG    . PHE J 6 102 ? 113.585 114.304 118.721 1.00 142.82 ? 101 PHE G CG    1 
ATOM 8947 C CD1   . PHE J 6 102 ? 114.445 113.704 119.614 1.00 142.82 ? 101 PHE G CD1   1 
ATOM 8948 C CD2   . PHE J 6 102 ? 112.257 114.438 119.061 1.00 142.82 ? 101 PHE G CD2   1 
ATOM 8949 C CE1   . PHE J 6 102 ? 113.987 113.246 120.824 1.00 142.82 ? 101 PHE G CE1   1 
ATOM 8950 C CE2   . PHE J 6 102 ? 111.793 113.982 120.267 1.00 142.82 ? 101 PHE G CE2   1 
ATOM 8951 C CZ    . PHE J 6 102 ? 112.657 113.384 121.149 1.00 142.82 ? 101 PHE G CZ    1 
ATOM 8952 N N     . ASN J 6 103 ? 115.724 117.786 115.973 1.00 138.17 ? 102 ASN G N     1 
ATOM 8953 C CA    . ASN J 6 103 ? 116.476 118.123 114.772 1.00 138.17 ? 102 ASN G CA    1 
ATOM 8954 C C     . ASN J 6 103 ? 117.888 117.570 114.854 1.00 138.17 ? 102 ASN G C     1 
ATOM 8955 O O     . ASN J 6 103 ? 118.478 117.215 113.832 1.00 138.17 ? 102 ASN G O     1 
ATOM 8956 C CB    . ASN J 6 103 ? 116.502 119.639 114.544 1.00 138.17 ? 102 ASN G CB    1 
ATOM 8957 C CG    . ASN J 6 103 ? 115.192 120.171 113.996 1.00 138.17 ? 102 ASN G CG    1 
ATOM 8958 O OD1   . ASN J 6 103 ? 114.517 120.977 114.635 1.00 138.17 ? 102 ASN G OD1   1 
ATOM 8959 N ND2   . ASN J 6 103 ? 114.824 119.715 112.806 1.00 138.17 ? 102 ASN G ND2   1 
ATOM 8960 N N     . THR J 6 104 ? 118.466 117.556 116.044 1.00 131.89 ? 103 THR G N     1 
ATOM 8961 C CA    . THR J 6 104 ? 119.868 117.228 116.232 1.00 131.89 ? 103 THR G CA    1 
ATOM 8962 C C     . THR J 6 104 ? 120.061 115.976 117.077 1.00 131.89 ? 103 THR G C     1 
ATOM 8963 O O     . THR J 6 104 ? 121.104 115.797 117.707 1.00 131.89 ? 103 THR G O     1 
ATOM 8964 C CB    . THR J 6 104 ? 120.605 118.413 116.828 1.00 131.89 ? 103 THR G CB    1 
ATOM 8965 O OG1   . THR J 6 104 ? 120.018 118.778 118.077 1.00 131.89 ? 103 THR G OG1   1 
ATOM 8966 C CG2   . THR J 6 104 ? 120.574 119.572 115.852 1.00 131.89 ? 103 THR G CG2   1 
ATOM 8967 N N     . THR J 6 105 ? 119.086 115.086 117.080 1.00 133.34 ? 104 THR G N     1 
ATOM 8968 C CA    . THR J 6 105 ? 119.202 113.848 117.823 1.00 133.34 ? 104 THR G CA    1 
ATOM 8969 C C     . THR J 6 105 ? 119.367 112.687 116.854 1.00 133.34 ? 104 THR G C     1 
ATOM 8970 O O     . THR J 6 105 ? 119.068 112.799 115.664 1.00 133.34 ? 104 THR G O     1 
ATOM 8971 C CB    . THR J 6 105 ? 117.970 113.651 118.707 1.00 133.34 ? 104 THR G CB    1 
ATOM 8972 O OG1   . THR J 6 105 ? 117.524 114.928 119.194 1.00 133.34 ? 104 THR G OG1   1 
ATOM 8973 C CG2   . THR J 6 105 ? 118.286 112.741 119.861 1.00 133.34 ? 104 THR G CG2   1 
ATOM 8974 N N     . THR J 6 106 ? 119.899 111.582 117.365 1.00 129.90 ? 105 THR G N     1 
ATOM 8975 C CA    . THR J 6 106 ? 120.130 110.381 116.572 1.00 129.90 ? 105 THR G CA    1 
ATOM 8976 C C     . THR J 6 106 ? 119.816 109.186 117.454 1.00 129.90 ? 105 THR G C     1 
ATOM 8977 O O     . THR J 6 106 ? 120.562 108.894 118.389 1.00 129.90 ? 105 THR G O     1 
ATOM 8978 C CB    . THR J 6 106 ? 121.568 110.288 116.058 1.00 129.90 ? 105 THR G CB    1 
ATOM 8979 O OG1   . THR J 6 106 ? 122.468 110.187 117.163 1.00 129.90 ? 105 THR G OG1   1 
ATOM 8980 C CG2   . THR J 6 106 ? 121.944 111.472 115.180 1.00 129.90 ? 105 THR G CG2   1 
ATOM 8981 N N     . ILE J 6 107 ? 118.732 108.491 117.151 1.00 132.74 ? 106 ILE G N     1 
ATOM 8982 C CA    . ILE J 6 107 ? 118.416 107.252 117.846 1.00 132.74 ? 106 ILE G CA    1 
ATOM 8983 C C     . ILE J 6 107 ? 119.334 106.170 117.306 1.00 132.74 ? 106 ILE G C     1 
ATOM 8984 O O     . ILE J 6 107 ? 119.470 106.005 116.091 1.00 132.74 ? 106 ILE G O     1 
ATOM 8985 C CB    . ILE J 6 107 ? 116.942 106.859 117.682 1.00 132.74 ? 106 ILE G CB    1 
ATOM 8986 C CG1   . ILE J 6 107 ? 116.040 107.778 118.502 1.00 132.74 ? 106 ILE G CG1   1 
ATOM 8987 C CG2   . ILE J 6 107 ? 116.740 105.449 118.176 1.00 132.74 ? 106 ILE G CG2   1 
ATOM 8988 C CD1   . ILE J 6 107 ? 115.523 108.949 117.744 1.00 132.74 ? 106 ILE G CD1   1 
ATOM 8989 N N     . SER J 6 108 ? 119.944 105.410 118.208 1.00 130.97 ? 107 SER G N     1 
ATOM 8990 C CA    . SER J 6 108 ? 121.103 104.602 117.852 1.00 130.97 ? 107 SER G CA    1 
ATOM 8991 C C     . SER J 6 108 ? 120.709 103.375 117.030 1.00 130.97 ? 107 SER G C     1 
ATOM 8992 O O     . SER J 6 108 ? 121.464 102.954 116.147 1.00 130.97 ? 107 SER G O     1 
ATOM 8993 C CB    . SER J 6 108 ? 121.862 104.206 119.122 1.00 130.97 ? 107 SER G CB    1 
ATOM 8994 O OG    . SER J 6 108 ? 121.202 103.168 119.821 1.00 130.97 ? 107 SER G OG    1 
ATOM 8995 N N     . GLN J 6 109 ? 119.548 102.780 117.309 1.00 132.81 ? 108 GLN G N     1 
ATOM 8996 C CA    . GLN J 6 109 ? 119.041 101.615 116.579 1.00 132.81 ? 108 GLN G CA    1 
ATOM 8997 C C     . GLN J 6 109 ? 119.939 100.387 116.702 1.00 132.81 ? 108 GLN G C     1 
ATOM 8998 O O     . GLN J 6 109 ? 119.817 99.446  115.910 1.00 132.81 ? 108 GLN G O     1 
ATOM 8999 C CB    . GLN J 6 109 ? 118.759 101.927 115.102 1.00 132.81 ? 108 GLN G CB    1 
ATOM 9000 C CG    . GLN J 6 109 ? 117.653 102.958 114.894 1.00 132.81 ? 108 GLN G CG    1 
ATOM 9001 C CD    . GLN J 6 109 ? 117.397 103.272 113.432 1.00 132.81 ? 108 GLN G CD    1 
ATOM 9002 O OE1   . GLN J 6 109 ? 118.062 102.744 112.543 1.00 132.81 ? 108 GLN G OE1   1 
ATOM 9003 N NE2   . GLN J 6 109 ? 116.396 104.102 113.175 1.00 132.81 ? 108 GLN G NE2   1 
ATOM 9004 N N     . VAL J 6 110 ? 120.854 100.374 117.665 1.00 127.18 ? 109 VAL G N     1 
ATOM 9005 C CA    . VAL J 6 110 ? 121.639 99.170  117.911 1.00 127.18 ? 109 VAL G CA    1 
ATOM 9006 C C     . VAL J 6 110 ? 121.640 98.900  119.411 1.00 127.18 ? 109 VAL G C     1 
ATOM 9007 O O     . VAL J 6 110 ? 121.743 99.827  120.214 1.00 127.18 ? 109 VAL G O     1 
ATOM 9008 C CB    . VAL J 6 110 ? 123.081 99.295  117.390 1.00 127.18 ? 109 VAL G CB    1 
ATOM 9009 C CG1   . VAL J 6 110 ? 123.446 100.751 117.189 1.00 127.18 ? 109 VAL G CG1   1 
ATOM 9010 C CG2   . VAL J 6 110 ? 124.045 98.588  118.313 1.00 127.18 ? 109 VAL G CG2   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   ?   ?   ?   I . n 
A 1 2   DT  2   2   ?   ?   ?   I . n 
A 1 3   DC  3   3   ?   ?   ?   I . n 
A 1 4   DG  4   4   ?   ?   ?   I . n 
A 1 5   DG  5   5   ?   ?   ?   I . n 
A 1 6   DA  6   6   ?   ?   ?   I . n 
A 1 7   DT  7   7   ?   ?   ?   I . n 
A 1 8   DG  8   8   ?   ?   ?   I . n 
A 1 9   DT  9   9   ?   ?   ?   I . n 
A 1 10  DA  10  10  ?   ?   ?   I . n 
A 1 11  DT  11  11  ?   ?   ?   I . n 
A 1 12  DA  12  12  ?   ?   ?   I . n 
A 1 13  DT  13  13  ?   ?   ?   I . n 
A 1 14  DA  14  14  ?   ?   ?   I . n 
A 1 15  DT  15  15  ?   ?   ?   I . n 
A 1 16  DC  16  16  ?   ?   ?   I . n 
A 1 17  DT  17  17  ?   ?   ?   I . n 
A 1 18  DG  18  18  ?   ?   ?   I . n 
A 1 19  DA  19  19  ?   ?   ?   I . n 
A 1 20  DC  20  20  ?   ?   ?   I . n 
A 1 21  DA  21  21  ?   ?   ?   I . n 
A 1 22  DC  22  22  ?   ?   ?   I . n 
A 1 23  DG  23  23  ?   ?   ?   I . n 
A 1 24  DT  24  24  ?   ?   ?   I . n 
A 1 25  DG  25  25  ?   ?   ?   I . n 
A 1 26  DC  26  26  ?   ?   ?   I . n 
A 1 27  DC  27  27  ?   ?   ?   I . n 
A 1 28  DT  28  28  28  DT  DT  I . n 
A 1 29  DG  29  29  29  DG  DG  I . n 
A 1 30  DG  30  30  30  DG  DG  I . n 
A 1 31  DA  31  31  31  DA  DA  I . n 
A 1 32  DG  32  32  32  DG  DG  I . n 
A 1 33  DA  33  33  33  DA  DA  I . n 
A 1 34  DC  34  34  34  DC  DC  I . n 
A 1 35  DT  35  35  35  DT  DT  I . n 
A 1 36  DA  36  36  36  DA  DA  I . n 
A 1 37  DG  37  37  37  DG  DG  I . n 
A 1 38  DG  38  38  38  DG  DG  I . n 
A 1 39  DG  39  39  39  DG  DG  I . n 
A 1 40  DA  40  40  40  DA  DA  I . n 
A 1 41  DG  41  41  41  DG  DG  I . n 
A 1 42  DT  42  42  42  DT  DT  I . n 
A 1 43  DA  43  43  43  DA  DA  I . n 
A 1 44  DA  44  44  44  DA  DA  I . n 
A 1 45  DT  45  45  45  DT  DT  I . n 
A 1 46  DC  46  46  46  DC  DC  I . n 
A 1 47  DC  47  47  47  DC  DC  I . n 
A 1 48  DC  48  48  48  DC  DC  I . n 
A 1 49  DC  49  49  49  DC  DC  I . n 
A 1 50  DT  50  50  50  DT  DT  I . n 
A 1 51  DT  51  51  51  DT  DT  I . n 
A 1 52  DG  52  52  52  DG  DG  I . n 
A 1 53  DG  53  53  53  DG  DG  I . n 
A 1 54  DC  54  54  54  DC  DC  I . n 
A 1 55  DG  55  55  55  DG  DG  I . n 
A 1 56  DG  56  56  56  DG  DG  I . n 
A 1 57  DT  57  57  57  DT  DT  I . n 
A 1 58  DT  58  58  58  DT  DT  I . n 
A 1 59  DA  59  59  59  DA  DA  I . n 
A 1 60  DA  60  60  60  DA  DA  I . n 
A 1 61  DA  61  61  61  DA  DA  I . n 
A 1 62  DA  62  62  62  DA  DA  I . n 
A 1 63  DC  63  63  63  DC  DC  I . n 
A 1 64  DG  64  64  64  DG  DG  I . n 
A 1 65  DC  65  65  65  DC  DC  I . n 
A 1 66  DG  66  66  66  DG  DG  I . n 
A 1 67  DG  67  67  67  DG  DG  I . n 
A 1 68  DG  68  68  68  DG  DG  I . n 
A 1 69  DG  69  69  69  DG  DG  I . n 
A 1 70  DG  70  70  70  DG  DG  I . n 
A 1 71  DA  71  71  71  DA  DA  I . n 
A 1 72  DC  72  72  72  DC  DC  I . n 
A 1 73  DA  73  73  73  DA  DA  I . n 
A 1 74  DG  74  74  74  DG  DG  I . n 
A 1 75  DC  75  75  75  DC  DC  I . n 
A 1 76  DG  76  76  76  DG  DG  I . n 
A 1 77  DC  77  77  77  DC  DC  I . n 
A 1 78  DG  78  78  78  DG  DG  I . n 
A 1 79  DT  79  79  79  DT  DT  I . n 
A 1 80  DA  80  80  80  DA  DA  I . n 
A 1 81  DC  81  81  81  DC  DC  I . n 
A 1 82  DG  82  82  82  DG  DG  I . n 
A 1 83  DT  83  83  83  DT  DT  I . n 
A 1 84  DG  84  84  84  DG  DG  I . n 
A 1 85  DC  85  85  85  DC  DC  I . n 
A 1 86  DG  86  86  86  DG  DG  I . n 
A 1 87  DT  87  87  87  DT  DT  I . n 
A 1 88  DT  88  88  88  DT  DT  I . n 
A 1 89  DT  89  89  89  DT  DT  I . n 
A 1 90  DA  90  90  90  DA  DA  I . n 
A 1 91  DA  91  91  91  DA  DA  I . n 
A 1 92  DG  92  92  92  DG  DG  I . n 
A 1 93  DC  93  93  93  DC  DC  I . n 
A 1 94  DG  94  94  94  DG  DG  I . n 
A 1 95  DG  95  95  95  DG  DG  I . n 
A 1 96  DT  96  96  96  DT  DT  I . n 
A 1 97  DG  97  97  97  DG  DG  I . n 
A 1 98  DC  98  98  98  DC  DC  I . n 
A 1 99  DT  99  99  99  DT  DT  I . n 
A 1 100 DA  100 100 100 DA  DA  I . n 
A 1 101 DG  101 101 101 DG  DG  I . n 
A 1 102 DA  102 102 102 DA  DA  I . n 
A 1 103 DG  103 103 103 DG  DG  I . n 
A 1 104 DC  104 104 104 DC  DC  I . n 
A 1 105 DT  105 105 105 DT  DT  I . n 
A 1 106 DG  106 106 106 DG  DG  I . n 
A 1 107 DT  107 107 107 DT  DT  I . n 
A 1 108 DC  108 108 108 DC  DC  I . n 
A 1 109 DT  109 109 109 DT  DT  I . n 
A 1 110 DA  110 110 110 DA  DA  I . n 
A 1 111 DC  111 111 111 DC  DC  I . n 
A 1 112 DG  112 112 112 DG  DG  I . n 
A 1 113 DA  113 113 113 DA  DA  I . n 
A 1 114 DC  114 114 114 DC  DC  I . n 
A 1 115 DC  115 115 115 DC  DC  I . n 
A 1 116 DA  116 116 116 DA  DA  I . n 
A 1 117 DA  117 117 117 DA  DA  I . n 
A 1 118 DT  118 118 118 DT  DT  I . n 
A 1 119 DT  119 119 119 DT  DT  I . n 
A 1 120 DG  120 120 120 DG  DG  I . n 
A 1 121 DA  121 121 ?   ?   ?   I . n 
A 1 122 DG  122 122 ?   ?   ?   I . n 
A 1 123 DC  123 123 ?   ?   ?   I . n 
A 1 124 DG  124 124 ?   ?   ?   I . n 
A 1 125 DG  125 125 ?   ?   ?   I . n 
A 1 126 DC  126 126 ?   ?   ?   I . n 
A 1 127 DC  127 127 ?   ?   ?   I . n 
A 1 128 DT  128 128 ?   ?   ?   I . n 
A 1 129 DC  129 129 ?   ?   ?   I . n 
A 1 130 DG  130 130 ?   ?   ?   I . n 
A 1 131 DG  131 131 ?   ?   ?   I . n 
A 1 132 DC  132 132 ?   ?   ?   I . n 
A 1 133 DA  133 133 ?   ?   ?   I . n 
A 1 134 DC  134 134 ?   ?   ?   I . n 
A 1 135 DC  135 135 ?   ?   ?   I . n 
A 1 136 DG  136 136 ?   ?   ?   I . n 
A 1 137 DG  137 137 ?   ?   ?   I . n 
A 1 138 DG  138 138 ?   ?   ?   I . n 
A 1 139 DA  139 139 ?   ?   ?   I . n 
A 1 140 DT  140 140 ?   ?   ?   I . n 
A 1 141 DT  141 141 ?   ?   ?   I . n 
A 1 142 DC  142 142 ?   ?   ?   I . n 
A 1 143 DT  143 143 ?   ?   ?   I . n 
A 1 144 DC  144 144 ?   ?   ?   I . n 
A 1 145 DG  145 145 ?   ?   ?   I . n 
A 1 146 DA  146 146 ?   ?   ?   I . n 
A 1 147 DT  147 147 ?   ?   ?   I . n 
B 2 1   DA  1   1   ?   ?   ?   J . n 
B 2 2   DT  2   2   ?   ?   ?   J . n 
B 2 3   DC  3   3   ?   ?   ?   J . n 
B 2 4   DG  4   4   ?   ?   ?   J . n 
B 2 5   DA  5   5   ?   ?   ?   J . n 
B 2 6   DG  6   6   ?   ?   ?   J . n 
B 2 7   DA  7   7   ?   ?   ?   J . n 
B 2 8   DA  8   8   ?   ?   ?   J . n 
B 2 9   DT  9   9   ?   ?   ?   J . n 
B 2 10  DC  10  10  ?   ?   ?   J . n 
B 2 11  DC  11  11  ?   ?   ?   J . n 
B 2 12  DC  12  12  ?   ?   ?   J . n 
B 2 13  DG  13  13  ?   ?   ?   J . n 
B 2 14  DG  14  14  ?   ?   ?   J . n 
B 2 15  DT  15  15  ?   ?   ?   J . n 
B 2 16  DG  16  16  ?   ?   ?   J . n 
B 2 17  DC  17  17  ?   ?   ?   J . n 
B 2 18  DC  18  18  ?   ?   ?   J . n 
B 2 19  DG  19  19  ?   ?   ?   J . n 
B 2 20  DA  20  20  ?   ?   ?   J . n 
B 2 21  DG  21  21  ?   ?   ?   J . n 
B 2 22  DG  22  22  ?   ?   ?   J . n 
B 2 23  DC  23  23  ?   ?   ?   J . n 
B 2 24  DC  24  24  ?   ?   ?   J . n 
B 2 25  DG  25  25  ?   ?   ?   J . n 
B 2 26  DC  26  26  ?   ?   ?   J . n 
B 2 27  DT  27  27  ?   ?   ?   J . n 
B 2 28  DC  28  28  28  DC  DC  J . n 
B 2 29  DA  29  29  29  DA  DA  J . n 
B 2 30  DA  30  30  30  DA  DA  J . n 
B 2 31  DT  31  31  31  DT  DT  J . n 
B 2 32  DT  32  32  32  DT  DT  J . n 
B 2 33  DG  33  33  33  DG  DG  J . n 
B 2 34  DG  34  34  34  DG  DG  J . n 
B 2 35  DT  35  35  35  DT  DT  J . n 
B 2 36  DC  36  36  36  DC  DC  J . n 
B 2 37  DG  37  37  37  DG  DG  J . n 
B 2 38  DT  38  38  38  DT  DT  J . n 
B 2 39  DA  39  39  39  DA  DA  J . n 
B 2 40  DG  40  40  40  DG  DG  J . n 
B 2 41  DA  41  41  41  DA  DA  J . n 
B 2 42  DC  42  42  42  DC  DC  J . n 
B 2 43  DA  43  43  43  DA  DA  J . n 
B 2 44  DG  44  44  44  DG  DG  J . n 
B 2 45  DC  45  45  45  DC  DC  J . n 
B 2 46  DT  46  46  46  DT  DT  J . n 
B 2 47  DC  47  47  47  DC  DC  J . n 
B 2 48  DT  48  48  48  DT  DT  J . n 
B 2 49  DA  49  49  49  DA  DA  J . n 
B 2 50  DG  50  50  50  DG  DG  J . n 
B 2 51  DC  51  51  51  DC  DC  J . n 
B 2 52  DA  52  52  52  DA  DA  J . n 
B 2 53  DC  53  53  53  DC  DC  J . n 
