data_6M6A
# 
_entry.id   6M6A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.336 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6M6A         
WWPDB D_1300016163 
EMDB  EMD-30117    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        
'CryoEM structure of Thermus thermophilus transcription-repair coupling complex in the absence of ATP-gamma-S' 
_pdbx_database_related.db_id          EMD-30117 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6M6A 
_pdbx_database_status.recvd_initial_deposition_date   2020-03-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shi, J.'  1 ? 
'Wen, A.'  2 ? 
'Feng, Y.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            48 
_citation.language                  ? 
_citation.page_first                11762 
_citation.page_last                 11772 
_citation.title                     'Structural basis of Mfd-dependent transcription termination.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkaa904 
_citation.pdbx_database_id_PubMed   33068413 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shi, J.'   1  ? 
primary 'Wen, A.'   2  ? 
primary 'Zhao, M.'  3  ? 
primary 'Jin, S.'   4  ? 
primary 'You, L.'   5  ? 
primary 'Shi, Y.'   6  ? 
primary 'Dong, S.'  7  ? 
primary 'Hua, X.'   8  ? 
primary 'Zhang, Y.' 9  ? 
primary 'Feng, Y.'  10 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6M6A 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6M6A 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'DNA-directed RNA polymerase subunit alpha' 35056.164  2 2.7.7.6 ? ? ? 
2 polymer     nat 'DNA-directed RNA polymerase subunit beta'  125436.539 1 2.7.7.6 ? ? ? 
3 polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 1 2.7.7.6 ? ? ? 
4 polymer     nat 'DNA-directed RNA polymerase subunit omega' 11533.316  1 2.7.7.6 ? ? ? 
5 polymer     man 'Transcription-repair-coupling factor'      109874.047 1 3.6.4.- ? ? ? 
6 polymer     syn 'template strand DNA'                       19290.348  1 ?       ? ? ? 
7 polymer     syn 'nontemplate strand DNA'                    19366.436  1 ?       ? ? ? 
8 non-polymer syn 'ZINC ION'                                  65.409     2 ?       ? ? ? 
9 non-polymer syn 'MAGNESIUM ION'                             24.305     1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
5 TRCF                                                                          
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B ? 
2 'polypeptide(L)'        no no 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C   ? 
3 'polypeptide(L)'        no no 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D   ? 
4 'polypeptide(L)'        no no 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E   ? 
5 'polypeptide(L)'        no no 
;MEIALERIYGHRLALPQVGAALLFAQEAPPALLLVPEARLRRYRDLSAFGAKVYVNPGLEALEEKALFVLSYEEALSPFP
EDPEAWRLLLEVGRAYPREALLSRLLKLGYARDEDYRVLGEVVELGEVRLEFFGDELERLVVRGEERRRHVLLPKPGKAE
GFTSKKVLHFPGPVYLDTPALAPKALWPLLAGRPWVALGGGVELPPLELGARPLPPYRGSLKALEKDLARWLAEGKRVHL
FVGHARTLEYLKRRLQAFSPLILDRFPGPKGRLALLPGDFEGGAEWGEWVLLTEALVFATGGVRARVRVGEGLSDPGALS
PGDYLIHPEHGVGQYLGLETREVLGVKRDYLVLRYKGEGKLYLPVEQLPLLKRHPGTTDDPPELSSLGKNEWQRAKEKAR
KDVEELAGRLLVLQAKRKATPGRAFPPLPEWDPLVEKGFPYELTPDQKRALEEVLRDLESPHPMDRLVSGDVGFGKTEVA
LRAAHRVVGHGAQVAFLVPTTLLAEQHGKTFRERFQGLPVRVAVLSRFTPPKEEEAILKGLAEGTVDIVIGTHRLLQEDV
RFRDLGLLIVDEEHRFGVAQKERIRELKAEVDTLYLSATPIPRTLYSALVGLKDLSSIQTPPPGRKPIKTFLAPFDPLLV
REAILFELERGGKVFYVHDRVASIEARRRFLESLVPEARIGVVHGQMPESLIEETMLLFAEGAYDVLLATTIIEAGLDVP
EANTILIERADRLGLATLYQLRGRVGRREEEAYAYLFHPPRLTEAAEKRLAAIADLSDLGSGHLLAERDMEIRGVGNLLG
PEQHGHIRALSLEVYTELLEEAIRKLKGEVKEERRHVTLDLALSARLPAEYVGSLEARSRYYSRFAEAKSLAELSRLVRE
LKERYGPLPEEAENFVALARLRLVAERKGVVSITEGLTHLEVVFPRYPLDYDARGLKGLPYRVELTQYPPGFRLEKKGLR
PRDYPEALMEVLYLFADL
;
;MEIALERIYGHRLALPQVGAALLFAQEAPPALLLVPEARLRRYRDLSAFGAKVYVNPGLEALEEKALFVLSYEEALSPFP
EDPEAWRLLLEVGRAYPREALLSRLLKLGYARDEDYRVLGEVVELGEVRLEFFGDELERLVVRGEERRRHVLLPKPGKAE
GFTSKKVLHFPGPVYLDTPALAPKALWPLLAGRPWVALGGGVELPPLELGARPLPPYRGSLKALEKDLARWLAEGKRVHL
FVGHARTLEYLKRRLQAFSPLILDRFPGPKGRLALLPGDFEGGAEWGEWVLLTEALVFATGGVRARVRVGEGLSDPGALS
PGDYLIHPEHGVGQYLGLETREVLGVKRDYLVLRYKGEGKLYLPVEQLPLLKRHPGTTDDPPELSSLGKNEWQRAKEKAR
KDVEELAGRLLVLQAKRKATPGRAFPPLPEWDPLVEKGFPYELTPDQKRALEEVLRDLESPHPMDRLVSGDVGFGKTEVA
LRAAHRVVGHGAQVAFLVPTTLLAEQHGKTFRERFQGLPVRVAVLSRFTPPKEEEAILKGLAEGTVDIVIGTHRLLQEDV
RFRDLGLLIVDEEHRFGVAQKERIRELKAEVDTLYLSATPIPRTLYSALVGLKDLSSIQTPPPGRKPIKTFLAPFDPLLV
REAILFELERGGKVFYVHDRVASIEARRRFLESLVPEARIGVVHGQMPESLIEETMLLFAEGAYDVLLATTIIEAGLDVP
EANTILIERADRLGLATLYQLRGRVGRREEEAYAYLFHPPRLTEAAEKRLAAIADLSDLGSGHLLAERDMEIRGVGNLLG
PEQHGHIRALSLEVYTELLEEAIRKLKGEVKEERRHVTLDLALSARLPAEYVGSLEARSRYYSRFAEAKSLAELSRLVRE
LKERYGPLPEEAENFVALARLRLVAERKGVVSITEGLTHLEVVFPRYPLDYDARGLKGLPYRVELTQYPPGFRLEKKGLR
PRDYPEALMEVLYLFADL
;
M   ? 
6 polydeoxyribonucleotide no no 
;(DG)(DG)(DG)(DT)(DA)(DT)(DT)(DC)(DG)(DC)(DC)(DG)(DT)(DG)(DT)(DA)(DC)(DC)(DT)(DC)
(DT)(DC)(DC)(DT)(DA)(DG)(DC)(DC)(DC)(DA)(DA)(DC)(DC)(DA)(DT)(DA)(DT)(DG)(DG)(DA)
(DT)(DT)(DA)(DT)(DT)(DA)(DA)(DG)(DC)(DA)(DA)(DA)(DG)(DC)(DT)(DT)(DC)(DT)(DT)(DT)
(DT)(DC)(DG)
;
GGGTATTCGCCGTGTACCTCTCCTAGCCCAACCATATGGATTATTAAGCAAAGCTTCTTTTCG T   ? 
7 polydeoxyribonucleotide no no 
;(DC)(DG)(DA)(DA)(DA)(DA)(DG)(DA)(DA)(DG)(DC)(DT)(DT)(DT)(DG)(DC)(DT)(DT)(DA)(DA)
(DT)(DA)(DA)(DT)(DC)(DC)(DA)(DT)(DA)(DT)(DG)(DG)(DT)(DT)(DG)(DG)(DG)(DC)(DT)(DA)
(DC)(DC)(DT)(DC)(DT)(DC)(DC)(DA)(DT)(DG)(DA)(DC)(DG)(DG)(DC)(DG)(DA)(DA)(DT)(DA)
(DC)(DC)(DC)
;
CGAAAAGAAGCTTTGCTTAATAATCCATATGGTTGGGCTACCTCTCCATGACGGCGAATACCC N   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLU n 
5 3    ILE n 
5 4    ALA n 
5 5    LEU n 
5 6    GLU n 
5 7    ARG n 
5 8    ILE n 
5 9    TYR n 
5 10   GLY n 
5 11   HIS n 
5 12   ARG n 
5 13   LEU n 
5 14   ALA n 
5 15   LEU n 
5 16   PRO n 
5 17   GLN n 
5 18   VAL n 
5 19   GLY n 
5 20   ALA n 
5 21   ALA n 
5 22   LEU n 
5 23   LEU n 
5 24   PHE n 
5 25   ALA n 
5 26   GLN n 
5 27   GLU n 
5 28   ALA n 
5 29   PRO n 
5 30   PRO n 
5 31   ALA n 
5 32   LEU n 
5 33   LEU n 
5 34   LEU n 
5 35   VAL n 
5 36   PRO n 
5 37   GLU n 
5 38   ALA n 
5 39   ARG n 
5 40   LEU n 
5 41   ARG n 
5 42   ARG n 
5 43   TYR n 
5 44   ARG n 
5 45   ASP n 
5 46   LEU n 
5 47   SER n 
5 48   ALA n 
5 49   PHE n 
5 50   GLY n 
5 51   ALA n 
5 52   LYS n 
5 53   VAL n 
5 54   TYR n 
5 55   VAL n 
5 56   ASN n 
5 57   PRO n 
5 58   GLY n 
5 59   LEU n 
5 60   GLU n 
5 61   ALA n 
5 62   LEU n 
5 63   GLU n 
5 64   GLU n 
5 65   LYS n 
5 66   ALA n 
5 67   LEU n 
5 68   PHE n 
5 69   VAL n 
5 70   LEU n 
5 71   SER n 
5 72   TYR n 
5 73   GLU n 
5 74   GLU n 
5 75   ALA n 
5 76   LEU n 
5 77   SER n 
5 78   PRO n 
5 79   PHE n 
5 80   PRO n 
5 81   GLU n 
5 82   ASP n 
5 83   PRO n 
5 84   GLU n 
5 85   ALA n 
5 86   TRP n 
5 87   ARG n 
5 88   LEU n 
5 89   LEU n 
5 90   LEU n 
5 91   GLU n 
5 92   VAL n 
5 93   GLY n 
5 94   ARG n 
5 95   ALA n 
5 96   TYR n 
5 97   PRO n 
5 98   ARG n 
5 99   GLU n 
5 100  ALA n 
5 101  LEU n 
5 102  LEU n 
5 103  SER n 
5 104  ARG n 
5 105  LEU n 
5 106  LEU n 
5 107  LYS n 
5 108  LEU n 
5 109  GLY n 
5 110  TYR n 
5 111  ALA n 
5 112  ARG n 
5 113  ASP n 
5 114  GLU n 
5 115  ASP n 
5 116  TYR n 
5 117  ARG n 
5 118  VAL n 
5 119  LEU n 
5 120  GLY n 
5 121  GLU n 
5 122  VAL n 
5 123  VAL n 
5 124  GLU n 
5 125  LEU n 
5 126  GLY n 
5 127  GLU n 
5 128  VAL n 
5 129  ARG n 
5 130  LEU n 
5 131  GLU n 
5 132  PHE n 
5 133  PHE n 
5 134  GLY n 
5 135  ASP n 
5 136  GLU n 
5 137  LEU n 
5 138  GLU n 
5 139  ARG n 
5 140  LEU n 
5 141  VAL n 
5 142  VAL n 
5 143  ARG n 
5 144  GLY n 
5 145  GLU n 
5 146  GLU n 
5 147  ARG n 
5 148  ARG n 
5 149  ARG n 
5 150  HIS n 
5 151  VAL n 
5 152  LEU n 
5 153  LEU n 
5 154  PRO n 
5 155  LYS n 
5 156  PRO n 
5 157  GLY n 
5 158  LYS n 
5 159  ALA n 
5 160  GLU n 
5 161  GLY n 
5 162  PHE n 
5 163  THR n 
5 164  SER n 
5 165  LYS n 
5 166  LYS n 
5 167  VAL n 
5 168  LEU n 
5 169  HIS n 
5 170  PHE n 
5 171  PRO n 
5 172  GLY n 
5 173  PRO n 
5 174  VAL n 
5 175  TYR n 
5 176  LEU n 
5 177  ASP n 
5 178  THR n 
5 179  PRO n 
5 180  ALA n 
5 181  LEU n 
5 182  ALA n 
5 183  PRO n 
5 184  LYS n 
5 185  ALA n 
5 186  LEU n 
5 187  TRP n 
5 188  PRO n 
5 189  LEU n 
5 190  LEU n 
5 191  ALA n 
5 192  GLY n 
5 193  ARG n 
5 194  PRO n 
5 195  TRP n 
5 196  VAL n 
5 197  ALA n 
5 198  LEU n 
5 199  GLY n 
5 200  GLY n 
5 201  GLY n 
5 202  VAL n 
5 203  GLU n 
5 204  LEU n 
5 205  PRO n 
5 206  PRO n 
5 207  LEU n 
5 208  GLU n 
5 209  LEU n 
5 210  GLY n 
5 211  ALA n 
5 212  ARG n 
5 213  PRO n 
5 214  LEU n 
5 215  PRO n 
5 216  PRO n 
5 217  TYR n 
5 218  ARG n 
5 219  GLY n 
5 220  SER n 
5 221  LEU n 
5 222  LYS n 
5 223  ALA n 
5 224  LEU n 
5 225  GLU n 
5 226  LYS n 
5 227  ASP n 
5 228  LEU n 
5 229  ALA n 
5 230  ARG n 
5 231  TRP n 
5 232  LEU n 
5 233  ALA n 
5 234  GLU n 
5 235  GLY n 
5 236  LYS n 
5 237  ARG n 
5 238  VAL n 
5 239  HIS n 
5 240  LEU n 
5 241  PHE n 
5 242  VAL n 
5 243  GLY n 
5 244  HIS n 
5 245  ALA n 
5 246  ARG n 
5 247  THR n 
5 248  LEU n 
5 249  GLU n 
5 250  TYR n 
5 251  LEU n 
5 252  LYS n 
5 253  ARG n 
5 254  ARG n 
5 255  LEU n 
5 256  GLN n 
5 257  ALA n 
5 258  PHE n 
5 259  SER n 
5 260  PRO n 
5 261  LEU n 
5 262  ILE n 
5 263  LEU n 
5 264  ASP n 
5 265  ARG n 
5 266  PHE n 
5 267  PRO n 
5 268  GLY n 
5 269  PRO n 
5 270  LYS n 
5 271  GLY n 
5 272  ARG n 
5 273  LEU n 
5 274  ALA n 
5 275  LEU n 
5 276  LEU n 
5 277  PRO n 
5 278  GLY n 
5 279  ASP n 
5 280  PHE n 
5 281  GLU n 
5 282  GLY n 
5 283  GLY n 
5 284  ALA n 
5 285  GLU n 
5 286  TRP n 
5 287  GLY n 
5 288  GLU n 
5 289  TRP n 
5 290  VAL n 
5 291  LEU n 
5 292  LEU n 
5 293  THR n 
5 294  GLU n 
5 295  ALA n 
5 296  LEU n 
5 297  VAL n 
5 298  PHE n 
5 299  ALA n 
5 300  THR n 
5 301  GLY n 
5 302  GLY n 
5 303  VAL n 
5 304  ARG n 
5 305  ALA n 
5 306  ARG n 
5 307  VAL n 
5 308  ARG n 
5 309  VAL n 
5 310  GLY n 
5 311  GLU n 
5 312  GLY n 
5 313  LEU n 
5 314  SER n 
5 315  ASP n 
5 316  PRO n 
5 317  GLY n 
5 318  ALA n 
5 319  LEU n 
5 320  SER n 
5 321  PRO n 
5 322  GLY n 
5 323  ASP n 
5 324  TYR n 
5 325  LEU n 
5 326  ILE n 
5 327  HIS n 
5 328  PRO n 
5 329  GLU n 
5 330  HIS n 
5 331  GLY n 
5 332  VAL n 
5 333  GLY n 
5 334  GLN n 
5 335  TYR n 
5 336  LEU n 
5 337  GLY n 
5 338  LEU n 
5 339  GLU n 
5 340  THR n 
5 341  ARG n 
5 342  GLU n 
5 343  VAL n 
5 344  LEU n 
5 345  GLY n 
5 346  VAL n 
5 347  LYS n 
5 348  ARG n 
5 349  ASP n 
5 350  TYR n 
5 351  LEU n 
5 352  VAL n 
5 353  LEU n 
5 354  ARG n 
5 355  TYR n 
5 356  LYS n 
5 357  GLY n 
5 358  GLU n 
5 359  GLY n 
5 360  LYS n 
5 361  LEU n 
5 362  TYR n 
5 363  LEU n 
5 364  PRO n 
5 365  VAL n 
5 366  GLU n 
5 367  GLN n 
5 368  LEU n 
5 369  PRO n 
5 370  LEU n 
5 371  LEU n 
5 372  LYS n 
5 373  ARG n 
5 374  HIS n 
5 375  PRO n 
5 376  GLY n 
5 377  THR n 
5 378  THR n 
5 379  ASP n 
5 380  ASP n 
5 381  PRO n 
5 382  PRO n 
5 383  GLU n 
5 384  LEU n 
5 385  SER n 
5 386  SER n 
5 387  LEU n 
5 388  GLY n 
5 389  LYS n 
5 390  ASN n 
5 391  GLU n 
5 392  TRP n 
5 393  GLN n 
5 394  ARG n 
5 395  ALA n 
5 396  LYS n 
5 397  GLU n 
5 398  LYS n 
5 399  ALA n 
5 400  ARG n 
5 401  LYS n 
5 402  ASP n 
5 403  VAL n 
5 404  GLU n 
5 405  GLU n 
5 406  LEU n 
5 407  ALA n 
5 408  GLY n 
5 409  ARG n 
5 410  LEU n 
5 411  LEU n 
5 412  VAL n 
5 413  LEU n 
5 414  GLN n 
5 415  ALA n 
5 416  LYS n 
5 417  ARG n 
5 418  LYS n 
5 419  ALA n 
5 420  THR n 
5 421  PRO n 
5 422  GLY n 
5 423  ARG n 
5 424  ALA n 
5 425  PHE n 
5 426  PRO n 
5 427  PRO n 
5 428  LEU n 
5 429  PRO n 
5 430  GLU n 
5 431  TRP n 
5 432  ASP n 
5 433  PRO n 
5 434  LEU n 
5 435  VAL n 
5 436  GLU n 
5 437  LYS n 
5 438  GLY n 
5 439  PHE n 
5 440  PRO n 
5 441  TYR n 
5 442  GLU n 
5 443  LEU n 
5 444  THR n 
5 445  PRO n 
5 446  ASP n 
5 447  GLN n 
5 448  LYS n 
5 449  ARG n 
5 450  ALA n 
5 451  LEU n 
5 452  GLU n 
5 453  GLU n 
5 454  VAL n 
5 455  LEU n 
5 456  ARG n 
5 457  ASP n 
5 458  LEU n 
5 459  GLU n 
5 460  SER n 
5 461  PRO n 
5 462  HIS n 
5 463  PRO n 
5 464  MET n 
5 465  ASP n 
5 466  ARG n 
5 467  LEU n 
5 468  VAL n 
5 469  SER n 
5 470  GLY n 
5 471  ASP n 
5 472  VAL n 
5 473  GLY n 
5 474  PHE n 
5 475  GLY n 
5 476  LYS n 
5 477  THR n 
5 478  GLU n 
5 479  VAL n 
5 480  ALA n 
5 481  LEU n 
5 482  ARG n 
5 483  ALA n 
5 484  ALA n 
5 485  HIS n 
5 486  ARG n 
5 487  VAL n 
5 488  VAL n 
5 489  GLY n 
5 490  HIS n 
5 491  GLY n 
5 492  ALA n 
5 493  GLN n 
5 494  VAL n 
5 495  ALA n 
5 496  PHE n 
5 497  LEU n 
5 498  VAL n 
5 499  PRO n 
5 500  THR n 
5 501  THR n 
5 502  LEU n 
5 503  LEU n 
5 504  ALA n 
5 505  GLU n 
5 506  GLN n 
5 507  HIS n 
5 508  GLY n 
5 509  LYS n 
5 510  THR n 
5 511  PHE n 
5 512  ARG n 
5 513  GLU n 
5 514  ARG n 
5 515  PHE n 
5 516  GLN n 
5 517  GLY n 
5 518  LEU n 
5 519  PRO n 
5 520  VAL n 
5 521  ARG n 
5 522  VAL n 
5 523  ALA n 
5 524  VAL n 
5 525  LEU n 
5 526  SER n 
5 527  ARG n 
5 528  PHE n 
5 529  THR n 
5 530  PRO n 
5 531  PRO n 
5 532  LYS n 
5 533  GLU n 
5 534  GLU n 
5 535  GLU n 
5 536  ALA n 
5 537  ILE n 
5 538  LEU n 
5 539  LYS n 
5 540  GLY n 
5 541  LEU n 
5 542  ALA n 
5 543  GLU n 
5 544  GLY n 
5 545  THR n 
5 546  VAL n 
5 547  ASP n 
5 548  ILE n 
5 549  VAL n 
5 550  ILE n 
5 551  GLY n 
5 552  THR n 
5 553  HIS n 
5 554  ARG n 
5 555  LEU n 
5 556  LEU n 
5 557  GLN n 
5 558  GLU n 
5 559  ASP n 
5 560  VAL n 
5 561  ARG n 
5 562  PHE n 
5 563  ARG n 
5 564  ASP n 
5 565  LEU n 
5 566  GLY n 
5 567  LEU n 
5 568  LEU n 
5 569  ILE n 
5 570  VAL n 
5 571  ASP n 
5 572  GLU n 
5 573  GLU n 
5 574  HIS n 
5 575  ARG n 
5 576  PHE n 
5 577  GLY n 
5 578  VAL n 
5 579  ALA n 
5 580  GLN n 
5 581  LYS n 
5 582  GLU n 
5 583  ARG n 
5 584  ILE n 
5 585  ARG n 
5 586  GLU n 
5 587  LEU n 
5 588  LYS n 
5 589  ALA n 
5 590  GLU n 
5 591  VAL n 
5 592  ASP n 
5 593  THR n 
5 594  LEU n 
5 595  TYR n 
5 596  LEU n 
5 597  SER n 
5 598  ALA n 
5 599  THR n 
5 600  PRO n 
5 601  ILE n 
5 602  PRO n 
5 603  ARG n 
5 604  THR n 
5 605  LEU n 
5 606  TYR n 
5 607  SER n 
5 608  ALA n 
5 609  LEU n 
5 610  VAL n 
5 611  GLY n 
5 612  LEU n 
5 613  LYS n 
5 614  ASP n 
5 615  LEU n 
5 616  SER n 
5 617  SER n 
5 618  ILE n 
5 619  GLN n 
5 620  THR n 
5 621  PRO n 
5 622  PRO n 
5 623  PRO n 
5 624  GLY n 
5 625  ARG n 
5 626  LYS n 
5 627  PRO n 
5 628  ILE n 
5 629  LYS n 
5 630  THR n 
5 631  PHE n 
5 632  LEU n 
5 633  ALA n 
5 634  PRO n 
5 635  PHE n 
5 636  ASP n 
5 637  PRO n 
5 638  LEU n 
5 639  LEU n 
5 640  VAL n 
5 641  ARG n 
5 642  GLU n 
5 643  ALA n 
5 644  ILE n 
5 645  LEU n 
5 646  PHE n 
5 647  GLU n 
5 648  LEU n 
5 649  GLU n 
5 650  ARG n 
5 651  GLY n 
5 652  GLY n 
5 653  LYS n 
5 654  VAL n 
5 655  PHE n 
5 656  TYR n 
5 657  VAL n 
5 658  HIS n 
5 659  ASP n 
5 660  ARG n 
5 661  VAL n 
5 662  ALA n 
5 663  SER n 
5 664  ILE n 
5 665  GLU n 
5 666  ALA n 
5 667  ARG n 
5 668  ARG n 
5 669  ARG n 
5 670  PHE n 
5 671  LEU n 
5 672  GLU n 
5 673  SER n 
5 674  LEU n 
5 675  VAL n 
5 676  PRO n 
5 677  GLU n 
5 678  ALA n 
5 679  ARG n 
5 680  ILE n 
5 681  GLY n 
5 682  VAL n 
5 683  VAL n 
5 684  HIS n 
5 685  GLY n 
5 686  GLN n 
5 687  MET n 
5 688  PRO n 
5 689  GLU n 
5 690  SER n 
5 691  LEU n 
5 692  ILE n 
5 693  GLU n 
5 694  GLU n 
5 695  THR n 
5 696  MET n 
5 697  LEU n 
5 698  LEU n 
5 699  PHE n 
5 700  ALA n 
5 701  GLU n 
5 702  GLY n 
5 703  ALA n 
5 704  TYR n 
5 705  ASP n 
5 706  VAL n 
5 707  LEU n 
5 708  LEU n 
5 709  ALA n 
5 710  THR n 
5 711  THR n 
5 712  ILE n 
5 713  ILE n 
5 714  GLU n 
5 715  ALA n 
5 716  GLY n 
5 717  LEU n 
5 718  ASP n 
5 719  VAL n 
5 720  PRO n 
5 721  GLU n 
5 722  ALA n 
5 723  ASN n 
5 724  THR n 
5 725  ILE n 
5 726  LEU n 
5 727  ILE n 
5 728  GLU n 
5 729  ARG n 
5 730  ALA n 
5 731  ASP n 
5 732  ARG n 
5 733  LEU n 
5 734  GLY n 
5 735  LEU n 
5 736  ALA n 
5 737  THR n 
5 738  LEU n 
5 739  TYR n 
5 740  GLN n 
5 741  LEU n 
5 742  ARG n 
5 743  GLY n 
5 744  ARG n 
5 745  VAL n 
5 746  GLY n 
5 747  ARG n 
5 748  ARG n 
5 749  GLU n 
5 750  GLU n 
5 751  GLU n 
5 752  ALA n 
5 753  TYR n 
5 754  ALA n 
5 755  TYR n 
5 756  LEU n 
5 757  PHE n 
5 758  HIS n 
5 759  PRO n 
5 760  PRO n 
5 761  ARG n 
5 762  LEU n 
5 763  THR n 
5 764  GLU n 
5 765  ALA n 
5 766  ALA n 
5 767  GLU n 
5 768  LYS n 
5 769  ARG n 
5 770  LEU n 
5 771  ALA n 
5 772  ALA n 
5 773  ILE n 
5 774  ALA n 
5 775  ASP n 
5 776  LEU n 
5 777  SER n 
5 778  ASP n 
5 779  LEU n 
5 780  GLY n 
5 781  SER n 
5 782  GLY n 
5 783  HIS n 
5 784  LEU n 
5 785  LEU n 
5 786  ALA n 
5 787  GLU n 
5 788  ARG n 
5 789  ASP n 
5 790  MET n 
5 791  GLU n 
5 792  ILE n 
5 793  ARG n 
5 794  GLY n 
5 795  VAL n 
5 796  GLY n 
5 797  ASN n 
5 798  LEU n 
5 799  LEU n 
5 800  GLY n 
5 801  PRO n 
5 802  GLU n 
5 803  GLN n 
5 804  HIS n 
5 805  GLY n 
5 806  HIS n 
5 807  ILE n 
5 808  ARG n 
5 809  ALA n 
5 810  LEU n 
5 811  SER n 
5 812  LEU n 
5 813  GLU n 
5 814  VAL n 
5 815  TYR n 
5 816  THR n 
5 817  GLU n 
5 818  LEU n 
5 819  LEU n 
5 820  GLU n 
5 821  GLU n 
5 822  ALA n 
5 823  ILE n 
5 824  ARG n 
5 825  LYS n 
5 826  LEU n 
5 827  LYS n 
5 828  GLY n 
5 829  GLU n 
5 830  VAL n 
5 831  LYS n 
5 832  GLU n 
5 833  GLU n 
5 834  ARG n 
5 835  ARG n 
5 836  HIS n 
5 837  VAL n 
5 838  THR n 
5 839  LEU n 
5 840  ASP n 
5 841  LEU n 
5 842  ALA n 
5 843  LEU n 
5 844  SER n 
5 845  ALA n 
5 846  ARG n 
5 847  LEU n 
5 848  PRO n 
5 849  ALA n 
5 850  GLU n 
5 851  TYR n 
5 852  VAL n 
5 853  GLY n 
5 854  SER n 
5 855  LEU n 
5 856  GLU n 
5 857  ALA n 
5 858  ARG n 
5 859  SER n 
5 860  ARG n 
5 861  TYR n 
5 862  TYR n 
5 863  SER n 
5 864  ARG n 
5 865  PHE n 
5 866  ALA n 
5 867  GLU n 
5 868  ALA n 
5 869  LYS n 
5 870  SER n 
5 871  LEU n 
5 872  ALA n 
5 873  GLU n 
5 874  LEU n 
5 875  SER n 
5 876  ARG n 
5 877  LEU n 
5 878  VAL n 
5 879  ARG n 
5 880  GLU n 
5 881  LEU n 
5 882  LYS n 
5 883  GLU n 
5 884  ARG n 
5 885  TYR n 
5 886  GLY n 
5 887  PRO n 
5 888  LEU n 
5 889  PRO n 
5 890  GLU n 
5 891  GLU n 
5 892  ALA n 
5 893  GLU n 
5 894  ASN n 
5 895  PHE n 
5 896  VAL n 
5 897  ALA n 
5 898  LEU n 
5 899  ALA n 
5 900  ARG n 
5 901  LEU n 
5 902  ARG n 
5 903  LEU n 
5 904  VAL n 
5 905  ALA n 
5 906  GLU n 
5 907  ARG n 
5 908  LYS n 
5 909  GLY n 
5 910  VAL n 
5 911  VAL n 
5 912  SER n 
5 913  ILE n 
5 914  THR n 
5 915  GLU n 
5 916  GLY n 
5 917  LEU n 
5 918  THR n 
5 919  HIS n 
5 920  LEU n 
5 921  GLU n 
5 922  VAL n 
5 923  VAL n 
5 924  PHE n 
5 925  PRO n 
5 926  ARG n 
5 927  TYR n 
5 928  PRO n 
5 929  LEU n 
5 930  ASP n 
5 931  TYR n 
5 932  ASP n 
5 933  ALA n 
5 934  ARG n 
5 935  GLY n 
5 936  LEU n 
5 937  LYS n 
5 938  GLY n 
5 939  LEU n 
5 940  PRO n 
5 941  TYR n 
5 942  ARG n 
5 943  VAL n 
5 944  GLU n 
5 945  LEU n 
5 946  THR n 
5 947  GLN n 
5 948  TYR n 
5 949  PRO n 
5 950  PRO n 
5 951  GLY n 
5 952  PHE n 
5 953  ARG n 
5 954  LEU n 
5 955  GLU n 
5 956  LYS n 
5 957  LYS n 
5 958  GLY n 
5 959  LEU n 
5 960  ARG n 
5 961  PRO n 
5 962  ARG n 
5 963  ASP n 
5 964  TYR n 
5 965  PRO n 
5 966  GLU n 
5 967  ALA n 
5 968  LEU n 
5 969  MET n 
5 970  GLU n 
5 971  VAL n 
5 972  LEU n 
5 973  TYR n 
5 974  LEU n 
5 975  PHE n 
5 976  ALA n 
5 977  ASP n 
5 978  LEU n 
6 1    DG  n 
6 2    DG  n 
6 3    DG  n 
6 4    DT  n 
6 5    DA  n 
6 6    DT  n 
6 7    DT  n 
6 8    DC  n 
6 9    DG  n 
6 10   DC  n 
6 11   DC  n 
6 12   DG  n 
6 13   DT  n 
6 14   DG  n 
6 15   DT  n 
6 16   DA  n 
6 17   DC  n 
6 18   DC  n 
6 19   DT  n 
6 20   DC  n 
6 21   DT  n 
6 22   DC  n 
6 23   DC  n 
6 24   DT  n 
6 25   DA  n 
6 26   DG  n 
6 27   DC  n 
6 28   DC  n 
6 29   DC  n 
6 30   DA  n 
6 31   DA  n 
6 32   DC  n 
6 33   DC  n 
6 34   DA  n 
6 35   DT  n 
6 36   DA  n 
6 37   DT  n 
6 38   DG  n 
6 39   DG  n 
6 40   DA  n 
6 41   DT  n 
6 42   DT  n 
6 43   DA  n 
6 44   DT  n 
6 45   DT  n 
6 46   DA  n 
6 47   DA  n 
6 48   DG  n 
6 49   DC  n 
6 50   DA  n 
6 51   DA  n 
6 52   DA  n 
6 53   DG  n 
6 54   DC  n 
6 55   DT  n 
6 56   DT  n 
6 57   DC  n 
6 58   DT  n 
6 59   DT  n 
6 60   DT  n 
6 61   DT  n 
6 62   DC  n 
6 63   DG  n 
7 1    DC  n 
7 2    DG  n 
7 3    DA  n 
7 4    DA  n 
7 5    DA  n 
7 6    DA  n 
7 7    DG  n 
7 8    DA  n 
7 9    DA  n 
7 10   DG  n 
7 11   DC  n 
7 12   DT  n 
7 13   DT  n 
7 14   DT  n 
7 15   DG  n 
7 16   DC  n 
7 17   DT  n 
7 18   DT  n 
7 19   DA  n 
7 20   DA  n 
7 21   DT  n 
7 22   DA  n 
7 23   DA  n 
7 24   DT  n 
7 25   DC  n 
7 26   DC  n 
7 27   DA  n 
7 28   DT  n 
7 29   DA  n 
7 30   DT  n 
7 31   DG  n 
7 32   DG  n 
7 33   DT  n 
7 34   DT  n 
7 35   DG  n 
7 36   DG  n 
7 37   DG  n 
7 38   DC  n 
7 39   DT  n 
7 40   DA  n 
7 41   DC  n 
7 42   DC  n 
7 43   DT  n 
7 44   DC  n 
7 45   DT  n 
7 46   DC  n 
7 47   DC  n 
7 48   DA  n 
7 49   DT  n 
7 50   DG  n 
7 51   DA  n 
7 52   DC  n 
7 53   DG  n 
7 54   DG  n 
7 55   DC  n 
7 56   DG  n 
7 57   DA  n 
7 58   DA  n 
7 59   DT  n 
7 60   DA  n 
7 61   DC  n 
7 62   DC  n 
7 63   DC  n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   978 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'mfd, TT_C0533' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'HB27 / ATCC BAA-163 / DSM 7039' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     262724 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample 1 315  ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
2 1 sample 1 1119 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
3 1 sample 1 1524 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
4 1 sample 1 99   ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 63 'Thermus thermophilus' ? 274 ? 
7 1 sample 1 63 'Thermus thermophilus' ? 274 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_THET8   Q5SHR6 ? 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 
2 UNP RPOB_THET8   Q8RQE9 ? 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 
3 UNP RPOC_THET8   Q8RQE8 ? 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 
4 UNP RPOZ_THET8   Q8RQE7 ? 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 
5 UNP Q72KB4_THET2 Q72KB4 ? 5 
;MEIALERIYGHRLALPQVGAALLFAQEAPPALLLVPEARLRRYRDLSAFGAKVYVNPGLEALEEKALFVLSYEEALSPFP
EDPEAWRLLLEVGRAYPREALLSRLLKLGYARDEDYRVLGEVVELGEVRLEFFGDELERLVVRGEERRRHVLLPKPGKAE
GFTSKKVLHFPGPVYLDTPALAPKALWPLLAGRPWVALGGGVELPPLELGARPLPPYRGSLKALEKDLARWLAEGKRVHL
FVGHARTLEYLKRRLQAFSPLILDRFPGPKGRLALLPGDFEGGAEWGEWVLLTEALVFATGGVRARVRVGEGLSDPGALS
PGDYLIHPEHGVGQYLGLETREVLGVKRDYLVLRYKGEGKLYLPVEQLPLLKRHPGTTDDPPELSSLGKNEWQRAKEKAR
KDVEELAGRLLVLQAKRKATPGRAFPPLPEWDPLVEKGFPYELTPDQKRALEEVLRDLESPHPMDRLVSGDVGFGKTEVA
LRAAHRVVGHGAQVAFLVPTTLLAEQHGKTFRERFQGLPVRVAVLSRFTPPKEEEAILKGLAEGTVDIVIGTHRLLQEDV
RFRDLGLLIVDEEHRFGVAQKERIRELKAEVDTLYLSATPIPRTLYSALVGLKDLSSIQTPPPGRKPIKTFLAPFDPLLV
REAILFELERGGKVFYVHDRVASIEARRRFLESLVPEARIGVVHGQMPESLIEETMLLFAEGAYDVLLATTIIEAGLDVP
EANTILIERADRLGLATLYQLRGRVGRREEEAYAYLFHPPRLTEAAEKRLAAIADLSDLGSGHLLAERDMEIRGVGNLLG
PEQHGHIRALSLEVYTELLEEAIRKLKGEVKEERRHVTLDLALSARLPAEYVGSLEARSRYYSRFAEAKSLAELSRLVRE
LKERYGPLPEEAENFVALARLRLVAERKGVVSITEGLTHLEVVFPRYPLDYDARGLKGLPYRVELTQYPPGFRLEKKGLR
PRDYPEALMEVLYLFADL
;
1 
6 PDB 6M6A         6M6A   ? 6 ? 1 
7 PDB 6M6A         6M6A   ? 7 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6M6A A 1 ? 315  ? Q5SHR6 1   ? 315  ? 1   315  
2 1 6M6A B 1 ? 315  ? Q5SHR6 1   ? 315  ? 1   315  
3 2 6M6A C 1 ? 1119 ? Q8RQE9 1   ? 1119 ? 1   1119 
4 3 6M6A D 1 ? 1524 ? Q8RQE8 1   ? 1524 ? 1   1524 
5 4 6M6A E 1 ? 99   ? Q8RQE7 1   ? 99   ? 1   99   
6 5 6M6A M 1 ? 978  ? Q72KB4 1   ? 978  ? 1   978  
7 6 6M6A T 1 ? 63   ? 6M6A   1   ? 63   ? 1   63   
8 7 6M6A N 1 ? 63   ? 6M6A   -23 ? 39   ? -23 39   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6M6A 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6M6A 
_struct.title                        'Cryo-EM structure of Thermus thermophilus Mfd in complex with RNA polymerase' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, Transcription-repair-coupling factor/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6M6A 
_struct_keywords.text            'Transcription, RNA polymerase, DNA repair, Mfd' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 8 ? 
J N N 8 ? 
K N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   AA2 ASP A 74   ? GLU A 84   ? ASP A 74   GLU A 84   1 ? 11 
HELX_P HELX_P3   AA3 ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   AA4 PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   AA5 THR A 206  ? THR A 223  ? THR A 206  THR A 223  1 ? 18 
HELX_P HELX_P6   AA6 TYR A 224  ? ASN A 227  ? TYR A 224  ASN A 227  5 ? 4  
HELX_P HELX_P7   AA7 GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P8   AA8 ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P9   AA9 ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P10  AB1 PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P11  AB2 THR B 206  ? TYR B 224  ? THR B 206  TYR B 224  1 ? 19 
HELX_P HELX_P12  AB3 THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P13  AB4 GLY C 43   ? PHE C 52   ? GLY C 43   PHE C 52   1 ? 10 
HELX_P HELX_P14  AB5 PRO C 79   ? LYS C 86   ? PRO C 79   LYS C 86   1 ? 8  
HELX_P HELX_P15  AB6 LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P16  AB7 ASP C 203  ? LEU C 211  ? ASP C 203  LEU C 211  1 ? 9  
HELX_P HELX_P17  AB8 TYR C 214  ? MET C 222  ? TYR C 214  MET C 222  1 ? 9  
HELX_P HELX_P18  AB9 ASP C 223  ? ALA C 228  ? ASP C 223  ALA C 228  1 ? 6  
HELX_P HELX_P19  AC1 ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P20  AC2 LYS C 249  ? ILE C 261  ? LYS C 249  ILE C 261  1 ? 13 
HELX_P HELX_P21  AC3 GLY C 270  ? LEU C 281  ? GLY C 270  LEU C 281  1 ? 12 
HELX_P HELX_P22  AC4 VAL C 302  ? ALA C 315  ? VAL C 302  ALA C 315  1 ? 14 
HELX_P HELX_P23  AC5 HIS C 327  ? GLY C 329  ? HIS C 327  GLY C 329  5 ? 3  
HELX_P HELX_P24  AC6 THR C 335  ? MET C 359  ? THR C 335  MET C 359  1 ? 25 
HELX_P HELX_P25  AC7 THR C 368  ? LEU C 372  ? THR C 368  LEU C 372  5 ? 5  
HELX_P HELX_P26  AC8 SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P27  AC9 ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P28  AD1 HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P29  AD2 THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P30  AD3 PRO C 536  ? PHE C 540  ? PRO C 536  PHE C 540  5 ? 5  
HELX_P HELX_P31  AD4 ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P32  AD5 PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P33  AD6 ASP C 554  ? THR C 566  ? ASP C 554  THR C 566  1 ? 13 
HELX_P HELX_P34  AD7 LEU C 583  ? LEU C 592  ? LEU C 583  LEU C 592  1 ? 10 
HELX_P HELX_P35  AD8 PRO C 769  ? GLY C 779  ? PRO C 769  GLY C 779  1 ? 11 
HELX_P HELX_P36  AD9 ASN C 872  ? VAL C 876  ? ASN C 872  VAL C 876  5 ? 5  
HELX_P HELX_P37  AE1 LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P38  AE2 LYS C 910  ? LYS C 930  ? LYS C 910  LYS C 930  1 ? 21 
HELX_P HELX_P39  AE3 ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P40  AE4 THR C 958  ? GLN C 969  ? THR C 958  GLN C 969  1 ? 12 
HELX_P HELX_P41  AE5 MET C 1000 ? LYS C 1004 ? MET C 1000 LYS C 1004 5 ? 5  
HELX_P HELX_P42  AE6 GLU C 1034 ? GLY C 1044 ? GLU C 1034 GLY C 1044 1 ? 11 
HELX_P HELX_P43  AE7 ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P44  AE8 ASP C 1059 ? GLY C 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P45  AE9 PRO C 1082 ? LEU C 1095 ? PRO C 1082 LEU C 1095 1 ? 14 
HELX_P HELX_P46  AF1 SER D 14   ? SER D 20   ? SER D 14   SER D 20   1 ? 7  
HELX_P HELX_P47  AF2 ASP D 46   ? GLY D 51   ? ASP D 46   GLY D 51   1 ? 6  
HELX_P HELX_P48  AF3 LYS D 82   ? TYR D 88   ? LYS D 82   TYR D 88   5 ? 7  
HELX_P HELX_P49  AF4 ILE D 102  ? ASP D 107  ? ILE D 102  ASP D 107  1 ? 6  
HELX_P HELX_P50  AF5 SER D 110  ? LEU D 116  ? SER D 110  LEU D 116  1 ? 7  
HELX_P HELX_P51  AF6 SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P52  AF7 ASP D 155  ? GLY D 164  ? ASP D 155  GLY D 164  1 ? 10 
HELX_P HELX_P53  AF8 ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P54  AF9 GLY D 457  ? GLU D 467  ? GLY D 457  GLU D 467  1 ? 11 
HELX_P HELX_P55  AG1 ASP D 469  ? HIS D 483  ? ASP D 469  HIS D 483  1 ? 15 
HELX_P HELX_P56  AG2 SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P57  AG3 ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P58  AG4 SER D 538  ? ALA D 559  ? SER D 538  ALA D 559  1 ? 22 
HELX_P HELX_P59  AG5 PRO D 563  ? ASP D 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P60  AG6 SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P61  AG7 GLY D 612  ? GLY D 620  ? GLY D 612  GLY D 620  1 ? 9  
HELX_P HELX_P62  AG8 PRO D 645  ? PHE D 653  ? PRO D 645  PHE D 653  1 ? 9  
HELX_P HELX_P63  AG9 PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P64  AH1 ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P65  AH2 GLN D 680  ? ILE D 683  ? GLN D 680  ILE D 683  5 ? 4  
HELX_P HELX_P66  AH3 ASP D 685  ? ILE D 695  ? ASP D 685  ILE D 695  1 ? 11 
HELX_P HELX_P67  AH4 HIS D 709  ? ILE D 713  ? HIS D 709  ILE D 713  5 ? 5  
HELX_P HELX_P68  AH5 HIS D 729  ? CYS D 733  ? HIS D 729  CYS D 733  5 ? 5  
HELX_P HELX_P69  AH6 SER D 752  ? GLN D 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P70  AH7 SER D 782  ? GLN D 794  ? SER D 782  GLN D 794  1 ? 13 
HELX_P HELX_P71  AH8 THR D 808  ? ARG D 818  ? THR D 808  ARG D 818  1 ? 11 
HELX_P HELX_P72  AH9 SER D 835  ? TYR D 841  ? SER D 835  TYR D 841  1 ? 7  
HELX_P HELX_P73  AI1 ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P74  AI2 SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P75  AI3 ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P76  AI4 GLU D 907  ? GLY D 923  ? GLU D 907  GLY D 923  1 ? 17 
HELX_P HELX_P77  AI5 MET D 924  ? SER D 945  ? MET D 924  SER D 945  1 ? 22 
HELX_P HELX_P78  AI6 GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P79  AI7 GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P80  AI8 THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P81  AI9 ASN D 1018 ? GLY D 1027 ? ASN D 1018 GLY D 1027 1 ? 10 
HELX_P HELX_P82  AJ1 ASN D 1031 ? CYS D 1039 ? ASN D 1031 CYS D 1039 1 ? 9  
HELX_P HELX_P83  AJ2 THR D 1066 ? THR D 1102 ? THR D 1066 THR D 1102 1 ? 37 
HELX_P HELX_P84  AJ3 LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P85  AJ4 SER D 1167 ? GLY D 1181 ? SER D 1167 GLY D 1181 1 ? 15 
HELX_P HELX_P86  AJ5 SER D 1190 ? CYS D 1194 ? SER D 1190 CYS D 1194 5 ? 5  
HELX_P HELX_P87  AJ6 GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P88  AJ7 ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P89  AJ8 PRO D 1232 ? LEU D 1236 ? PRO D 1232 LEU D 1236 5 ? 5  
HELX_P HELX_P90  AJ9 GLY D 1255 ? PHE D 1263 ? GLY D 1255 PHE D 1263 1 ? 9  
HELX_P HELX_P91  AK1 ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P92  AK2 PRO D 1341 ? GLY D 1360 ? PRO D 1341 GLY D 1360 1 ? 20 
HELX_P HELX_P93  AK3 ASP D 1365 ? MET D 1376 ? ASP D 1365 MET D 1376 1 ? 12 
HELX_P HELX_P94  AK4 LYS D 1397 ? GLY D 1411 ? LYS D 1397 GLY D 1411 1 ? 15 
HELX_P HELX_P95  AK5 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P96  AK6 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P97  AK7 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P98  AK8 LEU D 1462 ? GLY D 1469 ? LEU D 1462 GLY D 1469 1 ? 8  
HELX_P HELX_P99  AK9 ALA D 1474 ? GLY D 1477 ? ALA D 1474 GLY D 1477 5 ? 4  
HELX_P HELX_P100 AL1 SER D 1478 ? PHE D 1483 ? SER D 1478 PHE D 1483 1 ? 6  
HELX_P HELX_P101 AL2 GLN D 1489 ? GLU D 1501 ? GLN D 1489 GLU D 1501 1 ? 13 
HELX_P HELX_P102 AL3 GLY E 5    ? GLY E 11   ? GLY E 5    GLY E 11   1 ? 7  
HELX_P HELX_P103 AL4 SER E 15   ? HIS E 33   ? SER E 15   HIS E 33   1 ? 19 
HELX_P HELX_P104 AL5 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P105 AL6 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P106 AL7 PRO F 364  ? LEU F 371  ? PRO M 364  LEU M 371  5 ? 8  
HELX_P HELX_P107 AL8 ALA F 407  ? THR F 420  ? ALA M 407  THR M 420  1 ? 14 
HELX_P HELX_P108 AL9 GLU F 430  ? LYS F 437  ? GLU M 430  LYS M 437  1 ? 8  
HELX_P HELX_P109 AM1 THR F 444  ? SER F 460  ? THR M 444  SER M 460  1 ? 17 
HELX_P HELX_P110 AM2 THR F 477  ? VAL F 488  ? THR M 477  VAL M 488  1 ? 12 
HELX_P HELX_P111 AM3 GLY F 489  ? GLY F 491  ? GLY M 489  GLY M 491  5 ? 3  
HELX_P HELX_P112 AM4 THR F 500  ? PHE F 515  ? THR M 500  PHE M 515  1 ? 16 
HELX_P HELX_P113 AM5 PRO F 530  ? GLU F 543  ? PRO M 530  GLU M 543  1 ? 14 
HELX_P HELX_P114 AM6 THR F 552  ? GLU F 558  ? THR M 552  GLU M 558  1 ? 7  
HELX_P HELX_P115 AM7 GLU F 572  ? GLY F 577  ? GLU M 572  GLY M 577  1 ? 6  
HELX_P HELX_P116 AM8 GLY F 577  ? LEU F 587  ? GLY M 577  LEU M 587  1 ? 11 
HELX_P HELX_P117 AM9 LEU F 605  ? LYS F 613  ? LEU M 605  LYS M 613  1 ? 9  
HELX_P HELX_P118 AN1 ASP F 636  ? ARG F 650  ? ASP M 636  ARG M 650  1 ? 15 
HELX_P HELX_P119 AN2 SER F 663  ? VAL F 675  ? SER M 663  VAL M 675  1 ? 13 
HELX_P HELX_P120 AN3 PRO F 688  ? GLY F 702  ? PRO M 688  GLY M 702  1 ? 15 
HELX_P HELX_P121 AN4 ARG F 729  ? LEU F 733  ? ARG M 729  LEU M 733  5 ? 5  
HELX_P HELX_P122 AN5 GLY F 734  ? GLY F 743  ? GLY M 734  GLY M 743  1 ? 10 
HELX_P HELX_P123 AN6 THR F 763  ? ASP F 775  ? THR M 763  ASP M 775  1 ? 13 
HELX_P HELX_P124 AN7 SER F 781  ? GLY F 796  ? SER M 781  GLY M 796  1 ? 16 
HELX_P HELX_P125 AN8 LEU F 812  ? LYS F 825  ? LEU M 812  LYS M 825  1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? D GLU 40   O   ? ? ? 1_555 J ZN .  ZN ? ? D GLU 40   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.314 ? ? 
metalc2  metalc ? ? D PHE 45   N   ? ? ? 1_555 J ZN .  ZN ? ? D PHE 45   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.184 ? ? 
metalc3  metalc ? ? D ASP 46   N   ? ? ? 1_555 J ZN .  ZN ? ? D ASP 46   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.487 ? ? 
metalc4  metalc ? ? D ASP 739  OD1 ? ? ? 1_555 K MG .  MG ? ? D ASP 739  D MG 2003 1_555 ? ? ? ? ? ? ?            2.086 ? ? 
metalc5  metalc ? ? D ASP 739  OD2 ? ? ? 1_555 K MG .  MG ? ? D ASP 739  D MG 2003 1_555 ? ? ? ? ? ? ?            2.755 ? ? 
metalc6  metalc ? ? D ASP 741  OD1 ? ? ? 1_555 K MG .  MG ? ? D ASP 741  D MG 2003 1_555 ? ? ? ? ? ? ?            2.129 ? ? 
metalc7  metalc ? ? D ASP 741  OD2 ? ? ? 1_555 K MG .  MG ? ? D ASP 741  D MG 2003 1_555 ? ? ? ? ? ? ?            2.095 ? ? 
metalc8  metalc ? ? D ASP 743  OD1 ? ? ? 1_555 K MG .  MG ? ? D ASP 743  D MG 2003 1_555 ? ? ? ? ? ? ?            2.925 ? ? 
metalc9  metalc ? ? D ASP 743  OD2 ? ? ? 1_555 K MG .  MG ? ? D ASP 743  D MG 2003 1_555 ? ? ? ? ? ? ?            2.112 ? ? 
metalc10 metalc ? ? D CYS 1112 SG  ? ? ? 1_555 I ZN .  ZN ? ? D CYS 1112 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.455 ? ? 
metalc11 metalc ? ? D CYS 1194 SG  ? ? ? 1_555 I ZN .  ZN ? ? D CYS 1194 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.420 ? ? 
metalc12 metalc ? ? D CYS 1201 SG  ? ? ? 1_555 I ZN .  ZN ? ? D CYS 1201 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.462 ? ? 
metalc13 metalc ? ? D CYS 1204 SG  ? ? ? 1_555 I ZN .  ZN ? ? D CYS 1204 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.519 ? ? 
hydrog1  hydrog ? ? G DG  1    N1  ? ? ? 1_555 H DC 63 N3 ? ? T DG  1    N DC 39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2  hydrog ? ? G DG  1    N2  ? ? ? 1_555 H DC 63 O2 ? ? T DG  1    N DC 39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ? ? G DG  1    O6  ? ? ? 1_555 H DC 63 N4 ? ? T DG  1    N DC 39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ? ? G DG  2    N1  ? ? ? 1_555 H DC 62 N3 ? ? T DG  2    N DC 38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5  hydrog ? ? G DG  2    N2  ? ? ? 1_555 H DC 62 O2 ? ? T DG  2    N DC 38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ? ? G DG  2    O6  ? ? ? 1_555 H DC 62 N4 ? ? T DG  2    N DC 38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7  hydrog ? ? G DG  3    N1  ? ? ? 1_555 H DC 61 N3 ? ? T DG  3    N DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ? ? G DG  3    N2  ? ? ? 1_555 H DC 61 O2 ? ? T DG  3    N DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9  hydrog ? ? G DG  3    O6  ? ? ? 1_555 H DC 61 N4 ? ? T DG  3    N DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10 hydrog ? ? G DT  4    N3  ? ? ? 1_555 H DA 60 N1 ? ? T DT  4    N DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11 hydrog ? ? G DT  4    O4  ? ? ? 1_555 H DA 60 N6 ? ? T DT  4    N DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ? ? G DA  5    N1  ? ? ? 1_555 H DT 59 N3 ? ? T DA  5    N DT 35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ? ? G DA  5    N6  ? ? ? 1_555 H DT 59 O4 ? ? T DA  5    N DT 35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14 hydrog ? ? G DT  6    N3  ? ? ? 1_555 H DA 58 N1 ? ? T DT  6    N DA 34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15 hydrog ? ? G DT  6    O4  ? ? ? 1_555 H DA 58 N6 ? ? T DT  6    N DA 34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog16 hydrog ? ? G DT  7    N3  ? ? ? 1_555 H DA 57 N1 ? ? T DT  7    N DA 33   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ? ? G DT  7    O4  ? ? ? 1_555 H DA 57 N6 ? ? T DT  7    N DA 33   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ? ? G DC  8    N3  ? ? ? 1_555 H DG 56 N1 ? ? T DC  8    N DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19 hydrog ? ? G DC  8    N4  ? ? ? 1_555 H DG 56 O6 ? ? T DC  8    N DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ? ? G DC  8    O2  ? ? ? 1_555 H DG 56 N2 ? ? T DC  8    N DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ? ? G DG  9    N1  ? ? ? 1_555 H DC 55 N3 ? ? T DG  9    N DC 31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ? ? G DG  9    N2  ? ? ? 1_555 H DC 55 O2 ? ? T DG  9    N DC 31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ? ? G DG  9    O6  ? ? ? 1_555 H DC 55 N4 ? ? T DG  9    N DC 31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24 hydrog ? ? G DC  10   N3  ? ? ? 1_555 H DG 54 N1 ? ? T DC  10   N DG 30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25 hydrog ? ? G DC  10   N4  ? ? ? 1_555 H DG 54 O6 ? ? T DC  10   N DG 30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog26 hydrog ? ? G DC  10   O2  ? ? ? 1_555 H DG 54 N2 ? ? T DC  10   N DG 30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27 hydrog ? ? G DC  11   N3  ? ? ? 1_555 H DG 53 N1 ? ? T DC  11   N DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog28 hydrog ? ? G DC  11   N4  ? ? ? 1_555 H DG 53 O6 ? ? T DC  11   N DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog29 hydrog ? ? G DC  11   O2  ? ? ? 1_555 H DG 53 N2 ? ? T DC  11   N DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog30 hydrog ? ? G DG  12   N1  ? ? ? 1_555 H DA 51 N1 ? ? T DG  12   N DA 27   1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? ? 
hydrog31 hydrog ? ? G DG  12   O6  ? ? ? 1_555 H DA 51 N6 ? ? T DG  12   N DA 27   1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? ? 
hydrog32 hydrog ? ? G DG  12   N1  ? ? ? 1_555 H DC 52 N3 ? ? T DG  12   N DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog33 hydrog ? ? G DG  12   N2  ? ? ? 1_555 H DC 52 O2 ? ? T DG  12   N DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog34 hydrog ? ? G DG  12   O6  ? ? ? 1_555 H DC 52 N4 ? ? T DG  12   N DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog35 hydrog ? ? G DT  13   N3  ? ? ? 1_555 H DA 51 N1 ? ? T DT  13   N DA 27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog36 hydrog ? ? G DT  13   O4  ? ? ? 1_555 H DA 51 N6 ? ? T DT  13   N DA 27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog37 hydrog ? ? G DG  26   N1  ? ? ? 1_555 H DC 38 N3 ? ? T DG  26   N DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog38 hydrog ? ? G DG  26   N2  ? ? ? 1_555 H DC 38 O2 ? ? T DG  26   N DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog39 hydrog ? ? G DG  26   O6  ? ? ? 1_555 H DC 38 N4 ? ? T DG  26   N DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog40 hydrog ? ? G DC  27   N3  ? ? ? 1_555 H DG 37 N1 ? ? T DC  27   N DG 13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog41 hydrog ? ? G DC  27   N4  ? ? ? 1_555 H DG 37 O6 ? ? T DC  27   N DG 13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog42 hydrog ? ? G DC  27   O2  ? ? ? 1_555 H DG 37 N2 ? ? T DC  27   N DG 13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog43 hydrog ? ? G DC  28   N3  ? ? ? 1_555 H DG 36 N1 ? ? T DC  28   N DG 12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog44 hydrog ? ? G DC  28   N4  ? ? ? 1_555 H DG 36 O6 ? ? T DC  28   N DG 12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog45 hydrog ? ? G DC  28   O2  ? ? ? 1_555 H DG 36 N2 ? ? T DC  28   N DG 12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog46 hydrog ? ? G DC  28   N3  ? ? ? 1_555 H DG 37 N1 ? ? T DC  28   N DG 13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog47 hydrog ? ? G DC  28   N4  ? ? ? 1_555 H DG 37 O6 ? ? T DC  28   N DG 13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog48 hydrog ? ? G DC  28   O2  ? ? ? 1_555 H DG 37 N2 ? ? T DC  28   N DG 13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog49 hydrog ? ? G DC  29   N3  ? ? ? 1_555 H DG 35 N1 ? ? T DC  29   N DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog50 hydrog ? ? G DC  29   N4  ? ? ? 1_555 H DG 35 O6 ? ? T DC  29   N DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog51 hydrog ? ? G DC  29   O2  ? ? ? 1_555 H DG 35 N2 ? ? T DC  29   N DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog52 hydrog ? ? G DC  29   N3  ? ? ? 1_555 H DG 36 N1 ? ? T DC  29   N DG 12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog53 hydrog ? ? G DC  29   N4  ? ? ? 1_555 H DG 36 O6 ? ? T DC  29   N DG 12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog54 hydrog ? ? G DC  29   O2  ? ? ? 1_555 H DG 36 N2 ? ? T DC  29   N DG 12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog55 hydrog ? ? G DA  30   N1  ? ? ? 1_555 H DT 34 N3 ? ? T DA  30   N DT 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog56 hydrog ? ? G DA  30   N6  ? ? ? 1_555 H DT 34 O4 ? ? T DA  30   N DT 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog57 hydrog ? ? G DA  31   N1  ? ? ? 1_555 H DT 33 N3 ? ? T DA  31   N DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog58 hydrog ? ? G DA  31   N6  ? ? ? 1_555 H DT 33 O4 ? ? T DA  31   N DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog59 hydrog ? ? G DA  31   N1  ? ? ? 1_555 H DT 34 N3 ? ? T DA  31   N DT 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog60 hydrog ? ? G DA  31   N6  ? ? ? 1_555 H DT 34 O4 ? ? T DA  31   N DT 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog61 hydrog ? ? G DC  32   N3  ? ? ? 1_555 H DG 32 N1 ? ? T DC  32   N DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog62 hydrog ? ? G DC  32   N4  ? ? ? 1_555 H DG 32 O6 ? ? T DC  32   N DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog63 hydrog ? ? G DC  32   O2  ? ? ? 1_555 H DG 32 N2 ? ? T DC  32   N DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog64 hydrog ? ? G DC  32   N3  ? ? ? 1_555 H DT 33 N3 ? ? T DC  32   N DT 9    1_555 ? ? ? ? ? ? TYPE_18_PAIR ?     ? ? 
hydrog65 hydrog ? ? G DC  32   N4  ? ? ? 1_555 H DT 33 O4 ? ? T DC  32   N DT 9    1_555 ? ? ? ? ? ? TYPE_18_PAIR ?     ? ? 
hydrog66 hydrog ? ? G DC  33   N3  ? ? ? 1_555 H DG 31 N1 ? ? T DC  33   N DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog67 hydrog ? ? G DC  33   N4  ? ? ? 1_555 H DG 31 O6 ? ? T DC  33   N DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog68 hydrog ? ? G DC  33   O2  ? ? ? 1_555 H DG 31 N2 ? ? T DC  33   N DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog69 hydrog ? ? G DA  34   N1  ? ? ? 1_555 H DT 30 N3 ? ? T DA  34   N DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog70 hydrog ? ? G DA  34   N6  ? ? ? 1_555 H DT 30 O4 ? ? T DA  34   N DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog71 hydrog ? ? G DT  35   N3  ? ? ? 1_555 H DA 29 N1 ? ? T DT  35   N DA 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog72 hydrog ? ? G DT  35   O4  ? ? ? 1_555 H DA 29 N6 ? ? T DT  35   N DA 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog73 hydrog ? ? G DT  37   N3  ? ? ? 1_555 H DA 27 N1 ? ? T DT  37   N DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog74 hydrog ? ? G DT  37   O4  ? ? ? 1_555 H DA 27 N6 ? ? T DT  37   N DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog75 hydrog ? ? G DG  38   N1  ? ? ? 1_555 H DC 26 N3 ? ? T DG  38   N DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog76 hydrog ? ? G DG  38   N2  ? ? ? 1_555 H DC 26 O2 ? ? T DG  38   N DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog77 hydrog ? ? G DG  38   O6  ? ? ? 1_555 H DC 26 N4 ? ? T DG  38   N DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog78 hydrog ? ? G DG  39   N1  ? ? ? 1_555 H DC 25 N3 ? ? T DG  39   N DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog79 hydrog ? ? G DG  39   N2  ? ? ? 1_555 H DC 25 O2 ? ? T DG  39   N DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog80 hydrog ? ? G DG  39   O6  ? ? ? 1_555 H DC 25 N4 ? ? T DG  39   N DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -2.39 
2 GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -4.44 
3 PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 -5.52 
4 VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 1.32  
5 ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 -6.60 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 3 ? 
AB4 ? 4 ? 
AB5 ? 3 ? 
AB6 ? 4 ? 
AB7 ? 5 ? 
AB8 ? 2 ? 
AB9 ? 3 ? 
AC1 ? 3 ? 
AC2 ? 3 ? 
AC3 ? 2 ? 
AC4 ? 3 ? 
AC5 ? 4 ? 
AC6 ? 2 ? 
AC7 ? 7 ? 
AC8 ? 4 ? 
AC9 ? 2 ? 
AD1 ? 2 ? 
AD2 ? 2 ? 
AD3 ? 6 ? 
AD4 ? 3 ? 
AD5 ? 2 ? 
AD6 ? 3 ? 
AD7 ? 3 ? 
AD8 ? 2 ? 
AD9 ? 3 ? 
AE1 ? 2 ? 
AE2 ? 4 ? 
AE3 ? 4 ? 
AE4 ? 2 ? 
AE5 ? 2 ? 
AE6 ? 2 ? 
AE7 ? 2 ? 
AE8 ? 2 ? 
AE9 ? 2 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 4 ? 
AF4 ? 3 ? 
AF5 ? 2 ? 
AF6 ? 2 ? 
AF7 ? 4 ? 
AF8 ? 7 ? 
AF9 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? parallel      
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB7 4 5 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? parallel      
AC7 2 3 ? anti-parallel 
AC7 3 4 ? parallel      
AC7 4 5 ? anti-parallel 
AC7 5 6 ? anti-parallel 
AC7 6 7 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD3 4 5 ? anti-parallel 
AD3 5 6 ? parallel      
AD4 1 2 ? anti-parallel 
AD4 2 3 ? parallel      
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD7 1 2 ? parallel      
AD7 2 3 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE2 3 4 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE7 1 2 ? parallel      
AE8 1 2 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF4 2 3 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF7 2 3 ? anti-parallel 
AF7 3 4 ? anti-parallel 
AF8 1 2 ? parallel      
AF8 2 3 ? parallel      
AF8 3 4 ? parallel      
AF8 4 5 ? parallel      
AF8 5 6 ? parallel      
AF8 6 7 ? parallel      
AF9 1 2 ? parallel      
AF9 2 3 ? parallel      
AF9 3 4 ? parallel      
AF9 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
AA1 2 TYR A 20   ? GLU A 26   ? TYR A 20   GLU A 26   
AA2 1 THR A 96   ? LEU A 100  ? THR A 96   LEU A 100  
AA2 2 MET A 140  ? VAL A 148  ? MET A 140  VAL A 148  
AA2 3 PRO A 49   ? ILE A 58   ? PRO A 49   ILE A 58   
AA2 4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
AA3 1 ALA A 103  ? GLU A 104  ? ALA A 103  GLU A 104  
AA3 2 ARG A 137  ? LEU A 138  ? ARG A 137  LEU A 138  
AA4 1 GLU A 108  ? LYS A 110  ? GLU A 108  LYS A 110  
AA4 2 HIS A 128  ? THR A 131  ? HIS A 128  THR A 131  
AA5 1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
AA5 2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
AA6 1 VAL A 174  ? THR A 184  ? VAL A 174  THR A 184  
AA6 2 LEU A 192  ? THR A 201  ? LEU A 192  THR A 201  
AA7 1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
AA7 2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
AA7 3 ASP B 193  ? THR B 201  ? ASP B 193  THR B 201  
AA7 4 VAL B 174  ? ASP B 183  ? VAL B 174  ASP B 183  
AA8 1 THR B 96   ? ALA B 103  ? THR B 96   ALA B 103  
AA8 2 LEU B 138  ? VAL B 148  ? LEU B 138  VAL B 148  
AA8 3 PRO B 49   ? ILE B 58   ? PRO B 49   ILE B 58   
AA8 4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
AA9 1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
AA9 2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
AB1 1 GLU B 108  ? LYS B 110  ? GLU B 108  LYS B 110  
AB1 2 HIS B 128  ? THR B 131  ? HIS B 128  THR B 131  
AB2 1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
AB2 2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
AB3 1 GLU C 2    ? ARG C 5    ? GLU C 2    ARG C 5    
AB3 2 GLN C 899  ? ILE C 902  ? GLN C 899  ILE C 902  
AB3 3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
AB4 1 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
AB4 2 GLN C 91   ? ILE C 101  ? GLN C 91   ILE C 101  
AB4 3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
AB4 4 LYS F 360  ? TYR F 362  ? LYS M 360  TYR M 362  
AB5 1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
AB5 2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
AB5 3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
AB6 1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
AB6 2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
AB6 3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
AB6 4 THR C 453  ? SER C 454  ? THR C 453  SER C 454  
AB7 1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
AB7 2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
AB7 3 ILE C 172  ? VAL C 176  ? ILE C 172  VAL C 176  
AB7 4 VAL C 182  ? LYS C 185  ? VAL C 182  LYS C 185  
AB7 5 LYS C 190  ? PRO C 192  ? LYS C 190  PRO C 192  
AB8 1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
AB8 2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
AB9 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB9 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB9 3 VAL C 484  ? MET C 486  ? VAL C 484  MET C 486  
AC1 1 VAL C 478  ? VAL C 479  ? VAL C 478  VAL C 479  
AC1 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AC1 3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
AC2 1 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
AC2 2 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
AC2 3 VAL C 522  ? VAL C 524  ? VAL C 522  VAL C 524  
AC3 1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
AC3 2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
AC4 1 LEU C 595  ? ALA C 597  ? LEU C 595  ALA C 597  
AC4 2 ASP C 653  ? ASP C 657  ? ASP C 653  ASP C 657  
AC4 3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
AC5 1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
AC5 2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
AC5 3 GLY C 601  ? ASP C 607  ? GLY C 601  ASP C 607  
AC5 4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
AC6 1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
AC6 2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
AC7 1 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
AC7 2 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
AC7 3 ALA C 687  ? SER C 691  ? ALA C 687  SER C 691  
AC7 4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
AC7 5 LYS C 838  ? ASN C 841  ? LYS C 838  ASN C 841  
AC7 6 GLY C 990  ? LYS C 996  ? GLY C 990  LYS C 996  
AC7 7 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
AC8 1 SER C 702  ? ARG C 713  ? SER C 702  ARG C 713  
AC8 2 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
AC8 3 GLY C 798  ? ARG C 807  ? GLY C 798  ARG C 807  
AC8 4 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
AC9 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AC9 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AD1 1 THR C 759  ? PHE C 761  ? THR C 759  PHE C 761  
AD1 2 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AD2 1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
AD2 2 ILE C 987  ? VAL C 988  ? ILE C 987  VAL C 988  
AD3 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AD3 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD3 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AD3 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AD3 5 ALA D 715  ? LEU D 720  ? ALA D 715  LEU D 720  
AD3 6 GLN D 641  ? LEU D 644  ? GLN D 641  LEU D 644  
AD4 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AD4 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD4 3 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AD5 1 GLN C 1030 ? PHE C 1032 ? GLN C 1030 PHE C 1032 
AD5 2 LYS D 621  ? VAL D 623  ? LYS D 621  VAL D 623  
AD6 1 LEU C 1097 ? VAL C 1099 ? LEU C 1097 VAL C 1099 
AD6 2 VAL D 8    ? LEU D 12   ? VAL D 8    LEU D 12   
AD6 3 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AD7 1 SER D 22   ? GLU D 25   ? SER D 22   GLU D 25   
AD7 2 MET D 90   ? ILE D 93   ? MET D 90   ILE D 93   
AD7 3 VAL D 517  ? PRO D 518  ? VAL D 517  PRO D 518  
AD8 1 ALA D 99   ? ALA D 100  ? ALA D 99   ALA D 100  
AD8 2 ILE D 513  ? LEU D 514  ? ILE D 513  LEU D 514  
AD9 1 LEU D 152  ? THR D 154  ? LEU D 152  THR D 154  
AD9 2 LYS D 131  ? ASP D 136  ? LYS D 131  ASP D 136  
AD9 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AE1 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AE1 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AE2 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AE2 2 SER D 392  ? VAL D 396  ? SER D 392  VAL D 396  
AE2 3 GLY D 201  ? TYR D 205  ? GLY D 201  TYR D 205  
AE2 4 GLU D 183  ? VAL D 185  ? GLU D 183  VAL D 185  
AE3 1 ALA D 398  ? ARG D 399  ? ALA D 398  ARG D 399  
AE3 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AE3 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AE3 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AE4 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AE4 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AE5 1 ILE D 827  ? VAL D 829  ? ILE D 827  VAL D 829  
AE5 2 ARG D 832  ? THR D 834  ? ARG D 832  THR D 834  
AE6 1 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AE6 2 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AE7 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AE7 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AE8 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AE8 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AE9 1 PHE D 1123 ? PRO D 1125 ? PHE D 1123 PRO D 1125 
AE9 2 LEU D 1132 ? LEU D 1134 ? LEU D 1132 LEU D 1134 
AF1 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AF1 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AF2 1 TYR D 1207 ? ASP D 1208 ? TYR D 1207 ASP D 1208 
AF2 2 ARG D 1213 ? PRO D 1214 ? ARG D 1213 PRO D 1214 
AF3 1 SER D 1300 ? LEU D 1305 ? SER D 1300 LEU D 1305 
AF3 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AF3 3 GLY D 1279 ? GLU D 1284 ? GLY D 1279 GLU D 1284 
AF3 4 ASP D 1317 ? VAL D 1319 ? ASP D 1317 VAL D 1319 
AF4 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AF4 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AF4 3 ALA D 1416 ? PRO D 1419 ? ALA D 1416 PRO D 1419 
AF5 1 GLN D 1485 ? VAL D 1487 ? GLN D 1485 VAL D 1487 
AF5 2 VAL E 74   ? GLY E 76   ? VAL E 74   GLY E 76   
AF6 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AF6 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
AF7 1 VAL F 346  ? LEU F 353  ? VAL M 346  LEU M 353  
AF7 2 VAL F 332  ? VAL F 343  ? VAL M 332  VAL M 343  
AF7 3 ASP F 323  ? ILE F 326  ? ASP M 323  ILE M 326  
AF7 4 LYS F 372  ? ARG F 373  ? LYS M 372  ARG M 373  
AF8 1 VAL F 522  ? VAL F 524  ? VAL M 522  VAL M 524  
AF8 2 ILE F 548  ? ILE F 550  ? ILE M 548  ILE M 550  
AF8 3 GLN F 493  ? PHE F 496  ? GLN M 493  PHE M 496  
AF8 4 LEU F 565  ? ASP F 571  ? LEU M 565  ASP M 571  
AF8 5 THR F 593  ? LEU F 596  ? THR M 593  LEU M 596  
AF8 6 ASP F 465  ? LEU F 467  ? ASP M 465  LEU M 467  
AF8 7 ASP F 614  ? LEU F 615  ? ASP M 614  LEU M 615  
AF9 1 LYS F 629  ? ALA F 633  ? LYS M 629  ALA M 633  
AF9 2 TYR F 753  ? PHE F 757  ? TYR M 753  PHE M 757  
AF9 3 ALA F 722  ? ILE F 727  ? ALA M 722  ILE M 727  
AF9 4 LYS F 653  ? VAL F 657  ? LYS M 653  VAL M 657  
AF9 5 VAL F 706  ? ALA F 709  ? VAL M 706  ALA M 709  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 14   ? N ARG A 14   O GLU A 22   ? O GLU A 22   
AA2 1 2 N LEU A 99   ? N LEU A 99   O VAL A 142  ? O VAL A 142  
AA2 2 3 O GLU A 141  ? O GLU A 141  N TYR A 57   ? N TYR A 57   
AA2 3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
AA3 1 2 N ALA A 103  ? N ALA A 103  O LEU A 138  ? O LEU A 138  
AA4 1 2 N VAL A 109  ? N VAL A 109  O ILE A 129  ? O ILE A 129  
AA5 1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
AA6 1 2 N GLU A 182  ? N GLU A 182  O LYS A 194  ? O LYS A 194  
AA7 1 2 N VAL B 10   ? N VAL B 10   O GLU B 26   ? O GLU B 26   
AA7 2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
AA7 3 4 O TRP B 200  ? O TRP B 200  N ARG B 176  ? N ARG B 176  
AA8 1 2 N LEU B 99   ? N LEU B 99   O VAL B 142  ? O VAL B 142  
AA8 2 3 O ARG B 143  ? O ARG B 143  N THR B 54   ? N THR B 54   
AA8 3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
AA9 1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
AB1 1 2 N VAL B 109  ? N VAL B 109  O ILE B 129  ? O ILE B 129  
AB2 1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
AB3 1 2 N LYS C 4    ? N LYS C 4    O ILE C 902  ? O ILE C 902  
AB3 2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
AB4 1 2 N ASP C 67   ? N ASP C 67   O GLN C 99   ? O GLN C 99   
AB4 2 3 N ALA C 92   ? N ALA C 92   O ILE C 118  ? O ILE C 118  
AB4 3 4 N ILE C 108  ? N ILE C 108  O TYR F 362  ? O TYR M 362  
AB5 1 2 N ILE C 129  ? N ILE C 129  O ALA C 132  ? O ALA C 132  
AB5 2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
AB6 1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
AB6 2 3 N ILE C 140  ? N ILE C 140  O SER C 411  ? O SER C 411  
AB6 3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
AB7 1 2 N THR C 149  ? N THR C 149  O ILE C 159  ? O ILE C 159  
AB7 2 3 N ILE C 162  ? N ILE C 162  O ILE C 172  ? O ILE C 172  
AB7 3 4 N GLU C 175  ? N GLU C 175  O SER C 183  ? O SER C 183  
AB7 4 5 N MET C 184  ? N MET C 184  O PHE C 191  ? O PHE C 191  
AB8 1 2 N ARG C 292  ? N ARG C 292  O LYS C 299  ? O LYS C 299  
AB9 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB9 2 3 N TYR C 471  ? N TYR C 471  O VAL C 484  ? O VAL C 484  
AC1 1 2 O VAL C 478  ? O VAL C 478  N VAL C 475  ? N VAL C 475  
AC1 2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
AC2 1 2 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
AC2 2 3 N VAL C 513  ? N VAL C 513  O VAL C 524  ? O VAL C 524  
AC3 1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
AC4 1 2 N LEU C 595  ? N LEU C 595  O LEU C 655  ? O LEU C 655  
AC4 2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
AC5 1 2 O TYR C 623  ? O TYR C 623  N ILE C 611  ? N ILE C 611  
AC5 2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
AC5 3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
AC6 1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
AC7 1 2 N ALA C 675  ? N ALA C 675  O VAL C 869  ? O VAL C 869  
AC7 2 3 O ILE C 870  ? O ILE C 870  N VAL C 689  ? N VAL C 689  
AC7 3 4 N ILE C 688  ? N ILE C 688  O ALA C 850  ? O ALA C 850  
AC7 4 5 O GLY C 847  ? O GLY C 847  N LEU C 839  ? N LEU C 839  
AC7 5 6 N ALA C 840  ? N ALA C 840  O MET C 995  ? O MET C 995  
AC7 6 7 O GLY C 990  ? O GLY C 990  N VAL C 674  ? N VAL C 674  
AC8 1 2 N TYR C 708  ? N TYR C 708  O VAL C 825  ? O VAL C 825  
AC8 2 3 O VAL C 822  ? O VAL C 822  N LEU C 806  ? N LEU C 806  
AC8 3 4 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
AC9 1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AD1 1 2 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AD2 1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
AD3 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AD3 2 3 N SER D 629  ? N SER D 629  O MET D 745  ? O MET D 745  
AD3 3 4 O ALA D 746  ? O ALA D 746  N ASN D 703  ? N ASN D 703  
AD3 4 5 N VAL D 700  ? N VAL D 700  O PHE D 716  ? O PHE D 716  
AD3 5 6 O VAL D 719  ? O VAL D 719  N LEU D 644  ? N LEU D 644  
AD4 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AD4 2 3 N VAL D 632  ? N VAL D 632  O LEU D 728  ? O LEU D 728  
AD5 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD6 1 2 N ASP C 1098 ? N ASP C 1098 O ALA D 11   ? O ALA D 11   
AD6 2 3 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD7 1 2 N TYR D 23   ? N TYR D 23   O MET D 90   ? O MET D 90   
AD7 2 3 N ILE D 93   ? N ILE D 93   O VAL D 517  ? O VAL D 517  
AD8 1 2 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AD9 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AD9 2 3 N ILE D 133  ? N ILE D 133  O ARG D 455  ? O ARG D 455  
AE1 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AE2 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AE2 2 3 O VAL D 396  ? O VAL D 396  N VAL D 202  ? N VAL D 202  
AE2 3 4 O GLY D 201  ? O GLY D 201  N VAL D 185  ? N VAL D 185  
AE3 1 2 N ARG D 399  ? N ARG D 399  O VAL D 446  ? O VAL D 446  
AE3 2 3 O VAL D 443  ? O VAL D 443  N ASP D 438  ? N ASP D 438  
AE3 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AE4 1 2 N LEU D 421  ? N LEU D 421  O VAL D 427  ? O VAL D 427  
AE5 1 2 N VAL D 829  ? N VAL D 829  O ARG D 832  ? O ARG D 832  
AE6 1 2 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AE7 1 2 N ARG D 1108 ? N ARG D 1108 O VAL D 1200 ? O VAL D 1200 
AE8 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AE9 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AF1 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AF2 1 2 N ASP D 1208 ? N ASP D 1208 O ARG D 1213 ? O ARG D 1213 
AF3 1 2 O LEU D 1305 ? O LEU D 1305 N LEU D 1290 ? N LEU D 1290 
AF3 2 3 O GLU D 1295 ? O GLU D 1295 N VAL D 1280 ? N VAL D 1280 
AF3 3 4 N VAL D 1281 ? N VAL D 1281 O ASP D 1317 ? O ASP D 1317 
AF4 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AF4 2 3 N GLU D 1380 ? N GLU D 1380 O LYS D 1418 ? O LYS D 1418 
AF5 1 2 N VAL D 1487 ? N VAL D 1487 O VAL E 74   ? O VAL E 74   
AF6 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
AF7 1 2 O TYR F 350  ? O TYR M 350  N GLU F 339  ? N GLU M 339  
AF7 2 3 O TYR F 335  ? O TYR M 335  N ASP F 323  ? N ASP M 323  
AF7 3 4 N ILE F 326  ? N ILE M 326  O LYS F 372  ? O LYS M 372  
AF8 1 2 N ALA F 523  ? N ALA M 523  O ILE F 550  ? O ILE M 550  
AF8 2 3 O VAL F 549  ? O VAL M 549  N VAL F 494  ? N VAL M 494  
AF8 3 4 N ALA F 495  ? N ALA M 495  O LEU F 567  ? O LEU M 567  
AF8 4 5 N VAL F 570  ? N VAL M 570  O LEU F 594  ? O LEU M 594  
AF8 5 6 O TYR F 595  ? O TYR M 595  N ARG F 466  ? N ARG M 466  
AF8 6 7 N ASP F 465  ? N ASP M 465  O ASP F 614  ? O ASP M 614  
AF9 1 2 N PHE F 631  ? N PHE M 631  O LEU F 756  ? O LEU M 756  
AF9 2 3 O PHE F 757  ? O PHE M 757  N ILE F 727  ? N ILE M 727  
AF9 3 4 O LEU F 726  ? O LEU M 726  N PHE F 655  ? N PHE M 655  
AF9 4 5 N VAL F 654  ? N VAL M 654  O LEU F 707  ? O LEU M 707  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software D ZN 2001 ? 5 'binding site for residue ZN D 2001' 
AC2 Software D ZN 2002 ? 6 'binding site for residue ZN D 2002' 
AC3 Software D MG 2003 ? 3 'binding site for residue MG D 2003' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 CYS D 1112 ? CYS D 1112 . ? 1_555 ? 