B 2 54  DC  54  54  54  DC  DC  J . n 
B 2 55  DG  55  55  55  DG  DG  J . n 
B 2 56  DC  56  56  56  DC  DC  J . n 
B 2 57  DT  57  57  57  DT  DT  J . n 
B 2 58  DT  58  58  58  DT  DT  J . n 
B 2 59  DA  59  59  59  DA  DA  J . n 
B 2 60  DA  60  60  60  DA  DA  J . n 
B 2 61  DA  61  61  61  DA  DA  J . n 
B 2 62  DC  62  62  62  DC  DC  J . n 
B 2 63  DG  63  63  63  DG  DG  J . n 
B 2 64  DC  64  64  64  DC  DC  J . n 
B 2 65  DA  65  65  65  DA  DA  J . n 
B 2 66  DC  66  66  66  DC  DC  J . n 
B 2 67  DG  67  67  67  DG  DG  J . n 
B 2 68  DT  68  68  68  DT  DT  J . n 
B 2 69  DA  69  69  69  DA  DA  J . n 
B 2 70  DC  70  70  70  DC  DC  J . n 
B 2 71  DG  71  71  71  DG  DG  J . n 
B 2 72  DC  72  72  72  DC  DC  J . n 
B 2 73  DG  73  73  73  DG  DG  J . n 
B 2 74  DC  74  74  74  DC  DC  J . n 
B 2 75  DT  75  75  75  DT  DT  J . n 
B 2 76  DG  76  76  76  DG  DG  J . n 
B 2 77  DT  77  77  77  DT  DT  J . n 
B 2 78  DC  78  78  78  DC  DC  J . n 
B 2 79  DC  79  79  79  DC  DC  J . n 
B 2 80  DC  80  80  80  DC  DC  J . n 
B 2 81  DC  81  81  81  DC  DC  J . n 
B 2 82  DC  82  82  82  DC  DC  J . n 
B 2 83  DG  83  83  83  DG  DG  J . n 
B 2 84  DC  84  84  84  DC  DC  J . n 
B 2 85  DG  85  85  85  DG  DG  J . n 
B 2 86  DT  86  86  86  DT  DT  J . n 
B 2 87  DT  87  87  87  DT  DT  J . n 
B 2 88  DT  88  88  88  DT  DT  J . n 
B 2 89  DT  89  89  89  DT  DT  J . n 
B 2 90  DA  90  90  90  DA  DA  J . n 
B 2 91  DA  91  91  91  DA  DA  J . n 
B 2 92  DC  92  92  92  DC  DC  J . n 
B 2 93  DC  93  93  93  DC  DC  J . n 
B 2 94  DG  94  94  94  DG  DG  J . n 
B 2 95  DC  95  95  95  DC  DC  J . n 
B 2 96  DC  96  96  96  DC  DC  J . n 
B 2 97  DA  97  97  97  DA  DA  J . n 
B 2 98  DA  98  98  98  DA  DA  J . n 
B 2 99  DG  99  99  99  DG  DG  J . n 
B 2 100 DG  100 100 100 DG  DG  J . n 
B 2 101 DG  101 101 101 DG  DG  J . n 
B 2 102 DG  102 102 102 DG  DG  J . n 
B 2 103 DA  103 103 103 DA  DA  J . n 
B 2 104 DT  104 104 104 DT  DT  J . n 
B 2 105 DT  105 105 105 DT  DT  J . n 
B 2 106 DA  106 106 106 DA  DA  J . n 
B 2 107 DC  107 107 107 DC  DC  J . n 
B 2 108 DT  108 108 108 DT  DT  J . n 
B 2 109 DC  109 109 109 DC  DC  J . n 
B 2 110 DC  110 110 110 DC  DC  J . n 
B 2 111 DC  111 111 111 DC  DC  J . n 
B 2 112 DT  112 112 112 DT  DT  J . n 
B 2 113 DA  113 113 113 DA  DA  J . n 
B 2 114 DG  114 114 114 DG  DG  J . n 
B 2 115 DT  115 115 115 DT  DT  J . n 
B 2 116 DC  116 116 116 DC  DC  J . n 
B 2 117 DT  117 117 117 DT  DT  J . n 
B 2 118 DC  118 118 118 DC  DC  J . n 
B 2 119 DC  119 119 119 DC  DC  J . n 
B 2 120 DA  120 120 120 DA  DA  J . n 
B 2 121 DG  121 121 ?   ?   ?   J . n 
B 2 122 DG  122 122 ?   ?   ?   J . n 
B 2 123 DC  123 123 ?   ?   ?   J . n 
B 2 124 DA  124 124 ?   ?   ?   J . n 
B 2 125 DC  125 125 ?   ?   ?   J . n 
B 2 126 DG  126 126 ?   ?   ?   J . n 
B 2 127 DT  127 127 ?   ?   ?   J . n 
B 2 128 DG  128 128 ?   ?   ?   J . n 
B 2 129 DT  129 129 ?   ?   ?   J . n 
B 2 130 DC  130 130 ?   ?   ?   J . n 
B 2 131 DA  131 131 ?   ?   ?   J . n 
B 2 132 DG  132 132 ?   ?   ?   J . n 
B 2 133 DA  133 133 ?   ?   ?   J . n 
B 2 134 DT  134 134 ?   ?   ?   J . n 
B 2 135 DA  135 135 ?   ?   ?   J . n 
B 2 136 DT  136 136 ?   ?   ?   J . n 
B 2 137 DA  137 137 ?   ?   ?   J . n 
B 2 138 DT  138 138 ?   ?   ?   J . n 
B 2 139 DA  139 139 ?   ?   ?   J . n 
B 2 140 DC  140 140 ?   ?   ?   J . n 
B 2 141 DA  141 141 ?   ?   ?   J . n 
B 2 142 DT  142 142 ?   ?   ?   J . n 
B 2 143 DC  143 143 ?   ?   ?   J . n 
B 2 144 DC  144 144 ?   ?   ?   J . n 
B 2 145 DG  145 145 ?   ?   ?   J . n 
B 2 146 DA  146 146 ?   ?   ?   J . n 
B 2 147 DT  147 147 ?   ?   ?   J . n 
C 3 1   MET 1   0   ?   ?   ?   A . n 
C 3 2   ALA 2   1   ?   ?   ?   A . n 
C 3 3   ARG 3   2   ?   ?   ?   A . n 
C 3 4   THR 4   3   ?   ?   ?   A . n 
C 3 5   LYS 5   4   ?   ?   ?   A . n 
C 3 6   GLN 6   5   ?   ?   ?   A . n 
C 3 7   THR 7   6   ?   ?   ?   A . n 
C 3 8   ALA 8   7   ?   ?   ?   A . n 
C 3 9   ARG 9   8   ?   ?   ?   A . n 
C 3 10  LYS 10  9   ?   ?   ?   A . n 
C 3 11  SER 11  10  ?   ?   ?   A . n 
C 3 12  THR 12  11  ?   ?   ?   A . n 
C 3 13  GLY 13  12  ?   ?   ?   A . n 
C 3 14  GLY 14  13  ?   ?   ?   A . n 
C 3 15  LYS 15  14  ?   ?   ?   A . n 
C 3 16  ALA 16  15  ?   ?   ?   A . n 
C 3 17  PRO 17  16  ?   ?   ?   A . n 
C 3 18  ARG 18  17  ?   ?   ?   A . n 
C 3 19  LYS 19  18  ?   ?   ?   A . n 
C 3 20  GLN 20  19  ?   ?   ?   A . n 
C 3 21  LEU 21  20  ?   ?   ?   A . n 
C 3 22  ALA 22  21  ?   ?   ?   A . n 
C 3 23  THR 23  22  ?   ?   ?   A . n 
C 3 24  LYS 24  23  ?   ?   ?   A . n 
C 3 25  ALA 25  24  ?   ?   ?   A . n 
C 3 26  ALA 26  25  ?   ?   ?   A . n 
C 3 27  ARG 27  26  ?   ?   ?   A . n 
C 3 28  LYS 28  27  ?   ?   ?   A . n 
C 3 29  SER 29  28  ?   ?   ?   A . n 
C 3 30  ALA 30  29  ?   ?   ?   A . n 
C 3 31  PRO 31  30  ?   ?   ?   A . n 
C 3 32  ALA 32  31  ?   ?   ?   A . n 
C 3 33  THR 33  32  ?   ?   ?   A . n 
C 3 34  GLY 34  33  ?   ?   ?   A . n 
C 3 35  GLY 35  34  ?   ?   ?   A . n 
C 3 36  VAL 36  35  ?   ?   ?   A . n 
C 3 37  LYS 37  36  ?   ?   ?   A . n 
C 3 38  LYS 38  37  ?   ?   ?   A . n 
C 3 39  PRO 39  38  ?   ?   ?   A . n 
C 3 40  HIS 40  39  ?   ?   ?   A . n 
C 3 41  ARG 41  40  ?   ?   ?   A . n 
C 3 42  TYR 42  41  ?   ?   ?   A . n 
C 3 43  ARG 43  42  ?   ?   ?   A . n 
C 3 44  PRO 44  43  ?   ?   ?   A . n 
C 3 45  GLY 45  44  ?   ?   ?   A . n 
C 3 46  THR 46  45  ?   ?   ?   A . n 
C 3 47  VAL 47  46  ?   ?   ?   A . n 
C 3 48  ALA 48  47  ?   ?   ?   A . n 
C 3 49  LEU 49  48  ?   ?   ?   A . n 
C 3 50  ARG 50  49  ?   ?   ?   A . n 
C 3 51  GLU 51  50  ?   ?   ?   A . n 
C 3 52  ILE 52  51  ?   ?   ?   A . n 
C 3 53  ARG 53  52  ?   ?   ?   A . n 
C 3 54  ARG 54  53  ?   ?   ?   A . n 
C 3 55  TYR 55  54  ?   ?   ?   A . n 
C 3 56  GLN 56  55  ?   ?   ?   A . n 
C 3 57  LYS 57  56  ?   ?   ?   A . n 
C 3 58  SER 58  57  ?   ?   ?   A . n 
C 3 59  THR 59  58  ?   ?   ?   A . n 
C 3 60  GLU 60  59  ?   ?   ?   A . n 
C 3 61  LEU 61  60  60  LEU LEU A . n 
C 3 62  LEU 62  61  61  LEU LEU A . n 
C 3 63  ILE 63  62  62  ILE ILE A . n 
C 3 64  ARG 64  63  63  ARG ARG A . n 
C 3 65  LYS 65  64  64  LYS LYS A . n 
C 3 66  LEU 66  65  65  LEU LEU A . n 
C 3 67  PRO 67  66  66  PRO PRO A . n 
C 3 68  PHE 68  67  67  PHE PHE A . n 
C 3 69  GLN 69  68  68  GLN GLN A . n 
C 3 70  ARG 70  69  69  ARG ARG A . n 
C 3 71  LEU 71  70  70  LEU LEU A . n 
C 3 72  VAL 72  71  71  VAL VAL A . n 
C 3 73  ARG 73  72  72  ARG ARG A . n 
C 3 74  GLU 74  73  73  GLU GLU A . n 
C 3 75  ILE 75  74  74  ILE ILE A . n 
C 3 76  ALA 76  75  75  ALA ALA A . n 
C 3 77  GLN 77  76  76  GLN GLN A . n 
C 3 78  ASP 78  77  77  ASP ASP A . n 
C 3 79  PHE 79  78  78  PHE PHE A . n 
C 3 80  LYS 80  79  79  LYS LYS A . n 
C 3 81  THR 81  80  80  THR THR A . n 
C 3 82  ASP 82  81  81  ASP ASP A . n 
C 3 83  LEU 83  82  82  LEU LEU A . n 
C 3 84  ARG 84  83  83  ARG ARG A . n 
C 3 85  PHE 85  84  84  PHE PHE A . n 
C 3 86  GLN 86  85  85  GLN GLN A . n 
C 3 87  SER 87  86  86  SER SER A . n 
C 3 88  SER 88  87  87  SER SER A . n 
C 3 89  ALA 89  88  88  ALA ALA A . n 
C 3 90  VAL 90  89  89  VAL VAL A . n 
C 3 91  MET 91  90  90  MET MET A . n 
C 3 92  ALA 92  91  91  ALA ALA A . n 
C 3 93  LEU 93  92  92  LEU LEU A . n 
C 3 94  GLN 94  93  93  GLN GLN A . n 
C 3 95  GLU 95  94  94  GLU GLU A . n 
C 3 96  ALA 96  95  95  ALA ALA A . n 
C 3 97  CYS 97  96  96  CYS CYS A . n 
C 3 98  GLU 98  97  97  GLU GLU A . n 
C 3 99  ALA 99  98  98  ALA ALA A . n 
C 3 100 TYR 100 99  99  TYR TYR A . n 
C 3 101 LEU 101 100 100 LEU LEU A . n 
C 3 102 VAL 102 101 101 VAL VAL A . n 
C 3 103 GLY 103 102 102 GLY GLY A . n 
C 3 104 LEU 104 103 103 LEU LEU A . n 
C 3 105 PHE 105 104 104 PHE PHE A . n 
C 3 106 GLU 106 105 105 GLU GLU A . n 
C 3 107 ASP 107 106 106 ASP ASP A . n 
C 3 108 THR 108 107 107 THR THR A . n 
C 3 109 ASN 109 108 108 ASN ASN A . n 
C 3 110 LEU 110 109 109 LEU LEU A . n 
C 3 111 CYS 111 110 110 CYS CYS A . n 
C 3 112 ALA 112 111 111 ALA ALA A . n 
C 3 113 ILE 113 112 112 ILE ILE A . n 
C 3 114 HIS 114 113 113 HIS HIS A . n 
C 3 115 ALA 115 114 114 ALA ALA A . n 
C 3 116 LYS 116 115 115 LYS LYS A . n 
C 3 117 ARG 117 116 116 ARG ARG A . n 
C 3 118 VAL 118 117 117 VAL VAL A . n 
C 3 119 THR 119 118 118 THR THR A . n 
C 3 120 ILE 120 119 119 ILE ILE A . n 
C 3 121 MET 121 120 120 MET MET A . n 
C 3 122 PRO 122 121 121 PRO PRO A . n 
C 3 123 LYS 123 122 122 LYS LYS A . n 
C 3 124 ASP 124 123 123 ASP ASP A . n 
C 3 125 ILE 125 124 124 ILE ILE A . n 
C 3 126 GLN 126 125 125 GLN GLN A . n 
C 3 127 LEU 127 126 126 LEU LEU A . n 
C 3 128 ALA 128 127 127 ALA ALA A . n 
C 3 129 ARG 129 128 128 ARG ARG A . n 
C 3 130 ARG 130 129 129 ARG ARG A . n 
C 3 131 ILE 131 130 130 ILE ILE A . n 
C 3 132 ARG 132 131 131 ARG ARG A . n 
C 3 133 GLY 133 132 132 GLY GLY A . n 
C 3 134 GLU 134 133 133 GLU GLU A . n 
C 3 135 ARG 135 134 ?   ?   ?   A . n 
C 3 136 ALA 136 135 ?   ?   ?   A . n 
D 4 1   MET 1   0   ?   ?   ?   B . n 
D 4 2   SER 2   1   ?   ?   ?   B . n 
D 4 3   GLY 3   2   ?   ?   ?   B . n 
D 4 4   ARG 4   3   ?   ?   ?   B . n 
D 4 5   GLY 5   4   ?   ?   ?   B . n 
D 4 6   LYS 6   5   ?   ?   ?   B . n 
D 4 7   GLY 7   6   ?   ?   ?   B . n 
D 4 8   GLY 8   7   ?   ?   ?   B . n 
D 4 9   LYS 9   8   ?   ?   ?   B . n 
D 4 10  GLY 10  9   ?   ?   ?   B . n 
D 4 11  LEU 11  10  ?   ?   ?   B . n 
D 4 12  GLY 12  11  ?   ?   ?   B . n 
D 4 13  LYS 13  12  ?   ?   ?   B . n 
D 4 14  GLY 14  13  ?   ?   ?   B . n 
D 4 15  GLY 15  14  ?   ?   ?   B . n 
D 4 16  ALA 16  15  ?   ?   ?   B . n 
D 4 17  LYS 17  16  ?   ?   ?   B . n 
D 4 18  ARG 18  17  ?   ?   ?   B . n 
D 4 19  HIS 19  18  ?   ?   ?   B . n 
D 4 20  ARG 20  19  ?   ?   ?   B . n 
D 4 21  LYS 21  20  ?   ?   ?   B . n 
D 4 22  VAL 22  21  ?   ?   ?   B . n 
D 4 23  LEU 23  22  ?   ?   ?   B . n 
D 4 24  ARG 24  23  ?   ?   ?   B . n 
D 4 25  ASP 25  24  ?   ?   ?   B . n 
D 4 26  ASN 26  25  25  ASN ASN B . n 
D 4 27  ILE 27  26  26  ILE ILE B . n 
D 4 28  GLN 28  27  27  GLN GLN B . n 
D 4 29  GLY 29  28  28  GLY GLY B . n 
D 4 30  ILE 30  29  29  ILE ILE B . n 
D 4 31  THR 31  30  30  THR THR B . n 
D 4 32  LYS 32  31  31  LYS LYS B . n 
D 4 33  PRO 33  32  32  PRO PRO B . n 
D 4 34  ALA 34  33  33  ALA ALA B . n 
D 4 35  ILE 35  34  34  ILE ILE B . n 
D 4 36  ARG 36  35  35  ARG ARG B . n 
D 4 37  ARG 37  36  36  ARG ARG B . n 
D 4 38  LEU 38  37  37  LEU LEU B . n 
D 4 39  ALA 39  38  38  ALA ALA B . n 
D 4 40  ARG 40  39  39  ARG ARG B . n 
D 4 41  ARG 41  40  40  ARG ARG B . n 
D 4 42  GLY 42  41  41  GLY GLY B . n 
D 4 43  GLY 43  42  42  GLY GLY B . n 
D 4 44  VAL 44  43  43  VAL VAL B . n 
D 4 45  LYS 45  44  44  LYS LYS B . n 
D 4 46  ARG 46  45  45  ARG ARG B . n 
D 4 47  ILE 47  46  46  ILE ILE B . n 
D 4 48  SER 48  47  47  SER SER B . n 
D 4 49  GLY 49  48  48  GLY GLY B . n 
D 4 50  LEU 50  49  49  LEU LEU B . n 
D 4 51  ILE 51  50  50  ILE ILE B . n 
D 4 52  TYR 52  51  51  TYR TYR B . n 
D 4 53  GLU 53  52  52  GLU GLU B . n 
D 4 54  GLU 54  53  53  GLU GLU B . n 
D 4 55  THR 55  54  54  THR THR B . n 
D 4 56  ARG 56  55  55  ARG ARG B . n 
D 4 57  GLY 57  56  56  GLY GLY B . n 
D 4 58  VAL 58  57  57  VAL VAL B . n 
D 4 59  LEU 59  58  58  LEU LEU B . n 
D 4 60  LYS 60  59  59  LYS LYS B . n 
D 4 61  VAL 61  60  60  VAL VAL B . n 
D 4 62  PHE 62  61  61  PHE PHE B . n 
D 4 63  LEU 63  62  62  LEU LEU B . n 
D 4 64  GLU 64  63  63  GLU GLU B . n 
D 4 65  ASN 65  64  64  ASN ASN B . n 
D 4 66  VAL 66  65  65  VAL VAL B . n 
D 4 67  ILE 67  66  66  ILE ILE B . n 
D 4 68  ARG 68  67  67  ARG ARG B . n 
D 4 69  ASP 69  68  68  ASP ASP B . n 
D 4 70  ALA 70  69  69  ALA ALA B . n 
D 4 71  VAL 71  70  70  VAL VAL B . n 
D 4 72  THR 72  71  71  THR THR B . n 
D 4 73  TYR 73  72  72  TYR TYR B . n 
D 4 74  THR 74  73  73  THR THR B . n 
D 4 75  GLU 75  74  74  GLU GLU B . n 
D 4 76  HIS 76  75  75  HIS HIS B . n 
D 4 77  ALA 77  76  76  ALA ALA B . n 
D 4 78  LYS 78  77  77  LYS LYS B . n 
D 4 79  ARG 79  78  78  ARG ARG B . n 
D 4 80  LYS 80  79  79  LYS LYS B . n 
D 4 81  THR 81  80  80  THR THR B . n 
D 4 82  VAL 82  81  81  VAL VAL B . n 
D 4 83  THR 83  82  82  THR THR B . n 
D 4 84  ALA 84  83  83  ALA ALA B . n 
D 4 85  MET 85  84  84  MET MET B . n 
D 4 86  ASP 86  85  85  ASP ASP B . n 
D 4 87  VAL 87  86  86  VAL VAL B . n 
D 4 88  VAL 88  87  87  VAL VAL B . n 
D 4 89  TYR 89  88  88  TYR TYR B . n 
D 4 90  ALA 90  89  89  ALA ALA B . n 
D 4 91  LEU 91  90  90  LEU LEU B . n 
D 4 92  LYS 92  91  91  LYS LYS B . n 
D 4 93  ARG 93  92  92  ARG ARG B . n 
D 4 94  GLN 94  93  93  GLN GLN B . n 
D 4 95  GLY 95  94  94  GLY GLY B . n 
D 4 96  ARG 96  95  95  ARG ARG B . n 
D 4 97  THR 97  96  96  THR THR B . n 
D 4 98  LEU 98  97  97  LEU LEU B . n 
D 4 99  TYR 99  98  98  TYR TYR B . n 
D 4 100 GLY 100 99  99  GLY GLY B . n 
D 4 101 PHE 101 100 100 PHE PHE B . n 
D 4 102 GLY 102 101 ?   ?   ?   B . n 
D 4 103 GLY 103 102 ?   ?   ?   B . n 
E 5 1   MET 1   0   ?   ?   ?   D . n 
E 5 2   PRO 2   1   ?   ?   ?   D . n 
E 5 3   GLU 3   2   ?   ?   ?   D . n 
E 5 4   PRO 4   3   ?   ?   ?   D . n 
E 5 5   ALA 5   4   ?   ?   ?   D . n 
E 5 6   LYS 6   5   ?   ?   ?   D . n 
E 5 7   SER 7   6   ?   ?   ?   D . n 
E 5 8   ALA 8   7   ?   ?   ?   D . n 
E 5 9   PRO 9   8   ?   ?   ?   D . n 
E 5 10  ALA 10  9   ?   ?   ?   D . n 
E 5 11  PRO 11  10  ?   ?   ?   D . n 
E 5 12  LYS 12  11  ?   ?   ?   D . n 
E 5 13  LYS 13  12  ?   ?   ?   D . n 
E 5 14  GLY 14  13  ?   ?   ?   D . n 
E 5 15  SER 15  14  ?   ?   ?   D . n 
E 5 16  LYS 16  15  ?   ?   ?   D . n 
E 5 17  LYS 17  16  ?   ?   ?   D . n 
E 5 18  ALA 18  17  ?   ?   ?   D . n 
E 5 19  VAL 19  18  ?   ?   ?   D . n 
E 5 20  THR 20  19  ?   ?   ?   D . n 
E 5 21  LYS 21  20  ?   ?   ?   D . n 
E 5 22  ALA 22  21  ?   ?   ?   D . n 
E 5 23  GLN 23  22  ?   ?   ?   D . n 
E 5 24  LYS 24  23  ?   ?   ?   D . n 
E 5 25  LYS 25  24  ?   ?   ?   D . n 
E 5 26  ASP 26  25  ?   ?   ?   D . n 
E 5 27  GLY 27  26  ?   ?   ?   D . n 
E 5 28  LYS 28  27  ?   ?   ?   D . n 
E 5 29  LYS 29  28  ?   ?   ?   D . n 
E 5 30  ARG 30  29  ?   ?   ?   D . n 
E 5 31  LYS 31  30  ?   ?   ?   D . n 
E 5 32  ARG 32  31  ?   ?   ?   D . n 
E 5 33  SER 33  32  ?   ?   ?   D . n 
E 5 34  ARG 34  33  ?   ?   ?   D . n 
E 5 35  LYS 35  34  ?   ?   ?   D . n 
E 5 36  GLU 36  35  ?   ?   ?   D . n 
E 5 37  SER 37  36  36  SER SER D . n 
E 5 38  TYR 38  37  37  TYR TYR D . n 
E 5 39  SER 39  38  38  SER SER D . n 
E 5 40  ILE 40  39  39  ILE ILE D . n 
E 5 41  TYR 41  40  40  TYR TYR D . n 
E 5 42  VAL 42  41  41  VAL VAL D . n 
E 5 43  TYR 43  42  42  TYR TYR D . n 
E 5 44  LYS 44  43  43  LYS LYS D . n 
E 5 45  VAL 45  44  44  VAL VAL D . n 
E 5 46  LEU 46  45  45  LEU LEU D . n 
E 5 47  LYS 47  46  46  LYS LYS D . n 
E 5 48  GLN 48  47  47  GLN GLN D . n 
E 5 49  VAL 49  48  48  VAL VAL D . n 
E 5 50  HIS 50  49  49  HIS HIS D . n 
E 5 51  PRO 51  50  50  PRO PRO D . n 
E 5 52  ASP 52  51  51  ASP ASP D . n 
E 5 53  THR 53  52  52  THR THR D . n 
E 5 54  GLY 54  53  53  GLY GLY D . n 
E 5 55  ILE 55  54  54  ILE ILE D . n 
E 5 56  SER 56  55  55  SER SER D . n 
E 5 57  SER 57  56  56  SER SER D . n 
E 5 58  LYS 58  57  57  LYS LYS D . n 
E 5 59  ALA 59  58  58  ALA ALA D . n 
E 5 60  MET 60  59  59  MET MET D . n 
E 5 61  GLY 61  60  60  GLY GLY D . n 
E 5 62  ILE 62  61  61  ILE ILE D . n 
E 5 63  MET 63  62  62  MET MET D . n 
E 5 64  ASN 64  63  63  ASN ASN D . n 
E 5 65  SER 65  64  64  SER SER D . n 
E 5 66  PHE 66  65  65  PHE PHE D . n 
E 5 67  VAL 67  66  66  VAL VAL D . n 
E 5 68  ASN 68  67  67  ASN ASN D . n 
E 5 69  ASP 69  68  68  ASP ASP D . n 
E 5 70  ILE 70  69  69  ILE ILE D . n 
E 5 71  PHE 71  70  70  PHE PHE D . n 
E 5 72  GLU 72  71  71  GLU GLU D . n 
E 5 73  ARG 73  72  72  ARG ARG D . n 
E 5 74  ILE 74  73  73  ILE ILE D . n 
E 5 75  ALA 75  74  74  ALA ALA D . n 
E 5 76  GLY 76  75  75  GLY GLY D . n 
E 5 77  GLU 77  76  76  GLU GLU D . n 
E 5 78  ALA 78  77  77  ALA ALA D . n 
E 5 79  SER 79  78  78  SER SER D . n 
E 5 80  ARG 80  79  79  ARG ARG D . n 
E 5 81  LEU 81  80  80  LEU LEU D . n 
E 5 82  ALA 82  81  81  ALA ALA D . n 
E 5 83  HIS 83  82  82  HIS HIS D . n 
E 5 84  TYR 84  83  83  TYR TYR D . n 
E 5 85  ASN 85  84  84  ASN ASN D . n 
E 5 86  LYS 86  85  85  LYS LYS D . n 
E 5 87  ARG 87  86  86  ARG ARG D . n 
E 5 88  SER 88  87  87  SER SER D . n 
E 5 89  THR 89  88  88  THR THR D . n 
E 5 90  ILE 90  89  89  ILE ILE D . n 
E 5 91  THR 91  90  90  THR THR D . n 
E 5 92  SER 92  91  91  SER SER D . n 
E 5 93  ARG 93  92  92  ARG ARG D . n 
E 5 94  GLU 94  93  93  GLU GLU D . n 
E 5 95  ILE 95  94  94  ILE ILE D . n 
E 5 96  GLN 96  95  95  GLN GLN D . n 
E 5 97  THR 97  96  96  THR THR D . n 
E 5 98  ALA 98  97  97  ALA ALA D . n 
E 5 99  VAL 99  98  98  VAL VAL D . n 
E 5 100 ARG 100 99  99  ARG ARG D . n 
E 5 101 LEU 101 100 100 LEU LEU D . n 
E 5 102 LEU 102 101 101 LEU LEU D . n 
E 5 103 LEU 103 102 102 LEU LEU D . n 
E 5 104 PRO 104 103 103 PRO PRO D . n 
E 5 105 GLY 105 104 104 GLY GLY D . n 
E 5 106 GLU 106 105 105 GLU GLU D . n 
E 5 107 LEU 107 106 106 LEU LEU D . n 
E 5 108 ALA 108 107 107 ALA ALA D . n 
E 5 109 LYS 109 108 108 LYS LYS D . n 
E 5 110 HIS 110 109 109 HIS HIS D . n 
E 5 111 ALA 111 110 110 ALA ALA D . n 
E 5 112 VAL 112 111 111 VAL VAL D . n 
E 5 113 SER 113 112 112 SER SER D . n 
E 5 114 GLU 114 113 113 GLU GLU D . n 
E 5 115 GLY 115 114 114 GLY GLY D . n 
E 5 116 THR 116 115 115 THR THR D . n 
E 5 117 LYS 117 116 116 LYS LYS D . n 
E 5 118 ALA 118 117 117 ALA ALA D . n 
E 5 119 VAL 119 118 118 VAL VAL D . n 
E 5 120 THR 120 119 119 THR THR D . n 
E 5 121 LYS 121 120 120 LYS LYS D . n 
E 5 122 TYR 122 121 121 TYR TYR D . n 
E 5 123 THR 123 122 122 THR THR D . n 
E 5 124 SER 124 123 123 SER SER D . n 
E 5 125 SER 125 124 ?   ?   ?   D . n 
E 5 126 LYS 126 125 ?   ?   ?   D . n 
F 3 1   MET 1   0   ?   ?   ?   E . n 
F 3 2   ALA 2   1   ?   ?   ?   E . n 
F 3 3   ARG 3   2   ?   ?   ?   E . n 
F 3 4   THR 4   3   ?   ?   ?   E . n 
F 3 5   LYS 5   4   ?   ?   ?   E . n 
F 3 6   GLN 6   5   ?   ?   ?   E . n 
F 3 7   THR 7   6   ?   ?   ?   E . n 
F 3 8   ALA 8   7   ?   ?   ?   E . n 
F 3 9   ARG 9   8   ?   ?   ?   E . n 
F 3 10  LYS 10  9   ?   ?   ?   E . n 
F 3 11  SER 11  10  ?   ?   ?   E . n 
F 3 12  THR 12  11  ?   ?   ?   E . n 
F 3 13  GLY 13  12  ?   ?   ?   E . n 
F 3 14  GLY 14  13  ?   ?   ?   E . n 
F 3 15  LYS 15  14  ?   ?   ?   E . n 
F 3 16  ALA 16  15  ?   ?   ?   E . n 
F 3 17  PRO 17  16  ?   ?   ?   E . n 
F 3 18  ARG 18  17  ?   ?   ?   E . n 
F 3 19  LYS 19  18  ?   ?   ?   E . n 
F 3 20  GLN 20  19  ?   ?   ?   E . n 
F 3 21  LEU 21  20  ?   ?   ?   E . n 
F 3 22  ALA 22  21  ?   ?   ?   E . n 
F 3 23  THR 23  22  ?   ?   ?   E . n 
F 3 24  LYS 24  23  ?   ?   ?   E . n 
F 3 25  ALA 25  24  ?   ?   ?   E . n 
F 3 26  ALA 26  25  ?   ?   ?   E . n 
F 3 27  ARG 27  26  ?   ?   ?   E . n 
F 3 28  LYS 28  27  ?   ?   ?   E . n 
F 3 29  SER 29  28  ?   ?   ?   E . n 
F 3 30  ALA 30  29  ?   ?   ?   E . n 
F 3 31  PRO 31  30  ?   ?   ?   E . n 
F 3 32  ALA 32  31  ?   ?   ?   E . n 
F 3 33  THR 33  32  ?   ?   ?   E . n 
F 3 34  GLY 34  33  ?   ?   ?   E . n 
F 3 35  GLY 35  34  ?   ?   ?   E . n 
F 3 36  VAL 36  35  ?   ?   ?   E . n 
F 3 37  LYS 37  36  ?   ?   ?   E . n 
F 3 38  LYS 38  37  ?   ?   ?   E . n 
F 3 39  PRO 39  38  ?   ?   ?   E . n 
F 3 40  HIS 40  39  ?   ?   ?   E . n 
F 3 41  ARG 41  40  ?   ?   ?   E . n 
F 3 42  TYR 42  41  ?   ?   ?   E . n 
F 3 43  ARG 43  42  ?   ?   ?   E . n 
F 3 44  PRO 44  43  ?   ?   ?   E . n 
F 3 45  GLY 45  44  ?   ?   ?   E . n 
F 3 46  THR 46  45  ?   ?   ?   E . n 
F 3 47  VAL 47  46  ?   ?   ?   E . n 
F 3 48  ALA 48  47  ?   ?   ?   E . n 
F 3 49  LEU 49  48  ?   ?   ?   E . n 
F 3 50  ARG 50  49  ?   ?   ?   E . n 
F 3 51  GLU 51  50  ?   ?   ?   E . n 
F 3 52  ILE 52  51  ?   ?   ?   E . n 
F 3 53  ARG 53  52  ?   ?   ?   E . n 
F 3 54  ARG 54  53  ?   ?   ?   E . n 
F 3 55  TYR 55  54  ?   ?   ?   E . n 
F 3 56  GLN 56  55  ?   ?   ?   E . n 
F 3 57  LYS 57  56  ?   ?   ?   E . n 
F 3 58  SER 58  57  ?   ?   ?   E . n 
F 3 59  THR 59  58  ?   ?   ?   E . n 
F 3 60  GLU 60  59  ?   ?   ?   E . n 
F 3 61  LEU 61  60  60  LEU LEU E . n 
F 3 62  LEU 62  61  61  LEU LEU E . n 
F 3 63  ILE 63  62  62  ILE ILE E . n 
F 3 64  ARG 64  63  63  ARG ARG E . n 
F 3 65  LYS 65  64  64  LYS LYS E . n 
F 3 66  LEU 66  65  65  LEU LEU E . n 
F 3 67  PRO 67  66  66  PRO PRO E . n 
F 3 68  PHE 68  67  67  PHE PHE E . n 
F 3 69  GLN 69  68  68  GLN GLN E . n 
F 3 70  ARG 70  69  69  ARG ARG E . n 
F 3 71  LEU 71  70  70  LEU LEU E . n 
F 3 72  VAL 72  71  71  VAL VAL E . n 
F 3 73  ARG 73  72  72  ARG ARG E . n 
F 3 74  GLU 74  73  73  GLU GLU E . n 
F 3 75  ILE 75  74  74  ILE ILE E . n 
F 3 76  ALA 76  75  75  ALA ALA E . n 
F 3 77  GLN 77  76  76  GLN GLN E . n 
F 3 78  ASP 78  77  77  ASP ASP E . n 
F 3 79  PHE 79  78  78  PHE PHE E . n 
F 3 80  LYS 80  79  79  LYS LYS E . n 
F 3 81  THR 81  80  80  THR THR E . n 
F 3 82  ASP 82  81  81  ASP ASP E . n 
F 3 83  LEU 83  82  82  LEU LEU E . n 
F 3 84  ARG 84  83  83  ARG ARG E . n 
F 3 85  PHE 85  84  84  PHE PHE E . n 
F 3 86  GLN 86  85  85  GLN GLN E . n 
F 3 87  SER 87  86  86  SER SER E . n 
F 3 88  SER 88  87  87  SER SER E . n 
F 3 89  ALA 89  88  88  ALA ALA E . n 
F 3 90  VAL 90  89  89  VAL VAL E . n 
F 3 91  MET 91  90  90  MET MET E . n 
F 3 92  ALA 92  91  91  ALA ALA E . n 
F 3 93  LEU 93  92  92  LEU LEU E . n 
F 3 94  GLN 94  93  93  GLN GLN E . n 
F 3 95  GLU 95  94  94  GLU GLU E . n 
F 3 96  ALA 96  95  95  ALA ALA E . n 
F 3 97  CYS 97  96  96  CYS CYS E . n 
F 3 98  GLU 98  97  97  GLU GLU E . n 
F 3 99  ALA 99  98  98  ALA ALA E . n 
F 3 100 TYR 100 99  99  TYR TYR E . n 
F 3 101 LEU 101 100 100 LEU LEU E . n 
F 3 102 VAL 102 101 101 VAL VAL E . n 
F 3 103 GLY 103 102 102 GLY GLY E . n 
F 3 104 LEU 104 103 103 LEU LEU E . n 
F 3 105 PHE 105 104 104 PHE PHE E . n 
F 3 106 GLU 106 105 105 GLU GLU E . n 
F 3 107 ASP 107 106 106 ASP ASP E . n 
F 3 108 THR 108 107 107 THR THR E . n 
F 3 109 ASN 109 108 108 ASN ASN E . n 
F 3 110 LEU 110 109 109 LEU LEU E . n 
F 3 111 CYS 111 110 110 CYS CYS E . n 
F 3 112 ALA 112 111 111 ALA ALA E . n 
F 3 113 ILE 113 112 112 ILE ILE E . n 
F 3 114 HIS 114 113 113 HIS HIS E . n 
F 3 115 ALA 115 114 114 ALA ALA E . n 
F 3 116 LYS 116 115 115 LYS LYS E . n 
F 3 117 ARG 117 116 116 ARG ARG E . n 
F 3 118 VAL 118 117 117 VAL VAL E . n 
F 3 119 THR 119 118 118 THR THR E . n 
F 3 120 ILE 120 119 119 ILE ILE E . n 
F 3 121 MET 121 120 120 MET MET E . n 
F 3 122 PRO 122 121 121 PRO PRO E . n 
F 3 123 LYS 123 122 122 LYS LYS E . n 
F 3 124 ASP 124 123 123 ASP ASP E . n 
F 3 125 ILE 125 124 124 ILE ILE E . n 
F 3 126 GLN 126 125 125 GLN GLN E . n 
F 3 127 LEU 127 126 126 LEU LEU E . n 
F 3 128 ALA 128 127 127 ALA ALA E . n 
F 3 129 ARG 129 128 128 ARG ARG E . n 
F 3 130 ARG 130 129 129 ARG ARG E . n 
F 3 131 ILE 131 130 130 ILE ILE E . n 
F 3 132 ARG 132 131 131 ARG ARG E . n 
F 3 133 GLY 133 132 132 GLY GLY E . n 
F 3 134 GLU 134 133 133 GLU GLU E . n 
F 3 135 ARG 135 134 ?   ?   ?   E . n 
F 3 136 ALA 136 135 ?   ?   ?   E . n 
G 4 1   MET 1   0   ?   ?   ?   F . n 
G 4 2   SER 2   1   ?   ?   ?   F . n 
G 4 3   GLY 3   2   ?   ?   ?   F . n 
G 4 4   ARG 4   3   ?   ?   ?   F . n 
G 4 5   GLY 5   4   ?   ?   ?   F . n 
G 4 6   LYS 6   5   ?   ?   ?   F . n 
G 4 7   GLY 7   6   ?   ?   ?   F . n 
G 4 8   GLY 8   7   ?   ?   ?   F . n 
G 4 9   LYS 9   8   ?   ?   ?   F . n 
G 4 10  GLY 10  9   ?   ?   ?   F . n 
G 4 11  LEU 11  10  ?   ?   ?   F . n 
G 4 12  GLY 12  11  ?   ?   ?   F . n 
G 4 13  LYS 13  12  ?   ?   ?   F . n 
G 4 14  GLY 14  13  ?   ?   ?   F . n 
G 4 15  GLY 15  14  ?   ?   ?   F . n 
G 4 16  ALA 16  15  ?   ?   ?   F . n 
G 4 17  LYS 17  16  ?   ?   ?   F . n 
G 4 18  ARG 18  17  ?   ?   ?   F . n 
G 4 19  HIS 19  18  ?   ?   ?   F . n 
G 4 20  ARG 20  19  ?   ?   ?   F . n 
G 4 21  LYS 21  20  ?   ?   ?   F . n 
G 4 22  VAL 22  21  ?   ?   ?   F . n 
G 4 23  LEU 23  22  ?   ?   ?   F . n 
G 4 24  ARG 24  23  ?   ?   ?   F . n 
G 4 25  ASP 25  24  ?   ?   ?   F . n 
G 4 26  ASN 26  25  25  ASN ASN F . n 
G 4 27  ILE 27  26  26  ILE ILE F . n 
G 4 28  GLN 28  27  27  GLN GLN F . n 
G 4 29  GLY 29  28  28  GLY GLY F . n 
G 4 30  ILE 30  29  29  ILE ILE F . n 
G 4 31  THR 31  30  30  THR THR F . n 
G 4 32  LYS 32  31  31  LYS LYS F . n 
G 4 33  PRO 33  32  32  PRO PRO F . n 
G 4 34  ALA 34  33  33  ALA ALA F . n 
G 4 35  ILE 35  34  34  ILE ILE F . n 
G 4 36  ARG 36  35  35  ARG ARG F . n 
G 4 37  ARG 37  36  36  ARG ARG F . n 
G 4 38  LEU 38  37  37  LEU LEU F . n 
G 4 39  ALA 39  38  38  ALA ALA F . n 
G 4 40  ARG 40  39  39  ARG ARG F . n 
G 4 41  ARG 41  40  40  ARG ARG F . n 
G 4 42  GLY 42  41  41  GLY GLY F . n 
G 4 43  GLY 43  42  42  GLY GLY F . n 
G 4 44  VAL 44  43  43  VAL VAL F . n 
G 4 45  LYS 45  44  44  LYS LYS F . n 
G 4 46  ARG 46  45  45  ARG ARG F . n 
G 4 47  ILE 47  46  46  ILE ILE F . n 
G 4 48  SER 48  47  47  SER SER F . n 
G 4 49  GLY 49  48  48  GLY GLY F . n 
G 4 50  LEU 50  49  49  LEU LEU F . n 
G 4 51  ILE 51  50  50  ILE ILE F . n 
G 4 52  TYR 52  51  51  TYR TYR F . n 
G 4 53  GLU 53  52  52  GLU GLU F . n 
G 4 54  GLU 54  53  53  GLU GLU F . n 
G 4 55  THR 55  54  54  THR THR F . n 
G 4 56  ARG 56  55  55  ARG ARG F . n 
G 4 57  GLY 57  56  56  GLY GLY F . n 
G 4 58  VAL 58  57  57  VAL VAL F . n 
G 4 59  LEU 59  58  58  LEU LEU F . n 
G 4 60  LYS 60  59  59  LYS LYS F . n 
G 4 61  VAL 61  60  60  VAL VAL F . n 
G 4 62  PHE 62  61  61  PHE PHE F . n 
G 4 63  LEU 63  62  62  LEU LEU F . n 
G 4 64  GLU 64  63  63  GLU GLU F . n 
G 4 65  ASN 65  64  64  ASN ASN F . n 
G 4 66  VAL 66  65  65  VAL VAL F . n 
G 4 67  ILE 67  66  66  ILE ILE F . n 
G 4 68  ARG 68  67  67  ARG ARG F . n 
G 4 69  ASP 69  68  68  ASP ASP F . n 
G 4 70  ALA 70  69  69  ALA ALA F . n 
G 4 71  VAL 71  70  70  VAL VAL F . n 
G 4 72  THR 72  71  71  THR THR F . n 
G 4 73  TYR 73  72  72  TYR TYR F . n 
G 4 74  THR 74  73  73  THR THR F . n 
G 4 75  GLU 75  74  74  GLU GLU F . n 
G 4 76  HIS 76  75  75  HIS HIS F . n 
G 4 77  ALA 77  76  76  ALA ALA F . n 
G 4 78  LYS 78  77  77  LYS LYS F . n 
G 4 79  ARG 79  78  78  ARG ARG F . n 
G 4 80  LYS 80  79  79  LYS LYS F . n 
G 4 81  THR 81  80  80  THR THR F . n 
G 4 82  VAL 82  81  81  VAL VAL F . n 
G 4 83  THR 83  82  82  THR THR F . n 
G 4 84  ALA 84  83  83  ALA ALA F . n 
G 4 85  MET 85  84  84  MET MET F . n 
G 4 86  ASP 86  85  85  ASP ASP F . n 
G 4 87  VAL 87  86  86  VAL VAL F . n 
G 4 88  VAL 88  87  87  VAL VAL F . n 
G 4 89  TYR 89  88  88  TYR TYR F . n 
G 4 90  ALA 90  89  89  ALA ALA F . n 
G 4 91  LEU 91  90  90  LEU LEU F . n 
G 4 92  LYS 92  91  91  LYS LYS F . n 
G 4 93  ARG 93  92  92  ARG ARG F . n 
G 4 94  GLN 94  93  93  GLN GLN F . n 
G 4 95  GLY 95  94  94  GLY GLY F . n 
G 4 96  ARG 96  95  95  ARG ARG F . n 
G 4 97  THR 97  96  96  THR THR F . n 
G 4 98  LEU 98  97  97  LEU LEU F . n 
G 4 99  TYR 99  98  98  TYR TYR F . n 
G 4 100 GLY 100 99  99  GLY GLY F . n 
G 4 101 PHE 101 100 100 PHE PHE F . n 
G 4 102 GLY 102 101 ?   ?   ?   F . n 
G 4 103 GLY 103 102 ?   ?   ?   F . n 
H 5 1   MET 1   0   ?   ?   ?   H . n 
H 5 2   PRO 2   1   ?   ?   ?   H . n 
H 5 3   GLU 3   2   ?   ?   ?   H . n 
H 5 4   PRO 4   3   ?   ?   ?   H . n 
H 5 5   ALA 5   4   ?   ?   ?   H . n 
H 5 6   LYS 6   5   ?   ?   ?   H . n 
H 5 7   SER 7   6   ?   ?   ?   H . n 
H 5 8   ALA 8   7   ?   ?   ?   H . n 