2  AC1 5 ARG D 1189 ? ARG D 1189 . ? 1_555 ? 
3  AC1 5 CYS D 1194 ? CYS D 1194 . ? 1_555 ? 
4  AC1 5 CYS D 1201 ? CYS D 1201 . ? 1_555 ? 
5  AC1 5 CYS D 1204 ? CYS D 1204 . ? 1_555 ? 
6  AC2 6 THR D 31   ? THR D 31   . ? 1_555 ? 
7  AC2 6 GLU D 40   ? GLU D 40   . ? 1_555 ? 
8  AC2 6 GLY D 43   ? GLY D 43   . ? 1_555 ? 
9  AC2 6 LEU D 44   ? LEU D 44   . ? 1_555 ? 
10 AC2 6 PHE D 45   ? PHE D 45   . ? 1_555 ? 
11 AC2 6 ASP D 46   ? ASP D 46   . ? 1_555 ? 
12 AC3 3 ASP D 739  ? ASP D 739  . ? 1_555 ? 
13 AC3 3 ASP D 741  ? ASP D 741  . ? 1_555 ? 
14 AC3 3 ASP D 743  ? ASP D 743  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6M6A 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1 4    ? 77.780  77.842  153.201 1.00 386.94 ? 4    SER A N     1 
ATOM   2     C  CA    . SER A 1 4    ? 77.973  79.090  152.473 1.00 386.94 ? 4    SER A CA    1 
ATOM   3     C  C     . SER A 1 4    ? 79.074  78.945  151.439 1.00 386.94 ? 4    SER A C     1 
ATOM   4     O  O     . SER A 1 4    ? 80.229  79.267  151.707 1.00 386.94 ? 4    SER A O     1 
ATOM   5     C  CB    . SER A 1 4    ? 78.309  80.231  153.434 1.00 386.94 ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A 1 4    ? 78.994  81.273  152.762 1.00 386.94 ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A 1 5    ? 78.718  78.460  150.253 1.00 353.49 ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A 1 5    ? 79.697  78.272  149.195 1.00 353.49 ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A 1 5    ? 79.120  78.725  147.866 1.00 353.49 ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A 1 5    ? 78.017  78.318  147.491 1.00 353.49 ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A 1 5    ? 80.141  76.812  149.102 1.00 353.49 ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A 1 5    ? 81.323  76.608  148.179 1.00 353.49 ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A 1 5    ? 82.477  77.510  148.576 1.00 353.49 ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A 1 5    ? 83.354  77.833  147.385 1.00 353.49 ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A 1 5    ? 82.627  78.620  146.352 1.00 353.49 ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A 1 6    ? 79.869  79.572  147.167 1.00 318.73 ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A 1 6    ? 79.493  79.998  145.828 1.00 318.73 ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A 1 6    ? 79.625  78.837  144.854 1.00 318.73 ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A 1 6    ? 80.616  78.104  144.877 1.00 318.73 ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A 1 6    ? 80.374  81.163  145.386 1.00 318.73 ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A 1 6    ? 80.301  81.578  143.918 1.00 318.73 ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A 1 6    ? 78.951  82.184  143.589 1.00 318.73 ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A 1 6    ? 81.427  82.524  143.586 1.00 318.73 ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A 1 7    ? 78.630  78.676  143.989 1.00 289.25 ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A 1 7    ? 78.672  77.607  143.013 1.00 289.25 ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A 1 7    ? 79.561  77.988  141.836 1.00 289.25 ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A 1 7    ? 80.238  79.019  141.833 1.00 289.25 ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A 1 7    ? 77.266  77.275  142.531 1.00 289.25 ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A 1 7    ? 76.343  76.917  143.666 1.00 289.25 ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A 1 7    ? 76.887  75.714  144.413 1.00 289.25 ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A 1 7    ? 76.201  75.528  145.750 1.00 289.25 ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A 1 7    ? 76.683  76.507  146.757 1.00 289.25 ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A 1 8    ? 79.569  77.115  140.840 1.00 257.16 ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A 1 8    ? 80.272  77.363  139.594 1.00 257.16 ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A 1 8    ? 79.640  78.559  138.901 1.00 257.16 ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A 1 8    ? 78.439  78.546  138.607 1.00 257.16 ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A 1 8    ? 80.231  76.131  138.692 1.00 257.16 ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A 1 9    ? 80.402  79.622  138.672 1.00 242.07 ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A 1 9    ? 79.844  80.796  138.005 1.00 242.07 ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A 1 9    ? 79.588  80.501  136.540 1.00 242.07 ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A 1 9    ? 80.322  79.748  135.899 1.00 242.07 ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A 1 9    ? 80.937  81.853  138.176 1.00 242.07 ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A 1 9    ? 81.867  81.299  139.205 1.00 242.07 ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A 1 9    ? 81.806  79.828  139.045 1.00 242.07 ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A 1 10   ? 78.523  81.088  136.014 1.00 249.72 ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A 1 10   ? 78.113  80.797  134.647 1.00 249.72 ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A 1 10   ? 78.920  81.666  133.697 1.00 249.72 ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A 1 10   ? 78.934  82.895  133.822 1.00 249.72 ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A 1 10   ? 76.611  81.023  134.459 1.00 249.72 ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A 1 10   ? 76.209  80.648  133.046 1.00 249.72 ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A 1 10   ? 75.838  80.209  135.480 1.00 249.72 ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A 1 11   ? 79.595  81.031  132.750 1.00 258.47 ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A 1 11   ? 80.404  81.750  131.775 1.00 258.47 ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A 1 11   ? 79.611  81.988  130.493 1.00 258.47 ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A 1 11   ? 79.958  81.513  129.416 1.00 258.47 ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A 1 11   ? 81.694  80.992  131.497 1.00 258.47 ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A 1 11   ? 82.695  81.777  130.713 1.00 258.47 ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A 1 11   ? 83.584  81.135  129.875 1.00 258.47 ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A 1 11   ? 82.727  83.162  130.794 1.00 258.47 ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A 1 11   ? 84.499  81.858  129.146 1.00 258.47 ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A 1 11   ? 83.634  83.890  130.071 1.00 258.47 ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A 1 11   ? 84.523  83.239  129.245 1.00 258.47 ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A 1 12   ? 78.541  82.762  130.620 1.00 266.63 ? 12   THR A N     1 
ATOM   64    C  CA    . THR A 1 12   ? 77.800  83.161  129.435 1.00 266.63 ? 12   THR A CA    1 
ATOM   65    C  C     . THR A 1 12   ? 78.642  84.103  128.581 1.00 266.63 ? 12   THR A C     1 
ATOM   66    O  O     . THR A 1 12   ? 79.331  84.994  129.083 1.00 266.63 ? 12   THR A O     1 
ATOM   67    C  CB    . THR A 1 12   ? 76.475  83.814  129.819 1.00 266.63 ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A 1 12   ? 75.910  84.450  128.667 1.00 266.63 ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1 12   ? 76.662  84.828  130.937 1.00 266.63 ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A 1 13   ? 78.627  83.861  127.277 1.00 262.94 ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A 1 13   ? 79.554  84.505  126.356 1.00 262.94 ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A 1 13   ? 78.777  84.976  125.140 1.00 262.94 ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A 1 13   ? 78.067  84.187  124.512 1.00 262.94 ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A 1 13   ? 80.682  83.544  125.933 1.00 262.94 ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1 13   ? 81.413  84.068  124.715 1.00 262.94 ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1 13   ? 81.655  83.321  127.069 1.00 262.94 ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A 1 14   ? 78.908  86.255  124.803 1.00 254.97 ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A 1 14   ? 78.331  86.779  123.574 1.00 254.97 ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A 1 14   ? 79.395  87.550  122.819 1.00 254.97 ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A 1 14   ? 79.943  88.527  123.336 1.00 254.97 ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A 1 14   ? 77.130  87.679  123.846 1.00 254.97 ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A 1 14   ? 75.819  86.943  123.992 1.00 254.97 ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A 1 14   ? 75.636  86.578  125.431 1.00 254.97 ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A 1 14   ? 75.842  87.761  126.248 1.00 254.97 ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A 1 14   ? 76.406  87.744  127.446 1.00 254.97 ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A 1 14   ? 76.835  86.606  127.956 1.00 254.97 ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A 1 14   ? 76.557  88.871  128.123 1.00 254.97 ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A 1 15   ? 79.679  87.113  121.603 1.00 241.10 ? 15   THR A N     1 
ATOM   89    C  CA    . THR A 1 15   ? 80.533  87.846  120.689 1.00 241.10 ? 15   THR A CA    1 
ATOM   90    C  C     . THR A 1 15   ? 79.706  88.368  119.526 1.00 241.10 ? 15   THR A C     1 
ATOM   91    O  O     . THR A 1 15   ? 78.651  87.826  119.188 1.00 241.10 ? 15   THR A O     1 
ATOM   92    C  CB    . THR A 1 15   ? 81.664  86.968  120.159 1.00 241.10 ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A 1 15   ? 81.118  85.995  119.262 1.00 241.10 ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A 1 15   ? 82.366  86.264  121.305 1.00 241.10 ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A 1 16   ? 80.199  89.436  118.916 1.00 239.25 ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A 1 16   ? 79.543  90.039  117.768 1.00 239.25 ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A 1 16   ? 80.563  90.158  116.654 1.00 239.25 ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A 1 16   ? 81.491  90.968  116.742 1.00 239.25 ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A 1 16   ? 78.953  91.398  118.128 1.00 239.25 ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A 1 16   ? 77.768  91.278  119.060 1.00 239.25 ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A 1 16   ? 77.233  92.616  119.491 1.00 239.25 ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A 1 16   ? 77.647  93.655  118.982 1.00 239.25 ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A 1 16   ? 76.310  92.603  120.444 1.00 239.25 ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A 1 17   ? 80.390  89.352  115.616 1.00 233.74 ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A 1 17   ? 81.432  89.236  114.617 1.00 233.74 ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A 1 17   ? 82.597  88.467  115.202 1.00 233.74 ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A 1 17   ? 82.429  87.383  115.771 1.00 233.74 ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A 1 18   ? 83.796  89.034  115.074 1.00 242.79 ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A 1 18   ? 85.001  88.434  115.622 1.00 242.79 ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A 1 18   ? 85.822  89.384  116.474 1.00 242.79 ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A 1 18   ? 86.667  88.919  117.245 1.00 242.79 ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A 1 18   ? 85.893  87.902  114.493 1.00 242.79 ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A 1 18   ? 85.274  86.808  113.654 1.00 242.79 ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A 1 18   ? 86.248  86.325  112.601 1.00 242.79 ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A 1 18   ? 87.535  85.968  113.185 1.00 242.79 ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A 1 18   ? 87.809  84.777  113.702 1.00 242.79 ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A 1 18   ? 86.888  83.827  113.700 1.00 242.79 ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A 1 18   ? 89.004  84.528  114.210 1.00 242.79 ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A 1 19   ? 85.605  90.692  116.353 1.00 256.54 ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A 1 19   ? 86.377  91.656  117.123 1.00 256.54 ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A 1 19   ? 85.942  91.665  118.578 1.00 256.54 ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A 1 19   ? 86.728  91.359  119.481 1.00 256.54 ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A 1 19   ? 86.203  93.047  116.526 1.00 256.54 ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A 1 19   ? 86.213  93.074  115.022 1.00 256.54 ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A 1 19   ? 87.608  93.037  114.461 1.00 256.54 ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A 1 19   ? 88.540  93.420  115.189 1.00 256.54 ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A 1 19   ? 87.776  92.637  113.292 1.00 256.54 ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A 1 20   ? 84.687  92.016  118.820 1.00 233.60 ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A 1 20   ? 84.214  92.239  120.172 1.00 233.60 ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A 1 20   ? 83.486  91.016  120.707 1.00 233.60 ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A 1 20   ? 82.698  90.376  120.008 1.00 233.60 ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A 1 20   ? 83.296  93.460  120.253 1.00 233.60 ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A 1 20   ? 82.751  93.628  121.642 1.00 233.60 ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A 1 20   ? 81.422  93.370  121.925 1.00 233.60 ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A 1 20   ? 83.590  93.970  122.688 1.00 233.60 ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A 1 20   ? 80.944  93.489  123.198 1.00 233.60 ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A 1 20   ? 83.123  94.088  123.962 1.00 233.60 ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A 1 20   ? 81.801  93.846  124.214 1.00 233.60 ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A 1 20   ? 81.326  93.963  125.493 1.00 233.60 ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A 1 21   ? 83.754  90.712  121.967 1.00 230.36 ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A 1 21   ? 83.011  89.685  122.669 1.00 230.36 ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A 1 21   ? 82.821  90.040  124.123 1.00 230.36 ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A 1 21   ? 83.750  90.488  124.802 1.00 230.36 ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A 1 22   ? 81.599  89.845  124.600 1.00 243.50 ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A 1 22   ? 81.316  89.834  126.025 1.00 243.50 ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A 1 22   ? 81.604  88.439  126.541 1.00 243.50 ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A 1 22   ? 81.150  87.451  125.955 1.00 243.50 ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A 1 22   ? 79.864  90.195  126.316 1.00 243.50 ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A 1 22   ? 79.327  91.308  125.475 1.00 243.50 ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A 1 22   ? 77.820  91.306  125.424 1.00 243.50 ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A 1 22   ? 77.218  90.292  125.825 1.00 243.50 ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A 1 22   ? 77.237  92.318  124.986 1.00 243.50 ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A 1 23   ? 82.367  88.358  127.622 1.00 245.48 ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A 1 23   ? 82.747  87.077  128.204 1.00 245.48 ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A 1 23   ? 82.391  87.186  129.675 1.00 245.48 ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A 1 23   ? 83.212  87.570  130.509 1.00 245.48 ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A 1 23   ? 84.209  86.775  127.968 1.00 245.48 ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A 1 23   ? 84.531  86.462  126.542 1.00 245.48 ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A 1 23   ? 84.654  85.150  126.125 1.00 245.48 ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A 1 23   ? 84.700  87.474  125.612 1.00 245.48 ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A 1 23   ? 84.946  84.853  124.807 1.00 245.48 ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A 1 23   ? 84.986  87.183  124.299 1.00 245.48 ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A 1 23   ? 85.113  85.869  123.893 1.00 245.48 ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A 1 24   ? 81.151  86.850  129.983 1.00 265.52 ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A 1 24   ? 80.558  87.138  131.277 1.00 265.52 ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A 1 24   ? 80.638  85.864  132.103 1.00 265.52 ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A 1 24   ? 79.822  84.953  131.953 1.00 265.52 ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A 1 24   ? 79.125  87.648  131.126 1.00 265.52 ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A 1 24   ? 78.475  87.865  132.480 1.00 265.52 ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A 1 24   ? 79.137  88.936  130.334 1.00 265.52 ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A 1 25   ? 81.645  85.792  132.961 1.00 272.44 ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A 1 25   ? 81.719  84.770  133.991 1.00 272.44 ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A 1 25   ? 81.256  85.401  135.291 1.00 272.44 ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A 1 25   ? 81.865  86.366  135.766 1.00 272.44 ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A 1 25   ? 83.130  84.211  134.151 1.00 272.44 ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A 1 25   ? 83.256  83.202  135.298 1.00 272.44 ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A 1 25   ? 82.681  81.857  134.909 1.00 272.44 ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A 1 25   ? 84.695  83.047  135.759 1.00 272.44 ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A 1 26   ? 80.192  84.859  135.847 1.00 253.35 ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A 1 26   ? 79.543  85.375  137.035 1.00 253.35 ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A 1 26   ? 78.574  84.284  137.464 1.00 253.35 ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A 1 26   ? 78.248  83.415  136.649 1.00 253.35 ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A 1 26   ? 78.846  86.701  136.724 1.00 253.35 ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A 1 26   ? 77.633  86.569  135.869 1.00 253.35 ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A 1 26   ? 76.383  86.570  136.705 1.00 253.35 ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A 1 26   ? 76.465  87.001  137.874 1.00 253.35 ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A 1 26   ? 75.331  86.127  136.205 1.00 253.35 ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A 1 27   ? 78.100  84.259  138.716 1.00 248.24 ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A 1 27   ? 78.359  85.100  139.888 1.00 248.24 ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A 1 27   ? 79.676  84.752  140.550 1.00 248.24 ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A 1 27   ? 79.981  83.582  140.755 1.00 248.24 ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A 1 27   ? 77.179  84.797  140.801 1.00 248.24 ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A 1 27   ? 76.772  83.418  140.441 1.00 248.24 ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A 1 27   ? 77.096  83.220  138.997 1.00 248.24 ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A 1 28   ? 80.460  85.768  140.877 1.00 292.51 ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A 1 28   ? 81.795  85.556  141.405 1.00 292.51 ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A 1 28   ? 81.887  85.982  142.861 1.00 292.51 ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A 1 28   ? 81.034  86.701  143.386 1.00 292.51 ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A 1 28   ? 82.834  86.318  140.586 1.00 292.51 ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A 1 28   ? 82.617  86.307  139.082 1.00 292.51 ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A 1 28   ? 83.522  87.330  138.453 1.00 292.51 ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A 1 28   ? 82.928  84.935  138.569 1.00 292.51 ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A 1 29   ? 82.955  85.526  143.501 1.00 308.19 ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A 1 29   ? 83.211  85.853  144.889 1.00 308.19 ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A 1 29   ? 83.823  87.244  144.987 1.00 308.19 ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A 1 29   ? 84.508  87.703  144.070 1.00 308.19 ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A 1 29   ? 84.119  84.789  145.513 1.00 308.19 ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A 1 29   ? 84.289  84.893  147.014 1.00 308.19 ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A 1 29   ? 82.981  85.202  147.717 1.00 308.19 ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A 1 29   ? 82.011  84.428  147.568 1.00 308.19 ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A 1 29   ? 82.911  86.249  148.394 1.00 308.19 ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A 1 30   ? 83.535  87.914  146.105 1.00 288.78 ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A 1 30   ? 83.873  89.312  146.323 1.00 288.78 ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A 1 30   ? 85.375  89.551  146.247 1.00 288.78 ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A 1 30   ? 86.183  88.724  146.675 1.00 288.78 ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A 1 30   ? 83.344  89.752  147.685 1.00 288.78 ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A 1 30   ? 83.250  91.243  147.861 1.00 288.78 ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A 1 30   ? 82.964  91.588  149.304 1.00 288.78 ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A 1 30   ? 83.172  93.006  149.567 1.00 288.78 ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A 1 30   ? 84.340  93.537  149.907 1.00 288.78 ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A 1 30   ? 85.411  92.767  150.026 1.00 288.78 ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A 1 30   ? 84.440  94.839  150.126 1.00 288.78 ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A 1 31   ? 85.743  90.688  145.657 1.00 260.69 ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A 1 31   ? 87.125  91.087  145.531 1.00 260.69 ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A 1 31   ? 87.867  90.478  144.368 1.00 260.69 ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A 1 31   ? 88.962  90.945  144.035 1.00 260.69 ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A 1 32   ? 87.309  89.460  143.725 1.00 259.61 ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A 1 32   ? 88.046  88.764  142.689 1.00 259.61 ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A 1 32   ? 88.001  89.465  141.350 1.00 259.61 ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A 1 32   ? 88.666  89.003  140.417 1.00 259.61 ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A 1 32   ? 87.506  87.360  142.543 1.00 259.61 ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A 1 32   ? 87.975  86.451  143.603 1.00 259.61 ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A 1 32   ? 87.275  86.339  144.786 1.00 259.61 ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A 1 32   ? 89.138  85.727  143.436 1.00 259.61 ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A 1 32   ? 87.709  85.500  145.779 1.00 259.61 ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A 1 32   ? 89.585  84.882  144.423 1.00 259.61 ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A 1 32   ? 88.870  84.767  145.599 1.00 259.61 ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A 1 33   ? 87.247  90.554  141.244 1.00 239.74 ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A 1 33   ? 87.003  91.226  139.987 1.00 239.74 ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A 1 33   ? 88.250  91.761  139.328 1.00 239.74 ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A 1 33   ? 88.675  91.229  138.301 1.00 239.74 ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A 1 34   ? 88.866  92.781  139.928 1.00 228.86 ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A 1 34   ? 90.103  93.315  139.373 1.00 228.86 ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A 1 34   ? 91.221  92.304  139.536 1.00 228.86 ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A 1 34   ? 92.090  92.185  138.664 1.00 228.86 ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A 1 34   ? 90.450  94.668  140.021 1.00 228.86 ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A 1 34   ? 89.516  95.744  139.500 1.00 228.86 ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A 1 34   ? 90.364  94.585  141.537 1.00 228.86 ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A 1 35   ? 91.140  91.492  140.596 1.00 214.88 ? 35   THR A N     1 
ATOM   250   C  CA    . THR A 1 35   ? 92.093  90.465  140.990 1.00 214.88 ? 35   THR A CA    1 
ATOM   251   C  C     . THR A 1 35   ? 92.310  89.472  139.865 1.00 214.88 ? 35   THR A C     1 
ATOM   252   O  O     . THR A 1 35   ? 93.427  89.007  139.628 1.00 214.88 ? 35   THR A O     1 
ATOM   253   C  CB    . THR A 1 35   ? 91.570  89.732  142.220 1.00 214.88 ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A 1 35   ? 91.174  90.686  143.206 1.00 214.88 ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A 1 35   ? 92.637  88.842  142.814 1.00 214.88 ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A 1 36   ? 91.240  89.170  139.146 1.00 203.41 ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A 1 36   ? 91.332  88.300  137.993 1.00 203.41 ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A 1 36   ? 91.434  89.080  136.695 1.00 203.41 ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A 1 36   ? 92.219  88.712  135.821 1.00 203.41 ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A 1 36   ? 90.124  87.370  137.967 1.00 203.41 ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A 1 36   ? 90.263  86.306  139.048 1.00 203.41 ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A 1 36   ? 88.912  85.775  139.457 1.00 203.41 ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A 1 36   ? 91.151  85.188  138.544 1.00 203.41 ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A 1 37   ? 90.685  90.176  136.573 1.00 204.87 ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A 1 37   ? 90.560  90.834  135.286 1.00 204.87 ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A 1 37   ? 91.811  91.574  134.878 1.00 204.87 ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A 1 37   ? 92.294  91.416  133.755 1.00 204.87 ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A 1 38   ? 92.352  92.393  135.786 1.00 220.19 ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A 1 38   ? 93.546  93.178  135.474 1.00 220.19 ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A 1 38   ? 94.771  92.352  135.097 1.00 220.19 ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A 1 38   ? 95.445  92.725  134.125 1.00 220.19 ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A 1 38   ? 93.881  94.124  136.626 1.00 220.19 ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A 1 38   ? 95.039  95.037  136.284 1.00 220.19 ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A 1 38   ? 95.148  95.511  135.157 1.00 220.19 ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A 1 38   ? 95.947  95.225  137.224 1.00 220.19 ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A 1 39   ? 95.134  91.260  135.796 1.00 199.41 ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A 1 39   ? 96.287  90.489  135.304 1.00 199.41 ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A 1 39   ? 95.985  89.804  133.995 1.00 199.41 ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A 1 39   ? 96.859  89.704  133.125 1.00 199.41 ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A 1 39   ? 96.539  89.487  136.435 1.00 199.41 ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A 1 39   ? 95.918  90.096  137.599 1.00 199.41 ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A 1 39   ? 94.687  90.678  137.076 1.00 199.41 ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A 1 40   ? 94.736  89.377  133.827 1.00 204.45 ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A 1 40   ? 94.281  88.884  132.538 1.00 204.45 ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A 1 40   ? 94.355  89.971  131.487 1.00 204.45 ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A 1 40   ? 94.778  89.719  130.357 1.00 204.45 ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A 1 40   ? 92.857  88.364  132.654 1.00 204.45 ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A 1 40   ? 92.792  86.889  132.996 1.00 204.45 ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A 1 40   ? 91.403  86.523  133.464 1.00 204.45 ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A 1 40   ? 93.176  86.098  131.761 1.00 204.45 ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A 1 41   ? 93.967  91.193  131.858 1.00 217.14 ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A 1 41   ? 94.010  92.319  130.936 1.00 217.14 ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A 1 41   ? 95.434  92.603  130.492 1.00 217.14 ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A 1 41   ? 95.714  92.752  129.299 1.00 217.14 ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A 1 41   ? 93.406  93.549  131.604 1.00 217.14 ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A 1 41   ? 93.556  94.807  130.809 1.00 217.14 ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A 1 41   ? 92.832  95.953  131.471 1.00 217.14 ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A 1 41   ? 92.764  97.113  130.593 1.00 217.14 ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A 1 41   ? 93.719  98.029  130.491 1.00 217.14 ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A 1 41   ? 94.819  97.931  131.221 1.00 217.14 ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A 1 41   ? 93.569  99.052  129.664 1.00 217.14 ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A 1 42   ? 96.353  92.595  131.454 1.00 222.06 ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A 1 42   ? 97.756  92.869  131.186 1.00 222.06 ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A 1 42   ? 98.370  91.793  130.313 1.00 222.06 ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A 1 42   ? 99.092  92.079  129.351 1.00 222.06 ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A 1 42   ? 98.509  92.963  132.508 1.00 222.06 ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A 1 42   ? 98.179  94.192  133.307 1.00 222.06 ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A 1 42   ? 98.434  93.950  134.778 1.00 222.06 ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A 1 42   ? 99.816  93.579  135.028 1.00 222.06 ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A 1 42   ? 100.813 94.449  135.135 1.00 222.06 ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A 1 42   ? 100.592 95.748  135.007 1.00 222.06 ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A 1 42   ? 102.040 94.007  135.361 1.00 222.06 ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A 1 43   ? 98.062  90.543  130.624 1.00 217.16 ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A 1 43   ? 98.715  89.440  129.949 1.00 217.16 ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A 1 43   ? 98.129  89.253  128.563 1.00 217.16 ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A 1 43   ? 98.843  88.938  127.603 1.00 217.16 ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A 1 43   ? 98.619  88.198  130.850 1.00 217.16 ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A 1 43   ? 99.858  88.181  131.746 1.00 217.16 ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A 1 43   ? 98.388  86.913  130.075 1.00 217.16 ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A 1 43   ? 99.859  87.142  132.803 1.00 217.16 ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A 1 44   ? 96.844  89.549  128.413 1.00 209.22 ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A 1 44   ? 96.247  89.578  127.092 1.00 209.22 ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A 1 44   ? 96.768  90.759  126.293 1.00 209.22 ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A 1 44   ? 96.830  90.713  125.061 1.00 209.22 ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A 1 44   ? 94.731  89.629  127.225 1.00 209.22 ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A 1 44   ? 94.163  88.237  127.486 1.00 209.22 ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A 1 44   ? 92.788  88.320  128.109 1.00 209.22 ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A 1 44   ? 94.124  87.439  126.198 1.00 209.22 ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A 1 45   ? 97.159  91.827  126.979 1.00 211.14 ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A 1 45   ? 97.783  92.924  126.267 1.00 211.14 ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A 1 45   ? 99.190  92.589  125.825 1.00 211.14 ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A 1 45   ? 99.634  93.078  124.784 1.00 211.14 ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A 1 45   ? 97.810  94.172  127.139 1.00 211.14 ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A 1 45   ? 96.573  95.054  127.028 1.00 211.14 ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A 1 45   ? 96.844  96.406  127.651 1.00 211.14 ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A 1 45   ? 96.129  95.205  125.578 1.00 211.14 ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A 1 46   ? 99.893  91.755  126.574 1.00 226.39 ? 46   SER A N     1 
ATOM   338   C  CA    . SER A 1 46   ? 101.320 91.580  126.366 1.00 226.39 ? 46   SER A CA    1 
ATOM   339   C  C     . SER A 1 46   ? 101.682 90.247  125.735 1.00 226.39 ? 46   SER A C     1 
ATOM   340   O  O     . SER A 1 46   ? 102.414 90.207  124.743 1.00 226.39 ? 46   SER A O     1 
ATOM   341   C  CB    . SER A 1 46   ? 102.041 91.731  127.708 1.00 226.39 ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A 1 46   ? 101.289 91.111  128.731 1.00 226.39 ? 46   SER A OG    1 
ATOM   343   N  N     . SER A 1 47   ? 101.179 89.151  126.285 1.00 235.28 ? 47   SER A N     1 
ATOM   344   C  CA    . SER A 1 47   ? 101.729 87.842  125.977 1.00 235.28 ? 47   SER A CA    1 
ATOM   345   C  C     . SER A 1 47   ? 101.267 87.284  124.645 1.00 235.28 ? 47   SER A C     1 
ATOM   346   O  O     . SER A 1 47   ? 101.859 86.313  124.166 1.00 235.28 ? 47   SER A O     1 
ATOM   347   C  CB    . SER A 1 47   ? 101.331 86.858  127.063 1.00 235.28 ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A 1 47   ? 99.924  86.874  127.194 1.00 235.28 ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A 1 48   ? 100.226 87.847  124.053 1.00 215.87 ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A 1 48   ? 99.525  87.123  122.991 1.00 215.87 ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A 1 48   ? 100.323 87.205  121.697 1.00 215.87 ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A 1 48   ? 100.671 88.311  121.250 1.00 215.87 ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A 1 48   ? 98.121  87.674  122.809 1.00 215.87 ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A 1 48   ? 97.351  87.535  124.121 1.00 215.87 ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A 1 48   ? 97.407  86.913  121.709 1.00 215.87 ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A 1 48   ? 97.327  86.119  124.678 1.00 215.87 ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A 1 49   ? 100.639 86.083  121.083 1.00 205.15 ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A 1 49   ? 101.387 86.108  119.827 1.00 205.15 ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A 1 49   ? 100.530 86.529  118.652 1.00 205.15 ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A 1 49   ? 99.332  86.786  118.794 1.00 205.15 ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A 1 49   ? 101.854 84.655  119.671 1.00 205.15 ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A 1 49   ? 101.594 84.005  120.989 1.00 205.15 ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A 1 49   ? 100.433 84.713  121.564 1.00 205.15 ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A 1 50   ? 101.145 86.582  117.480 1.00 225.62 ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A 1 50   ? 100.432 86.934  116.274 1.00 225.62 ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A 1 50   ? 101.423 87.298  115.192 1.00 225.62 ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A 1 50   ? 102.612 87.020  115.303 1.00 225.62 ? 50   GLY A O     1 
ATOM   368   N  N     . THR A 1 51   ? 100.915 87.917  114.146 1.00 251.53 ? 51   THR A N     1 
ATOM   369   C  CA    . THR A 1 51   ? 101.767 88.248  113.022 1.00 251.53 ? 51   THR A CA    1 
ATOM   370   C  C     . THR A 1 51   ? 101.944 89.750  112.913 1.00 251.53 ? 51   THR A C     1 
ATOM   371   O  O     . THR A 1 51   ? 101.152 90.539  113.432 1.00 251.53 ? 51   THR A O     1 
ATOM   372   C  CB    . THR A 1 51   ? 101.198 87.696  111.718 1.00 251.53 ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A 1 51   ? 99.956  88.350  111.437 1.00 251.53 ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A 1 51   ? 100.967 86.203  111.836 1.00 251.53 ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A 1 52   ? 103.017 90.122  112.228 1.00 230.22 ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A 1 52   ? 103.305 91.501  111.879 1.00 230.22 ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A 1 52   ? 104.311 91.486  110.746 1.00 230.22 ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A 1 52   ? 104.904 90.450  110.431 1.00 230.22 ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A 1 52   ? 103.853 92.301  113.062 1.00 230.22 ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A 1 53   ? 104.480 92.653  110.129 1.00 230.94 ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A 1 53   ? 105.388 92.785  109.002 1.00 230.94 ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A 1 53   ? 106.829 92.654  109.466 1.00 230.94 ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A 1 53   ? 107.250 93.268  110.454 1.00 230.94 ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A 1 53   ? 105.119 94.109  108.272 1.00 230.94 ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A 1 53   ? 105.041 95.269  109.252 1.00 230.94 ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A 1 53   ? 106.207 94.378  107.256 1.00 230.94 ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A 1 54   ? 107.587 91.815  108.770 1.00 233.00 ? 54   THR A N     1 
ATOM   388   C  CA    . THR A 1 54   ? 109.001 91.663  109.067 1.00 233.00 ? 54   THR A CA    1 
ATOM   389   C  C     . THR A 1 54   ? 109.834 92.622  108.230 1.00 233.00 ? 54   THR A C     1 
ATOM   390   O  O     . THR A 1 54   ? 110.512 93.503  108.765 1.00 233.00 ? 54   THR A O     1 
ATOM   391   C  CB    . THR A 1 54   ? 109.426 90.225  108.795 1.00 233.00 ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A 1 54   ? 109.654 90.068  107.390 1.00 233.00 ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A 1 54   ? 108.324 89.281  109.224 1.00 233.00 ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A 1 55   ? 109.765 92.476  106.915 1.00 219.68 ? 55   SER A N     1 
ATOM   395   C  CA    . SER A 1 55   ? 110.585 93.286  106.035 1.00 219.68 ? 55   SER A CA    1 
ATOM   396   C  C     . SER A 1 55   ? 109.919 93.356  104.677 1.00 219.68 ? 55   SER A C     1 
ATOM   397   O  O     . SER A 1 55   ? 109.189 92.443  104.278 1.00 219.68 ? 55   SER A O     1 
ATOM   398   C  CB    . SER A 1 55   ? 112.000 92.722  105.907 1.00 219.68 ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A 1 55   ? 112.753 93.025  107.063 1.00 219.68 ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A 1 56   ? 110.174 94.457  103.979 1.00 210.93 ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A 1 56   ? 109.521 94.761  102.717 1.00 210.93 ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A 1 56   ? 110.591 94.989  101.662 1.00 210.93 ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A 1 56   ? 111.594 95.662  101.918 1.00 210.93 ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A 1 56   ? 108.630 96.016  102.821 1.00 210.93 ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A 1 56   ? 107.764 96.174  101.577 1.00 210.93 ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A 1 56   ? 107.817 96.030  104.101 1.00 210.93 ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A 1 57   ? 110.377 94.430  100.481 1.00 218.24 ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A 1 57   ? 111.038 94.888  99.275  1.00 218.24 ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A 1 57   ? 109.978 95.459  98.352  1.00 218.24 ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A 1 57   ? 108.841 94.992  98.333  1.00 218.24 ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A 1 57   ? 111.782 93.758  98.563  1.00 218.24 ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A 1 57   ? 112.407 94.179  97.250  1.00 218.24 ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A 1 57   ? 113.619 94.850  97.228  1.00 218.24 ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A 1 57   ? 111.781 93.919  96.032  1.00 218.24 ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A 1 57   ? 114.199 95.238  96.034  1.00 218.24 ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A 1 57   ? 112.349 94.307  94.838  1.00 218.24 ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A 1 57   ? 113.557 94.968  94.846  1.00 218.24 ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A 1 57   ? 114.132 95.362  93.664  1.00 218.24 ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A 1 58   ? 110.338 96.522  97.640  1.00 217.61 ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A 1 58   ? 109.636 96.965  96.442  1.00 217.61 ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A 1 58   ? 110.736 97.227  95.424  1.00 217.61 ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A 1 58   ? 111.901 97.394  95.793  1.00 217.61 ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A 1 58   ? 108.763 98.235  96.670  1.00 217.61 ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A 1 58   ? 108.033 98.207  98.011  1.00 217.61 ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A 1 58   ? 107.696 98.403  95.593  1.00 217.61 ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A 1 58   ? 107.318 99.485  98.335  1.00 217.61 ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A 1 59   ? 110.374 97.217  94.140  1.00 207.80 ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A 1 59   ? 111.287 97.557  93.054  1.00 207.80 ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A 1 59   ? 111.890 98.943  93.236  1.00 207.80 ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A 1 59   ? 111.195 99.883  93.627  1.00 207.80 ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A 1 59   ? 110.541 97.515  91.723  1.00 207.80 ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A 1 59   ? 109.888 96.205  91.392  1.00 207.80 ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A 1 59   ? 108.560 96.408  90.702  1.00 207.80 ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A 1 59   ? 107.818 97.323  91.112  1.00 207.80 ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A 1 59   ? 108.256 95.665  89.748  1.00 207.80 ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A 1 60   ? 113.197 99.043  92.966  1.00 197.31 ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A 1 60   ? 113.955 100.299 92.905  1.00 197.31 ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A 1 60   ? 113.898 101.064 94.225  1.00 197.31 ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A 1 60   ? 113.562 102.245 94.279  1.00 197.31 ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A 1 60   ? 113.466 101.174 91.750  1.00 197.31 ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A 1 60   ? 113.384 100.418 90.460  1.00 197.31 ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A 1 60   ? 114.219 99.512  90.263  1.00 197.31 ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A 1 60   ? 112.485 100.719 89.649  1.00 197.31 ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A 1 61   ? 114.235 100.365 95.297  1.00 190.85 ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A 1 61   ? 114.139 100.911 96.639  1.00 190.85 ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A 1 61   ? 115.524 100.896 97.259  1.00 190.85 ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A 1 61   ? 116.156 99.839  97.356  1.00 190.85 ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A 1 61   ? 113.136 100.115 97.490  1.00 190.85 ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A 1 61   ? 113.327 100.413 98.964  1.00 190.85 ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A 1 61   ? 111.734 100.454 97.057  1.00 190.85 ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A 1 62   ? 116.001 102.061 97.653  1.00 196.71 ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A 1 62   ? 117.254 102.151 98.375  1.00 196.71 ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A 1 62   ? 117.070 102.490 99.831  1.00 196.71 ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A 1 62   ? 117.889 102.082 100.652 1.00 196.71 ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A 1 62   ? 118.165 103.202 97.736  1.00 196.71 ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A 1 62   ? 118.609 102.872 96.315  1.00 196.71 ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A 1 62   ? 119.709 103.822 95.888  1.00 196.71 ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A 1 62   ? 119.071 101.425 96.205  1.00 196.71 ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A 1 63   ? 116.004 103.202 100.168 1.00 195.22 ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A 1 63   ? 115.763 103.697 101.510 1.00 195.22 ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A 1 63   ? 114.330 104.177 101.590 1.00 195.22 ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A 1 63   ? 113.630 104.274 100.582 1.00 195.22 ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A 1 63   ? 116.730 104.819 101.869 1.00 195.22 ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A 1 63   ? 116.910 105.816 100.769 1.00 195.22 ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A 1 63   ? 116.007 106.822 100.520 1.00 195.22 ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A 1 63   ? 117.893 105.957 99.850  1.00 195.22 ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A 1 63   ? 116.414 107.531 99.485  1.00 195.22 ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A 1 63   ? 117.565 107.036 99.071  1.00 195.22 ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A 1 64   ? 113.916 104.517 102.807 1.00 202.14 ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A 1 64   ? 112.557 104.985 103.037 1.00 202.14 ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A 1 64   ? 112.340 106.398 102.539 1.00 202.14 ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A 1 64   ? 111.213 106.895 102.572 1.00 202.14 ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A 1 64   ? 112.248 104.908 104.521 1.00 202.14 ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A 1 64   ? 113.227 105.687 105.362 1.00 202.14 ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A 1 64   ? 112.885 105.628 106.832 1.00 202.14 ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A 1 64   ? 111.856 105.015 107.169 1.00 202.14 ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A 1 64   ? 113.643 106.169 107.662 1.00 202.14 ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A 1 65   ? 113.395 107.074 102.122 1.00 217.36 ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A 1 65   ? 113.283 108.422 101.609 1.00 217.36 ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A 1 65   ? 113.277 108.432 100.107 1.00 217.36 ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A 1 65   ? 113.461 109.482 99.496  1.00 217.36 ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A 1 65   ? 114.436 109.241 102.136 1.00 217.36 ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A 1 65   ? 114.665 109.027 103.576 1.00 217.36 ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A 1 65   ? 113.806 109.560 104.507 1.00 217.36 ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A 1 65   ? 115.723 108.253 104.007 1.00 217.36 ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A 1 65   ? 114.013 109.351 105.844 1.00 217.36 ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A 1 65   ? 115.945 108.037 105.349 1.00 217.36 ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A 1 65   ? 115.092 108.586 106.272 1.00 217.36 ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A 1 66   ? 113.058 107.281 99.501  1.00 201.24 ? 66   SER A N     1 
ATOM   490   C  CA    . SER A 1 66   ? 113.139 107.165 98.058  1.00 201.24 ? 66   SER A CA    1 
ATOM   491   C  C     . SER A 1 66   ? 111.819 107.638 97.458  1.00 201.24 ? 66   SER A C     1 
ATOM   492   O  O     . SER A 1 66   ? 110.926 108.127 98.155  1.00 201.24 ? 66   SER A O     1 
ATOM   493   C  CB    . SER A 1 66   ? 113.495 105.733 97.671  1.00 201.24 ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A 1 66   ? 114.499 105.224 98.540  1.00 201.24 ? 66   SER A OG    1 
ATOM   495   N  N     . THR A 1 67   ? 111.689 107.499 96.144  1.00 219.38 ? 67   THR A N     1 
ATOM   496   C  CA    . THR A 1 67   ? 110.504 107.955 95.438  1.00 219.38 ? 67   THR A CA    1 
ATOM   497   C  C     . THR A 1 67   ? 110.423 107.235 94.105  1.00 219.38 ? 67   THR A C     1 
ATOM   498   O  O     . THR A 1 67   ? 111.442 106.847 93.527  1.00 219.38 ? 67   THR A O     1 
ATOM   499   C  CB    . THR A 1 67   ? 110.517 109.476 95.231  1.00 219.38 ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A 1 67   ? 109.344 109.880 94.514  1.00 219.38 ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A 1 67   ? 111.765 109.929 94.494  1.00 219.38 ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A 1 68   ? 109.197 107.025 93.646  1.00 216.52 ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A 1 68   ? 108.960 106.351 92.378  1.00 216.52 ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A 1 68   ? 107.896 107.142 91.632  1.00 216.52 ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A 1 68   ? 106.821 107.405 92.184  1.00 216.52 ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A 1 68   ? 108.544 104.886 92.587  1.00 216.52 ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A 1 68   ? 109.749 104.038 92.986  1.00 216.52 ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A 1 68   ? 107.924 104.312 91.337  1.00 216.52 ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A 1 68   ? 109.389 102.658 93.417  1.00 216.52 ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A 1 69   ? 108.162 107.566 90.411  1.00 227.35 ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A 1 69   ? 107.131 108.256 89.635  1.00 227.35 ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A 1 69   ? 106.011 107.316 89.240  1.00 227.35 ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A 1 69   ? 106.183 106.095 89.223  1.00 227.35 ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A 1 69   ? 107.897 108.778 88.415  1.00 227.35 ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A 1 69   ? 109.319 108.814 88.856  1.00 227.35 ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A 1 69   ? 109.474 107.634 89.756  1.00 227.35 ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A 1 70   ? 104.857 107.878 88.914  1.00 233.93 ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A 1 70   ? 103.701 107.043 88.701  1.00 233.93 ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A 1 70   ? 102.945 106.717 89.960  1.00 233.93 ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A 1 70   ? 102.067 105.854 89.933  1.00 233.93 ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A 1 71   ? 103.283 107.369 91.071  1.00 215.59 ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A 1 71   ? 102.498 107.314 92.291  1.00 215.59 ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A 1 71   ? 102.640 108.677 92.955  1.00 215.59 ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A 1 71   ? 103.593 109.419 92.707  1.00 215.59 ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A 1 71   ? 102.951 106.161 93.225  1.00 215.59 ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A 1 71   ? 104.252 106.485 93.930  1.00 215.59 ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A 1 71   ? 101.866 105.765 94.214  1.00 215.59 ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A 1 72   ? 101.646 109.035 93.759  1.00 223.39 ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A 1 72   ? 101.687 110.291 94.489  1.00 223.39 ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A 1 72   ? 102.485 110.180 95.778  1.00 223.39 ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A 1 72   ? 103.374 110.994 96.037  1.00 223.39 ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A 1 72   ? 100.265 110.759 94.802  1.00 223.39 ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A 1 72   ? 100.177 111.760 95.943  1.00 223.39 ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A 1 72   ? 98.763  112.272 96.113  1.00 223.39 ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A 1 72   ? 98.729  113.487 97.019  1.00 223.39 ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A 1 72   ? 97.366  114.069 97.087  1.00 223.39 ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A 1 73   ? 102.189 109.171 96.584  1.00 225.68 ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A 1 73   ? 102.700 109.102 97.937  1.00 225.68 ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A 1 73   ? 104.120 108.546 97.947  1.00 225.68 ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A 1 73   ? 104.572 107.894 97.002  1.00 225.68 ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A 1 73   ? 101.783 108.238 98.794  1.00 225.68 ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A 1 73   ? 100.287 108.473 98.567  1.00 225.68 ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A 1 73   ? 99.678  107.541 97.525  1.00 225.68 ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A 1 73   ? 100.120 107.578 96.356  1.00 225.68 ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A 1 73   ? 98.773  106.760 97.884  1.00 225.68 ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A 1 74   ? 104.825 108.803 99.039  1.00 218.81 ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A 1 74   ? 106.211 108.395 99.157  1.00 218.81 ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A 1 74   ? 106.293 107.046 99.860  1.00 218.81 ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A 1 74   ? 105.278 106.393 100.108 1.00 218.81 ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A 1 74   ? 107.020 109.459 99.892  1.00 218.81 ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A 1 74   ? 106.781 109.444 101.385 1.00 218.81 ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A 1 74   ? 105.615 109.309 101.817 1.00 218.81 ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A 1 74   ? 107.781 109.527 102.124 1.00 218.81 ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A 1 75   ? 107.517 106.648 100.217 1.00 200.51 ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A 1 75   ? 107.769 105.310 100.741 1.00 200.51 ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A 1 75   ? 107.146 105.137 102.121 1.00 200.51 ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A 1 75   ? 106.449 104.152 102.380 1.00 200.51 ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A 1 75   ? 109.278 105.034 100.782 1.00 200.51 ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A 1 75   ? 109.541 103.621 101.224 1.00 200.51 ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A 1 75   ? 109.902 105.310 99.438  1.00 200.51 ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A 1 76   ? 107.369 106.105 103.016 1.00 193.70 ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A 1 76   ? 106.996 105.907 104.415 1.00 193.70 ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A 1 76   ? 105.493 105.922 104.593 1.00 193.70 ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A 1 76   ? 104.975 105.359 105.562 1.00 193.70 ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A 1 76   ? 107.674 106.948 105.322 1.00 193.70 ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A 1 76   ? 109.158 106.927 105.111 1.00 193.70 ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A 1 76   ? 107.119 108.333 105.081 1.00 193.70 ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A 1 77   ? 104.769 106.531 103.651 1.00 226.23 ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A 1 77   ? 103.322 106.395 103.622 1.00 226.23 ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A 1 77   ? 102.936 104.940 103.437 1.00 226.23 ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A 1 77   ? 102.101 104.404 104.175 1.00 226.23 ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A 1 77   ? 102.739 107.246 102.495 1.00 226.23 ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A 1 77   ? 101.220 107.181 102.397 1.00 226.23 ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A 1 77   ? 100.728 106.161 101.386 1.00 226.23 ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A 1 77   ? 101.574 105.561 100.696 1.00 226.23 ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A 1 77   ? 99.502  105.947 101.295 1.00 226.23 ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A 1 78   ? 103.571 104.284 102.467 1.00 212.51 ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A 1 78   ? 103.311 102.876 102.213 1.00 212.51 ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A 1 78   ? 103.737 102.049 103.406 1.00 212.51 ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A 1 78   ? 103.101 101.046 103.737 1.00 212.51 ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A 1 78   ? 104.044 102.424 100.943 1.00 212.51 ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A 1 78   ? 103.908 103.478 99.859  1.00 212.51 ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A 1 78   ? 103.467 101.124 100.448 1.00 212.51 ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A 1 78   ? 104.957 103.378 98.790  1.00 212.51 ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A 1 79   ? 104.808 102.479 104.076 1.00 209.26 ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A 1 79   ? 105.294 101.785 105.261 1.00 209.26 ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A 1 79   ? 104.252 101.831 106.367 1.00 209.26 ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A 1 79   ? 103.965 100.821 107.016 1.00 209.26 ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A 1 79   ? 106.629 102.388 105.717 1.00 209.26 ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A 1 79   ? 107.677 102.183 104.634 1.00 209.26 ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A 1 79   ? 107.095 101.744 107.003 1.00 209.26 ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A 1 79   ? 108.993 102.838 104.928 1.00 209.26 ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A 1 80   ? 103.639 102.997 106.559 1.00 216.88 ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A 1 80   ? 102.575 103.127 107.547 1.00 216.88 ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A 1 80   ? 101.365 102.287 107.166 1.00 216.88 ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A 1 80   ? 100.730 101.664 108.027 1.00 216.88 ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A 1 80   ? 102.181 104.592 107.704 1.00 216.88 ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1 80   ? 102.838 105.376 108.839 1.00 216.88 ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1 80   ? 102.404 104.765 110.153 1.00 216.88 ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1 80   ? 104.349 105.418 108.754 1.00 216.88 ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A 1 81   ? 101.061 102.231 105.871 1.00 209.06 ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A 1 81   ? 99.914  101.455 105.417 1.00 209.06 ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A 1 81   ? 100.124 99.965  105.647 1.00 209.06 ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A 1 81   ? 99.218  99.262  106.109 1.00 209.06 ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A 1 81   ? 99.643  101.735 103.942 1.00 209.06 ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A 1 81   ? 99.348  103.187 103.675 1.00 209.06 ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A 1 81   ? 99.250  103.992 104.599 1.00 209.06 ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A 1 81   ? 99.201  103.534 102.407 1.00 209.06 ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A 1 82   ? 101.324 99.468  105.356 1.00 223.58 ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A 1 82   ? 101.590 98.051  105.574 1.00 223.58 ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A 1 82   ? 101.745 97.758  107.055 1.00 223.58 ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A 1 82   ? 101.523 96.630  107.507 1.00 223.58 ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A 1 82   ? 102.824 97.604  104.790 1.00 223.58 ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A 1 82   ? 104.181 98.280  104.981 1.00 223.58 ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A 1 82   ? 105.053 97.683  106.073 1.00 223.58 ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A 1 82   ? 104.927 98.324  103.658 1.00 223.58 ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A 1 83   ? 102.118 98.770  107.833 1.00 234.58 ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A 1 83   ? 102.036 98.625  109.273 1.00 234.58 ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A 1 83   ? 100.600 98.600  109.756 1.00 234.58 ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A 1 83   ? 100.347 98.145  110.874 1.00 234.58 ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A 1 83   ? 102.819 99.743  109.951 1.00 234.58 ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A 1 83   ? 104.311 99.476  109.951 1.00 234.58 ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A 1 83   ? 105.120 100.620 110.535 1.00 234.58 ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A 1 83   ? 106.599 100.242 110.604 1.00 234.58 ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A 1 83   ? 107.449 101.308 111.192 1.00 234.58 ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A 1 84   ? 99.658  99.063  108.944 1.00 243.48 ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A 1 84   ? 98.256  98.877  109.269 1.00 243.48 ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A 1 84   ? 97.665  97.611  108.676 1.00 243.48 ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A 1 84   ? 96.455  97.402  108.794 1.00 243.48 ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A 1 84   ? 97.443  100.081 108.801 1.00 243.48 ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A 1 84   ? 97.809  101.367 109.507 1.00 243.48 ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A 1 84   ? 98.335  101.140 110.914 1.00 243.48 ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A 1 84   ? 97.530  100.805 111.811 1.00 243.48 ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A 1 84   ? 99.560  101.290 111.114 1.00 243.48 ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A 1 85   ? 98.473  96.766  108.048 1.00 209.69 ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A 1 85   ? 97.926  95.575  107.419 1.00 209.69 ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A 1 85   ? 97.581  94.523  108.462 1.00 209.69 ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A 1 85   ? 98.413  94.157  109.293 1.00 209.69 ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A 1 85   ? 98.914  95.007  106.413 1.00 209.69 ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A 1 85   ? 98.430  93.702  105.791 1.00 209.69 ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A 1 85   ? 97.137  93.909  105.017 1.00 209.69 ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A 1 85   ? 99.498  93.112  104.910 1.00 209.69 ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A 1 86   ? 96.346  94.033  108.404 1.00 231.54 ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A 1 86   ? 95.859  92.998  109.303 1.00 231.54 ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A 1 86   ? 95.745  91.709  108.511 1.00 231.54 ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A 1 86   ? 94.930  91.603  107.587 1.00 231.54 ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A 1 86   ? 94.513  93.376  109.931 1.00 231.54 ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A 1 86   ? 94.188  92.424  111.060 1.00 231.54 ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A 1 86   ? 94.557  94.797  110.439 1.00 231.54 ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A 1 87   ? 96.559  90.727  108.881 1.00 244.12 ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A 1 87   ? 96.677  89.482  108.145 1.00 244.12 ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A 1 87   ? 96.154  88.372  109.052 1.00 244.12 ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A 1 87   ? 95.835  88.599  110.218 1.00 244.12 ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A 1 87   ? 98.130  89.215  107.707 1.00 244.12 ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A 1 87   ? 98.182  88.470  106.389 1.00 244.12 ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A 1 87   ? 98.903  90.507  107.616 1.00 244.12 ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A 1 88   ? 96.056  87.162  108.506 1.00 268.11 ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A 1 88   ? 95.591  86.022  109.287 1.00 268.11 ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A 1 88   ? 96.316  84.773  108.815 1.00 268.11 ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A 1 88   ? 96.165  84.369  107.660 1.00 268.11 ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A 1 88   ? 94.088  85.851  109.156 1.00 268.11 ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A 1 88   ? 93.513  84.718  109.952 1.00 268.11 ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A 1 88   ? 92.018  84.877  110.040 1.00 268.11 ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A 1 88   ? 91.377  83.766  110.728 1.00 268.11 ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A 1 88   ? 90.113  83.784  111.132 1.00 268.11 ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A 1 88   ? 89.371  84.860  110.920 1.00 268.11 ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A 1 88   ? 89.596  82.737  111.754 1.00 268.11 ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A 1 89   ? 97.091  84.165  109.705 1.00 288.40 ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A 1 89   ? 97.671  82.853  109.439 1.00 288.40 ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A 1 89   ? 96.573  81.822  109.632 1.00 288.40 ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A 1 89   ? 96.296  81.400  110.756 1.00 288.40 ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A 1 89   ? 98.843  82.568  110.372 1.00 288.40 ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A 1 89   ? 100.166 83.081  109.876 1.00 288.40 ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A 1 89   ? 100.231 84.114  108.955 1.00 288.40 ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A 1 89   ? 101.348 82.530  110.343 1.00 288.40 ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A 1 89   ? 101.449 84.590  108.514 1.00 288.40 ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A 1 89   ? 102.568 82.999  109.902 1.00 288.40 ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A 1 89   ? 102.620 84.030  108.983 1.00 288.40 ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A 1 90   ? 95.926  81.428  108.535 1.00 304.27 ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A 1 90   ? 94.856  80.443  108.633 1.00 304.27 ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A 1 90   ? 95.411  79.076  109.005 1.00 304.27 ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A 1 90   ? 94.747  78.294  109.694 1.00 304.27 ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A 1 90   ? 94.077  80.383  107.323 1.00 304.27 ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A 1 90   ? 93.481  81.712  106.864 1.00 304.27 ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A 1 90   ? 93.112  81.673  105.394 1.00 304.27 ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A 1 90   ? 92.264  82.011  107.703 1.00 304.27 ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A 1 91   ? 96.617  78.779  108.578 1.00 322.39 ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A 1 91   ? 97.257  77.618  109.174 1.00 322.39 ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A 1 91   ? 98.027  78.043  110.412 1.00 322.39 ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A 1 91   ? 98.840  78.972  110.337 1.00 322.39 ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A 1 91   ? 98.206  76.950  108.201 1.00 322.39 ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A 1 91   ? 98.820  75.697  108.769 1.00 322.39 ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A 1 91   ? 98.243  75.043  109.635 1.00 322.39 ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A 1 91   ? 99.998  75.344  108.279 1.00 322.39 ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A 1 92   ? 97.782  77.419  111.561 1.00 306.43 ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A 1 92   ? 98.640  77.687  112.719 1.00 306.43 ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A 1 92   ? 100.048 77.165  112.541 1.00 306.43 ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A 1 92   ? 100.994 77.781  113.045 1.00 306.43 ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A 1 92   ? 97.909  76.980  113.865 1.00 306.43 ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A 1 92   ? 96.494  76.892  113.402 1.00 306.43 ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A 1 92   ? 96.580  76.660  111.933 1.00 306.43 ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A 1 93   ? 100.227 76.066  111.807 1.00 320.35 ? 93   SER A N     1 
ATOM   703   C  CA    . SER A 1 93   ? 101.573 75.564  111.567 1.00 320.35 ? 93   SER A CA    1 
ATOM   704   C  C     . SER A 1 93   ? 102.286 76.301  110.442 1.00 320.35 ? 93   SER A C     1 
ATOM   705   O  O     . SER A 1 93   ? 103.414 75.933  110.101 1.00 320.35 ? 93   SER A O     1 
ATOM   706   C  CB    . SER A 1 93   ? 101.537 74.066  111.279 1.00 320.35 ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A 1 93   ? 100.505 73.733  110.378 1.00 320.35 ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A 1 94   ? 101.660 77.312  109.856 1.00 317.69 ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A 1 94   ? 102.365 78.273  109.027 1.00 317.69 ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A 1 94   ? 103.173 79.193  109.925 1.00 317.69 ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A 1 94   ? 102.748 79.519  111.031 1.00 317.69 ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A 1 94   ? 101.361 79.077  108.203 1.00 317.69 ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A 1 94   ? 101.797 80.315  107.422 1.00 317.69 ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A 1 94   ? 102.895 79.983  106.428 1.00 317.69 ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A 1 94   ? 100.597 80.938  106.726 1.00 317.69 ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A 1 95   ? 104.352 79.591  109.468 1.00 295.54 ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A 1 95   ? 105.148 80.513  110.259 1.00 295.54 ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A 1 95   ? 105.708 81.684  109.473 1.00 295.54 ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A 1 95   ? 106.153 82.652  110.097 1.00 295.54 ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A 1 95   ? 106.301 79.775  110.941 1.00 295.54 ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A 1 95   ? 105.881 79.113  112.221 1.00 295.54 ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A 1 95   ? 105.346 77.733  111.977 1.00 295.54 ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1 95   ? 105.857 77.008  111.129 1.00 295.54 ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1 95   ? 104.293 77.369  112.692 1.00 295.54 ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A 1 96   ? 105.698 81.644  108.144 1.00 270.82 ? 96   THR A N     1 
ATOM   726   C  CA    . THR A 1 96   ? 106.341 82.699  107.367 1.00 270.82 ? 96   THR A CA    1 
ATOM   727   C  C     . THR A 1 96   ? 105.721 82.765  105.983 1.00 270.82 ? 96   THR A C     1 
ATOM   728   O  O     . THR A 1 96   ? 105.662 81.748  105.288 1.00 270.82 ? 96   THR A O     1 
ATOM   729   C  CB    . THR A 1 96   ? 107.850 82.455  107.276 1.00 270.82 ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A 1 96   ? 108.459 82.807  108.522 1.00 270.82 ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A 1 96   ? 108.481 83.283  106.170 1.00 270.82 ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A 1 97   ? 105.257 83.945  105.579 1.00 245.26 ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A 1 97   ? 104.749 84.146  104.229 1.00 245.26 ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A 1 97   ? 105.276 85.471  103.687 1.00 245.26 ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A 1 97   ? 105.294 86.482  104.399 1.00 245.26 ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A 1 97   ? 103.210 84.074  104.176 1.00 245.26 ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A 1 97   ? 102.561 85.031  105.156 1.00 245.26 ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A 1 97   ? 102.689 84.287  102.759 1.00 245.26 ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A 1 98   ? 105.773 85.442  102.457 1.00 228.23 ? 98   THR A N     1 
ATOM   740   C  CA    . THR A 1 98   ? 106.101 86.647  101.718 1.00 228.23 ? 98   THR A CA    1 
ATOM   741   C  C     . THR A 1 98   ? 104.899 87.047  100.875 1.00 228.23 ? 98   THR A C     1 
ATOM   742   O  O     . THR A 1 98   ? 104.198 86.187  100.340 1.00 228.23 ? 98   THR A O     1 
ATOM   743   C  CB    . THR A 1 98   ? 107.317 86.405  100.828 1.00 228.23 ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A 1 98   ? 108.338 85.763  101.599 1.00 228.23 ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A 1 98   ? 107.861 87.718  100.285 1.00 228.23 ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A 1 99   ? 104.647 88.349  100.770 1.00 230.96 ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A 1 99   ? 103.498 88.835  100.021 1.00 230.96 ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A 1 99   ? 103.946 89.753  98.901  1.00 230.96 ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A 1 99   ? 104.871 90.552  99.069  1.00 230.96 ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A 1 99   ? 102.506 89.587  100.898 1.00 230.96 ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A 1 99   ? 101.445 88.787  101.648 1.00 230.96 ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A 1 99   ? 100.637 87.946  100.666 1.00 230.96 ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A 1 99   ? 102.023 87.948  102.782 1.00 230.96 ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A 1 100  ? 103.268 89.642  97.765  1.00 215.01 ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A 1 100  ? 103.580 90.428  96.587  1.00 215.01 ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A 1 100  ? 102.331 91.145  96.107  1.00 215.01 ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A 1 100  ? 101.205 90.751  96.418  1.00 215.01 ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A 1 100  ? 104.122 89.562  95.451  1.00 215.01 ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A 1 100  ? 105.151 88.471  95.729  1.00 215.01 ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A 1 100  ? 105.606 87.911  94.408  1.00 215.01 ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A 1 100  ? 106.350 88.977  96.499  1.00 215.01 ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A 1 101  ? 102.550 92.200  95.325  1.00 207.00 ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A 1 101  ? 101.446 92.949  94.737  1.00 207.00 ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A 1 101  ? 101.972 93.681  93.512  1.00 207.00 ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A 1 101  ? 102.581 94.743  93.649  1.00 207.00 ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A 1 101  ? 100.860 93.927  95.747  1.00 207.00 ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A 1 101  ? 99.468  94.488  95.459  1.00 207.00 ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A 1 101  ? 98.717  94.665  96.757  1.00 207.00 ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A 1 101  ? 99.528  95.815  94.719  1.00 207.00 ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A 1 102  ? 101.711 93.137  92.333  1.00 210.35 ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A 1 102  ? 101.992 93.841  91.094  1.00 210.35 ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A 1 102  ? 100.967 94.944  90.909  1.00 210.35 ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A 1 102  ? 99.804  94.797  91.290  1.00 210.35 ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A 1 102  ? 101.932 92.899  89.893  1.00 210.35 ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A 1 102  ? 103.198 92.127  89.599  1.00 210.35 ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A 1 102  ? 103.320 90.917  90.498  1.00 210.35 ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A 1 102  ? 102.116 90.021  90.400  1.00 210.35 ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A 1 102  ? 102.258 88.883  91.340  1.00 210.35 ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A 1 103  ? 101.398 96.048  90.308  1.00 241.26 ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A 1 103  ? 100.493 97.162  90.072  1.00 241.26 ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A 1 103  ? 101.011 98.005  88.924  1.00 241.26 ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A 1 103  ? 102.198 98.332  88.874  1.00 241.26 ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A 1 103  ? 100.335 98.038  91.316  1.00 241.26 ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A 1 104  ? 100.108 98.360  88.013  1.00 251.64 ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A 1 104  ? 100.432 99.245  86.908  1.00 251.64 ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A 1 104  ? 99.264  100.182 86.648  1.00 251.64 ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A 1 104  ? 98.105  99.845  86.895  1.00 251.64 ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A 1 104  ? 100.777 98.467  85.638  1.00 251.64 ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A 1 104  ? 102.220 98.024  85.585  1.00 251.64 ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A 1 104  ? 102.572 97.359  84.279  1.00 251.64 ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A 1 104  ? 101.645 97.073  83.494  1.00 251.64 ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A 1 104  ? 103.775 97.125  84.034  1.00 251.64 ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A 1 105  ? 99.583  101.374 86.152  1.00 234.89 ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A 1 105  ? 98.574  102.357 85.838  1.00 234.89 ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A 1 105  ? 98.039  103.051 87.072  1.00 234.89 ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A 1 105  ? 98.318  102.655 88.206  1.00 234.89 ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A 1 106  ? 97.258  104.107 86.875  1.00 227.05 ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A 1 106  ? 96.769  104.884 88.020  1.00 227.05 ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A 1 106  ? 95.663  104.176 88.778  1.00 227.05 ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A 1 106  ? 94.480  104.427 88.539  1.00 227.05 ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A 1 106  ? 96.249  106.178 87.381  1.00 227.05 ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A 1 106  ? 96.585  106.095 85.943  1.00 227.05 ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A 1 106  ? 96.791  104.665 85.602  1.00 227.05 ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A 1 107  ? 96.030  103.289 89.690  1.00 220.41 ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A 1 107  ? 95.050  102.533 90.444  1.00 220.41 ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A 1 107  ? 95.058  102.959 91.904  1.00 220.41 ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A 1 107  ? 96.043  103.495 92.421  1.00 220.41 ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A 1 107  ? 95.305  101.028 90.328  1.00 220.41 ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A 1 107  ? 96.649  100.593 90.857  1.00 220.41 ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A 1 107  ? 96.741  99.081  90.922  1.00 220.41 ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A 1 107  ? 96.753  98.472  89.535  1.00 220.41 ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A 1 107  ? 97.090  97.028  89.563  1.00 220.41 ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A 1 108  ? 93.931  102.708 92.558  1.00 228.77 ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A 1 108  ? 93.725  103.042 93.959  1.00 228.77 ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A 1 108  ? 93.892  101.765 94.770  1.00 228.77 ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A 1 108  ? 92.934  101.007 94.945  1.00 228.77 ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A 1 108  ? 92.339  103.643 94.155  1.00 228.77 ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A 1 108  ? 92.177  104.387 95.444  1.00 228.77 ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A 1 108  ? 92.881  105.714 95.415  1.00 228.77 ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A 1 108  ? 93.008  106.280 94.310  1.00 228.77 ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A 1 108  ? 93.318  106.186 96.484  1.00 228.77 ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A 1 109  ? 95.096  101.540 95.281  1.00 210.14 ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A 1 109  ? 95.497  100.206 95.710  1.00 210.14 ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A 1 109  ? 94.871  99.869  97.054  1.00 210.14 ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A 1 109  ? 95.052  100.590 98.040  1.00 210.14 ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A 1 109  ? 97.020  100.085 95.770  1.00 210.14 ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A 1 109  ? 97.398  98.645  95.979  1.00 210.14 ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A 1 109  ? 97.609  100.601 94.490  1.00 210.14 ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A 1 110  ? 94.118  98.777  97.084  1.00 230.89 ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A 1 110  ? 93.522  98.256  98.297  1.00 230.89 ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A 1 110  ? 94.173  96.928  98.641  1.00 230.89 ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A 1 110  ? 94.897  96.346  97.832  1.00 230.89 ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A 1 110  ? 92.024  98.060  98.148  1.00 230.89 ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A 1 110  ? 91.318  99.269  97.614  1.00 230.89 ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A 1 110  ? 91.385  100.384 98.619  1.00 230.89 ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A 1 110  ? 91.435  101.715 97.930  1.00 230.89 ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A 1 110  ? 92.833  102.120 97.754  1.00 230.89 ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A 1 111  ? 93.898  96.437  99.849  1.00 244.11 ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A 1 111  ? 94.541  95.211  100.297 1.00 244.11 ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A 1 111  ? 93.899  93.977  99.686  1.00 244.11 ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A 1 111  ? 94.386  92.857  99.881  1.00 244.11 ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A 1 111  ? 94.513  95.128  101.816 1.00 244.11 ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A 1 112  ? 92.794  94.151  98.970  1.00 239.36 ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A 1 112  ? 92.254  93.059  98.177  1.00 239.36 ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A 1 112  ? 93.122  92.761  96.965  1.00 239.36 ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A 1 112  ? 93.047  91.666  96.400  1.00 239.36 ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A 1 112  ? 90.838  93.414  97.756  1.00 239.36 ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A 1 112  ? 90.761  94.766  97.086  1.00 239.36 ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A 1 112  ? 89.346  95.288  97.068  1.00 239.36 ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A 1 112  ? 88.856  95.591  98.411  1.00 239.36 ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A 1 112  ? 87.963  94.849  99.056  1.00 239.36 ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A 1 112  ? 87.560  95.183  100.268 1.00 239.36 ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A 1 112  ? 87.483  93.758  98.485  1.00 239.36 ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A 1 113  ? 93.953  93.702  96.561  1.00 234.60 ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A 1 113  ? 94.751  93.541  95.356  1.00 234.60 ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A 1 113  ? 95.977  92.677  95.545  1.00 234.60 ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A 1 113  ? 96.813  92.686  94.637  1.00 234.60 ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A 1 113  ? 95.166  94.915  94.842  1.00 234.60 ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A 1 113  ? 94.033  95.905  94.883  1.00 234.60 ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A 1 113  ? 92.879  95.471  94.709  1.00 234.60 ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A 1 113  ? 94.282  97.111  95.091  1.00 234.60 ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A 1 114  ? 96.149  91.933  96.631  1.00 239.96 ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A 1 114  ? 97.376  91.185  96.827  1.00 239.96 ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A 1 114  ? 97.409  89.898  96.023  1.00 239.96 ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A 1 114  ? 96.442  89.492  95.379  1.00 239.96 ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A 1 114  ? 97.577  90.852  98.294  1.00 239.96 ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A 1 114  ? 98.245  91.931  99.053  1.00 239.96 ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A 1 114  ? 99.624  92.019  99.055  1.00 239.96 ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A 1 114  ? 97.511  92.875  99.732  1.00 239.96 ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A 1 114  ? 100.266 93.017  99.742  1.00 239.96 ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A 1 114  ? 98.138  93.880  100.427 1.00 239.96 ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A 1 114  ? 99.521  93.950  100.435 1.00 239.96 ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A 1 115  ? 98.568  89.262  96.077  1.00 253.83 ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A 1 115  ? 98.723  87.941  95.510  1.00 253.83 ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A 1 115  ? 97.940  86.938  96.352  1.00 253.83 ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A 1 115  ? 97.975  87.000  97.586  1.00 253.83 ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A 1 115  ? 100.202 87.570  95.473  1.00 253.83 ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A 1 115  ? 100.687 86.377  94.650  1.00 253.83 ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A 1 115  ? 102.095 86.673  94.184  1.00 253.83 ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A 1 115  ? 100.664 85.045  95.406  1.00 253.83 ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A 1 116  ? 97.231  85.999  95.725  1.00 264.93 ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A 1 116  ? 96.467  85.001  96.485  1.00 264.93 ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A 1 116  ? 97.388  83.913  97.013  1.00 264.93 ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A 1 116  ? 97.954  83.134  96.244  1.00 264.93 ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A 1 116  ? 95.479  84.448  95.451  1.00 264.93 ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A 1 116  ? 95.627  85.331  94.238  1.00 264.93 ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A 1 116  ? 97.001  85.877  94.282  1.00 264.93 ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A 1 117  ? 97.543  83.867  98.332  1.00 286.60 ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A 1 117  ? 98.354  82.855  98.995  1.00 286.60 ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A 1 117  ? 97.435  82.009  99.860  1.00 286.60 ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A 1 117  ? 96.562  82.545  100.551 1.00 286.60 ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A 1 117  ? 99.472  83.481  99.846  1.00 286.60 ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A 1 117  ? 100.476 82.425  100.247 1.00 286.60 ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A 1 117  ? 100.154 84.597  99.085  1.00 286.60 ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A 1 118  ? 97.623  80.694  99.810  1.00 316.95 ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A 1 118  ? 96.817  79.784  100.605 1.00 316.95 ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A 1 118  ? 97.148  79.924  102.087 1.00 316.95 ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A 1 118  ? 98.272  80.262  102.470 1.00 316.95 ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A 1 118  ? 97.037  78.341  100.157 1.00 316.95 ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A 1 119  ? 96.124  79.690  102.916 1.00 335.70 ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A 1 119  ? 96.166  79.750  104.381 1.00 335.70 ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A 1 119  ? 96.586  81.113  104.914 1.00 335.70 ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A 1 119  ? 97.056  81.224  106.052 1.00 335.70 ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A 1 119  ? 97.058  78.654  104.970 1.00 335.70 ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A 1 119  ? 96.274  77.427  105.361 1.00 335.70 ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A 1 119  ? 95.260  77.575  106.070 1.00 335.70 ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A 1 119  ? 96.671  76.316  104.964 1.00 335.70 ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A 1 120  ? 96.416  82.153  104.107 1.00 300.08 ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A 1 120  ? 96.673  83.531  104.488 1.00 300.08 ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A 1 120  ? 95.391  84.303  104.234 1.00 300.08 ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A 1 120  ? 94.697  84.070  103.240 1.00 300.08 ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A 1 120  ? 97.850  84.148  103.696 1.00 300.08 ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A 1 120  ? 98.280  85.441  104.318 1.00 300.08 ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A 1 120  ? 99.036  83.206  103.641 1.00 300.08 ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A 1 121  ? 95.061  85.217  105.138 1.00 260.22 ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A 1 121  ? 93.846  85.986  104.940 1.00 260.22 ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A 1 121  ? 94.046  87.430  105.355 1.00 260.22 ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A 1 121  ? 94.403  87.711  106.500 1.00 260.22 ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A 1 121  ? 92.684  85.389  105.719 1.00 260.22 ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A 1 121  ? 91.414  86.142  105.477 1.00 260.22 ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A 1 121  ? 90.357  85.812  106.487 1.00 260.22 ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A 1 121  ? 90.469  84.754  107.135 1.00 260.22 ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A 1 121  ? 89.418  86.618  106.645 1.00 260.22 ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A 1 122  ? 93.797  88.338  104.416 1.00 237.39 ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A 1 122  ? 93.697  89.749  104.747 1.00 237.39 ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A 1 122  ? 92.406  89.979  105.512 1.00 237.39 ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A 1 122  ? 91.339  89.485  105.129 1.00 237.39 ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A 1 122  ? 93.736  90.599  103.468 1.00 237.39 ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A 1 122  ? 95.006  90.307  102.678 1.00 237.39 ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A 1 122  ? 93.635  92.074  103.792 1.00 237.39 ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A 1 122  ? 94.758  89.528  101.401 1.00 237.39 ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A 1 123  ? 92.496  90.713  106.613 1.00 260.73 ? 123  MET A N     1 