H 5 9   PRO 9   8   ?   ?   ?   H . n 
H 5 10  ALA 10  9   ?   ?   ?   H . n 
H 5 11  PRO 11  10  ?   ?   ?   H . n 
H 5 12  LYS 12  11  ?   ?   ?   H . n 
H 5 13  LYS 13  12  ?   ?   ?   H . n 
H 5 14  GLY 14  13  ?   ?   ?   H . n 
H 5 15  SER 15  14  ?   ?   ?   H . n 
H 5 16  LYS 16  15  ?   ?   ?   H . n 
H 5 17  LYS 17  16  ?   ?   ?   H . n 
H 5 18  ALA 18  17  ?   ?   ?   H . n 
H 5 19  VAL 19  18  ?   ?   ?   H . n 
H 5 20  THR 20  19  ?   ?   ?   H . n 
H 5 21  LYS 21  20  ?   ?   ?   H . n 
H 5 22  ALA 22  21  ?   ?   ?   H . n 
H 5 23  GLN 23  22  ?   ?   ?   H . n 
H 5 24  LYS 24  23  ?   ?   ?   H . n 
H 5 25  LYS 25  24  ?   ?   ?   H . n 
H 5 26  ASP 26  25  ?   ?   ?   H . n 
H 5 27  GLY 27  26  ?   ?   ?   H . n 
H 5 28  LYS 28  27  ?   ?   ?   H . n 
H 5 29  LYS 29  28  ?   ?   ?   H . n 
H 5 30  ARG 30  29  ?   ?   ?   H . n 
H 5 31  LYS 31  30  ?   ?   ?   H . n 
H 5 32  ARG 32  31  ?   ?   ?   H . n 
H 5 33  SER 33  32  ?   ?   ?   H . n 
H 5 34  ARG 34  33  ?   ?   ?   H . n 
H 5 35  LYS 35  34  ?   ?   ?   H . n 
H 5 36  GLU 36  35  ?   ?   ?   H . n 
H 5 37  SER 37  36  36  SER SER H . n 
H 5 38  TYR 38  37  37  TYR TYR H . n 
H 5 39  SER 39  38  38  SER SER H . n 
H 5 40  ILE 40  39  39  ILE ILE H . n 
H 5 41  TYR 41  40  40  TYR TYR H . n 
H 5 42  VAL 42  41  41  VAL VAL H . n 
H 5 43  TYR 43  42  42  TYR TYR H . n 
H 5 44  LYS 44  43  43  LYS LYS H . n 
H 5 45  VAL 45  44  44  VAL VAL H . n 
H 5 46  LEU 46  45  45  LEU LEU H . n 
H 5 47  LYS 47  46  46  LYS LYS H . n 
H 5 48  GLN 48  47  47  GLN GLN H . n 
H 5 49  VAL 49  48  48  VAL VAL H . n 
H 5 50  HIS 50  49  49  HIS HIS H . n 
H 5 51  PRO 51  50  50  PRO PRO H . n 
H 5 52  ASP 52  51  51  ASP ASP H . n 
H 5 53  THR 53  52  52  THR THR H . n 
H 5 54  GLY 54  53  53  GLY GLY H . n 
H 5 55  ILE 55  54  54  ILE ILE H . n 
H 5 56  SER 56  55  55  SER SER H . n 
H 5 57  SER 57  56  56  SER SER H . n 
H 5 58  LYS 58  57  57  LYS LYS H . n 
H 5 59  ALA 59  58  58  ALA ALA H . n 
H 5 60  MET 60  59  59  MET MET H . n 
H 5 61  GLY 61  60  60  GLY GLY H . n 
H 5 62  ILE 62  61  61  ILE ILE H . n 
H 5 63  MET 63  62  62  MET MET H . n 
H 5 64  ASN 64  63  63  ASN ASN H . n 
H 5 65  SER 65  64  64  SER SER H . n 
H 5 66  PHE 66  65  65  PHE PHE H . n 
H 5 67  VAL 67  66  66  VAL VAL H . n 
H 5 68  ASN 68  67  67  ASN ASN H . n 
H 5 69  ASP 69  68  68  ASP ASP H . n 
H 5 70  ILE 70  69  69  ILE ILE H . n 
H 5 71  PHE 71  70  70  PHE PHE H . n 
H 5 72  GLU 72  71  71  GLU GLU H . n 
H 5 73  ARG 73  72  72  ARG ARG H . n 
H 5 74  ILE 74  73  73  ILE ILE H . n 
H 5 75  ALA 75  74  74  ALA ALA H . n 
H 5 76  GLY 76  75  75  GLY GLY H . n 
H 5 77  GLU 77  76  76  GLU GLU H . n 
H 5 78  ALA 78  77  77  ALA ALA H . n 
H 5 79  SER 79  78  78  SER SER H . n 
H 5 80  ARG 80  79  79  ARG ARG H . n 
H 5 81  LEU 81  80  80  LEU LEU H . n 
H 5 82  ALA 82  81  81  ALA ALA H . n 
H 5 83  HIS 83  82  82  HIS HIS H . n 
H 5 84  TYR 84  83  83  TYR TYR H . n 
H 5 85  ASN 85  84  84  ASN ASN H . n 
H 5 86  LYS 86  85  85  LYS LYS H . n 
H 5 87  ARG 87  86  86  ARG ARG H . n 
H 5 88  SER 88  87  87  SER SER H . n 
H 5 89  THR 89  88  88  THR THR H . n 
H 5 90  ILE 90  89  89  ILE ILE H . n 
H 5 91  THR 91  90  90  THR THR H . n 
H 5 92  SER 92  91  91  SER SER H . n 
H 5 93  ARG 93  92  92  ARG ARG H . n 
H 5 94  GLU 94  93  93  GLU GLU H . n 
H 5 95  ILE 95  94  94  ILE ILE H . n 
H 5 96  GLN 96  95  95  GLN GLN H . n 
H 5 97  THR 97  96  96  THR THR H . n 
H 5 98  ALA 98  97  97  ALA ALA H . n 
H 5 99  VAL 99  98  98  VAL VAL H . n 
H 5 100 ARG 100 99  99  ARG ARG H . n 
H 5 101 LEU 101 100 100 LEU LEU H . n 
H 5 102 LEU 102 101 101 LEU LEU H . n 
H 5 103 LEU 103 102 102 LEU LEU H . n 
H 5 104 PRO 104 103 103 PRO PRO H . n 
H 5 105 GLY 105 104 104 GLY GLY H . n 
H 5 106 GLU 106 105 105 GLU GLU H . n 
H 5 107 LEU 107 106 106 LEU LEU H . n 
H 5 108 ALA 108 107 107 ALA ALA H . n 
H 5 109 LYS 109 108 108 LYS LYS H . n 
H 5 110 HIS 110 109 109 HIS HIS H . n 
H 5 111 ALA 111 110 110 ALA ALA H . n 
H 5 112 VAL 112 111 111 VAL VAL H . n 
H 5 113 SER 113 112 112 SER SER H . n 
H 5 114 GLU 114 113 113 GLU GLU H . n 
H 5 115 GLY 115 114 114 GLY GLY H . n 
H 5 116 THR 116 115 115 THR THR H . n 
H 5 117 LYS 117 116 116 LYS LYS H . n 
H 5 118 ALA 118 117 117 ALA ALA H . n 
H 5 119 VAL 119 118 118 VAL VAL H . n 
H 5 120 THR 120 119 119 THR THR H . n 
H 5 121 LYS 121 120 120 LYS LYS H . n 
H 5 122 TYR 122 121 121 TYR TYR H . n 
H 5 123 THR 123 122 122 THR THR H . n 
H 5 124 SER 124 123 123 SER SER H . n 
H 5 125 SER 125 124 ?   ?   ?   H . n 
H 5 126 LYS 126 125 ?   ?   ?   H . n 
I 6 1   MET 1   0   ?   ?   ?   C . n 
I 6 2   PRO 2   1   ?   ?   ?   C . n 
I 6 3   ARG 3   2   ?   ?   ?   C . n 
I 6 4   ARG 4   3   ?   ?   ?   C . n 
I 6 5   ARG 5   4   ?   ?   ?   C . n 
I 6 6   ARG 6   5   ?   ?   ?   C . n 
I 6 7   ARG 7   6   ?   ?   ?   C . n 
I 6 8   ARG 8   7   ?   ?   ?   C . n 
I 6 9   GLY 9   8   ?   ?   ?   C . n 
I 6 10  SER 10  9   ?   ?   ?   C . n 
I 6 11  SER 11  10  ?   ?   ?   C . n 
I 6 12  GLY 12  11  ?   ?   ?   C . n 
I 6 13  ALA 13  12  ?   ?   ?   C . n 
I 6 14  GLY 14  13  ?   ?   ?   C . n 
I 6 15  GLY 15  14  ?   ?   ?   C . n 
I 6 16  ARG 16  15  ?   ?   ?   C . n 
I 6 17  GLY 17  16  ?   ?   ?   C . n 
I 6 18  ARG 18  17  ?   ?   ?   C . n 
I 6 19  THR 19  18  ?   ?   ?   C . n 
I 6 20  CYS 20  19  ?   ?   ?   C . n 
I 6 21  SER 21  20  20  SER SER C . n 
I 6 22  ARG 22  21  21  ARG ARG C . n 
I 6 23  THR 23  22  22  THR THR C . n 
I 6 24  VAL 24  23  23  VAL VAL C . n 
I 6 25  ARG 25  24  24  ARG ARG C . n 
I 6 26  ALA 26  25  25  ALA ALA C . n 
I 6 27  GLU 27  26  26  GLU GLU C . n 
I 6 28  LEU 28  27  27  LEU LEU C . n 
I 6 29  SER 29  28  28  SER SER C . n 
I 6 30  PHE 30  29  29  PHE PHE C . n 
I 6 31  SER 31  30  30  SER SER C . n 
I 6 32  VAL 32  31  31  VAL VAL C . n 
I 6 33  SER 33  32  32  SER SER C . n 
I 6 34  GLN 34  33  33  GLN GLN C . n 
I 6 35  VAL 35  34  34  VAL VAL C . n 
I 6 36  GLU 36  35  35  GLU GLU C . n 
I 6 37  ARG 37  36  36  ARG ARG C . n 
I 6 38  SER 38  37  37  SER SER C . n 
I 6 39  LEU 39  38  38  LEU LEU C . n 
I 6 40  ARG 40  39  39  ARG ARG C . n 
I 6 41  GLU 41  40  40  GLU GLU C . n 
I 6 42  GLY 42  41  41  GLY GLY C . n 
I 6 43  HIS 43  42  42  HIS HIS C . n 
I 6 44  TYR 44  43  43  TYR TYR C . n 
I 6 45  ALA 45  44  44  ALA ALA C . n 
I 6 46  GLN 46  45  45  GLN GLN C . n 
I 6 47  ARG 47  46  46  ARG ARG C . n 
I 6 48  LEU 48  47  47  LEU LEU C . n 
I 6 49  SER 49  48  48  SER SER C . n 
I 6 50  ARG 50  49  49  ARG ARG C . n 
I 6 51  THR 51  50  50  THR THR C . n 
I 6 52  ALA 52  51  51  ALA ALA C . n 
I 6 53  PRO 53  52  52  PRO PRO C . n 
I 6 54  VAL 54  53  53  VAL VAL C . n 
I 6 55  TYR 55  54  54  TYR TYR C . n 
I 6 56  LEU 56  55  55  LEU LEU C . n 
I 6 57  ALA 57  56  56  ALA ALA C . n 
I 6 58  ALA 58  57  57  ALA ALA C . n 
I 6 59  VAL 59  58  58  VAL VAL C . n 
I 6 60  ILE 60  59  59  ILE ILE C . n 
I 6 61  GLU 61  60  60  GLU GLU C . n 
I 6 62  TYR 62  61  61  TYR TYR C . n 
I 6 63  LEU 63  62  62  LEU LEU C . n 
I 6 64  THR 64  63  63  THR THR C . n 
I 6 65  ALA 65  64  64  ALA ALA C . n 
I 6 66  LYS 66  65  65  LYS LYS C . n 
I 6 67  VAL 67  66  66  VAL VAL C . n 
I 6 68  LEU 68  67  67  LEU LEU C . n 
I 6 69  GLU 69  68  68  GLU GLU C . n 
I 6 70  LEU 70  69  69  LEU LEU C . n 
I 6 71  ALA 71  70  70  ALA ALA C . n 
I 6 72  GLY 72  71  71  GLY GLY C . n 
I 6 73  ASN 73  72  72  ASN ASN C . n 
I 6 74  GLU 74  73  73  GLU GLU C . n 
I 6 75  ALA 75  74  74  ALA ALA C . n 
I 6 76  GLN 76  75  75  GLN GLN C . n 
I 6 77  ASN 77  76  76  ASN ASN C . n 
I 6 78  SER 78  77  77  SER SER C . n 
I 6 79  GLY 79  78  78  GLY GLY C . n 
I 6 80  GLU 80  79  79  GLU GLU C . n 
I 6 81  ARG 81  80  80  ARG ARG C . n 
I 6 82  ASN 82  81  81  ASN ASN C . n 
I 6 83  ILE 83  82  82  ILE ILE C . n 
I 6 84  THR 84  83  83  THR THR C . n 
I 6 85  PRO 85  84  84  PRO PRO C . n 
I 6 86  LEU 86  85  85  LEU LEU C . n 
I 6 87  LEU 87  86  86  LEU LEU C . n 
I 6 88  LEU 88  87  87  LEU LEU C . n 
I 6 89  ASP 89  88  88  ASP ASP C . n 
I 6 90  MET 90  89  89  MET MET C . n 
I 6 91  VAL 91  90  90  VAL VAL C . n 
I 6 92  VAL 92  91  91  VAL VAL C . n 
I 6 93  HIS 93  92  92  HIS HIS C . n 
I 6 94  ASN 94  93  93  ASN ASN C . n 
I 6 95  ASP 95  94  94  ASP ASP C . n 
I 6 96  ARG 96  95  95  ARG ARG C . n 
I 6 97  LEU 97  96  96  LEU LEU C . n 
I 6 98  LEU 98  97  97  LEU LEU C . n 
I 6 99  SER 99  98  98  SER SER C . n 
I 6 100 THR 100 99  99  THR THR C . n 
I 6 101 LEU 101 100 100 LEU LEU C . n 
I 6 102 PHE 102 101 101 PHE PHE C . n 
I 6 103 ASN 103 102 102 ASN ASN C . n 
I 6 104 THR 104 103 103 THR THR C . n 
I 6 105 THR 105 104 104 THR THR C . n 
I 6 106 THR 106 105 105 THR THR C . n 
I 6 107 ILE 107 106 106 ILE ILE C . n 
I 6 108 SER 108 107 107 SER SER C . n 
I 6 109 GLN 109 108 108 GLN GLN C . n 
I 6 110 VAL 110 109 109 VAL VAL C . n 
I 6 111 ALA 111 110 ?   ?   ?   C . n 
I 6 112 PRO 112 111 ?   ?   ?   C . n 
I 6 113 GLY 113 112 ?   ?   ?   C . n 
I 6 114 GLU 114 113 ?   ?   ?   C . n 
I 6 115 ASP 115 114 ?   ?   ?   C . n 
J 6 1   MET 1   0   ?   ?   ?   G . n 
J 6 2   PRO 2   1   ?   ?   ?   G . n 
J 6 3   ARG 3   2   ?   ?   ?   G . n 
J 6 4   ARG 4   3   ?   ?   ?   G . n 
J 6 5   ARG 5   4   ?   ?   ?   G . n 
J 6 6   ARG 6   5   ?   ?   ?   G . n 
J 6 7   ARG 7   6   ?   ?   ?   G . n 
J 6 8   ARG 8   7   ?   ?   ?   G . n 
J 6 9   GLY 9   8   ?   ?   ?   G . n 
J 6 10  SER 10  9   ?   ?   ?   G . n 
J 6 11  SER 11  10  ?   ?   ?   G . n 
J 6 12  GLY 12  11  ?   ?   ?   G . n 
J 6 13  ALA 13  12  ?   ?   ?   G . n 
J 6 14  GLY 14  13  ?   ?   ?   G . n 
J 6 15  GLY 15  14  ?   ?   ?   G . n 
J 6 16  ARG 16  15  ?   ?   ?   G . n 
J 6 17  GLY 17  16  ?   ?   ?   G . n 
J 6 18  ARG 18  17  ?   ?   ?   G . n 
J 6 19  THR 19  18  ?   ?   ?   G . n 
J 6 20  CYS 20  19  ?   ?   ?   G . n 
J 6 21  SER 21  20  20  SER SER G . n 
J 6 22  ARG 22  21  21  ARG ARG G . n 
J 6 23  THR 23  22  22  THR THR G . n 
J 6 24  VAL 24  23  23  VAL VAL G . n 
J 6 25  ARG 25  24  24  ARG ARG G . n 
J 6 26  ALA 26  25  25  ALA ALA G . n 
J 6 27  GLU 27  26  26  GLU GLU G . n 
J 6 28  LEU 28  27  27  LEU LEU G . n 
J 6 29  SER 29  28  28  SER SER G . n 
J 6 30  PHE 30  29  29  PHE PHE G . n 
J 6 31  SER 31  30  30  SER SER G . n 
J 6 32  VAL 32  31  31  VAL VAL G . n 
J 6 33  SER 33  32  32  SER SER G . n 
J 6 34  GLN 34  33  33  GLN GLN G . n 
J 6 35  VAL 35  34  34  VAL VAL G . n 
J 6 36  GLU 36  35  35  GLU GLU G . n 
J 6 37  ARG 37  36  36  ARG ARG G . n 
J 6 38  SER 38  37  37  SER SER G . n 
J 6 39  LEU 39  38  38  LEU LEU G . n 
J 6 40  ARG 40  39  39  ARG ARG G . n 
J 6 41  GLU 41  40  40  GLU GLU G . n 
J 6 42  GLY 42  41  41  GLY GLY G . n 
J 6 43  HIS 43  42  42  HIS HIS G . n 
J 6 44  TYR 44  43  43  TYR TYR G . n 
J 6 45  ALA 45  44  44  ALA ALA G . n 
J 6 46  GLN 46  45  45  GLN GLN G . n 
J 6 47  ARG 47  46  46  ARG ARG G . n 
J 6 48  LEU 48  47  47  LEU LEU G . n 
J 6 49  SER 49  48  48  SER SER G . n 
J 6 50  ARG 50  49  49  ARG ARG G . n 
J 6 51  THR 51  50  50  THR THR G . n 
J 6 52  ALA 52  51  51  ALA ALA G . n 
J 6 53  PRO 53  52  52  PRO PRO G . n 
J 6 54  VAL 54  53  53  VAL VAL G . n 
J 6 55  TYR 55  54  54  TYR TYR G . n 
J 6 56  LEU 56  55  55  LEU LEU G . n 
J 6 57  ALA 57  56  56  ALA ALA G . n 
J 6 58  ALA 58  57  57  ALA ALA G . n 
J 6 59  VAL 59  58  58  VAL VAL G . n 
J 6 60  ILE 60  59  59  ILE ILE G . n 
J 6 61  GLU 61  60  60  GLU GLU G . n 
J 6 62  TYR 62  61  61  TYR TYR G . n 
J 6 63  LEU 63  62  62  LEU LEU G . n 
J 6 64  THR 64  63  63  THR THR G . n 
J 6 65  ALA 65  64  64  ALA ALA G . n 
J 6 66  LYS 66  65  65  LYS LYS G . n 
J 6 67  VAL 67  66  66  VAL VAL G . n 
J 6 68  LEU 68  67  67  LEU LEU G . n 
J 6 69  GLU 69  68  68  GLU GLU G . n 
J 6 70  LEU 70  69  69  LEU LEU G . n 
J 6 71  ALA 71  70  70  ALA ALA G . n 
J 6 72  GLY 72  71  71  GLY GLY G . n 
J 6 73  ASN 73  72  72  ASN ASN G . n 
J 6 74  GLU 74  73  73  GLU GLU G . n 
J 6 75  ALA 75  74  74  ALA ALA G . n 
J 6 76  GLN 76  75  75  GLN GLN G . n 
J 6 77  ASN 77  76  76  ASN ASN G . n 
J 6 78  SER 78  77  77  SER SER G . n 
J 6 79  GLY 79  78  78  GLY GLY G . n 
J 6 80  GLU 80  79  79  GLU GLU G . n 
J 6 81  ARG 81  80  80  ARG ARG G . n 
J 6 82  ASN 82  81  81  ASN ASN G . n 
J 6 83  ILE 83  82  82  ILE ILE G . n 
J 6 84  THR 84  83  83  THR THR G . n 
J 6 85  PRO 85  84  84  PRO PRO G . n 
J 6 86  LEU 86  85  85  LEU LEU G . n 
J 6 87  LEU 87  86  86  LEU LEU G . n 
J 6 88  LEU 88  87  87  LEU LEU G . n 
J 6 89  ASP 89  88  88  ASP ASP G . n 
J 6 90  MET 90  89  89  MET MET G . n 
J 6 91  VAL 91  90  90  VAL VAL G . n 
J 6 92  VAL 92  91  91  VAL VAL G . n 
J 6 93  HIS 93  92  92  HIS HIS G . n 
J 6 94  ASN 94  93  93  ASN ASN G . n 
J 6 95  ASP 95  94  94  ASP ASP G . n 
J 6 96  ARG 96  95  95  ARG ARG G . n 
J 6 97  LEU 97  96  96  LEU LEU G . n 
J 6 98  LEU 98  97  97  LEU LEU G . n 
J 6 99  SER 99  98  98  SER SER G . n 
J 6 100 THR 100 99  99  THR THR G . n 
J 6 101 LEU 101 100 100 LEU LEU G . n 
J 6 102 PHE 102 101 101 PHE PHE G . n 
J 6 103 ASN 103 102 102 ASN ASN G . n 
J 6 104 THR 104 103 103 THR THR G . n 
J 6 105 THR 105 104 104 THR THR G . n 
J 6 106 THR 106 105 105 THR THR G . n 
J 6 107 ILE 107 106 106 ILE ILE G . n 
J 6 108 SER 108 107 107 SER SER G . n 
J 6 109 GLN 109 108 108 GLN GLN G . n 
J 6 110 VAL 110 109 109 VAL VAL G . n 
J 6 111 ALA 111 110 ?   ?   ?   G . n 
J 6 112 PRO 112 111 ?   ?   ?   G . n 
J 6 113 GLY 113 112 ?   ?   ?   G . n 
J 6 114 GLU 114 113 ?   ?   ?   G . n 
J 6 115 ASP 115 114 ?   ?   ?   G . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   decameric 
_pdbx_struct_assembly.oligomeric_count     10 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 38750 ? 