ATOM   933   C  CA    . MET A 1 123  ? 91.317  91.079  107.376 1.00 260.73 ? 123  MET A CA    1 
ATOM   934   C  C     . MET A 1 123  ? 90.818  92.476  107.059 1.00 260.73 ? 123  MET A C     1 
ATOM   935   O  O     . MET A 1 123  ? 89.735  92.854  107.516 1.00 260.73 ? 123  MET A O     1 
ATOM   936   C  CB    . MET A 1 123  ? 91.613  90.955  108.867 1.00 260.73 ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A 1 123  ? 92.427  89.736  109.175 1.00 260.73 ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A 1 123  ? 91.593  88.313  108.482 1.00 260.73 ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A 1 123  ? 90.133  88.238  109.512 1.00 260.73 ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A 1 124  ? 91.571  93.248  106.288 1.00 247.90 ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A 1 124  ? 91.207  94.622  105.948 1.00 247.90 ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A 1 124  ? 91.396  94.859  104.457 1.00 247.90 ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A 1 124  ? 92.229  95.669  104.048 1.00 247.90 ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A 1 124  ? 92.048  95.597  106.764 1.00 247.90 ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A 1 124  ? 93.503  95.176  106.844 1.00 247.90 ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A 1 124  ? 93.866  94.077  106.427 1.00 247.90 ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A 1 124  ? 94.350  96.068  107.337 1.00 247.90 ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A 1 125  ? 90.602  94.195  103.614 1.00 253.69 ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A 1 125  ? 90.906  94.187  102.172 1.00 253.69 ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A 1 125  ? 90.608  95.497  101.471 1.00 253.69 ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A 1 125  ? 91.084  95.709  100.349 1.00 253.69 ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A 1 125  ? 90.014  93.060  101.647 1.00 253.69 ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A 1 125  ? 88.828  93.110  102.550 1.00 253.69 ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A 1 125  ? 89.311  93.550  103.905 1.00 253.69 ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A 1 126  ? 89.845  96.380  102.102 1.00 254.32 ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A 1 126  ? 89.474  97.660  101.527 1.00 254.32 ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A 1 126  ? 90.383  98.792  101.953 1.00 254.32 ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A 1 126  ? 90.108  99.944  101.605 1.00 254.32 ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A 1 126  ? 88.062  98.022  101.955 1.00 254.32 ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A 1 126  ? 87.959  98.161  103.442 1.00 254.32 ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A 1 126  ? 87.958  99.307  103.927 1.00 254.32 ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A 1 126  ? 87.933  97.118  104.127 1.00 254.32 ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A 1 127  ? 91.412  98.507  102.740 1.00 230.42 ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A 1 127  ? 92.270  99.572  103.228 1.00 230.42 ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A 1 127  ? 93.134  100.101 102.099 1.00 230.42 ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A 1 127  ? 93.770  99.330  101.376 1.00 230.42 ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A 1 127  ? 93.144  99.072  104.369 1.00 230.42 ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A 1 127  ? 94.046  100.143 104.979 1.00 230.42 ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A 1 127  ? 93.242  101.373 105.386 1.00 230.42 ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A 1 127  ? 94.800  99.574  106.164 1.00 230.42 ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A 1 128  ? 93.137  101.422 101.945 1.00 201.78 ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A 1 128  ? 93.942  102.045 100.911 1.00 201.78 ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A 1 128  ? 95.418  101.860 101.195 1.00 201.78 ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A 1 128  ? 95.886  102.028 102.321 1.00 201.78 ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A 1 128  ? 93.644  103.534 100.805 1.00 201.78 ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A 1 128  ? 94.647  104.276 99.981  1.00 201.78 ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A 1 128  ? 95.760  104.880 100.526 1.00 201.78 ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A 1 128  ? 94.736  104.464 98.645  1.00 201.78 ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A 1 128  ? 96.475  105.430 99.562  1.00 201.78 ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A 1 128  ? 95.871  105.198 98.413  1.00 201.78 ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A 1 129  ? 96.157  101.525 100.152 1.00 198.01 ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A 1 129  ? 97.605  101.437 100.224 1.00 198.01 ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A 1 129  ? 98.263  102.548 99.427  1.00 198.01 ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A 1 129  ? 98.980  103.382 99.981  1.00 198.01 ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A 1 129  ? 98.104  100.070 99.744  1.00 198.01 ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A 1 129  ? 97.117  98.983  100.147 1.00 198.01 ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A 1 129  ? 99.463  99.804  100.338 1.00 198.01 ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A 1 129  ? 97.464  97.637  99.582  1.00 198.01 ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A 1 130  ? 98.018  102.582 98.125  1.00 197.57 ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A 1 130  ? 98.744  103.495 97.265  1.00 197.57 ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A 1 130  ? 97.800  104.075 96.231  1.00 197.57 ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A 1 130  ? 96.781  103.474 95.885  1.00 197.57 ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A 1 130  ? 99.917  102.801 96.576  1.00 197.57 ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A 1 131  ? 98.142  105.266 95.765  1.00 204.94 ? 131  THR A N     1 
ATOM   995   C  CA    . THR A 1 131  ? 97.365  105.971 94.758  1.00 204.94 ? 131  THR A CA    1 
ATOM   996   C  C     . THR A 1 131  ? 98.297  106.262 93.597  1.00 204.94 ? 131  THR A C     1 
ATOM   997   O  O     . THR A 1 131  ? 99.029  107.258 93.611  1.00 204.94 ? 131  THR A O     1 
ATOM   998   C  CB    . THR A 1 131  ? 96.767  107.248 95.329  1.00 204.94 ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A 1 131  ? 96.003  106.923 96.496  1.00 204.94 ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A 1 131  ? 95.870  107.914 94.310  1.00 204.94 ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A 1 132  ? 98.266  105.399 92.599  1.00 215.50 ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A 1 132  ? 99.237  105.471 91.527  1.00 215.50 ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A 1 132  ? 98.819  106.464 90.465  1.00 215.50 ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A 1 132  ? 97.694  106.965 90.443  1.00 215.50 ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A 1 132  ? 99.446  104.107 90.880  1.00 215.50 ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A 1 132  ? 100.549 103.220 91.443  1.00 215.50 ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A 1 132  ? 100.206 102.686 92.815  1.00 215.50 ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A 1 132  ? 100.810 102.082 90.488  1.00 215.50 ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A 1 133  ? 99.753  106.737 89.577  1.00 233.12 ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A 1 133  ? 99.546  107.533 88.388  1.00 233.12 ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A 1 133  ? 99.832  106.649 87.181  1.00 233.12 ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A 1 133  ? 100.001 105.432 87.306  1.00 233.12 ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A 1 133  ? 100.433 108.778 88.425  1.00 233.12 ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A 1 133  ? 99.775  110.037 87.892  1.00 233.12 ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A 1 133  ? 100.651 111.260 88.053  1.00 233.12 ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A 1 133  ? 101.838 111.099 88.402  1.00 233.12 ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A 1 133  ? 100.148 112.384 87.851  1.00 233.12 ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A 1 134  ? 99.861  107.263 86.005  1.00 235.95 ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A 1 134  ? 100.204 106.537 84.796  1.00 235.95 ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A 1 134  ? 101.662 106.102 84.825  1.00 235.95 ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A 1 134  ? 102.536 106.816 85.319  1.00 235.95 ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A 1 134  ? 99.964  107.408 83.567  1.00 235.95 ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A 1 134  ? 98.515  107.606 83.213  1.00 235.95 ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A 1 134  ? 97.881  106.356 82.646  1.00 235.95 ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A 1 134  ? 96.640  106.253 82.688  1.00 235.95 ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A 1 134  ? 98.617  105.476 82.155  1.00 235.95 ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A 1 135  ? 101.918 104.905 84.305  1.00 242.40 ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A 1 135  ? 103.269 104.415 84.149  1.00 242.40 ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A 1 135  ? 103.946 103.914 85.404  1.00 242.40 ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A 1 135  ? 105.055 103.374 85.309  1.00 242.40 ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A 1 136  ? 103.339 104.082 86.574  1.00 244.46 ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A 1 136  ? 103.896 103.509 87.778  1.00 244.46 ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A 1 136  ? 103.756 102.007 87.755  1.00 244.46 ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A 1 136  ? 102.647 101.477 87.827  1.00 244.46 ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A 1 137  ? 104.869 101.309 87.632  1.00 253.60 ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A 1 137  ? 104.867 99.856  87.548  1.00 253.60 ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A 1 137  ? 105.376 99.324  88.879  1.00 253.60 ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A 1 137  ? 106.583 99.211  89.096  1.00 253.60 ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A 1 137  ? 105.713 99.397  86.369  1.00 253.60 ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A 1 137  ? 105.287 100.053 85.070  1.00 253.60 ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A 1 137  ? 106.436 100.173 84.097  1.00 253.60 ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A 1 137  ? 107.231 98.952  84.045  1.00 253.60 ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A 1 137  ? 106.979 97.929  83.237  1.00 253.60 ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A 1 137  ? 105.946 97.972  82.410  1.00 253.60 ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A 1 137  ? 107.759 96.860  83.260  1.00 253.60 ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A 1 138  ? 104.449 98.998  89.770  1.00 232.96 ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A 1 138  ? 104.765 98.775  91.173  1.00 232.96 ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A 1 138  ? 104.545 97.318  91.539  1.00 232.96 ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A 1 138  ? 103.411 96.834  91.541  1.00 232.96 ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A 1 138  ? 103.925 99.680  92.073  1.00 232.96 ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A 1 138  ? 104.481 101.073 92.386  1.00 232.96 ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A 1 138  ? 105.845 100.932 93.037  1.00 232.96 ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A 1 138  ? 104.547 102.011 91.188  1.00 232.96 ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A 1 139  ? 105.626 96.628  91.863  1.00 209.00 ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A 1 139  ? 105.529 95.311  92.456  1.00 209.00 ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A 1 139  ? 106.461 95.249  93.650  1.00 209.00 ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A 1 139  ? 107.562 95.800  93.630  1.00 209.00 ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A 1 139  ? 105.862 94.202  91.475  1.00 209.00 ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A 1 139  ? 105.689 92.839  92.084  1.00 209.00 ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A 1 139  ? 104.855 92.647  92.970  1.00 209.00 ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A 1 139  ? 106.476 91.880  91.623  1.00 209.00 ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A 1 140  ? 106.015 94.553  94.685  1.00 202.26 ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A 1 140  ? 106.652 94.626  95.981  1.00 202.26 ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A 1 140  ? 106.819 93.226  96.548  1.00 202.26 ? 140  MET A C     1 
ATOM   1065  O  O     . MET A 1 140  ? 106.242 92.260  96.048  1.00 202.26 ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A 1 140  ? 105.825 95.520  96.894  1.00 202.26 ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A 1 140  ? 104.395 95.080  97.006  1.00 202.26 ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A 1 140  ? 104.183 94.200  98.543  1.00 202.26 ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A 1 140  ? 104.548 95.558  99.650  1.00 202.26 ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A 1 141  ? 107.643 93.116  97.590  1.00 214.52 ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A 1 141  ? 107.845 91.855  98.303  1.00 214.52 ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A 1 141  ? 107.879 92.169  99.788  1.00 214.52 ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A 1 141  ? 108.913 92.604  100.293 1.00 214.52 ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A 1 141  ? 109.150 91.168  97.912  1.00 214.52 ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A 1 141  ? 109.491 91.071  96.449  1.00 214.52 ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A 1 141  ? 110.936 90.665  96.250  1.00 214.52 ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A 1 141  ? 111.621 90.409  97.263  1.00 214.52 ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A 1 141  ? 111.397 90.623  95.091  1.00 214.52 ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A 1 142  ? 106.792 91.922  100.496 1.00 226.97 ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A 1 142  ? 106.780 92.101  101.939 1.00 226.97 ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A 1 142  ? 106.656 90.729  102.586 1.00 226.97 ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A 1 142  ? 105.916 89.869  102.100 1.00 226.97 ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A 1 142  ? 105.647 93.059  102.372 1.00 226.97 ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A 1 142  ? 104.317 92.618  101.825 1.00 226.97 ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A 1 142  ? 105.557 93.164  103.868 1.00 226.97 ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A 1 143  ? 107.425 90.499  103.643 1.00 242.11 ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A 1 143  ? 107.259 89.303  104.450 1.00 242.11 ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A 1 143  ? 106.620 89.672  105.778 1.00 242.11 ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A 1 143  ? 107.076 90.586  106.468 1.00 242.11 ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A 1 143  ? 108.591 88.604  104.683 1.00 242.11 ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A 1 143  ? 108.472 87.111  104.679 1.00 242.11 ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A 1 143  ? 109.804 86.495  104.943 1.00 242.11 ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A 1 143  ? 110.301 86.883  106.255 1.00 242.11 ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A 1 143  ? 111.433 86.432  106.778 1.00 242.11 ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A 1 143  ? 112.187 85.587  106.092 1.00 242.11 ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A 1 143  ? 111.817 86.835  107.979 1.00 242.11 ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A 1 144  ? 105.535 88.978  106.105 1.00 254.64 ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A 1 144  ? 104.731 89.248  107.290 1.00 254.64 ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A 1 144  ? 104.564 87.917  107.996 1.00 254.64 ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A 1 144  ? 103.825 87.048  107.520 1.00 254.64 ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A 1 144  ? 103.359 89.840  106.952 1.00 254.64 ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A 1 144  ? 102.515 89.968  108.205 1.00 254.64 ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A 1 144  ? 103.498 91.177  106.257 1.00 254.64 ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A 1 145  ? 105.286 87.725  109.087 1.00 259.61 ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A 1 145  ? 105.368 86.411  109.698 1.00 259.61 ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A 1 145  ? 104.960 86.513  111.166 1.00 259.61 ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A 1 145  ? 104.711 87.603  111.687 1.00 259.61 ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A 1 145  ? 106.776 85.821  109.524 1.00 259.61 ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A 1 145  ? 107.340 86.021  108.110 1.00 259.61 ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A 1 145  ? 106.595 85.915  107.114 1.00 259.61 ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A 1 145  ? 108.555 86.257  107.991 1.00 259.61 ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A 1 146  ? 104.893 85.360  111.833 1.00 259.04 ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A 1 146  ? 104.357 85.263  113.184 1.00 259.04 ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A 1 146  ? 105.437 85.485  114.237 1.00 259.04 ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A 1 146  ? 106.560 84.994  114.116 1.00 259.04 ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A 1 146  ? 103.703 83.895  113.412 1.00 259.04 ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A 1 146  ? 102.988 83.771  114.757 1.00 259.04 ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A 1 146  ? 102.570 82.358  115.090 1.00 259.04 ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A 1 146  ? 101.448 81.902  114.283 1.00 259.04 ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A 1 146  ? 101.510 80.884  113.438 1.00 259.04 ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A 1 146  ? 102.646 80.222  113.281 1.00 259.04 ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A 1 146  ? 100.442 80.530  112.741 1.00 259.04 ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A 1 147  ? 105.076 86.219  115.278 1.00 224.48 ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A 1 147  ? 105.923 86.391  116.443 1.00 224.48 ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A 1 147  ? 105.051 86.669  117.649 1.00 224.48 ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A 1 147  ? 103.875 86.304  117.684 1.00 224.48 ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A 1 148  ? 105.628 87.306  118.667 1.00 210.64 ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A 1 148  ? 104.890 87.694  119.865 1.00 210.64 ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A 1 148  ? 105.133 89.171  120.128 1.00 210.64 ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A 1 148  ? 106.285 89.617  120.137 1.00 210.64 ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A 1 148  ? 105.307 86.881  121.107 1.00 210.64 ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A 1 148  ? 104.415 87.228  122.285 1.00 210.64 ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A 1 148  ? 105.280 85.389  120.846 1.00 210.64 ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A 1 149  ? 104.054 89.923  120.342 1.00 219.87 ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A 1 149  ? 104.113 91.251  120.926 1.00 219.87 ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A 1 149  ? 104.789 92.284  120.046 1.00 219.87 ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A 1 149  ? 104.743 92.228  118.815 1.00 219.87 ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A 1 150  ? 105.431 93.252  120.694 1.00 201.56 ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A 1 150  ? 106.119 94.312  119.976 1.00 201.56 ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A 1 150  ? 107.583 93.959  119.773 1.00 201.56 ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A 1 150  ? 108.267 93.539  120.707 1.00 201.56 ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A 1 150  ? 106.027 95.649  120.708 1.00 201.56 ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A 1 150  ? 106.966 96.663  120.107 1.00 201.56 ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A 1 150  ? 106.772 97.124  118.811 1.00 201.56 ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A 1 150  ? 108.064 97.128  120.812 1.00 201.56 ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A 1 150  ? 107.636 98.029  118.244 1.00 201.56 ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A 1 150  ? 108.924 98.037  120.255 1.00 201.56 ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A 1 150  ? 108.710 98.481  118.971 1.00 201.56 ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A 1 150  ? 109.573 99.391  118.413 1.00 201.56 ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A 1 151  ? 108.064 94.154  118.551 1.00 197.72 ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A 1 151  ? 109.478 93.968  118.243 1.00 197.72 ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A 1 151  ? 110.003 95.213  117.539 1.00 197.72 ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A 1 151  ? 109.449 95.626  116.510 1.00 197.72 ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A 1 151  ? 109.698 92.707  117.395 1.00 197.72 ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A 1 151  ? 111.075 92.708  116.776 1.00 197.72 ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A 1 151  ? 109.525 91.469  118.250 1.00 197.72 ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A 1 152  ? 111.042 95.849  118.074 1.00 184.92 ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A 1 152  ? 111.671 96.977  117.380 1.00 184.92 ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A 1 152  ? 112.352 96.549  116.091 1.00 184.92 ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A 1 152  ? 112.657 95.378  115.872 1.00 184.92 ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A 1 152  ? 112.701 97.492  118.388 1.00 184.92 ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A 1 152  ? 112.256 96.982  119.692 1.00 184.92 ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A 1 152  ? 111.514 95.708  119.457 1.00 184.92 ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A 1 153  ? 112.632 97.545  115.248 1.00 197.26 ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A 1 153  ? 113.072 97.305  113.879 1.00 197.26 ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A 1 153  ? 114.447 96.669  113.775 1.00 197.26 ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A 1 153  ? 114.771 96.114  112.721 1.00 197.26 ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A 1 153  ? 113.076 98.608  113.089 1.00 197.26 ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A 1 154  ? 115.253 96.718  114.827 1.00 192.84 ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A 1 154  ? 116.613 96.212  114.750 1.00 192.84 ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A 1 154  ? 116.821 94.930  115.521 1.00 192.84 ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A 1 154  ? 117.874 94.308  115.386 1.00 192.84 ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A 1 154  ? 117.599 97.264  115.259 1.00 192.84 ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A 1 154  ? 118.076 98.201  114.176 1.00 192.84 ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A 1 154  ? 116.953 99.030  113.602 1.00 192.84 ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A 1 154  ? 116.046 99.418  114.368 1.00 192.84 ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A 1 154  ? 116.958 99.268  112.381 1.00 192.84 ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A 1 155  ? 115.844 94.530  116.330 1.00 204.57 ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A 1 155  ? 115.962 93.276  117.057 1.00 204.57 ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A 1 155  ? 115.853 92.099  116.107 1.00 204.57 ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A 1 155  ? 116.628 91.142  116.188 1.00 204.57 ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A 1 155  ? 114.890 93.197  118.136 1.00 204.57 ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A 1 155  ? 114.872 94.403  119.025 1.00 204.57 ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A 1 155  ? 116.192 94.612  119.715 1.00 204.57 ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A 1 155  ? 116.087 95.783  120.658 1.00 204.57 ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A 1 155  ? 115.791 97.029  119.904 1.00 204.57 ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A 1 156  ? 114.898 92.159  115.189 1.00 205.76 ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A 1 156  ? 114.851 91.137  114.161 1.00 205.76 ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A 1 156  ? 115.931 91.376  113.120 1.00 205.76 ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A 1 156  ? 116.616 90.431  112.716 1.00 205.76 ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A 1 156  ? 113.463 91.094  113.529 1.00 205.76 ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A 1 156  ? 113.057 92.369  112.865 1.00 205.76 ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A 1 156  ? 113.020 92.508  111.497 1.00 205.76 ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A 1 156  ? 112.704 93.572  113.375 1.00 205.76 ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A 1 156  ? 112.633 93.731  111.190 1.00 205.76 ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A 1 156  ? 112.442 94.401  112.312 1.00 205.76 ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A 1 157  ? 116.124 92.634  112.717 1.00 204.95 ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A 1 157  ? 117.088 93.017  111.705 1.00 204.95 ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A 1 157  ? 116.907 92.297  110.387 1.00 204.95 ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A 1 157  ? 117.885 92.014  109.690 1.00 204.95 ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A 1 158  ? 115.661 91.978  110.045 1.00 224.18 ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A 1 158  ? 115.411 91.053  108.952 1.00 224.18 ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A 1 158  ? 115.620 91.757  107.624 1.00 224.18 ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A 1 158  ? 115.000 92.788  107.337 1.00 224.18 ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A 1 158  ? 114.000 90.460  109.056 1.00 224.18 ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A 1 158  ? 113.946 89.467  110.214 1.00 224.18 ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A 1 158  ? 113.593 89.787  107.752 1.00 224.18 ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A 1 158  ? 112.560 89.016  110.554 1.00 224.18 ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A 1 159  ? 116.522 91.214  106.821 1.00 241.21 ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A 1 159  ? 116.702 91.636  105.438 1.00 241.21 ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A 1 159  ? 116.789 90.350  104.623 1.00 241.21 ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A 1 159  ? 117.856 89.745  104.502 1.00 241.21 ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A 1 159  ? 117.934 92.507  105.270 1.00 241.21 ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A 1 159  ? 117.787 93.883  105.870 1.00 241.21 ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A 1 159  ? 119.071 94.670  105.750 1.00 241.21 ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A 1 159  ? 119.475 94.840  104.299 1.00 241.21 ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A 1 159  ? 120.841 95.412  104.180 1.00 241.21 ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A 1 160  ? 115.663 89.947  104.056 1.00 265.37 ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A 1 160  ? 115.556 88.711  103.284 1.00 265.37 ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A 1 160  ? 116.181 88.812  101.926 1.00 265.37 ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A 1 160  ? 116.248 87.811  101.214 1.00 265.37 ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A 1 160  ? 114.086 88.327  103.148 1.00 265.37 ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A 1 160  ? 113.426 88.095  104.487 1.00 265.37 ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A 1 160  ? 114.061 87.481  105.367 1.00 265.37 ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A 1 160  ? 112.287 88.563  104.670 1.00 265.37 ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A 1 161  ? 116.626 89.997  101.551 1.00 220.69 ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A 1 161  ? 117.369 90.232  100.324 1.00 220.69 ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A 1 161  ? 118.181 91.496  100.541 1.00 220.69 ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A 1 161  ? 118.381 91.934  101.680 1.00 220.69 ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A 1 161  ? 116.444 90.348  99.119  1.00 220.69 ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A 1 161  ? 115.329 91.315  99.325  1.00 220.69 ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A 1 161  ? 114.632 91.519  98.030  1.00 220.69 ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A 1 161  ? 115.571 91.920  96.997  1.00 220.69 ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A 1 161  ? 115.293 91.894  95.702  1.00 220.69 ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A 1 161  ? 114.102 91.490  95.292  1.00 220.69 ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A 1 161  ? 116.202 92.275  94.818  1.00 220.69 ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A 1 162  ? 118.660 92.076  99.448  1.00 214.72 ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A 1 162  ? 119.532 93.235  99.552  1.00 214.72 ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A 1 162  ? 118.743 94.460  99.981  1.00 214.72 ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A 1 162  ? 119.038 95.087  101.002 1.00 214.72 ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A 1 162  ? 120.260 93.472  98.223  1.00 214.72 ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A 1 162  ? 121.138 92.265  97.906  1.00 214.72 ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A 1 162  ? 121.073 94.747  98.287  1.00 214.72 ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A 1 162  ? 122.039 91.836  99.054  1.00 214.72 ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A 1 163  ? 117.723 94.808  99.222  1.00 211.98 ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A 1 163  ? 116.972 96.007  99.540  1.00 211.98 ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A 1 163  ? 115.750 95.731  100.393 1.00 211.98 ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A 1 163  ? 114.816 96.539  100.391 1.00 211.98 ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A 1 163  ? 116.580 96.718  98.252  1.00 211.98 ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A 1 163  ? 117.779 97.093  97.425  1.00 211.98 ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A 1 163  ? 118.878 97.267  97.953  1.00 211.98 ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A 1 163  ? 117.583 97.214  96.120  1.00 211.98 ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A 1 164  ? 115.725 94.612  101.108 1.00 219.50 ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A 1 164  ? 114.696 94.411  102.113 1.00 219.50 ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A 1 164  ? 114.932 95.374  103.266 1.00 219.50 ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A 1 164  ? 116.074 95.616  103.661 1.00 219.50 ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A 1 164  ? 114.708 92.968  102.606 1.00 219.50 ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A 1 165  ? 113.855 95.949  103.786 1.00 204.33 ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A 1 165  ? 113.968 96.988  104.800 1.00 204.33 ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A 1 165  ? 113.330 96.472  106.086 1.00 204.33 ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A 1 165  ? 112.127 96.177  106.108 1.00 204.33 ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A 1 165  ? 113.319 98.299  104.347 1.00 204.33 ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A 1 165  ? 114.111 98.887  103.183 1.00 204.33 ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A 1 165  ? 113.261 99.271  105.509 1.00 204.33 ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A 1 165  ? 113.640 100.251 102.750 1.00 204.33 ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A 1 166  ? 114.089 96.352  107.171 1.00 212.72 ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A 1 166  ? 113.495 95.984  108.456 1.00 212.72 ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A 1 166  ? 112.617 97.102  108.985 1.00 212.72 ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A 1 166  ? 112.906 98.286  108.812 1.00 212.72 ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A 1 166  ? 114.712 95.761  109.363 1.00 212.72 ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A 1 166  ? 115.892 95.718  108.466 1.00 212.72 ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A 1 166  ? 115.546 96.513  107.258 1.00 212.72 ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A 1 167  ? 111.516 96.710  109.614 1.00 203.03 ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A 1 167  ? 110.568 97.640  110.205 1.00 203.03 ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A 1 167  ? 110.230 97.142  111.600 1.00 203.03 ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A 1 167  ? 110.649 96.062  112.017 1.00 203.03 ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A 1 167  ? 109.283 97.778  109.368 1.00 203.03 ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A 1 167  ? 109.561 98.494  108.064 1.00 203.03 ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A 1 167  ? 108.715 96.409  109.098 1.00 203.03 ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A 1 168  ? 109.461 97.948  112.323 1.00 203.17 ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A 1 168  ? 108.952 97.507  113.609 1.00 203.17 ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A 1 168  ? 107.915 96.413  113.423 1.00 203.17 ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A 1 168  ? 107.227 96.339  112.403 1.00 203.17 ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A 1 168  ? 108.329 98.663  114.382 1.00 203.17 ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A 1 168  ? 109.323 99.366  115.264 1.00 203.17 ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A 1 168  ? 110.522 99.055  115.157 1.00 203.17 ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A 1 168  ? 108.906 100.206 116.085 1.00 203.17 ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A 1 169  ? 107.816 95.553  114.422 1.00 208.92 ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A 1 169  ? 106.861 94.463  114.409 1.00 208.92 ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A 1 169  ? 106.006 94.527  115.659 1.00 208.92 ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A 1 169  ? 106.528 94.598  116.772 1.00 208.92 ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A 1 169  ? 107.571 93.116  114.331 1.00 208.92 ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A 1 170  ? 104.692 94.525  115.468 1.00 213.80 ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A 1 170  ? 103.729 94.498  116.565 1.00 213.80 ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A 1 170  ? 102.866 93.260  116.341 1.00 213.80 ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A 1 170  ? 101.856 93.304  115.634 1.00 213.80 ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A 1 170  ? 102.876 95.766  116.635 1.00 213.80 ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A 1 170  ? 102.012 95.738  117.868 1.00 213.80 ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A 1 170  ? 103.759 97.001  116.641 1.00 213.80 ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A 1 171  ? 103.265 92.141  116.937 1.00 221.18 ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A 1 171  ? 102.537 90.900  116.742 1.00 221.18 ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A 1 171  ? 101.297 90.807  117.600 1.00 221.18 ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A 1 171  ? 100.437 89.973  117.315 1.00 221.18 ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A 1 171  ? 103.422 89.714  117.064 1.00 221.18 ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A 1 171  ? 104.674 89.681  116.285 1.00 221.18 ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A 1 171  ? 104.649 89.371  114.947 1.00 221.18 ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A 1 171  ? 105.881 89.965  116.883 1.00 221.18 ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A 1 171  ? 105.799 89.320  114.217 1.00 221.18 ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A 1 171  ? 107.039 89.918  116.162 1.00 221.18 ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A 1 171  ? 107.000 89.595  114.824 1.00 221.18 ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A 1 172  ? 101.213 91.610  118.650 1.00 210.00 ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A 1 172  ? 100.092 91.599  119.575 1.00 210.00 ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A 1 172  ? 98.812  91.965  118.845 1.00 210.00 ? 172  SER A C     1 
ATOM   1314  O  O     . SER A 1 172  ? 98.624  93.117  118.443 1.00 210.00 ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A 1 172  ? 100.340 92.573  120.715 1.00 210.00 ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A 1 172  ? 100.639 93.846  120.189 1.00 210.00 ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A 1 173  ? 97.913  91.004  118.650 1.00 224.04 ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A 1 173  ? 96.747  91.225  117.798 1.00 224.04 ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A 1 173  ? 95.585  91.906  118.495 1.00 224.04 ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A 1 173  ? 94.518  92.046  117.893 1.00 224.04 ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A 1 173  ? 96.380  89.794  117.400 1.00 224.04 ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A 1 173  ? 96.730  88.996  118.608 1.00 224.04 ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A 1 173  ? 97.874  89.685  119.298 1.00 224.04 ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A 1 174  ? 95.764  92.309  119.706 1.00 229.01 ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A 1 174  ? 94.725  92.956  120.488 1.00 229.01 ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A 1 174  ? 94.746  94.443  120.183 1.00 229.01 ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A 1 174  ? 95.808  95.042  120.002 1.00 229.01 ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A 1 174  ? 94.960  92.669  121.983 1.00 229.01 ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A 1 174  ? 93.890  93.294  122.842 1.00 229.01 ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A 1 174  ? 95.038  91.176  122.208 1.00 229.01 ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A 1 175  ? 93.574  95.047  120.101 1.00 250.84 ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A 1 175  ? 93.498  96.497  120.075 1.00 250.84 ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A 1 175  ? 93.109  97.091  121.415 1.00 250.84 ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A 1 175  ? 93.691  98.095  121.824 1.00 250.84 ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A 1 175  ? 92.503  96.948  119.017 1.00 250.84 ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A 1 175  ? 92.792  96.396  117.649 1.00 250.84 ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A 1 175  ? 91.702  96.797  116.686 1.00 250.84 ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A 1 175  ? 90.525  95.956  116.855 1.00 250.84 ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A 1 175  ? 89.412  96.337  117.471 1.00 250.84 ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A 1 175  ? 89.317  97.557  117.982 1.00 250.84 ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A 1 175  ? 88.398  95.488  117.579 1.00 250.84 ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A 1 176  ? 92.149  96.496  122.118 1.00 214.99 ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A 1 176  ? 91.725  97.052  123.394 1.00 214.99 ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A 1 176  ? 91.071  95.965  124.222 1.00 214.99 ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A 1 176  ? 90.212  95.243  123.730 1.00 214.99 ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A 1 176  ? 90.742  98.210  123.198 1.00 214.99 ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A 1 176  ? 90.253  98.817  124.496 1.00 214.99 ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A 1 176  ? 89.420  100.048 124.238 1.00 214.99 ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A 1 176  ? 88.572  99.885  123.064 1.00 214.99 ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A 1 176  ? 87.263  100.095 123.056 1.00 214.99 ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A 1 176  ? 86.641  100.468 124.165 1.00 214.99 ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A 1 176  ? 86.575  99.922  121.940 1.00 214.99 ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A 1 177  ? 91.467  95.854  125.479 1.00 215.94 ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A 1 177  ? 90.741  95.001  126.405 1.00 215.94 ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A 1 177  ? 90.331  95.802  127.623 1.00 215.94 ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A 1 177  ? 91.038  96.708  128.072 1.00 215.94 ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A 1 177  ? 91.524  93.748  126.822 1.00 215.94 ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A 1 177  ? 91.620  92.802  125.663 1.00 215.94 ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A 1 177  ? 92.910  94.129  127.266 1.00 215.94 ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A 1 178  ? 89.162  95.465  128.142 1.00 232.07 ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A 1 178  ? 88.629  96.114  129.324 1.00 232.07 ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A 1 178  ? 87.694  95.136  130.002 1.00 232.07 ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A 1 178  ? 87.343  94.091  129.449 1.00 232.07 ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A 1 178  ? 87.899  97.409  128.975 1.00 232.07 ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A 1 179  ? 87.295  95.488  131.213 1.00 228.04 ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A 1 179  ? 86.318  94.677  131.910 1.00 228.04 ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A 1 179  ? 85.561  95.559  132.878 1.00 228.04 ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A 1 179  ? 86.140  96.445  133.509 1.00 228.04 ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A 1 179  ? 86.966  93.495  132.639 1.00 228.04 ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A 1 179  ? 87.888  93.878  133.765 1.00 228.04 ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A 1 179  ? 87.449  93.855  135.082 1.00 228.04 ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A 1 179  ? 89.209  94.205  133.514 1.00 228.04 ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A 1 179  ? 88.295  94.180  136.119 1.00 228.04 ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A 1 179  ? 90.064  94.534  134.551 1.00 228.04 ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A 1 179  ? 89.605  94.519  135.854 1.00 228.04 ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A 1 180  ? 84.263  95.319  132.969 1.00 289.40 ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A 1 180  ? 83.416  95.951  133.966 1.00 289.40 ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A 1 180  ? 82.864  94.834  134.838 1.00 289.40 ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A 1 180  ? 82.068  94.010  134.377 1.00 289.40 ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A 1 180  ? 82.311  96.773  133.307 1.00 289.40 ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A 1 180  ? 81.140  97.144  134.198 1.00 289.40 ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A 1 180  ? 81.558  97.769  135.509 1.00 289.40 ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A 1 180  ? 82.366  98.693  135.541 1.00 289.40 ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A 1 180  ? 81.003  97.265  136.600 1.00 289.40 ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A 1 181  ? 83.313  94.792  136.088 1.00 292.03 ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A 1 181  ? 82.842  93.790  137.033 1.00 292.03 ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A 1 181  ? 81.720  94.435  137.845 1.00 292.03 ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A 1 181  ? 81.927  95.236  138.757 1.00 292.03 ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A 1 181  ? 83.980  93.205  137.873 1.00 292.03 ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A 1 181  ? 84.919  94.275  138.450 1.00 292.03 ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A 1 181  ? 83.419  92.311  138.953 1.00 292.03 ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A 1 182  ? 80.496  94.118  137.452 1.00 298.42 ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A 1 182  ? 79.343  94.710  138.094 1.00 298.42 ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A 1 182  ? 78.968  93.901  139.324 1.00 298.42 ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A 1 182  ? 79.649  92.951  139.714 1.00 298.42 ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A 1 182  ? 78.180  94.786  137.112 1.00 298.42 ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A 1 182  ? 78.642  94.947  135.680 1.00 298.42 ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A 1 182  ? 77.527  95.319  134.729 1.00 298.42 ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A 1 182  ? 76.350  95.294  135.146 1.00 298.42 ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A 1 182  ? 77.830  95.645  133.562 1.00 298.42 ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A 1 183  ? 77.875  94.298  139.951 1.00 294.92 ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A 1 183  ? 77.450  93.617  141.154 1.00 294.92 ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A 1 183  ? 76.428  92.540  140.829 1.00 294.92 ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A 1 183  ? 75.614  92.675  139.914 1.00 294.92 ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A 1 183  ? 76.859  94.607  142.152 1.00 294.92 ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A 1 183  ? 76.659  93.995  143.515 1.00 294.92 ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A 1 183  ? 77.378  93.032  143.837 1.00 294.92 ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A 1 183  ? 75.771  94.459  144.257 1.00 294.92 ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A 1 184  ? 76.496  91.453  141.584 1.00 313.32 ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A 1 184  ? 75.437  90.462  141.613 1.00 313.32 ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A 1 184  ? 75.341  89.952  143.042 1.00 313.32 ? 184  THR A C     1 
ATOM   1412  O  O     . THR A 1 184  ? 76.066  90.415  143.927 1.00 313.32 ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A 1 184  ? 75.692  89.338  140.599 1.00 313.32 ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A 1 184  ? 74.562  88.457  140.566 1.00 313.32 ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A 1 184  ? 76.930  88.542  140.972 1.00 313.32 ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A 1 185  ? 74.425  89.017  143.272 1.00 345.82 ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A 1 185  ? 74.283  88.391  144.577 1.00 345.82 ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A 1 185  ? 73.518  87.089  144.412 1.00 345.82 ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A 1 185  ? 72.906  86.833  143.372 1.00 345.82 ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A 1 185  ? 73.573  89.308  145.577 1.00 345.82 ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A 1 185  ? 72.076  89.357  145.466 1.00 345.82 ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A 1 185  ? 71.514  90.075  146.675 1.00 345.82 ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A 1 185  ? 71.812  89.383  147.928 1.00 345.82 ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A 1 185  ? 71.811  89.967  149.122 1.00 345.82 ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A 1 185  ? 71.552  91.261  149.227 1.00 345.82 ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A 1 185  ? 72.069  89.267  150.216 1.00 345.82 ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A 1 186  ? 73.574  86.265  145.455 1.00 332.06 ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A 1 186  ? 72.820  85.022  145.523 1.00 332.06 ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A 1 186  ? 71.684  85.096  146.526 1.00 332.06 ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A 1 186  ? 71.125  84.060  146.897 1.00 332.06 ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A 1 186  ? 73.742  83.849  145.861 1.00 332.06 ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A 1 186  ? 74.308  83.014  144.709 1.00 332.06 ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A 1 186  ? 73.183  82.278  144.005 1.00 332.06 ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A 1 186  ? 75.083  83.857  143.719 1.00 332.06 ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A 1 187  ? 71.339  86.292  146.982 1.00 353.30 ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A 1 187  ? 70.312  86.418  147.991 1.00 353.30 ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A 1 187  ? 70.869  86.419  149.399 1.00 353.30 ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A 1 187  ? 70.496  87.268  150.213 1.00 353.30 ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A 1 188  ? 71.782  85.491  149.694 1.00 332.34 ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A 1 188  ? 72.267  85.338  151.062 1.00 332.34 ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A 1 188  ? 73.256  86.440  151.432 1.00 332.34 ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A 1 188  ? 73.175  87.025  152.517 1.00 332.34 ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A 1 188  ? 72.856  83.933  151.255 1.00 332.34 ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A 1 188  ? 73.923  83.476  150.265 1.00 332.34 ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A 1 188  ? 75.330  83.837  150.696 1.00 332.34 ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A 1 188  ? 75.615  83.963  151.886 1.00 332.34 ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A 1 188  ? 76.220  84.002  149.727 1.00 332.34 ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A 1 189  ? 74.182  86.753  150.539 1.00 319.03 ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A 1 189  ? 75.119  87.837  150.754 1.00 319.03 ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A 1 189  ? 75.076  88.756  149.548 1.00 319.03 ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A 1 189  ? 74.625  88.373  148.469 1.00 319.03 ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A 1 189  ? 76.539  87.318  150.982 1.00 319.03 ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A 1 189  ? 77.354  87.144  149.718 1.00 319.03 ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A 1 189  ? 78.799  86.899  150.041 1.00 319.03 ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A 1 189  ? 79.074  85.479  150.200 1.00 319.03 ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A 1 189  ? 80.290  84.981  150.372 1.00 319.03 ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A 1 189  ? 81.334  85.796  150.412 1.00 319.03 ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A 1 189  ? 80.464  83.674  150.508 1.00 319.03 ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A 1 190  ? 75.512  89.981  149.751 1.00 322.16 ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A 1 190  ? 75.526  90.962  148.689 1.00 322.16 ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A 1 190  ? 76.964  91.026  148.171 1.00 322.16 ? 190  THR A C     1 
ATOM   1462  O  O     . THR A 1 190  ? 77.791  90.171  148.505 1.00 322.16 ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A 1 190  ? 74.987  92.286  149.240 1.00 322.16 ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A 1 190  ? 73.953  91.996  150.187 1.00 322.16 ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A 1 190  ? 74.318  93.114  148.137 1.00 322.16 ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A 1 191  ? 77.259  92.007  147.315 1.00 323.92 ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1 191  ? 78.591  92.382  146.845 1.00 323.92 ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1 191  ? 79.267  91.296  146.024 1.00 323.92 ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A 1 191  ? 80.490  91.341  145.846 1.00 323.92 ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1 191  ? 79.515  92.782  148.000 1.00 323.92 ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1 191  ? 78.843  93.711  148.976 1.00 323.92 ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1 191  ? 77.946  94.465  148.550 1.00 323.92 ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1 191  ? 79.202  93.673  150.170 1.00 323.92 ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A 1 192  ? 78.518  90.326  145.517 1.00 315.28 ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A 1 192  ? 79.122  89.297  144.692 1.00 315.28 ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A 1 192  ? 79.410  89.847  143.303 1.00 315.28 ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A 1 192  ? 78.685  90.693  142.776 1.00 315.28 ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A 1 192  ? 78.217  88.074  144.621 1.00 315.28 ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A 1 192  ? 78.128  87.370  145.971 1.00 315.28 ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A 1 192  ? 77.100  86.255  145.930 1.00 315.28 ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A 1 192  ? 79.493  86.835  146.370 1.00 315.28 ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A 1 193  ? 80.495  89.366  142.717 1.00 320.41 ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A 1 193  ? 81.053  90.021  141.548 1.00 320.41 ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A 1 193  ? 80.406  89.495  140.275 1.00 320.41 ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A 1 193  ? 80.175  88.290  140.131 1.00 320.41 ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A 1 193  ? 82.567  89.826  141.527 1.00 320.41 ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A 1 193  ? 83.225  90.310  142.804 1.00 320.41 ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A 1 193  ? 82.478  90.711  143.723 1.00 320.41 ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A 1 193  ? 84.474  90.304  142.887 1.00 320.41 ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A 1 194  ? 80.092  90.410  139.367 1.00 309.24 ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A 1 194  ? 79.463  90.088  138.093 1.00 309.24 ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A 1 194  ? 80.338  90.688  137.003 1.00 309.24 ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A 1 194  ? 80.201  91.865  136.667 1.00 309.24 ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A 1 194  ? 78.040  90.630  138.033 1.00 309.24 ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A 1 194  ? 77.243  90.099  136.869 1.00 309.24 ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A 1 194  ? 77.113  91.133  135.770 1.00 309.24 ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A 1 194  ? 76.474  90.539  134.535 1.00 309.24 ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A 1 194  ? 76.363  91.545  133.447 1.00 309.24 ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A 1 195  ? 81.225  89.884  136.439 1.00 287.03 ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A 1 195  ? 82.201  90.391  135.492 1.00 287.03 ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A 1 195  ? 81.632  90.412  134.084 1.00 287.03 ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A 1 195  ? 81.125  89.398  133.601 1.00 287.03 ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A 1 195  ? 83.463  89.537  135.510 1.00 287.03 ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A 1 195  ? 84.477  89.973  134.461 1.00 287.03 ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A 1 195  ? 84.927  91.362  134.800 1.00 287.03 ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A 1 195  ? 85.655  89.033  134.399 1.00 287.03 ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A 1 196  ? 81.741  91.560  133.425 1.00 292.25 ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A 1 196  ? 81.559  91.666  131.986 1.00 292.25 ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A 1 196  ? 82.922  91.898  131.357 1.00 292.25 ? 196  THR A C     1 
ATOM   1510  O  O     . THR A 1 196  ? 83.762  92.594  131.934 1.00 292.25 ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A 1 196  ? 80.624  92.816  131.626 1.00 292.25 ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A 1 196  ? 81.315  94.054  131.813 1.00 292.25 ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A 1 196  ? 79.410  92.801  132.527 1.00 292.25 ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A 1 197  ? 83.145  91.321  130.186 1.00 253.84 ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A 1 197  ? 84.435  91.436  129.528 1.00 253.84 ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A 1 197  ? 84.330  92.177  128.210 1.00 253.84 ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A 1 197  ? 83.430  91.929  127.405 1.00 253.84 ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A 1 197  ? 85.052  90.068  129.302 1.00 253.84 ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A 1 197  ? 86.074  89.853  130.401 1.00 253.84 ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A 1 197  ? 86.513  88.415  130.415 1.00 253.84 ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A 1 197  ? 87.249  90.782  130.152 1.00 253.84 ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A 1 198  ? 85.273  93.086  127.999 1.00 259.55 ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A 1 198  ? 85.225  94.035  126.899 1.00 259.55 ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A 1 198  ? 86.506  93.918  126.095 1.00 259.55 ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A 1 198  ? 87.562  94.367  126.546 1.00 259.55 ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A 1 198  ? 85.048  95.457  127.431 1.00 259.55 ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A 1 198  ? 84.091  95.611  128.604 1.00 259.55 ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A 1 198  ? 82.650  95.293  128.222 1.00 259.55 ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A 1 198  ? 82.332  95.642  126.838 1.00 259.55 ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A 1 198  ? 81.987  96.854  126.422 1.00 259.55 ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A 1 198  ? 81.724  97.056  125.140 1.00 259.55 ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A 1 198  ? 81.903  97.857  127.282 1.00 259.55 ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A 1 199  ? 86.409  93.338  124.902 1.00 237.38 ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A 1 199  ? 87.573  92.852  124.170 1.00 237.38 ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A 1 199  ? 87.574  93.442  122.771 1.00 237.38 ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A 1 199  ? 86.567  93.375  122.066 1.00 237.38 ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A 1 199  ? 87.570  91.314  124.095 1.00 237.38 ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A 1 199  ? 87.693  90.715  125.496 1.00 237.38 ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A 1 199  ? 88.676  90.812  123.187 1.00 237.38 ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A 1 199  ? 87.804  89.221  125.512 1.00 237.38 ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A 1 200  ? 88.699  94.006  122.353 1.00 237.89 ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A 1 200  ? 88.851  94.440  120.971 1.00 237.89 ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A 1 200  ? 90.200  93.954  120.482 1.00 237.89 ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A 1 200  ? 91.238  94.359  121.009 1.00 237.89 ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A 1 200  ? 88.725  95.947  120.871 1.00 237.89 ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A 1 200  ? 87.364  96.342  121.168 1.00 237.89 ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A 1 200  ? 86.321  96.392  120.302 1.00 237.89 ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A 1 200  ? 86.851  96.688  122.443 1.00 237.89 ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A 1 200  ? 85.184  96.779  120.957 1.00 237.89 ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A 1 200  ? 85.484  96.962  122.279 1.00 237.89 ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A 1 200  ? 87.415  96.795  123.711 1.00 237.89 ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A 1 200  ? 84.678  97.355  123.330 1.00 237.89 ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A 1 200  ? 86.620  97.186  124.747 1.00 237.89 ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A 1 200  ? 85.263  97.464  124.554 1.00 237.89 ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A 1 201  ? 90.173  93.065  119.506 1.00 263.46 ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A 1 201  ? 91.349  92.431  118.943 1.00 263.46 ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A 1 201  ? 91.432  92.752  117.460 1.00 263.46 ? 201  THR A C     1 
ATOM   1558  O  O     . THR A 1 201  ? 90.736  93.627  116.959 1.00 263.46 ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A 1 201  ? 91.314  90.925  119.179 1.00 263.46 ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A 1 201  ? 92.484  90.332  118.603 1.00 263.46 ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A 1 201  ? 90.054  90.313  118.567 1.00 263.46 ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A 1 202  ? 92.325  92.046  116.767 1.00 277.32 ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A 1 202  ? 92.396  92.133  115.313 1.00 277.32 ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A 1 202  ? 91.103  91.690  114.648 1.00 277.32 ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A 1 202  ? 90.704  92.249  113.622 1.00 277.32 ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A 1 202  ? 93.540  91.258  114.812 1.00 277.32 ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A 1 202  ? 93.487  89.850  115.387 1.00 277.32 ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A 1 202  ? 92.616  89.579  116.242 1.00 277.32 ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A 1 202  ? 94.312  89.007  114.986 1.00 277.32 ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A 1 203  ? 90.443  90.699  115.216 1.00 278.59 ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A 1 203  ? 89.347  90.010  114.564 1.00 278.59 ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A 1 203  ? 89.792  88.750  113.873 1.00 278.59 ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A 1 203  ? 88.995  87.840  113.663 1.00 278.59 ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A 1 204  ? 91.075  88.667  113.520 1.00 276.01 ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A 1 204  ? 91.556  87.454  112.877 1.00 276.01 ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A 1 204  ? 91.649  86.303  113.860 1.00 276.01 ? 204  SER A C     1 
ATOM   1577  O  O     . SER A 1 204  ? 91.696  85.144  113.438 1.00 276.01 ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A 1 204  ? 92.918  87.677  112.228 1.00 276.01 ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A 1 204  ? 93.943  87.698  113.195 1.00 276.01 ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A 1 205  ? 91.672  86.588  115.156 1.00 246.32 ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A 1 205  ? 91.638  85.548  116.171 1.00 246.32 ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A 1 205  ? 90.314  85.630  116.915 1.00 246.32 ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A 1 205  ? 89.642  86.669  116.932 1.00 246.32 ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A 1 205  ? 92.831  85.651  117.143 1.00 246.32 ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A 1 205  ? 94.131  85.717  116.366 1.00 246.32 ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A 1 205  ? 92.685  86.839  118.073 1.00 246.32 ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A 1 206  ? 89.918  84.513  117.489 1.00 208.36 ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A 1 206  ? 88.785  84.534  118.393 1.00 208.36 ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A 1 206  ? 89.222  85.152  119.708 1.00 208.36 ? 206  THR A C     1 
ATOM   1590  O  O     . THR A 1 206  ? 90.329  84.873  120.175 1.00 208.36 ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A 1 206  ? 88.250  83.132  118.641 1.00 208.36 ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A 1 206  ? 88.134  82.445  117.391 1.00 208.36 ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A 1 206  ? 86.898  83.169  119.316 1.00 208.36 ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A 1 207  ? 88.416  86.020  120.301 1.00 192.44 ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A 1 207  ? 88.717  86.469  121.664 1.00 192.44 ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A 1 207  ? 88.685  85.334  122.670 1.00 192.44 ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A 1 207  ? 89.439  85.347  123.655 1.00 192.44 ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A 1 207  ? 87.620  87.507  121.922 1.00 192.44 ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A 1 207  ? 87.224  87.985  120.565 1.00 192.44 ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A 1 207  ? 87.320  86.788  119.690 1.00 192.44 ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A 1 208  ? 87.846  84.331  122.417 1.00 213.52 ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A 1 208  ? 87.777  83.179  123.302 1.00 213.52 ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A 1 208  ? 89.078  82.391  123.286 1.00 213.52 ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A 1 208  ? 89.592  82.001  124.340 1.00 213.52 ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A 1 208  ? 86.605  82.289  122.904 1.00 213.52 ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A 1 208  ? 86.425  81.059  123.792 1.00 213.52 ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A 1 208  ? 86.249  81.470  125.242 1.00 213.52 ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A 1 208  ? 85.248  80.221  123.329 1.00 213.52 ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A 1 209  ? 89.647  82.177  122.099 1.00 225.18 ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A 1 209  ? 90.882  81.407  122.028 1.00 225.18 ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A 1 209  ? 92.057  82.192  122.594 1.00 225.18 ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A 1 209  ? 93.002  81.599  123.127 1.00 225.18 ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A 1 209  ? 91.142  80.963  120.588 1.00 225.18 ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A 1 209  ? 91.761  82.002  119.674 1.00 225.18 ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A 1 209  ? 91.416  81.771  118.229 1.00 225.18 ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A 1 209  ? 90.578  80.889  117.957 1.00 225.18 ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A 1 209  ? 91.959  82.479  117.362 1.00 225.18 ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A 1 210  ? 91.982  83.523  122.552 1.00 217.35 ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A 1 210  ? 93.004  84.331  123.196 1.00 217.35 ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A 1 210  ? 92.895  84.226  124.706 1.00 217.35 ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A 1 210  ? 93.912  84.200  125.410 1.00 217.35 ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A 1 210  ? 92.878  85.782  122.745 1.00 217.35 ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A 1 211  ? 91.663  84.148  125.211 1.00 214.55 ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A 1 211  ? 91.455  83.887  126.628 1.00 214.55 ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A 1 211  ? 92.009  82.526  127.022 1.00 214.55 ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A 1 211  ? 92.576  82.365  128.110 1.00 214.55 ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A 1 211  ? 89.965  83.971  126.941 1.00 214.55 ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A 1 211  ? 89.506  83.475  128.307 1.00 214.55 ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A 1 211  ? 90.142  84.293  129.419 1.00 214.55 ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A 1 211  ? 88.004  83.537  128.388 1.00 214.55 ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A 1 212  ? 91.863  81.542  126.136 1.00 217.75 ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A 1 212  ? 92.409  80.217  126.402 1.00 217.75 ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A 1 212  ? 93.928  80.244  126.447 1.00 217.75 ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A 1 212  ? 94.542  79.596  127.305 1.00 217.75 ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A 1 212  ? 91.923  79.239  125.343 1.00 217.75 ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A 1 212  ? 90.425  79.218  125.235 1.00 217.75 ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A 1 212  ? 89.721  79.605  126.168 1.00 217.75 ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A 1 212  ? 89.920  78.793  124.087 1.00 217.75 ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A 1 213  ? 94.541  81.011  125.541 1.00 205.96 ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A 1 213  ? 95.982  81.244  125.567 1.00 205.96 ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A 1 213  ? 96.415  81.856  126.889 1.00 205.96 ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A 1 213  ? 97.364  81.389  127.534 1.00 205.96 ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A 1 213  ? 96.380  82.176  124.427 1.00 205.96 ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A 1 213  ? 96.340  81.572  123.056 1.00 205.96 ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A 1 213  ? 96.974  82.485  122.033 1.00 205.96 ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A 1 213  ? 97.450  83.571  122.368 1.00 205.96 ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A 1 213  ? 96.990  82.053  120.779 1.00 205.96 ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A 1 214  ? 95.687  82.891  127.310 1.00 199.44 ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A 1 214  ? 96.001  83.615  128.532 1.00 199.44 ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A 1 214  ? 95.939  82.701  129.743 1.00 199.44 ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A 1 214  ? 96.909  82.588  130.494 1.00 199.44 ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A 1 214  ? 95.036  84.785  128.696 1.00 199.44 ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A 1 215  ? 94.832  81.966  129.880 1.00 204.97 ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A 1 215  ? 94.636  81.110  131.045 1.00 204.97 ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A 1 215  ? 95.604  79.934  131.021 1.00 204.97 ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A 1 215  ? 96.003  79.427  132.081 1.00 204.97 ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A 1 215  ? 93.156  80.670  131.134 1.00 204.97 ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A 1 215  ? 92.783  79.662  130.067 1.00 204.97 ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A 1 215  ? 92.849  80.108  132.497 1.00 204.97 ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A 1 216  ? 96.061  79.537  129.829 1.00 209.95 ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A 1 216  ? 97.147  78.576  129.749 1.00 209.95 ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A 1 216  ? 98.417  79.154  130.351 1.00 209.95 ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A 1 216  ? 99.110  78.480  131.122 1.00 209.95 ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A 1 216  ? 97.369  78.168  128.296 1.00 209.95 ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A 1 216  ? 98.702  77.498  128.037 1.00 209.95 ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A 1 216  ? 98.916  76.279  128.912 1.00 209.95 ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A 1 216  ? 98.017  75.417  128.962 1.00 209.95 ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A 1 216  ? 99.971  76.197  129.573 1.00 209.95 ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A 1 217  ? 98.717  80.413  130.029 1.00 210.23 ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A 1 217  ? 99.910  81.047  130.582 1.00 210.23 ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A 1 217  ? 99.793  81.197  132.091 1.00 210.23 ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A 1 217  ? 100.775 81.014  132.823 1.00 210.23 ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A 1 217  ? 100.152 82.400  129.893 1.00 210.23 ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A 1 217  ? 100.353 82.194  128.403 1.00 210.23 ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A 1 217  ? 101.390 83.079  130.433 1.00 210.23 ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A 1 217  ? 99.968  83.399  127.583 1.00 210.23 ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A 1 218  ? 98.584  81.466  132.578 1.00 216.33 ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A 1 218  ? 98.369  81.603  134.014 1.00 216.33 ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A 1 218  ? 98.592  80.288  134.736 1.00 216.33 ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A 1 218  ? 99.265  80.244  135.770 1.00 216.33 ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A 1 218  ? 96.967  82.122  134.305 1.00 216.33 ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A 1 218  ? 96.557  83.370  133.548 1.00 216.33 ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A 1 218  ? 95.173  83.820  133.925 1.00 216.33 ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A 1 218  ? 97.551  84.458  133.829 1.00 216.33 ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A 1 219  ? 98.037  79.205  134.200 1.00 210.30 ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A 1 219  ? 98.220  77.903  134.826 1.00 210.30 ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A 1 219  ? 99.672  77.457  134.740 1.00 210.30 ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A 1 219  ? 100.202 76.857  135.687 1.00 210.30 ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A 1 219  ? 97.275  76.905  134.158 1.00 210.30 ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A 1 219  ? 97.065  75.595  134.887 1.00 210.30 ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A 1 219  ? 97.987  74.534  134.349 1.00 210.30 ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A 1 219  ? 97.804  74.366  132.916 1.00 210.30 ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A 1 219  ? 98.734  73.877  132.107 1.00 210.30 ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A 1 219  ? 98.489  73.746  130.813 1.00 210.30 ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A 1 219  ? 99.919  73.540  132.591 1.00 210.30 ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A 1 220  ? 100.327 77.783  133.630 1.00 223.86 ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A 1 220  ? 101.739 77.494  133.439 1.00 223.86 ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A 1 220  ? 102.596 78.199  134.481 1.00 223.86 ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A 1 220  ? 103.491 77.597  135.084 1.00 223.86 ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A 1 220  ? 102.125 77.926  132.032 1.00 223.86 ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A 1 220  ? 103.565 78.296  131.859 1.00 223.86 ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A 1 220  ? 103.754 79.186  130.664 1.00 223.86 ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A 1 220  ? 102.745 79.491  129.997 1.00 223.86 ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A 1 220  ? 104.899 79.599  130.400 1.00 223.86 ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A 1 221  ? 102.318 79.477  134.722 1.00 209.52 ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A 1 221  ? 103.101 80.211  135.704 1.00 209.52 ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A 1 221  ? 102.731 79.796  137.114 1.00 209.52 ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A 1 221  ? 103.547 79.895  138.036 1.00 209.52 ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A 1 221  ? 102.911 81.707  135.505 1.00 209.52 ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A 1 221  ? 103.737 82.256  134.392 1.00 209.52 ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A 1 221  ? 103.528 81.909  133.076 1.00 209.52 ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A 1 221  ? 104.797 83.095  134.398 1.00 209.52 ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A 1 221  ? 104.415 82.526  132.317 1.00 209.52 ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A 1 221  ? 105.197 83.251  133.095 1.00 209.52 ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A 1 222  ? 101.505 79.314  137.292 1.00 212.10 ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A 1 222  ? 101.086 78.804  138.584 1.00 212.10 ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A 1 222  ? 101.823 77.532  138.929 1.00 212.10 ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A 1 222  ? 102.130 77.274  140.097 1.00 212.10 ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A 1 222  ? 99.586  78.552  138.570 1.00 212.10 ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A 1 222  ? 98.741  79.728  139.037 1.00 212.10 ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A 1 222  ? 97.323  79.262  139.281 1.00 212.10 ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A 1 222  ? 99.331  80.340  140.296 1.00 212.10 ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A 1 223  ? 102.155 76.741  137.912 1.00 224.59 ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A 1 223  ? 102.883 75.505  138.153 1.00 224.59 ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A 1 223  ? 104.339 75.737  138.542 1.00 224.59 ? 223  THR A C     1 
ATOM   1726  O  O     . THR A 1 223  ? 105.043 74.771  138.849 1.00 224.59 ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A 1 223  ? 102.819 74.622  136.913 1.00 224.59 ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A 1 223  ? 103.075 75.419  135.753 1.00 224.59 ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A 1 223  ? 101.448 73.997  136.789 1.00 224.59 ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A 1 224  ? 104.807 76.984  138.549 1.00 205.09 ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A 1 224  ? 106.194 77.245  138.905 1.00 205.09 ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A 1 224  ? 106.433 77.098  140.395 1.00 205.09 ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A 1 224  ? 107.573 76.884  140.819 1.00 205.09 ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A 1 224  ? 106.598 78.643  138.466 1.00 205.09 ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A 1 224  ? 106.646 78.820  136.982 1.00 205.09 ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A 1 224  ? 106.736 77.726  136.132 1.00 205.09 ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A 1 224  ? 106.616 80.084  136.428 1.00 205.09 ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A 1 224  ? 106.777 77.889  134.778 1.00 205.09 ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A 1 224  ? 106.660 80.261  135.072 1.00 205.09 ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A 1 224  ? 106.740 79.160  134.251 1.00 205.09 ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A 1 224  ? 106.786 79.336  132.891 1.00 205.09 ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A 1 225  ? 105.389 77.207  141.202 1.00 201.85 ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A 1 225  ? 105.545 77.145  142.646 1.00 201.85 ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A 1 225  ? 105.391 75.752  143.190 1.00 201.85 ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A 1 225  ? 104.976 75.583  144.341 1.00 201.85 ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A 1 225  ? 104.552 78.086  143.314 1.00 201.85 ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A 1 225  ? 104.763 79.508  142.947 1.00 201.85 ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A 1 225  ? 104.004 80.094  141.951 1.00 201.85 ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A 1 225  ? 105.745 80.254  143.573 1.00 201.85 ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A 1 225  ? 104.206 81.409  141.600 1.00 201.85 ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A 1 225  ? 105.953 81.571  143.229 1.00 201.85 ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A 1 225  ? 105.178 82.151  142.245 1.00 201.85 ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A 1 226  ? 105.707 74.750  142.378 1.00 244.26 ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A 1 226  ? 105.710 73.377  142.854 1.00 244.26 ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A 1 226  ? 106.892 73.127  143.779 1.00 244.26 ? 226  SER A C     1 
ATOM   1756  O  O     . SER A 1 226  ? 106.737 72.592  144.881 1.00 244.26 ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A 1 226  ? 105.752 72.429  141.659 1.00 244.26 ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A 1 226  ? 106.650 72.919  140.679 1.00 244.26 ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A 1 227  ? 108.086 73.521  143.345 1.00 260.83 ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A 1 227  ? 109.307 73.090  144.001 1.00 260.83 ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A 1 227  ? 109.964 74.251  144.723 1.00 260.83 ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A 1 227  ? 110.486 75.163  144.065 1.00 260.83 ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A 1 227  ? 110.261 72.485  142.981 1.00 260.83 ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A 1 227  ? 109.617 71.372  142.187 1.00 260.83 ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A 1 227  ? 108.633 70.777  142.621 1.00 260.83 ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A 1 227  ? 110.165 71.086  141.018 1.00 260.83 ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A 1 228  ? 109.952 74.274  146.053 1.00 301.32 ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A 1 228  ? 110.632 75.336  146.798 1.00 301.32 ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A 1 228  ? 112.049 74.964  147.203 1.00 301.32 ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A 1 228  ? 112.322 73.865  147.691 1.00 301.32 ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A 1 228  ? 109.742 75.502  148.038 1.00 301.32 ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A 1 228  ? 108.720 74.364  147.987 1.00 301.32 ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A 1 228  ? 109.161 73.412  146.939 1.00 301.32 ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A 1 229  ? 112.969 75.903  147.002 1.00 295.27 ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A 1 229  ? 114.351 75.696  147.426 1.00 295.27 ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A 1 229  ? 114.759 76.772  148.423 1.00 295.27 ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A 1 229  ? 113.910 77.426  149.026 1.00 295.27 ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A 1 229  ? 115.315 75.702  146.234 1.00 295.27 ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A 1 229  ? 114.735 75.191  144.922 1.00 295.27 ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A 1 229  ? 114.243 73.768  145.011 1.00 295.27 ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A 1 229  ? 113.113 73.465  144.628 1.00 295.27 ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A 1 229  ? 115.084 72.885  145.527 1.00 295.27 ? 229  GLN A NE2   1 
ATOM   1783  N  N     . LYS B 1 7    ? 111.973 79.794  129.501 1.00 185.15 ? 7    LYS B N     1 
ATOM   1784  C  CA    . LYS B 1 7    ? 112.912 79.967  130.600 1.00 185.15 ? 7    LYS B CA    1 
ATOM   1785  C  C     . LYS B 1 7    ? 112.219 79.779  131.935 1.00 185.15 ? 7    LYS B C     1 
ATOM   1786  O  O     . LYS B 1 7    ? 111.481 80.649  132.393 1.00 185.15 ? 7    LYS B O     1 
ATOM   1787  C  CB    . LYS B 1 7    ? 113.565 81.349  130.541 1.00 185.15 ? 7    LYS B CB    1 
ATOM   1788  C  CG    . LYS B 1 7    ? 114.197 81.678  129.206 1.00 185.15 ? 7    LYS B CG    1 
ATOM   1789  C  CD    . LYS B 1 7    ? 115.204 80.619  128.817 1.00 185.15 ? 7    LYS B CD    1 
ATOM   1790  C  CE    . LYS B 1 7    ? 116.421 80.668  129.715 1.00 185.15 ? 7    LYS B CE    1 
ATOM   1791  N  NZ    . LYS B 1 7    ? 116.949 79.300  129.943 1.00 185.15 ? 7    LYS B NZ    1 
ATOM   1792  N  N     . ALA B 1 8    ? 112.456 78.641  132.556 1.00 207.11 ? 8    ALA B N     1 
ATOM   1793  C  CA    . ALA B 1 8    ? 111.841 78.358  133.837 1.00 207.11 ? 8    ALA B CA    1 
ATOM   1794  C  C     . ALA B 1 8    ? 112.520 79.170  134.929 1.00 207.11 ? 8    ALA B C     1 
ATOM   1795  O  O     . ALA B 1 8    ? 113.757 79.204  134.986 1.00 207.11 ? 8    ALA B O     1 
ATOM   1796  C  CB    . ALA B 1 8    ? 111.931 76.872  134.154 1.00 207.11 ? 8    ALA B CB    1 
ATOM   1797  N  N     . PRO B 1 9    ? 111.776 79.838  135.788 1.00 207.76 ? 9    PRO B N     1 
ATOM   1798  C  CA    . PRO B 1 9    ? 112.399 80.499  136.940 1.00 207.76 ? 9    PRO B CA    1 
ATOM   1799  C  C     . PRO B 1 9    ? 112.705 79.500  138.042 1.00 207.76 ? 9    PRO B C     1 
ATOM   1800  O  O     . PRO B 1 9    ? 112.396 78.313  137.906 1.00 207.76 ? 9    PRO B O     1 
ATOM   1801  C  CB    . PRO B 1 9    ? 111.340 81.517  137.381 1.00 207.76 ? 9    PRO B CB    1 
ATOM   1802  C  CG    . PRO B 1 9    ? 110.279 81.497  136.299 1.00 207.76 ? 9    PRO B CG    1 
ATOM   1803  C  CD    . PRO B 1 9    ? 110.346 80.146  135.686 1.00 207.76 ? 9    PRO B CD    1 
ATOM   1804  N  N     . VAL B 1 10   ? 113.302 79.957  139.138 1.00 203.59 ? 10   VAL B N     1 
ATOM   1805  C  CA    . VAL B 1 10   ? 113.620 79.084  140.258 1.00 203.59 ? 10   VAL B CA    1 
ATOM   1806  C  C     . VAL B 1 10   ? 113.170 79.770  141.541 1.00 203.59 ? 10   VAL B C     1 
ATOM   1807  O  O     . VAL B 1 10   ? 113.071 80.999  141.607 1.00 203.59 ? 10   VAL B O     1 
ATOM   1808  C  CB    . VAL B 1 10   ? 115.125 78.715  140.284 1.00 203.59 ? 10   VAL B CB    1 
ATOM   1809  C  CG1   . VAL B 1 10   ? 115.980 79.850  140.826 1.00 203.59 ? 10   VAL B CG1   1 
ATOM   1810  C  CG2   . VAL B 1 10   ? 115.361 77.416  141.046 1.00 203.59 ? 10   VAL B CG2   1 
ATOM   1811  N  N     . PHE B 1 11   ? 112.856 78.967  142.552 1.00 219.48 ? 11   PHE B N     1 
ATOM   1812  C  CA    . PHE B 1 11   ? 112.122 79.438  143.713 1.00 219.48 ? 11   PHE B CA    1 
ATOM   1813  C  C     . PHE B 1 11   ? 112.864 79.160  145.013 1.00 219.48 ? 11   PHE B C     1 
ATOM   1814  O  O     . PHE B 1 11   ? 113.189 78.015  145.321 1.00 219.48 ? 11   PHE B O     1 
ATOM   1815  C  CB    . PHE B 1 11   ? 110.749 78.784  143.766 1.00 219.48 ? 11   PHE B CB    1 
ATOM   1816  C  CG    . PHE B 1 11   ? 109.892 79.327  144.834 1.00 219.48 ? 11   PHE B CG    1 
ATOM   1817  C  CD1   . PHE B 1 11   ? 109.698 80.689  144.938 1.00 219.48 ? 11   PHE B CD1   1 
ATOM   1818  C  CD2   . PHE B 1 11   ? 109.274 78.487  145.734 1.00 219.48 ? 11   PHE B CD2   1 
ATOM   1819  C  CE1   . PHE B 1 11   ? 108.910 81.211  145.930 1.00 219.48 ? 11   PHE B CE1   1 
ATOM   1820  C  CE2   . PHE B 1 11   ? 108.480 78.996  146.730 1.00 219.48 ? 11   PHE B CE2   1 
ATOM   1821  C  CZ    . PHE B 1 11   ? 108.294 80.363  146.826 1.00 219.48 ? 11   PHE B CZ    1 
ATOM   1822  N  N     . THR B 1 12   ? 113.095 80.212  145.799 1.00 226.19 ? 12   THR B N     1 
ATOM   1823  C  CA    . THR B 1 12   ? 113.833 80.064  147.047 1.00 226.19 ? 12   THR B CA    1 
ATOM   1824  C  C     . THR B 1 12   ? 112.965 80.504  148.211 1.00 226.19 ? 12   THR B C     1 
ATOM   1825  O  O     . THR B 1 12   ? 112.070 81.336  148.057 1.00 226.19 ? 12   THR B O     1 
ATOM   1826  C  CB    . THR B 1 12   ? 115.117 80.887  147.078 1.00 226.19 ? 12   THR B CB    1 
ATOM   1827  O  OG1   . THR B 1 12   ? 114.776 82.270  147.177 1.00 226.19 ? 12   THR B OG1   1 
ATOM   1828  C  CG2   . THR B 1 12   ? 115.924 80.666  145.823 1.00 226.19 ? 12   THR B CG2   1 
ATOM   1829  N  N     . VAL B 1 13   ? 113.251 79.943  149.384 1.00 239.11 ? 13   VAL B N     1 
ATOM   1830  C  CA    . VAL B 1 13   ? 112.448 80.139  150.587 1.00 239.11 ? 13   VAL B CA    1 
ATOM   1831  C  C     . VAL B 1 13   ? 113.370 80.462  151.753 1.00 239.11 ? 13   VAL B C     1 
ATOM   1832  O  O     . VAL B 1 13   ? 114.376 79.780  151.964 1.00 239.11 ? 13   VAL B O     1 
ATOM   1833  C  CB    . VAL B 1 13   ? 111.607 78.885  150.913 1.00 239.11 ? 13   VAL B CB    1 
ATOM   1834  C  CG1   . VAL B 1 13   ? 110.915 79.012  152.260 1.00 239.11 ? 13   VAL B CG1   1 
ATOM   1835  C  CG2   . VAL B 1 13   ? 110.584 78.617  149.829 1.00 239.11 ? 13   VAL B CG2   1 
ATOM   1836  N  N     . ARG B 1 14   ? 113.033 81.505  152.513 1.00 230.54 ? 14   ARG B N     1 
ATOM   1837  C  CA    . ARG B 1 14   ? 113.667 81.746  153.804 1.00 230.54 ? 14   ARG B CA    1 
ATOM   1838  C  C     . ARG B 1 14   ? 112.588 82.057  154.827 1.00 230.54 ? 14   ARG B C     1 
ATOM   1839  O  O     . ARG B 1 14   ? 111.772 82.955  154.610 1.00 230.54 ? 14   ARG B O     1 
ATOM   1840  C  CB    . ARG B 1 14   ? 114.668 82.902  153.746 1.00 230.54 ? 14   ARG B CB    1 
ATOM   1841  C  CG    . ARG B 1 14   ? 116.038 82.544  153.203 1.00 230.54 ? 14   ARG B CG    1 
ATOM   1842  C  CD    . ARG B 1 14   ? 116.031 82.691  151.711 1.00 230.54 ? 14   ARG B CD    1 
ATOM   1843  N  NE    . ARG B 1 14   ? 115.609 84.034  151.351 1.00 230.54 ? 14   ARG B NE    1 
ATOM   1844  C  CZ    . ARG B 1 14   ? 114.952 84.329  150.239 1.00 230.54 ? 14   ARG B CZ    1 
ATOM   1845  N  NH1   . ARG B 1 14   ? 114.614 83.363  149.393 1.00 230.54 ? 14   ARG B NH1   1 
ATOM   1846  N  NH2   . ARG B 1 14   ? 114.609 85.582  149.991 1.00 230.54 ? 14   ARG B NH2   1 
ATOM   1847  N  N     . THR B 1 15   ? 112.580 81.324  155.936 1.00 251.55 ? 15   THR B N     1 
ATOM   1848  C  CA    . THR B 1 15   ? 111.600 81.536  156.991 1.00 251.55 ? 15   THR B CA    1 
ATOM   1849  C  C     . THR B 1 15   ? 112.285 81.794  158.324 1.00 251.55 ? 15   THR B C     1 
ATOM   1850  O  O     . THR B 1 15   ? 113.449 81.443  158.534 1.00 251.55 ? 15   THR B O     1 
ATOM   1851  C  CB    . THR B 1 15   ? 110.663 80.335  157.161 1.00 251.55 ? 15   THR B CB    1 
ATOM   1852  O  OG1   . THR B 1 15   ? 111.418 79.206  157.613 1.00 251.55 ? 15   THR B OG1   1 
ATOM   1853  C  CG2   . THR B 1 15   ? 109.956 79.997  155.860 1.00 251.55 ? 15   THR B CG2   1 
ATOM   1854  N  N     . GLN B 1 16   ? 111.529 82.412  159.231 1.00 270.86 ? 16   GLN B N     1 
ATOM   1855  C  CA    . GLN B 1 16   ? 111.930 82.597  160.620 1.00 270.86 ? 16   GLN B CA    1 
ATOM   1856  C  C     . GLN B 1 16   ? 110.801 82.092  161.502 1.00 270.86 ? 16   GLN B C     1 
ATOM   1857  O  O     . GLN B 1 16   ? 109.777 82.769  161.651 1.00 270.86 ? 16   GLN B O     1 
ATOM   1858  C  CB    . GLN B 1 16   ? 112.231 84.064  160.933 1.00 270.86 ? 16   GLN B CB    1 
ATOM   1859  C  CG    . GLN B 1 16   ? 113.307 84.686  160.066 1.00 270.86 ? 16   GLN B CG    1 
ATOM   1860  C  CD    . GLN B 1 16   ? 113.192 86.193  160.007 1.00 270.86 ? 16   GLN B CD    1 
ATOM   1861  O  OE1   . GLN B 1 16   ? 112.400 86.795  160.733 1.00 270.86 ? 16   GLN B OE1   1 
ATOM   1862  N  NE2   . GLN B 1 16   ? 113.960 86.812  159.118 1.00 270.86 ? 16   GLN B NE2   1 
ATOM   1863  N  N     . GLY B 1 17   ? 110.993 80.915  162.086 1.00 260.89 ? 17   GLY B N     1 
ATOM   1864  C  CA    . GLY B 1 17   ? 109.926 80.298  162.850 1.00 260.89 ? 17   GLY B CA    1 
ATOM   1865  C  C     . GLY B 1 17   ? 108.825 79.848  161.918 1.00 260.89 ? 17   GLY B C     1 
ATOM   1866  O  O     . GLY B 1 17   ? 109.063 79.157  160.922 1.00 260.89 ? 17   GLY B O     1 
ATOM   1867  N  N     . ARG B 1 18   ? 107.602 80.255  162.230 1.00 282.86 ? 18   ARG B N     1 
ATOM   1868  C  CA    . ARG B 1 18   ? 106.466 79.988  161.369 1.00 282.86 ? 18   ARG B CA    1 
ATOM   1869  C  C     . ARG B 1 18   ? 105.750 81.253  160.933 1.00 282.86 ? 18   ARG B C     1 
ATOM   1870  O  O     . ARG B 1 18   ? 104.981 81.207  159.967 1.00 282.86 ? 18   ARG B O     1 
ATOM   1871  C  CB    . ARG B 1 18   ? 105.477 79.054  162.077 1.00 282.86 ? 18   ARG B CB    1 
ATOM   1872  C  CG    . ARG B 1 18   ? 104.619 78.222  161.156 1.00 282.86 ? 18   ARG B CG    1 
ATOM   1873  C  CD    . ARG B 1 18   ? 104.035 77.057  161.914 1.00 282.86 ? 18   ARG B CD    1 
ATOM   1874  N  NE    . ARG B 1 18   ? 102.852 76.509  161.267 1.00 282.86 ? 18   ARG B NE    1 
ATOM   1875  C  CZ    . ARG B 1 18   ? 102.887 75.589  160.311 1.00 282.86 ? 18   ARG B CZ    1 
ATOM   1876  N  NH1   . ARG B 1 18   ? 101.763 75.141  159.770 1.00 282.86 ? 18   ARG B NH1   1 
ATOM   1877  N  NH2   . ARG B 1 18   ? 104.052 75.130  159.881 1.00 282.86 ? 18   ARG B NH2   1 
ATOM   1878  N  N     . GLU B 1 19   ? 105.985 82.377  161.601 1.00 282.10 ? 19   GLU B N     1 
ATOM   1879  C  CA    . GLU B 1 19   ? 105.355 83.625  161.197 1.00 282.10 ? 19   GLU B CA    1 
ATOM   1880  C  C     . GLU B 1 19   ? 105.969 84.163  159.918 1.00 282.10 ? 19   GLU B C     1 
ATOM   1881  O  O     . GLU B 1 19   ? 105.264 84.435  158.941 1.00 282.10 ? 19   GLU B O     1 
ATOM   1882  C  CB    . GLU B 1 19   ? 105.491 84.660  162.307 1.00 282.10 ? 19   GLU B CB    1 
ATOM   1883  C  CG    . GLU B 1 19   ? 104.773 84.294  163.573 1.00 282.10 ? 19   GLU B CG    1 
ATOM   1884  C  CD    . GLU B 1 19   ? 104.023 85.462  164.172 1.00 282.10 ? 19   GLU B CD    1 
ATOM   1885  O  OE1   . GLU B 1 19   ? 104.167 86.591  163.659 1.00 282.10 ? 19   GLU B OE1   1 
ATOM   1886  O  OE2   . GLU B 1 19   ? 103.283 85.256  165.155 1.00 282.10 ? 19   GLU B OE2   1 
ATOM   1887  N  N     . TYR B 1 20   ? 107.281 84.302  159.908 1.00 226.25 ? 20   TYR B N     1 
ATOM   1888  C  CA    . TYR B 1 20   ? 107.962 85.053  158.878 1.00 226.25 ? 20   TYR B CA    1 
ATOM   1889  C  C     . TYR B 1 20   ? 108.268 84.181  157.676 1.00 226.25 ? 20   TYR B C     1 
ATOM   1890  O  O     . TYR B 1 20   ? 108.464 82.970  157.795 1.00 226.25 ? 20   TYR B O     1 
ATOM   1891  C  CB    . TYR B 1 20   ? 109.253 85.630  159.432 1.00 226.25 ? 20   TYR B CB    1 
ATOM   1892  C  CG    . TYR B 1 20   ? 109.808 86.740  158.603 1.00 226.25 ? 20   TYR B CG    1 
ATOM   1893  C  CD1   . TYR B 1 20   ? 110.796 86.502  157.665 1.00 226.25 ? 20   TYR B CD1   1 
ATOM   1894  C  CD2   . TYR B 1 20   ? 109.347 88.028  158.759 1.00 226.25 ? 20   TYR B CD2   1 
ATOM   1895  C  CE1   . TYR B 1 20   ? 111.310 87.520  156.916 1.00 226.25 ? 20   TYR B CE1   1 
ATOM   1896  C  CE2   . TYR B 1 20   ? 109.854 89.054  158.010 1.00 226.25 ? 20   TYR B CE2   1 
ATOM   1897  C  CZ    . TYR B 1 20   ? 110.833 88.798  157.088 1.00 226.25 ? 20   TYR B CZ    1 
ATOM   1898  O  OH    . TYR B 1 20   ? 111.339 89.830  156.335 1.00 226.25 ? 20   TYR B OH    1 
ATOM   1899  N  N     . GLY B 1 21   ? 108.314 84.814  156.511 1.00 217.30 ? 21   GLY B N     1 
ATOM   1900  C  CA    . GLY B 1 21   ? 108.748 84.130  155.312 1.00 217.30 ? 21   GLY B CA    1 
ATOM   1901  C  C     . GLY B 1 21   ? 109.382 85.092  154.333 1.00 217.30 ? 21   GLY B C     1 
ATOM   1902  O  O     . GLY B 1 21   ? 109.040 86.277  154.278 1.00 217.30 ? 21   GLY B O     1 
ATOM   1903  N  N     . GLU B 1 22   ? 110.333 84.562  153.569 1.00 230.36 ? 22   GLU B N     1 
ATOM   1904  C  CA    . GLU B 1 22   ? 110.900 85.249  152.415 1.00 230.36 ? 22   GLU B CA    1 
ATOM   1905  C  C     . GLU B 1 22   ? 110.905 84.275  151.257 1.00 230.36 ? 22   GLU B C     1 
ATOM   1906  O  O     . GLU B 1 22   ? 111.426 83.164  151.380 1.00 230.36 ? 22   GLU B O     1 
ATOM   1907  C  CB    . GLU B 1 22   ? 112.317 85.753  152.674 1.00 230.36 ? 22   GLU B CB    1 
ATOM   1908  C  CG    . GLU B 1 22   ? 112.381 86.940  153.584 1.00 230.36 ? 22   GLU B CG    1 
ATOM   1909  C  CD    . GLU B 1 22   ? 111.502 88.082  153.126 1.00 230.36 ? 22   GLU B CD    1 
ATOM   1910  O  OE1   . GLU B 1 22   ? 111.508 88.433  151.926 1.00 230.36 ? 22   GLU B OE1   1 
ATOM   1911  O  OE2   . GLU B 1 22   ? 110.795 88.627  153.986 1.00 230.36 ? 22   GLU B OE2   1 
ATOM   1912  N  N     . PHE B 1 23   ? 110.318 84.687  150.143 1.00 223.49 ? 23   PHE B N     1 
ATOM   1913  C  CA    . PHE B 1 23   ? 110.081 83.795  149.023 1.00 223.49 ? 23   PHE B CA    1 
ATOM   1914  C  C     . PHE B 1 23   ? 110.476 84.522  147.755 1.00 223.49 ? 23   PHE B C     1 
ATOM   1915  O  O     . PHE B 1 23   ? 109.892 85.555  147.420 1.00 223.49 ? 23   PHE B O     1 
ATOM   1916  C  CB    . PHE B 1 23   ? 108.618 83.359  148.967 1.00 223.49 ? 23   PHE B CB    1 
ATOM   1917  C  CG    . PHE B 1 23   ? 108.162 82.601  150.180 1.00 223.49 ? 23   PHE B CG    1 
ATOM   1918  C  CD1   . PHE B 1 23   ? 108.171 81.220  150.186 1.00 223.49 ? 23   PHE B CD1   1 
ATOM   1919  C  CD2   . PHE B 1 23   ? 107.701 83.264  151.304 1.00 223.49 ? 23   PHE B CD2   1 
ATOM   1920  C  CE1   . PHE B 1 23   ? 107.750 80.512  151.292 1.00 223.49 ? 23   PHE B CE1   1 
ATOM   1921  C  CE2   . PHE B 1 23   ? 107.292 82.565  152.410 1.00 223.49 ? 23   PHE B CE2   1 
ATOM   1922  C  CZ    . PHE B 1 23   ? 107.310 81.184  152.404 1.00 223.49 ? 23   PHE B CZ    1 
ATOM   1923  N  N     . VAL B 1 24   ? 111.473 83.993  147.061 1.00 205.50 ? 24   VAL B N     1 
ATOM   1924  C  CA    . VAL B 1 24   ? 111.977 84.609  145.847 1.00 205.50 ? 24   VAL B CA    1 
ATOM   1925  C  C     . VAL B 1 24   ? 111.795 83.632  144.704 1.00 205.50 ? 24   VAL B C     1 
ATOM   1926  O  O     . VAL B 1 24   ? 112.320 82.516  144.745 1.00 205.50 ? 24   VAL B O     1 
ATOM   1927  C  CB    . VAL B 1 24   ? 113.453 85.019  145.981 1.00 205.50 ? 24   VAL B CB    1 
ATOM   1928  C  CG1   . VAL B 1 24   ? 114.073 85.258  144.613 1.00 205.50 ? 24   VAL B CG1   1 
ATOM   1929  C  CG2   . VAL B 1 24   ? 113.563 86.254  146.829 1.00 205.50 ? 24   VAL B CG2   1 
ATOM   1930  N  N     . LEU B 1 25   ? 111.039 84.047  143.699 1.00 208.69 ? 25   LEU B N     1 
ATOM   1931  C  CA    . LEU B 1 25   ? 110.976 83.345  142.432 1.00 208.69 ? 25   LEU B CA    1 
ATOM   1932  C  C     . LEU B 1 25   ? 111.496 84.282  141.362 1.00 208.69 ? 25   LEU B C     1 
ATOM   1933  O  O     . LEU B 1 25   ? 111.037 85.423  141.267 1.00 208.69 ? 25   LEU B O     1 
ATOM   1934  C  CB    . LEU B 1 25   ? 109.560 82.896  142.098 1.00 208.69 ? 25   LEU B CB    1 
ATOM   1935  C  CG    . LEU B 1 25   ? 109.464 82.223  140.731 1.00 208.69 ? 25   LEU B CG    1 
ATOM   1936  C  CD1   . LEU B 1 25   ? 109.846 80.763  140.806 1.00 208.69 ? 25   LEU B CD1   1 
ATOM   1937  C  CD2   . LEU B 1 25   ? 108.076 82.374  140.160 1.00 208.69 ? 25   LEU B CD2   1 
ATOM   1938  N  N     . GLU B 1 26   ? 112.452 83.800  140.572 1.00 242.51 ? 26   GLU B N     1 
ATOM   1939  C  CA    . GLU B 1 26   ? 113.121 84.551  139.520 1.00 242.51 ? 26   GLU B CA    1 
ATOM   1940  C  C     . GLU B 1 26   ? 113.933 83.556  138.695 1.00 242.51 ? 26   GLU B C     1 
ATOM   1941  O  O     . GLU B 1 26   ? 114.149 82.429  139.159 1.00 242.51 ? 26   GLU B O     1 
ATOM   1942  C  CB    . GLU B 1 26   ? 114.002 85.646  140.123 1.00 242.51 ? 26   GLU B CB    1 
ATOM   1943  C  CG    . GLU B 1 26   ? 115.348 85.181  140.580 1.00 242.51 ? 26   GLU B CG    1 
ATOM   1944  C  CD    . GLU B 1 26   ? 116.339 86.318  140.619 1.00 242.51 ? 26   GLU B CD    1 
ATOM   1945  O  OE1   . GLU B 1 26   ? 116.204 87.240  139.791 1.00 242.51 ? 26   GLU B OE1   1 
ATOM   1946  O  OE2   . GLU B 1 26   ? 117.241 86.302  141.481 1.00 242.51 ? 26   GLU B OE2   1 
ATOM   1947  N  N     . PRO B 1 27   ? 114.374 83.887  137.466 1.00 233.14 ? 27   PRO B N     1 
ATOM   1948  C  CA    . PRO B 1 27   ? 114.185 85.062  136.606 1.00 233.14 ? 27   PRO B CA    1 
ATOM   1949  C  C     . PRO B 1 27   ? 112.778 85.142  136.062 1.00 233.14 ? 27   PRO B C     1 
ATOM   1950  O  O     . PRO B 1 27   ? 112.238 84.159  135.570 1.00 233.14 ? 27   PRO B O     1 
ATOM   1951  C  CB    . PRO B 1 27   ? 115.196 84.846  135.484 1.00 233.14 ? 27   PRO B CB    1 
ATOM   1952  C  CG    . PRO B 1 27   ? 115.401 83.393  135.441 1.00 233.14 ? 27   PRO B CG    1 
ATOM   1953  C  CD    . PRO B 1 27   ? 115.286 82.914  136.846 1.00 233.14 ? 27   PRO B CD    1 
ATOM   1954  N  N     . LEU B 1 28   ? 112.178 86.313  136.182 1.00 256.26 ? 28   LEU B N     1 
ATOM   1955  C  CA    . LEU B 1 28   ? 110.824 86.536  135.710 1.00 256.26 ? 28   LEU B CA    1 
ATOM   1956  C  C     . LEU B 1 28   ? 110.847 87.471  134.517 1.00 256.26 ? 28   LEU B C     1 
ATOM   1957  O  O     . LEU B 1 28   ? 111.639 88.417  134.474 1.00 256.26 ? 28   LEU B O     1 
ATOM   1958  C  CB    . LEU B 1 28   ? 109.955 87.133  136.811 1.00 256.26 ? 28   LEU B CB    1 
ATOM   1959  C  CG    . LEU B 1 28   ? 110.156 86.521  138.191 1.00 256.26 ? 28   LEU B CG    1 
ATOM   1960  C  CD1   . LEU B 1 28   ? 109.373 87.322  139.212 1.00 256.26 ? 28   LEU B CD1   1 
ATOM   1961  C  CD2   . LEU B 1 28   ? 109.711 85.074  138.174 1.00 256.26 ? 28   LEU B CD2   1 
ATOM   1962  N  N     . GLU B 1 29   ? 109.979 87.195  133.552 1.00 240.79 ? 29   GLU B N     1 
ATOM   1963  C  CA    . GLU B 1 29   ? 109.791 88.114  132.444 1.00 240.79 ? 29   GLU B CA    1 
ATOM   1964  C  C     . GLU B 1 29   ? 109.137 89.387  132.962 1.00 240.79 ? 29   GLU B C     1 
ATOM   1965  O  O     . GLU B 1 29   ? 108.312 89.343  133.878 1.00 240.79 ? 29   GLU B O     1 
ATOM   1966  C  CB    . GLU B 1 29   ? 108.937 87.465  131.361 1.00 240.79 ? 29   GLU B CB    1 
ATOM   1967  C  CG    . GLU B 1 29   ? 108.814 88.288  130.106 1.00 240.79 ? 29   GLU B CG    1 
ATOM   1968  C  CD    . GLU B 1 29   ? 110.146 88.881  129.702 1.00 240.79 ? 29   GLU B CD    1 
ATOM   1969  O  OE1   . GLU B 1 29   ? 111.027 88.111  129.270 1.00 240.79 ? 29   GLU B OE1   1 
ATOM   1970  O  OE2   . GLU B 1 29   ? 110.317 90.109  129.831 1.00 240.79 ? 29   GLU B OE2   1 
ATOM   1971  N  N     . ARG B 1 30   ? 109.558 90.528  132.417 1.00 233.15 ? 30   ARG B N     1 
ATOM   1972  C  CA    . ARG B 1 30   ? 109.051 91.807  132.888 1.00 233.15 ? 30   ARG B CA    1 
ATOM   1973  C  C     . ARG B 1 30   ? 107.565 91.951  132.590 1.00 233.15 ? 30   ARG B C     1 
ATOM   1974  O  O     . ARG B 1 30   ? 107.037 91.387  131.627 1.00 233.15 ? 30   ARG B O     1 
ATOM   1975  C  CB    . ARG B 1 30   ? 109.820 92.973  132.272 1.00 233.15 ? 30   ARG B CB    1 
ATOM   1976  C  CG    . ARG B 1 30   ? 109.640 93.122  130.799 1.00 233.15 ? 30   ARG B CG    1 
ATOM   1977  C  CD    . ARG B 1 30   ? 110.238 94.405  130.307 1.00 233.15 ? 30   ARG B CD    1 
ATOM   1978  N  NE    . ARG B 1 30   ? 110.124 94.490  128.862 1.00 233.15 ? 30   ARG B NE    1 
ATOM   1979  C  CZ    . ARG B 1 30   ? 109.041 94.922  128.227 1.00 233.15 ? 30   ARG B CZ    1 
ATOM   1980  N  NH1   . ARG B 1 30   ? 107.975 95.309  128.914 1.00 233.15 ? 30   ARG B NH1   1 
ATOM   1981  N  NH2   . ARG B 1 30   ? 109.027 94.964  126.904 1.00 233.15 ? 30   ARG B NH2   1 
ATOM   1982  N  N     . GLY B 1 31   ? 106.890 92.664  133.465 1.00 225.86 ? 31   GLY B N     1 
ATOM   1983  C  CA    . GLY B 1 31   ? 105.446 92.791  133.423 1.00 225.86 ? 31   GLY B CA    1 
ATOM   1984  C  C     . GLY B 1 31   ? 104.801 91.849  134.397 1.00 225.86 ? 31   GLY B C     1 
ATOM   1985  O  O     . GLY B 1 31   ? 103.820 92.201  135.047 1.00 225.86 ? 31   GLY B O     1 
ATOM   1986  N  N     . PHE B 1 32   ? 105.385 90.661  134.550 1.00 197.05 ? 32   PHE B N     1 
ATOM   1987  C  CA    . PHE B 1 32   ? 104.738 89.592  135.297 1.00 197.05 ? 32   PHE B CA    1 
ATOM   1988  C  C     . PHE B 1 32   ? 104.765 89.838  136.790 1.00 197.05 ? 32   PHE B C     1 
ATOM   1989  O  O     . PHE B 1 32   ? 104.022 89.184  137.524 1.00 197.05 ? 32   PHE B O     1 
ATOM   1990  C  CB    . PHE B 1 32   ? 105.419 88.264  135.005 1.00 197.05 ? 32   PHE B CB    1 
ATOM   1991  C  CG    . PHE B 1 32   ? 105.063 87.687  133.689 1.00 197.05 ? 32   PHE B CG    1 
ATOM   1992  C  CD1   . PHE B 1 32   ? 105.654 88.158  132.535 1.00 197.05 ? 32   PHE B CD1   1 
ATOM   1993  C  CD2   . PHE B 1 32   ? 104.141 86.665  133.601 1.00 197.05 ? 32   PHE B CD2   1 
ATOM   1994  C  CE1   . PHE B 1 32   ? 105.334 87.627  131.316 1.00 197.05 ? 32   PHE B CE1   1 
ATOM   1995  C  CE2   . PHE B 1 32   ? 103.812 86.126  132.382 1.00 197.05 ? 32   PHE B CE2   1 
ATOM   1996  C  CZ    . PHE B 1 32   ? 104.412 86.607  131.237 1.00 197.05 ? 32   PHE B CZ    1 
ATOM   1997  N  N     . GLY B 1 33   ? 105.616 90.756  137.248 1.00 197.48 ? 33   GLY B N     1 
ATOM   1998  C  CA    . GLY B 1 33   ? 105.889 90.968  138.655 1.00 197.48 ? 33   GLY B CA    1 
ATOM   1999  C  C     . GLY B 1 33   ? 104.664 91.286  139.478 1.00 197.48 ? 33   GLY B C     1 
ATOM   2000  O  O     . GLY B 1 33   ? 104.203 90.447  140.252 1.00 197.48 ? 33   GLY B O     1 
ATOM   2001  N  N     . VAL B 1 34   ? 104.068 92.454  139.252 1.00 229.56 ? 34   VAL B N     1 
ATOM   2002  C  CA    . VAL B 1 34   ? 102.849 92.772  139.980 1.00 229.56 ? 34   VAL B CA    1 
ATOM   2003  C  C     . VAL B 1 34   ? 101.677 91.994  139.414 1.00 229.56 ? 34   VAL B C     1 
ATOM   2004  O  O     . VAL B 1 34   ? 100.688 91.768  140.122 1.00 229.56 ? 34   VAL B O     1 
ATOM   2005  C  CB    . VAL B 1 34   ? 102.593 94.290  139.978 1.00 229.56 ? 34   VAL B CB    1 
ATOM   2006  C  CG1   . VAL B 1 34   ? 103.873 95.034  140.304 1.00 229.56 ? 34   VAL B CG1   1 
ATOM   2007  C  CG2   . VAL B 1 34   ? 102.005 94.765  138.654 1.00 229.56 ? 34   VAL B CG2   1 
ATOM   2008  N  N     . THR B 1 35   ? 101.805 91.512  138.169 1.00 208.94 ? 35   THR B N     1 
ATOM   2009  C  CA    . THR B 1 35   ? 100.771 90.727  137.513 1.00 208.94 ? 35   THR B CA    1 
ATOM   2010  C  C     . THR B 1 35   ? 100.514 89.438  138.257 1.00 208.94 ? 35   THR B C     1 
ATOM   2011  O  O     . THR B 1 35   ? 99.387  88.938  138.262 1.00 208.94 ? 35   THR B O     1 
ATOM   2012  C  CB    . THR B 1 35   ? 101.200 90.399  136.090 1.00 208.94 ? 35   THR B CB    1 
ATOM   2013  O  OG1   . THR B 1 35   ? 101.719 91.575  135.482 1.00 208.94 ? 35   THR B OG1   1 
ATOM   2014  C  CG2   . THR B 1 35   ? 100.024 89.956  135.263 1.00 208.94 ? 35   THR B CG2   1 
ATOM   2015  N  N     . LEU B 1 36   ? 101.532 88.910  138.910 1.00 220.82 ? 36   LEU B N     1 
ATOM   2016  C  CA    . LEU B 1 36   ? 101.359 87.812  139.836 1.00 220.82 ? 36   LEU B CA    1 
ATOM   2017  C  C     . LEU B 1 36   ? 101.311 88.272  141.280 1.00 220.82 ? 36   LEU B C     1 
ATOM   2018  O  O     . LEU B 1 36   ? 100.719 87.591  142.116 1.00 220.82 ? 36   LEU B O     1 
ATOM   2019  C  CB    . LEU B 1 36   ? 102.486 86.797  139.648 1.00 220.82 ? 36   LEU B CB    1 
ATOM   2020  C  CG    . LEU B 1 36   ? 102.668 86.331  138.202 1.00 220.82 ? 36   LEU B CG    1 
ATOM   2021  C  CD1   . LEU B 1 36   ? 103.743 85.274  138.119 1.00 220.82 ? 36   LEU B CD1   1 
ATOM   2022  C  CD2   . LEU B 1 36   ? 101.375 85.823  137.592 1.00 220.82 ? 36   LEU B CD2   1 
ATOM   2023  N  N     . GLY B 1 37   ? 101.875 89.439  141.585 1.00 222.97 ? 37   GLY B N     1 
ATOM   2024  C  CA    . GLY B 1 37   ? 101.918 89.925  142.946 1.00 222.97 ? 37   GLY B CA    1 
ATOM   2025  C  C     . GLY B 1 37   ? 100.574 90.301  143.523 1.00 222.97 ? 37   GLY B C     1 
ATOM   2026  O  O     . GLY B 1 37   ? 100.148 89.712  144.520 1.00 222.97 ? 37   GLY B O     1 
ATOM   2027  N  N     . ASN B 1 38   ? 99.919  91.281  142.896 1.00 225.93 ? 38   ASN B N     1 
ATOM   2028  C  CA    . ASN B 1 38   ? 98.587  91.732  143.307 1.00 225.93 ? 38   ASN B CA    1 
ATOM   2029  C  C     . ASN B 1 38   ? 97.540  90.633  143.467 1.00 225.93 ? 38   ASN B C     1 
ATOM   2030  O  O     . ASN B 1 38   ? 96.785  90.696  144.453 1.00 225.93 ? 38   ASN B O     1 
ATOM   2031  C  CB    . ASN B 1 38   ? 98.055  92.780  142.320 1.00 225.93 ? 38   ASN B CB    1 
ATOM   2032  C  CG    . ASN B 1 38   ? 99.100  93.758  141.895 1.00 225.93 ? 38   ASN B CG    1 
ATOM   2033  O  OD1   . ASN B 1 38   ? 99.725  94.416  142.718 1.00 225.93 ? 38   ASN B OD1   1 
ATOM   2034  N  ND2   . ASN B 1 38   ? 99.303  93.862  140.592 1.00 225.93 ? 38   ASN B ND2   1 
ATOM   2035  N  N     . PRO B 1 39   ? 97.406  89.608  142.542 1.00 223.18 ? 39   PRO B N     1 
ATOM   2036  C  CA    . PRO B 1 39   ? 96.392  88.575  142.777 1.00 223.18 ? 39   PRO B CA    1 
ATOM   2037  C  C     . PRO B 1 39   ? 96.659  87.792  144.033 1.00 223.18 ? 39   PRO B C     1 
ATOM   2038  O  O     . PRO B 1 39   ? 95.773  87.645  144.877 1.00 223.18 ? 39   PRO B O     1 
ATOM   2039  C  CB    . PRO B 1 39   ? 96.517  87.662  141.555 1.00 223.18 ? 39   PRO B CB    1 
ATOM   2040  C  CG    . PRO B 1 39   ? 97.120  88.445  140.567 1.00 223.18 ? 39   PRO B CG    1 
ATOM   2041  C  CD    . PRO B 1 39   ? 98.032  89.377  141.225 1.00 223.18 ? 39   PRO B CD    1 
ATOM   2042  N  N     . LEU B 1 40   ? 97.901  87.333  144.161 1.00 234.94 ? 40   LEU B N     1 
ATOM   2043  C  CA    . LEU B 1 40   ? 98.283  86.570  145.336 1.00 234.94 ? 40   LEU B CA    1 
ATOM   2044  C  C     . LEU B 1 40   ? 98.205  87.424  146.582 1.00 234.94 ? 40   LEU B C     1 
ATOM   2045  O  O     . LEU B 1 40   ? 97.822  86.922  147.644 1.00 234.94 ? 40   LEU B O     1 
ATOM   2046  C  CB    . LEU B 1 40   ? 99.689  86.003  145.170 1.00 234.94 ? 40   LEU B CB    1 
ATOM   2047  C  CG    . LEU B 1 40   ? 99.865  84.650  144.467 1.00 234.94 ? 40   LEU B CG    1 
ATOM   2048  C  CD1   . LEU B 1 40   ? 99.098  83.557  145.187 1.00 234.94 ? 40   LEU B CD1   1 
ATOM   2049  C  CD2   . LEU B 1 40   ? 99.504  84.674  142.994 1.00 234.94 ? 40   LEU B CD2   1 
ATOM   2050  N  N     . ARG B 1 41   ? 98.502  88.718  146.446 1.00 218.06 ? 41   ARG B N     1 
ATOM   2051  C  CA    . ARG B 1 41   ? 98.366  89.652  147.554 1.00 218.06 ? 41   ARG B CA    1 
ATOM   2052  C  C     . ARG B 1 41   ? 96.944  89.676  148.079 1.00 218.06 ? 41   ARG B C     1 
ATOM   2053  O  O     . ARG B 1 41   ? 96.703  89.344  149.240 1.00 218.06 ? 41   ARG B O     1 
ATOM   2054  C  CB    . ARG B 1 41   ? 98.779  91.051  147.121 1.00 218.06 ? 41   ARG B CB    1 
ATOM   2055  C  CG    . ARG B 1 41   ? 98.792  92.005  148.269 1.00 218.06 ? 41   ARG B CG    1 
ATOM   2056  C  CD    . ARG B 1 41   ? 98.787  93.439  147.806 1.00 218.06 ? 41   ARG B CD    1 
ATOM   2057  N  NE    . ARG B 1 41   ? 99.762  94.216  148.560 1.00 218.06 ? 41   ARG B NE    1 
ATOM   2058  C  CZ    . ARG B 1 41   ? 99.544  94.728  149.766 1.00 218.06 ? 41   ARG B CZ    1 
ATOM   2059  N  NH1   . ARG B 1 41   ? 98.375  94.561  150.367 1.00 218.06 ? 41   ARG B NH1   1 
ATOM   2060  N  NH2   . ARG B 1 41   ? 100.501 95.413  150.372 1.00 218.06 ? 41   ARG B NH2   1 
ATOM   2061  N  N     . ARG B 1 42   ? 95.983  89.978  147.204 1.00 223.14 ? 42   ARG B N     1 
ATOM   2062  C  CA    . ARG B 1 42   ? 94.593  90.086  147.634 1.00 223.14 ? 42   ARG B CA    1 
ATOM   2063  C  C     . ARG B 1 42   ? 94.025  88.736  148.051 1.00 223.14 ? 42   ARG B C     1 
ATOM   2064  O  O     . ARG B 1 42   ? 93.115  88.670  148.886 1.00 223.14 ? 42   ARG B O     1 
ATOM   2065  C  CB    . ARG B 1 42   ? 93.753  90.692  146.518 1.00 223.14 ? 42   ARG B CB    1 
ATOM   2066  C  CG    . ARG B 1 42   ? 94.115  92.118  146.200 1.00 223.14 ? 42   ARG B CG    1 
ATOM   2067  C  CD    . ARG B 1 42   ? 93.651  92.490  144.808 1.00 223.14 ? 42   ARG B CD    1 
ATOM   2068  N  NE    . ARG B 1 42   ? 92.212  92.313  144.640 1.00 223.14 ? 42   ARG B NE    1 
ATOM   2069  C  CZ    . ARG B 1 42   ? 91.307  93.247  144.915 1.00 223.14 ? 42   ARG B CZ    1 
ATOM   2070  N  NH1   . ARG B 1 42   ? 91.687  94.430  145.375 1.00 223.14 ? 42   ARG B NH1   1 
ATOM   2071  N  NH2   . ARG B 1 42   ? 90.020  92.994  144.726 1.00 223.14 ? 42   ARG B NH2   1 
ATOM   2072  N  N     . ILE B 1 43   ? 94.567  87.648  147.500 1.00 233.45 ? 43   ILE B N     1 
ATOM   2073  C  CA    . ILE B 1 43   ? 94.106  86.315  147.874 1.00 233.45 ? 43   ILE B CA    1 
ATOM   2074  C  C     . ILE B 1 43   ? 94.488  86.020  149.316 1.00 233.45 ? 43   ILE B C     1 
ATOM   2075  O  O     . ILE B 1 43   ? 93.661  85.576  150.124 1.00 233.45 ? 43   ILE B O     1 
ATOM   2076  C  CB    . ILE B 1 43   ? 94.672  85.260  146.910 1.00 233.45 ? 43   ILE B CB    1 
ATOM   2077  C  CG1   . ILE B 1 43   ? 93.830  85.200  145.642 1.00 233.45 ? 43   ILE B CG1   1 
ATOM   2078  C  CG2   . ILE B 1 43   ? 94.653  83.891  147.531 1.00 233.45 ? 43   ILE B CG2   1 
ATOM   2079  C  CD1   . ILE B 1 43   ? 94.522  84.496  144.504 1.00 233.45 ? 43   ILE B CD1   1 
ATOM   2080  N  N     . LEU B 1 44   ? 95.739  86.316  149.673 1.00 223.46 ? 44   LEU B N     1 
ATOM   2081  C  CA    . LEU B 1 44   ? 96.124  86.178  151.071 1.00 223.46 ? 44   LEU B CA    1 
ATOM   2082  C  C     . LEU B 1 44   ? 95.456  87.222  151.944 1.00 223.46 ? 44   LEU B C     1 
ATOM   2083  O  O     . LEU B 1 44   ? 95.291  87.005  153.147 1.00 223.46 ? 44   LEU B O     1 
ATOM   2084  C  CB    . LEU B 1 44   ? 97.637  86.239  151.227 1.00 223.46 ? 44   LEU B CB    1 
ATOM   2085  C  CG    . LEU B 1 44   ? 98.429  85.297  150.325 1.00 223.46 ? 44   LEU B CG    1 
ATOM   2086  C  CD1   . LEU B 1 44   ? 99.910  85.410  150.599 1.00 223.46 ? 44   LEU B CD1   1 
ATOM   2087  C  CD2   . LEU B 1 44   ? 97.970  83.868  150.494 1.00 223.46 ? 44   LEU B CD2   1 
ATOM   2088  N  N     . LEU B 1 45   ? 95.043  88.343  151.360 1.00 225.47 ? 45   LEU B N     1 
ATOM   2089  C  CA    . LEU B 1 45   ? 94.237  89.289  152.116 1.00 225.47 ? 45   LEU B CA    1 
ATOM   2090  C  C     . LEU B 1 45   ? 92.862  88.722  152.430 1.00 225.47 ? 45   LEU B C     1 
ATOM   2091  O  O     . LEU B 1 45   ? 92.257  89.092  153.440 1.00 225.47 ? 45   LEU B O     1 
ATOM   2092  C  CB    . LEU B 1 45   ? 94.081  90.597  151.348 1.00 225.47 ? 45   LEU B CB    1 
ATOM   2093  C  CG    . LEU B 1 45   ? 95.289  91.503  151.108 1.00 225.47 ? 45   LEU B CG    1 
ATOM   2094  C  CD1   . LEU B 1 45   ? 94.850  92.912  150.744 1.00 225.47 ? 45   LEU B CD1   1 
ATOM   2095  C  CD2   . LEU B 1 45   ? 96.269  91.489  152.274 1.00 225.47 ? 45   LEU B CD2   1 
ATOM   2096  N  N     . SER B 1 46   ? 92.354  87.826  151.589 1.00 237.80 ? 46   SER B N     1 
ATOM   2097  C  CA    . SER B 1 46   ? 90.940  87.479  151.640 1.00 237.80 ? 46   SER B CA    1 
ATOM   2098  C  C     . SER B 1 46   ? 90.671  86.033  152.023 1.00 237.80 ? 46   SER B C     1 
ATOM   2099  O  O     . SER B 1 46   ? 90.040  85.776  153.053 1.00 237.80 ? 46   SER B O     1 
ATOM   2100  C  CB    . SER B 1 46   ? 90.325  87.772  150.272 1.00 237.80 ? 46   SER B CB    1 
ATOM   2101  O  OG    . SER B 1 46   ? 91.199  87.319  149.254 1.00 237.80 ? 46   SER B OG    1 
ATOM   2102  N  N     . SER B 1 47   ? 91.149  85.077  151.236 1.00 211.80 ? 47   SER B N     1 
ATOM   2103  C  CA    . SER B 1 47   ? 90.516  83.771  151.141 1.00 211.80 ? 47   SER B CA    1 
ATOM   2104  C  C     . SER B 1 47   ? 91.212  82.719  151.980 1.00 211.80 ? 47   SER B C     1 
ATOM   2105  O  O     . SER B 1 47   ? 91.361  81.576  151.543 1.00 211.80 ? 47   SER B O     1 
ATOM   2106  C  CB    . SER B 1 47   ? 90.476  83.334  149.682 1.00 211.80 ? 47   SER B CB    1 
ATOM   2107  O  OG    . SER B 1 47   ? 91.719  83.613  149.068 1.00 211.80 ? 47   SER B OG    1 
ATOM   2108  N  N     . ILE B 1 48   ? 91.651  83.076  153.179 1.00 207.35 ? 48   ILE B N     1 
ATOM   2109  C  CA    . ILE B 1 48   ? 92.530  82.212  153.957 1.00 207.35 ? 48   ILE B CA    1 
ATOM   2110  C  C     . ILE B 1 48   ? 91.713  81.618  155.099 1.00 207.35 ? 48   ILE B C     1 
ATOM   2111  O  O     . ILE B 1 48   ? 91.236  82.371  155.962 1.00 207.35 ? 48   ILE B O     1 
ATOM   2112  C  CB    . ILE B 1 48   ? 93.753  82.972  154.471 1.00 207.35 ? 48   ILE B CB    1 
ATOM   2113  C  CG1   . ILE B 1 48   ? 94.370  83.764  153.323 1.00 207.35 ? 48   ILE B CG1   1 
ATOM   2114  C  CG2   . ILE B 1 48   ? 94.756  82.003  155.047 1.00 207.35 ? 48   ILE B CG2   1 
ATOM   2115  C  CD1   . ILE B 1 48   ? 94.797  82.889  152.154 1.00 207.35 ? 48   ILE B CD1   1 
ATOM   2116  N  N     . PRO B 1 49   ? 91.537  80.301  155.150 1.00 209.31 ? 49   PRO B N     1 
ATOM   2117  C  CA    . PRO B 1 49   ? 90.662  79.693  156.159 1.00 209.31 ? 49   PRO B CA    1 
ATOM   2118  C  C     . PRO B 1 49   ? 91.283  79.769  157.541 1.00 209.31 ? 49   PRO B C     1 
ATOM   2119  O  O     . PRO B 1 49   ? 92.306  79.143  157.815 1.00 209.31 ? 49   PRO B O     1 
ATOM   2120  C  CB    . PRO B 1 49   ? 90.528  78.244  155.679 1.00 209.31 ? 49   PRO B CB    1 
ATOM   2121  C  CG    . PRO B 1 49   ? 91.075  78.232  154.283 1.00 209.31 ? 49   PRO B CG    1 
ATOM   2122  C  CD    . PRO B 1 49   ? 92.101  79.298  154.240 1.00 209.31 ? 49   PRO B CD    1 
ATOM   2123  N  N     . GLY B 1 50   ? 90.655  80.549  158.417 1.00 240.60 ? 50   GLY B N     1 
ATOM   2124  C  CA    . GLY B 1 50   ? 91.208  80.789  159.731 1.00 240.60 ? 50   GLY B CA    1 
ATOM   2125  C  C     . GLY B 1 50   ? 90.131  80.865  160.794 1.00 240.60 ? 50   GLY B C     1 
ATOM   2126  O  O     . GLY B 1 50   ? 88.943  80.720  160.518 1.00 240.60 ? 50   GLY B O     1 
ATOM   2127  N  N     . THR B 1 51   ? 90.576  81.095  162.018 1.00 258.51 ? 51   THR B N     1 
ATOM   2128  C  CA    . THR B 1 51   ? 89.694  81.071  163.168 1.00 258.51 ? 51   THR B CA    1 
ATOM   2129  C  C     . THR B 1 51   ? 89.643  82.438  163.821 1.00 258.51 ? 51   THR B C     1 
ATOM   2130  O  O     . THR B 1 51   ? 90.597  83.217  163.758 1.00 258.51 ? 51   THR B O     1 
ATOM   2131  C  CB    . THR B 1 51   ? 90.152  80.051  164.204 1.00 258.51 ? 51   THR B CB    1 
ATOM   2132  O  OG1   . THR B 1 51   ? 91.421  80.459  164.724 1.00 258.51 ? 51   THR B OG1   1 
ATOM   2133  C  CG2   . THR B 1 51   ? 90.280  78.677  163.578 1.00 258.51 ? 51   THR B CG2   1 
ATOM   2134  N  N     . ALA B 1 52   ? 88.524  82.706  164.485 1.00 249.52 ? 52   ALA B N     1 
ATOM   2135  C  CA    . ALA B 1 52   ? 88.381  83.963  165.200 1.00 249.52 ? 52   ALA B CA    1 
ATOM   2136  C  C     . ALA B 1 52   ? 87.412  83.808  166.353 1.00 249.52 ? 52   ALA B C     1 
ATOM   2137  O  O     . ALA B 1 52   ? 86.358  83.182  166.206 1.00 249.52 ? 52   ALA B O     1 
ATOM   2138  C  CB    . ALA B 1 52   ? 87.887  85.071  164.287 1.00 249.52 ? 52   ALA B CB    1 
ATOM   2139  N  N     . VAL B 1 53   ? 87.786  84.386  167.493 1.00 243.22 ? 53   VAL B N     1 
ATOM   2140  C  CA    . VAL B 1 53   ? 86.837  84.651  168.558 1.00 243.22 ? 53   VAL B CA    1 
ATOM   2141  C  C     . VAL B 1 53   ? 85.739  85.564  168.034 1.00 243.22 ? 53   VAL B C     1 
ATOM   2142  O  O     . VAL B 1 53   ? 85.998  86.558  167.345 1.00 243.22 ? 53   VAL B O     1 
ATOM   2143  C  CB    . VAL B 1 53   ? 87.579  85.236  169.770 1.00 243.22 ? 53   VAL B CB    1 
ATOM   2144  C  CG1   . VAL B 1 53   ? 88.459  86.385  169.356 1.00 243.22 ? 53   VAL B CG1   1 
ATOM   2145  C  CG2   . VAL B 1 53   ? 86.610  85.728  170.781 1.00 243.22 ? 53   VAL B CG2   1 
ATOM   2146  N  N     . THR B 1 54   ? 84.501  85.196  168.298 1.00 255.60 ? 54   THR B N     1 
ATOM   2147  C  CA    . THR B 1 54   ? 83.394  85.890  167.666 1.00 255.60 ? 54   THR B CA    1 
ATOM   2148  C  C     . THR B 1 54   ? 82.469  86.579  168.646 1.00 255.60 ? 54   THR B C     1 
ATOM   2149  O  O     . THR B 1 54   ? 82.071  87.715  168.402 1.00 255.60 ? 54   THR B O     1 
ATOM   2150  C  CB    . THR B 1 54   ? 82.607  84.904  166.818 1.00 255.60 ? 54   THR B CB    1 
ATOM   2151  O  OG1   . THR B 1 54   ? 82.422  83.696  167.564 1.00 255.60 ? 54   THR B OG1   1 
ATOM   2152  C  CG2   . THR B 1 54   ? 83.380  84.595  165.554 1.00 255.60 ? 54   THR B CG2   1 
ATOM   2153  N  N     . SER B 1 55   ? 82.108  85.924  169.743 1.00 240.58 ? 55   SER B N     1 
ATOM   2154  C  CA    . SER B 1 55   ? 81.320  86.563  170.784 1.00 240.58 ? 55   SER B CA    1 
ATOM   2155  C  C     . SER B 1 55   ? 81.796  86.094  172.146 1.00 240.58 ? 55   SER B C     1 
ATOM   2156  O  O     . SER B 1 55   ? 82.202  84.944  172.324 1.00 240.58 ? 55   SER B O     1 
ATOM   2157  C  CB    . SER B 1 55   ? 79.824  86.304  170.624 1.00 240.58 ? 55   SER B CB    1 
ATOM   2158  O  OG    . SER B 1 55   ? 79.317  87.030  169.523 1.00 240.58 ? 55   SER B OG    1 
ATOM   2159  N  N     . VAL B 1 56   ? 81.777  87.015  173.102 1.00 239.41 ? 56   VAL B N     1 
ATOM   2160  C  CA    . VAL B 1 56   ? 82.360  86.782  174.417 1.00 239.41 ? 56   VAL B CA    1 
ATOM   2161  C  C     . VAL B 1 56   ? 81.387  87.269  175.476 1.00 239.41 ? 56   VAL B C     1 
ATOM   2162  O  O     . VAL B 1 56   ? 80.995  88.440  175.470 1.00 239.41 ? 56   VAL B O     1 
ATOM   2163  C  CB    . VAL B 1 56   ? 83.713  87.499  174.580 1.00 239.41 ? 56   VAL B CB    1 
ATOM   2164  C  CG1   . VAL B 1 56   ? 84.181  87.420  176.005 1.00 239.41 ? 56   VAL B CG1   1 
ATOM   2165  C  CG2   . VAL B 1 56   ? 84.751  86.887  173.696 1.00 239.41 ? 56   VAL B CG2   1 
ATOM   2166  N  N     . TYR B 1 57   ? 81.011  86.384  176.395 1.00 251.65 ? 57   TYR B N     1 
ATOM   2167  C  CA    . TYR B 1 57   ? 80.174  86.749  177.528 1.00 251.65 ? 57   TYR B CA    1 
ATOM   2168  C  C     . TYR B 1 57   ? 80.961  86.561  178.814 1.00 251.65 ? 57   TYR B C     1 
ATOM   2169  O  O     . TYR B 1 57   ? 81.318  85.437  179.166 1.00 251.65 ? 57   TYR B O     1 
ATOM   2170  C  CB    . TYR B 1 57   ? 78.892  85.920  177.569 1.00 251.65 ? 57   TYR B CB    1 
ATOM   2171  C  CG    . TYR B 1 57   ? 78.050  86.216  178.783 1.00 251.65 ? 57   TYR B CG    1 
ATOM   2172  C  CD1   . TYR B 1 57   ? 77.574  87.494  179.016 1.00 251.65 ? 57   TYR B CD1   1 
ATOM   2173  C  CD2   . TYR B 1 57   ? 77.729  85.221  179.692 1.00 251.65 ? 57   TYR B CD2   1 
ATOM   2174  C  CE1   . TYR B 1 57   ? 76.804  87.781  180.125 1.00 251.65 ? 57   TYR B CE1   1 
ATOM   2175  C  CE2   . TYR B 1 57   ? 76.954  85.490  180.805 1.00 251.65 ? 57   TYR B CE2   1 
ATOM   2176  C  CZ    . TYR B 1 57   ? 76.497  86.774  181.017 1.00 251.65 ? 57   TYR B CZ    1 
ATOM   2177  O  OH    . TYR B 1 57   ? 75.728  87.050  182.123 1.00 251.65 ? 57   TYR B OH    1 
ATOM   2178  N  N     . ILE B 1 58   ? 81.201  87.656  179.527 1.00 250.14 ? 58   ILE B N     1 
ATOM   2179  C  CA    . ILE B 1 58   ? 81.859  87.620  180.829 1.00 250.14 ? 58   ILE B CA    1 
ATOM   2180  C  C     . ILE B 1 58   ? 80.811  87.208  181.859 1.00 250.14 ? 58   ILE B C     1 
ATOM   2181  O  O     . ILE B 1 58   ? 79.637  87.040  181.515 1.00 250.14 ? 58   ILE B O     1 
ATOM   2182  C  CB    . ILE B 1 58   ? 82.498  88.982  181.169 1.00 250.14 ? 58   ILE B CB    1 
ATOM   2183  C  CG1   . ILE B 1 58   ? 82.977  89.681  179.895 1.00 250.14 ? 58   ILE B CG1   1 
ATOM   2184  C  CG2   . ILE B 1 58   ? 83.721  88.832  182.094 1.00 250.14 ? 58   ILE B CG2   1 
ATOM   2185  C  CD1   . ILE B 1 58   ? 84.223  89.081  179.264 1.00 250.14 ? 58   ILE B CD1   1 
ATOM   2186  N  N     . GLU B 1 59   ? 81.253  87.001  183.106 1.00 273.64 ? 59   GLU B N     1 
ATOM   2187  C  CA    . GLU B 1 59   ? 80.461  86.608  184.269 1.00 273.64 ? 59   GLU B CA    1 
ATOM   2188  C  C     . GLU B 1 59   ? 79.122  87.325  184.398 1.00 273.64 ? 59   GLU B C     1 
ATOM   2189  O  O     . GLU B 1 59   ? 78.060  86.696  184.361 1.00 273.64 ? 59   GLU B O     1 
ATOM   2190  C  CB    . GLU B 1 59   ? 81.323  86.878  185.506 1.00 273.64 ? 59   GLU B CB    1 
ATOM   2191  C  CG    . GLU B 1 59   ? 81.085  85.995  186.699 1.00 273.64 ? 59   GLU B CG    1 
ATOM   2192  C  CD    . GLU B 1 59   ? 82.177  86.164  187.744 1.00 273.64 ? 59   GLU B CD    1 
ATOM   2193  O  OE1   . GLU B 1 59   ? 82.679  87.298  187.899 1.00 273.64 ? 59   GLU B OE1   1 
ATOM   2194  O  OE2   . GLU B 1 59   ? 82.544  85.165  188.398 1.00 273.64 ? 59   GLU B OE2   1 
ATOM   2195  N  N     . ASP B 1 60   ? 79.153  88.643  184.540 1.00 278.32 ? 60   ASP B N     1 
ATOM   2196  C  CA    . ASP B 1 60   ? 77.928  89.428  184.599 1.00 278.32 ? 60   ASP B CA    1 
ATOM   2197  C  C     . ASP B 1 60   ? 78.104  90.750  183.876 1.00 278.32 ? 60   ASP B C     1 
ATOM   2198  O  O     . ASP B 1 60   ? 77.765  91.814  184.404 1.00 278.32 ? 60   ASP B O     1 
ATOM   2199  C  CB    . ASP B 1 60   ? 77.478  89.647  186.040 1.00 278.32 ? 60   ASP B CB    1 
ATOM   2200  C  CG    . ASP B 1 60   ? 76.542  88.560  186.519 1.00 278.32 ? 60   ASP B CG    1 
ATOM   2201  O  OD1   . ASP B 1 60   ? 75.660  88.155  185.735 1.00 278.32 ? 60   ASP B OD1   1 
ATOM   2202  O  OD2   . ASP B 1 60   ? 76.689  88.107  187.672 1.00 278.32 ? 60   ASP B OD2   1 
ATOM   2203  N  N     . VAL B 1 61   ? 78.669  90.702  182.668 1.00 271.90 ? 61   VAL B N     1 
ATOM   2204  C  CA    . VAL B 1 61   ? 78.891  91.924  181.909 1.00 271.90 ? 61   VAL B CA    1 
ATOM   2205  C  C     . VAL B 1 61   ? 77.552  92.479  181.434 1.00 271.90 ? 61   VAL B C     1 
ATOM   2206  O  O     . VAL B 1 61   ? 76.627  91.734  181.086 1.00 271.90 ? 61   VAL B O     1 
ATOM   2207  C  CB    . VAL B 1 61   ? 79.870  91.650  180.752 1.00 271.90 ? 61   VAL B CB    1 
ATOM   2208  C  CG1   . VAL B 1 61   ? 79.356  90.552  179.825 1.00 271.90 ? 61   VAL B CG1   1 
ATOM   2209  C  CG2   . VAL B 1 61   ? 80.220  92.924  179.985 1.00 271.90 ? 61   VAL B CG2   1 
ATOM   2210  N  N     . LEU B 1 62   ? 77.420  93.802  181.491 1.00 262.35 ? 62   LEU B N     1 
ATOM   2211  C  CA    . LEU B 1 62   ? 76.166  94.465  181.171 1.00 262.35 ? 62   LEU B CA    1 
ATOM   2212  C  C     . LEU B 1 62   ? 76.144  95.012  179.753 1.00 262.35 ? 62   LEU B C     1 
ATOM   2213  O  O     . LEU B 1 62   ? 75.167  94.813  179.028 1.00 262.35 ? 62   LEU B O     1 
ATOM   2214  C  CB    . LEU B 1 62   ? 75.913  95.594  182.170 1.00 262.35 ? 62   LEU B CB    1 
ATOM   2215  C  CG    . LEU B 1 62   ? 76.093  95.187  183.630 1.00 262.35 ? 62   LEU B CG    1 
ATOM   2216  C  CD1   . LEU B 1 62   ? 75.841  96.375  184.530 1.00 262.35 ? 62   LEU B CD1   1 
ATOM   2217  C  CD2   . LEU B 1 62   ? 75.173  94.032  183.994 1.00 262.35 ? 62   LEU B CD2   1 
ATOM   2218  N  N     . HIS B 1 63   ? 77.206  95.696  179.339 1.00 281.72 ? 63   HIS B N     1 
ATOM   2219  C  CA    . HIS B 1 63   ? 77.278  96.243  177.997 1.00 281.72 ? 63   HIS B CA    1 
ATOM   2220  C  C     . HIS B 1 63   ? 78.718  96.186  177.518 1.00 281.72 ? 63   HIS B C     1 
ATOM   2221  O  O     . HIS B 1 63   ? 79.598  95.636  178.188 1.00 281.72 ? 63   HIS B O     1 
ATOM   2222  C  CB    . HIS B 1 63   ? 76.724  97.670  177.945 1.00 281.72 ? 63   HIS B CB    1 
ATOM   2223  C  CG    . HIS B 1 63   ? 77.647  98.703  178.510 1.00 281.72 ? 63   HIS B CG    1 
ATOM   2224  N  ND1   . HIS B 1 63   ? 78.137  99.749  177.759 1.00 281.72 ? 63   HIS B ND1   1 
ATOM   2225  C  CD2   . HIS B 1 63   ? 78.160  98.858  179.752 1.00 281.72 ? 63   HIS B CD2   1 
ATOM   2226  C  CE1   . HIS B 1 63   ? 78.912  100.505 178.515 1.00 281.72 ? 63   HIS B CE1   1 
ATOM   2227  N  NE2   . HIS B 1 63   ? 78.946  99.984  179.728 1.00 281.72 ? 63   HIS B NE2   1 
ATOM   2228  N  N     . GLU B 1 64   ? 78.943  96.777  176.343 1.00 287.25 ? 64   GLU B N     1 
ATOM   2229  C  CA    . GLU B 1 64   ? 80.210  96.639  175.637 1.00 287.25 ? 64   GLU B CA    1 
ATOM   2230  C  C     . GLU B 1 64   ? 81.346  97.321  176.388 1.00 287.25 ? 64   GLU B C     1 
ATOM   2231  O  O     . GLU B 1 64   ? 82.444  96.769  176.520 1.00 287.25 ? 64   GLU B O     1 
ATOM   2232  C  CB    . GLU B 1 64   ? 80.065  97.216  174.231 1.00 287.25 ? 64   GLU B CB    1 
ATOM   2233  C  CG    . GLU B 1 64   ? 81.347  97.250  173.437 1.00 287.25 ? 64   GLU B CG    1 
ATOM   2234  C  CD    . GLU B 1 64   ? 81.169  97.907  172.088 1.00 287.25 ? 64   GLU B CD    1 
ATOM   2235  O  OE1   . GLU B 1 64   ? 80.032  98.315  171.772 1.00 287.25 ? 64   GLU B OE1   1 
ATOM   2236  O  OE2   . GLU B 1 64   ? 82.167  98.032  171.346 1.00 287.25 ? 64   GLU B OE2   1 
ATOM   2237  N  N     . PHE B 1 65   ? 81.093  98.516  176.910 1.00 290.75 ? 65   PHE B N     1 
ATOM   2238  C  CA    . PHE B 1 65   ? 82.120  99.296  177.582 1.00 290.75 ? 65   PHE B CA    1 
ATOM   2239  C  C     . PHE B 1 65   ? 81.971  99.260  179.093 1.00 290.75 ? 65   PHE B C     1 
ATOM   2240  O  O     . PHE B 1 65   ? 82.157  100.281 179.761 1.00 290.75 ? 65   PHE B O     1 
ATOM   2241  C  CB    . PHE B 1 65   ? 82.101  100.730 177.069 1.00 290.75 ? 65   PHE B CB    1 
ATOM   2242  C  CG    . PHE B 1 65   ? 82.203  100.823 175.586 1.00 290.75 ? 65   PHE B CG    1 
ATOM   2243  C  CD1   . PHE B 1 65   ? 83.424  100.647 174.956 1.00 290.75 ? 65   PHE B CD1   1 
ATOM   2244  C  CD2   . PHE B 1 65   ? 81.078  101.057 174.815 1.00 290.75 ? 65   PHE B CD2   1 
ATOM   2245  C  CE1   . PHE B 1 65   ? 83.527  100.725 173.584 1.00 290.75 ? 65   PHE B CE1   1 
ATOM   2246  C  CE2   . PHE B 1 65   ? 81.173  101.134 173.441 1.00 290.75 ? 65   PHE B CE2   1 
ATOM   2247  C  CZ    . PHE B 1 65   ? 82.401  100.970 172.826 1.00 290.75 ? 65   PHE B CZ    1 
ATOM   2248  N  N     . SER B 1 66   ? 81.602  98.105  179.637 1.00 287.08 ? 66   SER B N     1 
ATOM   2249  C  CA    . SER B 1 66   ? 81.528  97.934  181.076 1.00 287.08 ? 66   SER B CA    1 
ATOM   2250  C  C     . SER B 1 66   ? 82.930  97.994  181.686 1.00 287.08 ? 66   SER B C     1 
ATOM   2251  O  O     . SER B 1 66   ? 83.945  97.829  181.009 1.00 287.08 ? 66   SER B O     1 
ATOM   2252  C  CB    . SER B 1 66   ? 80.865  96.601  181.414 1.00 287.08 ? 66   SER B CB    1 
ATOM   2253  O  OG    . SER B 1 66   ? 79.770  96.338  180.554 1.00 287.08 ? 66   SER B OG    1 
ATOM   2254  N  N     . THR B 1 67   ? 82.982  98.264  182.984 1.00 281.29 ? 67   THR B N     1 
ATOM   2255  C  CA    . THR B 1 67   ? 84.230  98.213  183.728 1.00 281.29 ? 67   THR B CA    1 
ATOM   2256  C  C     . THR B 1 67   ? 84.060  97.247  184.886 1.00 281.29 ? 67   THR B C     1 
ATOM   2257  O  O     . THR B 1 67   ? 83.012  97.213  185.533 1.00 281.29 ? 67   THR B O     1 
ATOM   2258  C  CB    . THR B 1 67   ? 84.647  99.585  184.261 1.00 281.29 ? 67   THR B CB    1 
ATOM   2259  O  OG1   . THR B 1 67   ? 83.642  100.073 185.154 1.00 281.29 ? 67   THR B OG1   1 
ATOM   2260  C  CG2   . THR B 1 67   ? 84.833  100.574 183.120 1.00 281.29 ? 67   THR B CG2   1 
ATOM   2261  N  N     . ILE B 1 68   ? 85.093  96.458  185.144 1.00 270.91 ? 68   ILE B N     1 
ATOM   2262  C  CA    . ILE B 1 68   ? 85.022  95.379  186.123 1.00 270.91 ? 68   ILE B CA    1 
ATOM   2263  C  C     . ILE B 1 68   ? 85.590  95.883  187.444 1.00 270.91 ? 68   ILE B C     1 
ATOM   2264  O  O     . ILE B 1 68   ? 86.690  96.454  187.457 1.00 270.91 ? 68   ILE B O     1 
ATOM   2265  C  CB    . ILE B 1 68   ? 85.746  94.111  185.641 1.00 270.91 ? 68   ILE B CB    1 
ATOM   2266  C  CG1   . ILE B 1 68   ? 85.830  93.080  186.768 1.00 270.91 ? 68   ILE B CG1   1 
ATOM   2267  C  CG2   . ILE B 1 68   ? 87.099  94.412  185.018 1.00 270.91 ? 68   ILE B CG2   1 
ATOM   2268  C  CD1   . ILE B 1 68   ? 84.500  92.478  187.131 1.00 270.91 ? 68   ILE B CD1   1 
ATOM   2269  N  N     . PRO B 1 69   ? 84.858  95.767  188.542 1.00 267.94 ? 69   PRO B N     1 
ATOM   2270  C  CA    . PRO B 1 69   ? 85.459  95.927  189.863 1.00 267.94 ? 69   PRO B CA    1 
ATOM   2271  C  C     . PRO B 1 69   ? 85.946  94.589  190.389 1.00 267.94 ? 69   PRO B C     1 
ATOM   2272  O  O     . PRO B 1 69   ? 85.390  93.530  190.100 1.00 267.94 ? 69   PRO B O     1 
ATOM   2273  C  CB    . PRO B 1 69   ? 84.298  96.467  190.713 1.00 267.94 ? 69   PRO B CB    1 
ATOM   2274  C  CG    . PRO B 1 69   ? 83.144  96.680  189.753 1.00 267.94 ? 69   PRO B CG    1 
ATOM   2275  C  CD    . PRO B 1 69   ? 83.394  95.769  188.611 1.00 267.94 ? 69   PRO B CD    1 
ATOM   2276  N  N     . GLY B 1 70   ? 87.007  94.654  191.188 1.00 298.48 ? 70   GLY B N     1 
ATOM   2277  C  CA    . GLY B 1 70   ? 87.694  93.476  191.655 1.00 298.48 ? 70   GLY B CA    1 
ATOM   2278  C  C     . GLY B 1 70   ? 88.842  93.057  190.764 1.00 298.48 ? 70   GLY B C     1 
ATOM   2279  O  O     . GLY B 1 70   ? 89.847  92.540  191.258 1.00 298.48 ? 70   GLY B O     1 
ATOM   2280  N  N     . VAL B 1 71   ? 88.710  93.266  189.461 1.00 297.35 ? 71   VAL B N     1 
ATOM   2281  C  CA    . VAL B 1 71   ? 89.801  93.098  188.516 1.00 297.35 ? 71   VAL B CA    1 
ATOM   2282  C  C     . VAL B 1 71   ? 90.222  94.496  188.094 1.00 297.35 ? 71   VAL B C     1 
ATOM   2283  O  O     . VAL B 1 71   ? 89.368  95.355  187.841 1.00 297.35 ? 71   VAL B O     1 
ATOM   2284  C  CB    . VAL B 1 71   ? 89.379  92.243  187.315 1.00 297.35 ? 71   VAL B CB    1 
ATOM   2285  C  CG1   . VAL B 1 71   ? 90.553  91.973  186.390 1.00 297.35 ? 71   VAL B CG1   1 
ATOM   2286  C  CG2   . VAL B 1 71   ? 88.744  90.956  187.803 1.00 297.35 ? 71   VAL B CG2   1 
ATOM   2287  N  N     . LYS B 1 72   ? 91.536  94.725  188.040 1.00 309.57 ? 72   LYS B N     1 
ATOM   2288  C  CA    . LYS B 1 72   ? 92.070  96.070  187.851 1.00 309.57 ? 72   LYS B CA    1 
ATOM   2289  C  C     . LYS B 1 72   ? 91.743  96.631  186.474 1.00 309.57 ? 72   LYS B C     1 
ATOM   2290  O  O     . LYS B 1 72   ? 91.534  97.839  186.326 1.00 309.57 ? 72   LYS B O     1 
ATOM   2291  C  CB    . LYS B 1 72   ? 93.582  96.033  188.080 1.00 309.57 ? 72   LYS B CB    1 
ATOM   2292  C  CG    . LYS B 1 72   ? 94.346  97.343  187.959 1.00 309.57 ? 72   LYS B CG    1 
ATOM   2293  C  CD    . LYS B 1 72   ? 95.061  97.419  186.623 1.00 309.57 ? 72   LYS B CD    1 
ATOM   2294  C  CE    . LYS B 1 72   ? 95.980  96.233  186.438 1.00 309.57 ? 72   LYS B CE    1 
ATOM   2295  N  NZ    . LYS B 1 72   ? 96.547  96.216  185.068 1.00 309.57 ? 72   LYS B NZ    1 
ATOM   2296  N  N     . GLU B 1 73   ? 91.672  95.776  185.468 1.00 294.16 ? 73   GLU B N     1 
ATOM   2297  C  CA    . GLU B 1 73   ? 91.636  96.216  184.083 1.00 294.16 ? 73   GLU B CA    1 
ATOM   2298  C  C     . GLU B 1 73   ? 90.206  96.560  183.681 1.00 294.16 ? 73   GLU B C     1 
ATOM   2299  O  O     . GLU B 1 73   ? 89.321  96.738  184.521 1.00 294.16 ? 73   GLU B O     1 
ATOM   2300  C  CB    . GLU B 1 73   ? 92.247  95.138  183.198 1.00 294.16 ? 73   GLU B CB    1 
ATOM   2301  C  CG    . GLU B 1 73   ? 93.727  94.900  183.461 1.00 294.16 ? 73   GLU B CG    1 
ATOM   2302  C  CD    . GLU B 1 73   ? 94.003  93.862  184.542 1.00 294.16 ? 73   GLU B CD    1 
ATOM   2303  O  OE1   . GLU B 1 73   ? 93.215  93.742  185.505 1.00 294.16 ? 73   GLU B OE1   1 
ATOM   2304  O  OE2   . GLU B 1 73   ? 95.018  93.155  184.419 1.00 294.16 ? 73   GLU B OE2   1 
ATOM   2305  N  N     . ASP B 1 74   ? 89.977  96.703  182.383 1.00 253.44 ? 74   ASP B N     1 
ATOM   2306  C  CA    . ASP B 1 74   ? 88.638  96.813  181.835 1.00 253.44 ? 74   ASP B CA    1 
ATOM   2307  C  C     . ASP B 1 74   ? 88.401  95.659  180.876 1.00 253.44 ? 74   ASP B C     1 
ATOM   2308  O  O     . ASP B 1 74   ? 89.304  94.878  180.571 1.00 253.44 ? 74   ASP B O     1 
ATOM   2309  C  CB    . ASP B 1 74   ? 88.424  98.151  181.119 1.00 253.44 ? 74   ASP B CB    1 
ATOM   2310  C  CG    . ASP B 1 74   ? 89.463  98.419  180.048 1.00 253.44 ? 74   ASP B CG    1 
ATOM   2311  O  OD1   . ASP B 1 74   ? 90.493  97.712  180.002 1.00 253.44 ? 74   ASP B OD1   1 
ATOM   2312  O  OD2   . ASP B 1 74   ? 89.248  99.349  179.245 1.00 253.44 ? 74   ASP B OD2   1 
ATOM   2313  N  N     . VAL B 1 75   ? 87.168  95.577  180.377 1.00 248.08 ? 75   VAL B N     1 
ATOM   2314  C  CA    . VAL B 1 75   ? 86.825  94.492  179.470 1.00 248.08 ? 75   VAL B CA    1 
ATOM   2315  C  C     . VAL B 1 75   ? 87.428  94.746  178.096 1.00 248.08 ? 75   VAL B C     1 
ATOM   2316  O  O     . VAL B 1 75   ? 87.682  93.805  177.335 1.00 248.08 ? 75   VAL B O     1 
ATOM   2317  C  CB    . VAL B 1 75   ? 85.290  94.324  179.418 1.00 248.08 ? 75   VAL B CB    1 
ATOM   2318  C  CG1   . VAL B 1 75   ? 84.610  95.540  178.796 1.00 248.08 ? 75   VAL B CG1   1 
ATOM   2319  C  CG2   . VAL B 1 75   ? 84.882  93.026  178.729 1.00 248.08 ? 75   VAL B CG2   1 
ATOM   2320  N  N     . VAL B 1 76   ? 87.722  96.008  177.786 1.00 248.41 ? 76   VAL B N     1 
ATOM   2321  C  CA    . VAL B 1 76   ? 88.148  96.447  176.464 1.00 248.41 ? 76   VAL B CA    1 
ATOM   2322  C  C     . VAL B 1 76   ? 89.504  95.850  176.138 1.00 248.41 ? 76   VAL B C     1 
ATOM   2323  O  O     . VAL B 1 76   ? 89.684  95.217  175.091 1.00 248.41 ? 76   VAL B O     1 
ATOM   2324  C  CB    . VAL B 1 76   ? 88.193  97.980  176.406 1.00 248.41 ? 76   VAL B CB    1 
ATOM   2325  C  CG1   . VAL B 1 76   ? 88.704  98.441  175.062 1.00 248.41 ? 76   VAL B CG1   1 
ATOM   2326  C  CG2   . VAL B 1 76   ? 86.817  98.556  176.705 1.00 248.41 ? 76   VAL B CG2   1 
ATOM   2327  N  N     . GLU B 1 77   ? 90.448  96.011  177.063 1.00 269.16 ? 77   GLU B N     1 
ATOM   2328  C  CA    . GLU B 1 77   ? 91.762  95.408  176.899 1.00 269.16 ? 77   GLU B CA    1 
ATOM   2329  C  C     . GLU B 1 77   ? 91.681  93.891  176.890 1.00 269.16 ? 77   GLU B C     1 
ATOM   2330  O  O     . GLU B 1 77   ? 92.462  93.245  176.196 1.00 269.16 ? 77   GLU B O     1 
ATOM   2331  C  CB    . GLU B 1 77   ? 92.695  95.889  178.007 1.00 269.16 ? 77   GLU B CB    1 
ATOM   2332  C  CG    . GLU B 1 77   ? 94.128  95.387  177.909 1.00 269.16 ? 77   GLU B CG    1 
ATOM   2333  C  CD    . GLU B 1 77   ? 94.674  95.441  176.497 1.00 269.16 ? 77   GLU B CD    1 
ATOM   2334  O  OE1   . GLU B 1 77   ? 95.063  94.382  175.959 1.00 269.16 ? 77   GLU B OE1   1 
ATOM   2335  O  OE2   . GLU B 1 77   ? 94.743  96.549  175.925 1.00 269.16 ? 77   GLU B OE2   1 
ATOM   2336  N  N     . ILE B 1 78   ? 90.727  93.310  177.621 1.00 245.08 ? 78   ILE B N     1 
ATOM   2337  C  CA    . ILE B 1 78   ? 90.551  91.858  177.618 1.00 245.08 ? 78   ILE B CA    1 
ATOM   2338  C  C     . ILE B 1 78   ? 90.160  91.384  176.226 1.00 245.08 ? 78   ILE B C     1 
ATOM   2339  O  O     . ILE B 1 78   ? 90.704  90.404  175.703 1.00 245.08 ? 78   ILE B O     1 
ATOM   2340  C  CB    . ILE B 1 78   ? 89.513  91.446  178.673 1.00 245.08 ? 78   ILE B CB    1 
ATOM   2341  C  CG1   . ILE B 1 78   ? 90.083  91.670  180.070 1.00 245.08 ? 78   ILE B CG1   1 
ATOM   2342  C  CG2   . ILE B 1 78   ? 89.092  90.003  178.496 1.00 245.08 ? 78   ILE B CG2   1 
ATOM   2343  C  CD1   . ILE B 1 78   ? 89.045  91.633  181.153 1.00 245.08 ? 78   ILE B CD1   1 
ATOM   2344  N  N     . ILE B 1 79   ? 89.269  92.136  175.581 1.00 250.95 ? 79   ILE B N     1 
ATOM   2345  C  CA    . ILE B 1 79   ? 88.916  91.878  174.190 1.00 250.95 ? 79   ILE B CA    1 
ATOM   2346  C  C     . ILE B 1 79   ? 90.127  92.062  173.291 1.00 250.95 ? 79   ILE B C     1 
ATOM   2347  O  O     . ILE B 1 79   ? 90.333  91.307  172.333 1.00 250.95 ? 79   ILE B O     1 
ATOM   2348  C  CB    . ILE B 1 79   ? 87.753  92.794  173.776 1.00 250.95 ? 79   ILE B CB    1 
ATOM   2349  C  CG1   . ILE B 1 79   ? 86.526  92.477  174.616 1.00 250.95 ? 79   ILE B CG1   1 
ATOM   2350  C  CG2   . ILE B 1 79   ? 87.402  92.620  172.313 1.00 250.95 ? 79   ILE B CG2   1 
ATOM   2351  C  CD1   . ILE B 1 79   ? 85.602  93.654  174.780 1.00 250.95 ? 79   ILE B CD1   1 
ATOM   2352  N  N     . LEU B 1 80   ? 90.969  93.039  173.617 1.00 272.67 ? 80   LEU B N     1 
ATOM   2353  C  CA    . LEU B 1 80   ? 92.184  93.260  172.841 1.00 272.67 ? 80   LEU B CA    1 
ATOM   2354  C  C     . LEU B 1 80   ? 93.152  92.093  172.981 1.00 272.67 ? 80   LEU B C     1 
ATOM   2355  O  O     . LEU B 1 80   ? 93.894  91.774  172.048 1.00 272.67 ? 80   LEU B O     1 
ATOM   2356  C  CB    . LEU B 1 80   ? 92.843  94.564  173.275 1.00 272.67 ? 80   LEU B CB    1 
ATOM   2357  C  CG    . LEU B 1 80   ? 92.067  95.844  172.962 1.00 272.67 ? 80   LEU B CG    1 
ATOM   2358  C  CD1   . LEU B 1 80   ? 92.936  97.067  173.171 1.00 272.67 ? 80   LEU B CD1   1 
ATOM   2359  C  CD2   . LEU B 1 80   ? 91.485  95.832  171.559 1.00 272.67 ? 80   LEU B CD2   1 
ATOM   2360  N  N     . ASN B 1 81   ? 93.154  91.441  174.139 1.00 274.67 ? 81   ASN B N     1 
ATOM   2361  C  CA    . ASN B 1 81   ? 93.933  90.218  174.279 1.00 274.67 ? 81   ASN B CA    1 
ATOM   2362  C  C     . ASN B 1 81   ? 93.280  89.082  173.518 1.00 274.67 ? 81   ASN B C     1 
ATOM   2363  O  O     . ASN B 1 81   ? 93.963  88.182  173.017 1.00 274.67 ? 81   ASN B O     1 
ATOM   2364  C  CB    . ASN B 1 81   ? 94.087  89.837  175.742 1.00 274.67 ? 81   ASN B CB    1 
ATOM   2365  C  CG    . ASN B 1 81   ? 94.435  91.002  176.606 1.00 274.67 ? 81   ASN B CG    1 
ATOM   2366  O  OD1   . ASN B 1 81   ? 93.801  91.231  177.629 1.00 274.67 ? 81   ASN B OD1   1 
ATOM   2367  N  ND2   . ASN B 1 81   ? 95.429  91.773  176.195 1.00 274.67 ? 81   ASN B ND2   1 
ATOM   2368  N  N     . LEU B 1 82   ? 91.952  89.105  173.428 1.00 278.66 ? 82   LEU B N     1 
ATOM   2369  C  CA    . LEU B 1 82   ? 91.257  88.085  172.655 1.00 278.66 ? 82   LEU B CA    1 
ATOM   2370  C  C     . LEU B 1 82   ? 91.501  88.250  171.164 1.00 278.66 ? 82   LEU B C     1 
ATOM   2371  O  O     . LEU B 1 82   ? 91.357  87.286  170.408 1.00 278.66 ? 82   LEU B O     1 
ATOM   2372  C  CB    . LEU B 1 82   ? 89.762  88.118  172.951 1.00 278.66 ? 82   LEU B CB    1 
ATOM   2373  C  CG    . LEU B 1 82   ? 89.360  87.768  174.384 1.00 278.66 ? 82   LEU B CG    1 
ATOM   2374  C  CD1   . LEU B 1 82   ? 88.007  88.355  174.727 1.00 278.66 ? 82   LEU B CD1   1 
ATOM   2375  C  CD2   . LEU B 1 82   ? 89.354  86.277  174.629 1.00 278.66 ? 82   LEU B CD2   1 
ATOM   2376  N  N     . LYS B 1 83   ? 91.861  89.462  170.731 1.00 260.72 ? 83   LYS B N     1 
ATOM   2377  C  CA    . LYS B 1 83   ? 92.152  89.732  169.327 1.00 260.72 ? 83   LYS B CA    1 
ATOM   2378  C  C     . LYS B 1 83   ? 93.301  88.875  168.824 1.00 260.72 ? 83   LYS B C     1 
ATOM   2379  O  O     . LYS B 1 83   ? 93.219  88.256  167.759 1.00 260.72 ? 83   LYS B O     1 
ATOM   2380  C  CB    . LYS B 1 83   ? 92.504  91.204  169.142 1.00 260.72 ? 83   LYS B CB    1 
ATOM   2381  C  CG    . LYS B 1 83   ? 91.364  92.157  169.305 1.00 260.72 ? 83   LYS B CG    1 
ATOM   2382  C  CD    . LYS B 1 83   ? 91.739  93.495  168.714 1.00 260.72 ? 83   LYS B CD    1 
ATOM   2383  C  CE    . LYS B 1 83   ? 90.505  94.273  168.315 1.00 260.72 ? 83   LYS B CE    1 
ATOM   2384  N  NZ    . LYS B 1 83   ? 90.761  95.154  167.149 1.00 260.72 ? 83   LYS B NZ    1 
ATOM   2385  N  N     . GLU B 1 84   ? 94.369  88.803  169.603 1.00 288.06 ? 84   GLU B N     1 
ATOM   2386  C  CA    . GLU B 1 84   ? 95.555  88.062  169.212 1.00 288.06 ? 84   GLU B CA    1 
ATOM   2387  C  C     . GLU B 1 84   ? 95.522  86.622  169.663 1.00 288.06 ? 84   GLU B C     1 
ATOM   2388  O  O     . GLU B 1 84   ? 96.583  86.009  169.825 1.00 288.06 ? 84   GLU B O     1 
ATOM   2389  C  CB    . GLU B 1 84   ? 96.800  88.759  169.752 1.00 288.06 ? 84   GLU B CB    1 
ATOM   2390  C  CG    . GLU B 1 84   ? 96.913  90.182  169.268 1.00 288.06 ? 84   GLU B CG    1 
ATOM   2391  C  CD    . GLU B 1 84   ? 98.190  90.852  169.709 1.00 288.06 ? 84   GLU B CD    1 
ATOM   2392  O  OE1   . GLU B 1 84   ? 99.014  90.183  170.365 1.00 288.06 ? 84   GLU B OE1   1 
ATOM   2393  O  OE2   . GLU B 1 84   ? 98.369  92.048  169.394 1.00 288.06 ? 84   GLU B OE2   1 
ATOM   2394  N  N     . LEU B 1 85   ? 94.334  86.073  169.883 1.00 313.44 ? 85   LEU B N     1 
ATOM   2395  C  CA    . LEU B 1 85   ? 94.216  84.650  170.134 1.00 313.44 ? 85   LEU B CA    1 
ATOM   2396  C  C     . LEU B 1 85   ? 94.566  83.875  168.878 1.00 313.44 ? 85   LEU B C     1 
ATOM   2397  O  O     . LEU B 1 85   ? 93.983  84.097  167.814 1.00 313.44 ? 85   LEU B O     1 
ATOM   2398  C  CB    . LEU B 1 85   ? 92.802  84.306  170.570 1.00 313.44 ? 85   LEU B CB    1 
ATOM   2399  C  CG    . LEU B 1 85   ? 92.444  84.627  172.009 1.00 313.44 ? 85   LEU B CG    1 
ATOM   2400  C  CD1   . LEU B 1 85   ? 91.065  84.085  172.251 1.00 313.44 ? 85   LEU B CD1   1 
ATOM   2401  C  CD2   . LEU B 1 85   ? 93.449  84.039  172.977 1.00 313.44 ? 85   LEU B CD2   1 
ATOM   2402  N  N     . VAL B 1 86   ? 95.528  82.973  168.997 1.00 361.13 ? 86   VAL B N     1 
ATOM   2403  C  CA    . VAL B 1 86   ? 95.945  82.135  167.885 1.00 361.13 ? 86   VAL B CA    1 
ATOM   2404  C  C     . VAL B 1 86   ? 95.785  80.674  168.298 1.00 361.13 ? 86   VAL B C     1 
ATOM   2405  O  O     . VAL B 1 86   ? 96.289  80.246  169.343 1.00 361.13 ? 86   VAL B O     1 
ATOM   2406  C  CB    . VAL B 1 86   ? 97.367  82.492  167.408 1.00 361.13 ? 86   VAL B CB    1 
ATOM   2407  C  CG1   . VAL B 1 86   ? 98.396  82.479  168.540 1.00 361.13 ? 86   VAL B CG1   1 
ATOM   2408  C  CG2   . VAL B 1 86   ? 97.783  81.593  166.270 1.00 361.13 ? 86   VAL B CG2   1 
ATOM   2409  N  N     . VAL B 1 87   ? 95.020  79.931  167.509 1.00 374.37 ? 87   VAL B N     1 
ATOM   2410  C  CA    . VAL B 1 87   ? 94.532  78.613  167.870 1.00 374.37 ? 87   VAL B CA    1 
ATOM   2411  C  C     . VAL B 1 87   ? 94.446  77.804  166.579 1.00 374.37 ? 87   VAL B C     1 
ATOM   2412  O  O     . VAL B 1 87   ? 94.560  78.351  165.481 1.00 374.37 ? 87   VAL B O     1 
ATOM   2413  C  CB    . VAL B 1 87   ? 93.164  78.700  168.589 1.00 374.37 ? 87   VAL B CB    1 
ATOM   2414  C  CG1   . VAL B 1 87   ? 92.036  78.939  167.599 1.00 374.37 ? 87   VAL B CG1   1 
ATOM   2415  C  CG2   . VAL B 1 87   ? 92.895  77.522  169.510 1.00 374.37 ? 87   VAL B CG2   1 
ATOM   2416  N  N     . ARG B 1 88   ? 94.269  76.492  166.700 1.00 362.25 ? 88   ARG B N     1 
ATOM   2417  C  CA    . ARG B 1 88   ? 94.165  75.666  165.503 1.00 362.25 ? 88   ARG B CA    1 
ATOM   2418  C  C     . ARG B 1 88   ? 93.080  74.620  165.691 1.00 362.25 ? 88   ARG B C     1 
ATOM   2419  O  O     . ARG B 1 88   ? 93.198  73.748  166.557 1.00 362.25 ? 88   ARG B O     1 
ATOM   2420  C  CB    . ARG B 1 88   ? 95.499  75.005  165.184 1.00 362.25 ? 88   ARG B CB    1 
ATOM   2421  C  CG    . ARG B 1 88   ? 95.459  74.116  163.969 1.00 362.25 ? 88   ARG B CG    1 
ATOM   2422  C  CD    . ARG B 1 88   ? 96.825  73.528  163.714 1.00 362.25 ? 88   ARG B CD    1 
ATOM   2423  N  NE    . ARG B 1 88   ? 97.818  74.566  163.472 1.00 362.25 ? 88   ARG B NE    1 
ATOM   2424  C  CZ    . ARG B 1 88   ? 99.125  74.387  163.613 1.00 362.25 ? 88   ARG B CZ    1 
ATOM   2425  N  NH1   . ARG B 1 88   ? 99.591  73.212  164.009 1.00 362.25 ? 88   ARG B NH1   1 
ATOM   2426  N  NH2   . ARG B 1 88   ? 99.963  75.384  163.372 1.00 362.25 ? 88   ARG B NH2   1 
ATOM   2427  N  N     . PHE B 1 89   ? 92.031  74.715  164.880 1.00 342.79 ? 89   PHE B N     1 
ATOM   2428  C  CA    . PHE B 1 89   ? 91.009  73.675  164.801 1.00 342.79 ? 89   PHE B CA    1 
ATOM   2429  C  C     . PHE B 1 89   ? 91.625  72.454  164.133 1.00 342.79 ? 89   PHE B C     1 
ATOM   2430  O  O     . PHE B 1 89   ? 91.832  72.436  162.919 1.00 342.79 ? 89   PHE B O     1 
ATOM   2431  C  CB    . PHE B 1 89   ? 89.793  74.160  164.018 1.00 342.79 ? 89   PHE B CB    1 
ATOM   2432  C  CG    . PHE B 1 89   ? 88.934  75.151  164.755 1.00 342.79 ? 89   PHE B CG    1 
ATOM   2433  C  CD1   . PHE B 1 89   ? 89.082  75.353  166.118 1.00 342.79 ? 89   PHE B CD1   1 
ATOM   2434  C  CD2   . PHE B 1 89   ? 87.956  75.865  164.078 1.00 342.79 ? 89   PHE B CD2   1 
ATOM   2435  C  CE1   . PHE B 1 89   ? 88.280  76.262  166.791 1.00 342.79 ? 89   PHE B CE1   1 
ATOM   2436  C  CE2   . PHE B 1 89   ? 87.154  76.774  164.743 1.00 342.79 ? 89   PHE B CE2   1 
ATOM   2437  C  CZ    . PHE B 1 89   ? 87.313  76.972  166.099 1.00 342.79 ? 89   PHE B CZ    1 
ATOM   2438  N  N     . LEU B 1 90   ? 91.918  71.421  164.917 1.00 376.42 ? 90   LEU B N     1 
ATOM   2439  C  CA    . LEU B 1 90   ? 92.538  70.229  164.357 1.00 376.42 ? 90   LEU B CA    1 
ATOM   2440  C  C     . LEU B 1 90   ? 91.560  69.356  163.580 1.00 376.42 ? 90   LEU B C     1 
ATOM   2441  O  O     . LEU B 1 90   ? 91.999  68.550  162.754 1.00 376.42 ? 90   LEU B O     1 
ATOM   2442  C  CB    . LEU B 1 90   ? 93.189  69.411  165.467 1.00 376.42 ? 90   LEU B CB    1 
ATOM   2443  C  CG    . LEU B 1 90   ? 94.054  70.206  166.438 1.00 376.42 ? 90   LEU B CG    1 
ATOM   2444  C  CD1   . LEU B 1 90   ? 94.505  69.307  167.566 1.00 376.42 ? 90   LEU B CD1   1 
ATOM   2445  C  CD2   . LEU B 1 90   ? 95.237  70.794  165.706 1.00 376.42 ? 90   LEU B CD2   1 
ATOM   2446  N  N     . ASN B 1 91   ? 90.257  69.494  163.817 1.00 412.68 ? 91   ASN B N     1 
ATOM   2447  C  CA    . ASN B 1 91   ? 89.262  68.790  163.024 1.00 412.68 ? 91   ASN B CA    1 
ATOM   2448  C  C     . ASN B 1 91   ? 88.768  69.705  161.921 1.00 412.68 ? 91   ASN B C     1 
ATOM   2449  O  O     . ASN B 1 91   ? 88.257  70.797  162.218 1.00 412.68 ? 91   ASN B O     1 
ATOM   2450  C  CB    . ASN B 1 91   ? 88.094  68.339  163.892 1.00 412.68 ? 91   ASN B CB    1 
ATOM   2451  C  CG    . ASN B 1 91   ? 86.919  67.807  163.077 1.00 412.68 ? 91   ASN B CG    1 
ATOM   2452  O  OD1   . ASN B 1 91   ? 87.092  67.150  162.048 1.00 412.68 ? 91   ASN B OD1   1 
ATOM   2453  N  ND2   . ASN B 1 91   ? 85.714  68.077  163.555 1.00 412.68 ? 91   ASN B ND2   1 
ATOM   2454  N  N     . PRO B 1 92   ? 88.873  69.304  160.653 1.00 392.92 ? 92   PRO B N     1 
ATOM   2455  C  CA    . PRO B 1 92   ? 88.366  70.154  159.565 1.00 392.92 ? 92   PRO B CA    1 
ATOM   2456  C  C     . PRO B 1 92   ? 86.854  70.215  159.490 1.00 392.92 ? 92   PRO B C     1 
ATOM   2457  O  O     . PRO B 1 92   ? 86.324  71.077  158.779 1.00 392.92 ? 92   PRO B O     1 
ATOM   2458  C  CB    . PRO B 1 92   ? 88.948  69.498  158.305 1.00 392.92 ? 92   PRO B CB    1 
ATOM   2459  C  CG    . PRO B 1 92   ? 90.024  68.571  158.794 1.00 392.92 ? 92   PRO B CG    1 
ATOM   2460  C  CD    . PRO B 1 92   ? 89.588  68.125  160.144 1.00 392.92 ? 92   PRO B CD    1 
ATOM   2461  N  N     . SER B 1 93   ? 86.143  69.347  160.202 1.00 392.37 ? 93   SER B N     1 
ATOM   2462  C  CA    . SER B 1 93   ? 84.691  69.310  160.112 1.00 392.37 ? 93   SER B CA    1 
ATOM   2463  C  C     . SER B 1 93   ? 84.050  70.398  160.968 1.00 392.37 ? 93   SER B C     1 
ATOM   2464  O  O     . SER B 1 93   ? 83.271  71.214  160.467 1.00 392.37 ? 93   SER B O     1 
ATOM   2465  C  CB    . SER B 1 93   ? 84.197  67.924  160.525 1.00 392.37 ? 93   SER B CB    1 
ATOM   2466  O  OG    . SER B 1 93   ? 85.042  66.926  159.984 1.00 392.37 ? 93   SER B OG    1 
ATOM   2467  N  N     . LEU B 1 94   ? 84.375  70.423  162.255 1.00 354.67 ? 94   LEU B N     1 
ATOM   2468  C  CA    . LEU B 1 94   ? 83.761  71.373  163.169 1.00 354.67 ? 94   LEU B CA    1 
ATOM   2469  C  C     . LEU B 1 94   ? 84.345  72.763  162.967 1.00 354.67 ? 94   LEU B C     1 
ATOM   2470  O  O     . LEU B 1 94   ? 85.553  72.928  162.793 1.00 354.67 ? 94   LEU B O     1 
ATOM   2471  C  CB    . LEU B 1 94   ? 83.962  70.914  164.610 1.00 354.67 ? 94   LEU B CB    1 
ATOM   2472  C  CG    . LEU B 1 94   ? 83.352  71.771  165.714 1.00 354.67 ? 94   LEU B CG    1 
ATOM   2473  C  CD1   . LEU B 1 94   ? 82.559  70.916  166.677 1.00 354.67 ? 94   LEU B CD1   1 
ATOM   2474  C  CD2   . LEU B 1 94   ? 84.455  72.493  166.444 1.00 354.67 ? 94   LEU B CD2   1 
ATOM   2475  N  N     . GLN B 1 95   ? 83.477  73.771  163.014 1.00 328.09 ? 95   GLN B N     1 
ATOM   2476  C  CA    . GLN B 1 95   ? 83.857  75.132  162.679 1.00 328.09 ? 95   GLN B CA    1 
ATOM   2477  C  C     . GLN B 1 95   ? 83.822  76.103  163.845 1.00 328.09 ? 95   GLN B C     1 
ATOM   2478  O  O     . GLN B 1 95   ? 84.243  77.250  163.671 1.00 328.09 ? 95   GLN B O     1 
ATOM   2479  C  CB    . GLN B 1 95   ? 82.945  75.671  161.573 1.00 328.09 ? 95   GLN B CB    1 
ATOM   2480  C  CG    . GLN B 1 95   ? 82.814  74.737  160.406 1.00 328.09 ? 95   GLN B CG    1 
ATOM   2481  C  CD    . GLN B 1 95   ? 84.134  74.526  159.717 1.00 328.09 ? 95   GLN B CD    1 
ATOM   2482  O  OE1   . GLN B 1 95   ? 84.834  75.484  159.393 1.00 328.09 ? 95   GLN B OE1   1 
ATOM   2483  N  NE2   . GLN B 1 95   ? 84.491  73.269  159.496 1.00 328.09 ? 95   GLN B NE2   1 
ATOM   2484  N  N     . THR B 1 96   ? 83.328  75.702  165.015 1.00 312.72 ? 96   THR B N     1 
ATOM   2485  C  CA    . THR B 1 96   ? 83.096  76.702  166.047 1.00 312.72 ? 96   THR B CA    1 
ATOM   2486  C  C     . THR B 1 96   ? 83.046  76.059  167.426 1.00 312.72 ? 96   THR B C     1 
ATOM   2487  O  O     . THR B 1 96   ? 82.552  74.940  167.578 1.00 312.72 ? 96   THR B O     1 
ATOM   2488  C  CB    . THR B 1 96   ? 81.800  77.478  165.771 1.00 312.72 ? 96   THR B CB    1 
ATOM   2489  O  OG1   . THR B 1 96   ? 81.551  78.376  166.852 1.00 312.72 ? 96   THR B OG1   1 
ATOM   2490  C  CG2   . THR B 1 96   ? 80.611  76.550  165.557 1.00 312.72 ? 96   THR B CG2   1 
ATOM   2491  N  N     . VAL B 1 97   ? 83.569  76.774  168.423 1.00 288.88 ? 97   VAL B N     1 
ATOM   2492  C  CA    . VAL B 1 97   ? 83.586  76.319  169.812 1.00 288.88 ? 97   VAL B CA    1 
ATOM   2493  C  C     . VAL B 1 97   ? 83.311  77.512  170.716 1.00 288.88 ? 97   VAL B C     1 
ATOM   2494  O  O     . VAL B 1 97   ? 83.972  78.550  170.600 1.00 288.88 ? 97   VAL B O     1 
ATOM   2495  C  CB    . VAL B 1 97   ? 84.931  75.663  170.200 1.00 288.88 ? 97   VAL B CB    1 
ATOM   2496  C  CG1   . VAL B 1 97   ? 85.079  75.562  171.705 1.00 288.88 ? 97   VAL B CG1   1 
ATOM   2497  C  CG2   . VAL B 1 97   ? 85.049  74.273  169.631 1.00 288.88 ? 97   VAL B CG2   1 
ATOM   2498  N  N     . THR B 1 98   ? 82.323  77.376  171.599 1.00 274.90 ? 98   THR B N     1 
ATOM   2499  C  CA    . THR B 1 98   ? 82.194  78.261  172.750 1.00 274.90 ? 98   THR B CA    1 
ATOM   2500  C  C     . THR B 1 98   ? 83.115  77.734  173.840 1.00 274.90 ? 98   THR B C     1 
ATOM   2501  O  O     . THR B 1 98   ? 83.064  76.550  174.184 1.00 274.90 ? 98   THR B O     1 
ATOM   2502  C  CB    . THR B 1 98   ? 80.762  78.325  173.265 1.00 274.90 ? 98   THR B CB    1 
ATOM   2503  O  OG1   . THR B 1 98   ? 79.859  78.516  172.175 1.00 274.90 ? 98   THR B OG1   1 
ATOM   2504  C  CG2   . THR B 1 98   ? 80.616  79.487  174.238 1.00 274.90 ? 98   THR B CG2   1 
ATOM   2505  N  N     . LEU B 1 99   ? 83.954  78.601  174.383 1.00 260.90 ? 99   LEU B N     1 
ATOM   2506  C  CA    . LEU B 1 99   ? 84.806  78.229  175.498 1.00 260.90 ? 99   LEU B CA    1 
ATOM   2507  C  C     . LEU B 1 99   ? 84.375  78.958  176.757 1.00 260.90 ? 99   LEU B C     1 
ATOM   2508  O  O     . LEU B 1 99   ? 83.704  79.990  176.706 1.00 260.90 ? 99   LEU B O     1 
ATOM   2509  C  CB    . LEU B 1 99   ? 86.267  78.547  175.209 1.00 260.90 ? 99   LEU B CB    1 
ATOM   2510  C  CG    . LEU B 1 99   ? 86.909  77.781  174.070 1.00 260.90 ? 99   LEU B CG    1 
ATOM   2511  C  CD1   . LEU B 1 99   ? 86.941  78.640  172.822 1.00 260.90 ? 99   LEU B CD1   1 
ATOM   2512  C  CD2   . LEU B 1 99   ? 88.298  77.368  174.488 1.00 260.90 ? 99   LEU B CD2   1 
ATOM   2513  N  N     . LEU B 1 100  ? 84.777  78.406  177.897 1.00 253.38 ? 100  LEU B N     1 
ATOM   2514  C  CA    . LEU B 1 100  ? 84.513  78.998  179.197 1.00 253.38 ? 100  LEU B CA    1 
ATOM   2515  C  C     . LEU B 1 100  ? 85.803  79.013  180.002 1.00 253.38 ? 100  LEU B C     1 
ATOM   2516  O  O     . LEU B 1 100  ? 86.780  78.346  179.653 1.00 253.38 ? 100  LEU B O     1 
ATOM   2517  C  CB    . LEU B 1 100  ? 83.429  78.228  179.963 1.00 253.38 ? 100  LEU B CB    1 
ATOM   2518  C  CG    . LEU B 1 100  ? 82.155  77.786  179.239 1.00 253.38 ? 100  LEU B CG    1 
ATOM   2519  C  CD1   . LEU B 1 100  ? 81.312  76.928  180.157 1.00 253.38 ? 100  LEU B CD1   1 
ATOM   2520  C  CD2   . LEU B 1 100  ? 81.350  78.969  178.752 1.00 253.38 ? 100  LEU B CD2   1 
ATOM   2521  N  N     . LEU B 1 101  ? 85.792  79.792  181.085 1.00 255.56 ? 101  LEU B N     1 
ATOM   2522  C  CA    . LEU B 1 101  ? 86.863  79.797  182.074 1.00 255.56 ? 101  LEU B CA    1 
ATOM   2523  C  C     . LEU B 1 101  ? 86.383  80.492  183.335 1.00 255.56 ? 101  LEU B C     1 
ATOM   2524  O  O     . LEU B 1 101  ? 85.737  81.540  183.265 1.00 255.56 ? 101  LEU B O     1 
ATOM   2525  C  CB    . LEU B 1 101  ? 88.129  80.501  181.566 1.00 255.56 ? 101  LEU B CB    1 
ATOM   2526  C  CG    . LEU B 1 101  ? 89.381  80.286  182.417 1.00 255.56 ? 101  LEU B CG    1 
ATOM   2527  C  CD1   . LEU B 1 101  ? 89.506  78.832  182.848 1.00 255.56 ? 101  LEU B CD1   1 
ATOM   2528  C  CD2   . LEU B 1 101  ? 90.610  80.725  181.656 1.00 255.56 ? 101  LEU B CD2   1 
ATOM   2529  N  N     . LYS B 1 102  ? 86.715  79.909  184.480 1.00 255.45 ? 102  LYS B N     1 
ATOM   2530  C  CA    . LYS B 1 102  ? 86.590  80.572  185.764 1.00 255.45 ? 102  LYS B CA    1 
ATOM   2531  C  C     . LYS B 1 102  ? 87.964  80.722  186.394 1.00 255.45 ? 102  LYS B C     1 
ATOM   2532  O  O     . LYS B 1 102  ? 88.882  79.943  186.127 1.00 255.45 ? 102  LYS B O     1 
ATOM   2533  C  CB    . LYS B 1 102  ? 85.689  79.793  186.719 1.00 255.45 ? 102  LYS B CB    1 
ATOM   2534  C  CG    . LYS B 1 102  ? 84.548  79.100  186.054 1.00 255.45 ? 102  LYS B CG    1 
ATOM   2535  C  CD    . LYS B 1 102  ? 84.057  77.988  186.938 1.00 255.45 ? 102  LYS B CD    1 
ATOM   2536  C  CE    . LYS B 1 102  ? 83.127  77.068  186.186 1.00 255.45 ? 102  LYS B CE    1 
ATOM   2537  N  NZ    . LYS B 1 102  ? 82.856  75.830  186.961 1.00 255.45 ? 102  LYS B NZ    1 
ATOM   2538  N  N     . ALA B 1 103  ? 88.080  81.734  187.248 1.00 276.63 ? 103  ALA B N     1 
ATOM   2539  C  CA    . ALA B 1 103  ? 89.283  82.035  188.013 1.00 276.63 ? 103  ALA B CA    1 
ATOM   2540  C  C     . ALA B 1 103  ? 88.869  83.000  189.115 1.00 276.63 ? 103  ALA B C     1 
ATOM   2541  O  O     . ALA B 1 103  ? 87.746  83.510  189.120 1.00 276.63 ? 103  ALA B O     1 
ATOM   2542  C  CB    . ALA B 1 103  ? 90.390  82.634  187.145 1.00 276.63 ? 103  ALA B CB    1 
ATOM   2543  N  N     . GLU B 1 104  ? 89.783  83.238  190.054 1.00 292.52 ? 104  GLU B N     1 
ATOM   2544  C  CA    . GLU B 1 104  ? 89.541  84.170  191.150 1.00 292.52 ? 104  GLU B CA    1 
ATOM   2545  C  C     . GLU B 1 104  ? 90.877  84.567  191.758 1.00 292.52 ? 104  GLU B C     1 
ATOM   2546  O  O     . GLU B 1 104  ? 91.897  83.904  191.555 1.00 292.52 ? 104  GLU B O     1 
ATOM   2547  C  CB    . GLU B 1 104  ? 88.625  83.579  192.220 1.00 292.52 ? 104  GLU B CB    1 
ATOM   2548  C  CG    . GLU B 1 104  ? 89.148  82.310  192.840 1.00 292.52 ? 104  GLU B CG    1 
ATOM   2549  C  CD    . GLU B 1 104  ? 88.090  81.599  193.648 1.00 292.52 ? 104  GLU B CD    1 
ATOM   2550  O  OE1   . GLU B 1 104  ? 86.903  81.967  193.522 1.00 292.52 ? 104  GLU B OE1   1 
ATOM   2551  O  OE2   . GLU B 1 104  ? 88.442  80.675  194.409 1.00 292.52 ? 104  GLU B OE2   1 
ATOM   2552  N  N     . GLY B 1 105  ? 90.853  85.667  192.505 1.00 291.81 ? 105  GLY B N     1 
ATOM   2553  C  CA    . GLY B 1 105  ? 91.973  86.070  193.316 1.00 291.81 ? 105  GLY B CA    1 
ATOM   2554  C  C     . GLY B 1 105  ? 93.159  86.585  192.528 1.00 291.81 ? 105  GLY B C     1 
ATOM   2555  O  O     . GLY B 1 105  ? 93.060  86.910  191.342 1.00 291.81 ? 105  GLY B O     1 
ATOM   2556  N  N     . PRO B 1 106  ? 94.310  86.661  193.183 1.00 298.93 ? 106  PRO B N     1 
ATOM   2557  C  CA    . PRO B 1 106  ? 95.488  87.271  192.554 1.00 298.93 ? 106  PRO B CA    1 
ATOM   2558  C  C     . PRO B 1 106  ? 96.127  86.380  191.504 1.00 298.93 ? 106  PRO B C     1 
ATOM   2559  O  O     . PRO B 1 106  ? 97.087  85.658  191.786 1.00 298.93 ? 106  PRO B O     1 
ATOM   2560  C  CB    . PRO B 1 106  ? 96.432  87.496  193.738 1.00 298.93 ? 106  PRO B CB    1 
ATOM   2561  C  CG    . PRO B 1 106  ? 96.038  86.452  194.736 1.00 298.93 ? 106  PRO B CG    1 
ATOM   2562  C  CD    . PRO B 1 106  ? 94.577  86.196  194.555 1.00 298.93 ? 106  PRO B CD    1 
ATOM   2563  N  N     . LYS B 1 107  ? 95.613  86.421  190.283 1.00 302.60 ? 107  LYS B N     1 
ATOM   2564  C  CA    . LYS B 1 107  ? 96.042  85.478  189.267 1.00 302.60 ? 107  LYS B CA    1 
ATOM   2565  C  C     . LYS B 1 107  ? 96.473  86.220  188.010 1.00 302.60 ? 107  LYS B C     1 
ATOM   2566  O  O     . LYS B 1 107  ? 96.582  87.449  187.980 1.00 302.60 ? 107  LYS B O     1 
ATOM   2567  C  CB    . LYS B 1 107  ? 94.924  84.477  188.953 1.00 302.60 ? 107  LYS B CB    1 
ATOM   2568  C  CG    . LYS B 1 107  ? 95.360  83.033  188.904 1.00 302.60 ? 107  LYS B CG    1 
ATOM   2569  C  CD    . LYS B 1 107  ? 94.166  82.141  188.662 1.00 302.60 ? 107  LYS B CD    1 
ATOM   2570  C  CE    . LYS B 1 107  ? 94.579  80.693  188.557 1.00 302.60 ? 107  LYS B CE    1 
ATOM   2571  N  NZ    . LYS B 1 107  ? 93.393  79.818  188.380 1.00 302.60 ? 107  LYS B NZ    1 
ATOM   2572  N  N     . GLU B 1 108  ? 96.758  85.439  186.974 1.00 302.78 ? 108  GLU B N     1 
ATOM   2573  C  CA    . GLU B 1 108  ? 96.970  85.938  185.629 1.00 302.78 ? 108  GLU B CA    1 
ATOM   2574  C  C     . GLU B 1 108  ? 96.157  85.085  184.679 1.00 302.78 ? 108  GLU B C     1 
ATOM   2575  O  O     . GLU B 1 108  ? 96.060  83.867  184.846 1.00 302.78 ? 108  GLU B O     1 
ATOM   2576  C  CB    . GLU B 1 108  ? 98.426  85.873  185.195 1.00 302.78 ? 108  GLU B CB    1 
ATOM   2577  C  CG    . GLU B 1 108  ? 99.383  86.662  186.025 1.00 302.78 ? 108  GLU B CG    1 
ATOM   2578  C  CD    . GLU B 1 108  ? 100.805 86.389  185.610 1.00 302.78 ? 108  GLU B CD    1 
ATOM   2579  O  OE1   . GLU B 1 108  ? 100.994 85.748  184.555 1.00 302.78 ? 108  GLU B OE1   1 
ATOM   2580  O  OE2   . GLU B 1 108  ? 101.732 86.806  186.333 1.00 302.78 ? 108  GLU B OE2   1 
ATOM   2581  N  N     . VAL B 1 109  ? 95.593  85.721  183.666 1.00 291.00 ? 109  VAL B N     1 
ATOM   2582  C  CA    . VAL B 1 109  ? 94.791  85.015  182.679 1.00 291.00 ? 109  VAL B CA    1 
ATOM   2583  C  C     . VAL B 1 109  ? 95.756  84.567  181.590 1.00 291.00 ? 109  VAL B C     1 
ATOM   2584  O  O     . VAL B 1 109  ? 96.053  85.294  180.643 1.00 291.00 ? 109  VAL B O     1 
ATOM   2585  C  CB    . VAL B 1 109  ? 93.654  85.873  182.140 1.00 291.00 ? 109  VAL B CB    1 
ATOM   2586  C  CG1   . VAL B 1 109  ? 92.706  85.009  181.335 1.00 291.00 ? 109  VAL B CG1   1 
ATOM   2587  C  CG2   . VAL B 1 109  ? 92.916  86.548  183.281 1.00 291.00 ? 109  VAL B CG2   1 
ATOM   2588  N  N     . LYS B 1 110  ? 96.281  83.361  181.751 1.00 308.57 ? 110  LYS B N     1 
ATOM   2589  C  CA    . LYS B 1 110  ? 96.955  82.700  180.653 1.00 308.57 ? 110  LYS B CA    1 
ATOM   2590  C  C     . LYS B 1 110  ? 95.932  81.943  179.832 1.00 308.57 ? 110  LYS B C     1 
ATOM   2591  O  O     . LYS B 1 110  ? 94.910  81.491  180.353 1.00 308.57 ? 110  LYS B O     1 
ATOM   2592  C  CB    . LYS B 1 110  ? 98.025  81.741  181.154 1.00 308.57 ? 110  LYS B CB    1 
ATOM   2593  C  CG    . LYS B 1 110  ? 99.192  82.418  181.778 1.00 308.57 ? 110  LYS B CG    1 
ATOM   2594  C  CD    . LYS B 1 110  ? 99.918  83.236  180.753 1.00 308.57 ? 110  LYS B CD    1 
ATOM   2595  C  CE    . LYS B 1 110  ? 100.888 84.145  181.443 1.00 308.57 ? 110  LYS B CE    1 
ATOM   2596  N  NZ    . LYS B 1 110  ? 100.156 84.941  182.452 1.00 308.57 ? 110  LYS B NZ    1 
ATOM   2597  N  N     . ALA B 1 111  ? 96.207  81.809  178.538 1.00 344.86 ? 111  ALA B N     1 
ATOM   2598  C  CA    . ALA B 1 111  ? 95.316  81.023  177.699 1.00 344.86 ? 111  ALA B CA    1 
ATOM   2599  C  C     . ALA B 1 111  ? 95.474  79.535  177.973 1.00 344.86 ? 111  ALA B C     1 
ATOM   2600  O  O     . ALA B 1 111  ? 94.542  78.760  177.739 1.00 344.86 ? 111  ALA B O     1 
ATOM   2601  C  CB    . ALA B 1 111  ? 95.566  81.341  176.228 1.00 344.86 ? 111  ALA B CB    1 
ATOM   2602  N  N     . ARG B 1 112  ? 96.626  79.123  178.512 1.00 358.65 ? 112  ARG B N     1 
ATOM   2603  C  CA    . ARG B 1 112  ? 96.810  77.735  178.923 1.00 358.65 ? 112  ARG B CA    1 
ATOM   2604  C  C     . ARG B 1 112  ? 95.999  77.377  180.156 1.00 358.65 ? 112  ARG B C     1 
ATOM   2605  O  O     . ARG B 1 112  ? 95.881  76.193  180.486 1.00 358.65 ? 112  ARG B O     1 
ATOM   2606  C  CB    . ARG B 1 112  ? 98.277  77.453  179.216 1.00 358.65 ? 112  ARG B CB    1 
ATOM   2607  C  CG    . ARG B 1 112  ? 98.829  78.284  180.346 1.00 358.65 ? 112  ARG B CG    1 
ATOM   2608  C  CD    . ARG B 1 112  ? 100.339 78.218  180.399 1.00 358.65 ? 112  ARG B CD    1 
ATOM   2609  N  NE    . ARG B 1 112  ? 100.951 78.509  179.106 1.00 358.65 ? 112  ARG B NE    1 
ATOM   2610  C  CZ    . ARG B 1 112  ? 101.662 77.632  178.403 1.00 358.65 ? 112  ARG B CZ    1 
ATOM   2611  N  NH1   . ARG B 1 112  ? 102.184 77.978  177.237 1.00 358.65 ? 112  ARG B NH1   1 
ATOM   2612  N  NH2   . ARG B 1 112  ? 101.845 76.404  178.868 1.00 358.65 ? 112  ARG B NH2   1 
ATOM   2613  N  N     . ASP B 1 113  ? 95.453  78.367  180.853 1.00 312.70 ? 113  ASP B N     1 
ATOM   2614  C  CA    . ASP B 1 113  ? 94.615  78.099  182.007 1.00 312.70 ? 113  ASP B CA    1 
ATOM   2615  C  C     . ASP B 1 113  ? 93.203  77.683  181.629 1.00 312.70 ? 113  ASP B C     1 
ATOM   2616  O  O     . ASP B 1 113  ? 92.414  77.375  182.526 1.00 312.70 ? 113  ASP B O     1 
ATOM   2617  C  CB    . ASP B 1 113  ? 94.561  79.338  182.894 1.00 312.70 ? 113  ASP B CB    1 
ATOM   2618  C  CG    . ASP B 1 113  ? 95.933  79.871  183.222 1.00 312.70 ? 113  ASP B CG    1 
ATOM   2619  O  OD1   . ASP B 1 113  ? 96.915  79.110  183.089 1.00 312.70 ? 113  ASP B OD1   1 
ATOM   2620  O  OD2   . ASP B 1 113  ? 96.030  81.052  183.617 1.00 312.70 ? 113  ASP B OD2   1 
ATOM   2621  N  N     . PHE B 1 114  ? 92.867  77.656  180.343 1.00 264.85 ? 114  PHE B N     1 
ATOM   2622  C  CA    . PHE B 1 114  ? 91.493  77.493  179.906 1.00 264.85 ? 114  PHE B CA    1 
ATOM   2623  C  C     . PHE B 1 114  ? 91.009  76.058  180.061 1.00 264.85 ? 114  PHE B C     1 
ATOM   2624  O  O     . PHE B 1 114  ? 91.727  75.167  180.519 1.00 264.85 ? 114  PHE B O     1 
ATOM   2625  C  CB    . PHE B 1 114  ? 91.342  77.921  178.457 1.00 264.85 ? 114  PHE B CB    1 
ATOM   2626  C  CG    . PHE B 1 114  ? 90.820  79.296  178.308 1.00 264.85 ? 114  PHE B CG    1 
ATOM   2627  C  CD1   . PHE B 1 114  ? 89.458  79.526  178.262 1.00 264.85 ? 114  PHE B CD1   1 
ATOM   2628  C  CD2   . PHE B 1 114  ? 91.688  80.367  178.234 1.00 264.85 ? 114  PHE B CD2   1 
ATOM   2629  C  CE1   . PHE B 1 114  ? 88.968  80.802  178.128 1.00 264.85 ? 114  PHE B CE1   1 
ATOM   2630  C  CE2   . PHE B 1 114  ? 91.207  81.646  178.107 1.00 264.85 ? 114  PHE B CE2   1 
ATOM   2631  C  CZ    . PHE B 1 114  ? 89.845  81.864  178.054 1.00 264.85 ? 114  PHE B CZ    1 
ATOM   2632  N  N     . LEU B 1 115  ? 89.760  75.855  179.656 1.00 236.85 ? 115  LEU B N     1 
ATOM   2633  C  CA    . LEU B 1 115  ? 89.143  74.548  179.740 1.00 236.85 ? 115  LEU B CA    1 
ATOM   2634  C  C     . LEU B 1 115  ? 89.791  73.588  178.747 1.00 236.85 ? 115  LEU B C     1 
ATOM   2635  O  O     . LEU B 1 115  ? 90.137  73.975  177.629 1.00 236.85 ? 115  LEU B O     1 
ATOM   2636  C  CB    . LEU B 1 115  ? 87.648  74.647  179.464 1.00 236.85 ? 115  LEU B CB    1 
ATOM   2637  C  CG    . LEU B 1 115  ? 86.814  75.225  180.603 1.00 236.85 ? 115  LEU B CG    1 
ATOM   2638  C  CD1   . LEU B 1 115  ? 85.342  75.046  180.305 1.00 236.85 ? 115  LEU B CD1   1 
ATOM   2639  C  CD2   . LEU B 1 115  ? 87.179  74.587  181.932 1.00 236.85 ? 115  LEU B CD2   1 
ATOM   2640  N  N     . PRO B 1 116  ? 89.983  72.333  179.142 1.00 265.44 ? 116  PRO B N     1 
ATOM   2641  C  CA    . PRO B 1 116  ? 90.599  71.363  178.233 1.00 265.44 ? 116  PRO B CA    1 
ATOM   2642  C  C     . PRO B 1 116  ? 89.608  70.949  177.160 1.00 265.44 ? 116  PRO B C     1 
ATOM   2643  O  O     . PRO B 1 116  ? 88.542  70.407  177.456 1.00 265.44 ? 116  PRO B O     1 
ATOM   2644  C  CB    . PRO B 1 116  ? 90.959  70.190  179.152 1.00 265.44 ? 116  PRO B CB    1 
ATOM   2645  C  CG    . PRO B 1 116  ? 90.782  70.713  180.555 1.00 265.44 ? 116  PRO B CG    1 
ATOM   2646  C  CD    . PRO B 1 116  ? 89.727  71.751  180.464 1.00 265.44 ? 116  PRO B CD    1 
ATOM   2647  N  N     . VAL B 1 117  ? 89.959  71.230  175.907 1.00 322.50 ? 117  VAL B N     1 
ATOM   2648  C  CA    . VAL B 1 117  ? 89.103  70.927  174.768 1.00 322.50 ? 117  VAL B CA    1 
ATOM   2649  C  C     . VAL B 1 117  ? 89.883  70.094  173.758 1.00 322.50 ? 117  VAL B C     1 
ATOM   2650  O  O     . VAL B 1 117  ? 91.116  70.138  173.700 1.00 322.50 ? 117  VAL B O     1 
ATOM   2651  C  CB    . VAL B 1 117  ? 88.535  72.211  174.114 1.00 322.50 ? 117  VAL B CB    1 
ATOM   2652  C  CG1   . VAL B 1 117  ? 87.730  73.028  175.119 1.00 322.50 ? 117  VAL B CG1   1 
ATOM   2653  C  CG2   . VAL B 1 117  ? 89.651  73.063  173.559 1.00 322.50 ? 117  VAL B CG2   1 
ATOM   2654  N  N     . ALA B 1 118  ? 89.151  69.311  172.975 1.00 334.44 ? 118  ALA B N     1 
ATOM   2655  C  CA    . ALA B 1 118  ? 89.725  68.457  171.948 1.00 334.44 ? 118  ALA B CA    1 
ATOM   2656  C  C     . ALA B 1 118  ? 89.684  69.158  170.597 1.00 334.44 ? 118  ALA B C     1 
ATOM   2657  O  O     . ALA B 1 118  ? 88.836  70.018  170.349 1.00 334.44 ? 118  ALA B O     1 
ATOM   2658  C  CB    . ALA B 1 118  ? 88.979  67.125  171.872 1.00 334.44 ? 118  ALA B CB    1 
ATOM   2659  N  N     . ASP B 1 119  ? 90.670  68.823  169.752 1.00 375.28 ? 119  ASP B N     1 
ATOM   2660  C  CA    . ASP B 1 119  ? 90.832  69.289  168.369 1.00 375.28 ? 119  ASP B CA    1 
ATOM   2661  C  C     . ASP B 1 119  ? 91.027  70.794  168.232 1.00 375.28 ? 119  ASP B C     1 
ATOM   2662  O  O     . ASP B 1 119  ? 91.018  71.321  167.118 1.00 375.28 ? 119  ASP B O     1 
ATOM   2663  C  CB    . ASP B 1 119  ? 89.644  68.867  167.497 1.00 375.28 ? 119  ASP B CB    1 
ATOM   2664  C  CG    . ASP B 1 119  ? 89.839  67.513  166.859 1.00 375.28 ? 119  ASP B CG    1 
ATOM   2665  O  OD1   . ASP B 1 119  ? 90.965  67.218  166.416 1.00 375.28 ? 119  ASP B OD1   1 
ATOM   2666  O  OD2   . ASP B 1 119  ? 88.859  66.744  166.794 1.00 375.28 ? 119  ASP B OD2   1 
ATOM   2667  N  N     . VAL B 1 120  ? 91.157  71.506  169.345 1.00 352.86 ? 120  VAL B N     1 
ATOM   2668  C  CA    . VAL B 1 120  ? 91.262  72.957  169.346 1.00 352.86 ? 120  VAL B CA    1 
ATOM   2669  C  C     . VAL B 1 120  ? 92.405  73.295  170.289 1.00 352.86 ? 120  VAL B C     1 
ATOM   2670  O  O     . VAL B 1 120  ? 92.220  73.346  171.509 1.00 352.86 ? 120  VAL B O     1 
ATOM   2671  C  CB    . VAL B 1 120  ? 89.952  73.635  169.801 1.00 352.86 ? 120  VAL B CB    1 
ATOM   2672  C  CG1   . VAL B 1 120  ? 90.093  75.140  169.762 1.00 352.86 ? 120  VAL B CG1   1 
ATOM   2673  C  CG2   . VAL B 1 120  ? 88.740  73.200  168.975 1.00 352.86 ? 120  VAL B CG2   1 
ATOM   2674  N  N     . GLU B 1 121  ? 93.599  73.493  169.754 1.00 374.18 ? 121  GLU B N     1 
ATOM   2675  C  CA    . GLU B 1 121  ? 94.760  73.731  170.593 1.00 374.18 ? 121  GLU B CA    1 
ATOM   2676  C  C     . GLU B 1 121  ? 95.354  75.097  170.296 1.00 374.18 ? 121  GLU B C     1 
ATOM   2677  O  O     . GLU B 1 121  ? 95.435  75.519  169.139 1.00 374.18 ? 121  GLU B O     1 
ATOM   2678  C  CB    . GLU B 1 121  ? 95.798  72.627  170.412 1.00 374.18 ? 121  GLU B CB    1 
ATOM   2679  C  CG    . GLU B 1 121  ? 96.101  72.299  168.983 1.00 374.18 ? 121  GLU B CG    1 
ATOM   2680  C  CD    . GLU B 1 121  ? 97.253  73.096  168.442 1.00 374.18 ? 121  GLU B CD    1 
ATOM   2681  O  OE1   . GLU B 1 121  ? 98.016  73.651  169.260 1.00 374.18 ? 121  GLU B OE1   1 
ATOM   2682  O  OE2   . GLU B 1 121  ? 97.390  73.176  167.205 1.00 374.18 ? 121  GLU B OE2   1 
ATOM   2683  N  N     . ILE B 1 122  ? 95.765  75.781  171.360 1.00 367.21 ? 122  ILE B N     1 
ATOM   2684  C  CA    . ILE B 1 122  ? 96.162  77.174  171.257 1.00 367.21 ? 122  ILE B CA    1 
ATOM   2685  C  C     . ILE B 1 122  ? 97.613  77.255  170.818 1.00 367.21 ? 122  ILE B C     1 
ATOM   2686  O  O     . ILE B 1 122  ? 98.477  76.539  171.340 1.00 367.21 ? 122  ILE B O     1 
ATOM   2687  C  CB    . ILE B 1 122  ? 95.952  77.861  172.613 1.00 367.21 ? 122  ILE B CB    1 