1 MORE         -321  ? 
1 'SSA (A^2)'  57100 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-09-23 
2 'Structure model' 1 1 2021-04-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_CSD'          
5  2 'Structure model' '_citation.journal_id_ISSN'         
6  2 'Structure model' '_citation.journal_volume'          
7  2 'Structure model' '_citation.page_first'              
8  2 'Structure model' '_citation.page_last'               
9  2 'Structure model' '_citation.pdbx_database_id_DOI'    
10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
11 2 'Structure model' '_citation.title'                   
12 2 'Structure model' '_citation.year'                    
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   PHENIX 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                1.16_3549: 
_software.pdbx_ordinal           1 
# 
_em_3d_fitting.entry_id          6M4G 
_em_3d_fitting.id                1 
_em_3d_fitting.details           ? 
_em_3d_fitting.overall_b_value   ? 
_em_3d_fitting.ref_protocol      ? 
_em_3d_fitting.ref_space         ? 
_em_3d_fitting.target_criteria   ? 
_em_3d_fitting.method            ? 
# 
_em_3d_reconstruction.entry_id                    6M4G 
_em_3d_reconstruction.id                          1 
_em_3d_reconstruction.algorithm                   ? 
_em_3d_reconstruction.details                     ? 
_em_3d_reconstruction.refinement_type             ? 
_em_3d_reconstruction.image_processing_id         1 
_em_3d_reconstruction.num_class_averages          ? 
_em_3d_reconstruction.num_particles               62980 
_em_3d_reconstruction.resolution                  2.8 
_em_3d_reconstruction.resolution_method           'FSC 0.143 CUT-OFF' 
_em_3d_reconstruction.symmetry_type               POINT 
_em_3d_reconstruction.method                      ? 
_em_3d_reconstruction.nominal_pixel_size          ? 
_em_3d_reconstruction.actual_pixel_size           ? 
_em_3d_reconstruction.magnification_calibration   ? 
# 
_em_buffer.id            1 
_em_buffer.details       ? 
_em_buffer.pH            7.5 
_em_buffer.specimen_id   1 
_em_buffer.name          ? 
# 
_em_entity_assembly.id                   1 
_em_entity_assembly.parent_id            0 
_em_entity_assembly.details              ? 
_em_entity_assembly.name                 'H2A.B nucleosome' 
_em_entity_assembly.source               RECOMBINANT 
_em_entity_assembly.type                 COMPLEX 
_em_entity_assembly.entity_id_list       '1, 2, 3, 4, 5, 6' 
_em_entity_assembly.synonym              ? 
_em_entity_assembly.oligomeric_details   ? 
# 
_em_imaging.id                              1 
_em_imaging.entry_id                        6M4G 
_em_imaging.accelerating_voltage            300 
_em_imaging.alignment_procedure             ? 
_em_imaging.c2_aperture_diameter            ? 
_em_imaging.calibrated_defocus_max          ? 
_em_imaging.calibrated_defocus_min          ? 
_em_imaging.calibrated_magnification        ? 
_em_imaging.cryogen                         ? 
_em_imaging.details                         ? 
_em_imaging.electron_source                 'FIELD EMISSION GUN' 
_em_imaging.illumination_mode               'FLOOD BEAM' 
_em_imaging.microscope_model                'FEI TITAN KRIOS' 
_em_imaging.mode                            'BRIGHT FIELD' 
_em_imaging.nominal_cs                      ? 
_em_imaging.nominal_defocus_max             ? 
_em_imaging.nominal_defocus_min             ? 
_em_imaging.nominal_magnification           ? 
_em_imaging.recording_temperature_maximum   ? 
_em_imaging.recording_temperature_minimum   ? 
_em_imaging.residual_tilt                   ? 
_em_imaging.specimen_holder_model           ? 
_em_imaging.specimen_id                     1 
_em_imaging.citation_id                     ? 
_em_imaging.date                            ? 
_em_imaging.temperature                     ? 
_em_imaging.tilt_angle_min                  ? 
_em_imaging.tilt_angle_max                  ? 
_em_imaging.astigmatism                     ? 
_em_imaging.detector_distance               ? 
_em_imaging.electron_beam_tilt_params       ? 
_em_imaging.specimen_holder_type            ? 
# 
_em_vitrification.id                    1 
_em_vitrification.specimen_id           1 
_em_vitrification.chamber_temperature   ? 
_em_vitrification.cryogen_name          ETHANE 
_em_vitrification.details               ? 
_em_vitrification.humidity              ? 
_em_vitrification.instrument            ? 
_em_vitrification.entry_id              6M4G 
_em_vitrification.citation_id           ? 
_em_vitrification.method                ? 
_em_vitrification.temp                  ? 
_em_vitrification.time_resolved_state   ? 
# 
_em_experiment.entry_id                6M4G 
_em_experiment.id                      1 
_em_experiment.aggregation_state       PARTICLE 
_em_experiment.reconstruction_method   'SINGLE PARTICLE' 
_em_experiment.entity_assembly_id      1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 D GLU 76 ? ? NH2 D ARG 79 ? ? 2.17 
2 1 OE1 H GLU 76 ? ? NH2 H ARG 79 ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" I DG 38  ? ? "C1'" I DG 38  ? ? N9    I DG 38  ? ? 103.78 108.00 -4.22 0.70 N 
2 1 "O4'" I DG 41  ? ? "C1'" I DG 41  ? ? N9    I DG 41  ? ? 103.61 108.00 -4.39 0.70 N 
3 1 "O4'" I DG 53  ? ? "C1'" I DG 53  ? ? "C2'" I DG 53  ? ? 110.10 106.80 3.30  0.50 N 
4 1 "O4'" I DG 53  ? ? "C1'" I DG 53  ? ? N9    I DG 53  ? ? 110.36 108.30 2.06  0.30 N 
5 1 "O4'" I DT 57  ? ? "C1'" I DT 57  ? ? N1    I DT 57  ? ? 111.33 108.30 3.03  0.30 N 
6 1 "O4'" J DC 28  ? ? "C1'" J DC 28  ? ? N1    J DC 28  ? ? 110.84 108.30 2.54  0.30 N 
7 1 "O4'" J DG 102 ? ? "C1'" J DG 102 ? ? N9    J DG 102 ? ? 110.18 108.30 1.88  0.30 N 
8 1 "O4'" J DC 116 ? ? "C1'" J DC 116 ? ? "C2'" J DC 116 ? ? 109.85 106.80 3.05  0.50 N 
9 1 "O4'" J DC 119 ? ? "C1'" J DC 119 ? ? N1    J DC 119 ? ? 113.05 108.30 4.75  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG C 80 ? ? -93.67 -60.21 
2 1 ASP C 94 ? ? 60.28  72.00  
3 1 ARG C 95 ? ? -53.70 -9.42  
4 1 ARG G 80 ? ? -93.87 -60.13 
5 1 ASP G 94 ? ? 60.29  71.93  
6 1 ARG G 95 ? ? -53.59 -9.49  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DA 
_pdbx_validate_planes.auth_asym_id    I 
_pdbx_validate_planes.auth_seq_id     117 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.048 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     I 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     DT 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      58 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     C7 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    A 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    DT 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     58 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    C7 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 I DA  1   ? A DA  1   
2   1 Y 1 I DT  2   ? A DT  2   
3   1 Y 1 I DC  3   ? A DC  3   
4   1 Y 1 I DG  4   ? A DG  4   
5   1 Y 1 I DG  5   ? A DG  5   
6   1 Y 1 I DA  6   ? A DA  6   
7   1 Y 1 I DT  7   ? A DT  7   
8   1 Y 1 I DG  8   ? A DG  8   
9   1 Y 1 I DT  9   ? A DT  9   
10  1 Y 1 I DA  10  ? A DA  10  
11  1 Y 1 I DT  11  ? A DT  11  
12  1 Y 1 I DA  12  ? A DA  12  
13  1 Y 1 I DT  13  ? A DT  13  
14  1 Y 1 I DA  14  ? A DA  14  
15  1 Y 1 I DT  15  ? A DT  15  
16  1 Y 1 I DC  16  ? A DC  16  
17  1 Y 1 I DT  17  ? A DT  17  
18  1 Y 1 I DG  18  ? A DG  18  
19  1 Y 1 I DA  19  ? A DA  19  
20  1 Y 1 I DC  20  ? A DC  20  
21  1 Y 1 I DA  21  ? A DA  21  
22  1 Y 1 I DC  22  ? A DC  22  
23  1 Y 1 I DG  23  ? A DG  23  
24  1 Y 1 I DT  24  ? A DT  24  
25  1 Y 1 I DG  25  ? A DG  25  
26  1 Y 1 I DC  26  ? A DC  26  
27  1 Y 1 I DC  27  ? A DC  27  
28  1 Y 1 I DA  121 ? A DA  121 
29  1 Y 1 I DG  122 ? A DG  122 
30  1 Y 1 I DC  123 ? A DC  123 
31  1 Y 1 I DG  124 ? A DG  124 
32  1 Y 1 I DG  125 ? A DG  125 
33  1 Y 1 I DC  126 ? A DC  126 
34  1 Y 1 I DC  127 ? A DC  127 
35  1 Y 1 I DT  128 ? A DT  128 
36  1 Y 1 I DC  129 ? A DC  129 
37  1 Y 1 I DG  130 ? A DG  130 
38  1 Y 1 I DG  131 ? A DG  131 
39  1 Y 1 I DC  132 ? A DC  132 
40  1 Y 1 I DA  133 ? A DA  133 
41  1 Y 1 I DC  134 ? A DC  134 
42  1 Y 1 I DC  135 ? A DC  135 
43  1 Y 1 I DG  136 ? A DG  136 
44  1 Y 1 I DG  137 ? A DG  137 
45  1 Y 1 I DG  138 ? A DG  138 
46  1 Y 1 I DA  139 ? A DA  139 
47  1 Y 1 I DT  140 ? A DT  140 
48  1 Y 1 I DT  141 ? A DT  141 
49  1 Y 1 I DC  142 ? A DC  142 
50  1 Y 1 I DT  143 ? A DT  143 
51  1 Y 1 I DC  144 ? A DC  144 
52  1 Y 1 I DG  145 ? A DG  145 
53  1 Y 1 I DA  146 ? A DA  146 
54  1 Y 1 I DT  147 ? A DT  147 
55  1 Y 1 J DA  1   ? B DA  1   
56  1 Y 1 J DT  2   ? B DT  2   
57  1 Y 1 J DC  3   ? B DC  3   
58  1 Y 1 J DG  4   ? B DG  4   
59  1 Y 1 J DA  5   ? B DA  5   
60  1 Y 1 J DG  6   ? B DG  6   
61  1 Y 1 J DA  7   ? B DA  7   
62  1 Y 1 J DA  8   ? B DA  8   
63  1 Y 1 J DT  9   ? B DT  9   
64  1 Y 1 J DC  10  ? B DC  10  
65  1 Y 1 J DC  11  ? B DC  11  
66  1 Y 1 J DC  12  ? B DC  12  
67  1 Y 1 J DG  13  ? B DG  13  
68  1 Y 1 J DG  14  ? B DG  14  
69  1 Y 1 J DT  15  ? B DT  15  
70  1 Y 1 J DG  16  ? B DG  16  
71  1 Y 1 J DC  17  ? B DC  17  
72  1 Y 1 J DC  18  ? B DC  18  
73  1 Y 1 J DG  19  ? B DG  19  
74  1 Y 1 J DA  20  ? B DA  20  
75  1 Y 1 J DG  21  ? B DG  21  
76  1 Y 1 J DG  22  ? B DG  22  
77  1 Y 1 J DC  23  ? B DC  23  
78  1 Y 1 J DC  24  ? B DC  24  
79  1 Y 1 J DG  25  ? B DG  25  
80  1 Y 1 J DC  26  ? B DC  26  
81  1 Y 1 J DT  27  ? B DT  27  
82  1 Y 1 J DG  121 ? B DG  121 
83  1 Y 1 J DG  122 ? B DG  122 
84  1 Y 1 J DC  123 ? B DC  123 
85  1 Y 1 J DA  124 ? B DA  124 
86  1 Y 1 J DC  125 ? B DC  125 
87  1 Y 1 J DG  126 ? B DG  126 
88  1 Y 1 J DT  127 ? B DT  127 
89  1 Y 1 J DG  128 ? B DG  128 
90  1 Y 1 J DT  129 ? B DT  129 
91  1 Y 1 J DC  130 ? B DC  130 
92  1 Y 1 J DA  131 ? B DA  131 
93  1 Y 1 J DG  132 ? B DG  132 
94  1 Y 1 J DA  133 ? B DA  133 
95  1 Y 1 J DT  134 ? B DT  134 
96  1 Y 1 J DA  135 ? B DA  135 
97  1 Y 1 J DT  136 ? B DT  136 
98  1 Y 1 J DA  137 ? B DA  137 
99  1 Y 1 J DT  138 ? B DT  138 
100 1 Y 1 J DA  139 ? B DA  139 
101 1 Y 1 J DC  140 ? B DC  140 
102 1 Y 1 J DA  141 ? B DA  141 
103 1 Y 1 J DT  142 ? B DT  142 
104 1 Y 1 J DC  143 ? B DC  143 
105 1 Y 1 J DC  144 ? B DC  144 
106 1 Y 1 J DG  145 ? B DG  145 
107 1 Y 1 J DA  146 ? B DA  146 
108 1 Y 1 J DT  147 ? B DT  147 
109 1 Y 1 A MET 0   ? C MET 1   
110 1 Y 1 A ALA 1   ? C ALA 2   
111 1 Y 1 A ARG 2   ? C ARG 3   
112 1 Y 1 A THR 3   ? C THR 4   
113 1 Y 1 A LYS 4   ? C LYS 5   
114 1 Y 1 A GLN 5   ? C GLN 6   
115 1 Y 1 A THR 6   ? C THR 7   
116 1 Y 1 A ALA 7   ? C ALA 8   
117 1 Y 1 A ARG 8   ? C ARG 9   
118 1 Y 1 A LYS 9   ? C LYS 10  
119 1 Y 1 A SER 10  ? C SER 11  
120 1 Y 1 A THR 11  ? C THR 12  
121 1 Y 1 A GLY 12  ? C GLY 13  
122 1 Y 1 A GLY 13  ? C GLY 14  
123 1 Y 1 A LYS 14  ? C LYS 15  
124 1 Y 1 A ALA 15  ? C ALA 16  
125 1 Y 1 A PRO 16  ? C PRO 17  
126 1 Y 1 A ARG 17  ? C ARG 18  
127 1 Y 1 A LYS 18  ? C LYS 19  
128 1 Y 1 A GLN 19  ? C GLN 20  
129 1 Y 1 A LEU 20  ? C LEU 21  
130 1 Y 1 A ALA 21  ? C ALA 22  
131 1 Y 1 A THR 22  ? C THR 23  
132 1 Y 1 A LYS 23  ? C LYS 24  
133 1 Y 1 A ALA 24  ? C ALA 25  
134 1 Y 1 A ALA 25  ? C ALA 26  
135 1 Y 1 A ARG 26  ? C ARG 27  
136 1 Y 1 A LYS 27  ? C LYS 28  
137 1 Y 1 A SER 28  ? C SER 29  
138 1 Y 1 A ALA 29  ? C ALA 30  
139 1 Y 1 A PRO 30  ? C PRO 31  
140 1 Y 1 A ALA 31  ? C ALA 32  
141 1 Y 1 A THR 32  ? C THR 33  
142 1 Y 1 A GLY 33  ? C GLY 34  
143 1 Y 1 A GLY 34  ? C GLY 35  
144 1 Y 1 A VAL 35  ? C VAL 36  
145 1 Y 1 A LYS 36  ? C LYS 37  
146 1 Y 1 A LYS 37  ? C LYS 38  
147 1 Y 1 A PRO 38  ? C PRO 39  
148 1 Y 1 A HIS 39  ? C HIS 40  
149 1 Y 1 A ARG 40  ? C ARG 41  
150 1 Y 1 A TYR 41  ? C TYR 42  
151 1 Y 1 A ARG 42  ? C ARG 43  
152 1 Y 1 A PRO 43  ? C PRO 44  
153 1 Y 1 A GLY 44  ? C GLY 45  
154 1 Y 1 A THR 45  ? C THR 46  
155 1 Y 1 A VAL 46  ? C VAL 47  
156 1 Y 1 A ALA 47  ? C ALA 48  