ATOM   2688  C  CG1   . ILE B 1 122  ? 94.538  77.591  173.105 1.00 367.21 ? 122  ILE B CG1   1 
ATOM   2689  C  CG2   . ILE B 1 122  ? 96.122  79.348  172.486 1.00 367.21 ? 122  ILE B CG2   1 
ATOM   2690  C  CD1   . ILE B 1 122  ? 94.336  77.951  174.546 1.00 367.21 ? 122  ILE B CD1   1 
ATOM   2691  N  N     . MET B 1 123  ? 97.896  78.130  169.859 1.00 378.79 ? 123  MET B N     1 
ATOM   2692  C  CA    . MET B 1 123  ? 99.275  78.321  169.439 1.00 378.79 ? 123  MET B CA    1 
ATOM   2693  C  C     . MET B 1 123  ? 100.016 79.336  170.290 1.00 378.79 ? 123  MET B C     1 
ATOM   2694  O  O     . MET B 1 123  ? 101.243 79.431  170.181 1.00 378.79 ? 123  MET B O     1 
ATOM   2695  C  CB    . MET B 1 123  ? 99.337  78.734  167.969 1.00 378.79 ? 123  MET B CB    1 
ATOM   2696  C  CG    . MET B 1 123  ? 98.284  78.075  167.102 1.00 378.79 ? 123  MET B CG    1 
ATOM   2697  S  SD    . MET B 1 123  ? 98.094  76.328  167.454 1.00 378.79 ? 123  MET B SD    1 
ATOM   2698  C  CE    . MET B 1 123  ? 99.659  75.661  166.890 1.00 378.79 ? 123  MET B CE    1 
ATOM   2699  N  N     . ASN B 1 124  ? 99.315  80.094  171.127 1.00 363.02 ? 124  ASN B N     1 
ATOM   2700  C  CA    . ASN B 1 124  ? 99.954  80.869  172.189 1.00 363.02 ? 124  ASN B CA    1 
ATOM   2701  C  C     . ASN B 1 124  ? 99.170  80.709  173.482 1.00 363.02 ? 124  ASN B C     1 
ATOM   2702  O  O     . ASN B 1 124  ? 98.482  81.630  173.927 1.00 363.02 ? 124  ASN B O     1 
ATOM   2703  C  CB    . ASN B 1 124  ? 100.070 82.341  171.808 1.00 363.02 ? 124  ASN B CB    1 
ATOM   2704  C  CG    . ASN B 1 124  ? 101.128 83.051  172.606 1.00 363.02 ? 124  ASN B CG    1 
ATOM   2705  O  OD1   . ASN B 1 124  ? 100.864 83.554  173.695 1.00 363.02 ? 124  ASN B OD1   1 
ATOM   2706  N  ND2   . ASN B 1 124  ? 102.344 83.078  172.082 1.00 363.02 ? 124  ASN B ND2   1 
ATOM   2707  N  N     . PRO B 1 125  ? 99.262  79.544  174.126 1.00 365.95 ? 125  PRO B N     1 
ATOM   2708  C  CA    . PRO B 1 125  ? 98.543  79.362  175.392 1.00 365.95 ? 125  PRO B CA    1 
ATOM   2709  C  C     . PRO B 1 125  ? 99.196  80.089  176.547 1.00 365.95 ? 125  PRO B C     1 
ATOM   2710  O  O     . PRO B 1 125  ? 98.559  80.291  177.587 1.00 365.95 ? 125  PRO B O     1 
ATOM   2711  C  CB    . PRO B 1 125  ? 98.563  77.845  175.584 1.00 365.95 ? 125  PRO B CB    1 
ATOM   2712  C  CG    . PRO B 1 125  ? 99.812  77.420  174.935 1.00 365.95 ? 125  PRO B CG    1 
ATOM   2713  C  CD    . PRO B 1 125  ? 100.090 78.369  173.801 1.00 365.95 ? 125  PRO B CD    1 
ATOM   2714  N  N     . ASP B 1 126  ? 100.440 80.524  176.376 1.00 363.67 ? 126  ASP B N     1 
ATOM   2715  C  CA    . ASP B 1 126  ? 101.161 81.377  177.308 1.00 363.67 ? 126  ASP B CA    1 
ATOM   2716  C  C     . ASP B 1 126  ? 100.732 82.828  177.246 1.00 363.67 ? 126  ASP B C     1 
ATOM   2717  O  O     . ASP B 1 126  ? 101.406 83.664  177.857 1.00 363.67 ? 126  ASP B O     1 
ATOM   2718  C  CB    . ASP B 1 126  ? 102.653 81.306  177.015 1.00 363.67 ? 126  ASP B CB    1 
ATOM   2719  C  CG    . ASP B 1 126  ? 102.944 81.340  175.532 1.00 363.67 ? 126  ASP B CG    1 
ATOM   2720  O  OD1   . ASP B 1 126  ? 102.031 81.034  174.745 1.00 363.67 ? 126  ASP B OD1   1 
ATOM   2721  O  OD2   . ASP B 1 126  ? 104.072 81.698  175.148 1.00 363.67 ? 126  ASP B OD2   1 
ATOM   2722  N  N     . LEU B 1 127  ? 99.673  83.156  176.509 1.00 315.01 ? 127  LEU B N     1 
ATOM   2723  C  CA    . LEU B 1 127  ? 99.228  84.533  176.381 1.00 315.01 ? 127  LEU B CA    1 
ATOM   2724  C  C     . LEU B 1 127  ? 98.703  85.051  177.706 1.00 315.01 ? 127  LEU B C     1 
ATOM   2725  O  O     . LEU B 1 127  ? 97.646  84.625  178.172 1.00 315.01 ? 127  LEU B O     1 
ATOM   2726  C  CB    . LEU B 1 127  ? 98.147  84.661  175.311 1.00 315.01 ? 127  LEU B CB    1 
ATOM   2727  C  CG    . LEU B 1 127  ? 97.541  86.063  175.214 1.00 315.01 ? 127  LEU B CG    1 
ATOM   2728  C  CD1   . LEU B 1 127  ? 98.585  87.064  174.754 1.00 315.01 ? 127  LEU B CD1   1 
ATOM   2729  C  CD2   . LEU B 1 127  ? 96.332  86.076  174.300 1.00 315.01 ? 127  LEU B CD2   1 
ATOM   2730  N  N     . HIS B 1 128  ? 99.452  85.951  178.326 1.00 295.95 ? 128  HIS B N     1 
ATOM   2731  C  CA    . HIS B 1 128  ? 98.926  86.651  179.479 1.00 295.95 ? 128  HIS B CA    1 
ATOM   2732  C  C     . HIS B 1 128  ? 97.828  87.583  179.010 1.00 295.95 ? 128  HIS B C     1 
ATOM   2733  O  O     . HIS B 1 128  ? 98.113  88.661  178.481 1.00 295.95 ? 128  HIS B O     1 
ATOM   2734  C  CB    . HIS B 1 128  ? 100.010 87.453  180.183 1.00 295.95 ? 128  HIS B CB    1 
ATOM   2735  C  CG    . HIS B 1 128  ? 99.480  88.319  181.276 1.00 295.95 ? 128  HIS B CG    1 
ATOM   2736  N  ND1   . HIS B 1 128  ? 99.226  87.841  182.541 1.00 295.95 ? 128  HIS B ND1   1 
ATOM   2737  C  CD2   . HIS B 1 128  ? 99.120  89.623  181.285 1.00 295.95 ? 128  HIS B CD2   1 
ATOM   2738  C  CE1   . HIS B 1 128  ? 98.758  88.821  183.292 1.00 295.95 ? 128  HIS B CE1   1 
ATOM   2739  N  NE2   . HIS B 1 128  ? 98.674  89.910  182.550 1.00 295.95 ? 128  HIS B NE2   1 
ATOM   2740  N  N     . ILE B 1 129  ? 96.574  87.168  179.162 1.00 291.94 ? 129  ILE B N     1 
ATOM   2741  C  CA    . ILE B 1 129  ? 95.477  88.073  178.850 1.00 291.94 ? 129  ILE B CA    1 
ATOM   2742  C  C     . ILE B 1 129  ? 95.438  89.200  179.872 1.00 291.94 ? 129  ILE B C     1 
ATOM   2743  O  O     . ILE B 1 129  ? 95.665  90.367  179.542 1.00 291.94 ? 129  ILE B O     1 
ATOM   2744  C  CB    . ILE B 1 129  ? 94.140  87.312  178.776 1.00 291.94 ? 129  ILE B CB    1 
ATOM   2745  C  CG1   . ILE B 1 129  ? 94.084  86.407  177.542 1.00 291.94 ? 129  ILE B CG1   1 
ATOM   2746  C  CG2   . ILE B 1 129  ? 92.942  88.257  178.818 1.00 291.94 ? 129  ILE B CG2   1 
ATOM   2747  C  CD1   . ILE B 1 129  ? 94.415  84.954  177.800 1.00 291.94 ? 129  ILE B CD1   1 
ATOM   2748  N  N     . ALA B 1 130  ? 95.234  88.862  181.138 1.00 298.98 ? 130  ALA B N     1 
ATOM   2749  C  CA    . ALA B 1 130  ? 95.020  89.915  182.113 1.00 298.98 ? 130  ALA B CA    1 
ATOM   2750  C  C     . ALA B 1 130  ? 95.564  89.481  183.458 1.00 298.98 ? 130  ALA B C     1 
ATOM   2751  O  O     . ALA B 1 130  ? 95.662  88.290  183.756 1.00 298.98 ? 130  ALA B O     1 
ATOM   2752  C  CB    . ALA B 1 130  ? 93.537  90.271  182.228 1.00 298.98 ? 130  ALA B CB    1 
ATOM   2753  N  N     . THR B 1 131  ? 95.947  90.469  184.255 1.00 301.12 ? 131  THR B N     1 
ATOM   2754  C  CA    . THR B 1 131  ? 96.273  90.253  185.653 1.00 301.12 ? 131  THR B CA    1 
ATOM   2755  C  C     . THR B 1 131  ? 94.968  90.141  186.416 1.00 301.12 ? 131  THR B C     1 
ATOM   2756  O  O     . THR B 1 131  ? 94.108  91.020  186.314 1.00 301.12 ? 131  THR B O     1 
ATOM   2757  C  CB    . THR B 1 131  ? 97.097  91.399  186.238 1.00 301.12 ? 131  THR B CB    1 
ATOM   2758  O  OG1   . THR B 1 131  ? 96.249  92.541  186.417 1.00 301.12 ? 131  THR B OG1   1 
ATOM   2759  C  CG2   . THR B 1 131  ? 98.228  91.774  185.311 1.00 301.12 ? 131  THR B CG2   1 
ATOM   2760  N  N     . LEU B 1 132  ? 94.814  89.060  187.158 1.00 284.77 ? 132  LEU B N     1 
ATOM   2761  C  CA    . LEU B 1 132  ? 93.664  88.944  188.027 1.00 284.77 ? 132  LEU B CA    1 
ATOM   2762  C  C     . LEU B 1 132  ? 94.051  89.379  189.429 1.00 284.77 ? 132  LEU B C     1 
ATOM   2763  O  O     . LEU B 1 132  ? 95.199  89.225  189.854 1.00 284.77 ? 132  LEU B O     1 
ATOM   2764  C  CB    . LEU B 1 132  ? 93.149  87.517  188.038 1.00 284.77 ? 132  LEU B CB    1 
ATOM   2765  C  CG    . LEU B 1 132  ? 91.680  87.359  188.374 1.00 284.77 ? 132  LEU B CG    1 
ATOM   2766  C  CD1   . LEU B 1 132  ? 90.858  87.970  187.276 1.00 284.77 ? 132  LEU B CD1   1 
ATOM   2767  C  CD2   . LEU B 1 132  ? 91.395  85.907  188.498 1.00 284.77 ? 132  LEU B CD2   1 
ATOM   2768  N  N     . GLU B 1 133  ? 93.088  89.937  190.143 1.00 281.95 ? 133  GLU B N     1 
ATOM   2769  C  CA    . GLU B 1 133  ? 93.370  90.583  191.409 1.00 281.95 ? 133  GLU B CA    1 
ATOM   2770  C  C     . GLU B 1 133  ? 92.553  89.930  192.513 1.00 281.95 ? 133  GLU B C     1 
ATOM   2771  O  O     . GLU B 1 133  ? 91.573  89.226  192.251 1.00 281.95 ? 133  GLU B O     1 
ATOM   2772  C  CB    . GLU B 1 133  ? 93.079  92.085  191.325 1.00 281.95 ? 133  GLU B CB    1 
ATOM   2773  C  CG    . GLU B 1 133  ? 94.137  92.884  190.576 1.00 281.95 ? 133  GLU B CG    1 
ATOM   2774  C  CD    . GLU B 1 133  ? 94.037  92.724  189.075 1.00 281.95 ? 133  GLU B CD    1 
ATOM   2775  O  OE1   . GLU B 1 133  ? 92.964  92.316  188.603 1.00 281.95 ? 133  GLU B OE1   1 
ATOM   2776  O  OE2   . GLU B 1 133  ? 95.024  93.001  188.369 1.00 281.95 ? 133  GLU B OE2   1 
ATOM   2777  N  N     . GLU B 1 134  ? 92.983  90.183  193.750 1.00 295.58 ? 134  GLU B N     1 
ATOM   2778  C  CA    . GLU B 1 134  ? 92.415  89.546  194.934 1.00 295.58 ? 134  GLU B CA    1 
ATOM   2779  C  C     . GLU B 1 134  ? 90.949  89.902  195.099 1.00 295.58 ? 134  GLU B C     1 
ATOM   2780  O  O     . GLU B 1 134  ? 90.580  91.078  195.129 1.00 295.58 ? 134  GLU B O     1 
ATOM   2781  C  CB    . GLU B 1 134  ? 93.185  89.982  196.179 1.00 295.58 ? 134  GLU B CB    1 
ATOM   2782  C  CG    . GLU B 1 134  ? 94.608  89.490  196.252 1.00 295.58 ? 134  GLU B CG    1 
ATOM   2783  C  CD    . GLU B 1 134  ? 95.595  90.410  195.560 1.00 295.58 ? 134  GLU B CD    1 
ATOM   2784  O  OE1   . GLU B 1 134  ? 96.813  90.178  195.700 1.00 295.58 ? 134  GLU B OE1   1 
ATOM   2785  O  OE2   . GLU B 1 134  ? 95.158  91.356  194.870 1.00 295.58 ? 134  GLU B OE2   1 
ATOM   2786  N  N     . GLY B 1 135  ? 90.112  88.876  195.174 1.00 292.42 ? 135  GLY B N     1 
ATOM   2787  C  CA    . GLY B 1 135  ? 88.683  89.090  195.218 1.00 292.42 ? 135  GLY B CA    1 
ATOM   2788  C  C     . GLY B 1 135  ? 88.068  89.121  193.837 1.00 292.42 ? 135  GLY B C     1 
ATOM   2789  O  O     . GLY B 1 135  ? 86.904  88.750  193.664 1.00 292.42 ? 135  GLY B O     1 
ATOM   2790  N  N     . GLY B 1 136  ? 88.838  89.575  192.848 1.00 283.86 ? 136  GLY B N     1 
ATOM   2791  C  CA    . GLY B 1 136  ? 88.389  89.577  191.476 1.00 283.86 ? 136  GLY B CA    1 
ATOM   2792  C  C     . GLY B 1 136  ? 88.241  88.166  190.963 1.00 283.86 ? 136  GLY B C     1 
ATOM   2793  O  O     . GLY B 1 136  ? 89.229  87.470  190.714 1.00 283.86 ? 136  GLY B O     1 
ATOM   2794  N  N     . ARG B 1 137  ? 86.997  87.733  190.825 1.00 278.92 ? 137  ARG B N     1 
ATOM   2795  C  CA    . ARG B 1 137  ? 86.709  86.396  190.352 1.00 278.92 ? 137  ARG B CA    1 
ATOM   2796  C  C     . ARG B 1 137  ? 86.528  86.404  188.841 1.00 278.92 ? 137  ARG B C     1 
ATOM   2797  O  O     . ARG B 1 137  ? 86.741  87.410  188.162 1.00 278.92 ? 137  ARG B O     1 
ATOM   2798  C  CB    . ARG B 1 137  ? 85.474  85.835  191.044 1.00 278.92 ? 137  ARG B CB    1 
ATOM   2799  C  CG    . ARG B 1 137  ? 85.616  85.714  192.540 1.00 278.92 ? 137  ARG B CG    1 
ATOM   2800  C  CD    . ARG B 1 137  ? 84.306  85.278  193.153 1.00 278.92 ? 137  ARG B CD    1 
ATOM   2801  N  NE    . ARG B 1 137  ? 83.613  84.321  192.298 1.00 278.92 ? 137  ARG B NE    1 
ATOM   2802  C  CZ    . ARG B 1 137  ? 83.739  83.004  192.400 1.00 278.92 ? 137  ARG B CZ    1 
ATOM   2803  N  NH1   . ARG B 1 137  ? 84.528  82.482  193.328 1.00 278.92 ? 137  ARG B NH1   1 
ATOM   2804  N  NH2   . ARG B 1 137  ? 83.072  82.209  191.578 1.00 278.92 ? 137  ARG B NH2   1 
ATOM   2805  N  N     . LEU B 1 138  ? 86.362  85.206  188.272 1.00 275.53 ? 138  LEU B N     1 
ATOM   2806  C  CA    . LEU B 1 138  ? 86.231  85.136  186.793 1.00 275.53 ? 138  LEU B CA    1 
ATOM   2807  C  C     . LEU B 1 138  ? 85.262  84.038  186.344 1.00 275.53 ? 138  LEU B C     1 
ATOM   2808  O  O     . LEU B 1 138  ? 85.458  82.867  186.726 1.00 275.53 ? 138  LEU B O     1 
ATOM   2809  C  CB    . LEU B 1 138  ? 87.622  84.914  186.189 1.00 275.53 ? 138  LEU B CB    1 
ATOM   2810  C  CG    . LEU B 1 138  ? 87.668  84.814  184.665 1.00 275.53 ? 138  LEU B CG    1 
ATOM   2811  C  CD1   . LEU B 1 138  ? 87.070  86.056  184.022 1.00 275.53 ? 138  LEU B CD1   1 
ATOM   2812  C  CD2   . LEU B 1 138  ? 89.093  84.596  184.179 1.00 275.53 ? 138  LEU B CD2   1 
ATOM   2813  N  N     . ASN B 1 139  ? 84.269  84.431  185.545 1.00 267.49 ? 139  ASN B N     1 
ATOM   2814  C  CA    . ASN B 1 139  ? 83.301  83.518  184.882 1.00 267.49 ? 139  ASN B CA    1 
ATOM   2815  C  C     . ASN B 1 139  ? 83.229  84.016  183.437 1.00 267.49 ? 139  ASN B C     1 
ATOM   2816  O  O     . ASN B 1 139  ? 82.965  85.223  183.270 1.00 267.49 ? 139  ASN B O     1 
ATOM   2817  C  CB    . ASN B 1 139  ? 81.933  83.544  185.568 1.00 267.49 ? 139  ASN B CB    1 
ATOM   2818  C  CG    . ASN B 1 139  ? 80.932  82.607  184.926 1.00 267.49 ? 139  ASN B CG    1 
ATOM   2819  O  OD1   . ASN B 1 139  ? 81.250  81.922  183.956 1.00 267.49 ? 139  ASN B OD1   1 
ATOM   2820  N  ND2   . ASN B 1 139  ? 79.722  82.570  185.459 1.00 267.49 ? 139  ASN B ND2   1 
ATOM   2821  N  N     . MET B 1 140  ? 83.430  83.164  182.427 1.00 270.80 ? 140  MET B N     1 
ATOM   2822  C  CA    . MET B 1 140  ? 83.391  83.762  181.107 1.00 270.80 ? 140  MET B CA    1 
ATOM   2823  C  C     . MET B 1 140  ? 82.823  82.763  180.120 1.00 270.80 ? 140  MET B C     1 
ATOM   2824  O  O     . MET B 1 140  ? 82.839  81.553  180.356 1.00 270.80 ? 140  MET B O     1 
ATOM   2825  C  CB    . MET B 1 140  ? 84.778  84.217  180.649 1.00 270.80 ? 140  MET B CB    1 
ATOM   2826  C  CG    . MET B 1 140  ? 85.720  83.079  180.346 1.00 270.80 ? 140  MET B CG    1 
ATOM   2827  S  SD    . MET B 1 140  ? 87.302  83.670  179.747 1.00 270.80 ? 140  MET B SD    1 
ATOM   2828  C  CE    . MET B 1 140  ? 86.758  84.670  178.366 1.00 270.80 ? 140  MET B CE    1 
ATOM   2829  N  N     . GLU B 1 141  ? 82.276  83.298  179.040 1.00 249.36 ? 141  GLU B N     1 
ATOM   2830  C  CA    . GLU B 1 141  ? 81.994  82.554  177.828 1.00 249.36 ? 141  GLU B CA    1 
ATOM   2831  C  C     . GLU B 1 141  ? 82.707  83.263  176.697 1.00 249.36 ? 141  GLU B C     1 
ATOM   2832  O  O     . GLU B 1 141  ? 82.827  84.490  176.707 1.00 249.36 ? 141  GLU B O     1 
ATOM   2833  C  CB    . GLU B 1 141  ? 80.502  82.480  177.528 1.00 249.36 ? 141  GLU B CB    1 
ATOM   2834  C  CG    . GLU B 1 141  ? 79.634  82.267  178.738 1.00 249.36 ? 141  GLU B CG    1 
ATOM   2835  C  CD    . GLU B 1 141  ? 78.179  82.139  178.373 1.00 249.36 ? 141  GLU B CD    1 
ATOM   2836  O  OE1   . GLU B 1 141  ? 77.869  82.141  177.165 1.00 249.36 ? 141  GLU B OE1   1 
ATOM   2837  O  OE2   . GLU B 1 141  ? 77.346  82.048  179.294 1.00 249.36 ? 141  GLU B OE2   1 
ATOM   2838  N  N     . VAL B 1 142  ? 83.194  82.491  175.738 1.00 250.71 ? 142  VAL B N     1 
ATOM   2839  C  CA    . VAL B 1 142  ? 83.894  83.033  174.585 1.00 250.71 ? 142  VAL B CA    1 
ATOM   2840  C  C     . VAL B 1 142  ? 83.686  82.101  173.402 1.00 250.71 ? 142  VAL B C     1 
ATOM   2841  O  O     . VAL B 1 142  ? 83.982  80.905  173.478 1.00 250.71 ? 142  VAL B O     1 
ATOM   2842  C  CB    . VAL B 1 142  ? 85.386  83.279  174.895 1.00 250.71 ? 142  VAL B CB    1 
ATOM   2843  C  CG1   . VAL B 1 142  ? 85.977  82.146  175.694 1.00 250.71 ? 142  VAL B CG1   1 
ATOM   2844  C  CG2   . VAL B 1 142  ? 86.166  83.427  173.613 1.00 250.71 ? 142  VAL B CG2   1 
ATOM   2845  N  N     . ARG B 1 143  ? 83.149  82.648  172.320 1.00 271.49 ? 143  ARG B N     1 
ATOM   2846  C  CA    . ARG B 1 143  ? 82.795  81.873  171.145 1.00 271.49 ? 143  ARG B CA    1 
ATOM   2847  C  C     . ARG B 1 143  ? 83.826  82.120  170.055 1.00 271.49 ? 143  ARG B C     1 
ATOM   2848  O  O     . ARG B 1 143  ? 84.030  83.262  169.634 1.00 271.49 ? 143  ARG B O     1 
ATOM   2849  C  CB    . ARG B 1 143  ? 81.394  82.244  170.666 1.00 271.49 ? 143  ARG B CB    1 
ATOM   2850  C  CG    . ARG B 1 143  ? 80.931  81.484  169.459 1.00 271.49 ? 143  ARG B CG    1 
ATOM   2851  C  CD    . ARG B 1 143  ? 81.155  80.015  169.641 1.00 271.49 ? 143  ARG B CD    1 
ATOM   2852  N  NE    . ARG B 1 143  ? 80.412  79.228  168.681 1.00 271.49 ? 143  ARG B NE    1 
ATOM   2853  C  CZ    . ARG B 1 143  ? 79.238  78.673  168.939 1.00 271.49 ? 143  ARG B CZ    1 
ATOM   2854  N  NH1   . ARG B 1 143  ? 78.681  78.830  170.130 1.00 271.49 ? 143  ARG B NH1   1 
ATOM   2855  N  NH2   . ARG B 1 143  ? 78.623  77.967  168.003 1.00 271.49 ? 143  ARG B NH2   1 
ATOM   2856  N  N     . VAL B 1 144  ? 84.466  81.049  169.601 1.00 279.61 ? 144  VAL B N     1 
ATOM   2857  C  CA    . VAL B 1 144  ? 85.500  81.113  168.580 1.00 279.61 ? 144  VAL B CA    1 
ATOM   2858  C  C     . VAL B 1 144  ? 85.064  80.262  167.401 1.00 279.61 ? 144  VAL B C     1 
ATOM   2859  O  O     . VAL B 1 144  ? 84.826  79.060  167.556 1.00 279.61 ? 144  VAL B O     1 
ATOM   2860  C  CB    . VAL B 1 144  ? 86.856  80.628  169.112 1.00 279.61 ? 144  VAL B CB    1 
ATOM   2861  C  CG1   . VAL B 1 144  ? 87.904  80.734  168.023 1.00 279.61 ? 144  VAL B CG1   1 
ATOM   2862  C  CG2   . VAL B 1 144  ? 87.256  81.422  170.333 1.00 279.61 ? 144  VAL B CG2   1 
ATOM   2863  N  N     . ASP B 1 145  ? 84.954  80.884  166.229 1.00 298.95 ? 145  ASP B N     1 
ATOM   2864  C  CA    . ASP B 1 145  ? 84.438  80.230  165.034 1.00 298.95 ? 145  ASP B CA    1 
ATOM   2865  C  C     . ASP B 1 145  ? 85.532  80.125  163.979 1.00 298.95 ? 145  ASP B C     1 
ATOM   2866  O  O     . ASP B 1 145  ? 86.651  80.598  164.174 1.00 298.95 ? 145  ASP B O     1 
ATOM   2867  C  CB    . ASP B 1 145  ? 83.233  80.985  164.460 1.00 298.95 ? 145  ASP B CB    1 
ATOM   2868  C  CG    . ASP B 1 145  ? 82.151  81.251  165.498 1.00 298.95 ? 145  ASP B CG    1 
ATOM   2869  O  OD1   . ASP B 1 145  ? 82.184  80.641  166.580 1.00 298.95 ? 145  ASP B OD1   1 
ATOM   2870  O  OD2   . ASP B 1 145  ? 81.253  82.076  165.228 1.00 298.95 ? 145  ASP B OD2   1 
ATOM   2871  N  N     . ARG B 1 146  ? 85.194  79.510  162.844 1.00 303.88 ? 146  ARG B N     1 
ATOM   2872  C  CA    . ARG B 1 146  ? 86.098  79.386  161.708 1.00 303.88 ? 146  ARG B CA    1 
ATOM   2873  C  C     . ARG B 1 146  ? 85.495  80.022  160.460 1.00 303.88 ? 146  ARG B C     1 
ATOM   2874  O  O     . ARG B 1 146  ? 84.276  80.093  160.297 1.00 303.88 ? 146  ARG B O     1 
ATOM   2875  C  CB    . ARG B 1 146  ? 86.435  77.922  161.414 1.00 303.88 ? 146  ARG B CB    1 
ATOM   2876  C  CG    . ARG B 1 146  ? 87.844  77.707  160.913 1.00 303.88 ? 146  ARG B CG    1 
ATOM   2877  C  CD    . ARG B 1 146  ? 87.932  76.472  160.062 1.00 303.88 ? 146  ARG B CD    1 
ATOM   2878  N  NE    . ARG B 1 146  ? 87.619  75.278  160.834 1.00 303.88 ? 146  ARG B NE    1 
ATOM   2879  C  CZ    . ARG B 1 146  ? 87.473  74.068  160.309 1.00 303.88 ? 146  ARG B CZ    1 
ATOM   2880  N  NH1   . ARG B 1 146  ? 87.596  73.891  159.002 1.00 303.88 ? 146  ARG B NH1   1 
ATOM   2881  N  NH2   . ARG B 1 146  ? 87.189  73.035  161.088 1.00 303.88 ? 146  ARG B NH2   1 
ATOM   2882  N  N     . GLY B 1 147  ? 86.374  80.486  159.580 1.00 258.20 ? 147  GLY B N     1 
ATOM   2883  C  CA    . GLY B 1 147  ? 85.990  81.163  158.346 1.00 258.20 ? 147  GLY B CA    1 
ATOM   2884  C  C     . GLY B 1 147  ? 87.228  81.708  157.650 1.00 258.20 ? 147  GLY B C     1 
ATOM   2885  O  O     . GLY B 1 147  ? 88.328  81.198  157.835 1.00 258.20 ? 147  GLY B O     1 
ATOM   2886  N  N     . VAL B 1 148  ? 87.034  82.757  156.848 1.00 233.93 ? 148  VAL B N     1 
ATOM   2887  C  CA    . VAL B 1 148  ? 88.162  83.447  156.236 1.00 233.93 ? 148  VAL B CA    1 
ATOM   2888  C  C     . VAL B 1 148  ? 88.077  84.928  156.563 1.00 233.93 ? 148  VAL B C     1 
ATOM   2889  O  O     . VAL B 1 148  ? 87.025  85.453  156.930 1.00 233.93 ? 148  VAL B O     1 
ATOM   2890  C  CB    . VAL B 1 148  ? 88.260  83.260  154.699 1.00 233.93 ? 148  VAL B CB    1 
ATOM   2891  C  CG1   . VAL B 1 148  ? 88.256  81.799  154.310 1.00 233.93 ? 148  VAL B CG1   1 
ATOM   2892  C  CG2   . VAL B 1 148  ? 87.151  83.997  153.990 1.00 233.93 ? 148  VAL B CG2   1 
ATOM   2893  N  N     . GLY B 1 149  ? 89.219  85.595  156.426 1.00 225.68 ? 149  GLY B N     1 
ATOM   2894  C  CA    . GLY B 1 149  ? 89.373  87.031  156.471 1.00 225.68 ? 149  GLY B CA    1 
ATOM   2895  C  C     . GLY B 1 149  ? 88.962  87.671  157.785 1.00 225.68 ? 149  GLY B C     1 
ATOM   2896  O  O     . GLY B 1 149  ? 88.869  87.036  158.837 1.00 225.68 ? 149  GLY B O     1 
ATOM   2897  N  N     . TYR B 1 150  ? 88.716  88.971  157.696 1.00 221.84 ? 150  TYR B N     1 
ATOM   2898  C  CA    . TYR B 1 150  ? 88.197  89.746  158.805 1.00 221.84 ? 150  TYR B CA    1 
ATOM   2899  C  C     . TYR B 1 150  ? 86.702  89.948  158.620 1.00 221.84 ? 150  TYR B C     1 
ATOM   2900  O  O     . TYR B 1 150  ? 86.245  90.290  157.527 1.00 221.84 ? 150  TYR B O     1 
ATOM   2901  C  CB    . TYR B 1 150  ? 88.891  91.103  158.917 1.00 221.84 ? 150  TYR B CB    1 
ATOM   2902  C  CG    . TYR B 1 150  ? 88.058  92.151  159.614 1.00 221.84 ? 150  TYR B CG    1 
ATOM   2903  C  CD1   . TYR B 1 150  ? 87.795  92.068  160.977 1.00 221.84 ? 150  TYR B CD1   1 
ATOM   2904  C  CD2   . TYR B 1 150  ? 87.543  93.230  158.912 1.00 221.84 ? 150  TYR B CD2   1 
ATOM   2905  C  CE1   . TYR B 1 150  ? 87.029  93.011  161.614 1.00 221.84 ? 150  TYR B CE1   1 
ATOM   2906  C  CE2   . TYR B 1 150  ? 86.785  94.187  159.544 1.00 221.84 ? 150  TYR B CE2   1 
ATOM   2907  C  CZ    . TYR B 1 150  ? 86.528  94.070  160.896 1.00 221.84 ? 150  TYR B CZ    1 
ATOM   2908  O  OH    . TYR B 1 150  ? 85.773  95.020  161.539 1.00 221.84 ? 150  TYR B OH    1 
ATOM   2909  N  N     . VAL B 1 151  ? 85.945  89.749  159.697 1.00 219.84 ? 151  VAL B N     1 
ATOM   2910  C  CA    . VAL B 1 151  ? 84.522  90.041  159.716 1.00 219.84 ? 151  VAL B CA    1 
ATOM   2911  C  C     . VAL B 1 151  ? 84.225  91.019  160.848 1.00 219.84 ? 151  VAL B C     1 
ATOM   2912  O  O     . VAL B 1 151  ? 84.680  90.816  161.977 1.00 219.84 ? 151  VAL B O     1 
ATOM   2913  C  CB    . VAL B 1 151  ? 83.660  88.769  159.836 1.00 219.84 ? 151  VAL B CB    1 
ATOM   2914  C  CG1   . VAL B 1 151  ? 84.113  87.844  160.963 1.00 219.84 ? 151  VAL B CG1   1 
ATOM   2915  C  CG2   . VAL B 1 151  ? 82.206  89.112  159.991 1.00 219.84 ? 151  VAL B CG2   1 
ATOM   2916  N  N     . PRO B 1 152  ? 83.560  92.135  160.577 1.00 202.74 ? 152  PRO B N     1 
ATOM   2917  C  CA    . PRO B 1 152  ? 83.139  93.029  161.658 1.00 202.74 ? 152  PRO B CA    1 
ATOM   2918  C  C     . PRO B 1 152  ? 82.092  92.386  162.547 1.00 202.74 ? 152  PRO B C     1 
ATOM   2919  O  O     . PRO B 1 152  ? 81.453  91.400  162.181 1.00 202.74 ? 152  PRO B O     1 
ATOM   2920  C  CB    . PRO B 1 152  ? 82.558  94.233  160.916 1.00 202.74 ? 152  PRO B CB    1 
ATOM   2921  C  CG    . PRO B 1 152  ? 83.195  94.205  159.589 1.00 202.74 ? 152  PRO B CG    1 
ATOM   2922  C  CD    . PRO B 1 152  ? 83.516  92.784  159.260 1.00 202.74 ? 152  PRO B CD    1 
ATOM   2923  N  N     . ALA B 1 153  ? 81.895  92.992  163.719 1.00 215.02 ? 153  ALA B N     1 
ATOM   2924  C  CA    . ALA B 1 153  ? 80.951  92.454  164.688 1.00 215.02 ? 153  ALA B CA    1 
ATOM   2925  C  C     . ALA B 1 153  ? 79.520  92.598  164.209 1.00 215.02 ? 153  ALA B C     1 
ATOM   2926  O  O     . ALA B 1 153  ? 78.649  91.817  164.602 1.00 215.02 ? 153  ALA B O     1 
ATOM   2927  C  CB    . ALA B 1 153  ? 81.119  93.152  166.034 1.00 215.02 ? 153  ALA B CB    1 
ATOM   2928  N  N     . GLU B 1 154  ? 79.267  93.577  163.343 1.00 207.59 ? 154  GLU B N     1 
ATOM   2929  C  CA    . GLU B 1 154  ? 77.908  93.837  162.899 1.00 207.59 ? 154  GLU B CA    1 
ATOM   2930  C  C     . GLU B 1 154  ? 77.451  92.790  161.903 1.00 207.59 ? 154  GLU B C     1 
ATOM   2931  O  O     . GLU B 1 154  ? 76.249  92.595  161.702 1.00 207.59 ? 154  GLU B O     1 
ATOM   2932  C  CB    . GLU B 1 154  ? 77.824  95.232  162.289 1.00 207.59 ? 154  GLU B CB    1 
ATOM   2933  C  CG    . GLU B 1 154  ? 77.525  96.314  163.298 1.00 207.59 ? 154  GLU B CG    1 
ATOM   2934  C  CD    . GLU B 1 154  ? 78.631  96.478  164.317 1.00 207.59 ? 154  GLU B CD    1 
ATOM   2935  O  OE1   . GLU B 1 154  ? 79.813  96.338  163.937 1.00 207.59 ? 154  GLU B OE1   1 
ATOM   2936  O  OE2   . GLU B 1 154  ? 78.320  96.726  165.498 1.00 207.59 ? 154  GLU B OE2   1 
ATOM   2937  N  N     . LYS B 1 155  ? 78.394  92.097  161.274 1.00 216.22 ? 155  LYS B N     1 
ATOM   2938  C  CA    . LYS B 1 155  ? 78.021  91.184  160.204 1.00 216.22 ? 155  LYS B CA    1 
ATOM   2939  C  C     . LYS B 1 155  ? 77.563  89.851  160.770 1.00 216.22 ? 155  LYS B C     1 
ATOM   2940  O  O     . LYS B 1 155  ? 76.465  89.376  160.461 1.00 216.22 ? 155  LYS B O     1 
ATOM   2941  C  CB    . LYS B 1 155  ? 79.187  90.994  159.243 1.00 216.22 ? 155  LYS B CB    1 
ATOM   2942  C  CG    . LYS B 1 155  ? 79.969  92.253  158.988 1.00 216.22 ? 155  LYS B CG    1 
ATOM   2943  C  CD    . LYS B 1 155  ? 79.145  93.329  158.330 1.00 216.22 ? 155  LYS B CD    1 
ATOM   2944  C  CE    . LYS B 1 155  ? 79.429  94.653  158.997 1.00 216.22 ? 155  LYS B CE    1 
ATOM   2945  N  NZ    . LYS B 1 155  ? 78.829  95.780  158.252 1.00 216.22 ? 155  LYS B NZ    1 
ATOM   2946  N  N     . HIS B 1 156  ? 78.393  89.225  161.603 1.00 230.04 ? 156  HIS B N     1 
ATOM   2947  C  CA    . HIS B 1 156  ? 77.968  87.973  162.211 1.00 230.04 ? 156  HIS B CA    1 
ATOM   2948  C  C     . HIS B 1 156  ? 76.931  88.229  163.295 1.00 230.04 ? 156  HIS B C     1 
ATOM   2949  O  O     . HIS B 1 156  ? 75.881  87.578  163.318 1.00 230.04 ? 156  HIS B O     1 
ATOM   2950  C  CB    . HIS B 1 156  ? 79.173  87.193  162.747 1.00 230.04 ? 156  HIS B CB    1 
ATOM   2951  C  CG    . HIS B 1 156  ? 79.981  87.923  163.773 1.00 230.04 ? 156  HIS B CG    1 
ATOM   2952  N  ND1   . HIS B 1 156  ? 79.722  87.835  165.124 1.00 230.04 ? 156  HIS B ND1   1 
ATOM   2953  C  CD2   . HIS B 1 156  ? 81.054  88.738  163.649 1.00 230.04 ? 156  HIS B CD2   1 
ATOM   2954  C  CE1   . HIS B 1 156  ? 80.594  88.573  165.786 1.00 230.04 ? 156  HIS B CE1   1 
ATOM   2955  N  NE2   . HIS B 1 156  ? 81.416  89.129  164.915 1.00 230.04 ? 156  HIS B NE2   1 
ATOM   2956  N  N     . GLY B 1 157  ? 77.190  89.204  164.168 1.00 234.11 ? 157  GLY B N     1 
ATOM   2957  C  CA    . GLY B 1 157  ? 76.241  89.641  165.183 1.00 234.11 ? 157  GLY B CA    1 
ATOM   2958  C  C     . GLY B 1 157  ? 75.783  88.576  166.155 1.00 234.11 ? 157  GLY B C     1 
ATOM   2959  O  O     . GLY B 1 157  ? 74.693  88.697  166.722 1.00 234.11 ? 157  GLY B O     1 
ATOM   2960  N  N     . ILE B 1 158  ? 76.577  87.533  166.360 1.00 235.94 ? 158  ILE B N     1 
ATOM   2961  C  CA    . ILE B 1 158  ? 76.098  86.374  167.099 1.00 235.94 ? 158  ILE B CA    1 
ATOM   2962  C  C     . ILE B 1 158  ? 76.169  86.650  168.594 1.00 235.94 ? 158  ILE B C     1 
ATOM   2963  O  O     . ILE B 1 158  ? 77.052  87.367  169.082 1.00 235.94 ? 158  ILE B O     1 
ATOM   2964  C  CB    . ILE B 1 158  ? 76.881  85.108  166.703 1.00 235.94 ? 158  ILE B CB    1 
ATOM   2965  C  CG1   . ILE B 1 158  ? 78.368  85.247  167.008 1.00 235.94 ? 158  ILE B CG1   1 
ATOM   2966  C  CG2   . ILE B 1 158  ? 76.699  84.830  165.226 1.00 235.94 ? 158  ILE B CG2   1 
ATOM   2967  C  CD1   . ILE B 1 158  ? 79.030  83.947  167.344 1.00 235.94 ? 158  ILE B CD1   1 
ATOM   2968  N  N     . LYS B 1 159  ? 75.188  86.116  169.316 1.00 237.96 ? 159  LYS B N     1 
ATOM   2969  C  CA    . LYS B 1 159  ? 75.096  86.281  170.762 1.00 237.96 ? 159  LYS B CA    1 
ATOM   2970  C  C     . LYS B 1 159  ? 74.328  85.068  171.278 1.00 237.96 ? 159  LYS B C     1 
ATOM   2971  O  O     . LYS B 1 159  ? 73.096  85.047  171.220 1.00 237.96 ? 159  LYS B O     1 
ATOM   2972  C  CB    . LYS B 1 159  ? 74.403  87.589  171.118 1.00 237.96 ? 159  LYS B CB    1 
ATOM   2973  C  CG    . LYS B 1 159  ? 74.687  88.077  172.513 1.00 237.96 ? 159  LYS B CG    1 
ATOM   2974  C  CD    . LYS B 1 159  ? 74.174  89.474  172.745 1.00 237.96 ? 159  LYS B CD    1 
ATOM   2975  C  CE    . LYS B 1 159  ? 75.124  90.505  172.164 1.00 237.96 ? 159  LYS B CE    1 
ATOM   2976  N  NZ    . LYS B 1 159  ? 76.237  90.836  173.086 1.00 237.96 ? 159  LYS B NZ    1 
ATOM   2977  N  N     . ASP B 1 160  ? 75.063  84.062  171.762 1.00 278.47 ? 160  ASP B N     1 
ATOM   2978  C  CA    . ASP B 1 160  ? 74.447  82.811  172.192 1.00 278.47 ? 160  ASP B CA    1 
ATOM   2979  C  C     . ASP B 1 160  ? 73.606  82.992  173.444 1.00 278.47 ? 160  ASP B C     1 
ATOM   2980  O  O     . ASP B 1 160  ? 72.553  82.362  173.576 1.00 278.47 ? 160  ASP B O     1 
ATOM   2981  C  CB    . ASP B 1 160  ? 75.524  81.759  172.441 1.00 278.47 ? 160  ASP B CB    1 
ATOM   2982  C  CG    . ASP B 1 160  ? 76.367  81.496  171.214 1.00 278.47 ? 160  ASP B CG    1 
ATOM   2983  O  OD1   . ASP B 1 160  ? 75.855  81.693  170.093 1.00 278.47 ? 160  ASP B OD1   1 
ATOM   2984  O  OD2   . ASP B 1 160  ? 77.541  81.098  171.367 1.00 278.47 ? 160  ASP B OD2   1 
ATOM   2985  N  N     . ARG B 1 161  ? 74.057  83.835  174.359 1.00 266.89 ? 161  ARG B N     1 
ATOM   2986  C  CA    . ARG B 1 161  ? 73.253  84.333  175.458 1.00 266.89 ? 161  ARG B CA    1 
ATOM   2987  C  C     . ARG B 1 161  ? 73.602  85.802  175.554 1.00 266.89 ? 161  ARG B C     1 
ATOM   2988  O  O     . ARG B 1 161  ? 74.673  86.199  175.102 1.00 266.89 ? 161  ARG B O     1 
ATOM   2989  C  CB    . ARG B 1 161  ? 73.553  83.590  176.762 1.00 266.89 ? 161  ARG B CB    1 
ATOM   2990  C  CG    . ARG B 1 161  ? 72.606  83.882  177.908 1.00 266.89 ? 161  ARG B CG    1 
ATOM   2991  C  CD    . ARG B 1 161  ? 73.251  83.500  179.207 1.00 266.89 ? 161  ARG B CD    1 
ATOM   2992  N  NE    . ARG B 1 161  ? 73.542  82.075  179.229 1.00 266.89 ? 161  ARG B NE    1 
ATOM   2993  C  CZ    . ARG B 1 161  ? 74.403  81.503  180.059 1.00 266.89 ? 161  ARG B CZ    1 
ATOM   2994  N  NH1   . ARG B 1 161  ? 75.074  82.242  180.932 1.00 266.89 ? 161  ARG B NH1   1 
ATOM   2995  N  NH2   . ARG B 1 161  ? 74.607  80.196  180.005 1.00 266.89 ? 161  ARG B NH2   1 
ATOM   2996  N  N     . ILE B 1 162  ? 72.676  86.595  176.098 1.00 243.58 ? 162  ILE B N     1 
ATOM   2997  C  CA    . ILE B 1 162  ? 72.760  88.048  176.225 1.00 243.58 ? 162  ILE B CA    1 
ATOM   2998  C  C     . ILE B 1 162  ? 74.105  88.489  176.794 1.00 243.58 ? 162  ILE B C     1 
ATOM   2999  O  O     . ILE B 1 162  ? 74.646  87.843  177.699 1.00 243.58 ? 162  ILE B O     1 
ATOM   3000  C  CB    . ILE B 1 162  ? 71.583  88.552  177.080 1.00 243.58 ? 162  ILE B CB    1 
ATOM   3001  C  CG1   . ILE B 1 162  ? 71.698  90.048  177.394 1.00 243.58 ? 162  ILE B CG1   1 
ATOM   3002  C  CG2   . ILE B 1 162  ? 71.441  87.710  178.339 1.00 243.58 ? 162  ILE B CG2   1 
ATOM   3003  C  CD1   . ILE B 1 162  ? 71.616  90.941  176.176 1.00 243.58 ? 162  ILE B CD1   1 
ATOM   3004  N  N     . ASN B 1 163  ? 74.685  89.515  176.159 1.00 254.07 ? 163  ASN B N     1 
ATOM   3005  C  CA    . ASN B 1 163  ? 76.001  90.101  176.410 1.00 254.07 ? 163  ASN B CA    1 
ATOM   3006  C  C     . ASN B 1 163  ? 77.144  89.177  176.006 1.00 254.07 ? 163  ASN B C     1 
ATOM   3007  O  O     . ASN B 1 163  ? 78.263  89.332  176.498 1.00 254.07 ? 163  ASN B O     1 
ATOM   3008  C  CB    . ASN B 1 163  ? 76.182  90.562  177.866 1.00 254.07 ? 163  ASN B CB    1 
ATOM   3009  C  CG    . ASN B 1 163  ? 75.090  91.508  178.322 1.00 254.07 ? 163  ASN B CG    1 
ATOM   3010  O  OD1   . ASN B 1 163  ? 74.586  92.313  177.544 1.00 254.07 ? 163  ASN B OD1   1 
ATOM   3011  N  ND2   . ASN B 1 163  ? 74.726  91.418  179.594 1.00 254.07 ? 163  ASN B ND2   1 
ATOM   3012  N  N     . ALA B 1 164  ? 76.906  88.222  175.104 1.00 246.09 ? 164  ALA B N     1 
ATOM   3013  C  CA    . ALA B 1 164  ? 78.011  87.583  174.388 1.00 246.09 ? 164  ALA B CA    1 
ATOM   3014  C  C     . ALA B 1 164  ? 78.429  88.553  173.295 1.00 246.09 ? 164  ALA B C     1 
ATOM   3015  O  O     . ALA B 1 164  ? 77.921  88.539  172.172 1.00 246.09 ? 164  ALA B O     1 
ATOM   3016  C  CB    . ALA B 1 164  ? 77.622  86.225  173.825 1.00 246.09 ? 164  ALA B CB    1 
ATOM   3017  N  N     . ILE B 1 165  ? 79.360  89.427  173.659 1.00 243.32 ? 165  ILE B N     1 
ATOM   3018  C  CA    . ILE B 1 165  ? 79.664  90.632  172.896 1.00 243.32 ? 165  ILE B CA    1 
ATOM   3019  C  C     . ILE B 1 165  ? 80.304  90.274  171.565 1.00 243.32 ? 165  ILE B C     1 
ATOM   3020  O  O     . ILE B 1 165  ? 81.401  89.699  171.544 1.00 243.32 ? 165  ILE B O     1 
ATOM   3021  C  CB    . ILE B 1 165  ? 80.568  91.577  173.695 1.00 243.32 ? 165  ILE B CB    1 
ATOM   3022  C  CG1   . ILE B 1 165  ? 79.858  92.005  174.980 1.00 243.32 ? 165  ILE B CG1   1 
ATOM   3023  C  CG2   . ILE B 1 165  ? 80.937  92.779  172.846 1.00 243.32 ? 165  ILE B CG2   1 
ATOM   3024  C  CD1   . ILE B 1 165  ? 80.683  92.906  175.862 1.00 243.32 ? 165  ILE B CD1   1 
ATOM   3025  N  N     . PRO B 1 166  ? 79.646  90.594  170.452 1.00 221.86 ? 166  PRO B N     1 
ATOM   3026  C  CA    . PRO B 1 166  ? 80.164  90.213  169.136 1.00 221.86 ? 166  PRO B CA    1 
ATOM   3027  C  C     . PRO B 1 166  ? 81.471  90.919  168.829 1.00 221.86 ? 166  PRO B C     1 
ATOM   3028  O  O     . PRO B 1 166  ? 81.631  92.114  169.085 1.00 221.86 ? 166  PRO B O     1 
ATOM   3029  C  CB    . PRO B 1 166  ? 79.048  90.642  168.181 1.00 221.86 ? 166  PRO B CB    1 
ATOM   3030  C  CG    . PRO B 1 166  ? 78.331  91.708  168.905 1.00 221.86 ? 166  PRO B CG    1 
ATOM   3031  C  CD    . PRO B 1 166  ? 78.377  91.327  170.348 1.00 221.86 ? 166  PRO B CD    1 
ATOM   3032  N  N     . VAL B 1 167  ? 82.417  90.156  168.333 1.00 210.96 ? 167  VAL B N     1 
ATOM   3033  C  CA    . VAL B 1 167  ? 83.757  90.648  168.076 1.00 210.96 ? 167  VAL B CA    1 
ATOM   3034  C  C     . VAL B 1 167  ? 83.890  90.937  166.595 1.00 210.96 ? 167  VAL B C     1 
ATOM   3035  O  O     . VAL B 1 167  ? 83.502  90.120  165.751 1.00 210.96 ? 167  VAL B O     1 
ATOM   3036  C  CB    . VAL B 1 167  ? 84.815  89.631  168.542 1.00 210.96 ? 167  VAL B CB    1 
ATOM   3037  C  CG1   . VAL B 1 167  ? 86.202  90.217  168.420 1.00 210.96 ? 167  VAL B CG1   1 
ATOM   3038  C  CG2   . VAL B 1 167  ? 84.539  89.216  169.971 1.00 210.96 ? 167  VAL B CG2   1 
ATOM   3039  N  N     . ASP B 1 168  ? 84.405  92.114  166.277 1.00 214.23 ? 168  ASP B N     1 
ATOM   3040  C  CA    . ASP B 1 168  ? 84.917  92.366  164.940 1.00 214.23 ? 168  ASP B CA    1 
ATOM   3041  C  C     . ASP B 1 168  ? 86.111  91.448  164.766 1.00 214.23 ? 168  ASP B C     1 
ATOM   3042  O  O     . ASP B 1 168  ? 87.168  91.654  165.363 1.00 214.23 ? 168  ASP B O     1 
ATOM   3043  C  CB    . ASP B 1 168  ? 85.278  93.835  164.783 1.00 214.23 ? 168  ASP B CB    1 
ATOM   3044  C  CG    . ASP B 1 168  ? 84.142  94.744  165.183 1.00 214.23 ? 168  ASP B CG    1 
ATOM   3045  O  OD1   . ASP B 1 168  ? 83.272  95.014  164.329 1.00 214.23 ? 168  ASP B OD1   1 
ATOM   3046  O  OD2   . ASP B 1 168  ? 84.098  95.160  166.360 1.00 214.23 ? 168  ASP B OD2   1 
ATOM   3047  N  N     . ALA B 1 169  ? 85.928  90.403  163.977 1.00 223.80 ? 169  ALA B N     1 
ATOM   3048  C  CA    . ALA B 1 169  ? 86.710  89.190  164.112 1.00 223.80 ? 169  ALA B CA    1 
ATOM   3049  C  C     . ALA B 1 169  ? 87.524  88.914  162.858 1.00 223.80 ? 169  ALA B C     1 
ATOM   3050  O  O     . ALA B 1 169  ? 87.039  89.079  161.741 1.00 223.80 ? 169  ALA B O     1 
ATOM   3051  C  CB    . ALA B 1 169  ? 85.778  88.019  164.403 1.00 223.80 ? 169  ALA B CB    1 
ATOM   3052  N  N     . VAL B 1 170  ? 88.762  88.474  163.052 1.00 228.13 ? 170  VAL B N     1 
ATOM   3053  C  CA    . VAL B 1 170  ? 89.663  88.150  161.953 1.00 228.13 ? 170  VAL B CA    1 
ATOM   3054  C  C     . VAL B 1 170  ? 89.910  86.655  161.965 1.00 228.13 ? 170  VAL B C     1 
ATOM   3055  O  O     . VAL B 1 170  ? 90.612  86.145  162.848 1.00 228.13 ? 170  VAL B O     1 
ATOM   3056  C  CB    . VAL B 1 170  ? 90.997  88.896  162.055 1.00 228.13 ? 170  VAL B CB    1 
ATOM   3057  C  CG1   . VAL B 1 170  ? 91.923  88.438  160.937 1.00 228.13 ? 170  VAL B CG1   1 
ATOM   3058  C  CG2   . VAL B 1 170  ? 90.779  90.387  162.021 1.00 228.13 ? 170  VAL B CG2   1 
ATOM   3059  N  N     . PHE B 1 171  ? 89.338  85.954  160.994 1.00 248.08 ? 171  PHE B N     1 
ATOM   3060  C  CA    . PHE B 1 171  ? 89.590  84.526  160.883 1.00 248.08 ? 171  PHE B CA    1 
ATOM   3061  C  C     . PHE B 1 171  ? 91.014  84.257  160.437 1.00 248.08 ? 171  PHE B C     1 
ATOM   3062  O  O     . PHE B 1 171  ? 91.784  83.609  161.151 1.00 248.08 ? 171  PHE B O     1 
ATOM   3063  C  CB    . PHE B 1 171  ? 88.618  83.904  159.899 1.00 248.08 ? 171  PHE B CB    1 
ATOM   3064  C  CG    . PHE B 1 171  ? 87.250  83.786  160.426 1.00 248.08 ? 171  PHE B CG    1 
ATOM   3065  C  CD1   . PHE B 1 171  ? 87.006  83.045  161.560 1.00 248.08 ? 171  PHE B CD1   1 
ATOM   3066  C  CD2   . PHE B 1 171  ? 86.202  84.424  159.801 1.00 248.08 ? 171  PHE B CD2   1 
ATOM   3067  C  CE1   . PHE B 1 171  ? 85.741  82.953  162.074 1.00 248.08 ? 171  PHE B CE1   1 
ATOM   3068  C  CE2   . PHE B 1 171  ? 84.930  84.320  160.294 1.00 248.08 ? 171  PHE B CE2   1 
ATOM   3069  C  CZ    . PHE B 1 171  ? 84.697  83.578  161.434 1.00 248.08 ? 171  PHE B CZ    1 
ATOM   3070  N  N     . SER B 1 172  ? 91.376  84.800  159.279 1.00 233.43 ? 172  SER B N     1 
ATOM   3071  C  CA    . SER B 1 172  ? 92.550  84.421  158.512 1.00 233.43 ? 172  SER B CA    1 
ATOM   3072  C  C     . SER B 1 172  ? 93.842  84.683  159.284 1.00 233.43 ? 172  SER B C     1 
ATOM   3073  O  O     . SER B 1 172  ? 94.034  85.788  159.807 1.00 233.43 ? 172  SER B O     1 
ATOM   3074  C  CB    . SER B 1 172  ? 92.555  85.178  157.193 1.00 233.43 ? 172  SER B CB    1 
ATOM   3075  O  OG    . SER B 1 172  ? 91.580  84.635  156.319 1.00 233.43 ? 172  SER B OG    1 
ATOM   3076  N  N     . PRO B 1 173  ? 94.729  83.693  159.390 1.00 251.22 ? 173  PRO B N     1 
ATOM   3077  C  CA    . PRO B 1 173  ? 95.868  83.799  160.304 1.00 251.22 ? 173  PRO B CA    1 
ATOM   3078  C  C     . PRO B 1 173  ? 97.088  84.468  159.708 1.00 251.22 ? 173  PRO B C     1 
ATOM   3079  O  O     . PRO B 1 173  ? 98.110  84.573  160.395 1.00 251.22 ? 173  PRO B O     1 
ATOM   3080  C  CB    . PRO B 1 173  ? 96.162  82.336  160.629 1.00 251.22 ? 173  PRO B CB    1 
ATOM   3081  C  CG    . PRO B 1 173  ? 95.834  81.639  159.369 1.00 251.22 ? 173  PRO B CG    1 
ATOM   3082  C  CD    . PRO B 1 173  ? 94.655  82.364  158.768 1.00 251.22 ? 173  PRO B CD    1 
ATOM   3083  N  N     . VAL B 1 174  ? 97.040  84.898  158.454 1.00 234.77 ? 174  VAL B N     1 
ATOM   3084  C  CA    . VAL B 1 174  ? 98.184  85.606  157.903 1.00 234.77 ? 174  VAL B CA    1 
ATOM   3085  C  C     . VAL B 1 174  ? 98.268  86.982  158.541 1.00 234.77 ? 174  VAL B C     1 
ATOM   3086  O  O     . VAL B 1 174  ? 97.298  87.749  158.549 1.00 234.77 ? 174  VAL B O     1 
ATOM   3087  C  CB    . VAL B 1 174  ? 98.097  85.666  156.377 1.00 234.77 ? 174  VAL B CB    1 
ATOM   3088  C  CG1   . VAL B 1 174  ? 96.681  85.988  155.932 1.00 234.77 ? 174  VAL B CG1   1 
ATOM   3089  C  CG2   . VAL B 1 174  ? 99.083  86.695  155.837 1.00 234.77 ? 174  VAL B CG2   1 
ATOM   3090  N  N     . ARG B 1 175  ? 99.413  87.276  159.142 1.00 243.76 ? 175  ARG B N     1 
ATOM   3091  C  CA    . ARG B 1 175  ? 99.596  88.592  159.723 1.00 243.76 ? 175  ARG B CA    1 
ATOM   3092  C  C     . ARG B 1 175  ? 99.766  89.634  158.632 1.00 243.76 ? 175  ARG B C     1 
ATOM   3093  O  O     . ARG B 1 175  ? 98.954  90.555  158.510 1.00 243.76 ? 175  ARG B O     1 
ATOM   3094  C  CB    . ARG B 1 175  ? 100.791 88.583  160.668 1.00 243.76 ? 175  ARG B CB    1 
ATOM   3095  C  CG    . ARG B 1 175  ? 100.428 88.125  162.059 1.00 243.76 ? 175  ARG B CG    1 
ATOM   3096  C  CD    . ARG B 1 175  ? 99.626  89.173  162.794 1.00 243.76 ? 175  ARG B CD    1 
ATOM   3097  N  NE    . ARG B 1 175  ? 99.701  88.989  164.240 1.00 243.76 ? 175  ARG B NE    1 
ATOM   3098  C  CZ    . ARG B 1 175  ? 99.221  89.851  165.131 1.00 243.76 ? 175  ARG B CZ    1 
ATOM   3099  N  NH1   . ARG B 1 175  ? 98.625  90.965  164.726 1.00 243.76 ? 175  ARG B NH1   1 
ATOM   3100  N  NH2   . ARG B 1 175  ? 99.335  89.599  166.427 1.00 243.76 ? 175  ARG B NH2   1 
ATOM   3101  N  N     . ARG B 1 176  ? 100.786 89.482  157.796 1.00 227.78 ? 176  ARG B N     1 
ATOM   3102  C  CA    . ARG B 1 176  ? 101.094 90.557  156.867 1.00 227.78 ? 176  ARG B CA    1 
ATOM   3103  C  C     . ARG B 1 176  ? 101.861 90.004  155.680 1.00 227.78 ? 176  ARG B C     1 
ATOM   3104  O  O     . ARG B 1 176  ? 102.690 89.112  155.827 1.00 227.78 ? 176  ARG B O     1 
ATOM   3105  C  CB    . ARG B 1 176  ? 101.907 91.646  157.564 1.00 227.78 ? 176  ARG B CB    1 
ATOM   3106  C  CG    . ARG B 1 176  ? 102.150 92.887  156.743 1.00 227.78 ? 176  ARG B CG    1 
ATOM   3107  C  CD    . ARG B 1 176  ? 102.703 93.981  157.618 1.00 227.78 ? 176  ARG B CD    1 
ATOM   3108  N  NE    . ARG B 1 176  ? 103.465 93.425  158.728 1.00 227.78 ? 176  ARG B NE    1 
ATOM   3109  C  CZ    . ARG B 1 176  ? 104.766 93.606  158.896 1.00 227.78 ? 176  ARG B CZ    1 
ATOM   3110  N  NH1   . ARG B 1 176  ? 105.447 94.345  158.034 1.00 227.78 ? 176  ARG B NH1   1 
ATOM   3111  N  NH2   . ARG B 1 176  ? 105.380 93.062  159.934 1.00 227.78 ? 176  ARG B NH2   1 
ATOM   3112  N  N     . VAL B 1 177  ? 101.565 90.530  154.496 1.00 209.31 ? 177  VAL B N     1 
ATOM   3113  C  CA    . VAL B 1 177  ? 102.371 90.248  153.319 1.00 209.31 ? 177  VAL B CA    1 
ATOM   3114  C  C     . VAL B 1 177  ? 102.701 91.555  152.626 1.00 209.31 ? 177  VAL B C     1 
ATOM   3115  O  O     . VAL B 1 177  ? 101.965 92.539  152.709 1.00 209.31 ? 177  VAL B O     1 
ATOM   3116  C  CB    . VAL B 1 177  ? 101.693 89.287  152.324 1.00 209.31 ? 177  VAL B CB    1 
ATOM   3117  C  CG1   . VAL B 1 177  ? 101.598 87.897  152.914 1.00 209.31 ? 177  VAL B CG1   1 
ATOM   3118  C  CG2   . VAL B 1 177  ? 100.318 89.805  151.943 1.00 209.31 ? 177  VAL B CG2   1 
ATOM   3119  N  N     . ALA B 1 178  ? 103.841 91.550  151.951 1.00 211.55 ? 178  ALA B N     1 
ATOM   3120  C  CA    . ALA B 1 178  ? 104.261 92.670  151.130 1.00 211.55 ? 178  ALA B CA    1 
ATOM   3121  C  C     . ALA B 1 178  ? 105.235 92.154  150.092 1.00 211.55 ? 178  ALA B C     1 
ATOM   3122  O  O     . ALA B 1 178  ? 106.275 91.583  150.435 1.00 211.55 ? 178  ALA B O     1 
ATOM   3123  C  CB    . ALA B 1 178  ? 104.903 93.771  151.971 1.00 211.55 ? 178  ALA B CB    1 
ATOM   3124  N  N     . PHE B 1 179  ? 104.902 92.325  148.824 1.00 216.11 ? 179  PHE B N     1 
ATOM   3125  C  CA    . PHE B 1 179  ? 105.764 91.881  147.749 1.00 216.11 ? 179  PHE B CA    1 
ATOM   3126  C  C     . PHE B 1 179  ? 106.441 93.088  147.130 1.00 216.11 ? 179  PHE B C     1 
ATOM   3127  O  O     . PHE B 1 179  ? 105.831 94.148  146.975 1.00 216.11 ? 179  PHE B O     1 
ATOM   3128  C  CB    . PHE B 1 179  ? 104.988 91.075  146.703 1.00 216.11 ? 179  PHE B CB    1 
ATOM   3129  C  CG    . PHE B 1 179  ? 103.993 91.867  145.907 1.00 216.11 ? 179  PHE B CG    1 
ATOM   3130  C  CD1   . PHE B 1 179  ? 104.309 92.328  144.640 1.00 216.11 ? 179  PHE B CD1   1 
ATOM   3131  C  CD2   . PHE B 1 179  ? 102.720 92.096  146.400 1.00 216.11 ? 179  PHE B CD2   1 
ATOM   3132  C  CE1   . PHE B 1 179  ? 103.390 93.037  143.901 1.00 216.11 ? 179  PHE B CE1   1 
ATOM   3133  C  CE2   . PHE B 1 179  ? 101.795 92.798  145.661 1.00 216.11 ? 179  PHE B CE2   1 
ATOM   3134  C  CZ    . PHE B 1 179  ? 102.133 93.268  144.412 1.00 216.11 ? 179  PHE B CZ    1 
ATOM   3135  N  N     . GLN B 1 180  ? 107.712 92.923  146.800 1.00 204.00 ? 180  GLN B N     1 
ATOM   3136  C  CA    . GLN B 1 180  ? 108.552 94.022  146.359 1.00 204.00 ? 180  GLN B CA    1 
ATOM   3137  C  C     . GLN B 1 180  ? 109.198 93.535  145.074 1.00 204.00 ? 180  GLN B C     1 
ATOM   3138  O  O     . GLN B 1 180  ? 110.138 92.741  145.110 1.00 204.00 ? 180  GLN B O     1 
ATOM   3139  C  CB    . GLN B 1 180  ? 109.558 94.373  147.435 1.00 204.00 ? 180  GLN B CB    1 
ATOM   3140  C  CG    . GLN B 1 180  ? 110.198 95.730  147.304 1.00 204.00 ? 180  GLN B CG    1 
ATOM   3141  C  CD    . GLN B 1 180  ? 110.887 96.153  148.592 1.00 204.00 ? 180  GLN B CD    1 
ATOM   3142  O  OE1   . GLN B 1 180  ? 110.933 95.393  149.561 1.00 204.00 ? 180  GLN B OE1   1 
ATOM   3143  N  NE2   . GLN B 1 180  ? 111.414 97.371  148.615 1.00 204.00 ? 180  GLN B NE2   1 
ATOM   3144  N  N     . VAL B 1 181  ? 108.649 93.968  143.940 1.00 218.93 ? 181  VAL B N     1 
ATOM   3145  C  CA    . VAL B 1 181  ? 109.173 93.534  142.654 1.00 218.93 ? 181  VAL B CA    1 
ATOM   3146  C  C     . VAL B 1 181  ? 110.496 94.228  142.399 1.00 218.93 ? 181  VAL B C     1 
ATOM   3147  O  O     . VAL B 1 181  ? 110.618 95.449  142.546 1.00 218.93 ? 181  VAL B O     1 
ATOM   3148  C  CB    . VAL B 1 181  ? 108.169 93.839  141.528 1.00 218.93 ? 181  VAL B CB    1 
ATOM   3149  C  CG1   . VAL B 1 181  ? 108.738 93.452  140.168 1.00 218.93 ? 181  VAL B CG1   1 
ATOM   3150  C  CG2   . VAL B 1 181  ? 106.855 93.132  141.769 1.00 218.93 ? 181  VAL B CG2   1 
ATOM   3151  N  N     . GLU B 1 182  ? 111.507 93.451  142.031 1.00 235.38 ? 182  GLU B N     1 
ATOM   3152  C  CA    . GLU B 1 182  ? 112.754 94.057  141.611 1.00 235.38 ? 182  GLU B CA    1 
ATOM   3153  C  C     . GLU B 1 182  ? 113.189 93.427  140.304 1.00 235.38 ? 182  GLU B C     1 
ATOM   3154  O  O     . GLU B 1 182  ? 112.638 92.416  139.866 1.00 235.38 ? 182  GLU B O     1 
ATOM   3155  C  CB    . GLU B 1 182  ? 113.844 93.904  142.666 1.00 235.38 ? 182  GLU B CB    1 
ATOM   3156  C  CG    . GLU B 1 182  ? 114.333 92.495  142.822 1.00 235.38 ? 182  GLU B CG    1 
ATOM   3157  C  CD    . GLU B 1 182  ? 113.572 91.733  143.889 1.00 235.38 ? 182  GLU B CD    1 
ATOM   3158  O  OE1   . GLU B 1 182  ? 114.194 91.333  144.893 1.00 235.38 ? 182  GLU B OE1   1 
ATOM   3159  O  OE2   . GLU B 1 182  ? 112.352 91.533  143.732 1.00 235.38 ? 182  GLU B OE2   1 
ATOM   3160  N  N     . ASP B 1 183  ? 114.196 94.032  139.702 1.00 251.20 ? 183  ASP B N     1 
ATOM   3161  C  CA    . ASP B 1 183  ? 114.601 93.741  138.341 1.00 251.20 ? 183  ASP B CA    1 
ATOM   3162  C  C     . ASP B 1 183  ? 115.923 92.978  138.331 1.00 251.20 ? 183  ASP B C     1 
ATOM   3163  O  O     . ASP B 1 183  ? 116.802 93.225  139.158 1.00 251.20 ? 183  ASP B O     1 
ATOM   3164  C  CB    . ASP B 1 183  ? 114.705 95.059  137.570 1.00 251.20 ? 183  ASP B CB    1 
ATOM   3165  C  CG    . ASP B 1 183  ? 115.327 94.906  136.213 1.00 251.20 ? 183  ASP B CG    1 
ATOM   3166  O  OD1   . ASP B 1 183  ? 114.580 94.704  135.236 1.00 251.20 ? 183  ASP B OD1   1 
ATOM   3167  O  OD2   . ASP B 1 183  ? 116.566 95.023  136.129 1.00 251.20 ? 183  ASP B OD2   1 
ATOM   3168  N  N     . THR B 1 184  ? 116.059 92.039  137.391 1.00 251.85 ? 184  THR B N     1 
ATOM   3169  C  CA    . THR B 1 184  ? 117.276 91.242  137.292 1.00 251.85 ? 184  THR B CA    1 
ATOM   3170  C  C     . THR B 1 184  ? 117.743 91.141  135.848 1.00 251.85 ? 184  THR B C     1 
ATOM   3171  O  O     . THR B 1 184  ? 116.981 91.359  134.908 1.00 251.85 ? 184  THR B O     1 
ATOM   3172  C  CB    . THR B 1 184  ? 117.093 89.829  137.843 1.00 251.85 ? 184  THR B CB    1 
ATOM   3173  O  OG1   . THR B 1 184  ? 118.334 89.126  137.733 1.00 251.85 ? 184  THR B OG1   1 
ATOM   3174  C  CG2   . THR B 1 184  ? 116.038 89.078  137.052 1.00 251.85 ? 184  THR B CG2   1 
ATOM   3175  N  N     . ARG B 1 185  ? 119.006 90.788  135.678 1.00 217.01 ? 185  ARG B N     1 
ATOM   3176  C  CA    . ARG B 1 185  ? 119.562 90.762  134.338 1.00 217.01 ? 185  ARG B CA    1 
ATOM   3177  C  C     . ARG B 1 185  ? 119.583 89.351  133.769 1.00 217.01 ? 185  ARG B C     1 
ATOM   3178  O  O     . ARG B 1 185  ? 119.458 88.359  134.488 1.00 217.01 ? 185  ARG B O     1 
ATOM   3179  C  CB    . ARG B 1 185  ? 120.973 91.337  134.329 1.00 217.01 ? 185  ARG B CB    1 
ATOM   3180  C  CG    . ARG B 1 185  ? 122.060 90.333  134.605 1.00 217.01 ? 185  ARG B CG    1 
ATOM   3181  C  CD    . ARG B 1 185  ? 123.357 91.049  134.823 1.00 217.01 ? 185  ARG B CD    1 
ATOM   3182  N  NE    . ARG B 1 185  ? 124.455 90.119  135.025 1.00 217.01 ? 185  ARG B NE    1 
ATOM   3183  C  CZ    . ARG B 1 185  ? 125.396 89.879  134.123 1.00 217.01 ? 185  ARG B CZ    1 
ATOM   3184  N  NH1   . ARG B 1 185  ? 125.371 90.504  132.956 1.00 217.01 ? 185  ARG B NH1   1 
ATOM   3185  N  NH2   . ARG B 1 185  ? 126.367 89.016  134.384 1.00 217.01 ? 185  ARG B NH2   1 
ATOM   3186  N  N     . LEU B 1 186  ? 119.722 89.276  132.443 1.00 211.02 ? 186  LEU B N     1 
ATOM   3187  C  CA    . LEU B 1 186  ? 120.105 88.043  131.760 1.00 211.02 ? 186  LEU B CA    1 
ATOM   3188  C  C     . LEU B 1 186  ? 121.233 88.413  130.813 1.00 211.02 ? 186  LEU B C     1 
ATOM   3189  O  O     . LEU B 1 186  ? 121.015 88.587  129.611 1.00 211.02 ? 186  LEU B O     1 
ATOM   3190  C  CB    . LEU B 1 186  ? 118.941 87.423  131.030 1.00 211.02 ? 186  LEU B CB    1 
ATOM   3191  C  CG    . LEU B 1 186  ? 119.205 86.019  130.492 1.00 211.02 ? 186  LEU B CG    1 
ATOM   3192  C  CD1   . LEU B 1 186  ? 119.677 85.108  131.609 1.00 211.02 ? 186  LEU B CD1   1 
ATOM   3193  C  CD2   . LEU B 1 186  ? 117.973 85.458  129.816 1.00 211.02 ? 186  LEU B CD2   1 
ATOM   3194  N  N     . GLY B 1 187  ? 122.442 88.484  131.358 1.00 209.89 ? 187  GLY B N     1 
ATOM   3195  C  CA    . GLY B 1 187  ? 123.596 88.914  130.600 1.00 209.89 ? 187  GLY B CA    1 
ATOM   3196  C  C     . GLY B 1 187  ? 123.410 90.303  130.034 1.00 209.89 ? 187  GLY B C     1 
ATOM   3197  O  O     . GLY B 1 187  ? 123.355 91.289  130.772 1.00 209.89 ? 187  GLY B O     1 
ATOM   3198  N  N     . GLN B 1 188  ? 123.264 90.372  128.712 1.00 216.74 ? 188  GLN B N     1 
ATOM   3199  C  CA    . GLN B 1 188  ? 122.971 91.645  128.069 1.00 216.74 ? 188  GLN B CA    1 
ATOM   3200  C  C     . GLN B 1 188  ? 121.512 92.031  128.267 1.00 216.74 ? 188  GLN B C     1 
ATOM   3201  O  O     . GLN B 1 188  ? 121.164 93.215  128.216 1.00 216.74 ? 188  GLN B O     1 
ATOM   3202  C  CB    . GLN B 1 188  ? 123.336 91.573  126.583 1.00 216.74 ? 188  GLN B CB    1 
ATOM   3203  C  CG    . GLN B 1 188  ? 122.281 90.978  125.654 1.00 216.74 ? 188  GLN B CG    1 
ATOM   3204  C  CD    . GLN B 1 188  ? 121.928 89.532  125.973 1.00 216.74 ? 188  GLN B CD    1 
ATOM   3205  O  OE1   . GLN B 1 188  ? 122.736 88.786  126.523 1.00 216.74 ? 188  GLN B OE1   1 
ATOM   3206  N  NE2   . GLN B 1 188  ? 120.712 89.135  125.631 1.00 216.74 ? 188  GLN B NE2   1 
ATOM   3207  N  N     . ARG B 1 189  ? 120.644 91.053  128.506 1.00 221.44 ? 189  ARG B N     1 
ATOM   3208  C  CA    . ARG B 1 189  ? 119.279 91.382  128.870 1.00 221.44 ? 189  ARG B CA    1 
ATOM   3209  C  C     . ARG B 1 189  ? 119.254 91.813  130.322 1.00 221.44 ? 189  ARG B C     1 
ATOM   3210  O  O     . ARG B 1 189  ? 120.006 91.297  131.150 1.00 221.44 ? 189  ARG B O     1 
ATOM   3211  C  CB    . ARG B 1 189  ? 118.350 90.196  128.638 1.00 221.44 ? 189  ARG B CB    1 
ATOM   3212  C  CG    . ARG B 1 189  ? 117.893 90.077  127.205 1.00 221.44 ? 189  ARG B CG    1 
ATOM   3213  C  CD    . ARG B 1 189  ? 116.869 91.144  126.862 1.00 221.44 ? 189  ARG B CD    1 
ATOM   3214  N  NE    . ARG B 1 189  ? 115.631 90.967  127.615 1.00 221.44 ? 189  ARG B NE    1 
ATOM   3215  C  CZ    . ARG B 1 189  ? 114.658 90.134  127.259 1.00 221.44 ? 189  ARG B CZ    1 
ATOM   3216  N  NH1   . ARG B 1 189  ? 113.567 90.031  128.002 1.00 221.44 ? 189  ARG B NH1   1 
ATOM   3217  N  NH2   . ARG B 1 189  ? 114.774 89.399  126.162 1.00 221.44 ? 189  ARG B NH2   1 
ATOM   3218  N  N     . THR B 1 190  ? 118.427 92.806  130.616 1.00 240.87 ? 190  THR B N     1 
ATOM   3219  C  CA    . THR B 1 190  ? 118.463 93.453  131.916 1.00 240.87 ? 190  THR B CA    1 
ATOM   3220  C  C     . THR B 1 190  ? 117.037 93.642  132.412 1.00 240.87 ? 190  THR B C     1 
ATOM   3221  O  O     . THR B 1 190  ? 116.798 93.847  133.602 1.00 240.87 ? 190  THR B O     1 
ATOM   3222  C  CB    . THR B 1 190  ? 119.205 94.787  131.803 1.00 240.87 ? 190  THR B CB    1 
ATOM   3223  O  OG1   . THR B 1 190  ? 120.416 94.586  131.066 1.00 240.87 ? 190  THR B OG1   1 
ATOM   3224  C  CG2   . THR B 1 190  ? 119.597 95.327  133.172 1.00 240.87 ? 190  THR B CG2   1 
ATOM   3225  N  N     . ASP B 1 191  ? 116.073 93.538  131.500 1.00 257.89 ? 191  ASP B N     1 
ATOM   3226  C  CA    . ASP B 1 191  ? 114.691 93.886  131.809 1.00 257.89 ? 191  ASP B CA    1 
ATOM   3227  C  C     . ASP B 1 191  ? 114.013 92.895  132.742 1.00 257.89 ? 191  ASP B C     1 
ATOM   3228  O  O     . ASP B 1 191  ? 112.939 93.201  133.268 1.00 257.89 ? 191  ASP B O     1 
ATOM   3229  C  CB    . ASP B 1 191  ? 113.898 93.962  130.512 1.00 257.89 ? 191  ASP B CB    1 
ATOM   3230  C  CG    . ASP B 1 191  ? 113.697 92.593  129.887 1.00 257.89 ? 191  ASP B CG    1 
ATOM   3231  O  OD1   . ASP B 1 191  ? 114.682 91.818  129.866 1.00 257.89 ? 191  ASP B OD1   1 
ATOM   3232  O  OD2   . ASP B 1 191  ? 112.570 92.287  129.430 1.00 257.89 ? 191  ASP B OD2   1 
ATOM   3233  N  N     . LEU B 1 192  ? 114.611 91.726  132.956 1.00 264.58 ? 192  LEU B N     1 
ATOM   3234  C  CA    . LEU B 1 192  ? 113.942 90.645  133.661 1.00 264.58 ? 192  LEU B CA    1 
ATOM   3235  C  C     . LEU B 1 192  ? 113.777 90.969  135.137 1.00 264.58 ? 192  LEU B C     1 
ATOM   3236  O  O     . LEU B 1 192  ? 114.368 91.906  135.666 1.00 264.58 ? 192  LEU B O     1 
ATOM   3237  C  CB    . LEU B 1 192  ? 114.714 89.344  133.490 1.00 264.58 ? 192  LEU B CB    1 
ATOM   3238  C  CG    . LEU B 1 192  ? 114.854 88.910  132.031 1.00 264.58 ? 192  LEU B CG    1 
ATOM   3239  C  CD1   . LEU B 1 192  ? 115.394 87.508  131.982 1.00 264.58 ? 192  LEU B CD1   1 
ATOM   3240  C  CD2   . LEU B 1 192  ? 113.520 88.990  131.294 1.00 264.58 ? 192  LEU B CD2   1 
ATOM   3241  N  N     . ASP B 1 193  ? 112.942 90.192  135.807 1.00 272.83 ? 193  ASP B N     1 
ATOM   3242  C  CA    . ASP B 1 193  ? 112.492 90.616  137.115 1.00 272.83 ? 193  ASP B CA    1 
ATOM   3243  C  C     . ASP B 1 193  ? 112.645 89.518  138.151 1.00 272.83 ? 193  ASP B C     1 
ATOM   3244  O  O     . ASP B 1 193  ? 112.909 88.352  137.849 1.00 272.83 ? 193  ASP B O     1 
ATOM   3245  C  CB    . ASP B 1 193  ? 111.042 91.094  137.066 1.00 272.83 ? 193  ASP B CB    1 
ATOM   3246  C  CG    . ASP B 1 193  ? 110.912 92.458  136.438 1.00 272.83 ? 193  ASP B CG    1 
ATOM   3247  O  OD1   . ASP B 1 193  ? 111.920 93.194  136.401 1.00 272.83 ? 193  ASP B OD1   1 
ATOM   3248  O  OD2   . ASP B 1 193  ? 109.802 92.798  135.983 1.00 272.83 ? 193  ASP B OD2   1 
ATOM   3249  N  N     . LYS B 1 194  ? 112.466 89.945  139.394 1.00 242.55 ? 194  LYS B N     1 
ATOM   3250  C  CA    . LYS B 1 194  ? 112.585 89.116  140.573 1.00 242.55 ? 194  LYS B CA    1 
ATOM   3251  C  C     . LYS B 1 194  ? 111.469 89.546  141.509 1.00 242.55 ? 194  LYS B C     1 
ATOM   3252  O  O     . LYS B 1 194  ? 110.969 90.670  141.424 1.00 242.55 ? 194  LYS B O     1 
ATOM   3253  C  CB    . LYS B 1 194  ? 113.985 89.278  141.183 1.00 242.55 ? 194  LYS B CB    1 
ATOM   3254  C  CG    . LYS B 1 194  ? 114.286 88.523  142.465 1.00 242.55 ? 194  LYS B CG    1 
ATOM   3255  C  CD    . LYS B 1 194  ? 115.647 88.917  143.025 1.00 242.55 ? 194  LYS B CD    1 
ATOM   3256  C  CE    . LYS B 1 194  ? 115.795 88.499  144.484 1.00 242.55 ? 194  LYS B CE    1 
ATOM   3257  N  NZ    . LYS B 1 194  ? 117.097 88.898  145.078 1.00 242.55 ? 194  LYS B NZ    1 
ATOM   3258  N  N     . LEU B 1 195  ? 111.029 88.642  142.374 1.00 195.51 ? 195  LEU B N     1 
ATOM   3259  C  CA    . LEU B 1 195  ? 110.011 89.016  143.343 1.00 195.51 ? 195  LEU B CA    1 
ATOM   3260  C  C     . LEU B 1 195  ? 110.297 88.352  144.674 1.00 195.51 ? 195  LEU B C     1 
ATOM   3261  O  O     . LEU B 1 195  ? 110.159 87.136  144.810 1.00 195.51 ? 195  LEU B O     1 
ATOM   3262  C  CB    . LEU B 1 195  ? 108.623 88.642  142.855 1.00 195.51 ? 195  LEU B CB    1 
ATOM   3263  C  CG    . LEU B 1 195  ? 107.510 89.049  143.818 1.00 195.51 ? 195  LEU B CG    1 
ATOM   3264  C  CD1   . LEU B 1 195  ? 107.635 90.499  144.244 1.00 195.51 ? 195  LEU B CD1   1 
ATOM   3265  C  CD2   . LEU B 1 195  ? 106.162 88.815  143.168 1.00 195.51 ? 195  LEU B CD2   1 
ATOM   3266  N  N     . THR B 1 196  ? 110.656 89.163  145.652 1.00 193.53 ? 196  THR B N     1 
ATOM   3267  C  CA    . THR B 1 196  ? 110.738 88.716  147.026 1.00 193.53 ? 196  THR B CA    1 
ATOM   3268  C  C     . THR B 1 196  ? 109.400 88.921  147.713 1.00 193.53 ? 196  THR B C     1 
ATOM   3269  O  O     . THR B 1 196  ? 108.600 89.778  147.332 1.00 193.53 ? 196  THR B O     1 
ATOM   3270  C  CB    . THR B 1 196  ? 111.832 89.466  147.781 1.00 193.53 ? 196  THR B CB    1 
ATOM   3271  O  OG1   . THR B 1 196  ? 111.785 89.099  149.165 1.00 193.53 ? 196  THR B OG1   1 
ATOM   3272  C  CG2   . THR B 1 196  ? 111.646 90.969  147.638 1.00 193.53 ? 196  THR B CG2   1 
ATOM   3273  N  N     . LEU B 1 197  ? 109.168 88.122  148.751 1.00 202.37 ? 197  LEU B N     1 
ATOM   3274  C  CA    . LEU B 1 197  ? 107.895 88.116  149.468 1.00 202.37 ? 197  LEU B CA    1 
ATOM   3275  C  C     . LEU B 1 197  ? 108.140 88.343  150.956 1.00 202.37 ? 197  LEU B C     1 
ATOM   3276  O  O     . LEU B 1 197  ? 108.371 87.399  151.713 1.00 202.37 ? 197  LEU B O     1 
ATOM   3277  C  CB    . LEU B 1 197  ? 107.170 86.827  149.226 1.00 202.37 ? 197  LEU B CB    1 
ATOM   3278  C  CG    . LEU B 1 197  ? 106.755 86.452  147.810 1.00 202.37 ? 197  LEU B CG    1 
ATOM   3279  C  CD1   . LEU B 1 197  ? 105.733 85.342  147.880 1.00 202.37 ? 197  LEU B CD1   1 
ATOM   3280  C  CD2   . LEU B 1 197  ? 106.177 87.624  147.074 1.00 202.37 ? 197  LEU B CD2   1 
ATOM   3281  N  N     . ARG B 1 198  ? 108.080 89.601  151.374 1.00 185.92 ? 198  ARG B N     1 
ATOM   3282  C  CA    . ARG B 1 198  ? 108.075 89.906  152.796 1.00 185.92 ? 198  ARG B CA    1 
ATOM   3283  C  C     . ARG B 1 198  ? 106.727 89.493  153.374 1.00 185.92 ? 198  ARG B C     1 
ATOM   3284  O  O     . ARG B 1 198  ? 105.697 90.098  153.061 1.00 185.92 ? 198  ARG B O     1 
ATOM   3285  C  CB    . ARG B 1 198  ? 108.366 91.390  153.024 1.00 185.92 ? 198  ARG B CB    1 
ATOM   3286  C  CG    . ARG B 1 198  ? 109.798 91.699  153.533 1.00 185.92 ? 198  ARG B CG    1 
ATOM   3287  C  CD    . ARG B 1 198  ? 110.083 93.208  153.679 1.00 185.92 ? 198  ARG B CD    1 
ATOM   3288  N  NE    . ARG B 1 198  ? 111.381 93.489  154.293 1.00 185.92 ? 198  ARG B NE    1 
ATOM   3289  C  CZ    . ARG B 1 198  ? 112.009 94.659  154.230 1.00 185.92 ? 198  ARG B CZ    1 
ATOM   3290  N  NH1   . ARG B 1 198  ? 113.179 94.810  154.826 1.00 185.92 ? 198  ARG B NH1   1 
ATOM   3291  N  NH2   . ARG B 1 198  ? 111.474 95.680  153.574 1.00 185.92 ? 198  ARG B NH2   1 
ATOM   3292  N  N     . ILE B 1 199  ? 106.726 88.431  154.182 1.00 207.65 ? 199  ILE B N     1 
ATOM   3293  C  CA    . ILE B 1 199  ? 105.506 87.739  154.582 1.00 207.65 ? 199  ILE B CA    1 
ATOM   3294  C  C     . ILE B 1 199  ? 105.517 87.501  156.089 1.00 207.65 ? 199  ILE B C     1 
ATOM   3295  O  O     . ILE B 1 199  ? 106.534 87.112  156.669 1.00 207.65 ? 199  ILE B O     1 
ATOM   3296  C  CB    . ILE B 1 199  ? 105.354 86.399  153.819 1.00 207.65 ? 199  ILE B CB    1 
ATOM   3297  C  CG1   . ILE B 1 199  ? 105.136 86.642  152.327 1.00 207.65 ? 199  ILE B CG1   1 
ATOM   3298  C  CG2   . ILE B 1 199  ? 104.198 85.569  154.363 1.00 207.65 ? 199  ILE B CG2   1 
ATOM   3299  C  CD1   . ILE B 1 199  ? 104.758 85.403  151.549 1.00 207.65 ? 199  ILE B CD1   1 
ATOM   3300  N  N     . TRP B 1 200  ? 104.371 87.755  156.723 1.00 228.30 ? 200  TRP B N     1 
ATOM   3301  C  CA    . TRP B 1 200  ? 104.153 87.471  158.134 1.00 228.30 ? 200  TRP B CA    1 
ATOM   3302  C  C     . TRP B 1 200  ? 102.858 86.690  158.267 1.00 228.30 ? 200  TRP B C     1 
ATOM   3303  O  O     . TRP B 1 200  ? 101.813 87.140  157.790 1.00 228.30 ? 200  TRP B O     1 
ATOM   3304  C  CB    . TRP B 1 200  ? 104.066 88.768  158.931 1.00 228.30 ? 200  TRP B CB    1 
ATOM   3305  C  CG    . TRP B 1 200  ? 105.316 89.534  158.909 1.00 228.30 ? 200  TRP B CG    1 
ATOM   3306  C  CD1   . TRP B 1 200  ? 106.274 89.539  159.866 1.00 228.30 ? 200  TRP B CD1   1 
ATOM   3307  C  CD2   . TRP B 1 200  ? 105.771 90.412  157.878 1.00 228.30 ? 200  TRP B CD2   1 
ATOM   3308  N  NE1   . TRP B 1 200  ? 107.295 90.373  159.508 1.00 228.30 ? 200  TRP B NE1   1 
ATOM   3309  C  CE2   . TRP B 1 200  ? 107.015 90.912  158.283 1.00 228.30 ? 200  TRP B CE2   1 
ATOM   3310  C  CE3   . TRP B 1 200  ? 105.246 90.827  156.655 1.00 228.30 ? 200  TRP B CE3   1 
ATOM   3311  C  CZ2   . TRP B 1 200  ? 107.741 91.805  157.515 1.00 228.30 ? 200  TRP B CZ2   1 
ATOM   3312  C  CZ3   . TRP B 1 200  ? 105.967 91.700  155.894 1.00 228.30 ? 200  TRP B CZ3   1 
ATOM   3313  C  CH2   . TRP B 1 200  ? 107.203 92.184  156.324 1.00 228.30 ? 200  TRP B CH2   1 
ATOM   3314  N  N     . THR B 1 201  ? 102.924 85.525  158.893 1.00 264.31 ? 201  THR B N     1 
ATOM   3315  C  CA    . THR B 1 201  ? 101.734 84.867  159.395 1.00 264.31 ? 201  THR B CA    1 
ATOM   3316  C  C     . THR B 1 201  ? 101.728 85.039  160.902 1.00 264.31 ? 201  THR B C     1 
ATOM   3317  O  O     . THR B 1 201  ? 102.553 85.762  161.455 1.00 264.31 ? 201  THR B O     1 
ATOM   3318  C  CB    . THR B 1 201  ? 101.689 83.397  158.993 1.00 264.31 ? 201  THR B CB    1 
ATOM   3319  O  OG1   . THR B 1 201  ? 102.575 82.640  159.822 1.00 264.31 ? 201  THR B OG1   1 
ATOM   3320  C  CG2   . THR B 1 201  ? 102.108 83.247  157.557 1.00 264.31 ? 201  THR B CG2   1 
ATOM   3321  N  N     . ASP B 1 202  ? 100.792 84.389  161.585 1.00 289.05 ? 202  ASP B N     1 
ATOM   3322  C  CA    . ASP B 1 202  ? 100.757 84.448  163.037 1.00 289.05 ? 202  ASP B CA    1 
ATOM   3323  C  C     . ASP B 1 202  ? 101.435 83.250  163.681 1.00 289.05 ? 202  ASP B C     1 
ATOM   3324  O  O     . ASP B 1 202  ? 101.345 83.075  164.899 1.00 289.05 ? 202  ASP B O     1 
ATOM   3325  C  CB    . ASP B 1 202  ? 99.319  84.577  163.533 1.00 289.05 ? 202  ASP B CB    1 
ATOM   3326  C  CG    . ASP B 1 202  ? 98.449  83.403  163.140 1.00 289.05 ? 202  ASP B CG    1 
ATOM   3327  O  OD1   . ASP B 1 202  ? 98.879  82.539  162.345 1.00 289.05 ? 202  ASP B OD1   1 
ATOM   3328  O  OD2   . ASP B 1 202  ? 97.289  83.372  163.589 1.00 289.05 ? 202  ASP B OD2   1 
ATOM   3329  N  N     . GLY B 1 203  ? 102.082 82.403  162.886 1.00 298.81 ? 203  GLY B N     1 
ATOM   3330  C  CA    . GLY B 1 203  ? 102.751 81.238  163.409 1.00 298.81 ? 203  GLY B CA    1 
ATOM   3331  C  C     . GLY B 1 203  ? 101.886 80.010  163.553 1.00 298.81 ? 203  GLY B C     1 
ATOM   3332  O  O     . GLY B 1 203  ? 102.387 78.965  163.978 1.00 298.81 ? 203  GLY B O     1 
ATOM   3333  N  N     . SER B 1 204  ? 100.596 80.098  163.233 1.00 312.87 ? 204  SER B N     1 
ATOM   3334  C  CA    . SER B 1 204  ? 99.779  78.896  163.174 1.00 312.87 ? 204  SER B CA    1 
ATOM   3335  C  C     . SER B 1 204  ? 99.883  78.200  161.829 1.00 312.87 ? 204  SER B C     1 
ATOM   3336  O  O     . SER B 1 204  ? 99.276  77.139  161.649 1.00 312.87 ? 204  SER B O     1 
ATOM   3337  C  CB    . SER B 1 204  ? 98.317  79.232  163.456 1.00 312.87 ? 204  SER B CB    1 
ATOM   3338  O  OG    . SER B 1 204  ? 97.911  80.369  162.720 1.00 312.87 ? 204  SER B OG    1 
ATOM   3339  N  N     . VAL B 1 205  ? 100.637 78.761  160.893 1.00 296.45 ? 205  VAL B N     1 
ATOM   3340  C  CA    . VAL B 1 205  ? 100.614 78.301  159.515 1.00 296.45 ? 205  VAL B CA    1 
ATOM   3341  C  C     . VAL B 1 205  ? 101.939 78.676  158.860 1.00 296.45 ? 205  VAL B C     1 
ATOM   3342  O  O     . VAL B 1 205  ? 102.490 79.753  159.106 1.00 296.45 ? 205  VAL B O     1 
ATOM   3343  C  CB    . VAL B 1 205  ? 99.379  78.879  158.787 1.00 296.45 ? 205  VAL B CB    1 
ATOM   3344  C  CG1   . VAL B 1 205  ? 99.325  80.398  158.916 1.00 296.45 ? 205  VAL B CG1   1 
ATOM   3345  C  CG2   . VAL B 1 205  ? 99.318  78.433  157.341 1.00 296.45 ? 205  VAL B CG2   1 
ATOM   3346  N  N     . THR B 1 206  ? 102.480 77.750  158.079 1.00 269.10 ? 206  THR B N     1 
ATOM   3347  C  CA    . THR B 1 206  ? 103.621 78.064  157.243 1.00 269.10 ? 206  THR B CA    1 
ATOM   3348  C  C     . THR B 1 206  ? 103.173 79.024  156.147 1.00 269.10 ? 206  THR B C     1 
ATOM   3349  O  O     . THR B 1 206  ? 102.072 78.877  155.612 1.00 269.10 ? 206  THR B O     1 
ATOM   3350  C  CB    . THR B 1 206  ? 104.198 76.787  156.633 1.00 269.10 ? 206  THR B CB    1 
ATOM   3351  O  OG1   . THR B 1 206  ? 104.559 75.887  157.684 1.00 269.10 ? 206  THR B OG1   1 
ATOM   3352  C  CG2   . THR B 1 206  ? 105.428 77.060  155.786 1.00 269.10 ? 206  THR B CG2   1 
ATOM   3353  N  N     . PRO B 1 207  ? 103.962 80.050  155.843 1.00 248.20 ? 207  PRO B N     1 
ATOM   3354  C  CA    . PRO B 1 207  ? 103.612 80.920  154.710 1.00 248.20 ? 207  PRO B CA    1 
ATOM   3355  C  C     . PRO B 1 207  ? 103.570 80.186  153.379 1.00 248.20 ? 207  PRO B C     1 
ATOM   3356  O  O     . PRO B 1 207  ? 102.765 80.523  152.496 1.00 248.20 ? 207  PRO B O     1 
ATOM   3357  C  CB    . PRO B 1 207  ? 104.720 81.974  154.742 1.00 248.20 ? 207  PRO B CB    1 
ATOM   3358  C  CG    . PRO B 1 207  ? 105.243 81.965  156.128 1.00 248.20 ? 207  PRO B CG    1 
ATOM   3359  C  CD    . PRO B 1 207  ? 105.087 80.578  156.635 1.00 248.20 ? 207  PRO B CD    1 
ATOM   3360  N  N     . LEU B 1 208  ? 104.395 79.149  153.248 1.00 237.05 ? 208  LEU B N     1 
ATOM   3361  C  CA    . LEU B 1 208  ? 104.476 78.388  152.011 1.00 237.05 ? 208  LEU B CA    1 
ATOM   3362  C  C     . LEU B 1 208  ? 103.181 77.640  151.730 1.00 237.05 ? 208  LEU B C     1 
ATOM   3363  O  O     . LEU B 1 208  ? 102.658 77.686  150.613 1.00 237.05 ? 208  LEU B O     1 
ATOM   3364  C  CB    . LEU B 1 208  ? 105.650 77.421  152.088 1.00 237.05 ? 208  LEU B CB    1 
ATOM   3365  C  CG    . LEU B 1 208  ? 105.695 76.381  150.978 1.00 237.05 ? 208  LEU B CG    1 
ATOM   3366  C  CD1   . LEU B 1 208  ? 106.050 77.050  149.666 1.00 237.05 ? 208  LEU B CD1   1 
ATOM   3367  C  CD2   . LEU B 1 208  ? 106.688 75.293  151.321 1.00 237.05 ? 208  LEU B CD2   1 
ATOM   3368  N  N     . GLU B 1 209  ? 102.637 76.957  152.740 1.00 237.72 ? 209  GLU B N     1 
ATOM   3369  C  CA    . GLU B 1 209  ? 101.409 76.197  152.526 1.00 237.72 ? 209  GLU B CA    1 
ATOM   3370  C  C     . GLU B 1 209  ? 100.229 77.129  152.294 1.00 237.72 ? 209  GLU B C     1 
ATOM   3371  O  O     . GLU B 1 209  ? 99.286  76.784  151.572 1.00 237.72 ? 209  GLU B O     1 
ATOM   3372  C  CB    . GLU B 1 209  ? 101.148 75.261  153.708 1.00 237.72 ? 209  GLU B CB    1 
ATOM   3373  C  CG    . GLU B 1 209  ? 100.932 75.958  155.028 1.00 237.72 ? 209  GLU B CG    1 
ATOM   3374  C  CD    . GLU B 1 209  ? 101.099 75.056  156.221 1.00 237.72 ? 209  GLU B CD    1 
ATOM   3375  O  OE1   . GLU B 1 209  ? 101.164 73.826  156.029 1.00 237.72 ? 209  GLU B OE1   1 
ATOM   3376  O  OE2   . GLU B 1 209  ? 101.174 75.580  157.354 1.00 237.72 ? 209  GLU B OE2   1 
ATOM   3377  N  N     . ALA B 1 210  ? 100.298 78.336  152.855 1.00 225.49 ? 210  ALA B N     1 
ATOM   3378  C  CA    . ALA B 1 210  ? 99.301  79.352  152.563 1.00 225.49 ? 210  ALA B CA    1 
ATOM   3379  C  C     . ALA B 1 210  ? 99.372  79.763  151.104 1.00 225.49 ? 210  ALA B C     1 
ATOM   3380  O  O     . ALA B 1 210  ? 98.342  79.920  150.441 1.00 225.49 ? 210  ALA B O     1 
ATOM   3381  C  CB    . ALA B 1 210  ? 99.513  80.554  153.474 1.00 225.49 ? 210  ALA B CB    1 
ATOM   3382  N  N     . LEU B 1 211  ? 100.592 79.904  150.584 1.00 212.68 ? 211  LEU B N     1 
ATOM   3383  C  CA    . LEU B 1 211  ? 100.776 80.171  149.162 1.00 212.68 ? 211  LEU B CA    1 
ATOM   3384  C  C     . LEU B 1 211  ? 100.258 79.019  148.310 1.00 212.68 ? 211  LEU B C     1 
ATOM   3385  O  O     . LEU B 1 211  ? 99.710  79.230  147.221 1.00 212.68 ? 211  LEU B O     1 
ATOM   3386  C  CB    . LEU B 1 211  ? 102.256 80.427  148.891 1.00 212.68 ? 211  LEU B CB    1 
ATOM   3387  C  CG    . LEU B 1 211  ? 102.763 80.451  147.454 1.00 212.68 ? 211  LEU B CG    1 
ATOM   3388  C  CD1   . LEU B 1 211  ? 102.080 81.548  146.661 1.00 212.68 ? 211  LEU B CD1   1 
ATOM   3389  C  CD2   . LEU B 1 211  ? 104.264 80.643  147.441 1.00 212.68 ? 211  LEU B CD2   1 
ATOM   3390  N  N     . ASN B 1 212  ? 100.403 77.797  148.810 1.00 222.78 ? 212  ASN B N     1 
ATOM   3391  C  CA    . ASN B 1 212  ? 99.914  76.632  148.085 1.00 222.78 ? 212  ASN B CA    1 
ATOM   3392  C  C     . ASN B 1 212  ? 98.399  76.646  147.982 1.00 222.78 ? 212  ASN B C     1 
ATOM   3393  O  O     . ASN B 1 212  ? 97.839  76.447  146.902 1.00 222.78 ? 212  ASN B O     1 
ATOM   3394  C  CB    . ASN B 1 212  ? 100.389 75.363  148.775 1.00 222.78 ? 212  ASN B CB    1 
ATOM   3395  C  CG    . ASN B 1 212  ? 101.879 75.308  148.884 1.00 222.78 ? 212  ASN B CG    1 
ATOM   3396  O  OD1   . ASN B 1 212  ? 102.582 76.044  148.197 1.00 222.78 ? 212  ASN B OD1   1 
ATOM   3397  N  ND2   . ASN B 1 212  ? 102.379 74.459  149.767 1.00 222.78 ? 212  ASN B ND2   1 
ATOM   3398  N  N     . GLN B 1 213  ? 97.721  76.909  149.093 1.00 221.91 ? 213  GLN B N     1 
ATOM   3399  C  CA    . GLN B 1 213  ? 96.264  76.969  149.066 1.00 221.91 ? 213  GLN B CA    1 
ATOM   3400  C  C     . GLN B 1 213  ? 95.784  78.164  148.260 1.00 221.91 ? 213  GLN B C     1 
ATOM   3401  O  O     . GLN B 1 213  ? 94.726  78.111  147.613 1.00 221.91 ? 213  GLN B O     1 
ATOM   3402  C  CB    . GLN B 1 213  ? 95.747  77.028  150.490 1.00 221.91 ? 213  GLN B CB    1 
ATOM   3403  C  CG    . GLN B 1 213  ? 96.164  75.820  151.271 1.00 221.91 ? 213  GLN B CG    1 
ATOM   3404  C  CD    . GLN B 1 213  ? 96.492  76.159  152.695 1.00 221.91 ? 213  GLN B CD    1 
ATOM   3405  O  OE1   . GLN B 1 213  ? 96.468  77.324  153.084 1.00 221.91 ? 213  GLN B OE1   1 
ATOM   3406  N  NE2   . GLN B 1 213  ? 96.842  75.149  153.478 1.00 221.91 ? 213  GLN B NE2   1 
ATOM   3407  N  N     . ALA B 1 214  ? 96.579  79.233  148.263 1.00 214.85 ? 214  ALA B N     1 
ATOM   3408  C  CA    . ALA B 1 214  ? 96.306  80.399  147.440 1.00 214.85 ? 214  ALA B CA    1 
ATOM   3409  C  C     . ALA B 1 214  ? 96.288  80.034  145.964 1.00 214.85 ? 214  ALA B C     1 
ATOM   3410  O  O     . ALA B 1 214  ? 95.327  80.333  145.244 1.00 214.85 ? 214  ALA B O     1 
ATOM   3411  C  CB    . ALA B 1 214  ? 97.365  81.462  147.719 1.00 214.85 ? 214  ALA B CB    1 
ATOM   3412  N  N     . VAL B 1 215  ? 97.321  79.328  145.506 1.00 214.30 ? 215  VAL B N     1 
ATOM   3413  C  CA    . VAL B 1 215  ? 97.332  78.969  144.100 1.00 214.30 ? 215  VAL B CA    1 
ATOM   3414  C  C     . VAL B 1 215  ? 96.366  77.830  143.814 1.00 214.30 ? 215  VAL B C     1 
ATOM   3415  O  O     . VAL B 1 215  ? 95.994  77.623  142.655 1.00 214.30 ? 215  VAL B O     1 
ATOM   3416  C  CB    . VAL B 1 215  ? 98.764  78.661  143.624 1.00 214.30 ? 215  VAL B CB    1 
ATOM   3417  C  CG1   . VAL B 1 215  ? 99.685  79.809  143.992 1.00 214.30 ? 215  VAL B CG1   1 
ATOM   3418  C  CG2   . VAL B 1 215  ? 99.268  77.375  144.202 1.00 214.30 ? 215  VAL B CG2   1 
ATOM   3419  N  N     . GLU B 1 216  ? 95.898  77.124  144.848 1.00 235.62 ? 216  GLU B N     1 
ATOM   3420  C  CA    . GLU B 1 216  ? 94.802  76.178  144.655 1.00 235.62 ? 216  GLU B CA    1 
ATOM   3421  C  C     . GLU B 1 216  ? 93.524  76.897  144.260 1.00 235.62 ? 216  GLU B C     1 
ATOM   3422  O  O     . GLU B 1 216  ? 92.868  76.538  143.272 1.00 235.62 ? 216  GLU B O     1 
ATOM   3423  C  CB    . GLU B 1 216  ? 94.566  75.349  145.918 1.00 235.62 ? 216  GLU B CB    1 
ATOM   3424  C  CG    . GLU B 1 216  ? 95.605  74.285  146.176 1.00 235.62 ? 216  GLU B CG    1 
ATOM   3425  C  CD    . GLU B 1 216  ? 96.313  73.839  144.914 1.00 235.62 ? 216  GLU B CD    1 
ATOM   3426  O  OE1   . GLU B 1 216  ? 95.714  73.091  144.107 1.00 235.62 ? 216  GLU B OE1   1 
ATOM   3427  O  OE2   . GLU B 1 216  ? 97.477  74.255  144.729 1.00 235.62 ? 216  GLU B OE2   1 
ATOM   3428  N  N     . ILE B 1 217  ? 93.167  77.930  145.025 1.00 225.97 ? 217  ILE B N     1 
ATOM   3429  C  CA    . ILE B 1 217  ? 92.023  78.769  144.673 1.00 225.97 ? 217  ILE B CA    1 
ATOM   3430  C  C     . ILE B 1 217  ? 92.249  79.442  143.329 1.00 225.97 ? 217  ILE B C     1 
ATOM   3431  O  O     . ILE B 1 217  ? 91.311  79.626  142.539 1.00 225.97 ? 217  ILE B O     1 
ATOM   3432  C  CB    . ILE B 1 217  ? 91.775  79.805  145.784 1.00 225.97 ? 217  ILE B CB    1 
ATOM   3433  C  CG1   . ILE B 1 217  ? 91.678  79.114  147.138 1.00 225.97 ? 217  ILE B CG1   1 
ATOM   3434  C  CG2   . ILE B 1 217  ? 90.502  80.579  145.531 1.00 225.97 ? 217  ILE B CG2   1 
ATOM   3435  C  CD1   . ILE B 1 217  ? 92.076  80.007  148.291 1.00 225.97 ? 217  ILE B CD1   1 
ATOM   3436  N  N     . LEU B 1 218  ? 93.505  79.757  143.022 1.00 231.28 ? 218  LEU B N     1 
ATOM   3437  C  CA    . LEU B 1 218  ? 93.810  80.458  141.786 1.00 231.28 ? 218  LEU B CA    1 
ATOM   3438  C  C     . LEU B 1 218  ? 93.586  79.575  140.566 1.00 231.28 ? 218  LEU B C     1 
ATOM   3439  O  O     . LEU B 1 218  ? 92.885  79.971  139.628 1.00 231.28 ? 218  LEU B O     1 
ATOM   3440  C  CB    . LEU B 1 218  ? 95.240  80.980  141.828 1.00 231.28 ? 218  LEU B CB    1 
ATOM   3441  C  CG    . LEU B 1 218  ? 95.519  82.145  140.883 1.00 231.28 ? 218  LEU B CG    1 
ATOM   3442  C  CD1   . LEU B 1 218  ? 94.380  83.149  140.863 1.00 231.28 ? 218  LEU B CD1   1 
ATOM   3443  C  CD2   . LEU B 1 218  ? 96.780  82.825  141.315 1.00 231.28 ? 218  LEU B CD2   1 
ATOM   3444  N  N     . ARG B 1 219  ? 94.141  78.360  140.560 1.00 231.28 ? 219  ARG B N     1 
ATOM   3445  C  CA    . ARG B 1 219  ? 93.908  77.539  139.380 1.00 231.28 ? 219  ARG B CA    1 
ATOM   3446  C  C     . ARG B 1 219  ? 92.497  76.976  139.372 1.00 231.28 ? 219  ARG B C     1 
ATOM   3447  O  O     . ARG B 1 219  ? 92.002  76.612  138.302 1.00 231.28 ? 219  ARG B O     1 
ATOM   3448  C  CB    . ARG B 1 219  ? 94.931  76.407  139.223 1.00 231.28 ? 219  ARG B CB    1 
ATOM   3449  C  CG    . ARG B 1 219  ? 94.534  75.055  139.771 1.00 231.28 ? 219  ARG B CG    1 
ATOM   3450  C  CD    . ARG B 1 219  ? 94.788  74.940  141.232 1.00 231.28 ? 219  ARG B CD    1 
ATOM   3451  N  NE    . ARG B 1 219  ? 94.339  73.658  141.756 1.00 231.28 ? 219  ARG B NE    1 
ATOM   3452  C  CZ    . ARG B 1 219  ? 93.114  73.429  142.213 1.00 231.28 ? 219  ARG B CZ    1 
ATOM   3453  N  NH1   . ARG B 1 219  ? 92.221  74.404  142.236 1.00 231.28 ? 219  ARG B NH1   1 
ATOM   3454  N  NH2   . ARG B 1 219  ? 92.786  72.228  142.664 1.00 231.28 ? 219  ARG B NH2   1 
ATOM   3455  N  N     . GLU B 1 220  ? 91.821  76.958  140.524 1.00 243.66 ? 220  GLU B N     1 
ATOM   3456  C  CA    . GLU B 1 220  ? 90.377  76.759  140.542 1.00 243.66 ? 220  GLU B CA    1 
ATOM   3457  C  C     . GLU B 1 220  ? 89.664  77.831  139.726 1.00 243.66 ? 220  GLU B C     1 
ATOM   3458  O  O     . GLU B 1 220  ? 88.784  77.546  138.900 1.00 243.66 ? 220  GLU B O     1 
ATOM   3459  C  CB    . GLU B 1 220  ? 89.897  76.781  141.986 1.00 243.66 ? 220  GLU B CB    1 
ATOM   3460  C  CG    . GLU B 1 220  ? 88.426  76.984  142.142 1.00 243.66 ? 220  GLU B CG    1 
ATOM   3461  C  CD    . GLU B 1 220  ? 88.065  77.270  143.570 1.00 243.66 ? 220  GLU B CD    1 
ATOM   3462  O  OE1   . GLU B 1 220  ? 88.992  77.340  144.404 1.00 243.66 ? 220  GLU B OE1   1 
ATOM   3463  O  OE2   . GLU B 1 220  ? 86.863  77.429  143.862 1.00 243.66 ? 220  GLU B OE2   1 
ATOM   3464  N  N     . HIS B 1 221  ? 90.076  79.079  139.922 1.00 233.30 ? 221  HIS B N     1 
ATOM   3465  C  CA    . HIS B 1 221  ? 89.468  80.171  139.179 1.00 233.30 ? 221  HIS B CA    1 
ATOM   3466  C  C     . HIS B 1 221  ? 89.877  80.134  137.718 1.00 233.30 ? 221  HIS B C     1 
ATOM   3467  O  O     . HIS B 1 221  ? 89.175  80.661  136.849 1.00 233.30 ? 221  HIS B O     1 
ATOM   3468  C  CB    . HIS B 1 221  ? 89.839  81.494  139.829 1.00 233.30 ? 221  HIS B CB    1 
ATOM   3469  C  CG    . HIS B 1 221  ? 89.064  81.767  141.074 1.00 233.30 ? 221  HIS B CG    1 
ATOM   3470  N  ND1   . HIS B 1 221  ? 88.815  80.796  142.019 1.00 233.30 ? 221  HIS B ND1   1 
ATOM   3471  C  CD2   . HIS B 1 221  ? 88.481  82.898  141.533 1.00 233.30 ? 221  HIS B CD2   1 
ATOM   3472  C  CE1   . HIS B 1 221  ? 88.107  81.315  143.004 1.00 233.30 ? 221  HIS B CE1   1 
ATOM   3473  N  NE2   . HIS B 1 221  ? 87.893  82.590  142.735 1.00 233.30 ? 221  HIS B NE2   1 
ATOM   3474  N  N     . LEU B 1 222  ? 91.011  79.510  137.431 1.00 223.43 ? 222  LEU B N     1 
ATOM   3475  C  CA    . LEU B 1 222  ? 91.368  79.272  136.041 1.00 223.43 ? 222  LEU B CA    1 
ATOM   3476  C  C     . LEU B 1 222  ? 90.458  78.227  135.421 1.00 223.43 ? 222  LEU B C     1 
ATOM   3477  O  O     . LEU B 1 222  ? 90.030  78.364  134.270 1.00 223.43 ? 222  LEU B O     1 
ATOM   3478  C  CB    . LEU B 1 222  ? 92.823  78.840  135.948 1.00 223.43 ? 222  LEU B CB    1 
ATOM   3479  C  CG    . LEU B 1 222  ? 93.780  79.886  136.501 1.00 223.43 ? 222  LEU B CG    1 
ATOM   3480  C  CD1   . LEU B 1 222  ? 95.191  79.480  136.205 1.00 223.43 ? 222  LEU B CD1   1 
ATOM   3481  C  CD2   . LEU B 1 222  ? 93.482  81.269  135.968 1.00 223.43 ? 222  LEU B CD2   1 
ATOM   3482  N  N     . THR B 1 223  ? 90.120  77.190  136.190 1.00 236.19 ? 223  THR B N     1 
ATOM   3483  C  CA    . THR B 1 223  ? 89.216  76.157  135.695 1.00 236.19 ? 223  THR B CA    1 
ATOM   3484  C  C     . THR B 1 223  ? 87.792  76.662  135.589 1.00 236.19 ? 223  THR B C     1 
ATOM   3485  O  O     . THR B 1 223  ? 86.953  76.026  134.942 1.00 236.19 ? 223  THR B O     1 
ATOM   3486  C  CB    . THR B 1 223  ? 89.231  74.939  136.608 1.00 236.19 ? 223  THR B CB    1 
ATOM   3487  O  OG1   . THR B 1 223  ? 88.924  75.351  137.944 1.00 236.19 ? 223  THR B OG1   1 
ATOM   3488  C  CG2   . THR B 1 223  ? 90.579  74.250  136.568 1.00 236.19 ? 223  THR B CG2   1 
ATOM   3489  N  N     . TYR B 1 224  ? 87.498  77.797  136.221 1.00 239.17 ? 224  TYR B N     1 
ATOM   3490  C  CA    . TYR B 1 224  ? 86.190  78.425  136.070 1.00 239.17 ? 224  TYR B CA    1 
ATOM   3491  C  C     . TYR B 1 224  ? 85.878  78.879  134.644 1.00 239.17 ? 224  TYR B C     1 
ATOM   3492  O  O     . TYR B 1 224  ? 84.730  79.244  134.375 1.00 239.17 ? 224  TYR B O     1 
ATOM   3493  C  CB    . TYR B 1 224  ? 86.079  79.625  136.996 1.00 239.17 ? 224  TYR B CB    1 
ATOM   3494  C  CG    . TYR B 1 224  ? 85.873  79.269  138.442 1.00 239.17 ? 224  TYR B CG    1 
ATOM   3495  C  CD1   . TYR B 1 224  ? 85.586  77.967  138.828 1.00 239.17 ? 224  TYR B CD1   1 
ATOM   3496  C  CD2   . TYR B 1 224  ? 85.942  80.246  139.425 1.00 239.17 ? 224  TYR B CD2   1 
ATOM   3497  C  CE1   . TYR B 1 224  ? 85.394  77.649  140.154 1.00 239.17 ? 224  TYR B CE1   1 
ATOM   3498  C  CE2   . TYR B 1 224  ? 85.759  79.938  140.753 1.00 239.17 ? 224  TYR B CE2   1 
ATOM   3499  C  CZ    . TYR B 1 224  ? 85.478  78.641  141.111 1.00 239.17 ? 224  TYR B CZ    1 
ATOM   3500  O  OH    . TYR B 1 224  ? 85.285  78.337  142.436 1.00 239.17 ? 224  TYR B OH    1 
ATOM   3501  N  N     . PHE B 1 225  ? 86.849  78.867  133.728 1.00 239.84 ? 225  PHE B N     1 
ATOM   3502  C  CA    . PHE B 1 225  ? 86.626  79.211  132.330 1.00 239.84 ? 225  PHE B CA    1 
ATOM   3503  C  C     . PHE B 1 225  ? 86.305  78.004  131.472 1.00 239.84 ? 225  PHE B C     1 
ATOM   3504  O  O     . PHE B 1 225  ? 86.643  77.991  130.283 1.00 239.84 ? 225  PHE B O     1 
ATOM   3505  C  CB    . PHE B 1 225  ? 87.851  79.921  131.771 1.00 239.84 ? 225  PHE B CB    1 
ATOM   3506  C  CG    . PHE B 1 225  ? 88.215  81.141  132.521 1.00 239.84 ? 225  PHE B CG    1 
ATOM   3507  C  CD1   . PHE B 1 225  ? 87.243  82.050  132.892 1.00 239.84 ? 225  PHE B CD1   1 
ATOM   3508  C  CD2   . PHE B 1 225  ? 89.524  81.368  132.887 1.00 239.84 ? 225  PHE B CD2   1 
ATOM   3509  C  CE1   . PHE B 1 225  ? 87.580  83.180  133.595 1.00 239.84 ? 225  PHE B CE1   1 
ATOM   3510  C  CE2   . PHE B 1 225  ? 89.870  82.492  133.591 1.00 239.84 ? 225  PHE B CE2   1 
ATOM   3511  C  CZ    . PHE B 1 225  ? 88.895  83.402  133.948 1.00 239.84 ? 225  PHE B CZ    1 
ATOM   3512  N  N     . SER B 1 226  ? 85.671  76.981  132.038 1.00 280.38 ? 226  SER B N     1 
ATOM   3513  C  CA    . SER B 1 226  ? 85.492  75.737  131.301 1.00 280.38 ? 226  SER B CA    1 
ATOM   3514  C  C     . SER B 1 226  ? 84.358  75.844  130.291 1.00 280.38 ? 226  SER B C     1 
ATOM   3515  O  O     . SER B 1 226  ? 84.581  75.774  129.078 1.00 280.38 ? 226  SER B O     1 
ATOM   3516  C  CB    . SER B 1 226  ? 85.230  74.597  132.280 1.00 280.38 ? 226  SER B CB    1 
ATOM   3517  O  OG    . SER B 1 226  ? 84.321  75.013  133.280 1.00 280.38 ? 226  SER B OG    1 
ATOM   3518  N  N     . ASN B 1 227  ? 83.137  76.035  130.769 1.00 296.69 ? 227  ASN B N     1 
ATOM   3519  C  CA    . ASN B 1 227  ? 81.938  75.841  129.971 1.00 296.69 ? 227  ASN B CA    1 
ATOM   3520  C  C     . ASN B 1 227  ? 81.073  77.089  129.984 1.00 296.69 ? 227  ASN B C     1 
ATOM   3521  O  O     . ASN B 1 227  ? 81.067  77.840  130.965 1.00 296.69 ? 227  ASN B O     1 
ATOM   3522  C  CB    . ASN B 1 227  ? 81.128  74.650  130.503 1.00 296.69 ? 227  ASN B CB    1 
ATOM   3523  C  CG    . ASN B 1 227  ? 81.982  73.420  130.726 1.00 296.69 ? 227  ASN B CG    1 
ATOM   3524  O  OD1   . ASN B 1 227  ? 82.860  73.105  129.926 1.00 296.69 ? 227  ASN B OD1   1 
ATOM   3525  N  ND2   . ASN B 1 227  ? 81.729  72.717  131.823 1.00 296.69 ? 227  ASN B ND2   1 
ATOM   3526  N  N     . PRO B 1 228  ? 80.324  77.344  128.898 1.00 259.92 ? 228  PRO B N     1 
ATOM   3527  C  CA    . PRO B 1 228  ? 79.329  78.418  128.852 1.00 259.92 ? 228  PRO B CA    1 
ATOM   3528  C  C     . PRO B 1 228  ? 78.209  78.286  129.879 1.00 259.92 ? 228  PRO B C     1 
ATOM   3529  O  O     . PRO B 1 228  ? 77.822  79.308  130.446 1.00 259.92 ? 228  PRO B O     1 
ATOM   3530  C  CB    . PRO B 1 228  ? 78.766  78.307  127.438 1.00 259.92 ? 228  PRO B CB    1 
ATOM   3531  C  CG    . PRO B 1 228  ? 79.882  77.749  126.650 1.00 259.92 ? 228  PRO B CG    1 
ATOM   3532  C  CD    . PRO B 1 228  ? 80.582  76.789  127.557 1.00 259.92 ? 228  PRO B CD    1 
ATOM   3533  N  N     . MET C 2 1    ? 86.055  119.182 110.420 1.00 235.85 ? 1    MET C N     1 
ATOM   3534  C  CA    . MET C 2 1    ? 84.964  118.930 111.351 1.00 235.85 ? 1    MET C CA    1 
ATOM   3535  C  C     . MET C 2 1    ? 84.403  120.229 111.897 1.00 235.85 ? 1    MET C C     1 
ATOM   3536  O  O     . MET C 2 1    ? 84.581  121.296 111.306 1.00 235.85 ? 1    MET C O     1 
ATOM   3537  C  CB    . MET C 2 1    ? 85.436  118.045 112.505 1.00 235.85 ? 1    MET C CB    1 
ATOM   3538  C  CG    . MET C 2 1    ? 86.687  118.553 113.200 1.00 235.85 ? 1    MET C CG    1 
ATOM   3539  S  SD    . MET C 2 1    ? 87.445  117.303 114.246 1.00 235.85 ? 1    MET C SD    1 
ATOM   3540  C  CE    . MET C 2 1    ? 87.708  115.998 113.055 1.00 235.85 ? 1    MET C CE    1 
ATOM   3541  N  N     . GLU C 2 2    ? 83.707  120.121 113.024 1.00 245.51 ? 2    GLU C N     1 
ATOM   3542  C  CA    . GLU C 2 2    ? 83.281  121.298 113.758 1.00 245.51 ? 2    GLU C CA    1 
ATOM   3543  C  C     . GLU C 2 2    ? 84.498  122.033 114.285 1.00 245.51 ? 2    GLU C C     1 
ATOM   3544  O  O     . GLU C 2 2    ? 85.244  121.506 115.114 1.00 245.51 ? 2    GLU C O     1 
ATOM   3545  C  CB    . GLU C 2 2    ? 82.366  120.894 114.908 1.00 245.51 ? 2    GLU C CB    1 
ATOM   3546  C  CG    . GLU C 2 2    ? 81.498  122.007 115.457 1.00 245.51 ? 2    GLU C CG    1 
ATOM   3547  C  CD    . GLU C 2 2    ? 82.162  122.831 116.553 1.00 245.51 ? 2    GLU C CD    1 
ATOM   3548  O  OE1   . GLU C 2 2    ? 83.246  122.460 117.051 1.00 245.51 ? 2    GLU C OE1   1 
ATOM   3549  O  OE2   . GLU C 2 2    ? 81.565  123.851 116.939 1.00 245.51 ? 2    GLU C OE2   1 
ATOM   3550  N  N     . ILE C 2 3    ? 84.715  123.234 113.784 1.00 247.32 ? 3    ILE C N     1 
ATOM   3551  C  CA    . ILE C 2 3    ? 85.793  124.094 114.251 1.00 247.32 ? 3    ILE C CA    1 
ATOM   3552  C  C     . ILE C 2 3    ? 85.122  125.356 114.773 1.00 247.32 ? 3    ILE C C     1 
ATOM   3553  O  O     . ILE C 2 3    ? 84.846  126.291 114.018 1.00 247.32 ? 3    ILE C O     1 
ATOM   3554  C  CB    . ILE C 2 3    ? 86.805  124.418 113.152 1.00 247.32 ? 3    ILE C CB    1 
ATOM   3555  C  CG1   . ILE C 2 3    ? 87.134  123.176 112.323 1.00 247.32 ? 3    ILE C CG1   1 
ATOM   3556  C  CG2   . ILE C 2 3    ? 88.063  124.987 113.766 1.00 247.32 ? 3    ILE C CG2   1 
ATOM   3557  C  CD1   . ILE C 2 3    ? 87.842  122.093 113.091 1.00 247.32 ? 3    ILE C CD1   1 
ATOM   3558  N  N     . LYS C 2 4    ? 84.847  125.401 116.068 1.00 215.11 ? 4    LYS C N     1 
ATOM   3559  C  CA    . LYS C 2 4    ? 84.136  126.546 116.602 1.00 215.11 ? 4    LYS C CA    1 
ATOM   3560  C  C     . LYS C 2 4    ? 85.067  127.724 116.795 1.00 215.11 ? 4    LYS C C     1 
ATOM   3561  O  O     . LYS C 2 4    ? 86.116  127.612 117.429 1.00 215.11 ? 4    LYS C O     1 
ATOM   3562  C  CB    . LYS C 2 4    ? 83.476  126.225 117.931 1.00 215.11 ? 4    LYS C CB    1 
ATOM   3563  C  CG    . LYS C 2 4    ? 82.434  127.254 118.277 1.00 215.11 ? 4    LYS C CG    1 
ATOM   3564  C  CD    . LYS C 2 4    ? 81.950  127.113 119.692 1.00 215.11 ? 4    LYS C CD    1 
ATOM   3565  C  CE    . LYS C 2 4    ? 81.464  128.446 120.209 1.00 215.11 ? 4    LYS C CE    1 
ATOM   3566  N  NZ    . LYS C 2 4    ? 82.438  129.523 119.905 1.00 215.11 ? 4    LYS C NZ    1 
ATOM   3567  N  N     . ARG C 2 5    ? 84.665  128.859 116.251 1.00 211.22 ? 5    ARG C N     1 
ATOM   3568  C  CA    . ARG C 2 5    ? 85.288  130.129 116.561 1.00 211.22 ? 5    ARG C CA    1 
ATOM   3569  C  C     . ARG C 2 5    ? 84.641  130.693 117.812 1.00 211.22 ? 5    ARG C C     1 
ATOM   3570  O  O     . ARG C 2 5    ? 83.440  130.525 118.027 1.00 211.22 ? 5    ARG C O     1 
ATOM   3571  C  CB    . ARG C 2 5    ? 85.130  131.111 115.408 1.00 211.22 ? 5    ARG C CB    1 
ATOM   3572  C  CG    . ARG C 2 5    ? 86.121  130.906 114.289 1.00 211.22 ? 5    ARG C CG    1 
ATOM   3573  C  CD    . ARG C 2 5    ? 86.260  132.165 113.462 1.00 211.22 ? 5    ARG C CD    1 
ATOM   3574  N  NE    . ARG C 2 5    ? 86.112  133.366 114.280 1.00 211.22 ? 5    ARG C NE    1 
ATOM   3575  C  CZ    . ARG C 2 5    ? 87.109  133.957 114.931 1.00 211.22 ? 5    ARG C CZ    1 
ATOM   3576  N  NH1   . ARG C 2 5    ? 88.333  133.459 114.865 1.00 211.22 ? 5    ARG C NH1   1 
ATOM   3577  N  NH2   . ARG C 2 5    ? 86.880  135.045 115.651 1.00 211.22 ? 5    ARG C NH2   1 
ATOM   3578  N  N     . PHE C 2 6    ? 85.438  131.356 118.634 1.00 217.44 ? 6    PHE C N     1 
ATOM   3579  C  CA    . PHE C 2 6    ? 84.948  131.951 119.863 1.00 217.44 ? 6    PHE C CA    1 
ATOM   3580  C  C     . PHE C 2 6    ? 85.103  133.459 119.807 1.00 217.44 ? 6    PHE C C     1 
ATOM   3581  O  O     . PHE C 2 6    ? 85.660  134.018 118.862 1.00 217.44 ? 6    PHE C O     1 
ATOM   3582  C  CB    . PHE C 2 6    ? 85.695  131.404 121.076 1.00 217.44 ? 6    PHE C CB    1 
ATOM   3583  C  CG    . PHE C 2 6    ? 85.121  130.143 121.612 1.00 217.44 ? 6    PHE C CG    1 
ATOM   3584  C  CD1   . PHE C 2 6    ? 84.238  130.170 122.673 1.00 217.44 ? 6    PHE C CD1   1 
ATOM   3585  C  CD2   . PHE C 2 6    ? 85.463  128.926 121.054 1.00 217.44 ? 6    PHE C CD2   1 
ATOM   3586  C  CE1   . PHE C 2 6    ? 83.705  129.004 123.171 1.00 217.44 ? 6    PHE C CE1   1 
ATOM   3587  C  CE2   . PHE C 2 6    ? 84.937  127.757 121.549 1.00 217.44 ? 6    PHE C CE2   1 
ATOM   3588  C  CZ    . PHE C 2 6    ? 84.055  127.796 122.609 1.00 217.44 ? 6    PHE C CZ    1 
ATOM   3589  N  N     . GLY C 2 7    ? 84.593  134.114 120.842 1.00 239.36 ? 7    GLY C N     1 
ATOM   3590  C  CA    . GLY C 2 7    ? 84.826  135.529 121.026 1.00 239.36 ? 7    GLY C CA    1 
ATOM   3591  C  C     . GLY C 2 7    ? 83.964  136.447 120.188 1.00 239.36 ? 7    GLY C C     1 
ATOM   3592  O  O     . GLY C 2 7    ? 83.800  136.239 118.984 1.00 239.36 ? 7    GLY C O     1 
ATOM   3593  N  N     . ARG C 2 8    ? 83.422  137.489 120.815 1.00 261.15 ? 8    ARG C N     1 
ATOM   3594  C  CA    . ARG C 2 8    ? 82.615  138.446 120.071 1.00 261.15 ? 8    ARG C CA    1 
ATOM   3595  C  C     . ARG C 2 8    ? 83.496  139.405 119.293 1.00 261.15 ? 8    ARG C C     1 
ATOM   3596  O  O     . ARG C 2 8    ? 83.040  140.020 118.324 1.00 261.15 ? 8    ARG C O     1 
ATOM   3597  C  CB    . ARG C 2 8    ? 81.715  139.249 121.009 1.00 261.15 ? 8    ARG C CB    1 
ATOM   3598  C  CG    . ARG C 2 8    ? 80.487  138.535 121.539 1.00 261.15 ? 8    ARG C CG    1 
ATOM   3599  C  CD    . ARG C 2 8    ? 80.848  137.858 122.828 1.00 261.15 ? 8    ARG C CD    1 
ATOM   3600  N  NE    . ARG C 2 8    ? 81.520  138.809 123.703 1.00 261.15 ? 8    ARG C NE    1 
ATOM   3601  C  CZ    . ARG C 2 8    ? 82.424  138.470 124.611 1.00 261.15 ? 8    ARG C CZ    1 
ATOM   3602  N  NH1   . ARG C 2 8    ? 82.780  137.202 124.747 1.00 261.15 ? 8    ARG C NH1   1 
ATOM   3603  N  NH2   . ARG C 2 8    ? 82.990  139.400 125.366 1.00 261.15 ? 8    ARG C NH2   1 
ATOM   3604  N  N     . ILE C 2 9    ? 84.747  139.555 119.726 1.00 247.06 ? 9    ILE C N     1 
ATOM   3605  C  CA    . ILE C 2 9    ? 85.662  140.546 119.179 1.00 247.06 ? 9    ILE C CA    1 
ATOM   3606  C  C     . ILE C 2 9    ? 85.985  140.188 117.740 1.00 247.06 ? 9    ILE C C     1 
ATOM   3607  O  O     . ILE C 2 9    ? 86.389  139.061 117.435 1.00 247.06 ? 9    ILE C O     1 
ATOM   3608  C  CB    . ILE C 2 9    ? 86.934  140.664 120.038 1.00 247.06 ? 9    ILE C CB    1 
ATOM   3609  C  CG1   . ILE C 2 9    ? 86.661  141.562 121.241 1.00 247.06 ? 9    ILE C CG1   1 
ATOM   3610  C  CG2   . ILE C 2 9    ? 88.103  141.222 119.240 1.00 247.06 ? 9    ILE C CG2   1 
ATOM   3611  C  CD1   . ILE C 2 9    ? 87.826  141.673 122.180 1.00 247.06 ? 9    ILE C CD1   1 
ATOM   3612  N  N     . ARG C 2 10   ? 85.748  141.138 116.846 1.00 257.58 ? 10   ARG C N     1 
ATOM   3613  C  CA    . ARG C 2 10   ? 86.012  140.968 115.427 1.00 257.58 ? 10   ARG C CA    1 
ATOM   3614  C  C     . ARG C 2 10   ? 86.592  142.289 114.946 1.00 257.58 ? 10   ARG C C     1 
ATOM   3615  O  O     . ARG C 2 10   ? 85.883  143.297 114.882 1.00 257.58 ? 10   ARG C O     1 
ATOM   3616  C  CB    . ARG C 2 10   ? 84.733  140.589 114.682 1.00 257.58 ? 10   ARG C CB    1 
ATOM   3617  C  CG    . ARG C 2 10   ? 84.905  140.025 113.279 1.00 257.58 ? 10   ARG C CG    1 
ATOM   3618  C  CD    . ARG C 2 10   ? 84.819  141.150 112.279 1.00 257.58 ? 10   ARG C CD    1 
ATOM   3619  N  NE    . ARG C 2 10   ? 83.775  142.083 112.685 1.00 257.58 ? 10   ARG C NE    1 
ATOM   3620  C  CZ    . ARG C 2 10   ? 83.813  143.391 112.457 1.00 257.58 ? 10   ARG C CZ    1 
ATOM   3621  N  NH1   . ARG C 2 10   ? 82.821  144.167 112.868 1.00 257.58 ? 10   ARG C NH1   1 
ATOM   3622  N  NH2   . ARG C 2 10   ? 84.854  143.924 111.837 1.00 257.58 ? 10   ARG C NH2   1 
ATOM   3623  N  N     . GLU C 2 11   ? 87.873  142.274 114.604 1.00 243.89 ? 11   GLU C N     1 
ATOM   3624  C  CA    . GLU C 2 11   ? 88.598  143.467 114.205 1.00 243.89 ? 11   GLU C CA    1 
ATOM   3625  C  C     . GLU C 2 11   ? 88.172  143.895 112.804 1.00 243.89 ? 11   GLU C C     1 
ATOM   3626  O  O     . GLU C 2 11   ? 87.420  143.205 112.114 1.00 243.89 ? 11   GLU C O     1 
ATOM   3627  C  CB    . GLU C 2 11   ? 90.092  143.178 114.245 1.00 243.89 ? 11   GLU C CB    1 
ATOM   3628  C  CG    . GLU C 2 11   ? 90.571  142.423 113.014 1.00 243.89 ? 11   GLU C CG    1 
ATOM   3629  C  CD    . GLU C 2 11   ? 90.327  140.924 113.046 1.00 243.89 ? 11   GLU C CD    1 
ATOM   3630  O  OE1   . GLU C 2 11   ? 89.597  140.423 113.927 1.00 243.89 ? 11   GLU C OE1   1 
ATOM   3631  O  OE2   . GLU C 2 11   ? 90.865  140.237 112.154 1.00 243.89 ? 11   GLU C OE2   1 
ATOM   3632  N  N     . VAL C 2 12   ? 88.688  145.036 112.358 1.00 225.13 ? 12   VAL C N     1 
ATOM   3633  C  CA    . VAL C 2 12   ? 88.259  145.579 111.079 1.00 225.13 ? 12   VAL C CA    1 
ATOM   3634  C  C     . VAL C 2 12   ? 89.252  145.276 109.965 1.00 225.13 ? 12   VAL C C     1 
ATOM   3635  O  O     . VAL C 2 12   ? 88.906  145.368 108.784 1.00 225.13 ? 12   VAL C O     1 
ATOM   3636  C  CB    . VAL C 2 12   ? 88.005  147.093 111.190 1.00 225.13 ? 12   VAL C CB    1 
ATOM   3637  C  CG1   . VAL C 2 12   ? 87.103  147.378 112.375 1.00 225.13 ? 12   VAL C CG1   1 
ATOM   3638  C  CG2   . VAL C 2 12   ? 89.310  147.854 111.321 1.00 225.13 ? 12   VAL C CG2   1 
ATOM   3639  N  N     . ILE C 2 13   ? 90.484  144.915 110.307 1.00 207.64 ? 13   ILE C N     1 
ATOM   3640  C  CA    . ILE C 2 13   ? 91.495  144.756 109.263 1.00 207.64 ? 13   ILE C CA    1 
ATOM   3641  C  C     . ILE C 2 13   ? 92.263  143.455 109.439 1.00 207.64 ? 13   ILE C C     1 
ATOM   3642  O  O     . ILE C 2 13   ? 92.557  143.053 110.569 1.00 207.64 ? 13   ILE C O     1 
ATOM   3643  C  CB    . ILE C 2 13   ? 92.461  145.950 109.235 1.00 207.64 ? 13   ILE C CB    1 
ATOM   3644  C  CG1   . ILE C 2 13   ? 92.870  146.341 110.651 1.00 207.64 ? 13   ILE C CG1   1 
ATOM   3645  C  CG2   . ILE C 2 13   ? 91.852  147.119 108.482 1.00 207.64 ? 13   ILE C CG2   1 
ATOM   3646  C  CD1   . ILE C 2 13   ? 93.996  147.349 110.694 1.00 207.64 ? 13   ILE C CD1   1 
ATOM   3647  N  N     . PRO C 2 14   ? 92.633  142.783 108.361 1.00 198.64 ? 14   PRO C N     1 
ATOM   3648  C  CA    . PRO C 2 14   ? 93.426  141.560 108.501 1.00 198.64 ? 14   PRO C CA    1 
ATOM   3649  C  C     . PRO C 2 14   ? 94.878  141.854 108.811 1.00 198.64 ? 14   PRO C C     1 
ATOM   3650  O  O     . PRO C 2 14   ? 95.273  143.006 109.011 1.00 198.64 ? 14   PRO C O     1 
ATOM   3651  C  CB    . PRO C 2 14   ? 93.278  140.893 107.133 1.00 198.64 ? 14   PRO C CB    1 
ATOM   3652  C  CG    . PRO C 2 14   ? 93.126  142.037 106.209 1.00 198.64 ? 14   PRO C CG    1 
ATOM   3653  C  CD    . PRO C 2 14   ? 92.313  143.063 106.952 1.00 198.64 ? 14   PRO C CD    1 
ATOM   3654  N  N     . LEU C 2 15   ? 95.666  140.821 108.847 1.00 192.65 ? 15   LEU C N     1 
ATOM   3655  C  CA    . LEU C 2 15   ? 97.040  140.959 109.281 1.00 192.65 ? 15   LEU C CA    1 
ATOM   3656  C  C     . LEU C 2 15   ? 97.893  141.562 108.174 1.00 192.65 ? 15   LEU C C     1 
ATOM   3657  O  O     . LEU C 2 15   ? 97.719  141.225 107.001 1.00 192.65 ? 15   LEU C O     1 
ATOM   3658  C  CB    . LEU C 2 15   ? 97.604  139.610 109.681 1.00 192.65 ? 15   LEU C CB    1 
ATOM   3659  C  CG    . LEU C 2 15   ? 96.777  138.922 110.754 1.00 192.65 ? 15   LEU C CG    1 
ATOM   3660  C  CD1   . LEU C 2 15   ? 95.977  137.758 110.193 1.00 192.65 ? 15   LEU C CD1   1 
ATOM   3661  C  CD2   . LEU C 2 15   ? 97.690  138.484 111.868 1.00 192.65 ? 15   LEU C CD2   1 
ATOM   3662  N  N     . PRO C 2 16   ? 98.817  142.448 108.518 1.00 195.04 ? 16   PRO C N     1 
ATOM   3663  C  CA    . PRO C 2 16   ? 99.813  142.868 107.559 1.00 195.04 ? 16   PRO C CA    1 
ATOM   3664  C  C     . PRO C 2 16   ? 100.754 141.718 107.275 1.00 195.04 ? 16   PRO C C     1 
ATOM   3665  O  O     . PRO C 2 16   ? 100.850 140.778 108.078 1.00 195.04 ? 16   PRO C O     1 
ATOM   3666  C  CB    . PRO C 2 16   ? 100.543 144.017 108.274 1.00 195.04 ? 16   PRO C CB    1 
ATOM   3667  C  CG    . PRO C 2 16   ? 99.740  144.304 109.509 1.00 195.04 ? 16   PRO C CG    1 
ATOM   3668  C  CD    . PRO C 2 16   ? 99.055  143.033 109.844 1.00 195.04 ? 16   PRO C CD    1 
ATOM   3669  N  N     . PRO C 2 17   ? 101.437 141.735 106.149 1.00 212.74 ? 17   PRO C N     1 
ATOM   3670  C  CA    . PRO C 2 17   ? 102.466 140.718 105.902 1.00 212.74 ? 17   PRO C CA    1 
ATOM   3671  C  C     . PRO C 2 17   ? 103.627 140.817 106.877 1.00 212.74 ? 17   PRO C C     1 
ATOM   3672  O  O     . PRO C 2 17   ? 103.754 141.784 107.633 1.00 212.74 ? 17   PRO C O     1 
ATOM   3673  C  CB    . PRO C 2 17   ? 102.900 141.004 104.463 1.00 212.74 ? 17   PRO C CB    1 
ATOM   3674  C  CG    . PRO C 2 17   ? 101.708 141.637 103.848 1.00 212.74 ? 17   PRO C CG    1 
ATOM   3675  C  CD    . PRO C 2 17   ? 101.066 142.456 104.924 1.00 212.74 ? 17   PRO C CD    1 
ATOM   3676  N  N     . LEU C 2 18   ? 104.468 139.795 106.897 1.00 233.05 ? 18   LEU C N     1 
ATOM   3677  C  CA    . LEU C 2 18   ? 105.391 139.612 108.003 1.00 233.05 ? 18   LEU C CA    1 
ATOM   3678  C  C     . LEU C 2 18   ? 106.836 139.849 107.592 1.00 233.05 ? 18   LEU C C     1 
ATOM   3679  O  O     . LEU C 2 18   ? 107.523 140.682 108.184 1.00 233.05 ? 18   LEU C O     1 
ATOM   3680  C  CB    . LEU C 2 18   ? 105.204 138.208 108.577 1.00 233.05 ? 18   LEU C CB    1 
ATOM   3681  C  CG    . LEU C 2 18   ? 103.729 137.883 108.801 1.00 233.05 ? 18   LEU C CG    1 
ATOM   3682  C  CD1   . LEU C 2 18   ? 103.559 136.448 109.239 1.00 233.05 ? 18   LEU C CD1   1 
ATOM   3683  C  CD2   . LEU C 2 18   ? 103.132 138.840 109.825 1.00 233.05 ? 18   LEU C CD2   1 
ATOM   3684  N  N     . THR C 2 19   ? 107.310 139.159 106.560 1.00 237.80 ? 19   THR C N     1 
ATOM   3685  C  CA    . THR C 2 19   ? 108.653 139.419 106.072 1.00 237.80 ? 19   THR C CA    1 
ATOM   3686  C  C     . THR C 2 19   ? 108.730 140.666 105.212 1.00 237.80 ? 19   THR C C     1 
ATOM   3687  O  O     . THR C 2 19   ? 109.823 141.001 104.744 1.00 237.80 ? 19   THR C O     1 
ATOM   3688  C  CB    . THR C 2 19   ? 109.159 138.228 105.274 1.00 237.80 ? 19   THR C CB    1 
ATOM   3689  O  OG1   . THR C 2 19   ? 110.409 138.567 104.664 1.00 237.80 ? 19   THR C OG1   1 
ATOM   3690  C  CG2   . THR C 2 19   ? 108.156 137.867 104.199 1.00 237.80 ? 19   THR C CG2   1 
ATOM   3691  N  N     . GLU C 2 20   ? 107.606 141.360 105.017 1.00 227.10 ? 20   GLU C N     1 
ATOM   3692  C  CA    . GLU C 2 20   ? 107.484 142.534 104.166 1.00 227.10 ? 20   GLU C CA    1 
ATOM   3693  C  C     . GLU C 2 20   ? 108.403 143.664 104.605 1.00 227.10 ? 20   GLU C C     1 
ATOM   3694  O  O     . GLU C 2 20   ? 108.798 144.493 103.784 1.00 227.10 ? 20   GLU C O     1 
ATOM   3695  C  CB    . GLU C 2 20   ? 106.031 143.015 104.151 1.00 227.10 ? 20   GLU C CB    1 
ATOM   3696  C  CG    . GLU C 2 20   ? 105.509 143.479 105.502 1.00 227.10 ? 20   GLU C CG    1 
ATOM   3697  C  CD    . GLU C 2 20   ? 104.148 144.142 105.423 1.00 227.10 ? 20   GLU C CD    1 
ATOM   3698  O  OE1   . GLU C 2 20   ? 103.684 144.398 104.295 1.00 227.10 ? 20   GLU C OE1   1 
ATOM   3699  O  OE2   . GLU C 2 20   ? 103.540 144.407 106.483 1.00 227.10 ? 20   GLU C OE2   1 
ATOM   3700  N  N     . ILE C 2 21   ? 108.765 143.676 105.888 1.00 225.00 ? 21   ILE C N     1 
ATOM   3701  C  CA    . ILE C 2 21   ? 109.606 144.731 106.438 1.00 225.00 ? 21   ILE C CA    1 
ATOM   3702  C  C     . ILE C 2 21   ? 111.003 144.683 105.829 1.00 225.00 ? 21   ILE C C     1 
ATOM   3703  O  O     . ILE C 2 21   ? 111.486 145.673 105.263 1.00 225.00 ? 21   ILE C O     1 
ATOM   3704  C  CB    . ILE C 2 21   ? 109.631 144.637 107.975 1.00 225.00 ? 21   ILE C CB    1 
ATOM   3705  C  CG1   . ILE C 2 21   ? 110.660 145.594 108.565 1.00 225.00 ? 21   ILE C CG1   1 
ATOM   3706  C  CG2   . ILE C 2 21   ? 109.724 143.191 108.481 1.00 225.00 ? 21   ILE C CG2   1 
ATOM   3707  C  CD1   . ILE C 2 21   ? 110.307 147.034 108.375 1.00 225.00 ? 21   ILE C CD1   1 
ATOM   3708  N  N     . GLN C 2 22   ? 111.644 143.518 105.884 1.00 254.39 ? 22   GLN C N     1 
ATOM   3709  C  CA    . GLN C 2 22   ? 113.031 143.419 105.460 1.00 254.39 ? 22   GLN C CA    1 
ATOM   3710  C  C     . GLN C 2 22   ? 113.143 143.525 103.951 1.00 254.39 ? 22   GLN C C     1 
ATOM   3711  O  O     . GLN C 2 22   ? 113.994 144.253 103.431 1.00 254.39 ? 22   GLN C O     1 
ATOM   3712  C  CB    . GLN C 2 22   ? 113.637 142.109 105.956 1.00 254.39 ? 22   GLN C CB    1 
ATOM   3713  C  CG    . GLN C 2 22   ? 113.609 141.941 107.464 1.00 254.39 ? 22   GLN C CG    1 
ATOM   3714  C  CD    . GLN C 2 22   ? 114.850 142.502 108.150 1.00 254.39 ? 22   GLN C CD    1 
ATOM   3715  O  OE1   . GLN C 2 22   ? 115.445 143.476 107.689 1.00 254.39 ? 22   GLN C OE1   1 
ATOM   3716  N  NE2   . GLN C 2 22   ? 115.247 141.880 109.256 1.00 254.39 ? 22   GLN C NE2   1 
ATOM   3717  N  N     . VAL C 2 23   ? 112.258 142.835 103.233 1.00 242.65 ? 23   VAL C N     1 
ATOM   3718  C  CA    . VAL C 2 23   ? 112.315 142.872 101.779 1.00 242.65 ? 23   VAL C CA    1 
ATOM   3719  C  C     . VAL C 2 23   ? 111.889 144.238 101.271 1.00 242.65 ? 23   VAL C C     1 
ATOM   3720  O  O     . VAL C 2 23   ? 112.417 144.730 100.268 1.00 242.65 ? 23   VAL C O     1 
ATOM   3721  C  CB    . VAL C 2 23   ? 111.480 141.721 101.180 1.00 242.65 ? 23   VAL C CB    1 
ATOM   3722  C  CG1   . VAL C 2 23   ? 110.002 141.838 101.529 1.00 242.65 ? 23   VAL C CG1   1 
ATOM   3723  C  CG2   . VAL C 2 23   ? 111.685 141.620 99.676  1.00 242.65 ? 23   VAL C CG2   1 
ATOM   3724  N  N     . GLU C 2 24   ? 111.005 144.912 102.007 1.00 248.05 ? 24   GLU C N     1 
ATOM   3725  C  CA    . GLU C 2 24   ? 110.556 146.235 101.606 1.00 248.05 ? 24   GLU C CA    1 
ATOM   3726  C  C     . GLU C 2 24   ? 111.679 147.243 101.759 1.00 248.05 ? 24   GLU C C     1 
ATOM   3727  O  O     . GLU C 2 24   ? 111.961 148.016 100.838 1.00 248.05 ? 24   GLU C O     1 
ATOM   3728  C  CB    . GLU C 2 24   ? 109.338 146.644 102.431 1.00 248.05 ? 24   GLU C CB    1 
ATOM   3729  C  CG    . GLU C 2 24   ? 109.091 148.144 102.477 1.00 248.05 ? 24   GLU C CG    1 
ATOM   3730  C  CD    . GLU C 2 24   ? 108.841 148.743 101.099 1.00 248.05 ? 24   GLU C CD    1 
ATOM   3731  O  OE1   . GLU C 2 24   ? 108.108 148.121 100.302 1.00 248.05 ? 24   GLU C OE1   1 
ATOM   3732  O  OE2   . GLU C 2 24   ? 109.398 149.824 100.810 1.00 248.05 ? 24   GLU C OE2   1 
ATOM   3733  N  N     . SER C 2 25   ? 112.352 147.219 102.912 1.00 241.41 ? 25   SER C N     1 
ATOM   3734  C  CA    . SER C 2 25   ? 113.502 148.087 103.127 1.00 241.41 ? 25   SER C CA    1 
ATOM   3735  C  C     . SER C 2 25   ? 114.622 147.759 102.156 1.00 241.41 ? 25   SER C C     1 
ATOM   3736  O  O     . SER C 2 25   ? 115.332 148.654 101.680 1.00 241.41 ? 25   SER C O     1 
ATOM   3737  C  CB    . SER C 2 25   ? 113.986 147.939 104.564 1.00 241.41 ? 25   SER C CB    1 
ATOM   3738  O  OG    . SER C 2 25   ? 114.029 146.571 104.924 1.00 241.41 ? 25   SER C OG    1 
ATOM   3739  N  N     . TYR C 2 26   ? 114.738 146.485 101.790 1.00 241.89 ? 26   TYR C N     1 
ATOM   3740  C  CA    . TYR C 2 26   ? 115.794 146.060 100.890 1.00 241.89 ? 26   TYR C CA    1 
ATOM   3741  C  C     . TYR C 2 26   ? 115.579 146.604 99.490  1.00 241.89 ? 26   TYR C C     1 
ATOM   3742  O  O     . TYR C 2 26   ? 116.428 147.321 98.962  1.00 241.89 ? 26   TYR C O     1 
ATOM   3743  C  CB    . TYR C 2 26   ? 115.870 144.544 100.867 1.00 241.89 ? 26   TYR C CB    1 
ATOM   3744  C  CG    . TYR C 2 26   ? 117.178 144.075 100.331 1.00 241.89 ? 26   TYR C CG    1 
ATOM   3745  C  CD1   . TYR C 2 26   ? 118.306 144.072 101.127 1.00 241.89 ? 26   TYR C CD1   1 
ATOM   3746  C  CD2   . TYR C 2 26   ? 117.297 143.676 99.015  1.00 241.89 ? 26   TYR C CD2   1 
ATOM   3747  C  CE1   . TYR C 2 26   ? 119.512 143.655 100.634 1.00 241.89 ? 26   TYR C CE1   1 
ATOM   3748  C  CE2   . TYR C 2 26   ? 118.496 143.258 98.510  1.00 241.89 ? 26   TYR C CE2   1 
ATOM   3749  C  CZ    . TYR C 2 26   ? 119.601 143.245 99.324  1.00 241.89 ? 26   TYR C CZ    1 
ATOM   3750  O  OH    . TYR C 2 26   ? 120.804 142.823 98.816  1.00 241.89 ? 26   TYR C OH    1 
ATOM   3751  N  N     . ARG C 2 27   ? 114.425 146.308 98.888  1.00 222.55 ? 27   ARG C N     1 
ATOM   3752  C  CA    . ARG C 2 27   ? 114.166 146.795 97.537  1.00 222.55 ? 27   ARG C CA    1 
ATOM   3753  C  C     . ARG C 2 27   ? 113.940 148.294 97.525  1.00 222.55 ? 27   ARG C C     1 
ATOM   3754  O  O     . ARG C 2 27   ? 114.045 148.928 96.470  1.00 222.55 ? 27   ARG C O     1 
ATOM   3755  C  CB    . ARG C 2 27   ? 112.971 146.075 96.922  1.00 222.55 ? 27   ARG C CB    1 
ATOM   3756  C  CG    . ARG C 2 27   ? 111.671 146.338 97.624  1.00 222.55 ? 27   ARG C CG    1 
ATOM   3757  C  CD    . ARG C 2 27   ? 110.734 147.182 96.822  1.00 222.55 ? 27   ARG C CD    1 
ATOM   3758  N  NE    . ARG C 2 27   ? 109.462 147.297 97.518  1.00 222.55 ? 27   ARG C NE    1 
ATOM   3759  C  CZ    . ARG C 2 27   ? 108.501 148.143 97.176  1.00 222.55 ? 27   ARG C CZ    1 
ATOM   3760  N  NH1   . ARG C 2 27   ? 108.670 148.956 96.145  1.00 222.55 ? 27   ARG C NH1   1 
ATOM   3761  N  NH2   . ARG C 2 27   ? 107.371 148.181 97.870  1.00 222.55 ? 27   ARG C NH2   1 
ATOM   3762  N  N     . ARG C 2 28   ? 113.619 148.871 98.679  1.00 217.08 ? 28   ARG C N     1 
ATOM   3763  C  CA    . ARG C 2 28   ? 113.686 150.309 98.833  1.00 217.08 ? 28   ARG C CA    1 
ATOM   3764  C  C     . ARG C 2 28   ? 115.114 150.792 98.660  1.00 217.08 ? 28   ARG C C     1 
ATOM   3765  O  O     . ARG C 2 28   ? 115.370 151.789 97.977  1.00 217.08 ? 28   ARG C O     1 
ATOM   3766  C  CB    . ARG C 2 28   ? 113.136 150.684 100.204 1.00 217.08 ? 28   ARG C CB    1 
ATOM   3767  C  CG    . ARG C 2 28   ? 113.610 152.006 100.732 1.00 217.08 ? 28   ARG C CG    1 
ATOM   3768  C  CD    . ARG C 2 28   ? 112.721 152.445 101.867 1.00 217.08 ? 28   ARG C CD    1 
ATOM   3769  N  NE    . ARG C 2 28   ? 111.316 152.259 101.528 1.00 217.08 ? 28   ARG C NE    1 
ATOM   3770  C  CZ    . ARG C 2 28   ? 110.574 153.169 100.911 1.00 217.08 ? 28   ARG C CZ    1 
ATOM   3771  N  NH1   . ARG C 2 28   ? 111.103 154.334 100.574 1.00 217.08 ? 28   ARG C NH1   1 
ATOM   3772  N  NH2   . ARG C 2 28   ? 109.304 152.919 100.639 1.00 217.08 ? 28   ARG C NH2   1 
ATOM   3773  N  N     . ALA C 2 29   ? 116.066 150.070 99.249  1.00 220.57 ? 29   ALA C N     1 
ATOM   3774  C  CA    . ALA C 2 29   ? 117.460 150.436 99.060  1.00 220.57 ? 29   ALA C CA    1 
ATOM   3775  C  C     . ALA C 2 29   ? 117.930 150.127 97.650  1.00 220.57 ? 29   ALA C C     1 
ATOM   3776  O  O     . ALA C 2 29   ? 118.853 150.775 97.152  1.00 220.57 ? 29   ALA C O     1 
ATOM   3777  C  CB    . ALA C 2 29   ? 118.340 149.722 100.077 1.00 220.57 ? 29   ALA C CB    1 
ATOM   3778  N  N     . LEU C 2 30   ? 117.295 149.166 96.982  1.00 234.30 ? 30   LEU C N     1 
ATOM   3779  C  CA    . LEU C 2 30   ? 117.797 148.715 95.691  1.00 234.30 ? 30   LEU C CA    1 
ATOM   3780  C  C     . LEU C 2 30   ? 117.504 149.722 94.593  1.00 234.30 ? 30   LEU C C     1 
ATOM   3781  O  O     . LEU C 2 30   ? 118.427 150.235 93.952  1.00 234.30 ? 30   LEU C O     1 
ATOM   3782  C  CB    . LEU C 2 30   ? 117.191 147.368 95.323  1.00 234.30 ? 30   LEU C CB    1 
ATOM   3783  C  CG    . LEU C 2 30   ? 117.614 146.190 96.183  1.00 234.30 ? 30   LEU C CG    1 
ATOM   3784  C  CD1   . LEU C 2 30   ? 116.931 144.931 95.678  1.00 234.30 ? 30   LEU C CD1   1 
ATOM   3785  C  CD2   . LEU C 2 30   ? 119.120 146.059 96.212  1.00 234.30 ? 30   LEU C CD2   1 
ATOM   3786  N  N     . GLN C 2 31   ? 116.214 149.957 94.322  1.00 286.37 ? 31   GLN C N     1 
ATOM   3787  C  CA    . GLN C 2 31   ? 115.637 150.821 93.285  1.00 286.37 ? 31   GLN C CA    1 
ATOM   3788  C  C     . GLN C 2 31   ? 116.267 150.686 91.898  1.00 286.37 ? 31   GLN C C     1 
ATOM   3789  O  O     . GLN C 2 31   ? 116.165 151.601 91.079  1.00 286.37 ? 31   GLN C O     1 
ATOM   3790  C  CB    . GLN C 2 31   ? 115.628 152.302 93.728  1.00 286.37 ? 31   GLN C CB    1 
ATOM   3791  C  CG    . GLN C 2 31   ? 116.956 153.049 93.853  1.00 286.37 ? 31   GLN C CG    1 
ATOM   3792  C  CD    . GLN C 2 31   ? 116.794 154.464 94.360  1.00 286.37 ? 31   GLN C CD    1 
ATOM   3793  O  OE1   . GLN C 2 31   ? 115.820 155.144 94.047  1.00 286.37 ? 31   GLN C OE1   1 
ATOM   3794  N  NE2   . GLN C 2 31   ? 117.739 154.903 95.180  1.00 286.37 ? 31   GLN C NE2   1 
ATOM   3795  N  N     . ALA C 2 32   ? 116.875 149.540 91.592  1.00 306.69 ? 32   ALA C N     1 
ATOM   3796  C  CA    . ALA C 2 32   ? 117.438 149.349 90.261  1.00 306.69 ? 32   ALA C CA    1 
ATOM   3797  C  C     . ALA C 2 32   ? 116.340 149.030 89.259  1.00 306.69 ? 32   ALA C C     1 
ATOM   3798  O  O     . ALA C 2 32   ? 116.446 149.357 88.071  1.00 306.69 ? 32   ALA C O     1 
ATOM   3799  C  CB    . ALA C 2 32   ? 118.489 148.243 90.291  1.00 306.69 ? 32   ALA C CB    1 
ATOM   3800  N  N     . ASP C 2 33   ? 115.273 148.383 89.733  1.00 305.67 ? 33   ASP C N     1 
ATOM   3801  C  CA    . ASP C 2 33   ? 114.077 148.184 88.925  1.00 305.67 ? 33   ASP C CA    1 
ATOM   3802  C  C     . ASP C 2 33   ? 113.436 149.512 88.552  1.00 305.67 ? 33   ASP C C     1 
ATOM   3803  O  O     . ASP C 2 33   ? 112.839 149.645 87.479  1.00 305.67 ? 33   ASP C O     1 
ATOM   3804  C  CB    . ASP C 2 33   ? 113.099 147.302 89.692  1.00 305.67 ? 33   ASP C CB    1 
ATOM   3805  C  CG    . ASP C 2 33   ? 113.009 147.683 91.151  1.00 305.67 ? 33   ASP C CG    1 
ATOM   3806  O  OD1   . ASP C 2 33   ? 113.783 148.561 91.586  1.00 305.67 ? 33   ASP C OD1   1 
ATOM   3807  O  OD2   . ASP C 2 33   ? 112.177 147.099 91.872  1.00 305.67 ? 33   ASP C OD2   1 
ATOM   3808  N  N     . VAL C 2 34   ? 113.547 150.500 89.427  1.00 320.15 ? 34   VAL C N     1 
ATOM   3809  C  CA    . VAL C 2 34   ? 113.225 151.871 89.032  1.00 320.15 ? 34   VAL C CA    1 
ATOM   3810  C  C     . VAL C 2 34   ? 114.242 152.331 87.997  1.00 320.15 ? 34   VAL C C     1 
ATOM   3811  O  O     . VAL C 2 34   ? 115.451 152.130 88.194  1.00 320.15 ? 34   VAL C O     1 
ATOM   3812  C  CB    . VAL C 2 34   ? 113.232 152.789 90.250  1.00 320.15 ? 34   VAL C CB    1 
ATOM   3813  C  CG1   . VAL C 2 34   ? 112.747 154.177 89.883  1.00 320.15 ? 34   VAL C CG1   1 
ATOM   3814  C  CG2   . VAL C 2 34   ? 112.384 152.197 91.348  1.00 320.15 ? 34   VAL C CG2   1 
ATOM   3815  N  N     . PRO C 2 35   ? 113.807 152.905 86.878  1.00 320.74 ? 35   PRO C N     1 
ATOM   3816  C  CA    . PRO C 2 35   ? 114.760 153.420 85.908  1.00 320.74 ? 35   PRO C CA    1 
ATOM   3817  C  C     . PRO C 2 35   ? 115.473 154.635 86.465  1.00 320.74 ? 35   PRO C C     1 
ATOM   3818  O  O     . PRO C 2 35   ? 114.953 155.319 87.365  1.00 320.74 ? 35   PRO C O     1 
ATOM   3819  C  CB    . PRO C 2 35   ? 113.871 153.781 84.704  1.00 320.74 ? 35   PRO C CB    1 
ATOM   3820  C  CG    . PRO C 2 35   ? 112.554 153.997 85.278  1.00 320.74 ? 35   PRO C CG    1 
ATOM   3821  C  CD    . PRO C 2 35   ? 112.424 153.028 86.401  1.00 320.74 ? 35   PRO C CD    1 
ATOM   3822  N  N     . PRO C 2 36   ? 116.687 154.936 85.978  1.00 317.15 ? 36   PRO C N     1 
ATOM   3823  C  CA    . PRO C 2 36   ? 117.546 155.897 86.695  1.00 317.15 ? 36   PRO C CA    1 
ATOM   3824  C  C     . PRO C 2 36   ? 117.051 157.325 86.648  1.00 317.15 ? 36   PRO C C     1 
ATOM   3825  O  O     . PRO C 2 36   ? 117.274 158.091 87.592  1.00 317.15 ? 36   PRO C O     1 
ATOM   3826  C  CB    . PRO C 2 36   ? 118.896 155.748 85.986  1.00 317.15 ? 36   PRO C CB    1 
ATOM   3827  C  CG    . PRO C 2 36   ? 118.803 154.500 85.196  1.00 317.15 ? 36   PRO C CG    1 
ATOM   3828  C  CD    . PRO C 2 36   ? 117.387 154.342 84.828  1.00 317.15 ? 36   PRO C CD    1 
ATOM   3829  N  N     . GLU C 2 37   ? 116.370 157.699 85.569  1.00 318.44 ? 37   GLU C N     1 
ATOM   3830  C  CA    . GLU C 2 37   ? 115.751 159.014 85.508  1.00 318.44 ? 37   GLU C CA    1 
ATOM   3831  C  C     . GLU C 2 37   ? 114.587 159.100 86.483  1.00 318.44 ? 37   GLU C C     1 
ATOM   3832  O  O     . GLU C 2 37   ? 114.266 160.178 86.990  1.00 318.44 ? 37   GLU C O     1 
ATOM   3833  C  CB    . GLU C 2 37   ? 115.306 159.297 84.068  1.00 318.44 ? 37   GLU C CB    1 
ATOM   3834  C  CG    . GLU C 2 37   ? 113.994 158.635 83.624  1.00 318.44 ? 37   GLU C CG    1 
ATOM   3835  C  CD    . GLU C 2 37   ? 114.091 157.122 83.415  1.00 318.44 ? 37   GLU C CD    1 
ATOM   3836  O  OE1   . GLU C 2 37   ? 115.185 156.531 83.554  1.00 318.44 ? 37   GLU C OE1   1 
ATOM   3837  O  OE2   . GLU C 2 37   ? 113.041 156.515 83.131  1.00 318.44 ? 37   GLU C OE2   1 
ATOM   3838  N  N     . LYS C 2 38   ? 113.965 157.963 86.783  1.00 302.94 ? 38   LYS C N     1 
ATOM   3839  C  CA    . LYS C 2 38   ? 112.925 157.934 87.788  1.00 302.94 ? 38   LYS C CA    1 
ATOM   3840  C  C     . LYS C 2 38   ? 113.478 157.541 89.134  1.00 302.94 ? 38   LYS C C     1 
ATOM   3841  O  O     . LYS C 2 38   ? 112.765 157.633 90.137  1.00 302.94 ? 38   LYS C O     1 
ATOM   3842  C  CB    . LYS C 2 38   ? 111.824 156.971 87.373  1.00 302.94 ? 38   LYS C CB    1 
ATOM   3843  C  CG    . LYS C 2 38   ? 110.785 157.620 86.489  1.00 302.94 ? 38   LYS C CG    1 
ATOM   3844  C  CD    . LYS C 2 38   ? 110.000 156.589 85.715  1.00 302.94 ? 38   LYS C CD    1 
ATOM   3845  C  CE    . LYS C 2 38   ? 109.414 155.542 86.643  1.00 302.94 ? 38   LYS C CE    1 
ATOM   3846  N  NZ    . LYS C 2 38   ? 109.252 154.229 85.971  1.00 302.94 ? 38   LYS C NZ    1 
ATOM   3847  N  N     . ARG C 2 39   ? 114.724 157.083 89.167  1.00 294.76 ? 39   ARG C N     1 
ATOM   3848  C  CA    . ARG C 2 39   ? 115.394 156.901 90.437  1.00 294.76 ? 39   ARG C CA    1 
ATOM   3849  C  C     . ARG C 2 39   ? 115.604 158.246 91.097  1.00 294.76 ? 39   ARG C C     1 
ATOM   3850  O  O     . ARG C 2 39   ? 115.712 159.280 90.433  1.00 294.76 ? 39   ARG C O     1 
ATOM   3851  C  CB    . ARG C 2 39   ? 116.726 156.196 90.257  1.00 294.76 ? 39   ARG C CB    1 
ATOM   3852  C  CG    . ARG C 2 39   ? 116.567 154.720 90.165  1.00 294.76 ? 39   ARG C CG    1 
ATOM   3853  C  CD    . ARG C 2 39   ? 117.862 154.063 89.825  1.00 294.76 ? 39   ARG C CD    1 
ATOM   3854  N  NE    . ARG C 2 39   ? 117.634 152.913 88.964  1.00 294.76 ? 39   ARG C NE    1 
ATOM   3855  C  CZ    . ARG C 2 39   ? 118.534 152.420 88.124  1.00 294.76 ? 39   ARG C CZ    1 
ATOM   3856  N  NH1   . ARG C 2 39   ? 119.734 152.972 88.030  1.00 294.76 ? 39   ARG C NH1   1 
ATOM   3857  N  NH2   . ARG C 2 39   ? 118.231 151.369 87.378  1.00 294.76 ? 39   ARG C NH2   1 
ATOM   3858  N  N     . GLU C 2 40   ? 115.649 158.218 92.414  1.00 310.45 ? 40   GLU C N     1 
ATOM   3859  C  CA    . GLU C 2 40   ? 115.646 159.409 93.233  1.00 310.45 ? 40   GLU C CA    1 
ATOM   3860  C  C     . GLU C 2 40   ? 116.678 159.225 94.327  1.00 310.45 ? 40   GLU C C     1 
ATOM   3861  O  O     . GLU C 2 40   ? 117.086 158.105 94.640  1.00 310.45 ? 40   GLU C O     1 
ATOM   3862  C  CB    . GLU C 2 40   ? 114.256 159.674 93.824  1.00 310.45 ? 40   GLU C CB    1 
ATOM   3863  C  CG    . GLU C 2 40   ? 113.807 158.659 94.865  1.00 310.45 ? 40   GLU C CG    1 
ATOM   3864  C  CD    . GLU C 2 40   ? 113.374 157.328 94.263  1.00 310.45 ? 40   GLU C CD    1 
ATOM   3865  O  OE1   . GLU C 2 40   ? 113.133 157.274 93.037  1.00 310.45 ? 40   GLU C OE1   1 
ATOM   3866  O  OE2   . GLU C 2 40   ? 113.303 156.334 95.010  1.00 310.45 ? 40   GLU C OE2   1 
ATOM   3867  N  N     . ASN C 2 41   ? 117.091 160.341 94.916  1.00 312.21 ? 41   ASN C N     1 
ATOM   3868  C  CA    . ASN C 2 41   ? 118.301 160.368 95.729  1.00 312.21 ? 41   ASN C CA    1 
ATOM   3869  C  C     . ASN C 2 41   ? 118.021 159.813 97.119  1.00 312.21 ? 41   ASN C C     1 
ATOM   3870  O  O     . ASN C 2 41   ? 117.973 160.532 98.118  1.00 312.21 ? 41   ASN C O     1 
ATOM   3871  C  CB    . ASN C 2 41   ? 118.850 161.780 95.808  1.00 312.21 ? 41   ASN C CB    1 
ATOM   3872  C  CG    . ASN C 2 41   ? 120.325 161.785 96.002  1.00 312.21 ? 41   ASN C CG    1 
ATOM   3873  O  OD1   . ASN C 2 41   ? 120.973 160.805 95.689  1.00 312.21 ? 41   ASN C OD1   1 
ATOM   3874  N  ND2   . ASN C 2 41   ? 120.869 162.873 96.524  1.00 312.21 ? 41   ASN C ND2   1 
ATOM   3875  N  N     . VAL C 2 42   ? 117.839 158.499 97.183  1.00 298.31 ? 42   VAL C N     1 
ATOM   3876  C  CA    . VAL C 2 42   ? 117.639 157.799 98.443  1.00 298.31 ? 42   VAL C CA    1 
ATOM   3877  C  C     . VAL C 2 42   ? 118.492 156.540 98.449  1.00 298.31 ? 42   VAL C C     1 
ATOM   3878  O  O     . VAL C 2 42   ? 118.771 155.946 97.401  1.00 298.31 ? 42   VAL C O     1 
ATOM   3879  C  CB    . VAL C 2 42   ? 116.157 157.446 98.703  1.00 298.31 ? 42   VAL C CB    1 
ATOM   3880  C  CG1   . VAL C 2 42   ? 115.337 158.692 99.009  1.00 298.31 ? 42   VAL C CG1   1 
ATOM   3881  C  CG2   . VAL C 2 42   ? 115.574 156.718 97.508  1.00 298.31 ? 42   VAL C CG2   1 
ATOM   3882  N  N     . GLY C 2 43   ? 118.915 156.152 99.650  1.00 277.41 ? 43   GLY C N     1 
ATOM   3883  C  CA    . GLY C 2 43   ? 119.631 154.916 99.888  1.00 277.41 ? 43   GLY C CA    1 
ATOM   3884  C  C     . GLY C 2 43   ? 120.950 154.791 99.163  1.00 277.41 ? 43   GLY C C     1 
ATOM   3885  O  O     . GLY C 2 43   ? 121.924 155.476 99.478  1.00 277.41 ? 43   GLY C O     1 
ATOM   3886  N  N     . ILE C 2 44   ? 120.974 153.908 98.172  1.00 267.09 ? 44   ILE C N     1 
ATOM   3887  C  CA    . ILE C 2 44   ? 122.184 153.702 97.393  1.00 267.09 ? 44   ILE C CA    1 
ATOM   3888  C  C     . ILE C 2 44   ? 122.436 154.898 96.495  1.00 267.09 ? 44   ILE C C     1 
ATOM   3889  O  O     . ILE C 2 44   ? 123.579 155.342 96.327  1.00 267.09 ? 44   ILE C O     1 
ATOM   3890  C  CB    . ILE C 2 44   ? 122.060 152.388 96.605  1.00 267.09 ? 44   ILE C CB    1 
ATOM   3891  C  CG1   . ILE C 2 44   ? 122.041 151.219 97.582  1.00 267.09 ? 44   ILE C CG1   1 
ATOM   3892  C  CG2   . ILE C 2 44   ? 123.210 152.200 95.666  1.00 267.09 ? 44   ILE C CG2   1 
ATOM   3893  C  CD1   . ILE C 2 44   ? 123.204 151.222 98.537  1.00 267.09 ? 44   ILE C CD1   1 
ATOM   3894  N  N     . GLN C 2 45   ? 121.365 155.467 95.942  1.00 284.31 ? 45   GLN C N     1 
ATOM   3895  C  CA    . GLN C 2 45   ? 121.501 156.692 95.168  1.00 284.31 ? 45   GLN C CA    1 
ATOM   3896  C  C     . GLN C 2 45   ? 121.947 157.845 96.046  1.00 284.31 ? 45   GLN C C     1 
ATOM   3897  O  O     . GLN C 2 45   ? 122.751 158.681 95.619  1.00 284.31 ? 45   GLN C O     1 
ATOM   3898  C  CB    . GLN C 2 45   ? 120.187 157.032 94.479  1.00 284.31 ? 45   GLN C CB    1 
ATOM   3899  C  CG    . GLN C 2 45   ? 120.336 158.078 93.409  1.00 284.31 ? 45   GLN C CG    1 
ATOM   3900  C  CD    . GLN C 2 45   ? 121.558 157.838 92.554  1.00 284.31 ? 45   GLN C CD    1 
ATOM   3901  O  OE1   . GLN C 2 45   ? 121.634 156.851 91.823  1.00 284.31 ? 45   GLN C OE1   1 
ATOM   3902  N  NE2   . GLN C 2 45   ? 122.531 158.738 92.648  1.00 284.31 ? 45   GLN C NE2   1 
ATOM   3903  N  N     . ALA C 2 46   ? 121.454 157.885 97.286  1.00 296.92 ? 46   ALA C N     1 
ATOM   3904  C  CA    . ALA C 2 46   ? 121.900 158.895 98.237  1.00 296.92 ? 46   ALA C CA    1 
ATOM   3905  C  C     . ALA C 2 46   ? 123.372 158.717 98.561  1.00 296.92 ? 46   ALA C C     1 
ATOM   3906  O  O     . ALA C 2 46   ? 124.115 159.696 98.686  1.00 296.92 ? 46   ALA C O     1 
ATOM   3907  C  CB    . ALA C 2 46   ? 121.064 158.819 99.511  1.00 296.92 ? 46   ALA C CB    1 
ATOM   3908  N  N     . ALA C 2 47   ? 123.812 157.465 98.669  1.00 292.61 ? 47   ALA C N     1 
ATOM   3909  C  CA    . ALA C 2 47   ? 125.210 157.187 98.955  1.00 292.61 ? 47   ALA C CA    1 
ATOM   3910  C  C     . ALA C 2 47   ? 126.091 157.577 97.782  1.00 292.61 ? 47   ALA C C     1 
ATOM   3911  O  O     . ALA C 2 47   ? 127.226 158.035 97.969  1.00 292.61 ? 47   ALA C O     1 
ATOM   3912  C  CB    . ALA C 2 47   ? 125.383 155.714 99.302  1.00 292.61 ? 47   ALA C CB    1 
ATOM   3913  N  N     . PHE C 2 48   ? 125.572 157.416 96.567  1.00 304.83 ? 48   PHE C N     1 
ATOM   3914  C  CA    . PHE C 2 48   ? 126.218 157.925 95.368  1.00 304.83 ? 48   PHE C CA    1 
ATOM   3915  C  C     . PHE C 2 48   ? 126.379 159.431 95.451  1.00 304.83 ? 48   PHE C C     1 
ATOM   3916  O  O     . PHE C 2 48   ? 127.497 159.948 95.484  1.00 304.83 ? 48   PHE C O     1 
ATOM   3917  C  CB    . PHE C 2 48   ? 125.402 157.593 94.127  1.00 304.83 ? 48   PHE C CB    1 
ATOM   3918  C  CG    . PHE C 2 48   ? 125.389 156.156 93.783  1.00 304.83 ? 48   PHE C CG    1 
ATOM   3919  C  CD1   . PHE C 2 48   ? 126.498 155.368 94.013  1.00 304.83 ? 48   PHE C CD1   1 
ATOM   3920  C  CD2   . PHE C 2 48   ? 124.265 155.586 93.217  1.00 304.83 ? 48   PHE C CD2   1 
ATOM   3921  C  CE1   . PHE C 2 48   ? 126.490 154.039 93.677  1.00 304.83 ? 48   PHE C CE1   1 
ATOM   3922  C  CE2   . PHE C 2 48   ? 124.246 154.261 92.884  1.00 304.83 ? 48   PHE C CE2   1 
ATOM   3923  C  CZ    . PHE C 2 48   ? 125.362 153.482 93.111  1.00 304.83 ? 48   PHE C CZ    1 
ATOM   3924  N  N     . ARG C 2 49   ? 125.258 160.138 95.559  1.00 312.42 ? 49   ARG C N     1 
ATOM   3925  C  CA    . ARG C 2 49   ? 125.301 161.588 95.436  1.00 312.42 ? 49   ARG C CA    1 
ATOM   3926  C  C     . ARG C 2 49   ? 125.922 162.255 96.653  1.00 312.42 ? 49   ARG C C     1 
ATOM   3927  O  O     . ARG C 2 49   ? 126.212 163.455 96.616  1.00 312.42 ? 49   ARG C O     1 
ATOM   3928  C  CB    . ARG C 2 49   ? 123.906 162.133 95.176  1.00 312.42 ? 49   ARG C CB    1 
ATOM   3929  C  CG    . ARG C 2 49   ? 123.385 161.820 93.786  1.00 312.42 ? 49   ARG C CG    1 
ATOM   3930  C  CD    . ARG C 2 49   ? 124.199 162.529 92.721  1.00 312.42 ? 49   ARG C CD    1 
ATOM   3931  N  NE    . ARG C 2 49   ? 125.159 161.655 92.047  1.00 312.42 ? 49   ARG C NE    1 
ATOM   3932  C  CZ    . ARG C 2 49   ? 126.196 162.098 91.344  1.00 312.42 ? 49   ARG C CZ    1 
ATOM   3933  N  NH1   . ARG C 2 49   ? 126.419 163.398 91.249  1.00 312.42 ? 49   ARG C NH1   1 
ATOM   3934  N  NH2   . ARG C 2 49   ? 127.017 161.251 90.743  1.00 312.42 ? 49   ARG C NH2   1 
ATOM   3935  N  N     . GLU C 2 50   ? 126.162 161.506 97.729  1.00 338.40 ? 50   GLU C N     1 
ATOM   3936  C  CA    . GLU C 2 50   ? 127.044 162.036 98.758  1.00 338.40 ? 50   GLU C CA    1 
ATOM   3937  C  C     . GLU C 2 50   ? 128.497 161.679 98.473  1.00 338.40 ? 50   GLU C C     1 
ATOM   3938  O  O     . GLU C 2 50   ? 129.403 162.413 98.874  1.00 338.40 ? 50   GLU C O     1 
ATOM   3939  C  CB    . GLU C 2 50   ? 126.613 161.561 100.150 1.00 338.40 ? 50   GLU C CB    1 
ATOM   3940  C  CG    . GLU C 2 50   ? 126.828 160.095 100.474 1.00 338.40 ? 50   GLU C CG    1 
ATOM   3941  C  CD    . GLU C 2 50   ? 128.159 159.814 101.141 1.00 338.40 ? 50   GLU C CD    1 
ATOM   3942  O  OE1   . GLU C 2 50   ? 128.761 160.761 101.689 1.00 338.40 ? 50   GLU C OE1   1 
ATOM   3943  O  OE2   . GLU C 2 50   ? 128.605 158.647 101.105 1.00 338.40 ? 50   GLU C OE2   1 
ATOM   3944  N  N     . THR C 2 51   ? 128.755 160.559 97.793  1.00 321.56 ? 51   THR C N     1 
ATOM   3945  C  CA    . THR C 2 51   ? 130.153 160.222 97.567  1.00 321.56 ? 51   THR C CA    1 
ATOM   3946  C  C     . THR C 2 51   ? 130.700 160.810 96.275  1.00 321.56 ? 51   THR C C     1 
ATOM   3947  O  O     . THR C 2 51   ? 131.913 160.746 96.050  1.00 321.56 ? 51   THR C O     1 
ATOM   3948  C  CB    . THR C 2 51   ? 130.352 158.702 97.578  1.00 321.56 ? 51   THR C CB    1 
ATOM   3949  O  OG1   . THR C 2 51   ? 131.719 158.409 97.883  1.00 321.56 ? 51   THR C OG1   1 
ATOM   3950  C  CG2   . THR C 2 51   ? 130.022 158.084 96.230  1.00 321.56 ? 51   THR C CG2   1 
ATOM   3951  N  N     . PHE C 2 52   ? 129.865 161.422 95.456  1.00 320.63 ? 52   PHE C N     1 
ATOM   3952  C  CA    . PHE C 2 52   ? 130.265 161.803 94.118  1.00 320.63 ? 52   PHE C CA    1 
ATOM   3953  C  C     . PHE C 2 52   ? 130.209 163.305 93.914  1.00 320.63 ? 52   PHE C C     1 
ATOM   3954  O  O     . PHE C 2 52   ? 129.411 163.997 94.554  1.00 320.63 ? 52   PHE C O     1 
ATOM   3955  C  CB    . PHE C 2 52   ? 129.358 161.107 93.102  1.00 320.63 ? 52   PHE C CB    1 
ATOM   3956  C  CG    . PHE C 2 52   ? 129.693 159.680 92.916  1.00 320.63 ? 52   PHE C CG    1 
ATOM   3957  C  CD1   . PHE C 2 52   ? 131.011 159.294 92.783  1.00 320.63 ? 52   PHE C CD1   1 
ATOM   3958  C  CD2   . PHE C 2 52   ? 128.706 158.717 92.897  1.00 320.63 ? 52   PHE C CD2   1 
ATOM   3959  C  CE1   . PHE C 2 52   ? 131.338 157.974 92.621  1.00 320.63 ? 52   PHE C CE1   1 
ATOM   3960  C  CE2   . PHE C 2 52   ? 129.022 157.392 92.740  1.00 320.63 ? 52   PHE C CE2   1 
ATOM   3961  C  CZ    . PHE C 2 52   ? 130.340 157.019 92.598  1.00 320.63 ? 52   PHE C CZ    1 
ATOM   3962  N  N     . PRO C 2 53   ? 131.053 163.858 93.026  1.00 318.63 ? 53   PRO C N     1 
ATOM   3963  C  CA    . PRO C 2 53   ? 132.139 163.232 92.263  1.00 318.63 ? 53   PRO C CA    1 
ATOM   3964  C  C     . PRO C 2 53   ? 133.483 163.315 92.950  1.00 318.63 ? 53   PRO C C     1 
ATOM   3965  O  O     . PRO C 2 53   ? 133.564 163.569 94.149  1.00 318.63 ? 53   PRO C O     1 
ATOM   3966  C  CB    . PRO C 2 53   ? 132.162 164.045 90.977  1.00 318.63 ? 53   PRO C CB    1 
ATOM   3967  C  CG    . PRO C 2 53   ? 131.790 165.394 91.418  1.00 318.63 ? 53   PRO C CG    1 
ATOM   3968  C  CD    . PRO C 2 53   ? 130.814 165.234 92.565  1.00 318.63 ? 53   PRO C CD    1 
ATOM   3969  N  N     . ILE C 2 54   ? 134.531 163.091 92.178  1.00 341.82 ? 54   ILE C N     1 
ATOM   3970  C  CA    . ILE C 2 54   ? 135.891 163.329 92.629  1.00 341.82 ? 54   ILE C CA    1 
ATOM   3971  C  C     . ILE C 2 54   ? 136.358 164.644 92.029  1.00 341.82 ? 54   ILE C C     1 
ATOM   3972  O  O     . ILE C 2 54   ? 135.894 165.073 90.965  1.00 341.82 ? 54   ILE C O     1 
ATOM   3973  C  CB    . ILE C 2 54   ? 136.829 162.163 92.262  1.00 341.82 ? 54   ILE C CB    1 
ATOM   3974  C  CG1   . ILE C 2 54   ? 136.997 162.052 90.751  1.00 341.82 ? 54   ILE C CG1   1 
ATOM   3975  C  CG2   . ILE C 2 54   ? 136.272 160.868 92.799  1.00 341.82 ? 54   ILE C CG2   1 
ATOM   3976  C  CD1   . ILE C 2 54   ? 138.060 161.084 90.349  1.00 341.82 ? 54   ILE C CD1   1 
ATOM   3977  N  N     . GLU C 2 55   ? 137.233 165.332 92.759  1.00 363.69 ? 55   GLU C N     1 
ATOM   3978  C  CA    . GLU C 2 55   ? 137.616 166.693 92.404  1.00 363.69 ? 55   GLU C CA    1 
ATOM   3979  C  C     . GLU C 2 55   ? 139.106 166.964 92.515  1.00 363.69 ? 55   GLU C C     1 
ATOM   3980  O  O     . GLU C 2 55   ? 139.566 167.952 91.932  1.00 363.69 ? 55   GLU C O     1 
ATOM   3981  C  CB    . GLU C 2 55   ? 136.880 167.712 93.297  1.00 363.69 ? 55   GLU C CB    1 
ATOM   3982  C  CG    . GLU C 2 55   ? 135.358 167.711 93.211  1.00 363.69 ? 55   GLU C CG    1 
ATOM   3983  C  CD    . GLU C 2 55   ? 134.725 166.660 94.104  1.00 363.69 ? 55   GLU C CD    1 
ATOM   3984  O  OE1   . GLU C 2 55   ? 133.494 166.493 94.053  1.00 363.69 ? 55   GLU C OE1   1 
ATOM   3985  O  OE2   . GLU C 2 55   ? 135.469 165.989 94.844  1.00 363.69 ? 55   GLU C OE2   1 
ATOM   3986  N  N     . GLU C 2 56   ? 139.868 166.110 93.202  1.00 399.97 ? 56   GLU C N     1 
ATOM   3987  C  CA    . GLU C 2 56   ? 141.205 166.394 93.733  1.00 399.97 ? 56   GLU C CA    1 
ATOM   3988  C  C     . GLU C 2 56   ? 141.220 167.720 94.488  1.00 399.97 ? 56   GLU C C     1 
ATOM   3989  O  O     . GLU C 2 56   ? 141.925 167.865 95.484  1.00 399.97 ? 56   GLU C O     1 
ATOM   3990  C  CB    . GLU C 2 56   ? 142.268 166.392 92.626  1.00 399.97 ? 56   GLU C CB    1 
ATOM   3991  C  CG    . GLU C 2 56   ? 143.699 166.331 93.139  1.00 399.97 ? 56   GLU C CG    1 
ATOM   3992  C  CD    . GLU C 2 56   ? 144.321 167.705 93.295  1.00 399.97 ? 56   GLU C CD    1 
ATOM   3993  O  OE1   . GLU C 2 56   ? 143.719 168.688 92.814  1.00 399.97 ? 56   GLU C OE1   1 
ATOM   3994  O  OE2   . GLU C 2 56   ? 145.402 167.802 93.911  1.00 399.97 ? 56   GLU C OE2   1 
ATOM   3995  N  N     . LEU C 2 64   ? 141.306 167.433 88.028  1.00 333.74 ? 64   LEU C N     1 
ATOM   3996  C  CA    . LEU C 2 64   ? 140.403 166.563 87.290  1.00 333.74 ? 64   LEU C CA    1 
ATOM   3997  C  C     . LEU C 2 64   ? 139.075 166.411 88.022  1.00 333.74 ? 64   LEU C C     1 
ATOM   3998  O  O     . LEU C 2 64   ? 139.000 166.580 89.236  1.00 333.74 ? 64   LEU C O     1 
ATOM   3999  C  CB    . LEU C 2 64   ? 141.051 165.191 87.069  1.00 333.74 ? 64   LEU C CB    1 
ATOM   4000  C  CG    . LEU C 2 64   ? 140.389 164.213 86.092  1.00 333.74 ? 64   LEU C CG    1 
ATOM   4001  C  CD1   . LEU C 2 64   ? 140.271 164.837 84.722  1.00 333.74 ? 64   LEU C CD1   1 
ATOM   4002  C  CD2   . LEU C 2 64   ? 141.128 162.897 86.031  1.00 333.74 ? 64   LEU C CD2   1 
ATOM   4003  N  N     . VAL C 2 65   ? 138.018 166.154 87.259  1.00 333.30 ? 65   VAL C N     1 
ATOM   4004  C  CA    . VAL C 2 65   ? 136.737 165.707 87.781  1.00 333.30 ? 65   VAL C CA    1 
ATOM   4005  C  C     . VAL C 2 65   ? 136.385 164.401 87.084  1.00 333.30 ? 65   VAL C C     1 
ATOM   4006  O  O     . VAL C 2 65   ? 136.610 164.247 85.880  1.00 333.30 ? 65   VAL C O     1 
ATOM   4007  C  CB    . VAL C 2 65   ? 135.647 166.785 87.575  1.00 333.30 ? 65   VAL C CB    1 
ATOM   4008  C  CG1   . VAL C 2 65   ? 134.243 166.243 87.803  1.00 333.30 ? 65   VAL C CG1   1 
ATOM   4009  C  CG2   . VAL C 2 65   ? 135.893 167.935 88.516  1.00 333.30 ? 65   VAL C CG2   1 
ATOM   4010  N  N     . LEU C 2 66   ? 135.900 163.431 87.849  1.00 306.38 ? 66   LEU C N     1 
ATOM   4011  C  CA    . LEU C 2 66   ? 135.234 162.300 87.231  1.00 306.38 ? 66   LEU C CA    1 
ATOM   4012  C  C     . LEU C 2 66   ? 133.931 162.081 87.968  1.00 306.38 ? 66   LEU C C     1 
ATOM   4013  O  O     . LEU C 2 66   ? 133.928 161.916 89.190  1.00 306.38 ? 66   LEU C O     1 
ATOM   4014  C  CB    . LEU C 2 66   ? 136.091 161.044 87.268  1.00 306.38 ? 66   LEU C CB    1 
ATOM   4015  C  CG    . LEU C 2 66   ? 135.659 159.960 86.293  1.00 306.38 ? 66   LEU C CG    1 
ATOM   4016  C  CD1   . LEU C 2 66   ? 136.909 159.346 85.744  1.00 306.38 ? 66   LEU C CD1   1 
ATOM   4017  C  CD2   . LEU C 2 66   ? 134.790 158.899 86.936  1.00 306.38 ? 66   LEU C CD2   1 
ATOM   4018  N  N     . ASP C 2 67   ? 132.838 162.065 87.225  1.00 287.49 ? 67   ASP C N     1 
ATOM   4019  C  CA    . ASP C 2 67   ? 131.532 161.976 87.836  1.00 287.49 ? 67   ASP C CA    1 
ATOM   4020  C  C     . ASP C 2 67   ? 130.865 160.666 87.462  1.00 287.49 ? 67   ASP C C     1 
ATOM   4021  O  O     . ASP C 2 67   ? 131.346 159.906 86.622  1.00 287.49 ? 67   ASP C O     1 
ATOM   4022  C  CB    . ASP C 2 67   ? 130.645 163.150 87.441  1.00 287.49 ? 67   ASP C CB    1 
ATOM   4023  C  CG    . ASP C 2 67   ? 129.681 163.529 88.538  1.00 287.49 ? 67   ASP C CG    1 
ATOM   4024  O  OD1   . ASP C 2 67   ? 128.973 162.623 89.031  1.00 287.49 ? 67   ASP C OD1   1 
ATOM   4025  O  OD2   . ASP C 2 67   ? 129.645 164.714 88.922  1.00 287.49 ? 67   ASP C OD2   1 
ATOM   4026  N  N     . PHE C 2 68   ? 129.749 160.422 88.125  1.00 295.88 ? 68   PHE C N     1 
ATOM   4027  C  CA    . PHE C 2 68   ? 128.975 159.202 87.996  1.00 295.88 ? 68   PHE C CA    1 
ATOM   4028  C  C     . PHE C 2 68   ? 127.614 159.598 87.452  1.00 295.88 ? 68   PHE C C     1 
ATOM   4029  O  O     . PHE C 2 68   ? 126.918 160.424 88.049  1.00 295.88 ? 68   PHE C O     1 
ATOM   4030  C  CB    . PHE C 2 68   ? 128.881 158.529 89.360  1.00 295.88 ? 68   PHE C CB    1 
ATOM   4031  C  CG    . PHE C 2 68   ? 127.674 157.657 89.561  1.00 295.88 ? 68   PHE C CG    1 
ATOM   4032  C  CD1   . PHE C 2 68   ? 127.692 156.340 89.157  1.00 295.88 ? 68   PHE C CD1   1 
ATOM   4033  C  CD2   . PHE C 2 68   ? 126.550 158.127 90.233  1.00 295.88 ? 68   PHE C CD2   1 
ATOM   4034  C  CE1   . PHE C 2 68   ? 126.609 155.527 89.385  1.00 295.88 ? 68   PHE C CE1   1 
ATOM   4035  C  CE2   . PHE C 2 68   ? 125.461 157.322 90.438  1.00 295.88 ? 68   PHE C CE2   1 
ATOM   4036  C  CZ    . PHE C 2 68   ? 125.493 156.018 90.018  1.00 295.88 ? 68   PHE C CZ    1 
ATOM   4037  N  N     . LEU C 2 69   ? 127.238 159.026 86.314  1.00 295.20 ? 69   LEU C N     1 
ATOM   4038  C  CA    . LEU C 2 69   ? 125.929 159.340 85.763  1.00 295.20 ? 69   LEU C CA    1 
ATOM   4039  C  C     . LEU C 2 69   ? 124.840 158.560 86.480  1.00 295.20 ? 69   LEU C C     1 
ATOM   4040  O  O     . LEU C 2 69   ? 124.007 159.135 87.188  1.00 295.20 ? 69   LEU C O     1 
ATOM   4041  C  CB    . LEU C 2 69   ? 125.909 159.038 84.271  1.00 295.20 ? 69   LEU C CB    1 
ATOM   4042  C  CG    . LEU C 2 69   ? 126.242 160.248 83.414  1.00 295.20 ? 69   LEU C CG    1 
ATOM   4043  C  CD1   . LEU C 2 69   ? 126.242 159.867 81.955  1.00 295.20 ? 69   LEU C CD1   1 
ATOM   4044  C  CD2   . LEU C 2 69   ? 125.261 161.369 83.673  1.00 295.20 ? 69   LEU C CD2   1 
ATOM   4045  N  N     . GLU C 2 70   ? 124.863 157.242 86.340  1.00 307.59 ? 70   GLU C N     1 
ATOM   4046  C  CA    . GLU C 2 70   ? 123.831 156.379 86.892  1.00 307.59 ? 70   GLU C CA    1 
ATOM   4047  C  C     . GLU C 2 70   ? 124.402 154.975 86.972  1.00 307.59 ? 70   GLU C C     1 
ATOM   4048  O  O     . GLU C 2 70   ? 125.518 154.710 86.524  1.00 307.59 ? 70   GLU C O     1 
ATOM   4049  C  CB    . GLU C 2 70   ? 122.561 156.410 86.046  1.00 307.59 ? 70   GLU C CB    1 
ATOM   4050  C  CG    . GLU C 2 70   ? 122.745 155.847 84.657  1.00 307.59 ? 70   GLU C CG    1 
ATOM   4051  C  CD    . GLU C 2 70   ? 121.584 156.185 83.749  1.00 307.59 ? 70   GLU C CD    1 
ATOM   4052  O  OE1   . GLU C 2 70   ? 120.992 157.272 83.918  1.00 307.59 ? 70   GLU C OE1   1 
ATOM   4053  O  OE2   . GLU C 2 70   ? 121.256 155.362 82.871  1.00 307.59 ? 70   GLU C OE2   1 
ATOM   4054  N  N     . TYR C 2 71   ? 123.645 154.082 87.580  1.00 282.66 ? 71   TYR C N     1 
ATOM   4055  C  CA    . TYR C 2 71   ? 124.098 152.720 87.757  1.00 282.66 ? 71   TYR C CA    1 
ATOM   4056  C  C     . TYR C 2 71   ? 123.090 151.781 87.126  1.00 282.66 ? 71   TYR C C     1 
ATOM   4057  O  O     . TYR C 2 71   ? 121.988 152.182 86.747  1.00 282.66 ? 71   TYR C O     1 
ATOM   4058  C  CB    . TYR C 2 71   ? 124.283 152.381 89.237  1.00 282.66 ? 71   TYR C CB    1 
ATOM   4059  C  CG    . TYR C 2 71   ? 122.983 152.109 89.953  1.00 282.66 ? 71   TYR C CG    1 
ATOM   4060  C  CD1   . TYR C 2 71   ? 122.578 150.808 90.250  1.00 282.66 ? 71   TYR C CD1   1 
ATOM   4061  C  CD2   . TYR C 2 71   ? 122.164 153.154 90.340  1.00 282.66 ? 71   TYR C CD2   1 
ATOM   4062  C  CE1   . TYR C 2 71   ? 121.385 150.569 90.899  1.00 282.66 ? 71   TYR C CE1   1 
ATOM   4063  C  CE2   . TYR C 2 71   ? 120.988 152.924 91.006  1.00 282.66 ? 71   TYR C CE2   1 
ATOM   4064  C  CZ    . TYR C 2 71   ? 120.595 151.633 91.274  1.00 282.66 ? 71   TYR C CZ    1 
ATOM   4065  O  OH    . TYR C 2 71   ? 119.408 151.410 91.931  1.00 282.66 ? 71   TYR C OH    1 
ATOM   4066  N  N     . ARG C 2 72   ? 123.469 150.512 87.051  1.00 268.98 ? 72   ARG C N     1 
ATOM   4067  C  CA    . ARG C 2 72   ? 122.545 149.450 86.691  1.00 268.98 ? 72   ARG C CA    1 
ATOM   4068  C  C     . ARG C 2 72   ? 123.062 148.159 87.304  1.00 268.98 ? 72   ARG C C     1 
ATOM   4069  O  O     . ARG C 2 72   ? 124.050 148.151 88.043  1.00 268.98 ? 72   ARG C O     1 
ATOM   4070  C  CB    . ARG C 2 72   ? 122.377 149.344 85.173  1.00 268.98 ? 72   ARG C CB    1 
ATOM   4071  C  CG    . ARG C 2 72   ? 123.667 149.196 84.412  1.00 268.98 ? 72   ARG C CG    1 
ATOM   4072  C  CD    . ARG C 2 72   ? 123.889 147.765 83.982  1.00 268.98 ? 72   ARG C CD    1 
ATOM   4073  N  NE    . ARG C 2 72   ? 125.102 147.608 83.194  1.00 268.98 ? 72   ARG C NE    1 
ATOM   4074  C  CZ    . ARG C 2 72   ? 125.713 146.446 83.011  1.00 268.98 ? 72   ARG C CZ    1 
ATOM   4075  N  NH1   . ARG C 2 72   ? 125.231 145.353 83.580  1.00 268.98 ? 72   ARG C NH1   1 
ATOM   4076  N  NH2   . ARG C 2 72   ? 126.814 146.380 82.278  1.00 268.98 ? 72   ARG C NH2   1 
ATOM   4077  N  N     . LEU C 2 73   ? 122.388 147.061 86.998  1.00 269.83 ? 73   LEU C N     1 
ATOM   4078  C  CA    . LEU C 2 73   ? 122.769 145.754 87.497  1.00 269.83 ? 73   LEU C CA    1 
ATOM   4079  C  C     . LEU C 2 73   ? 122.858 144.765 86.349  1.00 269.83 ? 73   LEU C C     1 
ATOM   4080  O  O     . LEU C 2 73   ? 122.487 145.053 85.210  1.00 269.83 ? 73   LEU C O     1 
ATOM   4081  C  CB    . LEU C 2 73   ? 121.780 145.230 88.544  1.00 269.83 ? 73   LEU C CB    1 
ATOM   4082  C  CG    . LEU C 2 73   ? 122.056 145.500 90.024  1.00 269.83 ? 73   LEU C CG    1 
ATOM   4083  C  CD1   . LEU C 2 73   ? 123.387 144.879 90.423  1.00 269.83 ? 73   LEU C CD1   1 
ATOM   4084  C  CD2   . LEU C 2 73   ? 121.998 146.971 90.396  1.00 269.83 ? 73   LEU C CD2   1 
ATOM   4085  N  N     . GLY C 2 74   ? 123.364 143.583 86.677  1.00 285.01 ? 74   GLY C N     1 
ATOM   4086  C  CA    . GLY C 2 74   ? 123.394 142.480 85.745  1.00 285.01 ? 74   GLY C CA    1 
ATOM   4087  C  C     . GLY C 2 74   ? 122.591 141.312 86.268  1.00 285.01 ? 74   GLY C C     1 
ATOM   4088  O  O     . GLY C 2 74   ? 121.383 141.432 86.491  1.00 285.01 ? 74   GLY C O     1 
ATOM   4089  N  N     . GLU C 2 75   ? 123.253 140.186 86.493  1.00 297.94 ? 75   GLU C N     1 
ATOM   4090  C  CA    . GLU C 2 75   ? 122.545 138.996 86.929  1.00 297.94 ? 75   GLU C CA    1 
ATOM   4091  C  C     . GLU C 2 75   ? 123.459 138.042 87.684  1.00 297.94 ? 75   GLU C C     1 
ATOM   4092  O  O     . GLU C 2 75   ? 124.562 137.738 87.213  1.00 297.94 ? 75   GLU C O     1 
ATOM   4093  C  CB    . GLU C 2 75   ? 121.935 138.278 85.729  1.00 297.94 ? 75   GLU C CB    1 
ATOM   4094  C  CG    . GLU C 2 75   ? 121.312 136.949 86.071  1.00 297.94 ? 75   GLU C CG    1 
ATOM   4095  C  CD    . GLU C 2 75   ? 120.166 137.100 87.042  1.00 297.94 ? 75   GLU C CD    1 
ATOM   4096  O  OE1   . GLU C 2 75   ? 119.391 138.068 86.904  1.00 297.94 ? 75   GLU C OE1   1 
ATOM   4097  O  OE2   . GLU C 2 75   ? 120.041 136.257 87.952  1.00 297.94 ? 75   GLU C OE2   1 
ATOM   4098  N  N     . PRO C 2 76   ? 123.050 137.579 88.861  1.00 301.07 ? 76   PRO C N     1 
ATOM   4099  C  CA    . PRO C 2 76   ? 123.702 136.427 89.474  1.00 301.07 ? 76   PRO C CA    1 
ATOM   4100  C  C     . PRO C 2 76   ? 123.575 135.210 88.582  1.00 301.07 ? 76   PRO C C     1 
ATOM   4101  O  O     . PRO C 2 76   ? 122.464 134.729 88.322  1.00 301.07 ? 76   PRO C O     1 
ATOM   4102  C  CB    . PRO C 2 76   ? 122.927 136.235 90.784  1.00 301.07 ? 76   PRO C CB    1 
ATOM   4103  C  CG    . PRO C 2 76   ? 122.366 137.564 91.078  1.00 301.07 ? 76   PRO C CG    1 
ATOM   4104  C  CD    . PRO C 2 76   ? 122.076 138.210 89.763  1.00 301.07 ? 76   PRO C CD    1 
ATOM   4105  N  N     . PRO C 2 77   ? 124.682 134.672 88.118  1.00 271.55 ? 77   PRO C N     1 
ATOM   4106  C  CA    . PRO C 2 77   ? 124.628 133.708 87.017  1.00 271.55 ? 77   PRO C CA    1 
ATOM   4107  C  C     . PRO C 2 77   ? 124.220 132.309 87.439  1.00 271.55 ? 77   PRO C C     1 
ATOM   4108  O  O     . PRO C 2 77   ? 124.259 131.384 86.626  1.00 271.55 ? 77   PRO C O     1 
ATOM   4109  C  CB    . PRO C 2 77   ? 126.066 133.714 86.482  1.00 271.55 ? 77   PRO C CB    1 
ATOM   4110  C  CG    . PRO C 2 77   ? 126.785 134.795 87.238  1.00 271.55 ? 77   PRO C CG    1 
ATOM   4111  C  CD    . PRO C 2 77   ? 126.062 134.959 88.515  1.00 271.55 ? 77   PRO C CD    1 
ATOM   4112  N  N     . PHE C 2 78   ? 123.849 132.124 88.701  1.00 259.76 ? 78   PHE C N     1 
ATOM   4113  C  CA    . PHE C 2 78   ? 123.579 130.803 89.209  1.00 259.76 ? 78   PHE C CA    1 
ATOM   4114  C  C     . PHE C 2 78   ? 122.312 130.850 90.042  1.00 259.76 ? 78   PHE C C     1 
ATOM   4115  O  O     . PHE C 2 78   ? 122.151 131.751 90.878  1.00 259.76 ? 78   PHE C O     1 
ATOM   4116  C  CB    . PHE C 2 78   ? 124.744 130.281 90.053  1.00 259.76 ? 78   PHE C CB    1 
ATOM   4117  C  CG    . PHE C 2 78   ? 126.077 130.600 89.469  1.00 259.76 ? 78   PHE C CG    1 
ATOM   4118  C  CD1   . PHE C 2 78   ? 126.801 131.693 89.909  1.00 259.76 ? 78   PHE C CD1   1 
ATOM   4119  C  CD2   . PHE C 2 78   ? 126.572 129.847 88.427  1.00 259.76 ? 78   PHE C CD2   1 
ATOM   4120  C  CE1   . PHE C 2 78   ? 128.014 132.002 89.345  1.00 259.76 ? 78   PHE C CE1   1 
ATOM   4121  C  CE2   . PHE C 2 78   ? 127.789 130.146 87.865  1.00 259.76 ? 78   PHE C CE2   1 
ATOM   4122  C  CZ    . PHE C 2 78   ? 128.509 131.228 88.325  1.00 259.76 ? 78   PHE C CZ    1 
ATOM   4123  N  N     . PRO C 2 79   ? 121.397 129.916 89.825  1.00 267.00 ? 79   PRO C N     1 
ATOM   4124  C  CA    . PRO C 2 79   ? 120.192 129.867 90.648  1.00 267.00 ? 79   PRO C CA    1 
ATOM   4125  C  C     . PRO C 2 79   ? 120.513 129.377 92.047  1.00 267.00 ? 79   PRO C C     1 
ATOM   4126  O  O     . PRO C 2 79   ? 121.573 128.799 92.299  1.00 267.00 ? 79   PRO C O     1 
ATOM   4127  C  CB    . PRO C 2 79   ? 119.295 128.880 89.896  1.00 267.00 ? 79   PRO C CB    1 
ATOM   4128  C  CG    . PRO C 2 79   ? 120.246 128.009 89.169  1.00 267.00 ? 79   PRO C CG    1 
ATOM   4129  C  CD    . PRO C 2 79   ? 121.390 128.890 88.773  1.00 267.00 ? 79   PRO C CD    1 
ATOM   4130  N  N     . GLN C 2 80   ? 119.554 129.615 92.948  1.00 285.36 ? 80   GLN C N     1 
ATOM   4131  C  CA    . GLN C 2 80   ? 119.789 129.513 94.386  1.00 285.36 ? 80   GLN C CA    1 
ATOM   4132  C  C     . GLN C 2 80   ? 120.125 128.093 94.801  1.00 285.36 ? 80   GLN C C     1 
ATOM   4133  O  O     . GLN C 2 80   ? 120.962 127.868 95.681  1.00 285.36 ? 80   GLN C O     1 
ATOM   4134  C  CB    . GLN C 2 80   ? 118.555 130.000 95.141  1.00 285.36 ? 80   GLN C CB    1 
ATOM   4135  C  CG    . GLN C 2 80   ? 118.149 131.411 94.800  1.00 285.36 ? 80   GLN C CG    1 
ATOM   4136  C  CD    . GLN C 2 80   ? 117.114 131.971 95.751  1.00 285.36 ? 80   GLN C CD    1 
ATOM   4137  O  OE1   . GLN C 2 80   ? 116.646 131.285 96.657  1.00 285.36 ? 80   GLN C OE1   1 
ATOM   4138  N  NE2   . GLN C 2 80   ? 116.763 133.234 95.559  1.00 285.36 ? 80   GLN C NE2   1 
ATOM   4139  N  N     . ASP C 2 81   ? 119.477 127.124 94.164  1.00 292.70 ? 81   ASP C N     1 
ATOM   4140  C  CA    . ASP C 2 81   ? 119.819 125.727 94.378  1.00 292.70 ? 81   ASP C CA    1 
ATOM   4141  C  C     . ASP C 2 81   ? 121.235 125.431 93.905  1.00 292.70 ? 81   ASP C C     1 
ATOM   4142  O  O     . ASP C 2 81   ? 122.029 124.815 94.623  1.00 292.70 ? 81   ASP C O     1 
ATOM   4143  C  CB    . ASP C 2 81   ? 118.784 124.862 93.664  1.00 292.70 ? 81   ASP C CB    1 
ATOM   4144  C  CG    . ASP C 2 81   ? 118.536 125.317 92.238  1.00 292.70 ? 81   ASP C CG    1 
ATOM   4145  O  OD1   . ASP C 2 81   ? 119.159 126.313 91.823  1.00 292.70 ? 81   ASP C OD1   1 
ATOM   4146  O  OD2   . ASP C 2 81   ? 117.709 124.699 91.541  1.00 292.70 ? 81   ASP C OD2   1 
ATOM   4147  N  N     . GLU C 2 82   ? 121.586 125.920 92.717  1.00 285.62 ? 82   GLU C N     1 
ATOM   4148  C  CA    . GLU C 2 82   ? 122.933 125.719 92.208  1.00 285.62 ? 82   GLU C CA    1 
ATOM   4149  C  C     . GLU C 2 82   ? 123.935 126.574 92.964  1.00 285.62 ? 82   GLU C C     1 
ATOM   4150  O  O     . GLU C 2 82   ? 125.102 126.190 93.097  1.00 285.62 ? 82   GLU C O     1 
ATOM   4151  C  CB    . GLU C 2 82   ? 122.965 126.034 90.720  1.00 285.62 ? 82   GLU C CB    1 
ATOM   4152  C  CG    . GLU C 2 82   ? 124.239 125.637 90.031  1.00 285.62 ? 82   GLU C CG    1 
ATOM   4153  C  CD    . GLU C 2 82   ? 124.125 125.756 88.538  1.00 285.62 ? 82   GLU C CD    1 
ATOM   4154  O  OE1   . GLU C 2 82   ? 123.038 126.137 88.064  1.00 285.62 ? 82   GLU C OE1   1 
ATOM   4155  O  OE2   . GLU C 2 82   ? 125.112 125.460 87.835  1.00 285.62 ? 82   GLU C OE2   1 
ATOM   4156  N  N     . CYS C 2 83   ? 123.488 127.716 93.484  1.00 298.93 ? 83   CYS C N     1 
ATOM   4157  C  CA    . CYS C 2 83   ? 124.349 128.549 94.313  1.00 298.93 ? 83   CYS C CA    1 
ATOM   4158  C  C     . CYS C 2 83   ? 124.692 127.844 95.620  1.00 298.93 ? 83   CYS C C     1 
ATOM   4159  O  O     . CYS C 2 83   ? 125.835 127.901 96.092  1.00 298.93 ? 83   CYS C O     1 
ATOM   4160  C  CB    . CYS C 2 83   ? 123.663 129.887 94.578  1.00 298.93 ? 83   CYS C CB    1 
ATOM   4161  S  SG    . CYS C 2 83   ? 124.683 131.109 95.397  1.00 298.93 ? 83   CYS C SG    1 
ATOM   4162  N  N     . ARG C 2 84   ? 123.713 127.158 96.212  1.00 301.35 ? 84   ARG C N     1 
ATOM   4163  C  CA    . ARG C 2 84   ? 123.981 126.366 97.405  1.00 301.35 ? 84   ARG C CA    1 
ATOM   4164  C  C     . ARG C 2 84   ? 124.798 125.135 97.061  1.00 301.35 ? 84   ARG C C     1 
ATOM   4165  O  O     . ARG C 2 84   ? 125.550 124.621 97.893  1.00 301.35 ? 84   ARG C O     1 
ATOM   4166  C  CB    . ARG C 2 84   ? 122.671 125.954 98.070  1.00 301.35 ? 84   ARG C CB    1 
ATOM   4167  C  CG    . ARG C 2 84   ? 121.949 127.087 98.745  1.00 301.35 ? 84   ARG C CG    1 
ATOM   4168  C  CD    . ARG C 2 84   ? 120.540 126.691 99.142  1.00 301.35 ? 84   ARG C CD    1 
ATOM   4169  N  NE    . ARG C 2 84   ? 119.689 126.397 97.993  1.00 301.35 ? 84   ARG C NE    1 
ATOM   4170  C  CZ    . ARG C 2 84   ? 118.366 126.283 98.061  1.00 301.35 ? 84   ARG C CZ    1 
ATOM   4171  N  NH1   . ARG C 2 84   ? 117.747 126.452 99.220  1.00 301.35 ? 84   ARG C NH1   1 
ATOM   4172  N  NH2   . ARG C 2 84   ? 117.658 126.007 96.976  1.00 301.35 ? 84   ARG C NH2   1 
ATOM   4173  N  N     . GLU C 2 85   ? 124.639 124.636 95.839  1.00 292.74 ? 85   GLU C N     1 
ATOM   4174  C  CA    . GLU C 2 85   ? 125.404 123.479 95.403  1.00 292.74 ? 85   GLU C CA    1 
ATOM   4175  C  C     . GLU C 2 85   ? 126.881 123.821 95.281  1.00 292.74 ? 85   GLU C C     1 
ATOM   4176  O  O     . GLU C 2 85   ? 127.744 123.105 95.797  1.00 292.74 ? 85   GLU C O     1 
ATOM   4177  C  CB    . GLU C 2 85   ? 124.841 122.973 94.075  1.00 292.74 ? 85   GLU C CB    1 
ATOM   4178  C  CG    . GLU C 2 85   ? 125.820 122.196 93.221  1.00 292.74 ? 85   GLU C CG    1 
ATOM   4179  C  CD    . GLU C 2 85   ? 126.279 120.911 93.878  1.00 292.74 ? 85   GLU C CD    1 
ATOM   4180  O  OE1   . GLU C 2 85   ? 125.455 120.246 94.539  1.00 292.74 ? 85   GLU C OE1   1 
ATOM   4181  O  OE2   . GLU C 2 85   ? 127.474 120.578 93.741  1.00 292.74 ? 85   GLU C OE2   1 
ATOM   4182  N  N     . LYS C 2 86   ? 127.190 124.926 94.623  1.00 297.99 ? 86   LYS C N     1 
ATOM   4183  C  CA    . LYS C 2 86   ? 128.572 125.324 94.437  1.00 297.99 ? 86   LYS C CA    1 
ATOM   4184  C  C     . LYS C 2 86   ? 129.113 126.123 95.603  1.00 297.99 ? 86   LYS C C     1 
ATOM   4185  O  O     . LYS C 2 86   ? 130.275 126.539 95.549  1.00 297.99 ? 86   LYS C O     1 
ATOM   4186  C  CB    . LYS C 2 86   ? 128.716 126.137 93.161  1.00 297.99 ? 86   LYS C CB    1 
ATOM   4187  C  CG    . LYS C 2 86   ? 128.116 125.465 91.972  1.00 297.99 ? 86   LYS C CG    1 
ATOM   4188  C  CD    . LYS C 2 86   ? 127.853 126.471 90.894  1.00 297.99 ? 86   LYS C CD    1 
ATOM   4189  C  CE    . LYS C 2 86   ? 127.894 125.804 89.551  1.00 297.99 ? 86   LYS C CE    1 
ATOM   4190  N  NZ    . LYS C 2 86   ? 127.729 126.795 88.466  1.00 297.99 ? 86   LYS C NZ    1 
ATOM   4191  N  N     . ASP C 2 87   ? 128.289 126.347 96.630  1.00 301.44 ? 87   ASP C N     1 
ATOM   4192  C  CA    . ASP C 2 87   ? 128.647 127.040 97.866  1.00 301.44 ? 87   ASP C CA    1 
ATOM   4193  C  C     . ASP C 2 87   ? 129.138 128.461 97.579  1.00 301.44 ? 87   ASP C C     1 
ATOM   4194  O  O     . ASP C 2 87   ? 130.286 128.827 97.818  1.00 301.44 ? 87   ASP C O     1 
ATOM   4195  C  CB    . ASP C 2 87   ? 129.675 126.241 98.667  1.00 301.44 ? 87   ASP C CB    1 
ATOM   4196  C  CG    . ASP C 2 87   ? 129.275 124.807 98.820  1.00 301.44 ? 87   ASP C CG    1 
ATOM   4197  O  OD1   . ASP C 2 87   ? 128.110 124.560 99.181  1.00 301.44 ? 87   ASP C OD1   1 
ATOM   4198  O  OD2   . ASP C 2 87   ? 130.110 123.920 98.555  1.00 301.44 ? 87   ASP C OD2   1 
ATOM   4199  N  N     . LEU C 2 88   ? 128.217 129.253 97.063  1.00 290.99 ? 88   LEU C N     1 
ATOM   4200  C  CA    . LEU C 2 88   ? 128.509 130.627 96.706  1.00 290.99 ? 88   LEU C CA    1 
ATOM   4201  C  C     . LEU C 2 88   ? 127.504 131.561 97.358  1.00 290.99 ? 88   LEU C C     1 
ATOM   4202  O  O     . LEU C 2 88   ? 126.661 131.152 98.160  1.00 290.99 ? 88   LEU C O     1 
ATOM   4203  C  CB    . LEU C 2 88   ? 128.503 130.791 95.192  1.00 290.99 ? 88   LEU C CB    1 
ATOM   4204  C  CG    . LEU C 2 88   ? 129.642 130.052 94.511  1.00 290.99 ? 88   LEU C CG    1 
ATOM   4205  C  CD1   . LEU C 2 88   ? 129.528 130.175 93.010  1.00 290.99 ? 88   LEU C CD1   1 
ATOM   4206  C  CD2   . LEU C 2 88   ? 130.960 130.609 95.015  1.00 290.99 ? 88   LEU C CD2   1 
ATOM   4207  N  N     . THR C 2 89   ? 127.598 132.832 96.995  1.00 286.58 ? 89   THR C N     1 
ATOM   4208  C  CA    . THR C 2 89   ? 126.643 133.836 97.419  1.00 286.58 ? 89   THR C CA    1 
ATOM   4209  C  C     . THR C 2 89   ? 125.827 134.257 96.214  1.00 286.58 ? 89   THR C C     1 
ATOM   4210  O  O     . THR C 2 89   ? 126.310 134.209 95.080  1.00 286.58 ? 89   THR C O     1 
ATOM   4211  C  CB    . THR C 2 89   ? 127.324 135.050 98.024  1.00 286.58 ? 89   THR C CB    1 
ATOM   4212  O  OG1   . THR C 2 89   ? 127.789 135.889 96.970  1.00 286.58 ? 89   THR C OG1   1 
ATOM   4213  C  CG2   . THR C 2 89   ? 128.511 134.629 98.851  1.00 286.58 ? 89   THR C CG2   1 
ATOM   4214  N  N     . TYR C 2 90   ? 124.592 134.669 96.465  1.00 279.41 ? 90   TYR C N     1 
ATOM   4215  C  CA    . TYR C 2 90   ? 123.636 134.964 95.407  1.00 279.41 ? 90   TYR C CA    1 
ATOM   4216  C  C     . TYR C 2 90   ? 123.821 136.419 94.973  1.00 279.41 ? 90   TYR C C     1 
ATOM   4217  O  O     . TYR C 2 90   ? 122.998 137.302 95.226  1.00 279.41 ? 90   TYR C O     1 
ATOM   4218  C  CB    . TYR C 2 90   ? 122.238 134.663 95.915  1.00 279.41 ? 90   TYR C CB    1 
ATOM   4219  C  CG    . TYR C 2 90   ? 121.174 134.673 94.869  1.00 279.41 ? 90   TYR C CG    1 
ATOM   4220  C  CD1   . TYR C 2 90   ? 121.137 133.685 93.897  1.00 279.41 ? 90   TYR C CD1   1 
ATOM   4221  C  CD2   . TYR C 2 90   ? 120.172 135.631 94.884  1.00 279.41 ? 90   TYR C CD2   1 
ATOM   4222  C  CE1   . TYR C 2 90   ? 120.158 133.674 92.933  1.00 279.41 ? 90   TYR C CE1   1 
ATOM   4223  C  CE2   . TYR C 2 90   ? 119.183 135.627 93.937  1.00 279.41 ? 90   TYR C CE2   1 
ATOM   4224  C  CZ    . TYR C 2 90   ? 119.179 134.639 92.963  1.00 279.41 ? 90   TYR C CZ    1 
ATOM   4225  O  OH    . TYR C 2 90   ? 118.194 134.631 92.007  1.00 279.41 ? 90   TYR C OH    1 
ATOM   4226  N  N     . GLN C 2 91   ? 124.942 136.657 94.299  1.00 290.60 ? 91   GLN C N     1 
ATOM   4227  C  CA    . GLN C 2 91   ? 125.497 137.992 94.164  1.00 290.60 ? 91   GLN C CA    1 
ATOM   4228  C  C     . GLN C 2 91   ? 125.340 138.560 92.761  1.00 290.60 ? 91   GLN C C     1 
ATOM   4229  O  O     . GLN C 2 91   ? 125.563 137.865 91.769  1.00 290.60 ? 91   GLN C O     1 
ATOM   4230  C  CB    . GLN C 2 91   ? 126.964 138.002 94.557  1.00 290.60 ? 91   GLN C CB    1 
ATOM   4231  C  CG    . GLN C 2 91   ? 127.785 136.920 93.919  1.00 290.60 ? 91   GLN C CG    1 
ATOM   4232  C  CD    . GLN C 2 91   ? 129.198 136.956 94.418  1.00 290.60 ? 91   GLN C CD    1 
ATOM   4233  O  OE1   . GLN C 2 91   ? 129.520 137.726 95.319  1.00 290.60 ? 91   GLN C OE1   1 
ATOM   4234  N  NE2   . GLN C 2 91   ? 130.056 136.132 93.840  1.00 290.60 ? 91   GLN C NE2   1 
ATOM   4235  N  N     . ALA C 2 92   ? 125.004 139.850 92.688  1.00 292.88 ? 92   ALA C N     1 
ATOM   4236  C  CA    . ALA C 2 92   ? 124.696 140.509 91.426  1.00 292.88 ? 92   ALA C CA    1 
ATOM   4237  C  C     . ALA C 2 92   ? 125.760 141.522 91.052  1.00 292.88 ? 92   ALA C C     1 
ATOM   4238  O  O     . ALA C 2 92   ? 126.100 142.383 91.873  1.00 292.88 ? 92   ALA C O     1 
ATOM   4239  C  CB    . ALA C 2 92   ? 123.349 141.211 91.502  1.00 292.88 ? 92   ALA C CB    1 
ATOM   4240  N  N     . PRO C 2 93   ? 126.247 141.494 89.810  1.00 282.24 ? 93   PRO C N     1 
ATOM   4241  C  CA    . PRO C 2 93   ? 127.304 142.423 89.388  1.00 282.24 ? 93   PRO C CA    1 
ATOM   4242  C  C     . PRO C 2 93   ? 126.782 143.848 89.288  1.00 282.24 ? 93   PRO C C     1 
ATOM   4243  O  O     . PRO C 2 93   ? 125.955 144.163 88.432  1.00 282.24 ? 93   PRO C O     1 
ATOM   4244  C  CB    . PRO C 2 93   ? 127.727 141.884 88.018  1.00 282.24 ? 93   PRO C CB    1 
ATOM   4245  C  CG    . PRO C 2 93   ? 126.562 141.103 87.528  1.00 282.24 ? 93   PRO C CG    1 
ATOM   4246  C  CD    . PRO C 2 93   ? 125.796 140.616 88.716  1.00 282.24 ? 93   PRO C CD    1 
ATOM   4247  N  N     . LEU C 2 94   ? 127.273 144.710 90.167  1.00 275.63 ? 94   LEU C N     1 
ATOM   4248  C  CA    . LEU C 2 94   ? 126.902 146.113 90.128  1.00 275.63 ? 94   LEU C CA    1 
ATOM   4249  C  C     . LEU C 2 94   ? 127.690 146.820 89.036  1.00 275.63 ? 94   LEU C C     1 
ATOM   4250  O  O     . LEU C 2 94   ? 128.911 146.665 88.941  1.00 275.63 ? 94   LEU C O     1 
ATOM   4251  C  CB    . LEU C 2 94   ? 127.148 146.785 91.474  1.00 275.63 ? 94   LEU C CB    1 
ATOM   4252  C  CG    . LEU C 2 94   ? 126.800 148.275 91.478  1.00 275.63 ? 94   LEU C CG    1 
ATOM   4253  C  CD1   . LEU C 2 94   ? 125.350 148.513 91.078  1.00 275.63 ? 94   LEU C CD1   1 
ATOM   4254  C  CD2   . LEU C 2 94   ? 127.089 148.891 92.824  1.00 275.63 ? 94   LEU C CD2   1 
ATOM   4255  N  N     . TYR C 2 95   ? 126.986 147.583 88.210  1.00 280.60 ? 95   TYR C N     1 
ATOM   4256  C  CA    . TYR C 2 95   ? 127.616 148.381 87.177  1.00 280.60 ? 95   TYR C CA    1 
ATOM   4257  C  C     . TYR C 2 95   ? 127.190 149.823 87.333  1.00 280.60 ? 95   TYR C C     1 
ATOM   4258  O  O     . TYR C 2 95   ? 126.038 150.105 87.653  1.00 280.60 ? 95   TYR C O     1 
ATOM   4259  C  CB    . TYR C 2 95   ? 127.255 147.890 85.803  1.00 280.60 ? 95   TYR C CB    1 
ATOM   4260  C  CG    . TYR C 2 95   ? 128.117 146.747 85.382  1.00 280.60 ? 95   TYR C CG    1 
ATOM   4261  C  CD1   . TYR C 2 95   ? 127.911 145.477 85.898  1.00 280.60 ? 95   TYR C CD1   1 
ATOM   4262  C  CD2   . TYR C 2 95   ? 129.157 146.935 84.489  1.00 280.60 ? 95   TYR C CD2   1 
ATOM   4263  C  CE1   . TYR C 2 95   ? 128.705 144.424 85.527  1.00 280.60 ? 95   TYR C CE1   1 
ATOM   4264  C  CE2   . TYR C 2 95   ? 129.953 145.886 84.100  1.00 280.60 ? 95   TYR C CE2   1 
ATOM   4265  C  CZ    . TYR C 2 95   ? 129.724 144.631 84.625  1.00 280.60 ? 95   TYR C CZ    1 
ATOM   4266  O  OH    . TYR C 2 95   ? 130.524 143.578 84.251  1.00 280.60 ? 95   TYR C OH    1 
ATOM   4267  N  N     . ALA C 2 96   ? 128.125 150.731 87.101  1.00 289.48 ? 96   ALA C N     1 
ATOM   4268  C  CA    . ALA C 2 96   ? 127.888 152.147 87.311  1.00 289.48 ? 96   ALA C CA    1 
ATOM   4269  C  C     . ALA C 2 96   ? 128.482 152.933 86.157  1.00 289.48 ? 96   ALA C C     1 
ATOM   4270  O  O     . ALA C 2 96   ? 129.679 152.820 85.879  1.00 289.48 ? 96   ALA C O     1 
ATOM   4271  C  CB    . ALA C 2 96   ? 128.496 152.603 88.633  1.00 289.48 ? 96   ALA C CB    1 
ATOM   4272  N  N     . ARG C 2 97   ? 127.649 153.726 85.493  1.00 314.46 ? 97   ARG C N     1 
ATOM   4273  C  CA    . ARG C 2 97   ? 128.127 154.598 84.430  1.00 314.46 ? 97   ARG C CA    1 
ATOM   4274  C  C     . ARG C 2 97   ? 128.908 155.746 85.045  1.00 314.46 ? 97   ARG C C     1 
ATOM   4275  O  O     . ARG C 2 97   ? 128.378 156.490 85.878  1.00 314.46 ? 97   ARG C O     1 
ATOM   4276  C  CB    . ARG C 2 97   ? 126.967 155.138 83.599  1.00 314.46 ? 97   ARG C CB    1 
ATOM   4277  C  CG    . ARG C 2 97   ? 125.858 154.147 83.320  1.00 314.46 ? 97   ARG C CG    1 
ATOM   4278  C  CD    . ARG C 2 97   ? 126.336 153.002 82.458  1.00 314.46 ? 97   ARG C CD    1 
ATOM   4279  N  NE    . ARG C 2 97   ? 127.277 153.423 81.422  1.00 314.46 ? 97   ARG C NE    1 
ATOM   4280  C  CZ    . ARG C 2 97   ? 127.003 153.452 80.124  1.00 314.46 ? 97   ARG C CZ    1 
ATOM   4281  N  NH1   . ARG C 2 97   ? 125.808 153.082 79.687  1.00 314.46 ? 97   ARG C NH1   1 
ATOM   4282  N  NH2   . ARG C 2 97   ? 127.929 153.841 79.260  1.00 314.46 ? 97   ARG C NH2   1 
ATOM   4283  N  N     . LEU C 2 98   ? 130.161 155.889 84.645  1.00 310.31 ? 98   LEU C N     1 
ATOM   4284  C  CA    . LEU C 2 98   ? 130.983 156.978 85.132  1.00 310.31 ? 98   LEU C CA    1 
ATOM   4285  C  C     . LEU C 2 98   ? 131.337 157.907 83.988  1.00 310.31 ? 98   LEU C C     1 
ATOM   4286  O  O     . LEU C 2 98   ? 131.388 157.509 82.823  1.00 310.31 ? 98   LEU C O     1 
ATOM   4287  C  CB    . LEU C 2 98   ? 132.265 156.479 85.784  1.00 310.31 ? 98   LEU C CB    1 
ATOM   4288  C  CG    . LEU C 2 98   ? 132.129 155.488 86.923  1.00 310.31 ? 98   LEU C CG    1 
ATOM   4289  C  CD1   . LEU C 2 98   ? 133.471 155.378 87.595  1.00 310.31 ? 98   LEU C CD1   1 
ATOM   4290  C  CD2   . LEU C 2 98   ? 131.076 155.940 87.906  1.00 310.31 ? 98   LEU C CD2   1 
ATOM   4291  N  N     . GLN C 2 99   ? 131.612 159.151 84.352  1.00 302.91 ? 99   GLN C N     1 
ATOM   4292  C  CA    . GLN C 2 99   ? 131.834 160.221 83.391  1.00 302.91 ? 99   GLN C CA    1 
ATOM   4293  C  C     . GLN C 2 99   ? 133.181 160.859 83.683  1.00 302.91 ? 99   GLN C C     1 
ATOM   4294  O  O     . GLN C 2 99   ? 133.309 161.632 84.636  1.00 302.91 ? 99   GLN C O     1 
ATOM   4295  C  CB    . GLN C 2 99   ? 130.725 161.250 83.477  1.00 302.91 ? 99   GLN C CB    1 
ATOM   4296  C  CG    . GLN C 2 99   ? 129.754 161.191 82.342  1.00 302.91 ? 99   GLN C CG    1 
ATOM   4297  C  CD    . GLN C 2 99   ? 128.819 162.368 82.356  1.00 302.91 ? 99   GLN C CD    1 
ATOM   4298  O  OE1   . GLN C 2 99   ? 128.426 162.844 83.419  1.00 302.91 ? 99   GLN C OE1   1 
ATOM   4299  N  NE2   . GLN C 2 99   ? 128.453 162.849 81.177  1.00 302.91 ? 99   GLN C NE2   1 
ATOM   4300  N  N     . LEU C 2 100  ? 134.177 160.540 82.870  1.00 306.11 ? 100  LEU C N     1 
ATOM   4301  C  CA    . LEU C 2 100  ? 135.392 161.335 82.884  1.00 306.11 ? 100  LEU C CA    1 
ATOM   4302  C  C     . LEU C 2 100  ? 135.068 162.675 82.254  1.00 306.11 ? 100  LEU C C     1 
ATOM   4303  O  O     . LEU C 2 100  ? 134.734 162.749 81.069  1.00 306.11 ? 100  LEU C O     1 
ATOM   4304  C  CB    . LEU C 2 100  ? 136.524 160.624 82.158  1.00 306.11 ? 100  LEU C CB    1 
ATOM   4305  C  CG    . LEU C 2 100  ? 137.859 161.363 82.077  1.00 306.11 ? 100  LEU C CG    1 
ATOM   4306  C  CD1   . LEU C 2 100  ? 138.259 161.974 83.414  1.00 306.11 ? 100  LEU C CD1   1 
ATOM   4307  C  CD2   . LEU C 2 100  ? 138.906 160.357 81.658  1.00 306.11 ? 100  LEU C CD2   1 
ATOM   4308  N  N     . ILE C 2 101  ? 135.097 163.721 83.075  1.00 327.40 ? 101  ILE C N     1 
ATOM   4309  C  CA    . ILE C 2 101  ? 134.787 165.084 82.651  1.00 327.40 ? 101  ILE C CA    1 
ATOM   4310  C  C     . ILE C 2 101  ? 135.966 165.935 83.105  1.00 327.40 ? 101  ILE C C     1 
ATOM   4311  O  O     . ILE C 2 101  ? 135.997 166.420 84.240  1.00 327.40 ? 101  ILE C O     1 
ATOM   4312  C  CB    . ILE C 2 101  ? 133.476 165.610 83.244  1.00 327.40 ? 101  ILE C CB    1 
ATOM   4313  C  CG1   . ILE C 2 101  ? 132.321 164.642 82.985  1.00 327.40 ? 101  ILE C CG1   1 
ATOM   4314  C  CG2   . ILE C 2 101  ? 133.159 166.996 82.693  1.00 327.40 ? 101  ILE C CG2   1 
ATOM   4315  C  CD1   . ILE C 2 101  ? 131.094 164.943 83.799  1.00 327.40 ? 101  ILE C CD1   1 
ATOM   4316  N  N     . HIS C 2 102  ? 136.941 166.125 82.222  1.00 325.59 ? 102  HIS C N     1 
ATOM   4317  C  CA    . HIS C 2 102  ? 138.099 166.936 82.566  1.00 325.59 ? 102  HIS C CA    1 
ATOM   4318  C  C     . HIS C 2 102  ? 137.669 168.385 82.712  1.00 325.59 ? 102  HIS C C     1 
ATOM   4319  O  O     . HIS C 2 102  ? 136.991 168.933 81.838  1.00 325.59 ? 102  HIS C O     1 
ATOM   4320  C  CB    . HIS C 2 102  ? 139.194 166.798 81.522  1.00 325.59 ? 102  HIS C CB    1 
ATOM   4321  C  CG    . HIS C 2 102  ? 140.554 167.139 82.041  1.00 325.59 ? 102  HIS C CG    1 
ATOM   4322  N  ND1   . HIS C 2 102  ? 140.809 168.282 82.768  1.00 325.59 ? 102  HIS C ND1   1 
ATOM   4323  C  CD2   . HIS C 2 102  ? 141.734 166.483 81.947  1.00 325.59 ? 102  HIS C CD2   1 
ATOM   4324  C  CE1   . HIS C 2 102  ? 142.086 168.316 83.099  1.00 325.59 ? 102  HIS C CE1   1 
ATOM   4325  N  NE2   . HIS C 2 102  ? 142.670 167.237 82.612  1.00 325.59 ? 102  HIS C NE2   1 
ATOM   4326  N  N     . LYS C 2 103  ? 138.045 168.983 83.843  1.00 350.99 ? 103  LYS C N     1 
ATOM   4327  C  CA    . LYS C 2 103  ? 137.621 170.332 84.190  1.00 350.99 ? 103  LYS C CA    1 
ATOM   4328  C  C     . LYS C 2 103  ? 138.157 171.372 83.218  1.00 350.99 ? 103  LYS C C     1 
ATOM   4329  O  O     . LYS C 2 103  ? 137.434 172.282 82.801  1.00 350.99 ? 103  LYS C O     1 
ATOM   4330  C  CB    . LYS C 2 103  ? 138.069 170.640 85.620  1.00 350.99 ? 103  LYS C CB    1 
ATOM   4331  C  CG    . LYS C 2 103  ? 139.453 170.100 85.962  1.00 350.99 ? 103  LYS C CG    1 
ATOM   4332  C  CD    . LYS C 2 103  ? 139.891 170.531 87.347  1.00 350.99 ? 103  LYS C CD    1 
ATOM   4333  C  CE    . LYS C 2 103  ? 139.034 169.882 88.416  1.00 350.99 ? 103  LYS C CE    1 
ATOM   4334  N  NZ    . LYS C 2 103  ? 139.630 169.979 89.776  1.00 350.99 ? 103  LYS C NZ    1 
ATOM   4335  N  N     . ASP C 2 104  ? 139.419 171.238 82.824  1.00 356.09 ? 104  ASP C N     1 
ATOM   4336  C  CA    . ASP C 2 104  ? 139.989 172.229 81.926  1.00 356.09 ? 104  ASP C CA    1 
ATOM   4337  C  C     . ASP C 2 104  ? 139.883 171.786 80.477  1.00 356.09 ? 104  ASP C C     1 
ATOM   4338  O  O     . ASP C 2 104  ? 139.581 172.596 79.595  1.00 356.09 ? 104  ASP C O     1 
ATOM   4339  C  CB    . ASP C 2 104  ? 141.440 172.500 82.296  1.00 356.09 ? 104  ASP C CB    1 
ATOM   4340  C  CG    . ASP C 2 104  ? 141.954 173.768 81.677  1.00 356.09 ? 104  ASP C CG    1 
ATOM   4341  O  OD1   . ASP C 2 104  ? 141.127 174.574 81.206  1.00 356.09 ? 104  ASP C OD1   1 
ATOM   4342  O  OD2   . ASP C 2 104  ? 143.182 173.961 81.652  1.00 356.09 ? 104  ASP C OD2   1 
ATOM   4343  N  N     . THR C 2 105  ? 140.133 170.505 80.213  1.00 327.17 ? 105  THR C N     1 
ATOM   4344  C  CA    . THR C 2 105  ? 140.069 170.016 78.843  1.00 327.17 ? 105  THR C CA    1 
ATOM   4345  C  C     . THR C 2 105  ? 138.632 169.947 78.352  1.00 327.17 ? 105  THR C C     1 
ATOM   4346  O  O     . THR C 2 105  ? 138.318 170.415 77.252  1.00 327.17 ? 105  THR C O     1 
ATOM   4347  C  CB    . THR C 2 105  ? 140.728 168.641 78.747  1.00 327.17 ? 105  THR C CB    1 
ATOM   4348  O  OG1   . THR C 2 105  ? 142.092 168.733 79.170  1.00 327.17 ? 105  THR C OG1   1 
ATOM   4349  C  CG2   . THR C 2 105  ? 140.674 168.110 77.325  1.00 327.17 ? 105  THR C CG2   1 
ATOM   4350  N  N     . GLY C 2 106  ? 137.738 169.409 79.169  1.00 317.42 ? 106  GLY C N     1 
ATOM   4351  C  CA    . GLY C 2 106  ? 136.488 168.947 78.622  1.00 317.42 ? 106  GLY C CA    1 
ATOM   4352  C  C     . GLY C 2 106  ? 136.635 167.617 77.941  1.00 317.42 ? 106  GLY C C     1 
ATOM   4353  O  O     . GLY C 2 106  ? 135.905 167.324 76.995  1.00 317.42 ? 106  GLY C O     1 
ATOM   4354  N  N     . LEU C 2 107  ? 137.610 166.827 78.358  1.00 313.92 ? 107  LEU C N     1 
ATOM   4355  C  CA    . LEU C 2 107  ? 137.727 165.465 77.878  1.00 313.92 ? 107  LEU C CA    1 
ATOM   4356  C  C     . LEU C 2 107  ? 136.551 164.662 78.407  1.00 313.92 ? 107  LEU C C     1 
ATOM   4357  O  O     . LEU C 2 107  ? 136.459 164.412 79.610  1.00 313.92 ? 107  LEU C O     1 
ATOM   4358  C  CB    . LEU C 2 107  ? 139.057 164.890 78.354  1.00 313.92 ? 107  LEU C CB    1 
ATOM   4359  C  CG    . LEU C 2 107  ? 139.638 163.595 77.799  1.00 313.92 ? 107  LEU C CG    1 
ATOM   4360  C  CD1   . LEU C 2 107  ? 141.150 163.692 77.826  1.00 313.92 ? 107  LEU C CD1   1 
ATOM   4361  C  CD2   . LEU C 2 107  ? 139.185 162.387 78.595  1.00 313.92 ? 107  LEU C CD2   1 
ATOM   4362  N  N     . ILE C 2 108  ? 135.639 164.281 77.518  1.00 284.90 ? 108  ILE C N     1 
ATOM   4363  C  CA    . ILE C 2 108  ? 134.397 163.618 77.902  1.00 284.90 ? 108  ILE C CA    1 
ATOM   4364  C  C     . ILE C 2 108  ? 134.536 162.146 77.568  1.00 284.90 ? 108  ILE C C     1 
ATOM   4365  O  O     . ILE C 2 108  ? 134.425 161.756 76.402  1.00 284.90 ? 108  ILE C O     1 
ATOM   4366  C  CB    . ILE C 2 108  ? 133.175 164.204 77.202  1.00 284.90 ? 108  ILE C CB    1 
ATOM   4367  C  CG1   . ILE C 2 108  ? 133.126 165.706 77.406  1.00 284.90 ? 108  ILE C CG1   1 
ATOM   4368  C  CG2   . ILE C 2 108  ? 131.916 163.534 77.729  1.00 284.90 ? 108  ILE C CG2   1 
ATOM   4369  C  CD1   . ILE C 2 108  ? 131.889 166.316 76.887  1.00 284.90 ? 108  ILE C CD1   1 
ATOM   4370  N  N     . LYS C 2 109  ? 134.734 161.321 78.585  1.00 302.29 ? 109  LYS C N     1 
ATOM   4371  C  CA    . LYS C 2 109  ? 134.793 159.876 78.412  1.00 302.29 ? 109  LYS C CA    1 
ATOM   4372  C  C     . LYS C 2 109  ? 133.773 159.245 79.351  1.00 302.29 ? 109  LYS C C     1 
ATOM   4373  O  O     . LYS C 2 109  ? 133.994 159.174 80.564  1.00 302.29 ? 109  LYS C O     1 
ATOM   4374  C  CB    . LYS C 2 109  ? 136.200 159.353 78.675  1.00 302.29 ? 109  LYS C CB    1 
ATOM   4375  C  CG    . LYS C 2 109  ? 136.325 157.841 78.579  1.00 302.29 ? 109  LYS C CG    1 
ATOM   4376  C  CD    . LYS C 2 109  ? 136.712 157.399 77.177  1.00 302.29 ? 109  LYS C CD    1 
ATOM   4377  C  CE    . LYS C 2 109  ? 137.216 155.965 77.156  1.00 302.29 ? 109  LYS C CE    1 
ATOM   4378  N  NZ    . LYS C 2 109  ? 136.137 155.001 77.492  1.00 302.29 ? 109  LYS C NZ    1 
ATOM   4379  N  N     . GLU C 2 110  ? 132.648 158.807 78.795  1.00 324.82 ? 110  GLU C N     1 
ATOM   4380  C  CA    . GLU C 2 110  ? 131.712 158.002 79.564  1.00 324.82 ? 110  GLU C CA    1 
ATOM   4381  C  C     . GLU C 2 110  ? 132.247 156.581 79.683  1.00 324.82 ? 110  GLU C C     1 
ATOM   4382  O  O     . GLU C 2 110  ? 132.722 155.998 78.706  1.00 324.82 ? 110  GLU C O     1 
ATOM   4383  C  CB    . GLU C 2 110  ? 130.331 158.018 78.904  1.00 324.82 ? 110  GLU C CB    1 
ATOM   4384  C  CG    . GLU C 2 110  ? 129.402 156.858 79.267  1.00 324.82 ? 110  GLU C CG    1 
ATOM   4385  C  CD    . GLU C 2 110  ? 129.126 156.736 80.759  1.00 324.82 ? 110  GLU C CD    1 
ATOM   4386  O  OE1   . GLU C 2 110  ? 128.829 157.760 81.406  1.00 324.82 ? 110  GLU C OE1   1 
ATOM   4387  O  OE2   . GLU C 2 110  ? 129.243 155.609 81.288  1.00 324.82 ? 110  GLU C OE2   1 
ATOM   4388  N  N     . ASP C 2 111  ? 132.182 156.026 80.892  1.00 315.07 ? 111  ASP C N     1 
ATOM   4389  C  CA    . ASP C 2 111  ? 132.754 154.709 81.143  1.00 315.07 ? 111  ASP C CA    1 
ATOM   4390  C  C     . ASP C 2 111  ? 131.931 153.990 82.202  1.00 315.07 ? 111  ASP C C     1 
ATOM   4391  O  O     . ASP C 2 111  ? 131.975 154.363 83.373  1.00 315.07 ? 111  ASP C O     1 
ATOM   4392  C  CB    . ASP C 2 111  ? 134.205 154.847 81.583  1.00 315.07 ? 111  ASP C CB    1 
ATOM   4393  C  CG    . ASP C 2 111  ? 135.040 153.645 81.225  1.00 315.07 ? 111  ASP C CG    1 
ATOM   4394  O  OD1   . ASP C 2 111  ? 134.478 152.536 81.136  1.00 315.07 ? 111  ASP C OD1   1 
ATOM   4395  O  OD2   . ASP C 2 111  ? 136.263 153.810 81.034  1.00 315.07 ? 111  ASP C OD2   1 
ATOM   4396  N  N     . GLU C 2 112  ? 131.202 152.952 81.805  1.00 296.88 ? 112  GLU C N     1 
ATOM   4397  C  CA    . GLU C 2 112  ? 130.644 152.048 82.797  1.00 296.88 ? 112  GLU C CA    1 
ATOM   4398  C  C     . GLU C 2 112  ? 131.754 151.194 83.391  1.00 296.88 ? 112  GLU C C     1 
ATOM   4399  O  O     . GLU C 2 112  ? 132.692 150.787 82.702  1.00 296.88 ? 112  GLU C O     1 
ATOM   4400  C  CB    . GLU C 2 112  ? 129.572 151.140 82.192  1.00 296.88 ? 112  GLU C CB    1 
ATOM   4401  C  CG    . GLU C 2 112  ? 128.754 150.375 83.237  1.00 296.88 ? 112  GLU C CG    1 
ATOM   4402  C  CD    . GLU C 2 112  ? 127.713 149.460 82.634  1.00 296.88 ? 112  GLU C CD    1 
ATOM   4403  O  OE1   . GLU C 2 112  ? 128.087 148.509 81.917  1.00 296.88 ? 112  GLU C OE1   1 
ATOM   4404  O  OE2   . GLU C 2 112  ? 126.513 149.684 82.884  1.00 296.88 ? 112  GLU C OE2   1 
ATOM   4405  N  N     . VAL C 2 113  ? 131.651 150.931 84.687  1.00 276.06 ? 113  VAL C N     1 
ATOM   4406  C  CA    . VAL C 2 113  ? 132.606 150.078 85.377  1.00 276.06 ? 113  VAL C CA    1 
ATOM   4407  C  C     . VAL C 2 113  ? 131.851 148.992 86.130  1.00 276.06 ? 113  VAL C C     1 
ATOM   4408  O  O     . VAL C 2 113  ? 130.760 149.230 86.661  1.00 276.06 ? 113  VAL C O     1 
ATOM   4409  C  CB    . VAL C 2 113  ? 133.506 150.894 86.323  1.00 276.06 ? 113  VAL C CB    1 
ATOM   4410  C  CG1   . VAL C 2 113  ? 134.462 151.753 85.524  1.00 276.06 ? 113  VAL C CG1   1 
ATOM   4411  C  CG2   . VAL C 2 113  ? 132.661 151.784 87.197  1.00 276.06 ? 113  VAL C CG2   1 
ATOM   4412  N  N     . PHE C 2 114  ? 132.409 147.789 86.136  1.00 277.24 ? 114  PHE C N     1 
ATOM   4413  C  CA    . PHE C 2 114  ? 131.916 146.748 87.018  1.00 277.24 ? 114  PHE C CA    1 
ATOM   4414  C  C     . PHE C 2 114  ? 132.319 147.082 88.439  1.00 277.24 ? 114  PHE C C     1 
ATOM   4415  O  O     . PHE C 2 114  ? 133.488 147.365 88.710  1.00 277.24 ? 114  PHE C O     1 
ATOM   4416  C  CB    . PHE C 2 114  ? 132.483 145.394 86.618  1.00 277.24 ? 114  PHE C CB    1 
ATOM   4417  C  CG    . PHE C 2 114  ? 132.453 144.385 87.717  1.00 277.24 ? 114  PHE C CG    1 
ATOM   4418  C  CD1   . PHE C 2 114  ? 131.248 143.877 88.173  1.00 277.24 ? 114  PHE C CD1   1 
ATOM   4419  C  CD2   . PHE C 2 114  ? 133.628 143.936 88.293  1.00 277.24 ? 114  PHE C CD2   1 
ATOM   4420  C  CE1   . PHE C 2 114  ? 131.216 142.942 89.189  1.00 277.24 ? 114  PHE C CE1   1 
ATOM   4421  C  CE2   . PHE C 2 114  ? 133.604 143.003 89.308  1.00 277.24 ? 114  PHE C CE2   1 
ATOM   4422  C  CZ    . PHE C 2 114  ? 132.398 142.501 89.752  1.00 277.24 ? 114  PHE C CZ    1 
ATOM   4423  N  N     . LEU C 2 115  ? 131.362 147.044 89.351  1.00 265.17 ? 115  LEU C N     1 
ATOM   4424  C  CA    . LEU C 2 115  ? 131.611 147.514 90.702  1.00 265.17 ? 115  LEU C CA    1 
ATOM   4425  C  C     . LEU C 2 115  ? 131.109 146.517 91.723  1.00 265.17 ? 115  LEU C C     1 
ATOM   4426  O  O     . LEU C 2 115  ? 130.371 146.847 92.651  1.00 265.17 ? 115  LEU C O     1 
ATOM   4427  C  CB    . LEU C 2 115  ? 130.989 148.883 90.903  1.00 265.17 ? 115  LEU C CB    1 
ATOM   4428  C  CG    . LEU C 2 115  ? 131.887 150.014 90.403  1.00 265.17 ? 115  LEU C CG    1 
ATOM   4429  C  CD1   . LEU C 2 115  ? 131.309 151.351 90.801  1.00 265.17 ? 115  LEU C CD1   1 
ATOM   4430  C  CD2   . LEU C 2 115  ? 133.314 149.870 90.919  1.00 265.17 ? 115  LEU C CD2   1 
ATOM   4431  N  N     . GLY C 2 116  ? 131.496 145.267 91.555  1.00 272.78 ? 116  GLY C N     1 
ATOM   4432  C  CA    . GLY C 2 116  ? 131.300 144.299 92.606  1.00 272.78 ? 116  GLY C CA    1 
ATOM   4433  C  C     . GLY C 2 116  ? 130.038 143.478 92.429  1.00 272.78 ? 116  GLY C C     1 
ATOM   4434  O  O     . GLY C 2 116  ? 129.102 143.853 91.726  1.00 272.78 ? 116  GLY C O     1 
ATOM   4435  N  N     . HIS C 2 117  ? 130.028 142.336 93.103  1.00 288.73 ? 117  HIS C N     1 
ATOM   4436  C  CA    . HIS C 2 117  ? 128.940 141.379 93.024  1.00 288.73 ? 117  HIS C CA    1 
ATOM   4437  C  C     . HIS C 2 117  ? 128.096 141.427 94.287  1.00 288.73 ? 117  HIS C C     1 
ATOM   4438  O  O     . HIS C 2 117  ? 128.467 140.845 95.309  1.00 288.73 ? 117  HIS C O     1 
ATOM   4439  C  CB    . HIS C 2 117  ? 129.489 139.981 92.805  1.00 288.73 ? 117  HIS C CB    1 
ATOM   4440  C  CG    . HIS C 2 117  ? 129.526 139.572 91.372  1.00 288.73 ? 117  HIS C CG    1 
ATOM   4441  N  ND1   . HIS C 2 117  ? 128.399 139.180 90.685  1.00 288.73 ? 117  HIS C ND1   1 
ATOM   4442  C  CD2   . HIS C 2 117  ? 130.552 139.494 90.493  1.00 288.73 ? 117  HIS C CD2   1 
ATOM   4443  C  CE1   . HIS C 2 117  ? 128.730 138.867 89.445  1.00 288.73 ? 117  HIS C CE1   1 
ATOM   4444  N  NE2   . HIS C 2 117  ? 130.030 139.055 89.302  1.00 288.73 ? 117  HIS C NE2   1 
ATOM   4445  N  N     . ILE C 2 118  ? 126.953 142.088 94.202  1.00 293.06 ? 118  ILE C N     1 
ATOM   4446  C  CA    . ILE C 2 118  ? 126.142 142.442 95.364  1.00 293.06 ? 118  ILE C CA    1 
ATOM   4447  C  C     . ILE C 2 118  ? 125.184 141.297 95.651  1.00 293.06 ? 118  ILE C C     1 
ATOM   4448  O  O     . ILE C 2 118  ? 124.406 140.922 94.765  1.00 293.06 ? 118  ILE C O     1 
ATOM   4449  C  CB    . ILE C 2 118  ? 125.364 143.750 95.139  1.00 293.06 ? 118  ILE C CB    1 
ATOM   4450  C  CG1   . ILE C 2 118  ? 126.317 144.936 95.238  1.00 293.06 ? 118  ILE C CG1   1 
ATOM   4451  C  CG2   . ILE C 2 118  ? 124.227 143.898 96.146  1.00 293.06 ? 118  ILE C CG2   1 
ATOM   4452  C  CD1   . ILE C 2 118  ? 125.637 146.267 95.067  1.00 293.06 ? 118  ILE C CD1   1 
ATOM   4453  N  N     . PRO C 2 119  ? 125.181 140.753 96.868  1.00 278.07 ? 119  PRO C N     1 
ATOM   4454  C  CA    . PRO C 2 119  ? 124.280 139.646 97.195  1.00 278.07 ? 119  PRO C CA    1 
ATOM   4455  C  C     . PRO C 2 119  ? 122.841 140.099 97.174  1.00 278.07 ? 119  PRO C C     1 
ATOM   4456  O  O     . PRO C 2 119  ? 122.514 141.221 97.557  1.00 278.07 ? 119  PRO C O     1 
ATOM   4457  C  CB    . PRO C 2 119  ? 124.703 139.243 98.610  1.00 278.07 ? 119  PRO C CB    1 
ATOM   4458  C  CG    . PRO C 2 119  ? 125.954 139.996 98.887  1.00 278.07 ? 119  PRO C CG    1 
ATOM   4459  C  CD    . PRO C 2 119  ? 125.917 141.214 98.048  1.00 278.07 ? 119  PRO C CD    1 
ATOM   4460  N  N     . LEU C 2 120  ? 121.986 139.225 96.706  1.00 276.67 ? 120  LEU C N     1 
ATOM   4461  C  CA    . LEU C 2 120  ? 120.596 139.570 96.479  1.00 276.67 ? 120  LEU C CA    1 
ATOM   4462  C  C     . LEU C 2 120  ? 119.745 138.871 97.518  1.00 276.67 ? 120  LEU C C     1 
ATOM   4463  O  O     . LEU C 2 120  ? 119.891 137.663 97.737  1.00 276.67 ? 120  LEU C O     1 
ATOM   4464  C  CB    . LEU C 2 120  ? 120.179 139.189 95.070  1.00 276.67 ? 120  LEU C CB    1 
ATOM   4465  C  CG    . LEU C 2 120  ? 120.878 140.028 93.995  1.00 276.67 ? 120  LEU C CG    1 
ATOM   4466  C  CD1   . LEU C 2 120  ? 120.072 139.928 92.730  1.00 276.67 ? 120  LEU C CD1   1 
ATOM   4467  C  CD2   . LEU C 2 120  ? 121.060 141.498 94.396  1.00 276.67 ? 120  LEU C CD2   1 
ATOM   4468  N  N     . MET C 2 121  ? 118.885 139.643 98.167  1.00 264.90 ? 121  MET C N     1 
ATOM   4469  C  CA    . MET C 2 121  ? 117.913 139.084 99.082  1.00 264.90 ? 121  MET C CA    1 
ATOM   4470  C  C     . MET C 2 121  ? 116.940 138.213 98.320  1.00 264.90 ? 121  MET C C     1 
ATOM   4471  O  O     . MET C 2 121  ? 116.409 138.612 97.282  1.00 264.90 ? 121  MET C O     1 
ATOM   4472  C  CB    . MET C 2 121  ? 117.177 140.205 99.800  1.00 264.90 ? 121  MET C CB    1 
ATOM   4473  C  CG    . MET C 2 121  ? 116.204 139.713 100.795 1.00 264.90 ? 121  MET C CG    1 
ATOM   4474  S  SD    . MET C 2 121  ? 115.372 141.010 101.694 1.00 264.90 ? 121  MET C SD    1 
ATOM   4475  C  CE    . MET C 2 121  ? 116.597 141.444 102.915 1.00 264.90 ? 121  MET C CE    1 
ATOM   4476  N  N     . THR C 2 122  ? 116.719 137.014 98.833  1.00 271.69 ? 122  THR C N     1 
ATOM   4477  C  CA    . THR C 2 122  ? 115.942 136.038 98.107  1.00 271.69 ? 122  THR C CA    1 
ATOM   4478  C  C     . THR C 2 122  ? 114.459 136.383 98.166  1.00 271.69 ? 122  THR C C     1 
ATOM   4479  O  O     . THR C 2 122  ? 114.042 137.385 98.750  1.00 271.69 ? 122  THR C O     1 
ATOM   4480  C  CB    . THR C 2 122  ? 116.187 134.654 98.682  1.00 271.69 ? 122  THR C CB    1 
ATOM   4481  O  OG1   . THR C 2 122  ? 115.675 134.614 100.019 1.00 271.69 ? 122  THR C OG1   1 
ATOM   4482  C  CG2   . THR C 2 122  ? 117.671 134.380 98.721  1.00 271.69 ? 122  THR C CG2   1 
ATOM   4483  N  N     . GLU C 2 123  ? 113.662 135.517 97.541  1.00 286.15 ? 123  GLU C N     1 
ATOM   4484  C  CA    . GLU C 2 123  ? 112.239 135.788 97.372  1.00 286.15 ? 123  GLU C CA    1 
ATOM   4485  C  C     . GLU C 2 123  ? 111.505 135.704 98.699  1.00 286.15 ? 123  GLU C C     1 
ATOM   4486  O  O     . GLU C 2 123  ? 110.645 136.536 99.003  1.00 286.15 ? 123  GLU C O     1 
ATOM   4487  C  CB    . GLU C 2 123  ? 111.656 134.798 96.374  1.00 286.15 ? 123  GLU C CB    1 
ATOM   4488  C  CG    . GLU C 2 123  ? 112.355 134.819 95.039  1.00 286.15 ? 123  GLU C CG    1 
ATOM   4489  C  CD    . GLU C 2 123  ? 111.886 133.705 94.141  1.00 286.15 ? 123  GLU C CD    1 
ATOM   4490  O  OE1   . GLU C 2 123  ? 111.118 132.848 94.621  1.00 286.15 ? 123  GLU C OE1   1 
ATOM   4491  O  OE2   . GLU C 2 123  ? 112.287 133.681 92.960  1.00 286.15 ? 123  GLU C OE2   1 
ATOM   4492  N  N     . ASP C 2 124  ? 111.836 134.699 99.506  1.00 266.15 ? 124  ASP C N     1 
ATOM   4493  C  CA    . ASP C 2 124  ? 111.354 134.682 100.876 1.00 266.15 ? 124  ASP C CA    1 
ATOM   4494  C  C     . ASP C 2 124  ? 112.004 135.770 101.706 1.00 266.15 ? 124  ASP C C     1 
ATOM   4495  O  O     . ASP C 2 124  ? 111.402 136.239 102.676 1.00 266.15 ? 124  ASP C O     1 
ATOM   4496  C  CB    . ASP C 2 124  ? 111.624 133.328 101.513 1.00 266.15 ? 124  ASP C CB    1 
ATOM   4497  C  CG    . ASP C 2 124  ? 113.045 132.885 101.319 1.00 266.15 ? 124  ASP C CG    1 
ATOM   4498  O  OD1   . ASP C 2 124  ? 113.730 133.482 100.470 1.00 266.15 ? 124  ASP C OD1   1 
ATOM   4499  O  OD2   . ASP C 2 124  ? 113.482 131.952 102.019 1.00 266.15 ? 124  ASP C OD2   1 
ATOM   4500  N  N     . GLY C 2 125  ? 113.223 136.167 101.363 1.00 270.53 ? 125  GLY C N     1 
ATOM   4501  C  CA    . GLY C 2 125  ? 113.895 137.249 102.042 1.00 270.53 ? 125  GLY C CA    1 
ATOM   4502  C  C     . GLY C 2 125  ? 115.229 136.890 102.648 1.00 270.53 ? 125  GLY C C     1 
ATOM   4503  O  O     . GLY C 2 125  ? 115.793 137.709 103.381 1.00 270.53 ? 125  GLY C O     1 
ATOM   4504  N  N     . SER C 2 126  ? 115.758 135.706 102.374 1.00 277.29 ? 126  SER C N     1 
ATOM   4505  C  CA    . SER C 2 126  ? 116.968 135.266 103.050 1.00 277.29 ? 126  SER C CA    1 
ATOM   4506  C  C     . SER C 2 126  ? 118.202 135.639 102.233 1.00 277.29 ? 126  SER C C     1 
ATOM   4507  O  O     . SER C 2 126  ? 118.156 136.464 101.317 1.00 277.29 ? 126  SER C O     1 
ATOM   4508  C  CB    . SER C 2 126  ? 116.907 133.772 103.328 1.00 277.29 ? 126  SER C CB    1 
ATOM   4509  O  OG    . SER C 2 126  ? 117.817 133.446 104.357 1.00 277.29 ? 126  SER C OG    1 
ATOM   4510  N  N     . PHE C 2 127  ? 119.335 135.034 102.584 1.00 280.55 ? 127  PHE C N     1 
ATOM   4511  C  CA    . PHE C 2 127  ? 120.613 135.337 101.957 1.00 280.55 ? 127  PHE C CA    1 
ATOM   4512  C  C     . PHE C 2 127  ? 121.471 134.089 101.942 1.00 280.55 ? 127  PHE C C     1 
ATOM   4513  O  O     . PHE C 2 127  ? 122.031 133.712 102.973 1.00 280.55 ? 127  PHE C O     1 
ATOM   4514  C  CB    . PHE C 2 127  ? 121.340 136.441 102.713 1.00 280.55 ? 127  PHE C CB    1 
ATOM   4515  C  CG    . PHE C 2 127  ? 120.990 137.806 102.260 1.00 280.55 ? 127  PHE C CG    1 
ATOM   4516  C  CD1   . PHE C 2 127  ? 120.163 138.602 103.023 1.00 280.55 ? 127  PHE C CD1   1 
ATOM   4517  C  CD2   . PHE C 2 127  ? 121.493 138.300 101.071 1.00 280.55 ? 127  PHE C CD2   1 