157 1 Y 1 A LEU 48  ? C LEU 49  
158 1 Y 1 A ARG 49  ? C ARG 50  
159 1 Y 1 A GLU 50  ? C GLU 51  
160 1 Y 1 A ILE 51  ? C ILE 52  
161 1 Y 1 A ARG 52  ? C ARG 53  
162 1 Y 1 A ARG 53  ? C ARG 54  
163 1 Y 1 A TYR 54  ? C TYR 55  
164 1 Y 1 A GLN 55  ? C GLN 56  
165 1 Y 1 A LYS 56  ? C LYS 57  
166 1 Y 1 A SER 57  ? C SER 58  
167 1 Y 1 A THR 58  ? C THR 59  
168 1 Y 1 A GLU 59  ? C GLU 60  
169 1 Y 1 A ARG 134 ? C ARG 135 
170 1 Y 1 A ALA 135 ? C ALA 136 
171 1 Y 1 B MET 0   ? D MET 1   
172 1 Y 1 B SER 1   ? D SER 2   
173 1 Y 1 B GLY 2   ? D GLY 3   
174 1 Y 1 B ARG 3   ? D ARG 4   
175 1 Y 1 B GLY 4   ? D GLY 5   
176 1 Y 1 B LYS 5   ? D LYS 6   
177 1 Y 1 B GLY 6   ? D GLY 7   
178 1 Y 1 B GLY 7   ? D GLY 8   
179 1 Y 1 B LYS 8   ? D LYS 9   
180 1 Y 1 B GLY 9   ? D GLY 10  
181 1 Y 1 B LEU 10  ? D LEU 11  
182 1 Y 1 B GLY 11  ? D GLY 12  
183 1 Y 1 B LYS 12  ? D LYS 13  
184 1 Y 1 B GLY 13  ? D GLY 14  
185 1 Y 1 B GLY 14  ? D GLY 15  
186 1 Y 1 B ALA 15  ? D ALA 16  
187 1 Y 1 B LYS 16  ? D LYS 17  
188 1 Y 1 B ARG 17  ? D ARG 18  
189 1 Y 1 B HIS 18  ? D HIS 19  
190 1 Y 1 B ARG 19  ? D ARG 20  
191 1 Y 1 B LYS 20  ? D LYS 21  
192 1 Y 1 B VAL 21  ? D VAL 22  
193 1 Y 1 B LEU 22  ? D LEU 23  
194 1 Y 1 B ARG 23  ? D ARG 24  
195 1 Y 1 B ASP 24  ? D ASP 25  
196 1 Y 1 B GLY 101 ? D GLY 102 
197 1 Y 1 B GLY 102 ? D GLY 103 
198 1 Y 1 D MET 0   ? E MET 1   
199 1 Y 1 D PRO 1   ? E PRO 2   
200 1 Y 1 D GLU 2   ? E GLU 3   
201 1 Y 1 D PRO 3   ? E PRO 4   
202 1 Y 1 D ALA 4   ? E ALA 5   
203 1 Y 1 D LYS 5   ? E LYS 6   
204 1 Y 1 D SER 6   ? E SER 7   
205 1 Y 1 D ALA 7   ? E ALA 8   
206 1 Y 1 D PRO 8   ? E PRO 9   
207 1 Y 1 D ALA 9   ? E ALA 10  
208 1 Y 1 D PRO 10  ? E PRO 11  
209 1 Y 1 D LYS 11  ? E LYS 12  
210 1 Y 1 D LYS 12  ? E LYS 13  
211 1 Y 1 D GLY 13  ? E GLY 14  
212 1 Y 1 D SER 14  ? E SER 15  
213 1 Y 1 D LYS 15  ? E LYS 16  
214 1 Y 1 D LYS 16  ? E LYS 17  
215 1 Y 1 D ALA 17  ? E ALA 18  
216 1 Y 1 D VAL 18  ? E VAL 19  
217 1 Y 1 D THR 19  ? E THR 20  
218 1 Y 1 D LYS 20  ? E LYS 21  
219 1 Y 1 D ALA 21  ? E ALA 22  
220 1 Y 1 D GLN 22  ? E GLN 23  
221 1 Y 1 D LYS 23  ? E LYS 24  
222 1 Y 1 D LYS 24  ? E LYS 25  
223 1 Y 1 D ASP 25  ? E ASP 26  
224 1 Y 1 D GLY 26  ? E GLY 27  
225 1 Y 1 D LYS 27  ? E LYS 28  
226 1 Y 1 D LYS 28  ? E LYS 29  
227 1 Y 1 D ARG 29  ? E ARG 30  
228 1 Y 1 D LYS 30  ? E LYS 31  
229 1 Y 1 D ARG 31  ? E ARG 32  
230 1 Y 1 D SER 32  ? E SER 33  
231 1 Y 1 D ARG 33  ? E ARG 34  
232 1 Y 1 D LYS 34  ? E LYS 35  
233 1 Y 1 D GLU 35  ? E GLU 36  
234 1 Y 1 D SER 124 ? E SER 125 
235 1 Y 1 D LYS 125 ? E LYS 126 
236 1 Y 1 E MET 0   ? F MET 1   
237 1 Y 1 E ALA 1   ? F ALA 2   
238 1 Y 1 E ARG 2   ? F ARG 3   
239 1 Y 1 E THR 3   ? F THR 4   
240 1 Y 1 E LYS 4   ? F LYS 5   
241 1 Y 1 E GLN 5   ? F GLN 6   
242 1 Y 1 E THR 6   ? F THR 7   
243 1 Y 1 E ALA 7   ? F ALA 8   
244 1 Y 1 E ARG 8   ? F ARG 9   
245 1 Y 1 E LYS 9   ? F LYS 10  
246 1 Y 1 E SER 10  ? F SER 11  
247 1 Y 1 E THR 11  ? F THR 12  
248 1 Y 1 E GLY 12  ? F GLY 13  
249 1 Y 1 E GLY 13  ? F GLY 14  
250 1 Y 1 E LYS 14  ? F LYS 15  
251 1 Y 1 E ALA 15  ? F ALA 16  
252 1 Y 1 E PRO 16  ? F PRO 17  
253 1 Y 1 E ARG 17  ? F ARG 18  
254 1 Y 1 E LYS 18  ? F LYS 19  
255 1 Y 1 E GLN 19  ? F GLN 20  
256 1 Y 1 E LEU 20  ? F LEU 21  
257 1 Y 1 E ALA 21  ? F ALA 22  
258 1 Y 1 E THR 22  ? F THR 23  
259 1 Y 1 E LYS 23  ? F LYS 24  
260 1 Y 1 E ALA 24  ? F ALA 25  
261 1 Y 1 E ALA 25  ? F ALA 26  
262 1 Y 1 E ARG 26  ? F ARG 27  
263 1 Y 1 E LYS 27  ? F LYS 28  
264 1 Y 1 E SER 28  ? F SER 29  
265 1 Y 1 E ALA 29  ? F ALA 30  
266 1 Y 1 E PRO 30  ? F PRO 31  
267 1 Y 1 E ALA 31  ? F ALA 32  
268 1 Y 1 E THR 32  ? F THR 33  
269 1 Y 1 E GLY 33  ? F GLY 34  
270 1 Y 1 E GLY 34  ? F GLY 35  
271 1 Y 1 E VAL 35  ? F VAL 36  
272 1 Y 1 E LYS 36  ? F LYS 37  
273 1 Y 1 E LYS 37  ? F LYS 38  
274 1 Y 1 E PRO 38  ? F PRO 39  
275 1 Y 1 E HIS 39  ? F HIS 40  
276 1 Y 1 E ARG 40  ? F ARG 41  
277 1 Y 1 E TYR 41  ? F TYR 42  
278 1 Y 1 E ARG 42  ? F ARG 43  
279 1 Y 1 E PRO 43  ? F PRO 44  
280 1 Y 1 E GLY 44  ? F GLY 45  
281 1 Y 1 E THR 45  ? F THR 46  
282 1 Y 1 E VAL 46  ? F VAL 47  
283 1 Y 1 E ALA 47  ? F ALA 48  
284 1 Y 1 E LEU 48  ? F LEU 49  
285 1 Y 1 E ARG 49  ? F ARG 50  
286 1 Y 1 E GLU 50  ? F GLU 51  
287 1 Y 1 E ILE 51  ? F ILE 52  
288 1 Y 1 E ARG 52  ? F ARG 53  
289 1 Y 1 E ARG 53  ? F ARG 54  
290 1 Y 1 E TYR 54  ? F TYR 55  
291 1 Y 1 E GLN 55  ? F GLN 56  
292 1 Y 1 E LYS 56  ? F LYS 57  
293 1 Y 1 E SER 57  ? F SER 58  
294 1 Y 1 E THR 58  ? F THR 59  
295 1 Y 1 E GLU 59  ? F GLU 60  
296 1 Y 1 E ARG 134 ? F ARG 135 
297 1 Y 1 E ALA 135 ? F ALA 136 
298 1 Y 1 F MET 0   ? G MET 1   
299 1 Y 1 F SER 1   ? G SER 2   
300 1 Y 1 F GLY 2   ? G GLY 3   
301 1 Y 1 F ARG 3   ? G ARG 4   
302 1 Y 1 F GLY 4   ? G GLY 5   
303 1 Y 1 F LYS 5   ? G LYS 6   
304 1 Y 1 F GLY 6   ? G GLY 7   
305 1 Y 1 F GLY 7   ? G GLY 8   
306 1 Y 1 F LYS 8   ? G LYS 9   
307 1 Y 1 F GLY 9   ? G GLY 10  
308 1 Y 1 F LEU 10  ? G LEU 11  
309 1 Y 1 F GLY 11  ? G GLY 12  
310 1 Y 1 F LYS 12  ? G LYS 13  
311 1 Y 1 F GLY 13  ? G GLY 14  
312 1 Y 1 F GLY 14  ? G GLY 15  
313 1 Y 1 F ALA 15  ? G ALA 16  
314 1 Y 1 F LYS 16  ? G LYS 17  
315 1 Y 1 F ARG 17  ? G ARG 18  
316 1 Y 1 F HIS 18  ? G HIS 19  
317 1 Y 1 F ARG 19  ? G ARG 20  
318 1 Y 1 F LYS 20  ? G LYS 21  
319 1 Y 1 F VAL 21  ? G VAL 22  
320 1 Y 1 F LEU 22  ? G LEU 23  
321 1 Y 1 F ARG 23  ? G ARG 24  
322 1 Y 1 F ASP 24  ? G ASP 25  
323 1 Y 1 F GLY 101 ? G GLY 102 
324 1 Y 1 F GLY 102 ? G GLY 103 
325 1 Y 1 H MET 0   ? H MET 1   
326 1 Y 1 H PRO 1   ? H PRO 2   
327 1 Y 1 H GLU 2   ? H GLU 3   
328 1 Y 1 H PRO 3   ? H PRO 4   
329 1 Y 1 H ALA 4   ? H ALA 5   
330 1 Y 1 H LYS 5   ? H LYS 6   
331 1 Y 1 H SER 6   ? H SER 7   
332 1 Y 1 H ALA 7   ? H ALA 8   
333 1 Y 1 H PRO 8   ? H PRO 9   
334 1 Y 1 H ALA 9   ? H ALA 10  
335 1 Y 1 H PRO 10  ? H PRO 11  
336 1 Y 1 H LYS 11  ? H LYS 12  
337 1 Y 1 H LYS 12  ? H LYS 13  
338 1 Y 1 H GLY 13  ? H GLY 14  
339 1 Y 1 H SER 14  ? H SER 15  
340 1 Y 1 H LYS 15  ? H LYS 16  
341 1 Y 1 H LYS 16  ? H LYS 17  
342 1 Y 1 H ALA 17  ? H ALA 18  
343 1 Y 1 H VAL 18  ? H VAL 19  
344 1 Y 1 H THR 19  ? H THR 20  
345 1 Y 1 H LYS 20  ? H LYS 21  
346 1 Y 1 H ALA 21  ? H ALA 22  
347 1 Y 1 H GLN 22  ? H GLN 23  
348 1 Y 1 H LYS 23  ? H LYS 24  
349 1 Y 1 H LYS 24  ? H LYS 25  
350 1 Y 1 H ASP 25  ? H ASP 26  
351 1 Y 1 H GLY 26  ? H GLY 27  
352 1 Y 1 H LYS 27  ? H LYS 28  
353 1 Y 1 H LYS 28  ? H LYS 29  
354 1 Y 1 H ARG 29  ? H ARG 30  
355 1 Y 1 H LYS 30  ? H LYS 31  
356 1 Y 1 H ARG 31  ? H ARG 32  
357 1 Y 1 H SER 32  ? H SER 33  
358 1 Y 1 H ARG 33  ? H ARG 34  
359 1 Y 1 H LYS 34  ? H LYS 35  
360 1 Y 1 H GLU 35  ? H GLU 36  
361 1 Y 1 H SER 124 ? H SER 125 
362 1 Y 1 H LYS 125 ? H LYS 126 
363 1 Y 1 C MET 0   ? I MET 1   
364 1 Y 1 C PRO 1   ? I PRO 2   
365 1 Y 1 C ARG 2   ? I ARG 3   
366 1 Y 1 C ARG 3   ? I ARG 4   
367 1 Y 1 C ARG 4   ? I ARG 5   
368 1 Y 1 C ARG 5   ? I ARG 6   
369 1 Y 1 C ARG 6   ? I ARG 7   
370 1 Y 1 C ARG 7   ? I ARG 8   
371 1 Y 1 C GLY 8   ? I GLY 9   
372 1 Y 1 C SER 9   ? I SER 10  
373 1 Y 1 C SER 10  ? I SER 11  
374 1 Y 1 C GLY 11  ? I GLY 12  
375 1 Y 1 C ALA 12  ? I ALA 13  
376 1 Y 1 C GLY 13  ? I GLY 14  
377 1 Y 1 C GLY 14  ? I GLY 15  
378 1 Y 1 C ARG 15  ? I ARG 16  
379 1 Y 1 C GLY 16  ? I GLY 17  
380 1 Y 1 C ARG 17  ? I ARG 18  
381 1 Y 1 C THR 18  ? I THR 19  
382 1 Y 1 C CYS 19  ? I CYS 20  
383 1 Y 1 C ALA 110 ? I ALA 111 
384 1 Y 1 C PRO 111 ? I PRO 112 
385 1 Y 1 C GLY 112 ? I GLY 113 
386 1 Y 1 C GLU 113 ? I GLU 114 
387 1 Y 1 C ASP 114 ? I ASP 115 
388 1 Y 1 G MET 0   ? J MET 1   
389 1 Y 1 G PRO 1   ? J PRO 2   
390 1 Y 1 G ARG 2   ? J ARG 3   
391 1 Y 1 G ARG 3   ? J ARG 4   
392 1 Y 1 G ARG 4   ? J ARG 5   
393 1 Y 1 G ARG 5   ? J ARG 6   
394 1 Y 1 G ARG 6   ? J ARG 7   
395 1 Y 1 G ARG 7   ? J ARG 8   
396 1 Y 1 G GLY 8   ? J GLY 9   
397 1 Y 1 G SER 9   ? J SER 10  
398 1 Y 1 G SER 10  ? J SER 11  
399 1 Y 1 G GLY 11  ? J GLY 12  
400 1 Y 1 G ALA 12  ? J ALA 13  
401 1 Y 1 G GLY 13  ? J GLY 14  
402 1 Y 1 G GLY 14  ? J GLY 15  
403 1 Y 1 G ARG 15  ? J ARG 16  
404 1 Y 1 G GLY 16  ? J GLY 17  
405 1 Y 1 G ARG 17  ? J ARG 18  
406 1 Y 1 G THR 18  ? J THR 19  
407 1 Y 1 G CYS 19  ? J CYS 20  
408 1 Y 1 G ALA 110 ? J ALA 111 
409 1 Y 1 G PRO 111 ? J PRO 112 
410 1 Y 1 G GLY 112 ? J GLY 113 
411 1 Y 1 G GLU 113 ? J GLU 114 
412 1 Y 1 G ASP 114 ? J ASP 115 
# 
_em_ctf_correction.id                       1 
_em_ctf_correction.em_image_processing_id   1 
_em_ctf_correction.type                     'PHASE FLIPPING AND AMPLITUDE CORRECTION' 
_em_ctf_correction.details                  ? 
# 
_em_entity_assembly_molwt.entity_assembly_id   1 
_em_entity_assembly_molwt.id                   1 
_em_entity_assembly_molwt.experimental_flag    NO 
_em_entity_assembly_molwt.units                ? 
_em_entity_assembly_molwt.value                ? 
# 
_em_entity_assembly_naturalsource.id                   2 
_em_entity_assembly_naturalsource.entity_assembly_id   1 
_em_entity_assembly_naturalsource.cell                 ? 
_em_entity_assembly_naturalsource.cellular_location    ? 
_em_entity_assembly_naturalsource.ncbi_tax_id          9606 
_em_entity_assembly_naturalsource.organ                ? 
_em_entity_assembly_naturalsource.organelle            ? 
_em_entity_assembly_naturalsource.organism             'Homo sapiens' 
_em_entity_assembly_naturalsource.strain               ? 
_em_entity_assembly_naturalsource.tissue               ? 
# 
_em_entity_assembly_recombinant.id                   2 
_em_entity_assembly_recombinant.entity_assembly_id   1 
_em_entity_assembly_recombinant.cell                 ? 
_em_entity_assembly_recombinant.ncbi_tax_id          866768 
_em_entity_assembly_recombinant.organism             
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
_em_entity_assembly_recombinant.plasmid              ? 
_em_entity_assembly_recombinant.strain               ? 
# 
_em_image_processing.id                   1 
_em_image_processing.image_recording_id   1 
_em_image_processing.details              ? 
# 
_em_image_recording.id                            1 
_em_image_recording.imaging_id                    1 
_em_image_recording.avg_electron_dose_per_image   50 
_em_image_recording.average_exposure_time         ? 
_em_image_recording.details                       ? 
_em_image_recording.detector_mode                 ? 
_em_image_recording.film_or_detector_model        'GATAN K2 QUANTUM (4k x 4k)' 
_em_image_recording.num_diffraction_images        ? 
_em_image_recording.num_grids_imaged              ? 
_em_image_recording.num_real_images               ? 
# 
loop_
_em_software.id 
_em_software.category 
_em_software.details 
_em_software.name 
_em_software.version 
_em_software.image_processing_id 
_em_software.fitting_id 
_em_software.imaging_id 
1  'CRYSTALLOGRAPHY MERGING'  ? ? ? 1 1 1 
2  'IMAGE ACQUISITION'        ? ? ? ? ? 1 
3  MASKING                    ? ? ? ? ? ? 
4  'CTF CORRECTION'           ? ? ? 1 ? ? 
5  'LAYERLINE INDEXING'       ? ? ? ? ? ? 
6  'DIFFRACTION INDEXING'     ? ? ? ? ? ? 
7  'MODEL FITTING'            ? ? ? ? ? ? 
8  'MODEL REFINEMENT'         ? ? ? ? ? ? 
9  OTHER                      ? ? ? ? ? ? 
10 'INITIAL EULER ASSIGNMENT' ? ? ? 1 ? ? 
11 'FINAL EULER ASSIGNMENT'   ? ? ? 1 ? ? 
12 CLASSIFICATION             ? ? ? 1 ? ? 
13 RECONSTRUCTION             ? ? ? 1 ? ? 
# 
_em_specimen.id                      1 
_em_specimen.experiment_id           1 
_em_specimen.concentration           ? 
_em_specimen.details                 ? 
_em_specimen.embedding_applied       NO 
_em_specimen.shadowing_applied       NO 
_em_specimen.staining_applied        NO 
_em_specimen.vitrification_applied   YES 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6M4G 'double helix'        
6M4G 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 29  1_555 B DC 119 1_555 0.144  -0.231 1.028  15.722  -14.475 -6.077  1  I_DG29:DC119_J I 29  ? J 119 ? 19 1 