ATOM   4518  C  CE1   . PHE C 2 127  ? 119.843 139.866 102.612 1.00 280.55 ? 127  PHE C CE1   1 
ATOM   4519  C  CE2   . PHE C 2 127  ? 121.175 139.567 100.653 1.00 280.55 ? 127  PHE C CE2   1 
ATOM   4520  C  CZ    . PHE C 2 127  ? 120.350 140.352 101.430 1.00 280.55 ? 127  PHE C CZ    1 
ATOM   4521  N  N     . ILE C 2 128  ? 121.606 133.472 100.779 1.00 297.56 ? 128  ILE C N     1 
ATOM   4522  C  CA    . ILE C 2 128  ? 122.535 132.367 100.611 1.00 297.56 ? 128  ILE C CA    1 
ATOM   4523  C  C     . ILE C 2 128  ? 123.922 132.969 100.481 1.00 297.56 ? 128  ILE C C     1 
ATOM   4524  O  O     . ILE C 2 128  ? 124.186 133.729 99.550  1.00 297.56 ? 128  ILE C O     1 
ATOM   4525  C  CB    . ILE C 2 128  ? 122.182 131.515 99.393  1.00 297.56 ? 128  ILE C CB    1 
ATOM   4526  C  CG1   . ILE C 2 128  ? 120.894 130.748 99.662  1.00 297.56 ? 128  ILE C CG1   1 
ATOM   4527  C  CG2   . ILE C 2 128  ? 123.316 130.567 99.071  1.00 297.56 ? 128  ILE C CG2   1 
ATOM   4528  C  CD1   . ILE C 2 128  ? 120.173 130.344 98.422  1.00 297.56 ? 128  ILE C CD1   1 
ATOM   4529  N  N     . ILE C 2 129  ? 124.800 132.661 101.429 1.00 280.20 ? 129  ILE C N     1 
ATOM   4530  C  CA    . ILE C 2 129  ? 126.161 133.183 101.441 1.00 280.20 ? 129  ILE C CA    1 
ATOM   4531  C  C     . ILE C 2 129  ? 127.112 132.010 101.594 1.00 280.20 ? 129  ILE C C     1 
ATOM   4532  O  O     . ILE C 2 129  ? 127.060 131.299 102.604 1.00 280.20 ? 129  ILE C O     1 
ATOM   4533  C  CB    . ILE C 2 129  ? 126.379 134.205 102.565 1.00 280.20 ? 129  ILE C CB    1 
ATOM   4534  C  CG1   . ILE C 2 129  ? 125.415 135.385 102.431 1.00 280.20 ? 129  ILE C CG1   1 
ATOM   4535  C  CG2   . ILE C 2 129  ? 127.813 134.691 102.549 1.00 280.20 ? 129  ILE C CG2   1 
ATOM   4536  C  CD1   . ILE C 2 129  ? 125.601 136.194 101.191 1.00 280.20 ? 129  ILE C CD1   1 
ATOM   4537  N  N     . ASN C 2 130  ? 127.983 131.824 100.595 1.00 272.85 ? 130  ASN C N     1 
ATOM   4538  C  CA    . ASN C 2 130  ? 128.902 130.686 100.488 1.00 272.85 ? 130  ASN C CA    1 
ATOM   4539  C  C     . ASN C 2 130  ? 128.143 129.372 100.523 1.00 272.85 ? 130  ASN C C     1 
ATOM   4540  O  O     . ASN C 2 130  ? 128.616 128.377 101.067 1.00 272.85 ? 130  ASN C O     1 
ATOM   4541  C  CB    . ASN C 2 130  ? 129.980 130.718 101.568 1.00 272.85 ? 130  ASN C CB    1 
ATOM   4542  C  CG    . ASN C 2 130  ? 130.718 132.022 101.593 1.00 272.85 ? 130  ASN C CG    1 
ATOM   4543  O  OD1   . ASN C 2 130  ? 130.597 132.797 102.537 1.00 272.85 ? 130  ASN C OD1   1 
ATOM   4544  N  ND2   . ASN C 2 130  ? 131.483 132.285 100.545 1.00 272.85 ? 130  ASN C ND2   1 
ATOM   4545  N  N     . GLY C 2 131  ? 126.950 129.365 99.941  1.00 301.67 ? 131  GLY C N     1 
ATOM   4546  C  CA    . GLY C 2 131  ? 126.045 128.247 100.087 1.00 301.67 ? 131  GLY C CA    1 
ATOM   4547  C  C     . GLY C 2 131  ? 125.217 128.341 101.347 1.00 301.67 ? 131  GLY C C     1 
ATOM   4548  O  O     . GLY C 2 131  ? 124.010 128.087 101.323 1.00 301.67 ? 131  GLY C O     1 
ATOM   4549  N  N     . ALA C 2 132  ? 125.862 128.707 102.452 1.00 304.69 ? 132  ALA C N     1 
ATOM   4550  C  CA    . ALA C 2 132  ? 125.190 128.802 103.733 1.00 304.69 ? 132  ALA C CA    1 
ATOM   4551  C  C     . ALA C 2 132  ? 124.212 129.962 103.728 1.00 304.69 ? 132  ALA C C     1 
ATOM   4552  O  O     . ALA C 2 132  ? 124.296 130.877 102.910 1.00 304.69 ? 132  ALA C O     1 
ATOM   4553  C  CB    . ALA C 2 132  ? 126.208 128.983 104.856 1.00 304.69 ? 132  ALA C CB    1 
ATOM   4554  N  N     . ASP C 2 133  ? 123.269 129.915 104.645 1.00 286.35 ? 133  ASP C N     1 
ATOM   4555  C  CA    . ASP C 2 133  ? 122.220 130.911 104.691 1.00 286.35 ? 133  ASP C CA    1 
ATOM   4556  C  C     . ASP C 2 133  ? 122.492 131.872 105.838 1.00 286.35 ? 133  ASP C C     1 
ATOM   4557  O  O     . ASP C 2 133  ? 122.673 131.448 106.984 1.00 286.35 ? 133  ASP C O     1 
ATOM   4558  C  CB    . ASP C 2 133  ? 120.861 130.242 104.833 1.00 286.35 ? 133  ASP C CB    1 
ATOM   4559  C  CG    . ASP C 2 133  ? 119.761 131.051 104.210 1.00 286.35 ? 133  ASP C CG    1 
ATOM   4560  O  OD1   . ASP C 2 133  ? 119.825 132.298 104.276 1.00 286.35 ? 133  ASP C OD1   1 
ATOM   4561  O  OD2   . ASP C 2 133  ? 118.831 130.443 103.642 1.00 286.35 ? 133  ASP C OD2   1 
ATOM   4562  N  N     . ARG C 2 134  ? 122.539 133.155 105.524 1.00 268.84 ? 134  ARG C N     1 
ATOM   4563  C  CA    . ARG C 2 134  ? 122.630 134.168 106.555 1.00 268.84 ? 134  ARG C CA    1 
ATOM   4564  C  C     . ARG C 2 134  ? 121.258 134.717 106.890 1.00 268.84 ? 134  ARG C C     1 
ATOM   4565  O  O     . ARG C 2 134  ? 120.263 134.467 106.207 1.00 268.84 ? 134  ARG C O     1 
ATOM   4566  C  CB    . ARG C 2 134  ? 123.525 135.333 106.144 1.00 268.84 ? 134  ARG C CB    1 
ATOM   4567  C  CG    . ARG C 2 134  ? 124.994 135.063 106.026 1.00 268.84 ? 134  ARG C CG    1 
ATOM   4568  C  CD    . ARG C 2 134  ? 125.581 134.530 107.298 1.00 268.84 ? 134  ARG C CD    1 
ATOM   4569  N  NE    . ARG C 2 134  ? 125.757 133.090 107.176 1.00 268.84 ? 134  ARG C NE    1 
ATOM   4570  C  CZ    . ARG C 2 134  ? 126.104 132.286 108.167 1.00 268.84 ? 134  ARG C CZ    1 
ATOM   4571  N  NH1   . ARG C 2 134  ? 126.320 132.779 109.377 1.00 268.84 ? 134  ARG C NH1   1 
ATOM   4572  N  NH2   . ARG C 2 134  ? 126.264 130.989 107.934 1.00 268.84 ? 134  ARG C NH2   1 
ATOM   4573  N  N     . VAL C 2 135  ? 121.232 135.508 107.955 1.00 255.62 ? 135  VAL C N     1 
ATOM   4574  C  CA    . VAL C 2 135  ? 120.066 136.290 108.325 1.00 255.62 ? 135  VAL C CA    1 
ATOM   4575  C  C     . VAL C 2 135  ? 120.576 137.532 109.039 1.00 255.62 ? 135  VAL C C     1 
ATOM   4576  O  O     . VAL C 2 135  ? 121.668 137.536 109.615 1.00 255.62 ? 135  VAL C O     1 
ATOM   4577  C  CB    . VAL C 2 135  ? 119.081 135.457 109.185 1.00 255.62 ? 135  VAL C CB    1 
ATOM   4578  C  CG1   . VAL C 2 135  ? 119.622 135.239 110.567 1.00 255.62 ? 135  VAL C CG1   1 
ATOM   4579  C  CG2   . VAL C 2 135  ? 117.697 136.090 109.231 1.00 255.62 ? 135  VAL C CG2   1 
ATOM   4580  N  N     . ILE C 2 136  ? 119.822 138.618 108.930 1.00 268.36 ? 136  ILE C N     1 
ATOM   4581  C  CA    . ILE C 2 136  ? 120.166 139.876 109.573 1.00 268.36 ? 136  ILE C CA    1 
ATOM   4582  C  C     . ILE C 2 136  ? 119.021 140.271 110.486 1.00 268.36 ? 136  ILE C C     1 
ATOM   4583  O  O     . ILE C 2 136  ? 117.875 140.381 110.040 1.00 268.36 ? 136  ILE C O     1 
ATOM   4584  C  CB    . ILE C 2 136  ? 120.432 140.994 108.555 1.00 268.36 ? 136  ILE C CB    1 
ATOM   4585  C  CG1   . ILE C 2 136  ? 121.311 140.504 107.408 1.00 268.36 ? 136  ILE C CG1   1 
ATOM   4586  C  CG2   . ILE C 2 136  ? 121.064 142.180 109.248 1.00 268.36 ? 136  ILE C CG2   1 
ATOM   4587  C  CD1   . ILE C 2 136  ? 122.699 140.142 107.815 1.00 268.36 ? 136  ILE C CD1   1 
ATOM   4588  N  N     . VAL C 2 137  ? 119.331 140.495 111.753 1.00 283.79 ? 137  VAL C N     1 
ATOM   4589  C  CA    . VAL C 2 137  ? 118.362 140.983 112.721 1.00 283.79 ? 137  VAL C CA    1 
ATOM   4590  C  C     . VAL C 2 137  ? 118.471 142.498 112.742 1.00 283.79 ? 137  VAL C C     1 
ATOM   4591  O  O     . VAL C 2 137  ? 119.567 143.041 112.909 1.00 283.79 ? 137  VAL C O     1 
ATOM   4592  C  CB    . VAL C 2 137  ? 118.610 140.369 114.106 1.00 283.79 ? 137  VAL C CB    1 
ATOM   4593  C  CG1   . VAL C 2 137  ? 117.929 141.167 115.191 1.00 283.79 ? 137  VAL C CG1   1 
ATOM   4594  C  CG2   . VAL C 2 137  ? 118.122 138.931 114.123 1.00 283.79 ? 137  VAL C CG2   1 
ATOM   4595  N  N     . SER C 2 138  ? 117.344 143.181 112.548 1.00 276.20 ? 138  SER C N     1 
ATOM   4596  C  CA    . SER C 2 138  ? 117.363 144.631 112.410 1.00 276.20 ? 138  SER C CA    1 
ATOM   4597  C  C     . SER C 2 138  ? 117.675 145.304 113.738 1.00 276.20 ? 138  SER C C     1 
ATOM   4598  O  O     . SER C 2 138  ? 117.244 144.856 114.803 1.00 276.20 ? 138  SER C O     1 
ATOM   4599  C  CB    . SER C 2 138  ? 116.026 145.133 111.872 1.00 276.20 ? 138  SER C CB    1 
ATOM   4600  O  OG    . SER C 2 138  ? 116.043 146.540 111.709 1.00 276.20 ? 138  SER C OG    1 
ATOM   4601  N  N     . GLN C 2 139  ? 118.428 146.391 113.665 1.00 269.01 ? 139  GLN C N     1 
ATOM   4602  C  CA    . GLN C 2 139  ? 118.968 147.047 114.841 1.00 269.01 ? 139  GLN C CA    1 
ATOM   4603  C  C     . GLN C 2 139  ? 118.132 148.258 115.204 1.00 269.01 ? 139  GLN C C     1 
ATOM   4604  O  O     . GLN C 2 139  ? 117.714 149.023 114.332 1.00 269.01 ? 139  GLN C O     1 
ATOM   4605  C  CB    . GLN C 2 139  ? 120.409 147.481 114.596 1.00 269.01 ? 139  GLN C CB    1 
ATOM   4606  C  CG    . GLN C 2 139  ? 121.105 148.031 115.816 1.00 269.01 ? 139  GLN C CG    1 
ATOM   4607  C  CD    . GLN C 2 139  ? 122.498 148.519 115.510 1.00 269.01 ? 139  GLN C CD    1 
ATOM   4608  O  OE1   . GLN C 2 139  ? 122.765 149.000 114.413 1.00 269.01 ? 139  GLN C OE1   1 
ATOM   4609  N  NE2   . GLN C 2 139  ? 123.399 148.393 116.475 1.00 269.01 ? 139  GLN C NE2   1 
ATOM   4610  N  N     . ILE C 2 140  ? 117.886 148.428 116.494 1.00 243.38 ? 140  ILE C N     1 
ATOM   4611  C  CA    . ILE C 2 140  ? 117.378 149.680 117.010 1.00 243.38 ? 140  ILE C CA    1 
ATOM   4612  C  C     . ILE C 2 140  ? 118.530 150.406 117.690 1.00 243.38 ? 140  ILE C C     1 
ATOM   4613  O  O     . ILE C 2 140  ? 119.517 149.805 118.112 1.00 243.38 ? 140  ILE C O     1 
ATOM   4614  C  CB    . ILE C 2 140  ? 116.183 149.479 117.962 1.00 243.38 ? 140  ILE C CB    1 
ATOM   4615  C  CG1   . ILE C 2 140  ? 115.317 150.737 117.997 1.00 243.38 ? 140  ILE C CG1   1 
ATOM   4616  C  CG2   . ILE C 2 140  ? 116.638 149.114 119.366 1.00 243.38 ? 140  ILE C CG2   1 
ATOM   4617  C  CD1   . ILE C 2 140  ? 114.050 150.585 118.760 1.00 243.38 ? 140  ILE C CD1   1 
ATOM   4618  N  N     . HIS C 2 141  ? 118.418 151.724 117.730 1.00 243.34 ? 141  HIS C N     1 
ATOM   4619  C  CA    . HIS C 2 141  ? 119.290 152.591 118.501 1.00 243.34 ? 141  HIS C CA    1 
ATOM   4620  C  C     . HIS C 2 141  ? 118.544 153.898 118.652 1.00 243.34 ? 141  HIS C C     1 
ATOM   4621  O  O     . HIS C 2 141  ? 117.472 154.088 118.076 1.00 243.34 ? 141  HIS C O     1 
ATOM   4622  C  CB    . HIS C 2 141  ? 120.630 152.820 117.818 1.00 243.34 ? 141  HIS C CB    1 
ATOM   4623  C  CG    . HIS C 2 141  ? 120.539 153.709 116.624 1.00 243.34 ? 141  HIS C CG    1 
ATOM   4624  N  ND1   . HIS C 2 141  ? 121.197 154.916 116.538 1.00 243.34 ? 141  HIS C ND1   1 
ATOM   4625  C  CD2   . HIS C 2 141  ? 119.834 153.580 115.476 1.00 243.34 ? 141  HIS C CD2   1 
ATOM   4626  C  CE1   . HIS C 2 141  ? 120.932 155.475 115.371 1.00 243.34 ? 141  HIS C CE1   1 
ATOM   4627  N  NE2   . HIS C 2 141  ? 120.102 154.688 114.711 1.00 243.34 ? 141  HIS C NE2   1 
ATOM   4628  N  N     . ARG C 2 142  ? 119.131 154.803 119.418 1.00 247.09 ? 142  ARG C N     1 
ATOM   4629  C  CA    . ARG C 2 142  ? 118.505 156.093 119.631 1.00 247.09 ? 142  ARG C CA    1 
ATOM   4630  C  C     . ARG C 2 142  ? 118.564 156.926 118.365 1.00 247.09 ? 142  ARG C C     1 
ATOM   4631  O  O     . ARG C 2 142  ? 119.575 156.930 117.664 1.00 247.09 ? 142  ARG C O     1 
ATOM   4632  C  CB    . ARG C 2 142  ? 119.191 156.823 120.770 1.00 247.09 ? 142  ARG C CB    1 
ATOM   4633  C  CG    . ARG C 2 142  ? 118.880 156.235 122.119 1.00 247.09 ? 142  ARG C CG    1 
ATOM   4634  C  CD    . ARG C 2 142  ? 119.325 157.182 123.192 1.00 247.09 ? 142  ARG C CD    1 
ATOM   4635  N  NE    . ARG C 2 142  ? 119.038 158.561 122.818 1.00 247.09 ? 142  ARG C NE    1 
ATOM   4636  C  CZ    . ARG C 2 142  ? 119.687 159.613 123.301 1.00 247.09 ? 142  ARG C CZ    1 
ATOM   4637  N  NH1   . ARG C 2 142  ? 120.653 159.439 124.191 1.00 247.09 ? 142  ARG C NH1   1 
ATOM   4638  N  NH2   . ARG C 2 142  ? 119.361 160.836 122.907 1.00 247.09 ? 142  ARG C NH2   1 
ATOM   4639  N  N     . SER C 2 143  ? 117.468 157.619 118.071 1.00 263.95 ? 143  SER C N     1 
ATOM   4640  C  CA    . SER C 2 143  ? 117.406 158.454 116.885 1.00 263.95 ? 143  SER C CA    1 
ATOM   4641  C  C     . SER C 2 143  ? 118.360 159.636 117.028 1.00 263.95 ? 143  SER C C     1 
ATOM   4642  O  O     . SER C 2 143  ? 118.675 160.056 118.145 1.00 263.95 ? 143  SER C O     1 
ATOM   4643  C  CB    . SER C 2 143  ? 115.989 158.974 116.672 1.00 263.95 ? 143  SER C CB    1 
ATOM   4644  O  OG    . SER C 2 143  ? 115.031 157.973 116.930 1.00 263.95 ? 143  SER C OG    1 
ATOM   4645  N  N     . PRO C 2 144  ? 118.833 160.196 115.921 1.00 278.22 ? 144  PRO C N     1 
ATOM   4646  C  CA    . PRO C 2 144  ? 119.614 161.431 115.999 1.00 278.22 ? 144  PRO C CA    1 
ATOM   4647  C  C     . PRO C 2 144  ? 118.734 162.618 116.347 1.00 278.22 ? 144  PRO C C     1 
ATOM   4648  O  O     . PRO C 2 144  ? 117.509 162.529 116.434 1.00 278.22 ? 144  PRO C O     1 
ATOM   4649  C  CB    . PRO C 2 144  ? 120.202 161.569 114.594 1.00 278.22 ? 144  PRO C CB    1 
ATOM   4650  C  CG    . PRO C 2 144  ? 120.181 160.208 114.049 1.00 278.22 ? 144  PRO C CG    1 
ATOM   4651  C  CD    . PRO C 2 144  ? 118.930 159.594 114.586 1.00 278.22 ? 144  PRO C CD    1 
ATOM   4652  N  N     . GLY C 2 145  ? 119.384 163.752 116.554 1.00 280.59 ? 145  GLY C N     1 
ATOM   4653  C  CA    . GLY C 2 145  ? 118.655 164.972 116.792 1.00 280.59 ? 145  GLY C CA    1 
ATOM   4654  C  C     . GLY C 2 145  ? 119.116 165.642 118.060 1.00 280.59 ? 145  GLY C C     1 
ATOM   4655  O  O     . GLY C 2 145  ? 120.163 165.305 118.622 1.00 280.59 ? 145  GLY C O     1 
ATOM   4656  N  N     . VAL C 2 146  ? 118.320 166.605 118.502 1.00 278.90 ? 146  VAL C N     1 
ATOM   4657  C  CA    . VAL C 2 146  ? 118.611 167.404 119.683 1.00 278.90 ? 146  VAL C CA    1 
ATOM   4658  C  C     . VAL C 2 146  ? 117.897 166.783 120.870 1.00 278.90 ? 146  VAL C C     1 
ATOM   4659  O  O     . VAL C 2 146  ? 116.774 166.276 120.743 1.00 278.90 ? 146  VAL C O     1 
ATOM   4660  C  CB    . VAL C 2 146  ? 118.191 168.871 119.470 1.00 278.90 ? 146  VAL C CB    1 
ATOM   4661  C  CG1   . VAL C 2 146  ? 119.087 169.511 118.444 1.00 278.90 ? 146  VAL C CG1   1 
ATOM   4662  C  CG2   . VAL C 2 146  ? 116.746 168.969 118.996 1.00 278.90 ? 146  VAL C CG2   1 
ATOM   4663  N  N     . TYR C 2 147  ? 118.568 166.762 122.019 1.00 284.71 ? 147  TYR C N     1 
ATOM   4664  C  CA    . TYR C 2 147  ? 118.027 166.079 123.186 1.00 284.71 ? 147  TYR C CA    1 
ATOM   4665  C  C     . TYR C 2 147  ? 118.397 166.854 124.438 1.00 284.71 ? 147  TYR C C     1 
ATOM   4666  O  O     . TYR C 2 147  ? 119.545 167.271 124.603 1.00 284.71 ? 147  TYR C O     1 
ATOM   4667  C  CB    . TYR C 2 147  ? 118.536 164.633 123.265 1.00 284.71 ? 147  TYR C CB    1 
ATOM   4668  C  CG    . TYR C 2 147  ? 118.108 163.806 122.078 1.00 284.71 ? 147  TYR C CG    1 
ATOM   4669  C  CD1   . TYR C 2 147  ? 118.986 163.550 121.031 1.00 284.71 ? 147  TYR C CD1   1 
ATOM   4670  C  CD2   . TYR C 2 147  ? 116.805 163.347 121.970 1.00 284.71 ? 147  TYR C CD2   1 
ATOM   4671  C  CE1   . TYR C 2 147  ? 118.585 162.823 119.929 1.00 284.71 ? 147  TYR C CE1   1 
ATOM   4672  C  CE2   . TYR C 2 147  ? 116.397 162.621 120.873 1.00 284.71 ? 147  TYR C CE2   1 
ATOM   4673  C  CZ    . TYR C 2 147  ? 117.288 162.365 119.859 1.00 284.71 ? 147  TYR C CZ    1 
ATOM   4674  O  OH    . TYR C 2 147  ? 116.866 161.644 118.775 1.00 284.71 ? 147  TYR C OH    1 
ATOM   4675  N  N     . PHE C 2 148  ? 117.415 167.050 125.306 1.00 279.44 ? 148  PHE C N     1 
ATOM   4676  C  CA    . PHE C 2 148  ? 117.600 167.752 126.562 1.00 279.44 ? 148  PHE C CA    1 
ATOM   4677  C  C     . PHE C 2 148  ? 117.576 166.759 127.711 1.00 279.44 ? 148  PHE C C     1 
ATOM   4678  O  O     . PHE C 2 148  ? 116.760 165.834 127.726 1.00 279.44 ? 148  PHE C O     1 
ATOM   4679  C  CB    . PHE C 2 148  ? 116.506 168.795 126.772 1.00 279.44 ? 148  PHE C CB    1 
ATOM   4680  C  CG    . PHE C 2 148  ? 116.658 170.011 125.922 1.00 279.44 ? 148  PHE C CG    1 
ATOM   4681  C  CD1   . PHE C 2 148  ? 116.176 170.031 124.626 1.00 279.44 ? 148  PHE C CD1   1 
ATOM   4682  C  CD2   . PHE C 2 148  ? 117.273 171.145 126.425 1.00 279.44 ? 148  PHE C CD2   1 
ATOM   4683  C  CE1   . PHE C 2 148  ? 116.312 171.158 123.842 1.00 279.44 ? 148  PHE C CE1   1 
ATOM   4684  C  CE2   . PHE C 2 148  ? 117.413 172.279 125.648 1.00 279.44 ? 148  PHE C CE2   1 
ATOM   4685  C  CZ    . PHE C 2 148  ? 116.936 172.283 124.353 1.00 279.44 ? 148  PHE C CZ    1 
ATOM   4686  N  N     . THR C 2 149  ? 118.468 166.963 128.676 1.00 294.04 ? 149  THR C N     1 
ATOM   4687  C  CA    . THR C 2 149  ? 118.522 166.156 129.880 1.00 294.04 ? 149  THR C CA    1 
ATOM   4688  C  C     . THR C 2 149  ? 119.061 166.993 131.031 1.00 294.04 ? 149  THR C C     1 
ATOM   4689  O  O     . THR C 2 149  ? 120.002 167.771 130.842 1.00 294.04 ? 149  THR C O     1 
ATOM   4690  C  CB    . THR C 2 149  ? 119.380 164.896 129.681 1.00 294.04 ? 149  THR C CB    1 
ATOM   4691  O  OG1   . THR C 2 149  ? 119.583 164.241 130.938 1.00 294.04 ? 149  THR C OG1   1 
ATOM   4692  C  CG2   . THR C 2 149  ? 120.707 165.202 129.019 1.00 294.04 ? 149  THR C CG2   1 
ATOM   4693  N  N     . PRO C 2 150  ? 118.475 166.878 132.222 1.00 301.54 ? 150  PRO C N     1 
ATOM   4694  C  CA    . PRO C 2 150  ? 118.901 167.741 133.328 1.00 301.54 ? 150  PRO C CA    1 
ATOM   4695  C  C     . PRO C 2 150  ? 120.249 167.296 133.866 1.00 301.54 ? 150  PRO C C     1 
ATOM   4696  O  O     . PRO C 2 150  ? 120.536 166.101 133.947 1.00 301.54 ? 150  PRO C O     1 
ATOM   4697  C  CB    . PRO C 2 150  ? 117.795 167.562 134.375 1.00 301.54 ? 150  PRO C CB    1 
ATOM   4698  C  CG    . PRO C 2 150  ? 116.724 166.784 133.703 1.00 301.54 ? 150  PRO C CG    1 
ATOM   4699  C  CD    . PRO C 2 150  ? 117.386 165.988 132.638 1.00 301.54 ? 150  PRO C CD    1 
ATOM   4700  N  N     . ASP C 2 151  ? 121.075 168.269 134.208 1.00 321.57 ? 151  ASP C N     1 
ATOM   4701  C  CA    . ASP C 2 151  ? 122.368 167.991 134.800 1.00 321.57 ? 151  ASP C CA    1 
ATOM   4702  C  C     . ASP C 2 151  ? 122.173 167.403 136.191 1.00 321.57 ? 151  ASP C C     1 
ATOM   4703  O  O     . ASP C 2 151  ? 121.465 168.003 137.011 1.00 321.57 ? 151  ASP C O     1 
ATOM   4704  C  CB    . ASP C 2 151  ? 123.193 169.268 134.871 1.00 321.57 ? 151  ASP C CB    1 
ATOM   4705  C  CG    . ASP C 2 151  ? 124.669 168.995 135.018 1.00 321.57 ? 151  ASP C CG    1 
ATOM   4706  O  OD1   . ASP C 2 151  ? 125.105 167.866 134.713 1.00 321.57 ? 151  ASP C OD1   1 
ATOM   4707  O  OD2   . ASP C 2 151  ? 125.399 169.909 135.441 1.00 321.57 ? 151  ASP C OD2   1 
ATOM   4708  N  N     . PRO C 2 152  ? 122.720 166.225 136.482 1.00 297.37 ? 152  PRO C N     1 
ATOM   4709  C  CA    . PRO C 2 152  ? 122.559 165.651 137.826 1.00 297.37 ? 152  PRO C CA    1 
ATOM   4710  C  C     . PRO C 2 152  ? 123.301 166.415 138.916 1.00 297.37 ? 152  PRO C C     1 
ATOM   4711  O  O     . PRO C 2 152  ? 122.710 166.754 139.946 1.00 297.37 ? 152  PRO C O     1 
ATOM   4712  C  CB    . PRO C 2 152  ? 123.110 164.227 137.667 1.00 297.37 ? 152  PRO C CB    1 
ATOM   4713  C  CG    . PRO C 2 152  ? 123.939 164.257 136.427 1.00 297.37 ? 152  PRO C CG    1 
ATOM   4714  C  CD    . PRO C 2 152  ? 123.308 165.265 135.535 1.00 297.37 ? 152  PRO C CD    1 
ATOM   4715  N  N     . ALA C 2 153  ? 124.590 166.692 138.696 1.00 311.97 ? 153  ALA C N     1 
ATOM   4716  C  CA    . ALA C 2 153  ? 125.401 167.341 139.723 1.00 311.97 ? 153  ALA C CA    1 
ATOM   4717  C  C     . ALA C 2 153  ? 124.994 168.793 139.913 1.00 311.97 ? 153  ALA C C     1 
ATOM   4718  O  O     . ALA C 2 153  ? 125.138 169.350 141.007 1.00 311.97 ? 153  ALA C O     1 
ATOM   4719  C  CB    . ALA C 2 153  ? 126.881 167.245 139.362 1.00 311.97 ? 153  ALA C CB    1 
ATOM   4720  N  N     . ARG C 2 154  ? 124.500 169.421 138.865 1.00 327.90 ? 154  ARG C N     1 
ATOM   4721  C  CA    . ARG C 2 154  ? 123.892 170.731 139.002 1.00 327.90 ? 154  ARG C CA    1 
ATOM   4722  C  C     . ARG C 2 154  ? 122.415 170.572 138.695 1.00 327.90 ? 154  ARG C C     1 
ATOM   4723  O  O     . ARG C 2 154  ? 122.003 170.757 137.543 1.00 327.90 ? 154  ARG C O     1 
ATOM   4724  C  CB    . ARG C 2 154  ? 124.542 171.741 138.065 1.00 327.90 ? 154  ARG C CB    1 
ATOM   4725  C  CG    . ARG C 2 154  ? 126.011 171.941 138.344 1.00 327.90 ? 154  ARG C CG    1 
ATOM   4726  C  CD    . ARG C 2 154  ? 126.750 172.428 137.107 1.00 327.90 ? 154  ARG C CD    1 
ATOM   4727  N  NE    . ARG C 2 154  ? 126.114 173.594 136.498 1.00 327.90 ? 154  ARG C NE    1 
ATOM   4728  C  CZ    . ARG C 2 154  ? 126.270 174.842 136.928 1.00 327.90 ? 154  ARG C CZ    1 
ATOM   4729  N  NH1   . ARG C 2 154  ? 127.038 175.093 137.977 1.00 327.90 ? 154  ARG C NH1   1 
ATOM   4730  N  NH2   . ARG C 2 154  ? 125.655 175.840 136.310 1.00 327.90 ? 154  ARG C NH2   1 
ATOM   4731  N  N     . PRO C 2 155  ? 121.594 170.246 139.697 1.00 307.10 ? 155  PRO C N     1 
ATOM   4732  C  CA    . PRO C 2 155  ? 120.200 169.862 139.423 1.00 307.10 ? 155  PRO C CA    1 
ATOM   4733  C  C     . PRO C 2 155  ? 119.325 170.991 138.909 1.00 307.10 ? 155  PRO C C     1 
ATOM   4734  O  O     . PRO C 2 155  ? 118.217 170.723 138.432 1.00 307.10 ? 155  PRO C O     1 
ATOM   4735  C  CB    . PRO C 2 155  ? 119.708 169.347 140.783 1.00 307.10 ? 155  PRO C CB    1 
ATOM   4736  C  CG    . PRO C 2 155  ? 120.951 169.062 141.561 1.00 307.10 ? 155  PRO C CG    1 
ATOM   4737  C  CD    . PRO C 2 155  ? 121.930 170.087 141.118 1.00 307.10 ? 155  PRO C CD    1 
ATOM   4738  N  N     . GLY C 2 156  ? 119.781 172.234 138.979 1.00 306.21 ? 156  GLY C N     1 
ATOM   4739  C  CA    . GLY C 2 156  ? 119.078 173.297 138.305 1.00 306.21 ? 156  GLY C CA    1 
ATOM   4740  C  C     . GLY C 2 156  ? 119.412 173.460 136.844 1.00 306.21 ? 156  GLY C C     1 
ATOM   4741  O  O     . GLY C 2 156  ? 118.836 174.326 136.182 1.00 306.21 ? 156  GLY C O     1 
ATOM   4742  N  N     . ARG C 2 157  ? 120.322 172.660 136.307 1.00 311.63 ? 157  ARG C N     1 
ATOM   4743  C  CA    . ARG C 2 157  ? 120.794 172.867 134.950 1.00 311.63 ? 157  ARG C CA    1 
ATOM   4744  C  C     . ARG C 2 157  ? 120.489 171.657 134.083 1.00 311.63 ? 157  ARG C C     1 
ATOM   4745  O  O     . ARG C 2 157  ? 120.129 170.583 134.566 1.00 311.63 ? 157  ARG C O     1 
ATOM   4746  C  CB    . ARG C 2 157  ? 122.287 173.193 134.936 1.00 311.63 ? 157  ARG C CB    1 
ATOM   4747  C  CG    . ARG C 2 157  ? 122.588 174.635 135.298 1.00 311.63 ? 157  ARG C CG    1 
ATOM   4748  C  CD    . ARG C 2 157  ? 121.614 175.597 134.618 1.00 311.63 ? 157  ARG C CD    1 
ATOM   4749  N  NE    . ARG C 2 157  ? 121.690 176.946 135.170 1.00 311.63 ? 157  ARG C NE    1 
ATOM   4750  C  CZ    . ARG C 2 157  ? 121.050 177.352 136.264 1.00 311.63 ? 157  ARG C CZ    1 
ATOM   4751  N  NH1   . ARG C 2 157  ? 120.273 176.516 136.937 1.00 311.63 ? 157  ARG C NH1   1 
ATOM   4752  N  NH2   . ARG C 2 157  ? 121.186 178.600 136.685 1.00 311.63 ? 157  ARG C NH2   1 
ATOM   4753  N  N     . TYR C 2 158  ? 120.632 171.859 132.776 1.00 296.01 ? 158  TYR C N     1 
ATOM   4754  C  CA    . TYR C 2 158  ? 120.173 170.903 131.785 1.00 296.01 ? 158  TYR C CA    1 
ATOM   4755  C  C     . TYR C 2 158  ? 121.205 170.791 130.678 1.00 296.01 ? 158  TYR C C     1 
ATOM   4756  O  O     . TYR C 2 158  ? 121.880 171.763 130.336 1.00 296.01 ? 158  TYR C O     1 
ATOM   4757  C  CB    . TYR C 2 158  ? 118.823 171.303 131.180 1.00 296.01 ? 158  TYR C CB    1 
ATOM   4758  C  CG    . TYR C 2 158  ? 117.807 171.723 132.205 1.00 296.01 ? 158  TYR C CG    1 
ATOM   4759  C  CD1   . TYR C 2 158  ? 116.996 170.786 132.821 1.00 296.01 ? 158  TYR C CD1   1 
ATOM   4760  C  CD2   . TYR C 2 158  ? 117.675 173.058 132.573 1.00 296.01 ? 158  TYR C CD2   1 
ATOM   4761  C  CE1   . TYR C 2 158  ? 116.079 171.161 133.763 1.00 296.01 ? 158  TYR C CE1   1 
ATOM   4762  C  CE2   . TYR C 2 158  ? 116.768 173.442 133.516 1.00 296.01 ? 158  TYR C CE2   1 
ATOM   4763  C  CZ    . TYR C 2 158  ? 115.968 172.492 134.105 1.00 296.01 ? 158  TYR C CZ    1 
ATOM   4764  O  OH    . TYR C 2 158  ? 115.050 172.880 135.046 1.00 296.01 ? 158  TYR C OH    1 
ATOM   4765  N  N     . ILE C 2 159  ? 121.294 169.601 130.102 1.00 296.66 ? 159  ILE C N     1 
ATOM   4766  C  CA    . ILE C 2 159  ? 122.297 169.289 129.098 1.00 296.66 ? 159  ILE C CA    1 
ATOM   4767  C  C     . ILE C 2 159  ? 121.579 169.153 127.767 1.00 296.66 ? 159  ILE C C     1 
ATOM   4768  O  O     . ILE C 2 159  ? 120.869 168.167 127.531 1.00 296.66 ? 159  ILE C O     1 
ATOM   4769  C  CB    . ILE C 2 159  ? 123.069 168.013 129.435 1.00 296.66 ? 159  ILE C CB    1 
ATOM   4770  C  CG1   . ILE C 2 159  ? 123.423 167.976 130.922 1.00 296.66 ? 159  ILE C CG1   1 
ATOM   4771  C  CG2   . ILE C 2 159  ? 124.314 167.926 128.577 1.00 296.66 ? 159  ILE C CG2   1 
ATOM   4772  C  CD1   . ILE C 2 159  ? 124.381 169.049 131.349 1.00 296.66 ? 159  ILE C CD1   1 
ATOM   4773  N  N     . ALA C 2 160  ? 121.754 170.141 126.899 1.00 305.63 ? 160  ALA C N     1 
ATOM   4774  C  CA    . ALA C 2 160  ? 121.186 170.085 125.557 1.00 305.63 ? 160  ALA C CA    1 
ATOM   4775  C  C     . ALA C 2 160  ? 122.159 169.317 124.678 1.00 305.63 ? 160  ALA C C     1 
ATOM   4776  O  O     . ALA C 2 160  ? 123.147 169.869 124.192 1.00 305.63 ? 160  ALA C O     1 
ATOM   4777  C  CB    . ALA C 2 160  ? 120.925 171.484 125.018 1.00 305.63 ? 160  ALA C CB    1 
ATOM   4778  N  N     . SER C 2 161  ? 121.885 168.036 124.481 1.00 299.32 ? 161  SER C N     1 
ATOM   4779  C  CA    . SER C 2 161  ? 122.752 167.169 123.703 1.00 299.32 ? 161  SER C CA    1 
ATOM   4780  C  C     . SER C 2 161  ? 122.211 167.022 122.291 1.00 299.32 ? 161  SER C C     1 
ATOM   4781  O  O     . SER C 2 161  ? 121.006 166.862 122.087 1.00 299.32 ? 161  SER C O     1 
ATOM   4782  C  CB    . SER C 2 161  ? 122.865 165.796 124.356 1.00 299.32 ? 161  SER C CB    1 
ATOM   4783  O  OG    . SER C 2 161  ? 121.670 165.065 124.163 1.00 299.32 ? 161  SER C OG    1 
ATOM   4784  N  N     . ILE C 2 162  ? 123.108 167.087 121.315 1.00 306.80 ? 162  ILE C N     1 
ATOM   4785  C  CA    . ILE C 2 162  ? 122.746 166.895 119.920 1.00 306.80 ? 162  ILE C CA    1 
ATOM   4786  C  C     . ILE C 2 162  ? 123.503 165.697 119.390 1.00 306.80 ? 162  ILE C C     1 
ATOM   4787  O  O     . ILE C 2 162  ? 124.731 165.621 119.505 1.00 306.80 ? 162  ILE C O     1 
ATOM   4788  C  CB    . ILE C 2 162  ? 123.054 168.132 119.064 1.00 306.80 ? 162  ILE C CB    1 
ATOM   4789  C  CG1   . ILE C 2 162  ? 122.542 169.392 119.756 1.00 306.80 ? 162  ILE C CG1   1 
ATOM   4790  C  CG2   . ILE C 2 162  ? 122.450 167.964 117.693 1.00 306.80 ? 162  ILE C CG2   1 
ATOM   4791  C  CD1   . ILE C 2 162  ? 122.874 170.659 119.024 1.00 306.80 ? 162  ILE C CD1   1 
ATOM   4792  N  N     . ILE C 2 163  ? 122.769 164.753 118.819 1.00 280.14 ? 163  ILE C N     1 
ATOM   4793  C  CA    . ILE C 2 163  ? 123.393 163.583 118.220 1.00 280.14 ? 163  ILE C CA    1 
ATOM   4794  C  C     . ILE C 2 163  ? 123.085 163.585 116.730 1.00 280.14 ? 163  ILE C C     1 
ATOM   4795  O  O     . ILE C 2 163  ? 121.922 163.731 116.340 1.00 280.14 ? 163  ILE C O     1 
ATOM   4796  C  CB    . ILE C 2 163  ? 122.911 162.286 118.880 1.00 280.14 ? 163  ILE C CB    1 
ATOM   4797  C  CG1   . ILE C 2 163  ? 122.839 162.451 120.396 1.00 280.14 ? 163  ILE C CG1   1 
ATOM   4798  C  CG2   . ILE C 2 163  ? 123.857 161.154 118.538 1.00 280.14 ? 163  ILE C CG2   1 
ATOM   4799  C  CD1   . ILE C 2 163  ? 122.259 161.262 121.103 1.00 280.14 ? 163  ILE C CD1   1 
ATOM   4800  N  N     . PRO C 2 164  ? 124.086 163.480 115.880 1.00 301.26 ? 164  PRO C N     1 
ATOM   4801  C  CA    . PRO C 2 164  ? 123.845 163.248 114.457 1.00 301.26 ? 164  PRO C CA    1 
ATOM   4802  C  C     . PRO C 2 164  ? 123.714 161.767 114.174 1.00 301.26 ? 164  PRO C C     1 
ATOM   4803  O  O     . PRO C 2 164  ? 123.570 160.963 115.100 1.00 301.26 ? 164  PRO C O     1 
ATOM   4804  C  CB    . PRO C 2 164  ? 125.098 163.826 113.806 1.00 301.26 ? 164  PRO C CB    1 
ATOM   4805  C  CG    . PRO C 2 164  ? 126.159 163.494 114.795 1.00 301.26 ? 164  PRO C CG    1 
ATOM   4806  C  CD    . PRO C 2 164  ? 125.524 163.487 116.174 1.00 301.26 ? 164  PRO C CD    1 
ATOM   4807  N  N     . LEU C 2 165  ? 123.727 161.407 112.901 1.00 297.99 ? 165  LEU C N     1 
ATOM   4808  C  CA    . LEU C 2 165  ? 123.934 160.018 112.527 1.00 297.99 ? 165  LEU C CA    1 
ATOM   4809  C  C     . LEU C 2 165  ? 125.306 159.547 113.008 1.00 297.99 ? 165  LEU C C     1 
ATOM   4810  O  O     . LEU C 2 165  ? 126.246 160.349 113.073 1.00 297.99 ? 165  LEU C O     1 
ATOM   4811  C  CB    . LEU C 2 165  ? 123.831 159.864 111.011 1.00 297.99 ? 165  LEU C CB    1 
ATOM   4812  C  CG    . LEU C 2 165  ? 122.424 159.875 110.443 1.00 297.99 ? 165  LEU C CG    1 
ATOM   4813  C  CD1   . LEU C 2 165  ? 122.473 159.849 108.932 1.00 297.99 ? 165  LEU C CD1   1 
ATOM   4814  C  CD2   . LEU C 2 165  ? 121.661 158.684 110.976 1.00 297.99 ? 165  LEU C CD2   1 
ATOM   4815  N  N     . PRO C 2 166  ? 125.454 158.271 113.371 1.00 270.53 ? 166  PRO C N     1 
ATOM   4816  C  CA    . PRO C 2 166  ? 126.754 157.786 113.842 1.00 270.53 ? 166  PRO C CA    1 
ATOM   4817  C  C     . PRO C 2 166  ? 127.764 157.745 112.710 1.00 270.53 ? 166  PRO C C     1 
ATOM   4818  O  O     . PRO C 2 166  ? 127.419 157.501 111.553 1.00 270.53 ? 166  PRO C O     1 
ATOM   4819  C  CB    . PRO C 2 166  ? 126.445 156.379 114.364 1.00 270.53 ? 166  PRO C CB    1 
ATOM   4820  C  CG    . PRO C 2 166  ? 124.967 156.343 114.537 1.00 270.53 ? 166  PRO C CG    1 
ATOM   4821  C  CD    . PRO C 2 166  ? 124.420 157.233 113.477 1.00 270.53 ? 166  PRO C CD    1 
ATOM   4822  N  N     . LYS C 2 167  ? 129.014 158.040 113.064 1.00 263.85 ? 167  LYS C N     1 
ATOM   4823  C  CA    . LYS C 2 167  ? 130.128 158.298 112.154 1.00 263.85 ? 167  LYS C CA    1 
ATOM   4824  C  C     . LYS C 2 167  ? 129.815 159.381 111.133 1.00 263.85 ? 167  LYS C C     1 
ATOM   4825  O  O     . LYS C 2 167  ? 130.389 159.381 110.041 1.00 263.85 ? 167  LYS C O     1 
ATOM   4826  C  CB    . LYS C 2 167  ? 130.591 157.023 111.443 1.00 263.85 ? 167  LYS C CB    1 
ATOM   4827  C  CG    . LYS C 2 167  ? 131.476 156.156 112.303 1.00 263.85 ? 167  LYS C CG    1 
ATOM   4828  C  CD    . LYS C 2 167  ? 132.647 156.956 112.843 1.00 263.85 ? 167  LYS C CD    1 
ATOM   4829  C  CE    . LYS C 2 167  ? 133.305 156.250 114.006 1.00 263.85 ? 167  LYS C CE    1 
ATOM   4830  N  NZ    . LYS C 2 167  ? 134.191 157.170 114.767 1.00 263.85 ? 167  LYS C NZ    1 
ATOM   4831  N  N     . ARG C 2 168  ? 128.908 160.298 111.459 1.00 322.88 ? 168  ARG C N     1 
ATOM   4832  C  CA    . ARG C 2 168  ? 128.495 161.385 110.586 1.00 322.88 ? 168  ARG C CA    1 
ATOM   4833  C  C     . ARG C 2 168  ? 128.497 162.698 111.350 1.00 322.88 ? 168  ARG C C     1 
ATOM   4834  O  O     . ARG C 2 168  ? 127.690 163.585 111.079 1.00 322.88 ? 168  ARG C O     1 
ATOM   4835  C  CB    . ARG C 2 168  ? 127.114 161.118 109.994 1.00 322.88 ? 168  ARG C CB    1 
ATOM   4836  C  CG    . ARG C 2 168  ? 127.020 159.863 109.149 1.00 322.88 ? 168  ARG C CG    1 
ATOM   4837  C  CD    . ARG C 2 168  ? 127.887 159.983 107.918 1.00 322.88 ? 168  ARG C CD    1 
ATOM   4838  N  NE    . ARG C 2 168  ? 127.557 161.173 107.143 1.00 322.88 ? 168  ARG C NE    1 
ATOM   4839  C  CZ    . ARG C 2 168  ? 128.394 162.183 106.936 1.00 322.88 ? 168  ARG C CZ    1 
ATOM   4840  N  NH1   . ARG C 2 168  ? 129.613 162.146 107.452 1.00 322.88 ? 168  ARG C NH1   1 
ATOM   4841  N  NH2   . ARG C 2 168  ? 128.008 163.226 106.219 1.00 322.88 ? 168  ARG C NH2   1 
ATOM   4842  N  N     . GLY C 2 169  ? 129.383 162.813 112.332 1.00 304.42 ? 169  GLY C N     1 
ATOM   4843  C  CA    . GLY C 2 169  ? 129.457 163.992 113.152 1.00 304.42 ? 169  GLY C CA    1 
ATOM   4844  C  C     . GLY C 2 169  ? 129.666 163.672 114.616 1.00 304.42 ? 169  GLY C C     1 
ATOM   4845  O  O     . GLY C 2 169  ? 129.356 162.575 115.091 1.00 304.42 ? 169  GLY C O     1 
ATOM   4846  N  N     . PRO C 2 170  ? 130.197 164.631 115.361 1.00 287.90 ? 170  PRO C N     1 
ATOM   4847  C  CA    . PRO C 2 170  ? 130.446 164.400 116.785 1.00 287.90 ? 170  PRO C CA    1 
ATOM   4848  C  C     . PRO C 2 170  ? 129.210 164.652 117.623 1.00 287.90 ? 170  PRO C C     1 
ATOM   4849  O  O     . PRO C 2 170  ? 128.172 165.048 117.094 1.00 287.90 ? 170  PRO C O     1 
ATOM   4850  C  CB    . PRO C 2 170  ? 131.550 165.407 117.101 1.00 287.90 ? 170  PRO C CB    1 
ATOM   4851  C  CG    . PRO C 2 170  ? 131.235 166.558 116.201 1.00 287.90 ? 170  PRO C CG    1 
ATOM   4852  C  CD    . PRO C 2 170  ? 130.651 165.968 114.937 1.00 287.90 ? 170  PRO C CD    1 
ATOM   4853  N  N     . TRP C 2 171  ? 129.311 164.449 118.928 1.00 308.43 ? 171  TRP C N     1 
ATOM   4854  C  CA    . TRP C 2 171  ? 128.189 164.652 119.833 1.00 308.43 ? 171  TRP C CA    1 
ATOM   4855  C  C     . TRP C 2 171  ? 128.287 166.050 120.420 1.00 308.43 ? 171  TRP C C     1 
ATOM   4856  O  O     . TRP C 2 171  ? 129.240 166.359 121.141 1.00 308.43 ? 171  TRP C O     1 
ATOM   4857  C  CB    . TRP C 2 171  ? 128.185 163.604 120.940 1.00 308.43 ? 171  TRP C CB    1 
ATOM   4858  C  CG    . TRP C 2 171  ? 127.798 162.253 120.468 1.00 308.43 ? 171  TRP C CG    1 
ATOM   4859  C  CD1   . TRP C 2 171  ? 127.583 161.856 119.178 1.00 308.43 ? 171  TRP C CD1   1 
ATOM   4860  C  CD2   . TRP C 2 171  ? 127.569 161.109 121.283 1.00 308.43 ? 171  TRP C CD2   1 
ATOM   4861  N  NE1   . TRP C 2 171  ? 127.241 160.531 119.144 1.00 308.43 ? 171  TRP C NE1   1 
ATOM   4862  C  CE2   . TRP C 2 171  ? 127.223 160.048 120.425 1.00 308.43 ? 171  TRP C CE2   1 
ATOM   4863  C  CE3   . TRP C 2 171  ? 127.625 160.875 122.659 1.00 308.43 ? 171  TRP C CE3   1 
ATOM   4864  C  CZ2   . TRP C 2 171  ? 126.935 158.774 120.899 1.00 308.43 ? 171  TRP C CZ2   1 
ATOM   4865  C  CZ3   . TRP C 2 171  ? 127.337 159.612 123.127 1.00 308.43 ? 171  TRP C CZ3   1 
ATOM   4866  C  CH2   . TRP C 2 171  ? 126.997 158.576 122.252 1.00 308.43 ? 171  TRP C CH2   1 
ATOM   4867  N  N     . ILE C 2 172  ? 127.305 166.886 120.116 1.00 313.78 ? 172  ILE C N     1 
ATOM   4868  C  CA    . ILE C 2 172  ? 127.326 168.292 120.496 1.00 313.78 ? 172  ILE C CA    1 
ATOM   4869  C  C     . ILE C 2 172  ? 126.413 168.460 121.698 1.00 313.78 ? 172  ILE C C     1 
ATOM   4870  O  O     . ILE C 2 172  ? 125.203 168.240 121.609 1.00 313.78 ? 172  ILE C O     1 
ATOM   4871  C  CB    . ILE C 2 172  ? 126.895 169.193 119.338 1.00 313.78 ? 172  ILE C CB    1 
ATOM   4872  C  CG1   . ILE C 2 172  ? 127.768 168.926 118.114 1.00 313.78 ? 172  ILE C CG1   1 
ATOM   4873  C  CG2   . ILE C 2 172  ? 127.016 170.633 119.745 1.00 313.78 ? 172  ILE C CG2   1 
ATOM   4874  C  CD1   . ILE C 2 172  ? 127.061 168.178 117.008 1.00 313.78 ? 172  ILE C CD1   1 
ATOM   4875  N  N     . ASP C 2 173  ? 126.990 168.848 122.831 1.00 319.70 ? 173  ASP C N     1 
ATOM   4876  C  CA    . ASP C 2 173  ? 126.292 168.822 124.110 1.00 319.70 ? 173  ASP C CA    1 
ATOM   4877  C  C     . ASP C 2 173  ? 126.432 170.179 124.778 1.00 319.70 ? 173  ASP C C     1 
ATOM   4878  O  O     . ASP C 2 173  ? 127.543 170.706 124.888 1.00 319.70 ? 173  ASP C O     1 
ATOM   4879  C  CB    . ASP C 2 173  ? 126.855 167.705 124.986 1.00 319.70 ? 173  ASP C CB    1 
ATOM   4880  C  CG    . ASP C 2 173  ? 127.107 166.434 124.197 1.00 319.70 ? 173  ASP C CG    1 
ATOM   4881  O  OD1   . ASP C 2 173  ? 126.159 165.942 123.551 1.00 319.70 ? 173  ASP C OD1   1 
ATOM   4882  O  OD2   . ASP C 2 173  ? 128.258 165.953 124.182 1.00 319.70 ? 173  ASP C OD2   1 
ATOM   4883  N  N     . LEU C 2 174  ? 125.310 170.740 125.229 1.00 331.02 ? 174  LEU C N     1 
ATOM   4884  C  CA    . LEU C 2 174  ? 125.241 172.140 125.626 1.00 331.02 ? 174  LEU C CA    1 
ATOM   4885  C  C     . LEU C 2 174  ? 124.725 172.302 127.047 1.00 331.02 ? 174  LEU C C     1 
ATOM   4886  O  O     . LEU C 2 174  ? 123.719 171.698 127.424 1.00 331.02 ? 174  LEU C O     1 
ATOM   4887  C  CB    . LEU C 2 174  ? 124.337 172.928 124.684 1.00 331.02 ? 174  LEU C CB    1 
ATOM   4888  C  CG    . LEU C 2 174  ? 124.999 173.639 123.511 1.00 331.02 ? 174  LEU C CG    1 
ATOM   4889  C  CD1   . LEU C 2 174  ? 125.392 172.656 122.426 1.00 331.02 ? 174  LEU C CD1   1 
ATOM   4890  C  CD2   . LEU C 2 174  ? 124.060 174.698 122.964 1.00 331.02 ? 174  LEU C CD2   1 
ATOM   4891  N  N     . GLU C 2 175  ? 125.399 173.163 127.808 1.00 360.33 ? 175  GLU C N     1 
ATOM   4892  C  CA    . GLU C 2 175  ? 124.991 173.560 129.149 1.00 360.33 ? 175  GLU C CA    1 
ATOM   4893  C  C     . GLU C 2 175  ? 125.710 174.854 129.501 1.00 360.33 ? 175  GLU C C     1 
ATOM   4894  O  O     . GLU C 2 175  ? 126.859 175.062 129.110 1.00 360.33 ? 175  GLU C O     1 
ATOM   4895  C  CB    . GLU C 2 175  ? 125.315 172.481 130.189 1.00 360.33 ? 175  GLU C CB    1 
ATOM   4896  C  CG    . GLU C 2 175  ? 124.735 172.740 131.572 1.00 360.33 ? 175  GLU C CG    1 
ATOM   4897  C  CD    . GLU C 2 175  ? 125.585 172.146 132.668 1.00 360.33 ? 175  GLU C CD    1 
ATOM   4898  O  OE1   . GLU C 2 175  ? 126.584 171.474 132.342 1.00 360.33 ? 175  GLU C OE1   1 
ATOM   4899  O  OE2   . GLU C 2 175  ? 125.268 172.364 133.854 1.00 360.33 ? 175  GLU C OE2   1 
ATOM   4900  N  N     . VAL C 2 176  ? 125.028 175.721 130.236 1.00 394.93 ? 176  VAL C N     1 
ATOM   4901  C  CA    . VAL C 2 176  ? 125.660 176.935 130.732 1.00 394.93 ? 176  VAL C CA    1 
ATOM   4902  C  C     . VAL C 2 176  ? 126.540 176.592 131.931 1.00 394.93 ? 176  VAL C C     1 
ATOM   4903  O  O     . VAL C 2 176  ? 126.160 175.814 132.816 1.00 394.93 ? 176  VAL C O     1 
ATOM   4904  C  CB    . VAL C 2 176  ? 124.594 178.008 131.046 1.00 394.93 ? 176  VAL C CB    1 
ATOM   4905  C  CG1   . VAL C 2 176  ? 123.557 177.515 132.051 1.00 394.93 ? 176  VAL C CG1   1 
ATOM   4906  C  CG2   . VAL C 2 176  ? 125.242 179.303 131.520 1.00 394.93 ? 176  VAL C CG2   1 
ATOM   4907  N  N     . GLU C 2 177  ? 127.763 177.110 131.915 1.00 389.65 ? 177  GLU C N     1 
ATOM   4908  C  CA    . GLU C 2 177  ? 128.689 176.945 133.020 1.00 389.65 ? 177  GLU C CA    1 
ATOM   4909  C  C     . GLU C 2 177  ? 128.316 177.922 134.135 1.00 389.65 ? 177  GLU C C     1 
ATOM   4910  O  O     . GLU C 2 177  ? 127.616 178.907 133.883 1.00 389.65 ? 177  GLU C O     1 
ATOM   4911  C  CB    . GLU C 2 177  ? 130.118 177.175 132.525 1.00 389.65 ? 177  GLU C CB    1 
ATOM   4912  C  CG    . GLU C 2 177  ? 130.437 176.542 131.183 1.00 389.65 ? 177  GLU C CG    1 
ATOM   4913  C  CD    . GLU C 2 177  ? 131.656 177.171 130.543 1.00 389.65 ? 177  GLU C CD    1 
ATOM   4914  O  OE1   . GLU C 2 177  ? 132.453 177.780 131.282 1.00 389.65 ? 177  GLU C OE1   1 
ATOM   4915  O  OE2   . GLU C 2 177  ? 131.819 177.081 129.311 1.00 389.65 ? 177  GLU C OE2   1 
ATOM   4916  N  N     . PRO C 2 178  ? 128.740 177.654 135.387 1.00 351.79 ? 178  PRO C N     1 
ATOM   4917  C  CA    . PRO C 2 178  ? 128.327 178.526 136.510 1.00 351.79 ? 178  PRO C CA    1 
ATOM   4918  C  C     . PRO C 2 178  ? 128.777 179.975 136.416 1.00 351.79 ? 178  PRO C C     1 
ATOM   4919  O  O     . PRO C 2 178  ? 128.172 180.836 137.065 1.00 351.79 ? 178  PRO C O     1 
ATOM   4920  C  CB    . PRO C 2 178  ? 128.957 177.840 137.733 1.00 351.79 ? 178  PRO C CB    1 
ATOM   4921  C  CG    . PRO C 2 178  ? 129.913 176.834 137.185 1.00 351.79 ? 178  PRO C CG    1 
ATOM   4922  C  CD    . PRO C 2 178  ? 129.331 176.405 135.895 1.00 351.79 ? 178  PRO C CD    1 
ATOM   4923  N  N     . ASN C 2 179  ? 129.816 180.269 135.632 1.00 390.18 ? 179  ASN C N     1 
ATOM   4924  C  CA    . ASN C 2 179  ? 130.173 181.657 135.362 1.00 390.18 ? 179  ASN C CA    1 
ATOM   4925  C  C     . ASN C 2 179  ? 129.103 182.372 134.556 1.00 390.18 ? 179  ASN C C     1 
ATOM   4926  O  O     . ASN C 2 179  ? 128.971 183.596 134.655 1.00 390.18 ? 179  ASN C O     1 
ATOM   4927  C  CB    . ASN C 2 179  ? 131.499 181.725 134.607 1.00 390.18 ? 179  ASN C CB    1 
ATOM   4928  C  CG    . ASN C 2 179  ? 131.570 180.739 133.450 1.00 390.18 ? 179  ASN C CG    1 
ATOM   4929  O  OD1   . ASN C 2 179  ? 130.555 180.364 132.865 1.00 390.18 ? 179  ASN C OD1   1 
ATOM   4930  N  ND2   . ASN C 2 179  ? 132.780 180.322 133.112 1.00 390.18 ? 179  ASN C ND2   1 
ATOM   4931  N  N     . GLY C 2 180  ? 128.356 181.632 133.746 1.00 400.89 ? 180  GLY C N     1 
ATOM   4932  C  CA    . GLY C 2 180  ? 127.360 182.197 132.876 1.00 400.89 ? 180  GLY C CA    1 
ATOM   4933  C  C     . GLY C 2 180  ? 127.652 182.028 131.404 1.00 400.89 ? 180  GLY C C     1 
ATOM   4934  O  O     . GLY C 2 180  ? 126.742 182.213 130.590 1.00 400.89 ? 180  GLY C O     1 
ATOM   4935  N  N     . VAL C 2 181  ? 128.888 181.694 131.034 1.00 389.97 ? 181  VAL C N     1 
ATOM   4936  C  CA    . VAL C 2 181  ? 129.181 181.385 129.640 1.00 389.97 ? 181  VAL C CA    1 
ATOM   4937  C  C     . VAL C 2 181  ? 128.811 179.918 129.462 1.00 389.97 ? 181  VAL C C     1 
ATOM   4938  O  O     . VAL C 2 181  ? 128.638 179.194 130.446 1.00 389.97 ? 181  VAL C O     1 
ATOM   4939  C  CB    . VAL C 2 181  ? 130.649 181.681 129.268 1.00 389.97 ? 181  VAL C CB    1 
ATOM   4940  C  CG1   . VAL C 2 181  ? 131.580 180.602 129.764 1.00 389.97 ? 181  VAL C CG1   1 
ATOM   4941  C  CG2   . VAL C 2 181  ? 130.817 181.922 127.765 1.00 389.97 ? 181  VAL C CG2   1 
ATOM   4942  N  N     . VAL C 2 182  ? 128.650 179.477 128.223 1.00 361.74 ? 182  VAL C N     1 
ATOM   4943  C  CA    . VAL C 2 182  ? 128.070 178.173 127.930 1.00 361.74 ? 182  VAL C CA    1 
ATOM   4944  C  C     . VAL C 2 182  ? 129.174 177.171 127.597 1.00 361.74 ? 182  VAL C C     1 
ATOM   4945  O  O     . VAL C 2 182  ? 130.152 177.497 126.912 1.00 361.74 ? 182  VAL C O     1 
ATOM   4946  C  CB    . VAL C 2 182  ? 127.023 178.297 126.804 1.00 361.74 ? 182  VAL C CB    1 
ATOM   4947  C  CG1   . VAL C 2 182  ? 127.608 178.956 125.577 1.00 361.74 ? 182  VAL C CG1   1 
ATOM   4948  C  CG2   . VAL C 2 182  ? 126.403 176.952 126.439 1.00 361.74 ? 182  VAL C CG2   1 
ATOM   4949  N  N     . SER C 2 183  ? 129.046 175.963 128.144 1.00 351.37 ? 183  SER C N     1 
ATOM   4950  C  CA    . SER C 2 183  ? 129.948 174.865 127.827 1.00 351.37 ? 183  SER C CA    1 
ATOM   4951  C  C     . SER C 2 183  ? 129.661 174.360 126.423 1.00 351.37 ? 183  SER C C     1 
ATOM   4952  O  O     . SER C 2 183  ? 128.531 173.973 126.110 1.00 351.37 ? 183  SER C O     1 
ATOM   4953  C  CB    . SER C 2 183  ? 129.799 173.736 128.840 1.00 351.37 ? 183  SER C CB    1 
ATOM   4954  O  OG    . SER C 2 183  ? 130.817 172.774 128.667 1.00 351.37 ? 183  SER C OG    1 
ATOM   4955  N  N     . MET C 2 184  ? 130.680 174.374 125.581 1.00 342.37 ? 184  MET C N     1 
ATOM   4956  C  CA    . MET C 2 184  ? 130.674 173.655 124.315 1.00 342.37 ? 184  MET C CA    1 
ATOM   4957  C  C     . MET C 2 184  ? 131.742 172.582 124.459 1.00 342.37 ? 184  MET C C     1 
ATOM   4958  O  O     . MET C 2 184  ? 132.934 172.871 124.361 1.00 342.37 ? 184  MET C O     1 
ATOM   4959  C  CB    . MET C 2 184  ? 130.959 174.590 123.143 1.00 342.37 ? 184  MET C CB    1 
ATOM   4960  C  CG    . MET C 2 184  ? 130.476 174.067 121.800 1.00 342.37 ? 184  MET C CG    1 
ATOM   4961  S  SD    . MET C 2 184  ? 130.660 175.272 120.467 1.00 342.37 ? 184  MET C SD    1 
ATOM   4962  C  CE    . MET C 2 184  ? 129.423 174.718 119.295 1.00 342.37 ? 184  MET C CE    1 
ATOM   4963  N  N     . LYS C 2 185  ? 131.327 171.353 124.736 1.00 288.46 ? 185  LYS C N     1 
ATOM   4964  C  CA    . LYS C 2 185  ? 132.277 170.269 124.927 1.00 288.46 ? 185  LYS C CA    1 
ATOM   4965  C  C     . LYS C 2 185  ? 132.077 169.233 123.838 1.00 288.46 ? 185  LYS C C     1 
ATOM   4966  O  O     . LYS C 2 185  ? 131.083 168.500 123.842 1.00 288.46 ? 185  LYS C O     1 
ATOM   4967  C  CB    . LYS C 2 185  ? 132.147 169.622 126.301 1.00 288.46 ? 185  LYS C CB    1 
ATOM   4968  C  CG    . LYS C 2 185  ? 133.398 168.843 126.682 1.00 288.46 ? 185  LYS C CG    1 
ATOM   4969  C  CD    . LYS C 2 185  ? 133.096 167.737 127.666 1.00 288.46 ? 185  LYS C CD    1 
ATOM   4970  C  CE    . LYS C 2 185  ? 132.473 168.291 128.931 1.00 288.46 ? 185  LYS C CE    1 
ATOM   4971  N  NZ    . LYS C 2 185  ? 132.137 167.212 129.894 1.00 288.46 ? 185  LYS C NZ    1 
ATOM   4972  N  N     . VAL C 2 186  ? 133.020 169.187 122.907 1.00 284.00 ? 186  VAL C N     1 
ATOM   4973  C  CA    . VAL C 2 186  ? 133.069 168.170 121.872 1.00 284.00 ? 186  VAL C CA    1 
ATOM   4974  C  C     . VAL C 2 186  ? 134.486 167.625 121.850 1.00 284.00 ? 186  VAL C C     1 
ATOM   4975  O  O     . VAL C 2 186  ? 135.440 168.390 121.661 1.00 284.00 ? 186  VAL C O     1 
ATOM   4976  C  CB    . VAL C 2 186  ? 132.668 168.733 120.497 1.00 284.00 ? 186  VAL C CB    1 
ATOM   4977  C  CG1   . VAL C 2 186  ? 133.101 167.794 119.401 1.00 284.00 ? 186  VAL C CG1   1 
ATOM   4978  C  CG2   . VAL C 2 186  ? 131.169 168.958 120.435 1.00 284.00 ? 186  VAL C CG2   1 
ATOM   4979  N  N     . ASN C 2 187  ? 134.611 166.311 122.063 1.00 308.34 ? 187  ASN C N     1 
ATOM   4980  C  CA    . ASN C 2 187  ? 135.884 165.598 122.184 1.00 308.34 ? 187  ASN C CA    1 
ATOM   4981  C  C     . ASN C 2 187  ? 136.760 166.216 123.273 1.00 308.34 ? 187  ASN C C     1 
ATOM   4982  O  O     . ASN C 2 187  ? 137.831 166.767 123.011 1.00 308.34 ? 187  ASN C O     1 
ATOM   4983  C  CB    . ASN C 2 187  ? 136.628 165.529 120.845 1.00 308.34 ? 187  ASN C CB    1 
ATOM   4984  C  CG    . ASN C 2 187  ? 137.588 164.356 120.771 1.00 308.34 ? 187  ASN C CG    1 
ATOM   4985  O  OD1   . ASN C 2 187  ? 138.682 164.399 121.331 1.00 308.34 ? 187  ASN C OD1   1 
ATOM   4986  N  ND2   . ASN C 2 187  ? 137.181 163.299 120.079 1.00 308.34 ? 187  ASN C ND2   1 
ATOM   4987  N  N     . LYS C 2 188  ? 136.238 166.167 124.499 1.00 299.11 ? 188  LYS C N     1 
ATOM   4988  C  CA    . LYS C 2 188  ? 136.942 166.449 125.748 1.00 299.11 ? 188  LYS C CA    1 
ATOM   4989  C  C     . LYS C 2 188  ? 137.431 167.885 125.869 1.00 299.11 ? 188  LYS C C     1 
ATOM   4990  O  O     . LYS C 2 188  ? 138.302 168.160 126.700 1.00 299.11 ? 188  LYS C O     1 
ATOM   4991  C  CB    . LYS C 2 188  ? 138.137 165.508 125.956 1.00 299.11 ? 188  LYS C CB    1 
ATOM   4992  C  CG    . LYS C 2 188  ? 137.776 164.101 126.398 1.00 299.11 ? 188  LYS C CG    1 
ATOM   4993  C  CD    . LYS C 2 188  ? 137.554 163.186 125.206 1.00 299.11 ? 188  LYS C CD    1 
ATOM   4994  C  CE    . LYS C 2 188  ? 138.815 163.081 124.371 1.00 299.11 ? 188  LYS C CE    1 
ATOM   4995  N  NZ    . LYS C 2 188  ? 138.637 162.163 123.219 1.00 299.11 ? 188  LYS C NZ    1 
ATOM   4996  N  N     . ARG C 2 189  ? 136.906 168.813 125.075 1.00 298.56 ? 189  ARG C N     1 
ATOM   4997  C  CA    . ARG C 2 189  ? 137.399 170.186 125.064 1.00 298.56 ? 189  ARG C CA    1 
ATOM   4998  C  C     . ARG C 2 189  ? 136.240 171.144 125.282 1.00 298.56 ? 189  ARG C C     1 
ATOM   4999  O  O     . ARG C 2 189  ? 135.377 171.293 124.412 1.00 298.56 ? 189  ARG C O     1 
ATOM   5000  C  CB    . ARG C 2 189  ? 138.125 170.496 123.759 1.00 298.56 ? 189  ARG C CB    1 
ATOM   5001  C  CG    . ARG C 2 189  ? 139.517 169.927 123.718 1.00 298.56 ? 189  ARG C CG    1 
ATOM   5002  C  CD    . ARG C 2 189  ? 140.142 170.063 122.352 1.00 298.56 ? 189  ARG C CD    1 
ATOM   5003  N  NE    . ARG C 2 189  ? 141.385 169.306 122.286 1.00 298.56 ? 189  ARG C NE    1 
ATOM   5004  C  CZ    . ARG C 2 189  ? 141.969 168.918 121.159 1.00 298.56 ? 189  ARG C CZ    1 
ATOM   5005  N  NH1   . ARG C 2 189  ? 141.428 169.221 119.990 1.00 298.56 ? 189  ARG C NH1   1 
ATOM   5006  N  NH2   . ARG C 2 189  ? 143.097 168.225 121.200 1.00 298.56 ? 189  ARG C NH2   1 
ATOM   5007  N  N     . LYS C 2 190  ? 136.228 171.788 126.445 1.00 307.23 ? 190  LYS C N     1 
ATOM   5008  C  CA    . LYS C 2 190  ? 135.309 172.878 126.724 1.00 307.23 ? 190  LYS C CA    1 
ATOM   5009  C  C     . LYS C 2 190  ? 135.927 174.188 126.264 1.00 307.23 ? 190  LYS C C     1 
ATOM   5010  O  O     . LYS C 2 190  ? 137.099 174.463 126.530 1.00 307.23 ? 190  LYS C O     1 
ATOM   5011  C  CB    . LYS C 2 190  ? 134.989 172.953 128.214 1.00 307.23 ? 190  LYS C CB    1 
ATOM   5012  C  CG    . LYS C 2 190  ? 133.991 171.919 128.687 1.00 307.23 ? 190  LYS C CG    1 
ATOM   5013  C  CD    . LYS C 2 190  ? 133.690 172.063 130.174 1.00 307.23 ? 190  LYS C CD    1 
ATOM   5014  C  CE    . LYS C 2 190  ? 133.365 173.503 130.553 1.00 307.23 ? 190  LYS C CE    1 
ATOM   5015  N  NZ    . LYS C 2 190  ? 132.768 173.595 131.911 1.00 307.23 ? 190  LYS C NZ    1 
ATOM   5016  N  N     . PHE C 2 191  ? 135.129 174.995 125.590 1.00 317.47 ? 191  PHE C N     1 
ATOM   5017  C  CA    . PHE C 2 191  ? 135.615 176.208 124.952 1.00 317.47 ? 191  PHE C CA    1 
ATOM   5018  C  C     . PHE C 2 191  ? 134.409 177.106 124.709 1.00 317.47 ? 191  PHE C C     1 
ATOM   5019  O  O     . PHE C 2 191  ? 133.272 176.624 124.807 1.00 317.47 ? 191  PHE C O     1 
ATOM   5020  C  CB    . PHE C 2 191  ? 136.377 175.865 123.662 1.00 317.47 ? 191  PHE C CB    1 
ATOM   5021  C  CG    . PHE C 2 191  ? 135.530 175.264 122.587 1.00 317.47 ? 191  PHE C CG    1 
ATOM   5022  C  CD1   . PHE C 2 191  ? 135.029 176.047 121.561 1.00 317.47 ? 191  PHE C CD1   1 
ATOM   5023  C  CD2   . PHE C 2 191  ? 135.274 173.904 122.577 1.00 317.47 ? 191  PHE C CD2   1 
ATOM   5024  C  CE1   . PHE C 2 191  ? 134.262 175.486 120.574 1.00 317.47 ? 191  PHE C CE1   1 
ATOM   5025  C  CE2   . PHE C 2 191  ? 134.497 173.339 121.600 1.00 317.47 ? 191  PHE C CE2   1 
ATOM   5026  C  CZ    . PHE C 2 191  ? 134.000 174.127 120.590 1.00 317.47 ? 191  PHE C CZ    1 
ATOM   5027  N  N     . PRO C 2 192  ? 134.595 178.420 124.440 1.00 317.12 ? 192  PRO C N     1 
ATOM   5028  C  CA    . PRO C 2 192  ? 133.432 179.283 124.192 1.00 317.12 ? 192  PRO C CA    1 
ATOM   5029  C  C     . PRO C 2 192  ? 132.633 178.919 122.953 1.00 317.12 ? 192  PRO C C     1 
ATOM   5030  O  O     . PRO C 2 192  ? 133.164 178.774 121.848 1.00 317.12 ? 192  PRO C O     1 
ATOM   5031  C  CB    . PRO C 2 192  ? 134.052 180.680 124.054 1.00 317.12 ? 192  PRO C CB    1 
ATOM   5032  C  CG    . PRO C 2 192  ? 135.500 180.443 123.812 1.00 317.12 ? 192  PRO C CG    1 
ATOM   5033  C  CD    . PRO C 2 192  ? 135.810 179.234 124.616 1.00 317.12 ? 192  PRO C CD    1 
ATOM   5034  N  N     . LEU C 2 193  ? 131.338 178.721 123.168 1.00 328.09 ? 193  LEU C N     1 
ATOM   5035  C  CA    . LEU C 2 193  ? 130.406 178.623 122.059 1.00 328.09 ? 193  LEU C CA    1 
ATOM   5036  C  C     . LEU C 2 193  ? 130.030 180.006 121.551 1.00 328.09 ? 193  LEU C C     1 
ATOM   5037  O  O     . LEU C 2 193  ? 129.636 180.157 120.392 1.00 328.09 ? 193  LEU C O     1 
ATOM   5038  C  CB    . LEU C 2 193  ? 129.180 177.842 122.519 1.00 328.09 ? 193  LEU C CB    1 
ATOM   5039  C  CG    . LEU C 2 193  ? 127.948 177.558 121.669 1.00 328.09 ? 193  LEU C CG    1 
ATOM   5040  C  CD1   . LEU C 2 193  ? 127.423 176.195 122.069 1.00 328.09 ? 193  LEU C CD1   1 
ATOM   5041  C  CD2   . LEU C 2 193  ? 126.863 178.607 121.865 1.00 328.09 ? 193  LEU C CD2   1 
ATOM   5042  N  N     . VAL C 2 194  ? 130.150 181.025 122.405 1.00 319.59 ? 194  VAL C N     1 
ATOM   5043  C  CA    . VAL C 2 194  ? 129.857 182.394 121.993 1.00 319.59 ? 194  VAL C CA    1 
ATOM   5044  C  C     . VAL C 2 194  ? 130.922 182.895 121.031 1.00 319.59 ? 194  VAL C C     1 
ATOM   5045  O  O     . VAL C 2 194  ? 130.666 183.787 120.211 1.00 319.59 ? 194  VAL C O     1 
ATOM   5046  C  CB    . VAL C 2 194  ? 129.727 183.294 123.233 1.00 319.59 ? 194  VAL C CB    1 
ATOM   5047  C  CG1   . VAL C 2 194  ? 128.418 183.003 123.945 1.00 319.59 ? 194  VAL C CG1   1 
ATOM   5048  C  CG2   . VAL C 2 194  ? 130.898 183.070 124.174 1.00 319.59 ? 194  VAL C CG2   1 
ATOM   5049  N  N     . LEU C 2 195  ? 132.127 182.327 121.124 1.00 314.62 ? 195  LEU C N     1 
ATOM   5050  C  CA    . LEU C 2 195  ? 133.121 182.393 120.059 1.00 314.62 ? 195  LEU C CA    1 
ATOM   5051  C  C     . LEU C 2 195  ? 132.532 181.980 118.722 1.00 314.62 ? 195  LEU C C     1 
ATOM   5052  O  O     . LEU C 2 195  ? 132.745 182.643 117.701 1.00 314.62 ? 195  LEU C O     1 
ATOM   5053  C  CB    . LEU C 2 195  ? 134.269 181.462 120.421 1.00 314.62 ? 195  LEU C CB    1 
ATOM   5054  C  CG    . LEU C 2 195  ? 135.485 181.195 119.552 1.00 314.62 ? 195  LEU C CG    1 
ATOM   5055  C  CD1   . LEU C 2 195  ? 136.437 182.358 119.554 1.00 314.62 ? 195  LEU C CD1   1 
ATOM   5056  C  CD2   . LEU C 2 195  ? 136.141 179.964 120.103 1.00 314.62 ? 195  LEU C CD2   1 
ATOM   5057  N  N     . LEU C 2 196  ? 131.764 180.897 118.719 1.00 329.40 ? 196  LEU C N     1 
ATOM   5058  C  CA    . LEU C 2 196  ? 131.173 180.422 117.480 1.00 329.40 ? 196  LEU C CA    1 
ATOM   5059  C  C     . LEU C 2 196  ? 129.988 181.278 117.064 1.00 329.40 ? 196  LEU C C     1 
ATOM   5060  O  O     . LEU C 2 196  ? 129.739 181.441 115.871 1.00 329.40 ? 196  LEU C O     1 
ATOM   5061  C  CB    . LEU C 2 196  ? 130.758 178.956 117.614 1.00 329.40 ? 196  LEU C CB    1 
ATOM   5062  C  CG    . LEU C 2 196  ? 131.798 177.881 117.290 1.00 329.40 ? 196  LEU C CG    1 
ATOM   5063  C  CD1   . LEU C 2 196  ? 132.219 178.029 115.836 1.00 329.40 ? 196  LEU C CD1   1 
ATOM   5064  C  CD2   . LEU C 2 196  ? 133.005 177.891 118.229 1.00 329.40 ? 196  LEU C CD2   1 
ATOM   5065  N  N     . LEU C 2 197  ? 129.243 181.824 118.026 1.00 303.68 ? 197  LEU C N     1 
ATOM   5066  C  CA    . LEU C 2 197  ? 128.145 182.724 117.679 1.00 303.68 ? 197  LEU C CA    1 
ATOM   5067  C  C     . LEU C 2 197  ? 128.675 184.002 117.056 1.00 303.68 ? 197  LEU C C     1 
ATOM   5068  O  O     . LEU C 2 197  ? 128.050 184.583 116.163 1.00 303.68 ? 197  LEU C O     1 
ATOM   5069  C  CB    . LEU C 2 197  ? 127.325 183.045 118.919 1.00 303.68 ? 197  LEU C CB    1 
ATOM   5070  C  CG    . LEU C 2 197  ? 126.891 181.813 119.703 1.00 303.68 ? 197  LEU C CG    1 
ATOM   5071  C  CD1   . LEU C 2 197  ? 126.172 182.213 120.978 1.00 303.68 ? 197  LEU C CD1   1 
ATOM   5072  C  CD2   . LEU C 2 197  ? 126.022 180.915 118.844 1.00 303.68 ? 197  LEU C CD2   1 
ATOM   5073  N  N     . ARG C 2 198  ? 129.836 184.446 117.523 1.00 322.35 ? 198  ARG C N     1 
ATOM   5074  C  CA    . ARG C 2 198  ? 130.555 185.510 116.846 1.00 322.35 ? 198  ARG C CA    1 
ATOM   5075  C  C     . ARG C 2 198  ? 131.019 185.062 115.467 1.00 322.35 ? 198  ARG C C     1 
ATOM   5076  O  O     . ARG C 2 198  ? 130.984 185.842 114.510 1.00 322.35 ? 198  ARG C O     1 
ATOM   5077  C  CB    . ARG C 2 198  ? 131.740 185.941 117.704 1.00 322.35 ? 198  ARG C CB    1 
ATOM   5078  C  CG    . ARG C 2 198  ? 132.742 186.821 117.005 1.00 322.35 ? 198  ARG C CG    1 
ATOM   5079  C  CD    . ARG C 2 198  ? 132.113 188.133 116.640 1.00 322.35 ? 198  ARG C CD    1 
ATOM   5080  N  NE    . ARG C 2 198  ? 133.093 189.201 116.695 1.00 322.35 ? 198  ARG C NE    1 
ATOM   5081  C  CZ    . ARG C 2 198  ? 132.952 190.384 116.110 1.00 322.35 ? 198  ARG C CZ    1 
ATOM   5082  N  NH1   . ARG C 2 198  ? 133.915 191.279 116.236 1.00 322.35 ? 198  ARG C NH1   1 
ATOM   5083  N  NH2   . ARG C 2 198  ? 131.875 190.670 115.402 1.00 322.35 ? 198  ARG C NH2   1 
ATOM   5084  N  N     . VAL C 2 199  ? 131.478 183.810 115.356 1.00 313.52 ? 199  VAL C N     1 
ATOM   5085  C  CA    . VAL C 2 199  ? 131.842 183.238 114.059 1.00 313.52 ? 199  VAL C CA    1 
ATOM   5086  C  C     . VAL C 2 199  ? 130.627 183.195 113.138 1.00 313.52 ? 199  VAL C C     1 
ATOM   5087  O  O     . VAL C 2 199  ? 130.738 183.450 111.931 1.00 313.52 ? 199  VAL C O     1 
ATOM   5088  C  CB    . VAL C 2 199  ? 132.501 181.852 114.269 1.00 313.52 ? 199  VAL C CB    1 
ATOM   5089  C  CG1   . VAL C 2 199  ? 132.362 180.944 113.062 1.00 313.52 ? 199  VAL C CG1   1 
ATOM   5090  C  CG2   . VAL C 2 199  ? 133.952 182.028 114.613 1.00 313.52 ? 199  VAL C CG2   1 
ATOM   5091  N  N     . LEU C 2 200  ? 129.439 182.989 113.704 1.00 305.16 ? 200  LEU C N     1 
ATOM   5092  C  CA    . LEU C 2 200  ? 128.212 183.216 112.945 1.00 305.16 ? 200  LEU C CA    1 
ATOM   5093  C  C     . LEU C 2 200  ? 127.960 184.677 112.625 1.00 305.16 ? 200  LEU C C     1 
ATOM   5094  O  O     . LEU C 2 200  ? 127.067 184.943 111.809 1.00 305.16 ? 200  LEU C O     1 
ATOM   5095  C  CB    . LEU C 2 200  ? 127.011 182.667 113.703 1.00 305.16 ? 200  LEU C CB    1 
ATOM   5096  C  CG    . LEU C 2 200  ? 127.102 181.207 114.119 1.00 305.16 ? 200  LEU C CG    1 
ATOM   5097  C  CD1   . LEU C 2 200  ? 125.983 180.805 115.065 1.00 305.16 ? 200  LEU C CD1   1 
ATOM   5098  C  CD2   . LEU C 2 200  ? 127.174 180.317 112.902 1.00 305.16 ? 200  LEU C CD2   1 
ATOM   5099  N  N     . GLY C 2 201  ? 128.676 185.631 113.214 1.00 281.87 ? 201  GLY C N     1 
ATOM   5100  C  CA    . GLY C 2 201  ? 128.426 187.029 112.939 1.00 281.87 ? 201  GLY C CA    1 
ATOM   5101  C  C     . GLY C 2 201  ? 127.517 187.631 113.982 1.00 281.87 ? 201  GLY C C     1 
ATOM   5102  O  O     . GLY C 2 201  ? 127.417 188.854 114.106 1.00 281.87 ? 201  GLY C O     1 
ATOM   5103  N  N     . TYR C 2 202  ? 126.844 186.770 114.739 1.00 279.40 ? 202  TYR C N     1 
ATOM   5104  C  CA    . TYR C 2 202  ? 125.883 187.249 115.717 1.00 279.40 ? 202  TYR C CA    1 
ATOM   5105  C  C     . TYR C 2 202  ? 126.640 187.782 116.917 1.00 279.40 ? 202  TYR C C     1 
ATOM   5106  O  O     . TYR C 2 202  ? 127.475 187.087 117.502 1.00 279.40 ? 202  TYR C O     1 
ATOM   5107  C  CB    . TYR C 2 202  ? 124.913 186.147 116.141 1.00 279.40 ? 202  TYR C CB    1 
ATOM   5108  C  CG    . TYR C 2 202  ? 124.315 185.331 115.011 1.00 279.40 ? 202  TYR C CG    1 
ATOM   5109  C  CD1   . TYR C 2 202  ? 123.967 185.915 113.792 1.00 279.40 ? 202  TYR C CD1   1 
ATOM   5110  C  CD2   . TYR C 2 202  ? 124.064 183.976 115.180 1.00 279.40 ? 202  TYR C CD2   1 
ATOM   5111  C  CE1   . TYR C 2 202  ? 123.429 185.161 112.768 1.00 279.40 ? 202  TYR C CE1   1 
ATOM   5112  C  CE2   . TYR C 2 202  ? 123.512 183.219 114.163 1.00 279.40 ? 202  TYR C CE2   1 
ATOM   5113  C  CZ    . TYR C 2 202  ? 123.203 183.814 112.962 1.00 279.40 ? 202  TYR C CZ    1 
ATOM   5114  O  OH    . TYR C 2 202  ? 122.657 183.055 111.955 1.00 279.40 ? 202  TYR C OH    1 
ATOM   5115  N  N     . ASP C 2 203  ? 126.362 189.023 117.267 1.00 298.81 ? 203  ASP C N     1 
ATOM   5116  C  CA    . ASP C 2 203  ? 127.177 189.766 118.207 1.00 298.81 ? 203  ASP C CA    1 
ATOM   5117  C  C     . ASP C 2 203  ? 126.347 190.110 119.438 1.00 298.81 ? 203  ASP C C     1 
ATOM   5118  O  O     . ASP C 2 203  ? 125.267 189.552 119.654 1.00 298.81 ? 203  ASP C O     1 
ATOM   5119  C  CB    . ASP C 2 203  ? 127.755 191.009 117.534 1.00 298.81 ? 203  ASP C CB    1 
ATOM   5120  C  CG    . ASP C 2 203  ? 128.840 190.672 116.536 1.00 298.81 ? 203  ASP C CG    1 
ATOM   5121  O  OD1   . ASP C 2 203  ? 129.143 189.477 116.359 1.00 298.81 ? 203  ASP C OD1   1 
ATOM   5122  O  OD2   . ASP C 2 203  ? 129.395 191.603 115.922 1.00 298.81 ? 203  ASP C OD2   1 
ATOM   5123  N  N     . GLN C 2 204  ? 126.905 191.007 120.255 1.00 338.87 ? 204  GLN C N     1 
ATOM   5124  C  CA    . GLN C 2 204  ? 126.344 191.421 121.539 1.00 338.87 ? 204  GLN C CA    1 
ATOM   5125  C  C     . GLN C 2 204  ? 124.893 191.874 121.466 1.00 338.87 ? 204  GLN C C     1 
ATOM   5126  O  O     . GLN C 2 204  ? 124.075 191.536 122.334 1.00 338.87 ? 204  GLN C O     1 
ATOM   5127  C  CB    . GLN C 2 204  ? 127.209 192.552 122.083 1.00 338.87 ? 204  GLN C CB    1 
ATOM   5128  C  CG    . GLN C 2 204  ? 126.928 192.913 123.503 1.00 338.87 ? 204  GLN C CG    1 
ATOM   5129  C  CD    . GLN C 2 204  ? 128.152 193.457 124.177 1.00 338.87 ? 204  GLN C CD    1 
ATOM   5130  O  OE1   . GLN C 2 204  ? 128.872 194.274 123.605 1.00 338.87 ? 204  GLN C OE1   1 
ATOM   5131  N  NE2   . GLN C 2 204  ? 128.416 192.995 125.390 1.00 338.87 ? 204  GLN C NE2   1 
ATOM   5132  N  N     . GLU C 2 205  ? 124.569 192.640 120.421 1.00 353.57 ? 205  GLU C N     1 
ATOM   5133  C  CA    . GLU C 2 205  ? 123.217 193.148 120.238 1.00 353.57 ? 205  GLU C CA    1 
ATOM   5134  C  C     . GLU C 2 205  ? 122.224 192.019 120.036 1.00 353.57 ? 205  GLU C C     1 
ATOM   5135  O  O     . GLU C 2 205  ? 121.104 192.079 120.547 1.00 353.57 ? 205  GLU C O     1 
ATOM   5136  C  CB    . GLU C 2 205  ? 123.172 194.104 119.044 1.00 353.57 ? 205  GLU C CB    1 
ATOM   5137  C  CG    . GLU C 2 205  ? 121.825 194.806 118.840 1.00 353.57 ? 205  GLU C CG    1 
ATOM   5138  C  CD    . GLU C 2 205  ? 120.919 194.098 117.837 1.00 353.57 ? 205  GLU C CD    1 
ATOM   5139  O  OE1   . GLU C 2 205  ? 121.359 193.091 117.243 1.00 353.57 ? 205  GLU C OE1   1 
ATOM   5140  O  OE2   . GLU C 2 205  ? 119.766 194.541 117.650 1.00 353.57 ? 205  GLU C OE2   1 
ATOM   5141  N  N     . THR C 2 206  ? 122.625 190.982 119.299 1.00 357.49 ? 206  THR C N     1 
ATOM   5142  C  CA    . THR C 2 206  ? 121.735 189.860 119.020 1.00 357.49 ? 206  THR C CA    1 
ATOM   5143  C  C     . THR C 2 206  ? 121.379 189.117 120.299 1.00 357.49 ? 206  THR C C     1 
ATOM   5144  O  O     . THR C 2 206  ? 120.207 188.795 120.543 1.00 357.49 ? 206  THR C O     1 
ATOM   5145  C  CB    . THR C 2 206  ? 122.399 188.912 118.022 1.00 357.49 ? 206  THR C CB    1 
ATOM   5146  O  OG1   . THR C 2 206  ? 123.440 188.182 118.683 1.00 357.49 ? 206  THR C OG1   1 
ATOM   5147  C  CG2   . THR C 2 206  ? 123.010 189.695 116.870 1.00 357.49 ? 206  THR C CG2   1 
ATOM   5148  N  N     . LEU C 2 207  ? 122.385 188.880 121.145 1.00 356.89 ? 207  LEU C N     1 
ATOM   5149  C  CA    . LEU C 2 207  ? 122.185 188.194 122.414 1.00 356.89 ? 207  LEU C CA    1 
ATOM   5150  C  C     . LEU C 2 207  ? 121.303 189.015 123.341 1.00 356.89 ? 207  LEU C C     1 
ATOM   5151  O  O     . LEU C 2 207  ? 120.315 188.510 123.890 1.00 356.89 ? 207  LEU C O     1 
ATOM   5152  C  CB    . LEU C 2 207  ? 123.539 187.917 123.070 1.00 356.89 ? 207  LEU C CB    1 
ATOM   5153  C  CG    . LEU C 2 207  ? 124.662 187.429 122.153 1.00 356.89 ? 207  LEU C CG    1 
ATOM   5154  C  CD1   . LEU C 2 207  ? 125.949 187.267 122.928 1.00 356.89 ? 207  LEU C CD1   1 
ATOM   5155  C  CD2   . LEU C 2 207  ? 124.293 186.118 121.476 1.00 356.89 ? 207  LEU C CD2   1 
ATOM   5156  N  N     . ALA C 2 208  ? 121.626 190.305 123.478 1.00 373.83 ? 208  ALA C N     1 
ATOM   5157  C  CA    . ALA C 2 208  ? 120.883 191.181 124.378 1.00 373.83 ? 208  ALA C CA    1 
ATOM   5158  C  C     . ALA C 2 208  ? 119.456 191.399 123.889 1.00 373.83 ? 208  ALA C C     1 
ATOM   5159  O  O     . ALA C 2 208  ? 118.525 191.563 124.686 1.00 373.83 ? 208  ALA C O     1 
ATOM   5160  C  CB    . ALA C 2 208  ? 121.615 192.515 124.517 1.00 373.83 ? 208  ALA C CB    1 
ATOM   5161  N  N     . ARG C 2 209  ? 119.260 191.369 122.575 1.00 368.57 ? 209  ARG C N     1 
ATOM   5162  C  CA    . ARG C 2 209  ? 117.948 191.650 122.020 1.00 368.57 ? 209  ARG C CA    1 
ATOM   5163  C  C     . ARG C 2 209  ? 117.052 190.428 122.127 1.00 368.57 ? 209  ARG C C     1 
ATOM   5164  O  O     . ARG C 2 209  ? 115.991 190.478 122.759 1.00 368.57 ? 209  ARG C O     1 
ATOM   5165  C  CB    . ARG C 2 209  ? 118.117 192.111 120.570 1.00 368.57 ? 209  ARG C CB    1 
ATOM   5166  C  CG    . ARG C 2 209  ? 116.904 192.724 119.874 1.00 368.57 ? 209  ARG C CG    1 
ATOM   5167  C  CD    . ARG C 2 209  ? 116.170 191.673 119.072 1.00 368.57 ? 209  ARG C CD    1 
ATOM   5168  N  NE    . ARG C 2 209  ? 117.108 190.941 118.231 1.00 368.57 ? 209  ARG C NE    1 
ATOM   5169  C  CZ    . ARG C 2 209  ? 116.872 189.733 117.737 1.00 368.57 ? 209  ARG C CZ    1 
ATOM   5170  N  NH1   . ARG C 2 209  ? 115.725 189.124 118.000 1.00 368.57 ? 209  ARG C NH1   1 
ATOM   5171  N  NH2   . ARG C 2 209  ? 117.784 189.134 116.987 1.00 368.57 ? 209  ARG C NH2   1 
ATOM   5172  N  N     . GLU C 2 210  ? 117.464 189.315 121.518 1.00 342.18 ? 210  GLU C N     1 
ATOM   5173  C  CA    . GLU C 2 210  ? 116.601 188.142 121.503 1.00 342.18 ? 210  GLU C CA    1 
ATOM   5174  C  C     . GLU C 2 210  ? 116.583 187.463 122.863 1.00 342.18 ? 210  GLU C C     1 
ATOM   5175  O  O     . GLU C 2 210  ? 115.515 187.215 123.431 1.00 342.18 ? 210  GLU C O     1 
ATOM   5176  C  CB    . GLU C 2 210  ? 117.045 187.168 120.415 1.00 342.18 ? 210  GLU C CB    1 
ATOM   5177  C  CG    . GLU C 2 210  ? 116.191 185.904 120.318 1.00 342.18 ? 210  GLU C CG    1 
ATOM   5178  C  CD    . GLU C 2 210  ? 114.700 186.155 120.495 1.00 342.18 ? 210  GLU C CD    1 
ATOM   5179  O  OE1   . GLU C 2 210  ? 114.113 186.902 119.685 1.00 342.18 ? 210  GLU C OE1   1 
ATOM   5180  O  OE2   . GLU C 2 210  ? 114.117 185.598 121.448 1.00 342.18 ? 210  GLU C OE2   1 
ATOM   5181  N  N     . LEU C 2 211  ? 117.756 187.159 123.410 1.00 331.45 ? 211  LEU C N     1 
ATOM   5182  C  CA    . LEU C 2 211  ? 117.810 186.441 124.673 1.00 331.45 ? 211  LEU C CA    1 
ATOM   5183  C  C     . LEU C 2 211  ? 117.953 187.368 125.866 1.00 331.45 ? 211  LEU C C     1 
ATOM   5184  O  O     . LEU C 2 211  ? 118.586 187.005 126.865 1.00 331.45 ? 211  LEU C O     1 
ATOM   5185  C  CB    . LEU C 2 211  ? 118.924 185.400 124.650 1.00 331.45 ? 211  LEU C CB    1 
ATOM   5186  C  CG    . LEU C 2 211  ? 118.504 183.996 124.209 1.00 331.45 ? 211  LEU C CG    1 
ATOM   5187  C  CD1   . LEU C 2 211  ? 117.390 183.494 125.124 1.00 331.45 ? 211  LEU C CD1   1 
ATOM   5188  C  CD2   . LEU C 2 211  ? 118.104 183.903 122.743 1.00 331.45 ? 211  LEU C CD2   1 
ATOM   5189  N  N     . GLY C 2 212  ? 117.373 188.564 125.786 1.00 344.85 ? 212  GLY C N     1 
ATOM   5190  C  CA    . GLY C 2 212  ? 117.260 189.396 126.967 1.00 344.85 ? 212  GLY C CA    1 
ATOM   5191  C  C     . GLY C 2 212  ? 116.185 188.919 127.924 1.00 344.85 ? 212  GLY C C     1 
ATOM   5192  O  O     . GLY C 2 212  ? 116.129 189.374 129.069 1.00 344.85 ? 212  GLY C O     1 
ATOM   5193  N  N     . ALA C 2 213  ? 115.311 188.013 127.466 1.00 330.04 ? 213  ALA C N     1 
ATOM   5194  C  CA    . ALA C 2 213  ? 114.324 187.402 128.353 1.00 330.04 ? 213  ALA C CA    1 
ATOM   5195  C  C     . ALA C 2 213  ? 115.002 186.567 129.426 1.00 330.04 ? 213  ALA C C     1 
ATOM   5196  O  O     . ALA C 2 213  ? 114.554 186.530 130.578 1.00 330.04 ? 213  ALA C O     1 
ATOM   5197  C  CB    . ALA C 2 213  ? 113.352 186.538 127.548 1.00 330.04 ? 213  ALA C CB    1 
ATOM   5198  N  N     . TYR C 2 214  ? 116.086 185.892 129.063 1.00 309.28 ? 214  TYR C N     1 
ATOM   5199  C  CA    . TYR C 2 214  ? 116.956 185.221 130.019 1.00 309.28 ? 214  TYR C CA    1 
ATOM   5200  C  C     . TYR C 2 214  ? 118.309 185.888 129.852 1.00 309.28 ? 214  TYR C C     1 
ATOM   5201  O  O     . TYR C 2 214  ? 119.216 185.359 129.212 1.00 309.28 ? 214  TYR C O     1 
ATOM   5202  C  CB    . TYR C 2 214  ? 116.987 183.751 129.736 1.00 309.28 ? 214  TYR C CB    1 
ATOM   5203  C  CG    . TYR C 2 214  ? 115.613 183.261 129.373 1.00 309.28 ? 214  TYR C CG    1 
ATOM   5204  C  CD1   . TYR C 2 214  ? 114.600 183.241 130.319 1.00 309.28 ? 214  TYR C CD1   1 
ATOM   5205  C  CD2   . TYR C 2 214  ? 115.311 182.870 128.074 1.00 309.28 ? 214  TYR C CD2   1 
ATOM   5206  C  CE1   . TYR C 2 214  ? 113.339 182.830 129.991 1.00 309.28 ? 214  TYR C CE1   1 
ATOM   5207  C  CE2   . TYR C 2 214  ? 114.054 182.442 127.741 1.00 309.28 ? 214  TYR C CE2   1 
ATOM   5208  C  CZ    . TYR C 2 214  ? 113.072 182.430 128.705 1.00 309.28 ? 214  TYR C CZ    1 
ATOM   5209  O  OH    . TYR C 2 214  ? 111.806 182.015 128.388 1.00 309.28 ? 214  TYR C OH    1 
ATOM   5210  N  N     . GLY C 2 215  ? 118.443 187.062 130.465 1.00 350.12 ? 215  GLY C N     1 
ATOM   5211  C  CA    . GLY C 2 215  ? 119.624 187.866 130.241 1.00 350.12 ? 215  GLY C CA    1 
ATOM   5212  C  C     . GLY C 2 215  ? 120.723 187.571 131.224 1.00 350.12 ? 215  GLY C C     1 
ATOM   5213  O  O     . GLY C 2 215  ? 121.885 187.872 130.958 1.00 350.12 ? 215  GLY C O     1 
ATOM   5214  N  N     . GLU C 2 216  ? 120.380 186.972 132.361 1.00 363.61 ? 216  GLU C N     1 
ATOM   5215  C  CA    . GLU C 2 216  ? 121.364 186.767 133.417 1.00 363.61 ? 216  GLU C CA    1 
ATOM   5216  C  C     . GLU C 2 216  ? 122.322 185.651 133.042 1.00 363.61 ? 216  GLU C C     1 
ATOM   5217  O  O     . GLU C 2 216  ? 123.511 185.683 133.382 1.00 363.61 ? 216  GLU C O     1 
ATOM   5218  C  CB    . GLU C 2 216  ? 120.647 186.473 134.731 1.00 363.61 ? 216  GLU C CB    1 
ATOM   5219  C  CG    . GLU C 2 216  ? 119.398 187.320 134.926 1.00 363.61 ? 216  GLU C CG    1 
ATOM   5220  C  CD    . GLU C 2 216  ? 119.665 188.808 134.758 1.00 363.61 ? 216  GLU C CD    1 
ATOM   5221  O  OE1   . GLU C 2 216  ? 120.258 189.415 135.671 1.00 363.61 ? 216  GLU C OE1   1 
ATOM   5222  O  OE2   . GLU C 2 216  ? 119.301 189.360 133.697 1.00 363.61 ? 216  GLU C OE2   1 
ATOM   5223  N  N     . LEU C 2 217  ? 121.811 184.654 132.331 1.00 352.00 ? 217  LEU C N     1 
ATOM   5224  C  CA    . LEU C 2 217  ? 122.676 183.705 131.654 1.00 352.00 ? 217  LEU C CA    1 
ATOM   5225  C  C     . LEU C 2 217  ? 123.447 184.405 130.544 1.00 352.00 ? 217  LEU C C     1 
ATOM   5226  O  O     . LEU C 2 217  ? 124.647 184.177 130.357 1.00 352.00 ? 217  LEU C O     1 
ATOM   5227  C  CB    . LEU C 2 217  ? 121.819 182.568 131.105 1.00 352.00 ? 217  LEU C CB    1 
ATOM   5228  C  CG    . LEU C 2 217  ? 120.662 182.235 132.059 1.00 352.00 ? 217  LEU C CG    1 
ATOM   5229  C  CD1   . LEU C 2 217  ? 119.538 181.502 131.350 1.00 352.00 ? 217  LEU C CD1   1 
ATOM   5230  C  CD2   . LEU C 2 217  ? 121.143 181.437 133.261 1.00 352.00 ? 217  LEU C CD2   1 
ATOM   5231  N  N     . VAL C 2 218  ? 122.770 185.306 129.832 1.00 370.87 ? 218  VAL C N     1 
ATOM   5232  C  CA    . VAL C 2 218  ? 123.379 186.027 128.720 1.00 370.87 ? 218  VAL C CA    1 
ATOM   5233  C  C     . VAL C 2 218  ? 124.426 187.011 129.231 1.00 370.87 ? 218  VAL C C     1 
ATOM   5234  O  O     . VAL C 2 218  ? 125.463 187.229 128.591 1.00 370.87 ? 218  VAL C O     1 
ATOM   5235  C  CB    . VAL C 2 218  ? 122.271 186.701 127.888 1.00 370.87 ? 218  VAL C CB    1 
ATOM   5236  C  CG1   . VAL C 2 218  ? 122.773 187.849 127.027 1.00 370.87 ? 218  VAL C CG1   1 
ATOM   5237  C  CG2   . VAL C 2 218  ? 121.647 185.667 127.013 1.00 370.87 ? 218  VAL C CG2   1 
ATOM   5238  N  N     . GLN C 2 219  ? 124.220 187.546 130.437 1.00 389.28 ? 219  GLN C N     1 
ATOM   5239  C  CA    . GLN C 2 219  ? 125.228 188.414 131.039 1.00 389.28 ? 219  GLN C CA    1 
ATOM   5240  C  C     . GLN C 2 219  ? 126.498 187.660 131.404 1.00 389.28 ? 219  GLN C C     1 
ATOM   5241  O  O     . GLN C 2 219  ? 127.540 188.289 131.606 1.00 389.28 ? 219  GLN C O     1 
ATOM   5242  C  CB    . GLN C 2 219  ? 124.658 189.114 132.267 1.00 389.28 ? 219  GLN C CB    1 
ATOM   5243  C  CG    . GLN C 2 219  ? 123.760 190.276 131.906 1.00 389.28 ? 219  GLN C CG    1 
ATOM   5244  C  CD    . GLN C 2 219  ? 122.546 190.347 132.797 1.00 389.28 ? 219  GLN C CD    1 
ATOM   5245  O  OE1   . GLN C 2 219  ? 122.533 189.776 133.882 1.00 389.28 ? 219  GLN C OE1   1 
ATOM   5246  N  NE2   . GLN C 2 219  ? 121.497 191.005 132.321 1.00 389.28 ? 219  GLN C NE2   1 
ATOM   5247  N  N     . GLY C 2 220  ? 126.438 186.331 131.492 1.00 393.36 ? 220  GLY C N     1 
ATOM   5248  C  CA    . GLY C 2 220  ? 127.656 185.549 131.468 1.00 393.36 ? 220  GLY C CA    1 
ATOM   5249  C  C     . GLY C 2 220  ? 128.057 185.119 130.074 1.00 393.36 ? 220  GLY C C     1 
ATOM   5250  O  O     . GLY C 2 220  ? 129.221 184.780 129.841 1.00 393.36 ? 220  GLY C O     1 
ATOM   5251  N  N     . LEU C 2 221  ? 127.111 185.120 129.131 1.00 375.69 ? 221  LEU C N     1 
ATOM   5252  C  CA    . LEU C 2 221  ? 127.443 184.754 127.756 1.00 375.69 ? 221  LEU C CA    1 
ATOM   5253  C  C     . LEU C 2 221  ? 128.195 185.862 127.038 1.00 375.69 ? 221  LEU C C     1 
ATOM   5254  O  O     . LEU C 2 221  ? 128.808 185.612 125.994 1.00 375.69 ? 221  LEU C O     1 
ATOM   5255  C  CB    . LEU C 2 221  ? 126.180 184.425 126.967 1.00 375.69 ? 221  LEU C CB    1 
ATOM   5256  C  CG    . LEU C 2 221  ? 125.396 183.174 127.338 1.00 375.69 ? 221  LEU C CG    1 
ATOM   5257  C  CD1   . LEU C 2 221  ? 124.229 182.998 126.394 1.00 375.69 ? 221  LEU C CD1   1 
ATOM   5258  C  CD2   . LEU C 2 221  ? 126.304 181.978 127.292 1.00 375.69 ? 221  LEU C CD2   1 
ATOM   5259  N  N     . MET C 2 222  ? 128.134 187.087 127.554 1.00 384.91 ? 222  MET C N     1 
ATOM   5260  C  CA    . MET C 2 222  ? 128.774 188.210 126.886 1.00 384.91 ? 222  MET C CA    1 
ATOM   5261  C  C     . MET C 2 222  ? 130.288 188.089 126.969 1.00 384.91 ? 222  MET C C     1 
ATOM   5262  O  O     . MET C 2 222  ? 130.851 187.835 128.036 1.00 384.91 ? 222  MET C O     1 
ATOM   5263  C  CB    . MET C 2 222  ? 128.317 189.526 127.511 1.00 384.91 ? 222  MET C CB    1 
ATOM   5264  C  CG    . MET C 2 222  ? 126.866 189.891 127.223 1.00 384.91 ? 222  MET C CG    1 
ATOM   5265  S  SD    . MET C 2 222  ? 126.441 189.844 125.471 1.00 384.91 ? 222  MET C SD    1 
ATOM   5266  C  CE    . MET C 2 222  ? 124.808 190.581 125.472 1.00 384.91 ? 222  MET C CE    1 
ATOM   5267  N  N     . ASP C 2 223  ? 130.946 188.261 125.829 1.00 378.23 ? 223  ASP C N     1 
ATOM   5268  C  CA    . ASP C 2 223  ? 132.398 188.147 125.781 1.00 378.23 ? 223  ASP C CA    1 
ATOM   5269  C  C     . ASP C 2 223  ? 132.908 189.218 124.835 1.00 378.23 ? 223  ASP C C     1 
ATOM   5270  O  O     . ASP C 2 223  ? 132.850 189.042 123.616 1.00 378.23 ? 223  ASP C O     1 
ATOM   5271  C  CB    . ASP C 2 223  ? 132.825 186.762 125.326 1.00 378.23 ? 223  ASP C CB    1 
ATOM   5272  C  CG    . ASP C 2 223  ? 134.320 186.556 125.428 1.00 378.23 ? 223  ASP C CG    1 
ATOM   5273  O  OD1   . ASP C 2 223  ? 135.053 186.990 124.513 1.00 378.23 ? 223  ASP C OD1   1 
ATOM   5274  O  OD2   . ASP C 2 223  ? 134.768 185.969 126.434 1.00 378.23 ? 223  ASP C OD2   1 
ATOM   5275  N  N     . GLU C 2 224  ? 133.415 190.310 125.400 1.00 387.28 ? 224  GLU C N     1 
ATOM   5276  C  CA    . GLU C 2 224  ? 133.871 191.426 124.582 1.00 387.28 ? 224  GLU C CA    1 
ATOM   5277  C  C     . GLU C 2 224  ? 135.153 191.076 123.843 1.00 387.28 ? 224  GLU C C     1 
ATOM   5278  O  O     . GLU C 2 224  ? 135.416 191.607 122.756 1.00 387.28 ? 224  GLU C O     1 
ATOM   5279  C  CB    . GLU C 2 224  ? 134.071 192.657 125.458 1.00 387.28 ? 224  GLU C CB    1 
ATOM   5280  C  CG    . GLU C 2 224  ? 132.979 192.839 126.484 1.00 387.28 ? 224  GLU C CG    1 
ATOM   5281  C  CD    . GLU C 2 224  ? 131.608 192.822 125.853 1.00 387.28 ? 224  GLU C CD    1 
ATOM   5282  O  OE1   . GLU C 2 224  ? 131.368 193.636 124.939 1.00 387.28 ? 224  GLU C OE1   1 
ATOM   5283  O  OE2   . GLU C 2 224  ? 130.785 191.971 126.245 1.00 387.28 ? 224  GLU C OE2   1 
ATOM   5284  N  N     . SER C 2 225  ? 135.946 190.160 124.407 1.00 383.45 ? 225  SER C N     1 
ATOM   5285  C  CA    . SER C 2 225  ? 137.166 189.689 123.767 1.00 383.45 ? 225  SER C CA    1 
ATOM   5286  C  C     . SER C 2 225  ? 136.898 188.911 122.491 1.00 383.45 ? 225  SER C C     1 
ATOM   5287  O  O     . SER C 2 225  ? 137.812 188.768 121.673 1.00 383.45 ? 225  SER C O     1 
ATOM   5288  C  CB    . SER C 2 225  ? 137.965 188.820 124.734 1.00 383.45 ? 225  SER C CB    1 
ATOM   5289  O  OG    . SER C 2 225  ? 137.116 187.916 125.411 1.00 383.45 ? 225  SER C OG    1 
ATOM   5290  N  N     . VAL C 2 226  ? 135.682 188.406 122.293 1.00 372.15 ? 226  VAL C N     1 
ATOM   5291  C  CA    . VAL C 2 226  ? 135.292 187.890 120.997 1.00 372.15 ? 226  VAL C CA    1 
ATOM   5292  C  C     . VAL C 2 226  ? 134.373 188.855 120.246 1.00 372.15 ? 226  VAL C C     1 
ATOM   5293  O  O     . VAL C 2 226  ? 134.307 188.789 119.015 1.00 372.15 ? 226  VAL C O     1 
ATOM   5294  C  CB    . VAL C 2 226  ? 134.652 186.486 121.116 1.00 372.15 ? 226  VAL C CB    1 
ATOM   5295  C  CG1   . VAL C 2 226  ? 133.194 186.537 121.569 1.00 372.15 ? 226  VAL C CG1   1 
ATOM   5296  C  CG2   . VAL C 2 226  ? 134.833 185.694 119.836 1.00 372.15 ? 226  VAL C CG2   1 
ATOM   5297  N  N     . PHE C 2 227  ? 133.712 189.793 120.940 1.00 353.84 ? 227  PHE C N     1 
ATOM   5298  C  CA    . PHE C 2 227  ? 132.918 190.805 120.245 1.00 353.84 ? 227  PHE C CA    1 
ATOM   5299  C  C     . PHE C 2 227  ? 133.797 191.761 119.454 1.00 353.84 ? 227  PHE C C     1 
ATOM   5300  O  O     . PHE C 2 227  ? 133.342 192.354 118.471 1.00 353.84 ? 227  PHE C O     1 
ATOM   5301  C  CB    . PHE C 2 227  ? 132.062 191.596 121.232 1.00 353.84 ? 227  PHE C CB    1 
ATOM   5302  C  CG    . PHE C 2 227  ? 130.961 190.801 121.840 1.00 353.84 ? 227  PHE C CG    1 
ATOM   5303  C  CD1   . PHE C 2 227  ? 130.373 189.766 121.139 1.00 353.84 ? 227  PHE C CD1   1 
ATOM   5304  C  CD2   . PHE C 2 227  ? 130.519 191.080 123.117 1.00 353.84 ? 227  PHE C CD2   1 
ATOM   5305  C  CE1   . PHE C 2 227  ? 129.362 189.023 121.703 1.00 353.84 ? 227  PHE C CE1   1 
ATOM   5306  C  CE2   . PHE C 2 227  ? 129.519 190.338 123.691 1.00 353.84 ? 227  PHE C CE2   1 
ATOM   5307  C  CZ    . PHE C 2 227  ? 128.935 189.311 122.983 1.00 353.84 ? 227  PHE C CZ    1 
ATOM   5308  N  N     . ALA C 2 228  ? 135.051 191.929 119.866 1.00 358.55 ? 228  ALA C N     1 
ATOM   5309  C  CA    . ALA C 2 228  ? 135.966 192.755 119.091 1.00 358.55 ? 228  ALA C CA    1 
ATOM   5310  C  C     . ALA C 2 228  ? 136.550 191.987 117.912 1.00 358.55 ? 228  ALA C C     1 
ATOM   5311  O  O     . ALA C 2 228  ? 136.564 192.491 116.783 1.00 358.55 ? 228  ALA C O     1 
ATOM   5312  C  CB    . ALA C 2 228  ? 137.083 193.286 119.987 1.00 358.55 ? 228  ALA C CB    1 
ATOM   5313  N  N     . MET C 2 229  ? 137.031 190.767 118.149 1.00 334.20 ? 229  MET C N     1 
ATOM   5314  C  CA    . MET C 2 229  ? 137.738 190.031 117.111 1.00 334.20 ? 229  MET C CA    1 
ATOM   5315  C  C     . MET C 2 229  ? 136.738 189.484 116.102 1.00 334.20 ? 229  MET C C     1 
ATOM   5316  O  O     . MET C 2 229  ? 135.633 189.077 116.467 1.00 334.20 ? 229  MET C O     1 
ATOM   5317  C  CB    . MET C 2 229  ? 138.596 188.913 117.706 1.00 334.20 ? 229  MET C CB    1 
ATOM   5318  C  CG    . MET C 2 229  ? 137.855 187.787 118.386 1.00 334.20 ? 229  MET C CG    1 
ATOM   5319  S  SD    . MET C 2 229  ? 138.895 186.362 118.748 1.00 334.20 ? 229  MET C SD    1 
ATOM   5320  C  CE    . MET C 2 229  ? 140.071 187.063 119.897 1.00 334.20 ? 229  MET C CE    1 
ATOM   5321  N  N     . ARG C 2 230  ? 137.127 189.497 114.830 1.00 345.11 ? 230  ARG C N     1 
ATOM   5322  C  CA    . ARG C 2 230  ? 136.237 189.116 113.752 1.00 345.11 ? 230  ARG C CA    1 
ATOM   5323  C  C     . ARG C 2 230  ? 135.939 187.619 113.789 1.00 345.11 ? 230  ARG C C     1 
ATOM   5324  O  O     . ARG C 2 230  ? 136.633 186.859 114.468 1.00 345.11 ? 230  ARG C O     1 
ATOM   5325  C  CB    . ARG C 2 230  ? 136.860 189.477 112.408 1.00 345.11 ? 230  ARG C CB    1 
ATOM   5326  C  CG    . ARG C 2 230  ? 136.930 190.949 112.077 1.00 345.11 ? 230  ARG C CG    1 
ATOM   5327  C  CD    . ARG C 2 230  ? 135.535 191.544 111.909 1.00 345.11 ? 230  ARG C CD    1 
ATOM   5328  N  NE    . ARG C 2 230  ? 135.090 192.339 113.052 1.00 345.11 ? 230  ARG C NE    1 
ATOM   5329  C  CZ    . ARG C 2 230  ? 133.833 192.716 113.253 1.00 345.11 ? 230  ARG C CZ    1 
ATOM   5330  N  NH1   . ARG C 2 230  ? 133.521 193.476 114.299 1.00 345.11 ? 230  ARG C NH1   1 
ATOM   5331  N  NH2   . ARG C 2 230  ? 132.887 192.321 112.408 1.00 345.11 ? 230  ARG C NH2   1 
ATOM   5332  N  N     . PRO C 2 231  ? 134.869 187.182 113.075 1.00 333.31 ? 231  PRO C N     1 
ATOM   5333  C  CA    . PRO C 2 231  ? 134.638 185.747 112.844 1.00 333.31 ? 231  PRO C CA    1 
ATOM   5334  C  C     . PRO C 2 231  ? 135.826 184.984 112.272 1.00 333.31 ? 231  PRO C C     1 
ATOM   5335  O  O     . PRO C 2 231  ? 135.985 183.798 112.562 1.00 333.31 ? 231  PRO C O     1 
ATOM   5336  C  CB    . PRO C 2 231  ? 133.468 185.741 111.851 1.00 333.31 ? 231  PRO C CB    1 
ATOM   5337  C  CG    . PRO C 2 231  ? 132.802 187.075 111.991 1.00 333.31 ? 231  PRO C CG    1 
ATOM   5338  C  CD    . PRO C 2 231  ? 133.631 187.957 112.879 1.00 333.31 ? 231  PRO C CD    1 
ATOM   5339  N  N     . GLU C 2 232  ? 136.663 185.640 111.467 1.00 346.60 ? 232  GLU C N     1 
ATOM   5340  C  CA    . GLU C 2 232  ? 137.889 184.998 111.005 1.00 346.60 ? 232  GLU C CA    1 
ATOM   5341  C  C     . GLU C 2 232  ? 138.929 184.924 112.117 1.00 346.60 ? 232  GLU C C     1 
ATOM   5342  O  O     . GLU C 2 232  ? 139.643 183.924 112.241 1.00 346.60 ? 232  GLU C O     1 
ATOM   5343  C  CB    . GLU C 2 232  ? 138.449 185.742 109.789 1.00 346.60 ? 232  GLU C CB    1 
ATOM   5344  C  CG    . GLU C 2 232  ? 138.448 187.259 109.902 1.00 346.60 ? 232  GLU C CG    1 
ATOM   5345  C  CD    . GLU C 2 232  ? 137.211 187.900 109.303 1.00 346.60 ? 232  GLU C CD    1 
ATOM   5346  O  OE1   . GLU C 2 232  ? 137.356 188.888 108.558 1.00 346.60 ? 232  GLU C OE1   1 
ATOM   5347  O  OE2   . GLU C 2 232  ? 136.092 187.431 109.596 1.00 346.60 ? 232  GLU C OE2   1 
ATOM   5348  N  N     . GLU C 2 233  ? 139.017 185.964 112.944 1.00 359.29 ? 233  GLU C N     1 
ATOM   5349  C  CA    . GLU C 2 233  ? 139.969 185.953 114.047 1.00 359.29 ? 233  GLU C CA    1 
ATOM   5350  C  C     . GLU C 2 233  ? 139.498 185.014 115.144 1.00 359.29 ? 233  GLU C C     1 
ATOM   5351  O  O     . GLU C 2 233  ? 140.293 184.268 115.729 1.00 359.29 ? 233  GLU C O     1 
ATOM   5352  C  CB    . GLU C 2 233  ? 140.146 187.373 114.564 1.00 359.29 ? 233  GLU C CB    1 
ATOM   5353  C  CG    . GLU C 2 233  ? 140.225 188.351 113.417 1.00 359.29 ? 233  GLU C CG    1 
ATOM   5354  C  CD    . GLU C 2 233  ? 140.214 189.788 113.861 1.00 359.29 ? 233  GLU C CD    1 
ATOM   5355  O  OE1   . GLU C 2 233  ? 140.276 190.036 115.078 1.00 359.29 ? 233  GLU C OE1   1 
ATOM   5356  O  OE2   . GLU C 2 233  ? 140.114 190.675 112.992 1.00 359.29 ? 233  GLU C OE2   1 
ATOM   5357  N  N     . ALA C 2 234  ? 138.189 185.001 115.395 1.00 328.14 ? 234  ALA C N     1 
ATOM   5358  C  CA    . ALA C 2 234  ? 137.593 183.988 116.252 1.00 328.14 ? 234  ALA C CA    1 
ATOM   5359  C  C     . ALA C 2 234  ? 137.730 182.594 115.662 1.00 328.14 ? 234  ALA C C     1 
ATOM   5360  O  O     . ALA C 2 234  ? 137.849 181.624 116.414 1.00 328.14 ? 234  ALA C O     1 
ATOM   5361  C  CB    . ALA C 2 234  ? 136.123 184.322 116.490 1.00 328.14 ? 234  ALA C CB    1 
ATOM   5362  N  N     . LEU C 2 235  ? 137.759 182.483 114.336 1.00 315.48 ? 235  LEU C N     1 
ATOM   5363  C  CA    . LEU C 2 235  ? 137.929 181.199 113.671 1.00 315.48 ? 235  LEU C CA    1 
ATOM   5364  C  C     . LEU C 2 235  ? 139.348 180.678 113.842 1.00 315.48 ? 235  LEU C C     1 
ATOM   5365  O  O     . LEU C 2 235  ? 139.559 179.483 114.065 1.00 315.48 ? 235  LEU C O     1 
ATOM   5366  C  CB    . LEU C 2 235  ? 137.577 181.339 112.192 1.00 315.48 ? 235  LEU C CB    1 
ATOM   5367  C  CG    . LEU C 2 235  ? 136.997 180.099 111.524 1.00 315.48 ? 235  LEU C CG    1 
ATOM   5368  C  CD1   . LEU C 2 235  ? 135.779 179.635 112.284 1.00 315.48 ? 235  LEU C CD1   1 
ATOM   5369  C  CD2   . LEU C 2 235  ? 136.642 180.389 110.078 1.00 315.48 ? 235  LEU C CD2   1 
ATOM   5370  N  N     . ILE C 2 236  ? 140.327 181.574 113.746 1.00 320.98 ? 236  ILE C N     1 
ATOM   5371  C  CA    . ILE C 2 236  ? 141.717 181.233 114.037 1.00 320.98 ? 236  ILE C CA    1 
ATOM   5372  C  C     . ILE C 2 236  ? 141.870 180.860 115.507 1.00 320.98 ? 236  ILE C C     1 
ATOM   5373  O  O     . ILE C 2 236  ? 142.608 179.927 115.863 1.00 320.98 ? 236  ILE C O     1 
ATOM   5374  C  CB    . ILE C 2 236  ? 142.617 182.416 113.633 1.00 320.98 ? 236  ILE C CB    1 
ATOM   5375  C  CG1   . ILE C 2 236  ? 142.730 182.480 112.113 1.00 320.98 ? 236  ILE C CG1   1 
ATOM   5376  C  CG2   . ILE C 2 236  ? 143.991 182.345 114.274 1.00 320.98 ? 236  ILE C CG2   1 
ATOM   5377  C  CD1   . ILE C 2 236  ? 143.469 183.686 111.617 1.00 320.98 ? 236  ILE C CD1   1 
ATOM   5378  N  N     . ARG C 2 237  ? 141.128 181.553 116.371 1.00 326.27 ? 237  ARG C N     1 
ATOM   5379  C  CA    . ARG C 2 237  ? 141.127 181.270 117.801 1.00 326.27 ? 237  ARG C CA    1 
ATOM   5380  C  C     . ARG C 2 237  ? 140.620 179.860 118.095 1.00 326.27 ? 237  ARG C C     1 
ATOM   5381  O  O     . ARG C 2 237  ? 141.259 179.089 118.820 1.00 326.27 ? 237  ARG C O     1 
ATOM   5382  C  CB    . ARG C 2 237  ? 140.268 182.319 118.504 1.00 326.27 ? 237  ARG C CB    1 
ATOM   5383  C  CG    . ARG C 2 237  ? 140.316 182.258 119.998 1.00 326.27 ? 237  ARG C CG    1 
ATOM   5384  C  CD    . ARG C 2 237  ? 141.734 182.352 120.482 1.00 326.27 ? 237  ARG C CD    1 
ATOM   5385  N  NE    . ARG C 2 237  ? 141.789 182.842 121.849 1.00 326.27 ? 237  ARG C NE    1 
ATOM   5386  C  CZ    . ARG C 2 237  ? 142.815 182.640 122.662 1.00 326.27 ? 237  ARG C CZ    1 
ATOM   5387  N  NH1   . ARG C 2 237  ? 142.789 183.120 123.896 1.00 326.27 ? 237  ARG C NH1   1 
ATOM   5388  N  NH2   . ARG C 2 237  ? 143.864 181.949 122.242 1.00 326.27 ? 237  ARG C NH2   1 
ATOM   5389  N  N     . LEU C 2 238  ? 139.483 179.490 117.508 1.00 323.25 ? 238  LEU C N     1 
ATOM   5390  C  CA    . LEU C 2 238  ? 138.984 178.136 117.721 1.00 323.25 ? 238  LEU C CA    1 
ATOM   5391  C  C     . LEU C 2 238  ? 139.801 177.108 116.961 1.00 323.25 ? 238  LEU C C     1 
ATOM   5392  O  O     . LEU C 2 238  ? 139.761 175.927 117.299 1.00 323.25 ? 238  LEU C O     1 
ATOM   5393  C  CB    . LEU C 2 238  ? 137.515 178.022 117.332 1.00 323.25 ? 238  LEU C CB    1 
ATOM   5394  C  CG    . LEU C 2 238  ? 137.075 178.448 115.939 1.00 323.25 ? 238  LEU C CG    1 
ATOM   5395  C  CD1   . LEU C 2 238  ? 137.015 177.302 114.948 1.00 323.25 ? 238  LEU C CD1   1 
ATOM   5396  C  CD2   . LEU C 2 238  ? 135.742 179.148 116.034 1.00 323.25 ? 238  LEU C CD2   1 
ATOM   5397  N  N     . PHE C 2 239  ? 140.503 177.521 115.910 1.00 341.01 ? 239  PHE C N     1 
ATOM   5398  C  CA    . PHE C 2 239  ? 141.435 176.616 115.257 1.00 341.01 ? 239  PHE C CA    1 
ATOM   5399  C  C     . PHE C 2 239  ? 142.562 176.245 116.207 1.00 341.01 ? 239  PHE C C     1 
ATOM   5400  O  O     . PHE C 2 239  ? 142.975 175.084 116.287 1.00 341.01 ? 239  PHE C O     1 
ATOM   5401  C  CB    . PHE C 2 239  ? 141.982 177.267 113.991 1.00 341.01 ? 239  PHE C CB    1 
ATOM   5402  C  CG    . PHE C 2 239  ? 142.856 176.368 113.185 1.00 341.01 ? 239  PHE C CG    1 
ATOM   5403  C  CD1   . PHE C 2 239  ? 144.232 176.414 113.319 1.00 341.01 ? 239  PHE C CD1   1 
ATOM   5404  C  CD2   . PHE C 2 239  ? 142.301 175.470 112.294 1.00 341.01 ? 239  PHE C CD2   1 
ATOM   5405  C  CE1   . PHE C 2 239  ? 145.029 175.581 112.585 1.00 341.01 ? 239  PHE C CE1   1 
ATOM   5406  C  CE2   . PHE C 2 239  ? 143.094 174.647 111.542 1.00 341.01 ? 239  PHE C CE2   1 
ATOM   5407  C  CZ    . PHE C 2 239  ? 144.463 174.702 111.689 1.00 341.01 ? 239  PHE C CZ    1 
ATOM   5408  N  N     . THR C 2 240  ? 143.064 177.233 116.942 1.00 328.76 ? 240  THR C N     1 
ATOM   5409  C  CA    . THR C 2 240  ? 144.056 176.954 117.972 1.00 328.76 ? 240  THR C CA    1 
ATOM   5410  C  C     . THR C 2 240  ? 143.442 176.184 119.131 1.00 328.76 ? 240  THR C C     1 
ATOM   5411  O  O     . THR C 2 240  ? 144.137 175.449 119.836 1.00 328.76 ? 240  THR C O     1 
ATOM   5412  C  CB    . THR C 2 240  ? 144.667 178.258 118.473 1.00 328.76 ? 240  THR C CB    1 
ATOM   5413  O  OG1   . THR C 2 240  ? 143.618 179.130 118.908 1.00 328.76 ? 240  THR C OG1   1 
ATOM   5414  C  CG2   . THR C 2 240  ? 145.449 178.932 117.360 1.00 328.76 ? 240  THR C CG2   1 
ATOM   5415  N  N     . LEU C 2 241  ? 142.144 176.365 119.362 1.00 313.68 ? 241  LEU C N     1 
ATOM   5416  C  CA    . LEU C 2 241  ? 141.483 175.645 120.444 1.00 313.68 ? 241  LEU C CA    1 
ATOM   5417  C  C     . LEU C 2 241  ? 141.318 174.169 120.107 1.00 313.68 ? 241  LEU C C     1 
ATOM   5418  O  O     . LEU C 2 241  ? 141.897 173.295 120.762 1.00 313.68 ? 241  LEU C O     1 
ATOM   5419  C  CB    . LEU C 2 241  ? 140.125 176.280 120.732 1.00 313.68 ? 241  LEU C CB    1 
ATOM   5420  C  CG    . LEU C 2 241  ? 140.135 177.382 121.783 1.00 313.68 ? 241  LEU C CG    1 
ATOM   5421  C  CD1   . LEU C 2 241  ? 138.785 178.051 121.871 1.00 313.68 ? 241  LEU C CD1   1 
ATOM   5422  C  CD2   . LEU C 2 241  ? 140.517 176.789 123.121 1.00 313.68 ? 241  LEU C CD2   1 
ATOM   5423  N  N     . LEU C 2 242  ? 140.540 173.878 119.069 1.00 328.19 ? 242  LEU C N     1 
ATOM   5424  C  CA    . LEU C 2 242  ? 140.179 172.524 118.678 1.00 328.19 ? 242  LEU C CA    1 
ATOM   5425  C  C     . LEU C 2 242  ? 141.330 171.761 118.060 1.00 328.19 ? 242  LEU C C     1 
ATOM   5426  O  O     . LEU C 2 242  ? 141.280 170.530 117.993 1.00 328.19 ? 242  LEU C O     1 
ATOM   5427  C  CB    . LEU C 2 242  ? 139.019 172.567 117.689 1.00 328.19 ? 242  LEU C CB    1 
ATOM   5428  C  CG    . LEU C 2 242  ? 137.877 173.445 118.186 1.00 328.19 ? 242  LEU C CG    1 
ATOM   5429  C  CD1   . LEU C 2 242  ? 136.822 173.626 117.114 1.00 328.19 ? 242  LEU C CD1   1 
ATOM   5430  C  CD2   . LEU C 2 242  ? 137.293 172.844 119.443 1.00 328.19 ? 242  LEU C CD2   1 
ATOM   5431  N  N     . ARG C 2 243  ? 142.347 172.458 117.591 1.00 342.51 ? 243  ARG C N     1 
ATOM   5432  C  CA    . ARG C 2 243  ? 143.570 171.839 117.109 1.00 342.51 ? 243  ARG C CA    1 