1 A DG 30  1_555 B DC 118 1_555 0.618  -3.409 -1.330 14.664  7.460   76.470  2  I_DG30:DC118_J I 30  ? J 118 ? ?  ? 
1 A DG 32  1_555 B DC 116 1_555 -2.209 0.359  -1.333 -25.272 -15.296 49.530  3  I_DG32:DC116_J I 32  ? J 116 ? ?  1 
1 A DA 33  1_555 B DT 115 1_555 -2.380 -0.244 -0.594 -5.243  8.051   9.213   4  I_DA33:DT115_J I 33  ? J 115 ? 21 1 
1 A DC 34  1_555 B DG 114 1_555 0.126  -0.171 -0.316 5.544   8.947   -3.775  5  I_DC34:DG114_J I 34  ? J 114 ? 19 1 
1 A DT 35  1_555 B DA 113 1_555 -0.143 -0.087 -0.195 3.608   -7.244  -6.857  6  I_DT35:DA113_J I 35  ? J 113 ? 20 1 
1 B DC 111 1_555 A DG 37  1_555 0.866  2.340  0.208  -23.140 -11.040 -86.820 7  J_DC111:DG37_I J 111 ? I 37  ? ?  ? 
1 B DC 110 1_555 A DG 38  1_555 0.224  -0.157 0.095  -2.729  -26.860 4.174   8  J_DC110:DG38_I J 110 ? I 38  ? 19 1 
1 A DG 39  1_555 B DC 109 1_555 -1.041 0.615  -0.642 2.877   -29.450 -4.757  9  I_DG39:DC109_J I 39  ? J 109 ? ?  ? 
1 A DA 40  1_555 B DT 108 1_555 -0.005 -0.232 -0.969 -10.849 -17.524 3.740   10 I_DA40:DT108_J I 40  ? J 108 ? 20 1 
1 A DG 41  1_555 B DC 107 1_555 -0.350 -0.162 -0.854 -8.256  -12.319 6.413   11 I_DG41:DC107_J I 41  ? J 107 ? 19 1 
1 A DT 42  1_555 B DA 106 1_555 0.066  0.000  -0.163 4.980   -6.996  9.154   12 I_DT42:DA106_J I 42  ? J 106 ? 20 1 
1 A DA 43  1_555 B DT 105 1_555 0.106  -0.082 -0.434 -6.276  -8.587  -7.451  13 I_DA43:DT105_J I 43  ? J 105 ? 20 1 
1 A DA 44  1_555 B DT 104 1_555 0.011  -0.223 -0.215 2.463   -11.264 0.432   14 I_DA44:DT104_J I 44  ? J 104 ? 20 1 
1 A DT 45  1_555 B DA 103 1_555 1.257  -0.156 -0.111 -1.982  -13.632 0.734   15 I_DT45:DA103_J I 45  ? J 103 ? 20 1 
1 A DC 46  1_555 B DG 102 1_555 -0.329 3.690  0.661  -8.666  -17.335 -95.139 16 I_DC46:DG102_J I 46  ? J 102 ? ?  ? 
1 A DC 47  1_555 B DG 101 1_555 0.255  -0.139 -0.148 8.155   -8.244  3.224   17 I_DC47:DG101_J I 47  ? J 101 ? 19 1 
1 A DC 48  1_555 B DG 100 1_555 -0.297 0.360  0.026  -0.117  -21.374 -0.656  18 I_DC48:DG100_J I 48  ? J 100 ? 19 1 
1 A DC 49  1_555 B DG 99  1_555 0.324  0.469  -0.161 -2.662  -13.627 12.744  19 I_DC49:DG99_J  I 49  ? J 99  ? ?  1 
1 A DT 50  1_555 B DA 98  1_555 -0.363 -0.200 -0.412 -6.466  -19.326 -3.109  20 I_DT50:DA98_J  I 50  ? J 98  ? 20 1 
1 A DT 51  1_555 B DA 97  1_555 -0.140 -0.045 -0.176 -1.162  -8.177  0.303   21 I_DT51:DA97_J  I 51  ? J 97  ? 20 1 
1 A DG 52  1_555 B DC 96  1_555 -0.380 0.262  -0.117 -7.423  -4.612  7.546   22 I_DG52:DC96_J  I 52  ? J 96  ? 19 1 
1 A DG 53  1_555 B DC 95  1_555 -0.144 -0.275 -0.079 0.762   -8.689  -0.189  23 I_DG53:DC95_J  I 53  ? J 95  ? 19 1 
1 A DC 54  1_555 B DG 94  1_555 0.170  -0.203 -0.543 1.787   -3.634  -0.889  24 I_DC54:DG94_J  I 54  ? J 94  ? 19 1 
1 A DG 55  1_555 B DC 93  1_555 -0.219 -0.260 -0.630 -1.536  -4.225  1.477   25 I_DG55:DC93_J  I 55  ? J 93  ? 19 1 
1 A DG 56  1_555 B DC 92  1_555 -0.137 0.297  -0.406 -0.025  -10.487 7.662   26 I_DG56:DC92_J  I 56  ? J 92  ? 19 1 
1 A DT 57  1_555 B DA 91  1_555 -0.051 -0.109 -0.438 0.230   -21.512 -1.929  27 I_DT57:DA91_J  I 57  ? J 91  ? 20 1 
1 A DT 58  1_555 B DA 90  1_555 -0.408 0.565  -0.741 8.304   -11.097 9.820   28 I_DT58:DA90_J  I 58  ? J 90  ? ?  ? 
1 A DA 59  1_555 B DT 89  1_555 -0.523 0.381  -0.378 3.955   -24.246 8.931   29 I_DA59:DT89_J  I 59  ? J 89  ? ?  ? 
1 A DA 60  1_555 B DT 88  1_555 -0.252 0.450  -0.132 1.057   -23.679 14.955  30 I_DA60:DT88_J  I 60  ? J 88  ? ?  1 
1 A DA 61  1_555 B DT 87  1_555 -0.979 0.768  -0.754 -9.745  -23.919 16.052  31 I_DA61:DT87_J  I 61  ? J 87  ? ?  ? 
1 A DA 62  1_555 B DT 86  1_555 0.158  -0.153 -0.857 -8.475  -14.333 -2.133  32 I_DA62:DT86_J  I 62  ? J 86  ? 20 1 
1 A DC 63  1_555 B DG 85  1_555 0.202  -0.215 -0.123 -1.120  -7.603  0.419   33 I_DC63:DG85_J  I 63  ? J 85  ? 19 1 
1 A DG 64  1_555 B DC 84  1_555 -0.184 -0.203 -0.360 -4.354  -4.841  0.442   34 I_DG64:DC84_J  I 64  ? J 84  ? 19 1 
1 A DC 65  1_555 B DG 83  1_555 0.172  -0.178 -0.230 -1.722  -5.919  0.142   35 I_DC65:DG83_J  I 65  ? J 83  ? 19 1 
1 A DG 66  1_555 B DC 82  1_555 -0.187 -0.174 -0.184 -2.931  -14.120 -0.255  36 I_DG66:DC82_J  I 66  ? J 82  ? 19 1 
1 A DG 67  1_555 B DC 81  1_555 -0.218 -0.118 -0.076 0.318   -14.324 -0.514  37 I_DG67:DC81_J  I 67  ? J 81  ? 19 1 
1 A DG 68  1_555 B DC 80  1_555 -0.257 -0.196 -0.328 -0.617  -12.858 6.669   38 I_DG68:DC80_J  I 68  ? J 80  ? 19 1 
1 A DG 69  1_555 B DC 79  1_555 -0.036 0.275  -0.557 -6.446  -24.930 0.885   39 I_DG69:DC79_J  I 69  ? J 79  ? 19 1 
1 A DG 70  1_555 B DC 78  1_555 -0.290 -0.218 -0.585 -6.362  -13.587 6.540   40 I_DG70:DC78_J  I 70  ? J 78  ? 19 1 
1 A DC 72  1_555 B DG 76  1_555 0.190  -0.098 -0.253 5.885   -4.813  1.303   41 I_DC72:DG76_J  I 72  ? J 76  ? 19 1 
1 A DA 73  1_555 B DT 75  1_555 0.094  -0.140 -0.220 -0.975  -6.884  -4.266  42 I_DA73:DT75_J  I 73  ? J 75  ? 20 1 
1 A DG 74  1_555 B DC 74  1_555 -0.215 -0.240 -0.362 -2.078  -4.804  2.462   43 I_DG74:DC74_J  I 74  ? J 74  ? 19 1 
1 A DC 75  1_555 B DG 73  1_555 0.189  -0.164 -0.273 -3.260  -4.159  -0.389  44 I_DC75:DG73_J  I 75  ? J 73  ? 19 1 
1 A DG 76  1_555 B DC 72  1_555 -0.214 -0.124 -0.553 -8.011  -6.653  1.893   45 I_DG76:DC72_J  I 76  ? J 72  ? 19 1 
1 A DC 77  1_555 B DG 71  1_555 0.766  0.493  -0.174 2.358   -11.689 0.623   46 I_DC77:DG71_J  I 77  ? J 71  ? 19 1 
1 A DG 78  1_555 B DC 70  1_555 -0.215 -0.198 -0.307 -3.092  -5.829  3.686   47 I_DG78:DC70_J  I 78  ? J 70  ? 19 1 
1 A DT 79  1_555 B DA 69  1_555 -0.088 -0.102 -0.356 1.800   -27.368 -3.189  48 I_DT79:DA69_J  I 79  ? J 69  ? 20 1 
1 A DA 80  1_555 B DT 68  1_555 0.018  -0.062 -0.113 -8.949  -19.919 10.117  49 I_DA80:DT68_J  I 80  ? J 68  ? 20 1 
1 A DC 81  1_555 B DG 67  1_555 0.159  -0.107 -0.007 -5.912  -11.758 -1.223  50 I_DC81:DG67_J  I 81  ? J 67  ? 19 1 
1 A DG 82  1_555 B DC 66  1_555 -0.209 -0.192 -0.292 -5.071  -6.207  -0.871  51 I_DG82:DC66_J  I 82  ? J 66  ? 19 1 
1 A DT 83  1_555 B DA 65  1_555 -1.372 -0.023 -0.419 -1.106  -5.141  -4.836  52 I_DT83:DA65_J  I 83  ? J 65  ? 20 1 
1 A DG 84  1_555 B DC 64  1_555 -0.163 -0.216 -0.032 1.770   -5.873  -0.948  53 I_DG84:DC64_J  I 84  ? J 64  ? 19 1 
1 A DC 85  1_555 B DG 63  1_555 0.200  -0.194 -0.020 -2.485  -8.430  1.930   54 I_DC85:DG63_J  I 85  ? J 63  ? 19 1 
1 A DG 86  1_555 B DC 62  1_555 -0.186 -0.134 -0.401 1.068   -10.913 2.638   55 I_DG86:DC62_J  I 86  ? J 62  ? 19 1 
1 A DT 87  1_555 B DA 61  1_555 0.833  0.461  -0.360 1.816   -21.758 10.119  56 I_DT87:DA61_J  I 87  ? J 61  ? ?  ? 
1 A DT 88  1_555 B DA 60  1_555 -0.095 0.400  -0.328 -4.955  -23.934 12.538  57 I_DT88:DA60_J  I 88  ? J 60  ? ?  ? 
1 A DT 89  1_555 B DA 59  1_555 0.506  0.156  -0.636 -8.325  -25.764 8.107   58 I_DT89:DA59_J  I 89  ? J 59  ? 20 1 
1 A DA 90  1_555 B DT 58  1_555 -0.133 -3.975 1.210  3.748   18.963  81.013  59 I_DA90:DT58_J  I 90  ? J 58  ? ?  ? 
1 A DA 91  1_555 B DT 57  1_555 -0.067 -0.205 -1.041 -10.425 -21.316 0.426   60 I_DA91:DT57_J  I 91  ? J 57  ? 20 1 
1 A DG 92  1_555 B DC 56  1_555 -0.290 -0.121 -0.825 -9.442  -9.488  4.079   61 I_DG92:DC56_J  I 92  ? J 56  ? 19 1 
1 A DC 93  1_555 B DG 55  1_555 0.190  -0.309 -0.824 0.361   -1.576  1.090   62 I_DC93:DG55_J  I 93  ? J 55  ? 19 1 
1 A DG 94  1_555 B DC 54  1_555 -0.123 -0.220 -0.810 -4.030  -0.810  -4.678  63 I_DG94:DC54_J  I 94  ? J 54  ? 19 1 
1 A DG 95  1_555 B DC 53  1_555 -0.169 -0.209 -0.466 -4.575  1.366   -0.444  64 I_DG95:DC53_J  I 95  ? J 53  ? 19 1 
1 A DT 96  1_555 B DA 52  1_555 -0.138 -0.124 -0.120 -2.724  -6.114  -3.791  65 I_DT96:DA52_J  I 96  ? J 52  ? 20 1 
1 A DG 97  1_555 B DC 51  1_555 -0.214 -0.021 -0.445 -4.758  -11.075 4.681   66 I_DG97:DC51_J  I 97  ? J 51  ? 19 1 
1 A DC 98  1_555 B DG 50  1_555 0.253  -0.170 -0.467 6.602   -12.319 2.830   67 I_DC98:DG50_J  I 98  ? J 50  ? 19 1 
1 A DT 99  1_555 B DA 49  1_555 -0.745 0.415  0.031  0.285   -12.889 8.952   68 I_DT99:DA49_J  I 99  ? J 49  ? ?  ? 
1 A DA 100 1_555 B DT 48  1_555 0.136  -0.135 -0.473 -4.168  -23.291 -5.603  69 I_DA100:DT48_J I 100 ? J 48  ? 20 1 
1 A DG 101 1_555 B DC 47  1_555 -0.306 -0.237 -0.760 -7.574  -10.612 6.655   70 I_DG101:DC47_J I 101 ? J 47  ? 19 1 
1 A DA 102 1_555 B DT 46  1_555 0.060  -0.075 -0.791 -10.514 -17.626 -3.385  71 I_DA102:DT46_J I 102 ? J 46  ? 20 1 
1 A DG 103 1_555 B DC 45  1_555 -1.415 -0.176 -0.770 -7.175  -8.426  2.104   72 I_DG103:DC45_J I 103 ? J 45  ? 19 1 
1 A DC 104 1_555 B DG 44  1_555 0.146  -0.230 -0.567 -1.054  -5.595  -1.155  73 I_DC104:DG44_J I 104 ? J 44  ? 19 1 
1 A DT 105 1_555 B DA 43  1_555 -0.933 0.551  -0.567 0.428   -5.727  -8.491  74 I_DT105:DA43_J I 105 ? J 43  ? 20 1 
1 A DG 106 1_555 B DC 42  1_555 -2.531 -0.090 -0.281 -0.069  -1.739  5.324   75 I_DG106:DC42_J I 106 ? J 42  ? ?  1 
1 A DT 107 1_555 B DA 41  1_555 -0.127 -0.058 -0.365 4.872   -9.901  -3.088  76 I_DT107:DA41_J I 107 ? J 41  ? 20 1 
1 A DC 108 1_555 B DG 40  1_555 0.608  0.320  -0.205 5.048   -17.800 14.478  77 I_DC108:DG40_J I 108 ? J 40  ? 22 1 
1 A DT 109 1_555 B DA 39  1_555 -0.141 -0.124 -0.250 2.966   -24.573 -8.094  78 I_DT109:DA39_J I 109 ? J 39  ? 20 1 
1 A DA 110 1_555 B DT 38  1_555 0.001  -0.193 -0.440 -11.418 -25.307 1.468   79 I_DA110:DT38_J I 110 ? J 38  ? 20 1 
1 A DC 111 1_555 B DG 37  1_555 0.840  2.108  1.387  -27.082 -7.692  -90.041 80 I_DC111:DG37_J I 111 ? J 37  ? ?  ? 
1 A DG 112 1_555 B DC 36  1_555 -0.271 -0.111 -0.532 -4.365  -10.323 2.774   81 I_DG112:DC36_J I 112 ? J 36  ? 19 1 
1 A DA 113 1_555 B DT 35  1_555 -2.546 -0.242 -0.754 -5.085  -10.872 7.775   82 I_DA113:DT35_J I 113 ? J 35  ? ?  1 
1 A DC 114 1_555 B DG 34  1_555 0.138  -0.409 -1.027 0.229   5.896   -2.435  83 I_DC114:DG34_J I 114 ? J 34  ? 19 1 
1 A DC 115 1_555 B DG 33  1_555 3.083  -0.855 -0.225 8.648   0.955   0.763   84 I_DC115:DG33_J I 115 ? J 33  ? ?  ? 
1 A DA 116 1_555 B DT 32  1_555 0.088  -0.348 -0.636 7.124   -5.201  11.133  85 I_DA116:DT32_J I 116 ? J 32  ? 20 1 
1 A DA 117 1_555 B DT 31  1_555 -0.057 -0.264 1.478  7.931   -15.004 9.985   86 I_DA117:DT31_J I 117 ? J 31  ? 20 1 
1 A DT 118 1_555 B DA 30  1_555 -0.033 -0.739 2.155  -7.291  -0.911  18.233  87 I_DT118:DA30_J I 118 ? J 30  ? 20 1 
1 A DT 119 1_555 B DA 29  1_555 -0.112 -0.194 -0.605 -1.004  -12.711 -0.697  88 I_DT119:DA29_J I 119 ? J 29  ? 20 1 
1 A DG 120 1_555 B DC 28  1_555 -0.302 -0.230 -0.805 -11.381 -7.126  6.242   89 I_DG120:DC28_J I 120 ? J 28  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 29  1_555 B DC 119 1_555 A DG 30  1_555 B DC 118 1_555 -2.864 4.864  -0.430 174.673  -15.941  -166.009 -2.433 -1.446 -0.026 
7.972   87.354  -179.440 1  II_DG29DG30:DC118DC119_JJ I 29  ? J 119 ? I 30  ? J 118 ? 
1 A DG 32  1_555 B DC 116 1_555 A DA 33  1_555 B DT 115 1_555 -0.266 1.984  3.487  -12.713  17.430   41.460   0.745  -0.952 3.906  
22.858  16.671  46.517   2  II_DG32DA33:DT115DC116_JJ I 32  ? J 116 ? I 33  ? J 115 ? 
1 A DA 33  1_555 B DT 115 1_555 A DC 34  1_555 B DG 114 1_555 -0.239 -0.456 3.192  -3.210   12.127   37.843   -2.021 -0.006 2.926  
18.101  4.791   39.796   3  II_DA33DC34:DG114DT115_JJ I 33  ? J 115 ? I 34  ? J 114 ? 
1 A DC 34  1_555 B DG 114 1_555 A DT 35  1_555 B DA 113 1_555 0.061  -1.217 3.270  1.728    11.096   32.780   -3.660 0.148  2.726  
18.981  -2.955  34.600   4  II_DC34DT35:DA113DG114_JJ I 34  ? J 114 ? I 35  ? J 113 ? 
1 A DT 35  1_555 B DA 113 1_555 B DC 111 1_555 A DG 37  1_555 -3.075 6.583  -0.632 162.884  24.656   -168.971 -3.288 -1.563 -0.434 
-12.333 81.477  -178.538 5  IJ_DT35DC111:DG37DA113_IJ I 35  ? J 113 ? J 111 ? I 37  ? 
1 B DC 111 1_555 A DG 37  1_555 B DC 110 1_555 A DG 38  1_555 -1.866 0.006  -3.323 3.417    5.536    -89.029  0.111  -1.400 -3.262 
-3.944  2.434   -89.217  6  JJ_DC111DC110:DG38DG37_II J 111 ? I 37  ? J 110 ? I 38  ? 
1 B DC 110 1_555 A DG 38  1_555 A DG 39  1_555 B DC 109 1_555 -0.450 -3.497 1.964  164.615  -65.244  -125.140 1.897  0.150  1.342  
32.683  82.460  -178.652 7  JI_DC110DG39:DC109DG38_JI J 110 ? I 38  ? I 39  ? J 109 ? 
1 A DG 39  1_555 B DC 109 1_555 A DA 40  1_555 B DT 108 1_555 0.454  1.303  3.520  0.878    3.254    41.252   1.463  -0.539 3.616  
4.609   -1.244  41.384   8  II_DG39DA40:DT108DC109_JJ I 39  ? J 109 ? I 40  ? J 108 ? 
1 A DA 40  1_555 B DT 108 1_555 A DG 41  1_555 B DC 107 1_555 -0.700 0.756  3.227  -8.513   0.689    37.445   1.062  -0.012 3.315  
1.057   13.054  38.373   9  II_DA40DG41:DC107DT108_JJ I 40  ? J 108 ? I 41  ? J 107 ? 
1 A DG 41  1_555 B DC 107 1_555 A DT 42  1_555 B DA 106 1_555 0.201  0.212  3.011  -6.857   8.752    30.011   -1.083 -1.515 2.846  
16.217  12.705  31.960   10 II_DG41DT42:DA106DC107_JJ I 41  ? J 107 ? I 42  ? J 106 ? 
1 A DT 42  1_555 B DA 106 1_555 A DA 43  1_555 B DT 105 1_555 -0.958 0.036  3.467  -2.388   5.959    32.761   -0.998 1.243  3.479  
10.439  4.183   33.367   11 II_DT42DA43:DT105DA106_JJ I 42  ? J 106 ? I 43  ? J 105 ? 
1 A DA 43  1_555 B DT 105 1_555 A DA 44  1_555 B DT 104 1_555 0.336  -0.045 3.107  -2.594   6.689    35.832   -0.946 -0.875 3.019  
10.739  4.165   36.521   12 II_DA43DA44:DT104DT105_JJ I 43  ? J 105 ? I 44  ? J 104 ? 
1 A DA 44  1_555 B DT 104 1_555 A DT 45  1_555 B DA 103 1_555 -0.332 -0.618 3.369  0.278    3.773    37.098   -1.477 0.557  3.290  
5.910   -0.436  37.284   13 II_DA44DT45:DA103DT104_JJ I 44  ? J 104 ? I 45  ? J 103 ? 
1 A DT 45  1_555 B DA 103 1_555 A DC 46  1_555 B DG 102 1_555 0.349  -1.547 2.774  4.487    6.865    72.158   -1.495 -0.172 2.653  
5.810   -3.797  72.559   14 II_DT45DC46:DG102DA103_JJ I 45  ? J 103 ? I 46  ? J 102 ? 
1 A DC 46  1_555 B DG 102 1_555 A DC 47  1_555 B DG 101 1_555 1.599  2.190  3.598  4.878    -5.451   -6.438   -0.215 20.769 2.804  
36.292  32.477  -9.741   15 II_DC46DC47:DG101DG102_JJ I 46  ? J 102 ? I 47  ? J 101 ? 
1 A DC 47  1_555 B DG 101 1_555 A DC 48  1_555 B DG 100 1_555 -1.173 0.598  3.442  -5.204   0.978    34.246   0.842  1.105  3.591  
1.648   8.772   34.641   16 II_DC47DC48:DG100DG101_JJ I 47  ? J 101 ? I 48  ? J 100 ? 
1 A DC 48  1_555 B DG 100 1_555 A DC 49  1_555 B DG 99  1_555 1.274  0.872  3.500  2.936    0.633    40.248   1.187  -1.487 3.593  
0.919   -4.259  40.355   17 II_DC48DC49:DG99DG100_JJ  I 48  ? J 100 ? I 49  ? J 99  ? 
1 A DC 49  1_555 B DG 99  1_555 A DT 50  1_555 B DA 98  1_555 -1.435 1.127  3.449  -3.893   -3.146   34.617   2.381  1.763  3.472  
-5.254  6.500   34.966   18 II_DC49DT50:DA98DG99_JJ   I 49  ? J 99  ? I 50  ? J 98  ? 
1 A DT 50  1_555 B DA 98  1_555 A DT 51  1_555 B DA 97  1_555 0.112  0.124  3.353  -5.081   5.294    33.435   -0.646 -1.014 3.282  
9.066   8.702   34.208   19 II_DT50DT51:DA97DA98_JJ   I 50  ? J 98  ? I 51  ? J 97  ? 
1 A DT 51  1_555 B DA 97  1_555 A DG 52  1_555 B DC 96  1_555 0.571  -0.664 3.373  -1.709   6.163    31.201   -2.344 -1.355 3.152  
11.310  3.135   31.834   20 II_DT51DG52:DC96DA97_JJ   I 51  ? J 97  ? I 52  ? J 96  ? 
1 A DG 52  1_555 B DC 96  1_555 A DG 53  1_555 B DC 95  1_555 -0.685 -0.427 3.197  -7.086   10.570   29.129   -2.690 -0.027 2.951  
19.864  13.316  31.732   21 II_DG52DG53:DC95DC96_JJ   I 52  ? J 96  ? I 53  ? J 95  ? 
1 A DG 53  1_555 B DC 95  1_555 A DC 54  1_555 B DG 94  1_555 -0.454 -0.846 3.217  5.333    9.043    31.986   -2.852 1.604  2.773  
15.885  -9.367  33.622   22 II_DG53DC54:DG94DC95_JJ   I 53  ? J 95  ? I 54  ? J 94  ? 
1 A DC 54  1_555 B DG 94  1_555 A DG 55  1_555 B DC 93  1_555 0.044  0.104  3.562  1.644    12.017   26.986   -2.602 0.298  3.304  
24.255  -3.319  29.541   23 II_DC54DG55:DC93DG94_JJ   I 54  ? J 94  ? I 55  ? J 93  ? 
1 A DG 55  1_555 B DC 93  1_555 A DG 56  1_555 B DC 92  1_555 0.070  0.384  3.277  -0.885   7.555    33.956   -0.528 -0.255 3.281  
12.738  1.491   34.773   24 II_DG55DG56:DC92DC93_JJ   I 55  ? J 93  ? I 56  ? J 92  ? 
1 A DG 56  1_555 B DC 92  1_555 A DT 57  1_555 B DA 91  1_555 -0.411 -0.150 3.062  -0.562   2.788    32.410   -0.723 0.642  3.045  
4.982   1.005   32.532   25 II_DG56DT57:DA91DC92_JJ   I 56  ? J 92  ? I 57  ? J 91  ? 
1 A DT 57  1_555 B DA 91  1_555 A DT 58  1_555 B DA 90  1_555 1.313  1.497  3.255  12.326   -1.623   38.411   2.365  -0.444 3.437  
-2.392  -18.164 40.301   26 II_DT57DT58:DA90DA91_JJ   I 57  ? J 91  ? I 58  ? J 90  ? 
1 A DT 58  1_555 B DA 90  1_555 A DA 59  1_555 B DT 89  1_555 -0.901 1.374  3.648  -6.593   0.010    34.706   2.264  0.372  3.751  
0.016   10.931  35.308   27 II_DT58DA59:DT89DA90_JJ   I 58  ? J 90  ? I 59  ? J 89  ? 
1 A DA 59  1_555 B DT 89  1_555 A DA 60  1_555 B DT 88  1_555 0.443  0.574  3.334  -2.090   0.072    39.175   0.846  -0.913 3.308  
0.107   3.114   39.229   28 II_DA59DA60:DT88DT89_JJ   I 59  ? J 89  ? I 60  ? J 88  ? 
1 A DA 60  1_555 B DT 88  1_555 A DA 61  1_555 B DT 87  1_555 -0.125 0.596  3.413  -0.792   1.512    35.492   0.746  0.083  3.437  
2.479   1.298   35.532   29 II_DA60DA61:DT87DT88_JJ   I 60  ? J 88  ? I 61  ? J 87  ? 
1 A DA 61  1_555 B DT 87  1_555 A DA 62  1_555 B DT 86  1_555 -1.137 0.383  3.397  -8.120   3.917    40.551   0.091  0.673  3.571  
5.568   11.544  41.500   30 II_DA61DA62:DT86DT87_JJ   I 61  ? J 87  ? I 62  ? J 86  ? 
1 A DA 62  1_555 B DT 86  1_555 A DC 63  1_555 B DG 85  1_555 0.002  -0.090 3.104  -7.934   6.960    33.993   -1.110 -1.101 2.955  
11.563  13.182  35.547   31 II_DA62DC63:DG85DT86_JJ   I 62  ? J 86  ? I 63  ? J 85  ? 
1 A DC 63  1_555 B DG 85  1_555 A DG 64  1_555 B DC 84  1_555 -0.119 -0.167 3.401  2.070    6.647    28.548   -1.807 0.695  3.262  
13.233  -4.120  29.368   32 II_DC63DG64:DC84DG85_JJ   I 63  ? J 85  ? I 64  ? J 84  ? 
1 A DG 64  1_555 B DC 84  1_555 A DC 65  1_555 B DG 83  1_555 -0.062 0.138  3.313  -0.780   7.195    36.307   -0.768 -0.009 3.280  
11.407  1.237   36.998   33 II_DG64DC65:DG83DC84_JJ   I 64  ? J 84  ? I 65  ? J 83  ? 
1 A DC 65  1_555 B DG 83  1_555 A DG 66  1_555 B DC 82  1_555 0.232  0.204  3.417  0.752    12.476   29.052   -2.084 -0.279 3.234  
23.543  -1.418  31.574   34 II_DC65DG66:DC82DG83_JJ   I 65  ? J 83  ? I 66  ? J 82  ? 
1 A DG 66  1_555 B DC 82  1_555 A DG 67  1_555 B DC 81  1_555 -0.203 0.683  3.271  -2.094   2.675    37.430   0.709  0.040  3.316  
4.158   3.255   37.578   35 II_DG66DG67:DC81DC82_JJ   I 66  ? J 82  ? I 67  ? J 81  ? 
1 A DG 67  1_555 B DC 81  1_555 A DG 68  1_555 B DC 80  1_555 0.801  1.217  3.466  5.115    0.272    37.007   1.862  -0.523 3.550  
0.426   -8.012  37.348   36 II_DG67DG68:DC80DC81_JJ   I 67  ? J 81  ? I 68  ? J 80  ? 
1 A DG 68  1_555 B DC 80  1_555 A DG 69  1_555 B DC 79  1_555 -1.492 1.667  3.448  -6.564   -0.813   42.098   2.384  1.336  3.599  
-1.123  9.070   42.591   37 II_DG68DG69:DC79DC80_JJ   I 68  ? J 80  ? I 69  ? J 79  ? 
1 A DG 69  1_555 B DC 79  1_555 A DG 70  1_555 B DC 78  1_555 0.566  1.174  3.299  -0.072   2.290    34.707   1.608  -0.958 3.366  
3.833   0.120   34.780   38 II_DG69DG70:DC78DC79_JJ   I 69  ? J 79  ? I 70  ? J 78  ? 
1 A DG 70  1_555 B DC 78  1_555 A DC 72  1_555 B DG 76  1_555 -0.773 2.254  6.283  -13.050  1.828    73.938   1.743  -0.145 6.374  
1.508   10.767  74.938   39 II_DG70DC72:DG76DC78_JJ   I 70  ? J 78  ? I 72  ? J 76  ? 
1 A DC 72  1_555 B DG 76  1_555 A DA 73  1_555 B DT 75  1_555 -0.433 -0.066 3.515  -2.800   8.391    33.882   -1.474 0.265  3.425  
14.103  4.705   34.984   40 II_DC72DA73:DT75DG76_JJ   I 72  ? J 76  ? I 73  ? J 75  ? 
1 A DA 73  1_555 B DT 75  1_555 A DG 74  1_555 B DC 74  1_555 0.185  -0.354 3.468  -1.521   7.413    29.176   -2.266 -0.682 3.267  
14.411  2.957   30.121   41 II_DA73DG74:DC74DT75_JJ   I 73  ? J 75  ? I 74  ? J 74  ? 
1 A DG 74  1_555 B DC 74  1_555 A DC 75  1_555 B DG 73  1_555 -0.186 -0.502 3.320  -0.362   7.552    35.896   -1.835 0.247  3.155  
12.089  0.579   36.658   42 II_DG74DC75:DG73DC74_JJ   I 74  ? J 74  ? I 75  ? J 73  ? 
1 A DC 75  1_555 B DG 73  1_555 A DG 76  1_555 B DC 72  1_555 0.152  0.090  3.495  3.475    6.508    32.733   -0.992 0.351  3.447  
11.368  -6.070  33.532   43 II_DC75DG76:DC72DG73_JJ   I 75  ? J 73  ? I 76  ? J 72  ? 
1 A DG 76  1_555 B DC 72  1_555 A DC 77  1_555 B DG 71  1_555 -0.576 0.560  3.120  -2.739   4.085    38.546   0.360  0.543  3.193  
6.157   4.129   38.846   44 II_DG76DC77:DG71DC72_JJ   I 76  ? J 72  ? I 77  ? J 71  ? 
1 A DC 77  1_555 B DG 71  1_555 A DG 78  1_555 B DC 70  1_555 1.073  0.688  3.419  5.174    4.434    30.671   0.366  -0.927 3.609  
8.255   -9.633  31.401   45 II_DC77DG78:DC70DG71_JJ   I 77  ? J 71  ? I 78  ? J 70  ? 
1 A DG 78  1_555 B DC 70  1_555 A DT 79  1_555 B DA 69  1_555 -1.435 1.250  3.194  -3.819   -4.147   39.573   2.295  1.671  3.171  
-6.088  5.606   39.957   46 II_DG78DT79:DA69DC70_JJ   I 78  ? J 70  ? I 79  ? J 69  ? 
1 A DT 79  1_555 B DA 69  1_555 A DA 80  1_555 B DT 68  1_555 1.191  1.442  3.680  1.928    0.921    40.622   1.958  -1.470 3.761  
1.325   -2.774  40.676   47 II_DT79DA80:DT68DA69_JJ   I 79  ? J 69  ? I 80  ? J 68  ? 
1 A DA 80  1_555 B DT 68  1_555 A DC 81  1_555 B DG 67  1_555 -1.169 1.160  3.312  -8.434   -2.832   39.428   2.011  0.708  3.393  
-4.134  12.311  40.380   48 II_DA80DC81:DG67DT68_JJ   I 80  ? J 68  ? I 81  ? J 67  ? 
1 A DC 81  1_555 B DG 67  1_555 A DG 82  1_555 B DC 66  1_555 -0.158 0.548  3.326  -2.847   4.652    34.065   0.181  -0.189 3.371  
7.878   4.822   34.487   49 II_DC81DG82:DC66DG67_JJ   I 81  ? J 67  ? I 82  ? J 66  ? 
1 A DG 82  1_555 B DC 66  1_555 A DT 83  1_555 B DA 65  1_555 -0.506 -0.109 3.178  -0.273   7.058    27.345   -1.816 0.975  3.059  
14.622  0.566   28.225   50 II_DG82DT83:DA65DC66_JJ   I 82  ? J 66  ? I 83  ? J 65  ? 
1 A DT 83  1_555 B DA 65  1_555 A DG 84  1_555 B DC 64  1_555 0.268  0.436  3.506  -6.973   8.711    38.555   -0.440 -1.253 3.424  
12.868  10.300  40.079   51 II_DT83DG84:DC64DA65_JJ   I 83  ? J 65  ? I 84  ? J 64  ? 
1 A DG 84  1_555 B DC 64  1_555 A DC 85  1_555 B DG 63  1_555 -0.033 -0.437 3.344  -1.621   5.316    34.229   -1.561 -0.196 3.239  
8.959   2.732   34.664   52 II_DG84DC85:DG63DC64_JJ   I 84  ? J 64  ? I 85  ? J 63  ? 
1 A DC 85  1_555 B DG 63  1_555 A DG 86  1_555 B DC 62  1_555 0.000  0.347  3.391  5.995    8.197    32.106   -0.808 1.030  3.323  
14.378  -10.516 33.633   53 II_DC85DG86:DC62DG63_JJ   I 85  ? J 63  ? I 86  ? J 62  ? 
1 A DG 86  1_555 B DC 62  1_555 A DT 87  1_555 B DA 61  1_555 0.269  -0.090 3.194  1.770    4.174    38.915   -0.623 -0.194 3.176  
6.239   -2.645  39.168   54 II_DG86DT87:DA61DC62_JJ   I 86  ? J 62  ? I 87  ? J 61  ? 
1 A DT 87  1_555 B DA 61  1_555 A DT 88  1_555 B DA 60  1_555 -0.167 0.353  3.310  1.298    0.742    34.024   0.484  0.494  3.308  
1.268   -2.216  34.055   55 II_DT87DT88:DA60DA61_JJ   I 87  ? J 61  ? I 88  ? J 60  ? 
1 A DT 88  1_555 B DA 60  1_555 A DT 89  1_555 B DA 59  1_555 -0.600 0.754  3.333  -0.476   1.270    40.814   0.938  0.806  3.361  
1.820   0.682   40.836   56 II_DT88DT89:DA59DA60_JJ   I 88  ? J 60  ? I 89  ? J 59  ? 
1 A DT 89  1_555 B DA 59  1_555 A DA 90  1_555 B DT 58  1_555 1.152  -3.757 3.199  -175.917 15.558   51.942   -1.969 -1.595 0.072  
7.863   88.909  176.946  57 II_DT89DA90:DT58DA59_JJ   I 89  ? J 59  ? I 90  ? J 58  ? 
1 A DA 90  1_555 B DT 58  1_555 A DA 91  1_555 B DT 57  1_555 -4.438 -0.365 0.769  127.057  -110.223 -45.161  1.046  -1.234 3.169  
57.488  66.268  -169.111 58 II_DA90DA91:DT57DT58_JJ   I 90  ? J 58  ? I 91  ? J 57  ? 
1 A DA 91  1_555 B DT 57  1_555 A DG 92  1_555 B DC 56  1_555 0.226  0.338  3.134  -4.626   4.879    32.561   -0.195 -1.140 3.091  
8.588   8.142   33.229   59 II_DA91DG92:DC56DT57_JJ   I 91  ? J 57  ? I 92  ? J 56  ? 
1 A DG 92  1_555 B DC 56  1_555 A DC 93  1_555 B DG 55  1_555 -0.044 0.257  3.006  -1.640   6.897    35.371   -0.492 -0.145 3.001  
11.212  2.666   36.052   60 II_DG92DC93:DG55DC56_JJ   I 92  ? J 56  ? I 93  ? J 55  ? 
1 A DC 93  1_555 B DG 55  1_555 A DG 94  1_555 B DC 54  1_555 -0.317 0.124  3.584  -1.444   12.746   27.652   -2.594 0.283  3.329  
25.031  2.837   30.429   61 II_DC93DG94:DC54DG55_JJ   I 93  ? J 55  ? I 94  ? J 54  ? 
1 A DG 94  1_555 B DC 54  1_555 A DG 95  1_555 B DC 53  1_555 0.732  -0.545 3.385  -0.840   11.534   29.571   -3.129 -1.495 2.949  
21.587  1.572   31.705   62 II_DG94DG95:DC53DC54_JJ   I 94  ? J 54  ? I 95  ? J 53  ? 
1 A DG 95  1_555 B DC 53  1_555 A DT 96  1_555 B DA 52  1_555 0.097  -0.473 3.285  -1.724   6.853    28.632   -2.373 -0.554 3.080  
13.596  3.420   29.473   63 II_DG95DT96:DA52DC53_JJ   I 95  ? J 53  ? I 96  ? J 52  ? 
1 A DT 96  1_555 B DA 52  1_555 A DG 97  1_555 B DC 51  1_555 0.302  -1.036 3.272  4.235    16.249   29.921   -4.155 0.110  2.427  
28.796  -7.506  34.217   64 II_DT96DG97:DC51DA52_JJ   I 96  ? J 52  ? I 97  ? J 51  ? 
1 A DG 97  1_555 B DC 51  1_555 A DC 98  1_555 B DG 50  1_555 -0.067 0.123  3.206  0.514    2.368    33.964   -0.160 0.194  3.206  
4.048   -0.879  34.048   65 II_DG97DC98:DG50DC51_JJ   I 97  ? J 51  ? I 98  ? J 50  ? 
1 A DC 98  1_555 B DG 50  1_555 A DT 99  1_555 B DA 49  1_555 0.675  1.291  3.405  -0.188   -2.260   34.048   2.569  -1.182 3.311  
-3.855  0.320   34.121   66 II_DC98DT99:DA49DG50_JJ   I 98  ? J 50  ? I 99  ? J 49  ? 
1 A DT 99  1_555 B DA 49  1_555 A DA 100 1_555 B DT 48  1_555 -1.612 0.816  3.450  -3.043   3.461    41.839   0.750  1.904  3.607  
4.829   4.245   42.081   67 II_DT99DA100:DT48DA49_JJ  I 99  ? J 49  ? I 100 ? J 48  ? 
1 A DA 100 1_555 B DT 48  1_555 A DG 101 1_555 B DC 47  1_555 1.288  0.952  3.444  3.253    -0.679   35.568   1.656  -1.597 3.526  
-1.109  -5.310  35.717   68 II_DA100DG101:DC47DT48_JJ I 100 ? J 48  ? I 101 ? J 47  ? 
1 A DG 101 1_555 B DC 47  1_555 A DA 102 1_555 B DT 46  1_555 -1.783 1.216  3.409  -11.008  2.689    37.865   1.442  1.171  3.835  
4.034   16.517  39.464   69 II_DG101DA102:DT46DC47_JJ I 101 ? J 47  ? I 102 ? J 46  ? 
1 A DA 102 1_555 B DT 46  1_555 A DG 103 1_555 B DC 45  1_555 0.641  0.050  3.173  -1.677   4.912    28.371   -0.958 -1.649 3.095  
9.917   3.386   28.832   70 II_DA102DG103:DC45DT46_JJ I 102 ? J 46  ? I 103 ? J 45  ? 
1 A DG 103 1_555 B DC 45  1_555 A DC 104 1_555 B DG 44  1_555 0.018  -0.200 3.313  -5.747   2.681    35.517   -0.708 -0.852 3.248  
4.352   9.329   36.061   71 II_DG103DC104:DG44DC45_JJ I 103 ? J 45  ? I 104 ? J 44  ? 
1 A DC 104 1_555 B DG 44  1_555 A DT 105 1_555 B DA 43  1_555 -0.551 -0.712 3.148  2.189    9.432    30.765   -2.840 1.355  2.770  
17.250  -4.004  32.218   72 II_DC104DT105:DA43DG44_JJ I 104 ? J 44  ? I 105 ? J 43  ? 
1 A DT 105 1_555 B DA 43  1_555 A DG 106 1_555 B DC 42  1_555 1.383  0.445  3.214  -0.083   6.253    26.529   -0.616 -2.957 3.227  
13.391  0.178   27.243   73 II_DT105DG106:DC42DA43_JJ I 105 ? J 43  ? I 106 ? J 42  ? 
1 A DG 106 1_555 B DC 42  1_555 A DT 107 1_555 B DA 41  1_555 -0.710 -0.210 3.251  -0.109   6.167    40.358   -0.974 1.006  3.188  
8.875   0.157   40.807   74 II_DG106DT107:DA41DC42_JJ I 106 ? J 42  ? I 107 ? J 41  ? 
1 A DT 107 1_555 B DA 41  1_555 A DC 108 1_555 B DG 40  1_555 1.356  0.559  3.348  7.845    1.007    42.140   0.659  -1.026 3.545  
1.385   -10.796 42.843   75 II_DT107DC108:DG40DA41_JJ I 107 ? J 41  ? I 108 ? J 40  ? 
1 A DC 108 1_555 B DG 40  1_555 A DT 109 1_555 B DA 39  1_555 -1.117 1.223  3.411  -2.283   -1.769   32.651   2.486  1.569  3.410  
-3.138  4.050   32.775   76 II_DC108DT109:DA39DG40_JJ I 108 ? J 40  ? I 109 ? J 39  ? 
1 A DT 109 1_555 B DA 39  1_555 A DA 110 1_555 B DT 38  1_555 0.592  1.934  3.772  6.243    -0.343   46.202   2.478  -0.139 3.803  
-0.434  -7.912  46.600   77 II_DT109DA110:DT38DA39_JJ I 109 ? J 39  ? I 110 ? J 38  ? 
1 A DA 110 1_555 B DT 38  1_555 A DC 111 1_555 B DG 37  1_555 1.127  -0.363 3.047  -12.920  1.533    90.741   -0.280 -1.017 2.899  
1.072   9.040   91.467   78 II_DA110DC111:DG37DT38_JJ I 110 ? J 38  ? I 111 ? J 37  ? 
1 A DC 111 1_555 B DG 37  1_555 A DG 112 1_555 B DC 36  1_555 -0.092 2.688  3.370  7.919    3.608    -19.904  -8.518 2.783  2.684  
-9.853  21.623  -21.706  79 II_DC111DG112:DC36DG37_JJ I 111 ? J 37  ? I 112 ? J 36  ? 
1 A DG 112 1_555 B DC 36  1_555 A DA 113 1_555 B DT 35  1_555 -0.055 0.015  3.206  -6.057   7.646    25.480   -1.850 -1.374 3.017  
16.580  13.135  27.254   80 II_DG112DA113:DT35DC36_JJ I 112 ? J 36  ? I 113 ? J 35  ? 
1 A DA 113 1_555 B DT 35  1_555 A DC 114 1_555 B DG 34  1_555 -0.388 -0.083 3.392  -3.759   8.388    43.467   -0.920 0.151  3.342  
11.177  5.009   44.382   81 II_DA113DC114:DG34DT35_JJ I 113 ? J 35  ? I 114 ? J 34  ? 
1 A DC 114 1_555 B DG 34  1_555 A DC 115 1_555 B DG 33  1_555 -0.110 0.129  3.360  -0.061   13.743   46.174   -0.962 0.130  3.270  
17.083  0.076   48.068   82 II_DC114DC115:DG33DG34_JJ I 114 ? J 34  ? I 115 ? J 33  ? 
1 A DC 115 1_555 B DG 33  1_555 A DA 116 1_555 B DT 32  1_555 -0.376 0.445  3.446  5.466    11.729   24.542   -2.123 2.208  3.172  
25.455  -11.863 27.698   83 II_DC115DA116:DT32DG33_JJ I 115 ? J 33  ? I 116 ? J 32  ? 
1 A DA 116 1_555 B DT 32  1_555 A DA 117 1_555 B DT 31  1_555 -0.024 0.694  4.453  -2.144   1.577    39.488   0.773  -0.308 4.471  
2.331   3.169   39.574   84 II_DA116DA117:DT31DT32_JJ I 116 ? J 32  ? I 117 ? J 31  ? 
1 A DA 117 1_555 B DT 31  1_555 A DT 118 1_555 B DA 30  1_555 0.733  -1.398 4.157  -1.812   8.461    29.935   -4.558 -1.784 3.587  
15.965  3.420   31.133   85 II_DA117DT118:DA30DT31_JJ I 117 ? J 31  ? I 118 ? J 30  ? 
1 A DT 118 1_555 B DA 30  1_555 A DT 119 1_555 B DA 29  1_555 -2.000 2.570  3.997  12.306   -2.239   43.919   3.539  3.799  3.225  
-2.924  -16.069 45.581   86 II_DT118DT119:DA29DA30_JJ I 118 ? J 30  ? I 119 ? J 29  ? 
1 A DT 119 1_555 B DA 29  1_555 A DG 120 1_555 B DC 28  1_555 1.761  0.176  4.054  10.627   7.188    30.883   -1.287 -0.710 4.342  
12.826  -18.962 33.382   87 II_DT119DG120:DC28DA29_JJ I 119 ? J 29  ? I 120 ? J 28  ? 
# 
_pdbx_audit_support.funding_organization   'Ministry of Science and Technology (MoST, China)' 
_pdbx_audit_support.country                China 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'native gel electrophoresis' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#