ATOM   5433  C  C     . ARG C 2 243  ? 144.685 172.559 117.846 1.00 342.51 ? 243  ARG C C     1 
ATOM   5434  O  O     . ARG C 2 243  ? 145.186 173.593 117.384 1.00 342.51 ? 243  ARG C O     1 
ATOM   5435  C  CB    . ARG C 2 243  ? 143.678 171.944 115.593 1.00 342.51 ? 243  ARG C CB    1 
ATOM   5436  C  CG    . ARG C 2 243  ? 142.636 171.128 114.849 1.00 342.51 ? 243  ARG C CG    1 
ATOM   5437  C  CD    . ARG C 2 243  ? 142.511 171.615 113.428 1.00 342.51 ? 243  ARG C CD    1 
ATOM   5438  N  NE    . ARG C 2 243  ? 143.808 171.729 112.781 1.00 342.51 ? 243  ARG C NE    1 
ATOM   5439  C  CZ    . ARG C 2 243  ? 144.138 171.112 111.653 1.00 342.51 ? 243  ARG C CZ    1 
ATOM   5440  N  NH1   . ARG C 2 243  ? 143.263 170.328 111.041 1.00 342.51 ? 243  ARG C NH1   1 
ATOM   5441  N  NH2   . ARG C 2 243  ? 145.347 171.281 111.137 1.00 342.51 ? 243  ARG C NH2   1 
ATOM   5442  N  N     . PRO C 2 244  ? 145.064 172.064 119.021 1.00 326.60 ? 244  PRO C N     1 
ATOM   5443  C  CA    . PRO C 2 244  ? 145.997 172.806 119.873 1.00 326.60 ? 244  PRO C CA    1 
ATOM   5444  C  C     . PRO C 2 244  ? 147.407 172.819 119.320 1.00 326.60 ? 244  PRO C C     1 
ATOM   5445  O  O     . PRO C 2 244  ? 148.127 171.820 119.387 1.00 326.60 ? 244  PRO C O     1 
ATOM   5446  C  CB    . PRO C 2 244  ? 145.919 172.059 121.211 1.00 326.60 ? 244  PRO C CB    1 
ATOM   5447  C  CG    . PRO C 2 244  ? 144.650 171.276 121.139 1.00 326.60 ? 244  PRO C CG    1 
ATOM   5448  C  CD    . PRO C 2 244  ? 144.533 170.882 119.707 1.00 326.60 ? 244  PRO C CD    1 
ATOM   5449  N  N     . GLY C 2 245  ? 147.796 173.965 118.765 1.00 412.21 ? 245  GLY C N     1 
ATOM   5450  C  CA    . GLY C 2 245  ? 149.113 174.156 118.201 1.00 412.21 ? 245  GLY C CA    1 
ATOM   5451  C  C     . GLY C 2 245  ? 149.202 174.068 116.692 1.00 412.21 ? 245  GLY C C     1 
ATOM   5452  O  O     . GLY C 2 245  ? 150.298 174.244 116.146 1.00 412.21 ? 245  GLY C O     1 
ATOM   5453  N  N     . ASP C 2 246  ? 148.096 173.810 115.999 1.00 404.28 ? 246  ASP C N     1 
ATOM   5454  C  CA    . ASP C 2 246  ? 148.154 173.613 114.559 1.00 404.28 ? 246  ASP C CA    1 
ATOM   5455  C  C     . ASP C 2 246  ? 148.299 174.959 113.840 1.00 404.28 ? 246  ASP C C     1 
ATOM   5456  O  O     . ASP C 2 246  ? 147.874 175.992 114.367 1.00 404.28 ? 246  ASP C O     1 
ATOM   5457  C  CB    . ASP C 2 246  ? 146.910 172.855 114.089 1.00 404.28 ? 246  ASP C CB    1 
ATOM   5458  C  CG    . ASP C 2 246  ? 147.105 171.343 114.142 1.00 404.28 ? 246  ASP C CG    1 
ATOM   5459  O  OD1   . ASP C 2 246  ? 148.260 170.906 114.332 1.00 404.28 ? 246  ASP C OD1   1 
ATOM   5460  O  OD2   . ASP C 2 246  ? 146.126 170.590 113.980 1.00 404.28 ? 246  ASP C OD2   1 
ATOM   5461  N  N     . PRO C 2 247  ? 148.935 174.978 112.662 1.00 380.03 ? 247  PRO C N     1 
ATOM   5462  C  CA    . PRO C 2 247  ? 149.261 176.257 111.989 1.00 380.03 ? 247  PRO C CA    1 
ATOM   5463  C  C     . PRO C 2 247  ? 148.021 177.009 111.539 1.00 380.03 ? 247  PRO C C     1 
ATOM   5464  O  O     . PRO C 2 247  ? 147.289 176.550 110.651 1.00 380.03 ? 247  PRO C O     1 
ATOM   5465  C  CB    . PRO C 2 247  ? 150.100 175.814 110.782 1.00 380.03 ? 247  PRO C CB    1 
ATOM   5466  C  CG    . PRO C 2 247  ? 149.782 174.364 110.604 1.00 380.03 ? 247  PRO C CG    1 
ATOM   5467  C  CD    . PRO C 2 247  ? 149.610 173.854 111.988 1.00 380.03 ? 247  PRO C CD    1 
ATOM   5468  N  N     . PRO C 2 248  ? 147.786 178.201 112.096 1.00 366.49 ? 248  PRO C N     1 
ATOM   5469  C  CA    . PRO C 2 248  ? 146.499 178.881 111.901 1.00 366.49 ? 248  PRO C CA    1 
ATOM   5470  C  C     . PRO C 2 248  ? 146.351 179.598 110.571 1.00 366.49 ? 248  PRO C C     1 
ATOM   5471  O  O     . PRO C 2 248  ? 146.625 180.797 110.472 1.00 366.49 ? 248  PRO C O     1 
ATOM   5472  C  CB    . PRO C 2 248  ? 146.455 179.885 113.064 1.00 366.49 ? 248  PRO C CB    1 
ATOM   5473  C  CG    . PRO C 2 248  ? 147.663 179.587 113.924 1.00 366.49 ? 248  PRO C CG    1 
ATOM   5474  C  CD    . PRO C 2 248  ? 148.654 178.948 113.016 1.00 366.49 ? 248  PRO C CD    1 
ATOM   5475  N  N     . LYS C 2 249  ? 145.925 178.880 109.541 1.00 355.94 ? 249  LYS C N     1 
ATOM   5476  C  CA    . LYS C 2 249  ? 145.396 179.513 108.347 1.00 355.94 ? 249  LYS C CA    1 
ATOM   5477  C  C     . LYS C 2 249  ? 143.886 179.619 108.458 1.00 355.94 ? 249  LYS C C     1 
ATOM   5478  O  O     . LYS C 2 249  ? 143.247 178.884 109.217 1.00 355.94 ? 249  LYS C O     1 
ATOM   5479  C  CB    . LYS C 2 249  ? 145.759 178.749 107.080 1.00 355.94 ? 249  LYS C CB    1 
ATOM   5480  C  CG    . LYS C 2 249  ? 147.035 179.219 106.447 1.00 355.94 ? 249  LYS C CG    1 
ATOM   5481  C  CD    . LYS C 2 249  ? 147.157 178.671 105.052 1.00 355.94 ? 249  LYS C CD    1 
ATOM   5482  C  CE    . LYS C 2 249  ? 147.259 177.165 105.095 1.00 355.94 ? 249  LYS C CE    1 
ATOM   5483  N  NZ    . LYS C 2 249  ? 148.352 176.737 106.009 1.00 355.94 ? 249  LYS C NZ    1 
ATOM   5484  N  N     . ARG C 2 250  ? 143.327 180.552 107.692 1.00 357.85 ? 250  ARG C N     1 
ATOM   5485  C  CA    . ARG C 2 250  ? 141.886 180.764 107.714 1.00 357.85 ? 250  ARG C CA    1 
ATOM   5486  C  C     . ARG C 2 250  ? 141.153 179.601 107.059 1.00 357.85 ? 250  ARG C C     1 
ATOM   5487  O  O     . ARG C 2 250  ? 140.198 179.059 107.625 1.00 357.85 ? 250  ARG C O     1 
ATOM   5488  C  CB    . ARG C 2 250  ? 141.550 182.083 107.021 1.00 357.85 ? 250  ARG C CB    1 
ATOM   5489  C  CG    . ARG C 2 250  ? 140.072 182.328 106.849 1.00 357.85 ? 250  ARG C CG    1 
ATOM   5490  C  CD    . ARG C 2 250  ? 139.701 182.357 105.381 1.00 357.85 ? 250  ARG C CD    1 
ATOM   5491  N  NE    . ARG C 2 250  ? 138.257 182.372 105.187 1.00 357.85 ? 250  ARG C NE    1 
ATOM   5492  C  CZ    . ARG C 2 250  ? 137.664 182.151 104.020 1.00 357.85 ? 250  ARG C CZ    1 
ATOM   5493  N  NH1   . ARG C 2 250  ? 138.396 181.901 102.945 1.00 357.85 ? 250  ARG C NH1   1 
ATOM   5494  N  NH2   . ARG C 2 250  ? 136.342 182.178 103.927 1.00 357.85 ? 250  ARG C NH2   1 
ATOM   5495  N  N     . ASP C 2 251  ? 141.609 179.187 105.875 1.00 358.63 ? 251  ASP C N     1 
ATOM   5496  C  CA    . ASP C 2 251  ? 140.915 178.144 105.127 1.00 358.63 ? 251  ASP C CA    1 
ATOM   5497  C  C     . ASP C 2 251  ? 141.067 176.779 105.777 1.00 358.63 ? 251  ASP C C     1 
ATOM   5498  O  O     . ASP C 2 251  ? 140.231 175.899 105.556 1.00 358.63 ? 251  ASP C O     1 
ATOM   5499  C  CB    . ASP C 2 251  ? 141.437 178.092 103.700 1.00 358.63 ? 251  ASP C CB    1 
ATOM   5500  C  CG    . ASP C 2 251  ? 142.880 177.666 103.638 1.00 358.63 ? 251  ASP C CG    1 
ATOM   5501  O  OD1   . ASP C 2 251  ? 143.653 178.065 104.536 1.00 358.63 ? 251  ASP C OD1   1 
ATOM   5502  O  OD2   . ASP C 2 251  ? 143.239 176.915 102.709 1.00 358.63 ? 251  ASP C OD2   1 
ATOM   5503  N  N     . LYS C 2 252  ? 142.128 176.581 106.564 1.00 329.83 ? 252  LYS C N     1 
ATOM   5504  C  CA    . LYS C 2 252  ? 142.265 175.365 107.357 1.00 329.83 ? 252  LYS C CA    1 
ATOM   5505  C  C     . LYS C 2 252  ? 141.131 175.251 108.366 1.00 329.83 ? 252  LYS C C     1 
ATOM   5506  O  O     . LYS C 2 252  ? 140.481 174.206 108.479 1.00 329.83 ? 252  LYS C O     1 
ATOM   5507  C  CB    . LYS C 2 252  ? 143.620 175.357 108.063 1.00 329.83 ? 252  LYS C CB    1 
ATOM   5508  C  CG    . LYS C 2 252  ? 144.807 175.174 107.148 1.00 329.83 ? 252  LYS C CG    1 
ATOM   5509  C  CD    . LYS C 2 252  ? 146.097 175.149 107.943 1.00 329.83 ? 252  LYS C CD    1 
ATOM   5510  C  CE    . LYS C 2 252  ? 146.270 173.866 108.728 1.00 329.83 ? 252  LYS C CE    1 
ATOM   5511  N  NZ    . LYS C 2 252  ? 146.205 172.668 107.854 1.00 329.83 ? 252  LYS C NZ    1 
ATOM   5512  N  N     . ALA C 2 253  ? 140.854 176.345 109.079 1.00 332.90 ? 253  ALA C N     1 
ATOM   5513  C  CA    . ALA C 2 253  ? 139.722 176.369 109.998 1.00 332.90 ? 253  ALA C CA    1 
ATOM   5514  C  C     . ALA C 2 253  ? 138.399 176.302 109.250 1.00 332.90 ? 253  ALA C C     1 
ATOM   5515  O  O     . ALA C 2 253  ? 137.439 175.704 109.742 1.00 332.90 ? 253  ALA C O     1 
ATOM   5516  C  CB    . ALA C 2 253  ? 139.784 177.619 110.875 1.00 332.90 ? 253  ALA C CB    1 
ATOM   5517  N  N     . VAL C 2 254  ? 138.343 176.888 108.049 1.00 342.25 ? 254  VAL C N     1 
ATOM   5518  C  CA    . VAL C 2 254  ? 137.128 176.853 107.231 1.00 342.25 ? 254  VAL C CA    1 
ATOM   5519  C  C     . VAL C 2 254  ? 136.786 175.421 106.848 1.00 342.25 ? 254  VAL C C     1 
ATOM   5520  O  O     . VAL C 2 254  ? 135.668 174.951 107.074 1.00 342.25 ? 254  VAL C O     1 
ATOM   5521  C  CB    . VAL C 2 254  ? 137.289 177.744 105.987 1.00 342.25 ? 254  VAL C CB    1 
ATOM   5522  C  CG1   . VAL C 2 254  ? 136.228 177.427 104.955 1.00 342.25 ? 254  VAL C CG1   1 
ATOM   5523  C  CG2   . VAL C 2 254  ? 137.175 179.201 106.378 1.00 342.25 ? 254  VAL C CG2   1 
ATOM   5524  N  N     . ALA C 2 255  ? 137.768 174.695 106.316 1.00 334.11 ? 255  ALA C N     1 
ATOM   5525  C  CA    . ALA C 2 255  ? 137.551 173.307 105.935 1.00 334.11 ? 255  ALA C CA    1 
ATOM   5526  C  C     . ALA C 2 255  ? 137.355 172.416 107.151 1.00 334.11 ? 255  ALA C C     1 
ATOM   5527  O  O     . ALA C 2 255  ? 136.602 171.440 107.081 1.00 334.11 ? 255  ALA C O     1 
ATOM   5528  C  CB    . ALA C 2 255  ? 138.723 172.807 105.093 1.00 334.11 ? 255  ALA C CB    1 
ATOM   5529  N  N     . TYR C 2 256  ? 137.984 172.754 108.278 1.00 314.83 ? 256  TYR C N     1 
ATOM   5530  C  CA    . TYR C 2 256  ? 137.857 171.932 109.474 1.00 314.83 ? 256  TYR C CA    1 
ATOM   5531  C  C     . TYR C 2 256  ? 136.465 172.050 110.075 1.00 314.83 ? 256  TYR C C     1 
ATOM   5532  O  O     . TYR C 2 256  ? 135.811 171.043 110.357 1.00 314.83 ? 256  TYR C O     1 
ATOM   5533  C  CB    . TYR C 2 256  ? 138.921 172.335 110.488 1.00 314.83 ? 256  TYR C CB    1 
ATOM   5534  C  CG    . TYR C 2 256  ? 139.278 171.228 111.434 1.00 314.83 ? 256  TYR C CG    1 
ATOM   5535  C  CD1   . TYR C 2 256  ? 139.970 170.115 110.988 1.00 314.83 ? 256  TYR C CD1   1 
ATOM   5536  C  CD2   . TYR C 2 256  ? 138.923 171.291 112.771 1.00 314.83 ? 256  TYR C CD2   1 
ATOM   5537  C  CE1   . TYR C 2 256  ? 140.303 169.095 111.846 1.00 314.83 ? 256  TYR C CE1   1 
ATOM   5538  C  CE2   . TYR C 2 256  ? 139.248 170.273 113.642 1.00 314.83 ? 256  TYR C CE2   1 
ATOM   5539  C  CZ    . TYR C 2 256  ? 139.944 169.180 113.171 1.00 314.83 ? 256  TYR C CZ    1 
ATOM   5540  O  OH    . TYR C 2 256  ? 140.281 168.158 114.026 1.00 314.83 ? 256  TYR C OH    1 
ATOM   5541  N  N     . VAL C 2 257  ? 135.984 173.280 110.252 1.00 329.70 ? 257  VAL C N     1 
ATOM   5542  C  CA    . VAL C 2 257  ? 134.637 173.509 110.748 1.00 329.70 ? 257  VAL C CA    1 
ATOM   5543  C  C     . VAL C 2 257  ? 133.602 173.122 109.702 1.00 329.70 ? 257  VAL C C     1 
ATOM   5544  O  O     . VAL C 2 257  ? 132.475 172.769 110.046 1.00 329.70 ? 257  VAL C O     1 
ATOM   5545  C  CB    . VAL C 2 257  ? 134.546 174.981 111.208 1.00 329.70 ? 257  VAL C CB    1 
ATOM   5546  C  CG1   . VAL C 2 257  ? 133.165 175.368 111.716 1.00 329.70 ? 257  VAL C CG1   1 
ATOM   5547  C  CG2   . VAL C 2 257  ? 135.540 175.194 112.313 1.00 329.70 ? 257  VAL C CG2   1 
ATOM   5548  N  N     . TYR C 2 258  ? 133.981 173.094 108.427 1.00 342.87 ? 258  TYR C N     1 
ATOM   5549  C  CA    . TYR C 2 258  ? 133.089 172.565 107.408 1.00 342.87 ? 258  TYR C CA    1 
ATOM   5550  C  C     . TYR C 2 258  ? 132.897 171.064 107.578 1.00 342.87 ? 258  TYR C C     1 
ATOM   5551  O  O     . TYR C 2 258  ? 131.786 170.594 107.844 1.00 342.87 ? 258  TYR C O     1 
ATOM   5552  C  CB    . TYR C 2 258  ? 133.650 172.891 106.029 1.00 342.87 ? 258  TYR C CB    1 
ATOM   5553  C  CG    . TYR C 2 258  ? 132.699 172.581 104.916 1.00 342.87 ? 258  TYR C CG    1 
ATOM   5554  C  CD1   . TYR C 2 258  ? 133.099 171.816 103.835 1.00 342.87 ? 258  TYR C CD1   1 
ATOM   5555  C  CD2   . TYR C 2 258  ? 131.396 173.046 104.946 1.00 342.87 ? 258  TYR C CD2   1 
ATOM   5556  C  CE1   . TYR C 2 258  ? 132.229 171.527 102.807 1.00 342.87 ? 258  TYR C CE1   1 
ATOM   5557  C  CE2   . TYR C 2 258  ? 130.522 172.767 103.918 1.00 342.87 ? 258  TYR C CE2   1 
ATOM   5558  C  CZ    . TYR C 2 258  ? 130.938 172.002 102.857 1.00 342.87 ? 258  TYR C CZ    1 
ATOM   5559  O  OH    . TYR C 2 258  ? 130.059 171.718 101.840 1.00 342.87 ? 258  TYR C OH    1 
ATOM   5560  N  N     . GLY C 2 259  ? 133.990 170.305 107.484 1.00 345.40 ? 259  GLY C N     1 
ATOM   5561  C  CA    . GLY C 2 259  ? 133.933 168.857 107.568 1.00 345.40 ? 259  GLY C CA    1 
ATOM   5562  C  C     . GLY C 2 259  ? 133.532 168.323 108.925 1.00 345.40 ? 259  GLY C C     1 
ATOM   5563  O  O     . GLY C 2 259  ? 133.056 167.189 109.017 1.00 345.40 ? 259  GLY C O     1 
ATOM   5564  N  N     . LEU C 2 260  ? 133.710 169.109 109.982 1.00 325.92 ? 260  LEU C N     1 
ATOM   5565  C  CA    . LEU C 2 260  ? 133.278 168.689 111.302 1.00 325.92 ? 260  LEU C CA    1 
ATOM   5566  C  C     . LEU C 2 260  ? 131.951 169.300 111.706 1.00 325.92 ? 260  LEU C C     1 
ATOM   5567  O  O     . LEU C 2 260  ? 131.353 168.848 112.688 1.00 325.92 ? 260  LEU C O     1 
ATOM   5568  C  CB    . LEU C 2 260  ? 134.341 169.042 112.348 1.00 325.92 ? 260  LEU C CB    1 
ATOM   5569  C  CG    . LEU C 2 260  ? 135.498 168.054 112.554 1.00 325.92 ? 260  LEU C CG    1 
ATOM   5570  C  CD1   . LEU C 2 260  ? 136.532 168.038 111.425 1.00 325.92 ? 260  LEU C CD1   1 
ATOM   5571  C  CD2   . LEU C 2 260  ? 136.169 168.335 113.883 1.00 325.92 ? 260  LEU C CD2   1 
ATOM   5572  N  N     . ILE C 2 261  ? 131.481 170.306 110.974 1.00 328.34 ? 261  ILE C N     1 
ATOM   5573  C  CA    . ILE C 2 261  ? 130.282 171.043 111.342 1.00 328.34 ? 261  ILE C CA    1 
ATOM   5574  C  C     . ILE C 2 261  ? 129.301 171.078 110.178 1.00 328.34 ? 261  ILE C C     1 
ATOM   5575  O  O     . ILE C 2 261  ? 128.172 170.601 110.301 1.00 328.34 ? 261  ILE C O     1 
ATOM   5576  C  CB    . ILE C 2 261  ? 130.642 172.467 111.810 1.00 328.34 ? 261  ILE C CB    1 
ATOM   5577  C  CG1   . ILE C 2 261  ? 131.354 172.422 113.159 1.00 328.34 ? 261  ILE C CG1   1 
ATOM   5578  C  CG2   . ILE C 2 261  ? 129.415 173.354 111.898 1.00 328.34 ? 261  ILE C CG2   1 
ATOM   5579  C  CD1   . ILE C 2 261  ? 130.591 171.686 114.220 1.00 328.34 ? 261  ILE C CD1   1 
ATOM   5580  N  N     . ALA C 2 262  ? 129.713 171.616 109.032 1.00 340.27 ? 262  ALA C N     1 
ATOM   5581  C  CA    . ALA C 2 262  ? 128.735 171.972 108.016 1.00 340.27 ? 262  ALA C CA    1 
ATOM   5582  C  C     . ALA C 2 262  ? 128.918 171.292 106.671 1.00 340.27 ? 262  ALA C C     1 
ATOM   5583  O  O     . ALA C 2 262  ? 128.208 171.650 105.727 1.00 340.27 ? 262  ALA C O     1 
ATOM   5584  C  CB    . ALA C 2 262  ? 128.720 173.488 107.800 1.00 340.27 ? 262  ALA C CB    1 
ATOM   5585  N  N     . ASP C 2 263  ? 129.833 170.339 106.539 1.00 343.72 ? 263  ASP C N     1 
ATOM   5586  C  CA    . ASP C 2 263  ? 129.881 169.595 105.288 1.00 343.72 ? 263  ASP C CA    1 
ATOM   5587  C  C     . ASP C 2 263  ? 128.774 168.563 105.308 1.00 343.72 ? 263  ASP C C     1 
ATOM   5588  O  O     . ASP C 2 263  ? 128.732 167.743 106.224 1.00 343.72 ? 263  ASP C O     1 
ATOM   5589  C  CB    . ASP C 2 263  ? 131.229 168.910 105.083 1.00 343.72 ? 263  ASP C CB    1 
ATOM   5590  C  CG    . ASP C 2 263  ? 131.357 168.268 103.715 1.00 343.72 ? 263  ASP C CG    1 
ATOM   5591  O  OD1   . ASP C 2 263  ? 130.687 168.716 102.768 1.00 343.72 ? 263  ASP C OD1   1 
ATOM   5592  O  OD2   . ASP C 2 263  ? 132.141 167.312 103.579 1.00 343.72 ? 263  ASP C OD2   1 
ATOM   5593  N  N     . PRO C 2 264  ? 127.859 168.571 104.340 1.00 328.79 ? 264  PRO C N     1 
ATOM   5594  C  CA    . PRO C 2 264  ? 126.890 167.471 104.269 1.00 328.79 ? 264  PRO C CA    1 
ATOM   5595  C  C     . PRO C 2 264  ? 127.543 166.146 103.940 1.00 328.79 ? 264  PRO C C     1 
ATOM   5596  O  O     . PRO C 2 264  ? 127.037 165.095 104.348 1.00 328.79 ? 264  PRO C O     1 
ATOM   5597  C  CB    . PRO C 2 264  ? 125.930 167.926 103.165 1.00 328.79 ? 264  PRO C CB    1 
ATOM   5598  C  CG    . PRO C 2 264  ? 126.738 168.855 102.335 1.00 328.79 ? 264  PRO C CG    1 
ATOM   5599  C  CD    . PRO C 2 264  ? 127.637 169.568 103.281 1.00 328.79 ? 264  PRO C CD    1 
ATOM   5600  N  N     . ARG C 2 265  ? 128.678 166.170 103.238 1.00 343.85 ? 265  ARG C N     1 
ATOM   5601  C  CA    . ARG C 2 265  ? 129.398 164.935 102.951 1.00 343.85 ? 265  ARG C CA    1 
ATOM   5602  C  C     . ARG C 2 265  ? 130.114 164.411 104.190 1.00 343.85 ? 265  ARG C C     1 
ATOM   5603  O  O     . ARG C 2 265  ? 130.277 163.197 104.350 1.00 343.85 ? 265  ARG C O     1 
ATOM   5604  C  CB    . ARG C 2 265  ? 130.388 165.156 101.806 1.00 343.85 ? 265  ARG C CB    1 
ATOM   5605  C  CG    . ARG C 2 265  ? 129.737 165.254 100.431 1.00 343.85 ? 265  ARG C CG    1 
ATOM   5606  C  CD    . ARG C 2 265  ? 130.704 165.755 99.360  1.00 343.85 ? 265  ARG C CD    1 
ATOM   5607  N  NE    . ARG C 2 265  ? 131.616 164.722 98.870  1.00 343.85 ? 265  ARG C NE    1 
ATOM   5608  C  CZ    . ARG C 2 265  ? 131.564 164.192 97.651  1.00 343.85 ? 265  ARG C CZ    1 
ATOM   5609  N  NH1   . ARG C 2 265  ? 130.628 164.579 96.799  1.00 343.85 ? 265  ARG C NH1   1 
ATOM   5610  N  NH2   . ARG C 2 265  ? 132.433 163.263 97.291  1.00 343.85 ? 265  ARG C NH2   1 
ATOM   5611  N  N     . ARG C 2 266  ? 130.529 165.298 105.089 1.00 321.72 ? 266  ARG C N     1 
ATOM   5612  C  CA    . ARG C 2 266  ? 131.263 164.868 106.267 1.00 321.72 ? 266  ARG C CA    1 
ATOM   5613  C  C     . ARG C 2 266  ? 130.568 165.191 107.579 1.00 321.72 ? 266  ARG C C     1 
ATOM   5614  O  O     . ARG C 2 266  ? 131.168 164.996 108.640 1.00 321.72 ? 266  ARG C O     1 
ATOM   5615  C  CB    . ARG C 2 266  ? 132.666 165.474 106.261 1.00 321.72 ? 266  ARG C CB    1 
ATOM   5616  C  CG    . ARG C 2 266  ? 133.555 164.845 105.220 1.00 321.72 ? 266  ARG C CG    1 
ATOM   5617  C  CD    . ARG C 2 266  ? 134.996 165.208 105.453 1.00 321.72 ? 266  ARG C CD    1 
ATOM   5618  N  NE    . ARG C 2 266  ? 135.614 164.336 106.443 1.00 321.72 ? 266  ARG C NE    1 
ATOM   5619  C  CZ    . ARG C 2 266  ? 135.845 164.682 107.702 1.00 321.72 ? 266  ARG C CZ    1 
ATOM   5620  N  NH1   . ARG C 2 266  ? 136.414 163.820 108.531 1.00 321.72 ? 266  ARG C NH1   1 
ATOM   5621  N  NH2   . ARG C 2 266  ? 135.511 165.889 108.136 1.00 321.72 ? 266  ARG C NH2   1 
ATOM   5622  N  N     . TYR C 2 267  ? 129.331 165.667 107.538 1.00 332.99 ? 267  TYR C N     1 
ATOM   5623  C  CA    . TYR C 2 267  ? 128.479 165.740 108.713 1.00 332.99 ? 267  TYR C CA    1 
ATOM   5624  C  C     . TYR C 2 267  ? 127.054 165.487 108.259 1.00 332.99 ? 267  TYR C C     1 
ATOM   5625  O  O     . TYR C 2 267  ? 126.623 166.032 107.239 1.00 332.99 ? 267  TYR C O     1 
ATOM   5626  C  CB    . TYR C 2 267  ? 128.570 167.105 109.408 1.00 332.99 ? 267  TYR C CB    1 
ATOM   5627  C  CG    . TYR C 2 267  ? 127.515 167.289 110.464 1.00 332.99 ? 267  TYR C CG    1 
ATOM   5628  C  CD1   . TYR C 2 267  ? 127.649 166.680 111.694 1.00 332.99 ? 267  TYR C CD1   1 
ATOM   5629  C  CD2   . TYR C 2 267  ? 126.378 168.056 110.228 1.00 332.99 ? 267  TYR C CD2   1 
ATOM   5630  C  CE1   . TYR C 2 267  ? 126.696 166.822 112.663 1.00 332.99 ? 267  TYR C CE1   1 
ATOM   5631  C  CE2   . TYR C 2 267  ? 125.421 168.211 111.194 1.00 332.99 ? 267  TYR C CE2   1 
ATOM   5632  C  CZ    . TYR C 2 267  ? 125.582 167.588 112.409 1.00 332.99 ? 267  TYR C CZ    1 
ATOM   5633  O  OH    . TYR C 2 267  ? 124.625 167.736 113.382 1.00 332.99 ? 267  TYR C OH    1 
ATOM   5634  N  N     . ASP C 2 268  ? 126.311 164.687 109.019 1.00 335.09 ? 268  ASP C N     1 
ATOM   5635  C  CA    . ASP C 2 268  ? 124.926 164.426 108.641 1.00 335.09 ? 268  ASP C CA    1 
ATOM   5636  C  C     . ASP C 2 268  ? 124.095 164.109 109.869 1.00 335.09 ? 268  ASP C C     1 
ATOM   5637  O  O     . ASP C 2 268  ? 124.429 163.199 110.633 1.00 335.09 ? 268  ASP C O     1 
ATOM   5638  C  CB    . ASP C 2 268  ? 124.837 163.285 107.639 1.00 335.09 ? 268  ASP C CB    1 
ATOM   5639  C  CG    . ASP C 2 268  ? 123.456 163.148 107.050 1.00 335.09 ? 268  ASP C CG    1 
ATOM   5640  O  OD1   . ASP C 2 268  ? 122.703 164.141 107.073 1.00 335.09 ? 268  ASP C OD1   1 
ATOM   5641  O  OD2   . ASP C 2 268  ? 123.120 162.053 106.562 1.00 335.09 ? 268  ASP C OD2   1 
ATOM   5642  N  N     . LEU C 2 269  ? 123.005 164.845 110.038 1.00 300.42 ? 269  LEU C N     1 
ATOM   5643  C  CA    . LEU C 2 269  ? 121.982 164.485 110.996 1.00 300.42 ? 269  LEU C CA    1 
ATOM   5644  C  C     . LEU C 2 269  ? 121.176 163.307 110.453 1.00 300.42 ? 269  LEU C C     1 
ATOM   5645  O  O     . LEU C 2 269  ? 121.294 162.926 109.290 1.00 300.42 ? 269  LEU C O     1 
ATOM   5646  C  CB    . LEU C 2 269  ? 121.094 165.702 111.272 1.00 300.42 ? 269  LEU C CB    1 
ATOM   5647  C  CG    . LEU C 2 269  ? 120.052 165.760 112.390 1.00 300.42 ? 269  LEU C CG    1 
ATOM   5648  C  CD1   . LEU C 2 269  ? 120.635 165.166 113.640 1.00 300.42 ? 269  LEU C CD1   1 
ATOM   5649  C  CD2   . LEU C 2 269  ? 119.653 167.187 112.644 1.00 300.42 ? 269  LEU C CD2   1 
ATOM   5650  N  N     . GLY C 2 270  ? 120.384 162.685 111.320 1.00 280.33 ? 270  GLY C N     1 
ATOM   5651  C  CA    . GLY C 2 270  ? 119.319 161.830 110.836 1.00 280.33 ? 270  GLY C CA    1 
ATOM   5652  C  C     . GLY C 2 270  ? 118.280 162.670 110.126 1.00 280.33 ? 270  GLY C C     1 
ATOM   5653  O  O     . GLY C 2 270  ? 117.997 163.803 110.532 1.00 280.33 ? 270  GLY C O     1 
ATOM   5654  N  N     . GLU C 2 271  ? 117.737 162.138 109.033 1.00 264.42 ? 271  GLU C N     1 
ATOM   5655  C  CA    . GLU C 2 271  ? 116.639 162.826 108.372 1.00 264.42 ? 271  GLU C CA    1 
ATOM   5656  C  C     . GLU C 2 271  ? 115.408 162.831 109.252 1.00 264.42 ? 271  GLU C C     1 
ATOM   5657  O  O     . GLU C 2 271  ? 114.700 163.840 109.348 1.00 264.42 ? 271  GLU C O     1 
ATOM   5658  C  CB    . GLU C 2 271  ? 116.328 162.178 107.031 1.00 264.42 ? 271  GLU C CB    1 
ATOM   5659  C  CG    . GLU C 2 271  ? 115.517 163.081 106.137 1.00 264.42 ? 271  GLU C CG    1 
ATOM   5660  C  CD    . GLU C 2 271  ? 115.933 164.536 106.257 1.00 264.42 ? 271  GLU C CD    1 
ATOM   5661  O  OE1   . GLU C 2 271  ? 117.001 164.897 105.725 1.00 264.42 ? 271  GLU C OE1   1 
ATOM   5662  O  OE2   . GLU C 2 271  ? 115.187 165.321 106.880 1.00 264.42 ? 271  GLU C OE2   1 
ATOM   5663  N  N     . ALA C 2 272  ? 115.149 161.707 109.911 1.00 266.45 ? 272  ALA C N     1 
ATOM   5664  C  CA    . ALA C 2 272  ? 114.176 161.690 110.989 1.00 266.45 ? 272  ALA C CA    1 
ATOM   5665  C  C     . ALA C 2 272  ? 114.647 162.543 112.154 1.00 266.45 ? 272  ALA C C     1 
ATOM   5666  O  O     . ALA C 2 272  ? 113.832 163.159 112.842 1.00 266.45 ? 272  ALA C O     1 
ATOM   5667  C  CB    . ALA C 2 272  ? 113.928 160.256 111.441 1.00 266.45 ? 272  ALA C CB    1 
ATOM   5668  N  N     . GLY C 2 273  ? 115.959 162.590 112.391 1.00 262.61 ? 273  GLY C N     1 
ATOM   5669  C  CA    . GLY C 2 273  ? 116.480 163.462 113.429 1.00 262.61 ? 273  GLY C CA    1 
ATOM   5670  C  C     . GLY C 2 273  ? 116.318 164.925 113.077 1.00 262.61 ? 273  GLY C C     1 
ATOM   5671  O  O     . GLY C 2 273  ? 115.971 165.746 113.933 1.00 262.61 ? 273  GLY C O     1 
ATOM   5672  N  N     . ARG C 2 274  ? 116.533 165.261 111.803 1.00 282.36 ? 274  ARG C N     1 
ATOM   5673  C  CA    . ARG C 2 274  ? 116.259 166.609 111.326 1.00 282.36 ? 274  ARG C CA    1 
ATOM   5674  C  C     . ARG C 2 274  ? 114.786 166.936 111.459 1.00 282.36 ? 274  ARG C C     1 
ATOM   5675  O  O     . ARG C 2 274  ? 114.415 168.026 111.901 1.00 282.36 ? 274  ARG C O     1 
ATOM   5676  C  CB    . ARG C 2 274  ? 116.697 166.755 109.873 1.00 282.36 ? 274  ARG C CB    1 
ATOM   5677  C  CG    . ARG C 2 274  ? 116.467 168.155 109.350 1.00 282.36 ? 274  ARG C CG    1 
ATOM   5678  C  CD    . ARG C 2 274  ? 116.347 168.220 107.853 1.00 282.36 ? 274  ARG C CD    1 
ATOM   5679  N  NE    . ARG C 2 274  ? 115.934 169.551 107.435 1.00 282.36 ? 274  ARG C NE    1 
ATOM   5680  C  CZ    . ARG C 2 274  ? 116.201 170.074 106.247 1.00 282.36 ? 274  ARG C CZ    1 
ATOM   5681  N  NH1   . ARG C 2 274  ? 116.886 169.378 105.353 1.00 282.36 ? 274  ARG C NH1   1 
ATOM   5682  N  NH2   . ARG C 2 274  ? 115.777 171.293 105.955 1.00 282.36 ? 274  ARG C NH2   1 
ATOM   5683  N  N     . TYR C 2 275  ? 113.940 165.970 111.119 1.00 251.95 ? 275  TYR C N     1 
ATOM   5684  C  CA    . TYR C 2 275  ? 112.501 166.149 111.200 1.00 251.95 ? 275  TYR C CA    1 
ATOM   5685  C  C     . TYR C 2 275  ? 112.048 166.344 112.639 1.00 251.95 ? 275  TYR C C     1 
ATOM   5686  O  O     . TYR C 2 275  ? 111.200 167.195 112.931 1.00 251.95 ? 275  TYR C O     1 
ATOM   5687  C  CB    . TYR C 2 275  ? 111.825 164.936 110.585 1.00 251.95 ? 275  TYR C CB    1 
ATOM   5688  C  CG    . TYR C 2 275  ? 110.344 165.066 110.536 1.00 251.95 ? 275  TYR C CG    1 
ATOM   5689  C  CD1   . TYR C 2 275  ? 109.741 165.837 109.558 1.00 251.95 ? 275  TYR C CD1   1 
ATOM   5690  C  CD2   . TYR C 2 275  ? 109.541 164.428 111.470 1.00 251.95 ? 275  TYR C CD2   1 
ATOM   5691  C  CE1   . TYR C 2 275  ? 108.379 165.968 109.504 1.00 251.95 ? 275  TYR C CE1   1 
ATOM   5692  C  CE2   . TYR C 2 275  ? 108.179 164.552 111.428 1.00 251.95 ? 275  TYR C CE2   1 
ATOM   5693  C  CZ    . TYR C 2 275  ? 107.600 165.323 110.440 1.00 251.95 ? 275  TYR C CZ    1 
ATOM   5694  O  OH    . TYR C 2 275  ? 106.234 165.455 110.384 1.00 251.95 ? 275  TYR C OH    1 
ATOM   5695  N  N     . LYS C 2 276  ? 112.623 165.567 113.549 1.00 236.74 ? 276  LYS C N     1 
ATOM   5696  C  CA    . LYS C 2 276  ? 112.263 165.639 114.955 1.00 236.74 ? 276  LYS C CA    1 
ATOM   5697  C  C     . LYS C 2 276  ? 112.703 166.956 115.561 1.00 236.74 ? 276  LYS C C     1 
ATOM   5698  O  O     . LYS C 2 276  ? 111.962 167.562 116.338 1.00 236.74 ? 276  LYS C O     1 
ATOM   5699  C  CB    . LYS C 2 276  ? 112.901 164.477 115.704 1.00 236.74 ? 276  LYS C CB    1 
ATOM   5700  C  CG    . LYS C 2 276  ? 112.491 164.381 117.146 1.00 236.74 ? 276  LYS C CG    1 
ATOM   5701  C  CD    . LYS C 2 276  ? 111.012 164.115 117.253 1.00 236.74 ? 276  LYS C CD    1 
ATOM   5702  C  CE    . LYS C 2 276  ? 110.703 163.288 118.487 1.00 236.74 ? 276  LYS C CE    1 
ATOM   5703  N  NZ    . LYS C 2 276  ? 111.449 161.995 118.511 1.00 236.74 ? 276  LYS C NZ    1 
ATOM   5704  N  N     . ALA C 2 277  ? 113.899 167.421 115.198 1.00 238.83 ? 277  ALA C N     1 
ATOM   5705  C  CA    . ALA C 2 277  ? 114.354 168.720 115.672 1.00 238.83 ? 277  ALA C CA    1 
ATOM   5706  C  C     . ALA C 2 277  ? 113.513 169.842 115.084 1.00 238.83 ? 277  ALA C C     1 
ATOM   5707  O  O     . ALA C 2 277  ? 113.213 170.829 115.768 1.00 238.83 ? 277  ALA C O     1 
ATOM   5708  C  CB    . ALA C 2 277  ? 115.826 168.909 115.320 1.00 238.83 ? 277  ALA C CB    1 
ATOM   5709  N  N     . GLU C 2 278  ? 113.111 169.691 113.819 1.00 272.92 ? 278  GLU C N     1 
ATOM   5710  C  CA    . GLU C 2 278  ? 112.282 170.686 113.154 1.00 272.92 ? 278  GLU C CA    1 
ATOM   5711  C  C     . GLU C 2 278  ? 110.919 170.777 113.812 1.00 272.92 ? 278  GLU C C     1 
ATOM   5712  O  O     . GLU C 2 278  ? 110.336 171.860 113.919 1.00 272.92 ? 278  GLU C O     1 
ATOM   5713  C  CB    . GLU C 2 278  ? 112.147 170.327 111.673 1.00 272.92 ? 278  GLU C CB    1 
ATOM   5714  C  CG    . GLU C 2 278  ? 113.266 170.880 110.801 1.00 272.92 ? 278  GLU C CG    1 
ATOM   5715  C  CD    . GLU C 2 278  ? 113.485 170.077 109.530 1.00 272.92 ? 278  GLU C CD    1 
ATOM   5716  O  OE1   . GLU C 2 278  ? 113.079 168.897 109.485 1.00 272.92 ? 278  GLU C OE1   1 
ATOM   5717  O  OE2   . GLU C 2 278  ? 114.076 170.626 108.576 1.00 272.92 ? 278  GLU C OE2   1 
ATOM   5718  N  N     . GLU C 2 279  ? 110.407 169.642 114.274 1.00 249.92 ? 279  GLU C N     1 
ATOM   5719  C  CA    . GLU C 2 279  ? 109.207 169.656 115.092 1.00 249.92 ? 279  GLU C CA    1 
ATOM   5720  C  C     . GLU C 2 279  ? 109.478 170.316 116.435 1.00 249.92 ? 279  GLU C C     1 
ATOM   5721  O  O     . GLU C 2 279  ? 108.696 171.154 116.897 1.00 249.92 ? 279  GLU C O     1 
ATOM   5722  C  CB    . GLU C 2 279  ? 108.708 168.227 115.287 1.00 249.92 ? 279  GLU C CB    1 
ATOM   5723  C  CG    . GLU C 2 279  ? 107.681 168.067 116.393 1.00 249.92 ? 279  GLU C CG    1 
ATOM   5724  C  CD    . GLU C 2 279  ? 108.295 167.590 117.692 1.00 249.92 ? 279  GLU C CD    1 
ATOM   5725  O  OE1   . GLU C 2 279  ? 109.368 166.956 117.637 1.00 249.92 ? 279  GLU C OE1   1 
ATOM   5726  O  OE2   . GLU C 2 279  ? 107.722 167.881 118.761 1.00 249.92 ? 279  GLU C OE2   1 
ATOM   5727  N  N     . LYS C 2 280  ? 110.592 169.940 117.067 1.00 250.98 ? 280  LYS C N     1 
ATOM   5728  C  CA    . LYS C 2 280  ? 110.851 170.254 118.467 1.00 250.98 ? 280  LYS C CA    1 
ATOM   5729  C  C     . LYS C 2 280  ? 111.031 171.747 118.681 1.00 250.98 ? 280  LYS C C     1 
ATOM   5730  O  O     . LYS C 2 280  ? 110.445 172.337 119.595 1.00 250.98 ? 280  LYS C O     1 
ATOM   5731  C  CB    . LYS C 2 280  ? 112.092 169.490 118.931 1.00 250.98 ? 280  LYS C CB    1 
ATOM   5732  C  CG    . LYS C 2 280  ? 112.819 170.107 120.113 1.00 250.98 ? 280  LYS C CG    1 
ATOM   5733  C  CD    . LYS C 2 280  ? 112.161 169.740 121.428 1.00 250.98 ? 280  LYS C CD    1 
ATOM   5734  C  CE    . LYS C 2 280  ? 113.130 169.916 122.580 1.00 250.98 ? 280  LYS C CE    1 
ATOM   5735  N  NZ    . LYS C 2 280  ? 112.519 169.541 123.880 1.00 250.98 ? 280  LYS C NZ    1 
ATOM   5736  N  N     . LEU C 2 281  ? 111.821 172.377 117.831 1.00 270.63 ? 281  LEU C N     1 
ATOM   5737  C  CA    . LEU C 2 281  ? 111.943 173.819 117.907 1.00 270.63 ? 281  LEU C CA    1 
ATOM   5738  C  C     . LEU C 2 281  ? 110.899 174.526 117.076 1.00 270.63 ? 281  LEU C C     1 
ATOM   5739  O  O     . LEU C 2 281  ? 110.871 175.761 117.075 1.00 270.63 ? 281  LEU C O     1 
ATOM   5740  C  CB    . LEU C 2 281  ? 113.342 174.246 117.482 1.00 270.63 ? 281  LEU C CB    1 
ATOM   5741  C  CG    . LEU C 2 281  ? 114.395 173.519 118.310 1.00 270.63 ? 281  LEU C CG    1 
ATOM   5742  C  CD1   . LEU C 2 281  ? 115.774 173.816 117.780 1.00 270.63 ? 281  LEU C CD1   1 
ATOM   5743  C  CD2   . LEU C 2 281  ? 114.278 173.912 119.774 1.00 270.63 ? 281  LEU C CD2   1 
ATOM   5744  N  N     . GLY C 2 282  ? 110.042 173.770 116.396 1.00 283.98 ? 282  GLY C N     1 
ATOM   5745  C  CA    . GLY C 2 282  ? 108.997 174.373 115.581 1.00 283.98 ? 282  GLY C CA    1 
ATOM   5746  C  C     . GLY C 2 282  ? 109.541 175.175 114.423 1.00 283.98 ? 282  GLY C C     1 
ATOM   5747  O  O     . GLY C 2 282  ? 108.954 176.193 114.038 1.00 283.98 ? 282  GLY C O     1 
ATOM   5748  N  N     . ILE C 2 283  ? 110.672 174.755 113.875 1.00 279.46 ? 283  ILE C N     1 
ATOM   5749  C  CA    . ILE C 2 283  ? 111.371 175.489 112.840 1.00 279.46 ? 283  ILE C CA    1 
ATOM   5750  C  C     . ILE C 2 283  ? 111.530 174.575 111.635 1.00 279.46 ? 283  ILE C C     1 
ATOM   5751  O  O     . ILE C 2 283  ? 111.091 173.425 111.639 1.00 279.46 ? 283  ILE C O     1 
ATOM   5752  C  CB    . ILE C 2 283  ? 112.747 175.993 113.313 1.00 279.46 ? 283  ILE C CB    1 
ATOM   5753  C  CG1   . ILE C 2 283  ? 113.591 174.812 113.789 1.00 279.46 ? 283  ILE C CG1   1 
ATOM   5754  C  CG2   . ILE C 2 283  ? 112.587 177.017 114.421 1.00 279.46 ? 283  ILE C CG2   1 
ATOM   5755  C  CD1   . ILE C 2 283  ? 114.974 175.193 114.246 1.00 279.46 ? 283  ILE C CD1   1 
ATOM   5756  N  N     . ARG C 2 284  ? 112.153 175.107 110.589 1.00 293.74 ? 284  ARG C N     1 
ATOM   5757  C  CA    . ARG C 2 284  ? 112.637 174.286 109.485 1.00 293.74 ? 284  ARG C CA    1 
ATOM   5758  C  C     . ARG C 2 284  ? 113.766 175.076 108.848 1.00 293.74 ? 284  ARG C C     1 
ATOM   5759  O  O     . ARG C 2 284  ? 113.557 176.208 108.405 1.00 293.74 ? 284  ARG C O     1 
ATOM   5760  C  CB    . ARG C 2 284  ? 111.536 173.972 108.478 1.00 293.74 ? 284  ARG C CB    1 
ATOM   5761  C  CG    . ARG C 2 284  ? 111.846 172.818 107.510 1.00 293.74 ? 284  ARG C CG    1 
ATOM   5762  C  CD    . ARG C 2 284  ? 112.499 173.312 106.238 1.00 293.74 ? 284  ARG C CD    1 
ATOM   5763  N  NE    . ARG C 2 284  ? 111.686 174.350 105.624 1.00 293.74 ? 284  ARG C NE    1 
ATOM   5764  C  CZ    . ARG C 2 284  ? 112.160 175.274 104.799 1.00 293.74 ? 284  ARG C CZ    1 
ATOM   5765  N  NH1   . ARG C 2 284  ? 111.341 176.181 104.288 1.00 293.74 ? 284  ARG C NH1   1 
ATOM   5766  N  NH2   . ARG C 2 284  ? 113.452 175.301 104.504 1.00 293.74 ? 284  ARG C NH2   1 
ATOM   5767  N  N     . LEU C 2 285  ? 114.939 174.484 108.799 1.00 302.06 ? 285  LEU C N     1 
ATOM   5768  C  CA    . LEU C 2 285  ? 116.105 175.143 108.249 1.00 302.06 ? 285  LEU C CA    1 
ATOM   5769  C  C     . LEU C 2 285  ? 116.530 174.434 106.971 1.00 302.06 ? 285  LEU C C     1 
ATOM   5770  O  O     . LEU C 2 285  ? 115.791 173.615 106.420 1.00 302.06 ? 285  LEU C O     1 
ATOM   5771  C  CB    . LEU C 2 285  ? 117.220 175.201 109.284 1.00 302.06 ? 285  LEU C CB    1 
ATOM   5772  C  CG    . LEU C 2 285  ? 117.274 176.517 110.065 1.00 302.06 ? 285  LEU C CG    1 
ATOM   5773  C  CD1   . LEU C 2 285  ? 117.451 177.701 109.124 1.00 302.06 ? 285  LEU C CD1   1 
ATOM   5774  C  CD2   . LEU C 2 285  ? 116.087 176.722 110.997 1.00 302.06 ? 285  LEU C CD2   1 
ATOM   5775  N  N     . SER C 2 286  ? 117.721 174.792 106.484 1.00 322.11 ? 286  SER C N     1 
ATOM   5776  C  CA    . SER C 2 286  ? 118.142 174.384 105.147 1.00 322.11 ? 286  SER C CA    1 
ATOM   5777  C  C     . SER C 2 286  ? 118.403 172.886 105.074 1.00 322.11 ? 286  SER C C     1 
ATOM   5778  O  O     . SER C 2 286  ? 117.724 172.161 104.339 1.00 322.11 ? 286  SER C O     1 
ATOM   5779  C  CB    . SER C 2 286  ? 119.395 175.151 104.733 1.00 322.11 ? 286  SER C CB    1 
ATOM   5780  O  OG    . SER C 2 286  ? 120.431 174.956 105.673 1.00 322.11 ? 286  SER C OG    1 
ATOM   5781  N  N     . GLY C 2 287  ? 119.375 172.396 105.838 1.00 312.05 ? 287  GLY C N     1 
ATOM   5782  C  CA    . GLY C 2 287  ? 119.823 171.031 105.670 1.00 312.05 ? 287  GLY C CA    1 
ATOM   5783  C  C     . GLY C 2 287  ? 120.291 170.403 106.965 1.00 312.05 ? 287  GLY C C     1 
ATOM   5784  O  O     . GLY C 2 287  ? 120.205 170.994 108.043 1.00 312.05 ? 287  GLY C O     1 
ATOM   5785  N  N     . ARG C 2 288  ? 120.796 169.182 106.824 1.00 295.14 ? 288  ARG C N     1 
ATOM   5786  C  CA    . ARG C 2 288  ? 121.346 168.399 107.916 1.00 295.14 ? 288  ARG C CA    1 
ATOM   5787  C  C     . ARG C 2 288  ? 122.822 168.634 108.118 1.00 295.14 ? 288  ARG C C     1 
ATOM   5788  O  O     . ARG C 2 288  ? 123.490 167.812 108.753 1.00 295.14 ? 288  ARG C O     1 
ATOM   5789  C  CB    . ARG C 2 288  ? 121.082 166.920 107.672 1.00 295.14 ? 288  ARG C CB    1 
ATOM   5790  C  CG    . ARG C 2 288  ? 119.627 166.602 107.646 1.00 295.14 ? 288  ARG C CG    1 
ATOM   5791  C  CD    . ARG C 2 288  ? 119.422 165.156 107.880 1.00 295.14 ? 288  ARG C CD    1 
ATOM   5792  N  NE    . ARG C 2 288  ? 119.173 164.473 106.623 1.00 295.14 ? 288  ARG C NE    1 
ATOM   5793  C  CZ    . ARG C 2 288  ? 119.562 163.235 106.359 1.00 295.14 ? 288  ARG C CZ    1 
ATOM   5794  N  NH1   . ARG C 2 288  ? 120.210 162.529 107.270 1.00 295.14 ? 288  ARG C NH1   1 
ATOM   5795  N  NH2   . ARG C 2 288  ? 119.284 162.698 105.185 1.00 295.14 ? 288  ARG C NH2   1 
ATOM   5796  N  N     . THR C 2 289  ? 123.346 169.705 107.543 1.00 330.46 ? 289  THR C N     1 
ATOM   5797  C  CA    . THR C 2 289  ? 124.573 170.311 108.016 1.00 330.46 ? 289  THR C CA    1 
ATOM   5798  C  C     . THR C 2 289  ? 124.234 171.131 109.248 1.00 330.46 ? 289  THR C C     1 
ATOM   5799  O  O     . THR C 2 289  ? 123.079 171.505 109.462 1.00 330.46 ? 289  THR C O     1 
ATOM   5800  C  CB    . THR C 2 289  ? 125.185 171.211 106.949 1.00 330.46 ? 289  THR C CB    1 
ATOM   5801  O  OG1   . THR C 2 289  ? 124.552 172.496 106.992 1.00 330.46 ? 289  THR C OG1   1 
ATOM   5802  C  CG2   . THR C 2 289  ? 124.957 170.612 105.579 1.00 330.46 ? 289  THR C CG2   1 
ATOM   5803  N  N     . LEU C 2 290  ? 125.244 171.407 110.068 1.00 358.59 ? 290  LEU C N     1 
ATOM   5804  C  CA    . LEU C 2 290  ? 124.984 172.224 111.246 1.00 358.59 ? 290  LEU C CA    1 
ATOM   5805  C  C     . LEU C 2 290  ? 124.914 173.702 110.892 1.00 358.59 ? 290  LEU C C     1 
ATOM   5806  O  O     . LEU C 2 290  ? 124.265 174.482 111.599 1.00 358.59 ? 290  LEU C O     1 
ATOM   5807  C  CB    . LEU C 2 290  ? 126.053 171.973 112.303 1.00 358.59 ? 290  LEU C CB    1 
ATOM   5808  C  CG    . LEU C 2 290  ? 125.880 172.585 113.687 1.00 358.59 ? 290  LEU C CG    1 
ATOM   5809  C  CD1   . LEU C 2 290  ? 124.473 172.339 114.176 1.00 358.59 ? 290  LEU C CD1   1 
ATOM   5810  C  CD2   . LEU C 2 290  ? 126.890 172.013 114.646 1.00 358.59 ? 290  LEU C CD2   1 
ATOM   5811  N  N     . ALA C 2 291  ? 125.558 174.103 109.804 1.00 373.93 ? 291  ALA C N     1 
ATOM   5812  C  CA    . ALA C 2 291  ? 125.586 175.498 109.410 1.00 373.93 ? 291  ALA C CA    1 
ATOM   5813  C  C     . ALA C 2 291  ? 125.336 175.629 107.916 1.00 373.93 ? 291  ALA C C     1 
ATOM   5814  O  O     . ALA C 2 291  ? 125.579 174.707 107.133 1.00 373.93 ? 291  ALA C O     1 
ATOM   5815  C  CB    . ALA C 2 291  ? 126.918 176.159 109.783 1.00 373.93 ? 291  ALA C CB    1 
ATOM   5816  N  N     . ARG C 2 292  ? 124.820 176.793 107.531 1.00 385.17 ? 292  ARG C N     1 
ATOM   5817  C  CA    . ARG C 2 292  ? 124.721 177.179 106.128 1.00 385.17 ? 292  ARG C CA    1 
ATOM   5818  C  C     . ARG C 2 292  ? 126.099 177.703 105.756 1.00 385.17 ? 292  ARG C C     1 
ATOM   5819  O  O     . ARG C 2 292  ? 126.476 178.827 106.090 1.00 385.17 ? 292  ARG C O     1 
ATOM   5820  C  CB    . ARG C 2 292  ? 123.635 178.221 105.901 1.00 385.17 ? 292  ARG C CB    1 
ATOM   5821  C  CG    . ARG C 2 292  ? 122.228 177.698 106.004 1.00 385.17 ? 292  ARG C CG    1 
ATOM   5822  C  CD    . ARG C 2 292  ? 121.293 178.779 106.511 1.00 385.17 ? 292  ARG C CD    1 
ATOM   5823  N  NE    . ARG C 2 292  ? 121.558 179.110 107.907 1.00 385.17 ? 292  ARG C NE    1 
ATOM   5824  C  CZ    . ARG C 2 292  ? 120.761 179.863 108.656 1.00 385.17 ? 292  ARG C CZ    1 
ATOM   5825  N  NH1   . ARG C 2 292  ? 119.649 180.365 108.142 1.00 385.17 ? 292  ARG C NH1   1 
ATOM   5826  N  NH2   . ARG C 2 292  ? 121.075 180.113 109.919 1.00 385.17 ? 292  ARG C NH2   1 
ATOM   5827  N  N     . PHE C 2 293  ? 126.871 176.850 105.102 1.00 361.04 ? 293  PHE C N     1 
ATOM   5828  C  CA    . PHE C 2 293  ? 128.227 177.185 104.694 1.00 361.04 ? 293  PHE C CA    1 
ATOM   5829  C  C     . PHE C 2 293  ? 128.140 177.981 103.406 1.00 361.04 ? 293  PHE C C     1 
ATOM   5830  O  O     . PHE C 2 293  ? 128.054 177.430 102.310 1.00 361.04 ? 293  PHE C O     1 
ATOM   5831  C  CB    . PHE C 2 293  ? 129.061 175.928 104.515 1.00 361.04 ? 293  PHE C CB    1 
ATOM   5832  C  CG    . PHE C 2 293  ? 130.463 176.189 104.063 1.00 361.04 ? 293  PHE C CG    1 
ATOM   5833  C  CD1   . PHE C 2 293  ? 131.409 176.638 104.956 1.00 361.04 ? 293  PHE C CD1   1 
ATOM   5834  C  CD2   . PHE C 2 293  ? 130.840 175.967 102.748 1.00 361.04 ? 293  PHE C CD2   1 
ATOM   5835  C  CE1   . PHE C 2 293  ? 132.699 176.864 104.559 1.00 361.04 ? 293  PHE C CE1   1 
ATOM   5836  C  CE2   . PHE C 2 293  ? 132.135 176.193 102.341 1.00 361.04 ? 293  PHE C CE2   1 
ATOM   5837  C  CZ    . PHE C 2 293  ? 133.066 176.646 103.250 1.00 361.04 ? 293  PHE C CZ    1 
ATOM   5838  N  N     . GLU C 2 294  ? 128.132 179.295 103.543 1.00 389.11 ? 294  GLU C N     1 
ATOM   5839  C  CA    . GLU C 2 294  ? 128.300 180.181 102.409 1.00 389.11 ? 294  GLU C CA    1 
ATOM   5840  C  C     . GLU C 2 294  ? 129.566 180.984 102.627 1.00 389.11 ? 294  GLU C C     1 
ATOM   5841  O  O     . GLU C 2 294  ? 130.039 181.113 103.755 1.00 389.11 ? 294  GLU C O     1 
ATOM   5842  C  CB    . GLU C 2 294  ? 127.102 181.115 102.234 1.00 389.11 ? 294  GLU C CB    1 
ATOM   5843  C  CG    . GLU C 2 294  ? 125.848 180.400 101.803 1.00 389.11 ? 294  GLU C CG    1 
ATOM   5844  C  CD    . GLU C 2 294  ? 125.035 179.922 102.977 1.00 389.11 ? 294  GLU C CD    1 
ATOM   5845  O  OE1   . GLU C 2 294  ? 125.249 180.440 104.090 1.00 389.11 ? 294  GLU C OE1   1 
ATOM   5846  O  OE2   . GLU C 2 294  ? 124.189 179.029 102.782 1.00 389.11 ? 294  GLU C OE2   1 
ATOM   5847  N  N     . ASP C 2 295  ? 130.151 181.445 101.519 1.00 391.03 ? 295  ASP C N     1 
ATOM   5848  C  CA    . ASP C 2 295  ? 131.240 182.424 101.485 1.00 391.03 ? 295  ASP C CA    1 
ATOM   5849  C  C     . ASP C 2 295  ? 132.512 181.943 102.184 1.00 391.03 ? 295  ASP C C     1 
ATOM   5850  O  O     . ASP C 2 295  ? 133.413 182.742 102.451 1.00 391.03 ? 295  ASP C O     1 
ATOM   5851  C  CB    . ASP C 2 295  ? 130.793 183.756 102.102 1.00 391.03 ? 295  ASP C CB    1 
ATOM   5852  C  CG    . ASP C 2 295  ? 129.435 184.192 101.611 1.00 391.03 ? 295  ASP C CG    1 
ATOM   5853  O  OD1   . ASP C 2 295  ? 129.055 183.800 100.491 1.00 391.03 ? 295  ASP C OD1   1 
ATOM   5854  O  OD2   . ASP C 2 295  ? 128.737 184.910 102.354 1.00 391.03 ? 295  ASP C OD2   1 
ATOM   5855  N  N     . GLY C 2 296  ? 132.618 180.651 102.493 1.00 388.70 ? 296  GLY C N     1 
ATOM   5856  C  CA    . GLY C 2 296  ? 133.605 180.178 103.434 1.00 388.70 ? 296  GLY C CA    1 
ATOM   5857  C  C     . GLY C 2 296  ? 133.195 180.267 104.889 1.00 388.70 ? 296  GLY C C     1 
ATOM   5858  O  O     . GLY C 2 296  ? 133.797 179.585 105.727 1.00 388.70 ? 296  GLY C O     1 
ATOM   5859  N  N     . GLU C 2 297  ? 132.201 181.083 105.227 1.00 368.72 ? 297  GLU C N     1 
ATOM   5860  C  CA    . GLU C 2 297  ? 131.751 181.222 106.599 1.00 368.72 ? 297  GLU C CA    1 
ATOM   5861  C  C     . GLU C 2 297  ? 130.574 180.285 106.847 1.00 368.72 ? 297  GLU C C     1 
ATOM   5862  O  O     . GLU C 2 297  ? 130.270 179.400 106.046 1.00 368.72 ? 297  GLU C O     1 
ATOM   5863  C  CB    . GLU C 2 297  ? 131.430 182.688 106.917 1.00 368.72 ? 297  GLU C CB    1 
ATOM   5864  C  CG    . GLU C 2 297  ? 130.422 183.357 106.003 1.00 368.72 ? 297  GLU C CG    1 
ATOM   5865  C  CD    . GLU C 2 297  ? 128.988 183.148 106.436 1.00 368.72 ? 297  GLU C CD    1 
ATOM   5866  O  OE1   . GLU C 2 297  ? 128.752 182.898 107.635 1.00 368.72 ? 297  GLU C OE1   1 
ATOM   5867  O  OE2   . GLU C 2 297  ? 128.101 183.205 105.565 1.00 368.72 ? 297  GLU C OE2   1 
ATOM   5868  N  N     . PHE C 2 298  ? 129.923 180.457 107.990 1.00 335.69 ? 298  PHE C N     1 
ATOM   5869  C  CA    . PHE C 2 298  ? 128.979 179.481 108.504 1.00 335.69 ? 298  PHE C CA    1 
ATOM   5870  C  C     . PHE C 2 298  ? 127.766 180.205 109.055 1.00 335.69 ? 298  PHE C C     1 
ATOM   5871  O  O     . PHE C 2 298  ? 127.910 181.184 109.791 1.00 335.69 ? 298  PHE C O     1 
ATOM   5872  C  CB    . PHE C 2 298  ? 129.632 178.638 109.598 1.00 335.69 ? 298  PHE C CB    1 
ATOM   5873  C  CG    . PHE C 2 298  ? 130.748 177.771 109.106 1.00 335.69 ? 298  PHE C CG    1 
ATOM   5874  C  CD1   . PHE C 2 298  ? 132.053 178.242 109.068 1.00 335.69 ? 298  PHE C CD1   1 
ATOM   5875  C  CD2   . PHE C 2 298  ? 130.496 176.482 108.691 1.00 335.69 ? 298  PHE C CD2   1 
ATOM   5876  C  CE1   . PHE C 2 298  ? 133.077 177.444 108.609 1.00 335.69 ? 298  PHE C CE1   1 
ATOM   5877  C  CE2   . PHE C 2 298  ? 131.515 175.678 108.247 1.00 335.69 ? 298  PHE C CE2   1 
ATOM   5878  C  CZ    . PHE C 2 298  ? 132.807 176.162 108.196 1.00 335.69 ? 298  PHE C CZ    1 
ATOM   5879  N  N     . LYS C 2 299  ? 126.578 179.727 108.701 1.00 370.37 ? 299  LYS C N     1 
ATOM   5880  C  CA    . LYS C 2 299  ? 125.325 180.246 109.246 1.00 370.37 ? 299  LYS C CA    1 
ATOM   5881  C  C     . LYS C 2 299  ? 124.571 179.078 109.873 1.00 370.37 ? 299  LYS C C     1 
ATOM   5882  O  O     . LYS C 2 299  ? 123.944 178.290 109.162 1.00 370.37 ? 299  LYS C O     1 
ATOM   5883  C  CB    . LYS C 2 299  ? 124.479 180.923 108.170 1.00 370.37 ? 299  LYS C CB    1 
ATOM   5884  C  CG    . LYS C 2 299  ? 125.215 181.817 107.189 1.00 370.37 ? 299  LYS C CG    1 
ATOM   5885  C  CD    . LYS C 2 299  ? 124.201 182.611 106.381 1.00 370.37 ? 299  LYS C CD    1 
ATOM   5886  C  CE    . LYS C 2 299  ? 124.861 183.466 105.328 1.00 370.37 ? 299  LYS C CE    1 
ATOM   5887  N  NZ    . LYS C 2 299  ? 125.953 184.281 105.915 1.00 370.37 ? 299  LYS C NZ    1 
ATOM   5888  N  N     . ASP C 2 300  ? 124.599 178.999 111.206 1.00 362.80 ? 300  ASP C N     1 
ATOM   5889  C  CA    . ASP C 2 300  ? 124.080 177.833 111.913 1.00 362.80 ? 300  ASP C CA    1 
ATOM   5890  C  C     . ASP C 2 300  ? 122.572 177.725 111.780 1.00 362.80 ? 300  ASP C C     1 
ATOM   5891  O  O     . ASP C 2 300  ? 121.847 178.722 111.819 1.00 362.80 ? 300  ASP C O     1 
ATOM   5892  C  CB    . ASP C 2 300  ? 124.449 177.880 113.394 1.00 362.80 ? 300  ASP C CB    1 
ATOM   5893  C  CG    . ASP C 2 300  ? 124.008 176.636 114.144 1.00 362.80 ? 300  ASP C CG    1 
ATOM   5894  O  OD1   . ASP C 2 300  ? 124.808 175.689 114.252 1.00 362.80 ? 300  ASP C OD1   1 
ATOM   5895  O  OD2   . ASP C 2 300  ? 122.861 176.603 114.629 1.00 362.80 ? 300  ASP C OD2   1 
ATOM   5896  N  N     . GLU C 2 301  ? 122.124 176.487 111.547 1.00 350.01 ? 301  GLU C N     1 
ATOM   5897  C  CA    . GLU C 2 301  ? 120.687 176.133 111.407 1.00 350.01 ? 301  GLU C CA    1 
ATOM   5898  C  C     . GLU C 2 301  ? 119.901 176.216 112.727 1.00 350.01 ? 301  GLU C C     1 
ATOM   5899  O  O     . GLU C 2 301  ? 118.800 176.801 112.697 1.00 350.01 ? 301  GLU C O     1 
ATOM   5900  C  CB    . GLU C 2 301  ? 120.560 174.727 110.814 1.00 350.01 ? 301  GLU C CB    1 
ATOM   5901  C  CG    . GLU C 2 301  ? 121.148 173.643 111.699 1.00 350.01 ? 301  GLU C CG    1 
ATOM   5902  C  CD    . GLU C 2 301  ? 121.144 172.253 111.086 1.00 350.01 ? 301  GLU C CD    1 
ATOM   5903  O  OE1   . GLU C 2 301  ? 120.389 172.039 110.117 1.00 350.01 ? 301  GLU C OE1   1 
ATOM   5904  O  OE2   . GLU C 2 301  ? 121.896 171.390 111.579 1.00 350.01 ? 301  GLU C OE2   1 
ATOM   5905  N  N     . VAL C 2 302  ? 120.431 175.695 113.846 1.00 324.38 ? 302  VAL C N     1 
ATOM   5906  C  CA    . VAL C 2 302  ? 119.580 175.658 115.080 1.00 324.38 ? 302  VAL C CA    1 
ATOM   5907  C  C     . VAL C 2 302  ? 120.299 176.001 116.400 1.00 324.38 ? 302  VAL C C     1 
ATOM   5908  O  O     . VAL C 2 302  ? 120.020 175.300 117.393 1.00 324.38 ? 302  VAL C O     1 
ATOM   5909  C  CB    . VAL C 2 302  ? 118.817 174.322 115.186 1.00 324.38 ? 302  VAL C CB    1 
ATOM   5910  C  CG1   . VAL C 2 302  ? 119.760 173.149 115.410 1.00 324.38 ? 302  VAL C CG1   1 
ATOM   5911  C  CG2   . VAL C 2 302  ? 117.747 174.364 116.267 1.00 324.38 ? 302  VAL C CG2   1 
ATOM   5912  N  N     . PHE C 2 303  ? 121.189 176.997 116.443 1.00 301.99 ? 303  PHE C N     1 
ATOM   5913  C  CA    . PHE C 2 303  ? 121.779 177.371 117.728 1.00 301.99 ? 303  PHE C CA    1 
ATOM   5914  C  C     . PHE C 2 303  ? 120.896 178.198 118.645 1.00 301.99 ? 303  PHE C C     1 
ATOM   5915  O  O     . PHE C 2 303  ? 120.535 177.719 119.719 1.00 301.99 ? 303  PHE C O     1 
ATOM   5916  C  CB    . PHE C 2 303  ? 123.088 178.126 117.521 1.00 301.99 ? 303  PHE C CB    1 
ATOM   5917  C  CG    . PHE C 2 303  ? 124.275 177.234 117.377 1.00 301.99 ? 303  PHE C CG    1 
ATOM   5918  C  CD1   . PHE C 2 303  ? 124.155 175.865 117.562 1.00 301.99 ? 303  PHE C CD1   1 
ATOM   5919  C  CD2   . PHE C 2 303  ? 125.515 177.762 117.066 1.00 301.99 ? 303  PHE C CD2   1 
ATOM   5920  C  CE1   . PHE C 2 303  ? 125.246 175.042 117.430 1.00 301.99 ? 303  PHE C CE1   1 
ATOM   5921  C  CE2   . PHE C 2 303  ? 126.615 176.943 116.935 1.00 301.99 ? 303  PHE C CE2   1 
ATOM   5922  C  CZ    . PHE C 2 303  ? 126.481 175.581 117.116 1.00 301.99 ? 303  PHE C CZ    1 
ATOM   5923  N  N     . LEU C 2 304  ? 120.554 179.421 118.238 1.00 299.38 ? 304  LEU C N     1 
ATOM   5924  C  CA    . LEU C 2 304  ? 119.695 180.299 119.041 1.00 299.38 ? 304  LEU C CA    1 
ATOM   5925  C  C     . LEU C 2 304  ? 118.348 179.697 119.442 1.00 299.38 ? 304  LEU C C     1 
ATOM   5926  O  O     . LEU C 2 304  ? 117.931 179.942 120.581 1.00 299.38 ? 304  LEU C O     1 
ATOM   5927  C  CB    . LEU C 2 304  ? 119.511 181.634 118.301 1.00 299.38 ? 304  LEU C CB    1 
ATOM   5928  C  CG    . LEU C 2 304  ? 118.573 182.675 118.918 1.00 299.38 ? 304  LEU C CG    1 
ATOM   5929  C  CD1   . LEU C 2 304  ? 119.241 184.031 118.926 1.00 299.38 ? 304  LEU C CD1   1 
ATOM   5930  C  CD2   . LEU C 2 304  ? 117.237 182.745 118.178 1.00 299.38 ? 304  LEU C CD2   1 
ATOM   5931  N  N     . PRO C 2 305  ? 117.631 178.920 118.603 1.00 300.80 ? 305  PRO C N     1 
ATOM   5932  C  CA    . PRO C 2 305  ? 116.452 178.211 119.135 1.00 300.80 ? 305  PRO C CA    1 
ATOM   5933  C  C     . PRO C 2 305  ? 116.759 177.234 120.254 1.00 300.80 ? 305  PRO C C     1 
ATOM   5934  O  O     . PRO C 2 305  ? 116.016 177.178 121.245 1.00 300.80 ? 305  PRO C O     1 
ATOM   5935  C  CB    . PRO C 2 305  ? 115.898 177.500 117.901 1.00 300.80 ? 305  PRO C CB    1 
ATOM   5936  C  CG    . PRO C 2 305  ? 116.239 178.371 116.813 1.00 300.80 ? 305  PRO C CG    1 
ATOM   5937  C  CD    . PRO C 2 305  ? 117.603 178.873 117.124 1.00 300.80 ? 305  PRO C CD    1 
ATOM   5938  N  N     . THR C 2 306  ? 117.857 176.488 120.139 1.00 307.48 ? 306  THR C N     1 
ATOM   5939  C  CA    . THR C 2 306  ? 118.270 175.604 121.221 1.00 307.48 ? 306  THR C CA    1 
ATOM   5940  C  C     . THR C 2 306  ? 118.651 176.400 122.454 1.00 307.48 ? 306  THR C C     1 
ATOM   5941  O  O     . THR C 2 306  ? 118.411 175.971 123.585 1.00 307.48 ? 306  THR C O     1 
ATOM   5942  C  CB    . THR C 2 306  ? 119.445 174.738 120.779 1.00 307.48 ? 306  THR C CB    1 
ATOM   5943  O  OG1   . THR C 2 306  ? 120.528 175.577 120.360 1.00 307.48 ? 306  THR C OG1   1 
ATOM   5944  C  CG2   . THR C 2 306  ? 119.036 173.843 119.638 1.00 307.48 ? 306  THR C CG2   1 
ATOM   5945  N  N     . LEU C 2 307  ? 119.217 177.586 122.244 1.00 289.01 ? 307  LEU C N     1 
ATOM   5946  C  CA    . LEU C 2 307  ? 119.659 178.415 123.353 1.00 289.01 ? 307  LEU C CA    1 
ATOM   5947  C  C     . LEU C 2 307  ? 118.475 178.948 124.137 1.00 289.01 ? 307  LEU C C     1 
ATOM   5948  O  O     . LEU C 2 307  ? 118.429 178.829 125.363 1.00 289.01 ? 307  LEU C O     1 
ATOM   5949  C  CB    . LEU C 2 307  ? 120.527 179.551 122.826 1.00 289.01 ? 307  LEU C CB    1 
ATOM   5950  C  CG    . LEU C 2 307  ? 121.880 179.031 122.343 1.00 289.01 ? 307  LEU C CG    1 
ATOM   5951  C  CD1   . LEU C 2 307  ? 122.724 180.147 121.764 1.00 289.01 ? 307  LEU C CD1   1 
ATOM   5952  C  CD2   . LEU C 2 307  ? 122.624 178.292 123.449 1.00 289.01 ? 307  LEU C CD2   1 
ATOM   5953  N  N     . ARG C 2 308  ? 117.488 179.513 123.435 1.00 278.48 ? 308  ARG C N     1 
ATOM   5954  C  CA    . ARG C 2 308  ? 116.301 180.008 124.126 1.00 278.48 ? 308  ARG C CA    1 
ATOM   5955  C  C     . ARG C 2 308  ? 115.493 178.869 124.719 1.00 278.48 ? 308  ARG C C     1 
ATOM   5956  O  O     . ARG C 2 308  ? 114.856 179.049 125.758 1.00 278.48 ? 308  ARG C O     1 
ATOM   5957  C  CB    . ARG C 2 308  ? 115.425 180.863 123.200 1.00 278.48 ? 308  ARG C CB    1 
ATOM   5958  C  CG    . ARG C 2 308  ? 115.033 180.231 121.877 1.00 278.48 ? 308  ARG C CG    1 
ATOM   5959  C  CD    . ARG C 2 308  ? 113.704 179.496 121.889 1.00 278.48 ? 308  ARG C CD    1 
ATOM   5960  N  NE    . ARG C 2 308  ? 113.570 178.684 120.689 1.00 278.48 ? 308  ARG C NE    1 
ATOM   5961  C  CZ    . ARG C 2 308  ? 112.710 177.684 120.548 1.00 278.48 ? 308  ARG C CZ    1 
ATOM   5962  N  NH1   . ARG C 2 308  ? 111.893 177.370 121.540 1.00 278.48 ? 308  ARG C NH1   1 
ATOM   5963  N  NH2   . ARG C 2 308  ? 112.673 176.995 119.415 1.00 278.48 ? 308  ARG C NH2   1 
ATOM   5964  N  N     . TYR C 2 309  ? 115.530 177.692 124.091 1.00 271.31 ? 309  TYR C N     1 
ATOM   5965  C  CA    . TYR C 2 309  ? 114.866 176.533 124.664 1.00 271.31 ? 309  TYR C CA    1 
ATOM   5966  C  C     . TYR C 2 309  ? 115.529 176.122 125.966 1.00 271.31 ? 309  TYR C C     1 
ATOM   5967  O  O     . TYR C 2 309  ? 114.853 175.903 126.977 1.00 271.31 ? 309  TYR C O     1 
ATOM   5968  C  CB    . TYR C 2 309  ? 114.889 175.384 123.666 1.00 271.31 ? 309  TYR C CB    1 
ATOM   5969  C  CG    . TYR C 2 309  ? 113.727 174.447 123.815 1.00 271.31 ? 309  TYR C CG    1 
ATOM   5970  C  CD1   . TYR C 2 309  ? 112.636 174.529 122.965 1.00 271.31 ? 309  TYR C CD1   1 
ATOM   5971  C  CD2   . TYR C 2 309  ? 113.714 173.486 124.810 1.00 271.31 ? 309  TYR C CD2   1 
ATOM   5972  C  CE1   . TYR C 2 309  ? 111.567 173.677 123.101 1.00 271.31 ? 309  TYR C CE1   1 
ATOM   5973  C  CE2   . TYR C 2 309  ? 112.662 172.629 124.950 1.00 271.31 ? 309  TYR C CE2   1 
ATOM   5974  C  CZ    . TYR C 2 309  ? 111.584 172.729 124.098 1.00 271.31 ? 309  TYR C CZ    1 
ATOM   5975  O  OH    . TYR C 2 309  ? 110.522 171.868 124.240 1.00 271.31 ? 309  TYR C OH    1 
ATOM   5976  N  N     . LEU C 2 310  ? 116.859 176.062 125.962 1.00 259.33 ? 310  LEU C N     1 
ATOM   5977  C  CA    . LEU C 2 310  ? 117.609 175.683 127.147 1.00 259.33 ? 310  LEU C CA    1 
ATOM   5978  C  C     . LEU C 2 310  ? 117.466 176.717 128.245 1.00 259.33 ? 310  LEU C C     1 
ATOM   5979  O  O     . LEU C 2 310  ? 117.442 176.367 129.424 1.00 259.33 ? 310  LEU C O     1 
ATOM   5980  C  CB    . LEU C 2 310  ? 119.078 175.495 126.781 1.00 259.33 ? 310  LEU C CB    1 
ATOM   5981  C  CG    . LEU C 2 310  ? 120.087 175.216 127.896 1.00 259.33 ? 310  LEU C CG    1 
ATOM   5982  C  CD1   . LEU C 2 310  ? 119.728 173.948 128.650 1.00 259.33 ? 310  LEU C CD1   1 
ATOM   5983  C  CD2   . LEU C 2 310  ? 121.487 175.125 127.326 1.00 259.33 ? 310  LEU C CD2   1 
ATOM   5984  N  N     . PHE C 2 311  ? 117.321 177.984 127.879 1.00 289.40 ? 311  PHE C N     1 
ATOM   5985  C  CA    . PHE C 2 311  ? 117.268 179.035 128.885 1.00 289.40 ? 311  PHE C CA    1 
ATOM   5986  C  C     . PHE C 2 311  ? 115.861 179.219 129.431 1.00 289.40 ? 311  PHE C C     1 
ATOM   5987  O  O     . PHE C 2 311  ? 115.684 179.570 130.600 1.00 289.40 ? 311  PHE C O     1 
ATOM   5988  C  CB    . PHE C 2 311  ? 117.784 180.348 128.301 1.00 289.40 ? 311  PHE C CB    1 
ATOM   5989  C  CG    . PHE C 2 311  ? 119.233 180.319 127.922 1.00 289.40 ? 311  PHE C CG    1 
ATOM   5990  C  CD1   . PHE C 2 311  ? 120.104 179.392 128.483 1.00 289.40 ? 311  PHE C CD1   1 
ATOM   5991  C  CD2   . PHE C 2 311  ? 119.727 181.222 126.997 1.00 289.40 ? 311  PHE C CD2   1 
ATOM   5992  C  CE1   . PHE C 2 311  ? 121.431 179.366 128.125 1.00 289.40 ? 311  PHE C CE1   1 
ATOM   5993  C  CE2   . PHE C 2 311  ? 121.055 181.203 126.635 1.00 289.40 ? 311  PHE C CE2   1 
ATOM   5994  C  CZ    . PHE C 2 311  ? 121.910 180.275 127.201 1.00 289.40 ? 311  PHE C CZ    1 
ATOM   5995  N  N     . ALA C 2 312  ? 114.855 178.993 128.589 1.00 289.35 ? 312  ALA C N     1 
ATOM   5996  C  CA    . ALA C 2 312  ? 113.482 178.947 129.058 1.00 289.35 ? 312  ALA C CA    1 
ATOM   5997  C  C     . ALA C 2 312  ? 113.279 177.752 129.967 1.00 289.35 ? 312  ALA C C     1 
ATOM   5998  O  O     . ALA C 2 312  ? 112.547 177.823 130.957 1.00 289.35 ? 312  ALA C O     1 
ATOM   5999  C  CB    . ALA C 2 312  ? 112.542 178.883 127.859 1.00 289.35 ? 312  ALA C CB    1 
ATOM   6000  N  N     . LEU C 2 313  ? 113.937 176.640 129.642 1.00 289.71 ? 313  LEU C N     1 
ATOM   6001  C  CA    . LEU C 2 313  ? 113.959 175.501 130.543 1.00 289.71 ? 313  LEU C CA    1 
ATOM   6002  C  C     . LEU C 2 313  ? 114.720 175.831 131.815 1.00 289.71 ? 313  LEU C C     1 
ATOM   6003  O  O     . LEU C 2 313  ? 114.329 175.412 132.910 1.00 289.71 ? 313  LEU C O     1 
ATOM   6004  C  CB    . LEU C 2 313  ? 114.596 174.315 129.834 1.00 289.71 ? 313  LEU C CB    1 
ATOM   6005  C  CG    . LEU C 2 313  ? 114.594 173.003 130.598 1.00 289.71 ? 313  LEU C CG    1 
ATOM   6006  C  CD1   . LEU C 2 313  ? 113.178 172.628 130.993 1.00 289.71 ? 313  LEU C CD1   1 
ATOM   6007  C  CD2   . LEU C 2 313  ? 115.219 171.947 129.725 1.00 289.71 ? 313  LEU C CD2   1 
ATOM   6008  N  N     . THR C 2 314  ? 115.805 176.594 131.685 1.00 291.35 ? 314  THR C N     1 
ATOM   6009  C  CA    . THR C 2 314  ? 116.556 177.060 132.840 1.00 291.35 ? 314  THR C CA    1 
ATOM   6010  C  C     . THR C 2 314  ? 115.725 178.016 133.676 1.00 291.35 ? 314  THR C C     1 
ATOM   6011  O  O     . THR C 2 314  ? 115.842 178.035 134.906 1.00 291.35 ? 314  THR C O     1 
ATOM   6012  C  CB    . THR C 2 314  ? 117.847 177.733 132.377 1.00 291.35 ? 314  THR C CB    1 
ATOM   6013  O  OG1   . THR C 2 314  ? 118.463 176.933 131.363 1.00 291.35 ? 314  THR C OG1   1 
ATOM   6014  C  CG2   . THR C 2 314  ? 118.813 177.892 133.529 1.00 291.35 ? 314  THR C CG2   1 
ATOM   6015  N  N     . ALA C 2 315  ? 114.861 178.793 133.034 1.00 298.61 ? 315  ALA C N     1 
ATOM   6016  C  CA    . ALA C 2 315  ? 113.876 179.590 133.741 1.00 298.61 ? 315  ALA C CA    1 
ATOM   6017  C  C     . ALA C 2 315  ? 112.600 178.814 134.014 1.00 298.61 ? 315  ALA C C     1 
ATOM   6018  O  O     . ALA C 2 315  ? 111.676 179.356 134.625 1.00 298.61 ? 315  ALA C O     1 
ATOM   6019  C  CB    . ALA C 2 315  ? 113.558 180.859 132.957 1.00 298.61 ? 315  ALA C CB    1 
ATOM   6020  N  N     . GLY C 2 316  ? 112.525 177.562 133.568 1.00 298.02 ? 316  GLY C N     1 
ATOM   6021  C  CA    . GLY C 2 316  ? 111.335 176.762 133.794 1.00 298.02 ? 316  GLY C CA    1 
ATOM   6022  C  C     . GLY C 2 316  ? 110.144 177.221 132.990 1.00 298.02 ? 316  GLY C C     1 
ATOM   6023  O  O     . GLY C 2 316  ? 109.003 176.919 133.351 1.00 298.02 ? 316  GLY C O     1 
ATOM   6024  N  N     . VAL C 2 317  ? 110.380 177.953 131.912 1.00 292.68 ? 317  VAL C N     1 
ATOM   6025  C  CA    . VAL C 2 317  ? 109.275 178.495 131.122 1.00 292.68 ? 317  VAL C CA    1 
ATOM   6026  C  C     . VAL C 2 317  ? 108.658 177.369 130.303 1.00 292.68 ? 317  VAL C C     1 
ATOM   6027  O  O     . VAL C 2 317  ? 109.388 176.657 129.591 1.00 292.68 ? 317  VAL C O     1 
ATOM   6028  C  CB    . VAL C 2 317  ? 109.771 179.623 130.228 1.00 292.68 ? 317  VAL C CB    1 
ATOM   6029  C  CG1   . VAL C 2 317  ? 108.687 180.051 129.255 1.00 292.68 ? 317  VAL C CG1   1 
ATOM   6030  C  CG2   . VAL C 2 317  ? 110.238 180.786 131.083 1.00 292.68 ? 317  VAL C CG2   1 
ATOM   6031  N  N     . PRO C 2 318  ? 107.335 177.163 130.386 1.00 307.23 ? 318  PRO C N     1 
ATOM   6032  C  CA    . PRO C 2 318  ? 106.706 175.974 129.789 1.00 307.23 ? 318  PRO C CA    1 
ATOM   6033  C  C     . PRO C 2 318  ? 106.781 175.888 128.271 1.00 307.23 ? 318  PRO C C     1 
ATOM   6034  O  O     . PRO C 2 318  ? 107.178 176.841 127.593 1.00 307.23 ? 318  PRO C O     1 
ATOM   6035  C  CB    . PRO C 2 318  ? 105.252 176.085 130.261 1.00 307.23 ? 318  PRO C CB    1 
ATOM   6036  C  CG    . PRO C 2 318  ? 105.330 176.889 131.515 1.00 307.23 ? 318  PRO C CG    1 
ATOM   6037  C  CD    . PRO C 2 318  ? 106.410 177.890 131.270 1.00 307.23 ? 318  PRO C CD    1 
ATOM   6038  N  N     . GLY C 2 319  ? 106.382 174.734 127.738 1.00 298.63 ? 319  GLY C N     1 
ATOM   6039  C  CA    . GLY C 2 319  ? 106.753 174.340 126.399 1.00 298.63 ? 319  GLY C CA    1 
ATOM   6040  C  C     . GLY C 2 319  ? 108.146 173.773 126.302 1.00 298.63 ? 319  GLY C C     1 
ATOM   6041  O  O     . GLY C 2 319  ? 108.603 173.467 125.196 1.00 298.63 ? 319  GLY C O     1 
ATOM   6042  N  N     . HIS C 2 320  ? 108.831 173.622 127.429 1.00 297.82 ? 320  HIS C N     1 
ATOM   6043  C  CA    . HIS C 2 320  ? 110.228 173.226 127.471 1.00 297.82 ? 320  HIS C CA    1 
ATOM   6044  C  C     . HIS C 2 320  ? 110.374 172.143 128.521 1.00 297.82 ? 320  HIS C C     1 
ATOM   6045  O  O     . HIS C 2 320  ? 110.072 172.375 129.696 1.00 297.82 ? 320  HIS C O     1 
ATOM   6046  C  CB    . HIS C 2 320  ? 111.128 174.420 127.789 1.00 297.82 ? 320  HIS C CB    1 
ATOM   6047  C  CG    . HIS C 2 320  ? 110.890 175.601 126.904 1.00 297.82 ? 320  HIS C CG    1 
ATOM   6048  N  ND1   . HIS C 2 320  ? 109.834 176.469 127.085 1.00 297.82 ? 320  HIS C ND1   1 
ATOM   6049  C  CD2   . HIS C 2 320  ? 111.567 176.053 125.824 1.00 297.82 ? 320  HIS C CD2   1 
ATOM   6050  C  CE1   . HIS C 2 320  ? 109.873 177.404 126.152 1.00 297.82 ? 320  HIS C CE1   1 
ATOM   6051  N  NE2   . HIS C 2 320  ? 110.917 177.176 125.377 1.00 297.82 ? 320  HIS C NE2   1 
ATOM   6052  N  N     . GLU C 2 321  ? 110.835 170.969 128.100 1.00 261.86 ? 321  GLU C N     1 
ATOM   6053  C  CA    . GLU C 2 321  ? 110.883 169.811 128.980 1.00 261.86 ? 321  GLU C CA    1 
ATOM   6054  C  C     . GLU C 2 321  ? 111.907 168.828 128.437 1.00 261.86 ? 321  GLU C C     1 
ATOM   6055  O  O     . GLU C 2 321  ? 111.963 168.602 127.225 1.00 261.86 ? 321  GLU C O     1 
ATOM   6056  C  CB    . GLU C 2 321  ? 109.500 169.171 129.082 1.00 261.86 ? 321  GLU C CB    1 
ATOM   6057  C  CG    . GLU C 2 321  ? 109.403 168.049 130.071 1.00 261.86 ? 321  GLU C CG    1 
ATOM   6058  C  CD    . GLU C 2 321  ? 109.466 166.717 129.389 1.00 261.86 ? 321  GLU C CD    1 
ATOM   6059  O  OE1   . GLU C 2 321  ? 109.335 166.689 128.149 1.00 261.86 ? 321  GLU C OE1   1 
ATOM   6060  O  OE2   . GLU C 2 321  ? 109.666 165.700 130.080 1.00 261.86 ? 321  GLU C OE2   1 
ATOM   6061  N  N     . VAL C 2 322  ? 112.709 168.252 129.334 1.00 269.56 ? 322  VAL C N     1 
ATOM   6062  C  CA    . VAL C 2 322  ? 113.830 167.391 128.966 1.00 269.56 ? 322  VAL C CA    1 
ATOM   6063  C  C     . VAL C 2 322  ? 113.335 166.082 128.376 1.00 269.56 ? 322  VAL C C     1 
ATOM   6064  O  O     . VAL C 2 322  ? 112.217 165.641 128.650 1.00 269.56 ? 322  VAL C O     1 
ATOM   6065  C  CB    . VAL C 2 322  ? 114.736 167.118 130.176 1.00 269.56 ? 322  VAL C CB    1 
ATOM   6066  C  CG1   . VAL C 2 322  ? 115.512 168.361 130.534 1.00 269.56 ? 322  VAL C CG1   1 
ATOM   6067  C  CG2   . VAL C 2 322  ? 113.896 166.657 131.347 1.00 269.56 ? 322  VAL C CG2   1 
ATOM   6068  N  N     . ASP C 2 323  ? 114.171 165.439 127.579 1.00 281.19 ? 323  ASP C N     1 
ATOM   6069  C  CA    . ASP C 2 323  ? 113.757 164.274 126.822 1.00 281.19 ? 323  ASP C CA    1 
ATOM   6070  C  C     . ASP C 2 323  ? 114.173 163.003 127.545 1.00 281.19 ? 323  ASP C C     1 
ATOM   6071  O  O     . ASP C 2 323  ? 115.337 162.842 127.918 1.00 281.19 ? 323  ASP C O     1 
ATOM   6072  C  CB    . ASP C 2 323  ? 114.363 164.314 125.422 1.00 281.19 ? 323  ASP C CB    1 
ATOM   6073  C  CG    . ASP C 2 323  ? 114.023 165.593 124.687 1.00 281.19 ? 323  ASP C CG    1 
ATOM   6074  O  OD1   . ASP C 2 323  ? 112.984 166.205 125.012 1.00 281.19 ? 323  ASP C OD1   1 
ATOM   6075  O  OD2   . ASP C 2 323  ? 114.789 165.991 123.787 1.00 281.19 ? 323  ASP C OD2   1 
ATOM   6076  N  N     . ASP C 2 324  ? 113.212 162.111 127.752 1.00 268.78 ? 324  ASP C N     1 
ATOM   6077  C  CA    . ASP C 2 324  ? 113.487 160.749 128.190 1.00 268.78 ? 324  ASP C CA    1 
ATOM   6078  C  C     . ASP C 2 324  ? 113.799 159.918 126.960 1.00 268.78 ? 324  ASP C C     1 
ATOM   6079  O  O     . ASP C 2 324  ? 112.951 159.764 126.080 1.00 268.78 ? 324  ASP C O     1 
ATOM   6080  C  CB    . ASP C 2 324  ? 112.308 160.147 128.944 1.00 268.78 ? 324  ASP C CB    1 
ATOM   6081  C  CG    . ASP C 2 324  ? 112.385 158.631 129.015 1.00 268.78 ? 324  ASP C CG    1 
ATOM   6082  O  OD1   . ASP C 2 324  ? 113.240 158.100 129.751 1.00 268.78 ? 324  ASP C OD1   1 
ATOM   6083  O  OD2   . ASP C 2 324  ? 111.586 157.971 128.321 1.00 268.78 ? 324  ASP C OD2   1 
ATOM   6084  N  N     . ILE C 2 325  ? 115.007 159.357 126.917 1.00 254.59 ? 325  ILE C N     1 
ATOM   6085  C  CA    . ILE C 2 325  ? 115.410 158.556 125.774 1.00 254.59 ? 325  ILE C CA    1 
ATOM   6086  C  C     . ILE C 2 325  ? 114.656 157.236 125.726 1.00 254.59 ? 325  ILE C C     1 
ATOM   6087  O  O     . ILE C 2 325  ? 114.530 156.636 124.655 1.00 254.59 ? 325  ILE C O     1 
ATOM   6088  C  CB    . ILE C 2 325  ? 116.936 158.359 125.810 1.00 254.59 ? 325  ILE C CB    1 
ATOM   6089  C  CG1   . ILE C 2 325  ? 117.339 157.376 126.901 1.00 254.59 ? 325  ILE C CG1   1 
ATOM   6090  C  CG2   . ILE C 2 325  ? 117.605 159.673 126.113 1.00 254.59 ? 325  ILE C CG2   1 
ATOM   6091  C  CD1   . ILE C 2 325  ? 118.769 156.927 126.816 1.00 254.59 ? 325  ILE C CD1   1 
ATOM   6092  N  N     . ASP C 2 326  ? 114.096 156.797 126.857 1.00 278.85 ? 326  ASP C N     1 
ATOM   6093  C  CA    . ASP C 2 326  ? 113.355 155.544 126.891 1.00 278.85 ? 326  ASP C CA    1 
ATOM   6094  C  C     . ASP C 2 326  ? 111.993 155.684 126.232 1.00 278.85 ? 326  ASP C C     1 
ATOM   6095  O  O     . ASP C 2 326  ? 111.347 154.677 125.920 1.00 278.85 ? 326  ASP C O     1 
ATOM   6096  C  CB    . ASP C 2 326  ? 113.211 155.071 128.334 1.00 278.85 ? 326  ASP C CB    1 
ATOM   6097  C  CG    . ASP C 2 326  ? 112.803 153.621 128.431 1.00 278.85 ? 326  ASP C CG    1 
ATOM   6098  O  OD1   . ASP C 2 326  ? 113.033 152.877 127.458 1.00 278.85 ? 326  ASP C OD1   1 
ATOM   6099  O  OD2   . ASP C 2 326  ? 112.250 153.221 129.475 1.00 278.85 ? 326  ASP C OD2   1 
ATOM   6100  N  N     . HIS C 2 327  ? 111.525 156.912 126.036 1.00 253.24 ? 327  HIS C N     1 
ATOM   6101  C  CA    . HIS C 2 327  ? 110.439 157.125 125.097 1.00 253.24 ? 327  HIS C CA    1 
ATOM   6102  C  C     . HIS C 2 327  ? 110.910 156.724 123.712 1.00 253.24 ? 327  HIS C C     1 
ATOM   6103  O  O     . HIS C 2 327  ? 112.000 157.099 123.274 1.00 253.24 ? 327  HIS C O     1 
ATOM   6104  C  CB    . HIS C 2 327  ? 109.991 158.578 125.100 1.00 253.24 ? 327  HIS C CB    1 
ATOM   6105  C  CG    . HIS C 2 327  ? 108.981 158.894 124.046 1.00 253.24 ? 327  HIS C CG    1 
ATOM   6106  N  ND1   . HIS C 2 327  ? 109.328 159.333 122.787 1.00 253.24 ? 327  HIS C ND1   1 
ATOM   6107  C  CD2   . HIS C 2 327  ? 107.629 158.839 124.065 1.00 253.24 ? 327  HIS C CD2   1 
ATOM   6108  C  CE1   . HIS C 2 327  ? 108.233 159.534 122.077 1.00 253.24 ? 327  HIS C CE1   1 
ATOM   6109  N  NE2   . HIS C 2 327  ? 107.188 159.240 122.828 1.00 253.24 ? 327  HIS C NE2   1 
ATOM   6110  N  N     . LEU C 2 328  ? 110.080 155.949 123.026 1.00 236.18 ? 328  LEU C N     1 
ATOM   6111  C  CA    . LEU C 2 328  ? 110.572 155.215 121.873 1.00 236.18 ? 328  LEU C CA    1 
ATOM   6112  C  C     . LEU C 2 328  ? 110.717 156.101 120.652 1.00 236.18 ? 328  LEU C C     1 
ATOM   6113  O  O     . LEU C 2 328  ? 111.413 155.730 119.705 1.00 236.18 ? 328  LEU C O     1 
ATOM   6114  C  CB    . LEU C 2 328  ? 109.646 154.048 121.585 1.00 236.18 ? 328  LEU C CB    1 
ATOM   6115  C  CG    . LEU C 2 328  ? 109.505 153.080 122.756 1.00 236.18 ? 328  LEU C CG    1 
ATOM   6116  C  CD1   . LEU C 2 328  ? 108.770 151.864 122.291 1.00 236.18 ? 328  LEU C CD1   1 
ATOM   6117  C  CD2   . LEU C 2 328  ? 110.857 152.683 123.316 1.00 236.18 ? 328  LEU C CD2   1 
ATOM   6118  N  N     . GLY C 2 329  ? 110.100 157.280 120.665 1.00 254.34 ? 329  GLY C N     1 
ATOM   6119  C  CA    . GLY C 2 329  ? 110.289 158.236 119.590 1.00 254.34 ? 329  GLY C CA    1 
ATOM   6120  C  C     . GLY C 2 329  ? 111.683 158.810 119.513 1.00 254.34 ? 329  GLY C C     1 
ATOM   6121  O  O     . GLY C 2 329  ? 112.038 159.398 118.487 1.00 254.34 ? 329  GLY C O     1 
ATOM   6122  N  N     . ASN C 2 330  ? 112.475 158.661 120.564 1.00 261.37 ? 330  ASN C N     1 
ATOM   6123  C  CA    . ASN C 2 330  ? 113.884 159.005 120.530 1.00 261.37 ? 330  ASN C CA    1 
ATOM   6124  C  C     . ASN C 2 330  ? 114.737 157.880 119.985 1.00 261.37 ? 330  ASN C C     1 
ATOM   6125  O  O     . ASN C 2 330  ? 115.953 158.038 119.890 1.00 261.37 ? 330  ASN C O     1 
ATOM   6126  C  CB    . ASN C 2 330  ? 114.350 159.357 121.933 1.00 261.37 ? 330  ASN C CB    1 
ATOM   6127  C  CG    . ASN C 2 330  ? 113.416 160.307 122.608 1.00 261.37 ? 330  ASN C CG    1 
ATOM   6128  O  OD1   . ASN C 2 330  ? 113.060 161.342 122.053 1.00 261.37 ? 330  ASN C OD1   1 
ATOM   6129  N  ND2   . ASN C 2 330  ? 112.961 159.939 123.789 1.00 261.37 ? 330  ASN C ND2   1 
ATOM   6130  N  N     . ARG C 2 331  ? 114.120 156.762 119.613 1.00 243.15 ? 331  ARG C N     1 
ATOM   6131  C  CA    . ARG C 2 331  ? 114.823 155.540 119.257 1.00 243.15 ? 331  ARG C CA    1 
ATOM   6132  C  C     . ARG C 2 331  ? 114.373 155.099 117.876 1.00 243.15 ? 331  ARG C C     1 
ATOM   6133  O  O     . ARG C 2 331  ? 113.183 154.857 117.660 1.00 243.15 ? 331  ARG C O     1 
ATOM   6134  C  CB    . ARG C 2 331  ? 114.542 154.450 120.284 1.00 243.15 ? 331  ARG C CB    1 
ATOM   6135  C  CG    . ARG C 2 331  ? 114.909 154.866 121.678 1.00 243.15 ? 331  ARG C CG    1 
ATOM   6136  C  CD    . ARG C 2 331  ? 114.385 153.907 122.708 1.00 243.15 ? 331  ARG C CD    1 
ATOM   6137  N  NE    . ARG C 2 331  ? 114.839 154.288 124.038 1.00 243.15 ? 331  ARG C NE    1 
ATOM   6138  C  CZ    . ARG C 2 331  ? 116.021 153.949 124.547 1.00 243.15 ? 331  ARG C CZ    1 
ATOM   6139  N  NH1   . ARG C 2 331  ? 116.352 154.346 125.766 1.00 243.15 ? 331  ARG C NH1   1 
ATOM   6140  N  NH2   . ARG C 2 331  ? 116.873 153.219 123.841 1.00 243.15 ? 331  ARG C NH2   1 
ATOM   6141  N  N     . ARG C 2 332  ? 115.310 154.990 116.946 1.00 235.33 ? 332  ARG C N     1 
ATOM   6142  C  CA    . ARG C 2 332  ? 114.950 154.686 115.572 1.00 235.33 ? 332  ARG C CA    1 
ATOM   6143  C  C     . ARG C 2 332  ? 115.514 153.348 115.128 1.00 235.33 ? 332  ARG C C     1 
ATOM   6144  O  O     . ARG C 2 332  ? 116.412 152.776 115.748 1.00 235.33 ? 332  ARG C O     1 
ATOM   6145  C  CB    . ARG C 2 332  ? 115.432 155.774 114.617 1.00 235.33 ? 332  ARG C CB    1 
ATOM   6146  C  CG    . ARG C 2 332  ? 116.907 155.731 114.350 1.00 235.33 ? 332  ARG C CG    1 
ATOM   6147  C  CD    . ARG C 2 332  ? 117.249 156.603 113.173 1.00 235.33 ? 332  ARG C CD    1 
ATOM   6148  N  NE    . ARG C 2 332  ? 116.218 156.548 112.145 1.00 235.33 ? 332  ARG C NE    1 
ATOM   6149  C  CZ    . ARG C 2 332  ? 116.190 155.643 111.176 1.00 235.33 ? 332  ARG C CZ    1 
ATOM   6150  N  NH1   . ARG C 2 332  ? 117.138 154.722 111.110 1.00 235.33 ? 332  ARG C NH1   1 
ATOM   6151  N  NH2   . ARG C 2 332  ? 115.220 155.659 110.276 1.00 235.33 ? 332  ARG C NH2   1 
ATOM   6152  N  N     . ILE C 2 333  ? 115.001 152.893 114.019 1.00 241.57 ? 333  ILE C N     1 
ATOM   6153  C  CA    . ILE C 2 333  ? 115.248 151.552 113.518 1.00 241.57 ? 333  ILE C CA    1 
ATOM   6154  C  C     . ILE C 2 333  ? 116.330 151.605 112.458 1.00 241.57 ? 333  ILE C C     1 
ATOM   6155  O  O     . ILE C 2 333  ? 116.380 152.515 111.629 1.00 241.57 ? 333  ILE C O     1 
ATOM   6156  C  CB    . ILE C 2 333  ? 113.956 150.942 112.945 1.00 241.57 ? 333  ILE C CB    1 
ATOM   6157  C  CG1   . ILE C 2 333  ? 112.765 151.296 113.829 1.00 241.57 ? 333  ILE C CG1   1 
ATOM   6158  C  CG2   . ILE C 2 333  ? 114.093 149.442 112.794 1.00 241.57 ? 333  ILE C CG2   1 
ATOM   6159  C  CD1   . ILE C 2 333  ? 112.815 150.678 115.200 1.00 241.57 ? 333  ILE C CD1   1 
ATOM   6160  N  N     . ARG C 2 334  ? 117.203 150.609 112.479 1.00 268.21 ? 334  ARG C N     1 
ATOM   6161  C  CA    . ARG C 2 334  ? 118.123 150.371 111.381 1.00 268.21 ? 334  ARG C CA    1 
ATOM   6162  C  C     . ARG C 2 334  ? 117.765 149.032 110.769 1.00 268.21 ? 334  ARG C C     1 
ATOM   6163  O  O     . ARG C 2 334  ? 117.778 148.010 111.460 1.00 268.21 ? 334  ARG C O     1 
ATOM   6164  C  CB    . ARG C 2 334  ? 119.567 150.386 111.866 1.00 268.21 ? 334  ARG C CB    1 
ATOM   6165  C  CG    . ARG C 2 334  ? 119.955 151.701 112.492 1.00 268.21 ? 334  ARG C CG    1 
ATOM   6166  C  CD    . ARG C 2 334  ? 121.403 151.678 112.921 1.00 268.21 ? 334  ARG C CD    1 
ATOM   6167  N  NE    . ARG C 2 334  ? 122.295 151.608 111.771 1.00 268.21 ? 334  ARG C NE    1 
ATOM   6168  C  CZ    . ARG C 2 334  ? 123.618 151.688 111.845 1.00 268.21 ? 334  ARG C CZ    1 
ATOM   6169  N  NH1   . ARG C 2 334  ? 124.214 151.843 113.019 1.00 268.21 ? 334  ARG C NH1   1 
ATOM   6170  N  NH2   . ARG C 2 334  ? 124.347 151.614 110.741 1.00 268.21 ? 334  ARG C NH2   1 
ATOM   6171  N  N     . THR C 2 335  ? 117.430 149.044 109.486 1.00 264.46 ? 335  THR C N     1 
ATOM   6172  C  CA    . THR C 2 335  ? 117.108 147.843 108.737 1.00 264.46 ? 335  THR C CA    1 
ATOM   6173  C  C     . THR C 2 335  ? 118.255 147.515 107.801 1.00 264.46 ? 335  THR C C     1 
ATOM   6174  O  O     . THR C 2 335  ? 119.289 148.179 107.805 1.00 264.46 ? 335  THR C O     1 
ATOM   6175  C  CB    . THR C 2 335  ? 115.829 148.019 107.930 1.00 264.46 ? 335  THR C CB    1 
ATOM   6176  O  OG1   . THR C 2 335  ? 116.058 149.003 106.916 1.00 264.46 ? 335  THR C OG1   1 
ATOM   6177  C  CG2   . THR C 2 335  ? 114.722 148.480 108.836 1.00 264.46 ? 335  THR C CG2   1 
ATOM   6178  N  N     . VAL C 2 336  ? 118.027 146.500 106.965 1.00 270.66 ? 336  VAL C N     1 
ATOM   6179  C  CA    . VAL C 2 336  ? 119.110 145.896 106.192 1.00 270.66 ? 336  VAL C CA    1 
ATOM   6180  C  C     . VAL C 2 336  ? 119.647 146.866 105.148 1.00 270.66 ? 336  VAL C C     1 
ATOM   6181  O  O     . VAL C 2 336  ? 120.865 146.976 104.951 1.00 270.66 ? 336  VAL C O     1 
ATOM   6182  C  CB    . VAL C 2 336  ? 118.639 144.573 105.561 1.00 270.66 ? 336  VAL C CB    1 
ATOM   6183  C  CG1   . VAL C 2 336  ? 118.568 143.515 106.619 1.00 270.66 ? 336  VAL C CG1   1 
ATOM   6184  C  CG2   . VAL C 2 336  ? 117.263 144.719 104.930 1.00 270.66 ? 336  VAL C CG2   1 
ATOM   6185  N  N     . GLY C 2 337  ? 118.746 147.613 104.503 1.00 281.29 ? 337  GLY C N     1 
ATOM   6186  C  CA    . GLY C 2 337  ? 119.164 148.548 103.474 1.00 281.29 ? 337  GLY C CA    1 
ATOM   6187  C  C     . GLY C 2 337  ? 119.976 149.686 104.046 1.00 281.29 ? 337  GLY C C     1 
ATOM   6188  O  O     . GLY C 2 337  ? 120.954 150.134 103.442 1.00 281.29 ? 337  GLY C O     1 
ATOM   6189  N  N     . GLU C 2 338  ? 119.604 150.122 105.249 1.00 281.27 ? 338  GLU C N     1 
ATOM   6190  C  CA    . GLU C 2 338  ? 120.364 151.111 105.999 1.00 281.27 ? 338  GLU C CA    1 
ATOM   6191  C  C     . GLU C 2 338  ? 121.789 150.638 106.245 1.00 281.27 ? 338  GLU C C     1 
ATOM   6192  O  O     . GLU C 2 338  ? 122.753 151.370 106.000 1.00 281.27 ? 338  GLU C O     1 
ATOM   6193  C  CB    . GLU C 2 338  ? 119.646 151.365 107.319 1.00 281.27 ? 338  GLU C CB    1 
ATOM   6194  C  CG    . GLU C 2 338  ? 119.744 152.746 107.881 1.00 281.27 ? 338  GLU C CG    1 
ATOM   6195  C  CD    . GLU C 2 338  ? 118.681 152.974 108.928 1.00 281.27 ? 338  GLU C CD    1 
ATOM   6196  O  OE1   . GLU C 2 338  ? 117.593 152.382 108.794 1.00 281.27 ? 338  GLU C OE1   1 
ATOM   6197  O  OE2   . GLU C 2 338  ? 118.931 153.722 109.894 1.00 281.27 ? 338  GLU C OE2   1 
ATOM   6198  N  N     . LEU C 2 339  ? 121.934 149.380 106.657 1.00 282.84 ? 339  LEU C N     1 
ATOM   6199  C  CA    . LEU C 2 339  ? 123.244 148.863 107.031 1.00 282.84 ? 339  LEU C CA    1 
ATOM   6200  C  C     . LEU C 2 339  ? 124.137 148.670 105.818 1.00 282.84 ? 339  LEU C C     1 
ATOM   6201  O  O     . LEU C 2 339  ? 125.338 148.982 105.862 1.00 282.84 ? 339  LEU C O     1 
ATOM   6202  C  CB    . LEU C 2 339  ? 123.082 147.548 107.774 1.00 282.84 ? 339  LEU C CB    1 
ATOM   6203  C  CG    . LEU C 2 339  ? 122.238 147.701 109.025 1.00 282.84 ? 339  LEU C CG    1 
ATOM   6204  C  CD1   . LEU C 2 339  ? 121.565 146.386 109.349 1.00 282.84 ? 339  LEU C CD1   1 
ATOM   6205  C  CD2   . LEU C 2 339  ? 123.075 148.199 110.179 1.00 282.84 ? 339  LEU C CD2   1 
ATOM   6206  N  N     . MET C 2 340  ? 123.578 148.141 104.730 1.00 289.61 ? 340  MET C N     1 
ATOM   6207  C  CA    . MET C 2 340  ? 124.401 147.972 103.541 1.00 289.61 ? 340  MET C CA    1 
ATOM   6208  C  C     . MET C 2 340  ? 124.725 149.316 102.916 1.00 289.61 ? 340  MET C C     1 
ATOM   6209  O  O     . MET C 2 340  ? 125.791 149.475 102.320 1.00 289.61 ? 340  MET C O     1 
ATOM   6210  C  CB    . MET C 2 340  ? 123.738 147.038 102.529 1.00 289.61 ? 340  MET C CB    1 
ATOM   6211  C  CG    . MET C 2 340  ? 122.338 147.391 102.123 1.00 289.61 ? 340  MET C CG    1 
ATOM   6212  S  SD    . MET C 2 340  ? 122.220 148.502 100.724 1.00 289.61 ? 340  MET C SD    1 
ATOM   6213  C  CE    . MET C 2 340  ? 123.020 147.526 99.461  1.00 289.61 ? 340  MET C CE    1 
ATOM   6214  N  N     . THR C 2 341  ? 123.845 150.310 103.094 1.00 289.40 ? 341  THR C N     1 
ATOM   6215  C  CA    . THR C 2 341  ? 124.178 151.674 102.700 1.00 289.40 ? 341  THR C CA    1 
ATOM   6216  C  C     . THR C 2 341  ? 125.358 152.201 103.497 1.00 289.40 ? 341  THR C C     1 
ATOM   6217  O  O     . THR C 2 341  ? 126.260 152.830 102.935 1.00 289.40 ? 341  THR C O     1 
ATOM   6218  C  CB    . THR C 2 341  ? 122.972 152.588 102.895 1.00 289.40 ? 341  THR C CB    1 
ATOM   6219  O  OG1   . THR C 2 341  ? 121.800 151.954 102.376 1.00 289.40 ? 341  THR C OG1   1 
ATOM   6220  C  CG2   . THR C 2 341  ? 123.187 153.904 102.175 1.00 289.40 ? 341  THR C CG2   1 
ATOM   6221  N  N     . ASP C 2 342  ? 125.384 151.910 104.798 1.00 297.38 ? 342  ASP C N     1 
ATOM   6222  C  CA    . ASP C 2 342  ? 126.466 152.378 105.659 1.00 297.38 ? 342  ASP C CA    1 
ATOM   6223  C  C     . ASP C 2 342  ? 127.800 151.771 105.256 1.00 297.38 ? 342  ASP C C     1 
ATOM   6224  O  O     . ASP C 2 342  ? 128.772 152.489 104.986 1.00 297.38 ? 342  ASP C O     1 
ATOM   6225  C  CB    . ASP C 2 342  ? 126.154 152.033 107.110 1.00 297.38 ? 342  ASP C CB    1 
ATOM   6226  C  CG    . ASP C 2 342  ? 124.948 152.765 107.627 1.00 297.38 ? 342  ASP C CG    1 
ATOM   6227  O  OD1   . ASP C 2 342  ? 124.767 153.940 107.249 1.00 297.38 ? 342  ASP C OD1   1 
ATOM   6228  O  OD2   . ASP C 2 342  ? 124.170 152.163 108.396 1.00 297.38 ? 342  ASP C OD2   1 
ATOM   6229  N  N     . GLN C 2 343  ? 127.850 150.442 105.184 1.00 283.19 ? 343  GLN C N     1 
ATOM   6230  C  CA    . GLN C 2 343  ? 129.105 149.780 104.846 1.00 283.19 ? 343  GLN C CA    1 
ATOM   6231  C  C     . GLN C 2 343  ? 129.490 150.035 103.402 1.00 283.19 ? 343  GLN C C     1 
ATOM   6232  O  O     . GLN C 2 343  ? 130.682 150.066 103.069 1.00 283.19 ? 343  GLN C O     1 
ATOM   6233  C  CB    . GLN C 2 343  ? 129.006 148.283 105.104 1.00 283.19 ? 343  GLN C CB    1 
ATOM   6234  C  CG    . GLN C 2 343  ? 129.233 147.905 106.538 1.00 283.19 ? 343  GLN C CG    1 
ATOM   6235  C  CD    . GLN C 2 343  ? 128.051 148.233 107.403 1.00 283.19 ? 343  GLN C CD    1 
ATOM   6236  O  OE1   . GLN C 2 343  ? 128.155 149.018 108.338 1.00 283.19 ? 343  GLN C OE1   1 
ATOM   6237  N  NE2   . GLN C 2 343  ? 126.908 147.651 107.084 1.00 283.19 ? 343  GLN C NE2   1 
ATOM   6238  N  N     . PHE C 2 344  ? 128.493 150.259 102.549 1.00 275.14 ? 344  PHE C N     1 
ATOM   6239  C  CA    . PHE C 2 344  ? 128.737 150.689 101.189 1.00 275.14 ? 344  PHE C CA    1 
ATOM   6240  C  C     . PHE C 2 344  ? 129.426 152.036 101.175 1.00 275.14 ? 344  PHE C C     1 
ATOM   6241  O  O     . PHE C 2 344  ? 130.371 152.241 100.418 1.00 275.14 ? 344  PHE C O     1 
ATOM   6242  C  CB    . PHE C 2 344  ? 127.405 150.735 100.447 1.00 275.14 ? 344  PHE C CB    1 
ATOM   6243  C  CG    . PHE C 2 344  ? 127.481 151.353 99.096  1.00 275.14 ? 344  PHE C CG    1 
ATOM   6244  C  CD1   . PHE C 2 344  ? 126.615 152.367 98.742  1.00 275.14 ? 344  PHE C CD1   1 
ATOM   6245  C  CD2   . PHE C 2 344  ? 128.402 150.913 98.167  1.00 275.14 ? 344  PHE C CD2   1 
ATOM   6246  C  CE1   . PHE C 2 344  ? 126.667 152.934 97.485  1.00 275.14 ? 344  PHE C CE1   1 
ATOM   6247  C  CE2   . PHE C 2 344  ? 128.468 151.485 96.915  1.00 275.14 ? 344  PHE C CE2   1 
ATOM   6248  C  CZ    . PHE C 2 344  ? 127.599 152.497 96.576  1.00 275.14 ? 344  PHE C CZ    1 
ATOM   6249  N  N     . ARG C 2 345  ? 128.998 152.947 102.046 1.00 290.18 ? 345  ARG C N     1 
ATOM   6250  C  CA    . ARG C 2 345  ? 129.636 154.254 102.118 1.00 290.18 ? 345  ARG C CA    1 
ATOM   6251  C  C     . ARG C 2 345  ? 131.050 154.162 102.658 1.00 290.18 ? 345  ARG C C     1 
ATOM   6252  O  O     . ARG C 2 345  ? 131.919 154.931 102.242 1.00 290.18 ? 345  ARG C O     1 
ATOM   6253  C  CB    . ARG C 2 345  ? 128.825 155.188 102.999 1.00 290.18 ? 345  ARG C CB    1 
ATOM   6254  C  CG    . ARG C 2 345  ? 127.574 155.727 102.362 1.00 290.18 ? 345  ARG C CG    1 
ATOM   6255  C  CD    . ARG C 2 345  ? 126.778 156.545 103.365 1.00 290.18 ? 345  ARG C CD    1 
ATOM   6256  N  NE    . ARG C 2 345  ? 126.565 155.844 104.632 1.00 290.18 ? 345  ARG C NE    1 
ATOM   6257  C  CZ    . ARG C 2 345  ? 127.089 156.225 105.795 1.00 290.18 ? 345  ARG C CZ    1 
ATOM   6258  N  NH1   . ARG C 2 345  ? 127.871 157.294 105.850 1.00 290.18 ? 345  ARG C NH1   1 
ATOM   6259  N  NH2   . ARG C 2 345  ? 126.844 155.533 106.898 1.00 290.18 ? 345  ARG C NH2   1 
ATOM   6260  N  N     . VAL C 2 346  ? 131.293 153.242 103.589 1.00 278.73 ? 346  VAL C N     1 
ATOM   6261  C  CA    . VAL C 2 346  ? 132.651 153.056 104.101 1.00 278.73 ? 346  VAL C CA    1 
ATOM   6262  C  C     . VAL C 2 346  ? 133.564 152.526 103.006 1.00 278.73 ? 346  VAL C C     1 
ATOM   6263  O  O     . VAL C 2 346  ? 134.703 152.988 102.834 1.00 278.73 ? 346  VAL C O     1 
ATOM   6264  C  CB    . VAL C 2 346  ? 132.646 152.126 105.324 1.00 278.73 ? 346  VAL C CB    1 
ATOM   6265  C  CG1   . VAL C 2 346  ? 134.034 152.041 105.916 1.00 278.73 ? 346  VAL C CG1   1 
ATOM   6266  C  CG2   . VAL C 2 346  ? 131.703 152.659 106.367 1.00 278.73 ? 346  VAL C CG2   1 
ATOM   6267  N  N     . GLY C 2 347  ? 133.070 151.554 102.240 1.00 286.64 ? 347  GLY C N     1 
ATOM   6268  C  CA    . GLY C 2 347  ? 133.835 151.069 101.109 1.00 286.64 ? 347  GLY C CA    1 
ATOM   6269  C  C     . GLY C 2 347  ? 134.022 152.134 100.048 1.00 286.64 ? 347  GLY C C     1 
ATOM   6270  O  O     . GLY C 2 347  ? 135.083 152.224 99.430  1.00 286.64 ? 347  GLY C O     1 
ATOM   6271  N  N     . LEU C 2 348  ? 133.013 152.988 99.870  1.00 295.39 ? 348  LEU C N     1 
ATOM   6272  C  CA    . LEU C 2 348  ? 133.130 154.132 98.978  1.00 295.39 ? 348  LEU C CA    1 
ATOM   6273  C  C     . LEU C 2 348  ? 134.190 155.096 99.464  1.00 295.39 ? 348  LEU C C     1 
ATOM   6274  O  O     . LEU C 2 348  ? 134.872 155.730 98.662  1.00 295.39 ? 348  LEU C O     1 
ATOM   6275  C  CB    . LEU C 2 348  ? 131.799 154.869 98.883  1.00 295.39 ? 348  LEU C CB    1 
ATOM   6276  C  CG    . LEU C 2 348  ? 130.664 154.349 98.012  1.00 295.39 ? 348  LEU C CG    1 
ATOM   6277  C  CD1   . LEU C 2 348  ? 129.393 155.090 98.384  1.00 295.39 ? 348  LEU C CD1   1 
ATOM   6278  C  CD2   . LEU C 2 348  ? 130.983 154.487 96.546  1.00 295.39 ? 348  LEU C CD2   1 
ATOM   6279  N  N     . ALA C 2 349  ? 134.331 155.227 100.779 1.00 297.88 ? 349  ALA C N     1 
ATOM   6280  C  CA    . ALA C 2 349  ? 135.345 156.114 101.328 1.00 297.88 ? 349  ALA C CA    1 
ATOM   6281  C  C     . ALA C 2 349  ? 136.737 155.556 101.090 1.00 297.88 ? 349  ALA C C     1 
ATOM   6282  O  O     . ALA C 2 349  ? 137.674 156.311 100.795 1.00 297.88 ? 349  ALA C O     1 
ATOM   6283  C  CB    . ALA C 2 349  ? 135.098 156.326 102.818 1.00 297.88 ? 349  ALA C CB    1 
ATOM   6284  N  N     . ARG C 2 350  ? 136.880 154.234 101.215 1.00 302.48 ? 350  ARG C N     1 
ATOM   6285  C  CA    . ARG C 2 350  ? 138.150 153.599 100.874 1.00 302.48 ? 350  ARG C CA    1 
ATOM   6286  C  C     . ARG C 2 350  ? 138.453 153.764 99.392  1.00 302.48 ? 350  ARG C C     1 
ATOM   6287  O  O     . ARG C 2 350  ? 139.600 154.026 99.007  1.00 302.48 ? 350  ARG C O     1 
ATOM   6288  C  CB    . ARG C 2 350  ? 138.130 152.123 101.263 1.00 302.48 ? 350  ARG C CB    1 
ATOM   6289  C  CG    . ARG C 2 350  ? 138.428 151.871 102.738 1.00 302.48 ? 350  ARG C CG    1 
ATOM   6290  C  CD    . ARG C 2 350  ? 139.910 152.052 103.077 1.00 302.48 ? 350  ARG C CD    1 
ATOM   6291  N  NE    . ARG C 2 350  ? 140.261 151.477 104.380 1.00 302.48 ? 350  ARG C NE    1 
ATOM   6292  C  CZ    . ARG C 2 350  ? 140.884 152.133 105.357 1.00 302.48 ? 350  ARG C CZ    1 
ATOM   6293  N  NH1   . ARG C 2 350  ? 141.241 153.399 105.192 1.00 302.48 ? 350  ARG C NH1   1 
ATOM   6294  N  NH2   . ARG C 2 350  ? 141.159 151.523 106.502 1.00 302.48 ? 350  ARG C NH2   1 
ATOM   6295  N  N     . LEU C 2 351  ? 137.420 153.685 98.555  1.00 294.30 ? 351  LEU C N     1 
ATOM   6296  C  CA    . LEU C 2 351  ? 137.601 153.946 97.133  1.00 294.30 ? 351  LEU C CA    1 
ATOM   6297  C  C     . LEU C 2 351  ? 137.940 155.404 96.882  1.00 294.30 ? 351  LEU C C     1 
ATOM   6298  O  O     . LEU C 2 351  ? 138.703 155.718 95.969  1.00 294.30 ? 351  LEU C O     1 
ATOM   6299  C  CB    . LEU C 2 351  ? 136.346 153.566 96.352  1.00 294.30 ? 351  LEU C CB    1 
ATOM   6300  C  CG    . LEU C 2 351  ? 135.928 152.098 96.317  1.00 294.30 ? 351  LEU C CG    1 
ATOM   6301  C  CD1   . LEU C 2 351  ? 135.020 151.825 95.140  1.00 294.30 ? 351  LEU C CD1   1 
ATOM   6302  C  CD2   . LEU C 2 351  ? 137.124 151.177 96.305  1.00 294.30 ? 351  LEU C CD2   1 
ATOM   6303  N  N     . ALA C 2 352  ? 137.392 156.302 97.695  1.00 297.29 ? 352  ALA C N     1 
ATOM   6304  C  CA    . ALA C 2 352  ? 137.609 157.727 97.499  1.00 297.29 ? 352  ALA C CA    1 
ATOM   6305  C  C     . ALA C 2 352  ? 139.042 158.098 97.817  1.00 297.29 ? 352  ALA C C     1 
ATOM   6306  O  O     . ALA C 2 352  ? 139.689 158.818 97.051  1.00 297.29 ? 352  ALA C O     1 
ATOM   6307  C  CB    . ALA C 2 352  ? 136.641 158.526 98.367  1.00 297.29 ? 352  ALA C CB    1 
ATOM   6308  N  N     . ARG C 2 353  ? 139.569 157.576 98.923  1.00 312.68 ? 353  ARG C N     1 
ATOM   6309  C  CA    . ARG C 2 353  ? 140.964 157.844 99.243  1.00 312.68 ? 353  ARG C CA    1 
ATOM   6310  C  C     . ARG C 2 353  ? 141.894 157.125 98.274  1.00 312.68 ? 353  ARG C C     1 
ATOM   6311  O  O     . ARG C 2 353  ? 142.940 157.669 97.900  1.00 312.68 ? 353  ARG C O     1 
ATOM   6312  C  CB    . ARG C 2 353  ? 141.271 157.483 100.699 1.00 312.68 ? 353  ARG C CB    1 
ATOM   6313  C  CG    . ARG C 2 353  ? 140.962 156.067 101.124 1.00 312.68 ? 353  ARG C CG    1 
ATOM   6314  C  CD    . ARG C 2 353  ? 140.424 156.011 102.556 1.00 312.68 ? 353  ARG C CD    1 
ATOM   6315  N  NE    . ARG C 2 353  ? 141.352 156.556 103.542 1.00 312.68 ? 353  ARG C NE    1 
ATOM   6316  C  CZ    . ARG C 2 353  ? 141.095 156.630 104.845 1.00 312.68 ? 353  ARG C CZ    1 
ATOM   6317  N  NH1   . ARG C 2 353  ? 139.938 156.191 105.319 1.00 312.68 ? 353  ARG C NH1   1 
ATOM   6318  N  NH2   . ARG C 2 353  ? 141.994 157.141 105.675 1.00 312.68 ? 353  ARG C NH2   1 
ATOM   6319  N  N     . GLY C 2 354  ? 141.492 155.947 97.781  1.00 312.56 ? 354  GLY C N     1 
ATOM   6320  C  CA    . GLY C 2 354  ? 142.316 155.257 96.801  1.00 312.56 ? 354  GLY C CA    1 
ATOM   6321  C  C     . GLY C 2 354  ? 142.372 155.970 95.462  1.00 312.56 ? 354  GLY C C     1 
ATOM   6322  O  O     . GLY C 2 354  ? 143.441 156.107 94.863  1.00 312.56 ? 354  GLY C O     1 
ATOM   6323  N  N     . VAL C 2 355  ? 141.230 156.460 94.992  1.00 320.74 ? 355  VAL C N     1 
ATOM   6324  C  CA    . VAL C 2 355  ? 141.202 157.166 93.723  1.00 320.74 ? 355  VAL C CA    1 
ATOM   6325  C  C     . VAL C 2 355  ? 141.834 158.541 93.857  1.00 320.74 ? 355  VAL C C     1 
ATOM   6326  O  O     . VAL C 2 355  ? 142.556 158.981 92.962  1.00 320.74 ? 355  VAL C O     1 
ATOM   6327  C  CB    . VAL C 2 355  ? 139.759 157.227 93.196  1.00 320.74 ? 355  VAL C CB    1 
ATOM   6328  C  CG1   . VAL C 2 355  ? 139.649 158.129 91.995  1.00 320.74 ? 355  VAL C CG1   1 
ATOM   6329  C  CG2   . VAL C 2 355  ? 139.310 155.845 92.793  1.00 320.74 ? 355  VAL C CG2   1 
ATOM   6330  N  N     . ARG C 2 356  ? 141.641 159.225 94.984  1.00 350.03 ? 356  ARG C N     1 
ATOM   6331  C  CA    . ARG C 2 356  ? 142.293 160.515 95.145  1.00 350.03 ? 356  ARG C CA    1 
ATOM   6332  C  C     . ARG C 2 356  ? 143.786 160.375 95.400  1.00 350.03 ? 356  ARG C C     1 
ATOM   6333  O  O     . ARG C 2 356  ? 144.525 161.349 95.226  1.00 350.03 ? 356  ARG C O     1 
ATOM   6334  C  CB    . ARG C 2 356  ? 141.615 161.311 96.252  1.00 350.03 ? 356  ARG C CB    1 
ATOM   6335  C  CG    . ARG C 2 356  ? 140.340 161.986 95.772  1.00 350.03 ? 356  ARG C CG    1 
ATOM   6336  C  CD    . ARG C 2 356  ? 139.676 162.780 96.877  1.00 350.03 ? 356  ARG C CD    1 
ATOM   6337  N  NE    . ARG C 2 356  ? 138.243 162.939 96.651  1.00 350.03 ? 356  ARG C NE    1 
ATOM   6338  C  CZ    . ARG C 2 356  ? 137.686 163.994 96.068  1.00 350.03 ? 356  ARG C CZ    1 
ATOM   6339  N  NH1   . ARG C 2 356  ? 138.439 165.000 95.650  1.00 350.03 ? 356  ARG C NH1   1 
ATOM   6340  N  NH2   . ARG C 2 356  ? 136.373 164.047 95.912  1.00 350.03 ? 356  ARG C NH2   1 
ATOM   6341  N  N     . GLU C 2 357  ? 144.252 159.190 95.791  1.00 360.75 ? 357  GLU C N     1 
ATOM   6342  C  CA    . GLU C 2 357  ? 145.661 158.880 95.601  1.00 360.75 ? 357  GLU C CA    1 
ATOM   6343  C  C     . GLU C 2 357  ? 145.971 158.727 94.121  1.00 360.75 ? 357  GLU C C     1 
ATOM   6344  O  O     . GLU C 2 357  ? 146.952 159.282 93.618  1.00 360.75 ? 357  GLU C O     1 
ATOM   6345  C  CB    . GLU C 2 357  ? 146.032 157.607 96.356  1.00 360.75 ? 357  GLU C CB    1 
ATOM   6346  C  CG    . GLU C 2 357  ? 147.510 157.228 96.252  1.00 360.75 ? 357  GLU C CG    1 
ATOM   6347  C  CD    . GLU C 2 357  ? 147.789 156.189 95.176  1.00 360.75 ? 357  GLU C CD    1 
ATOM   6348  O  OE1   . GLU C 2 357  ? 146.822 155.613 94.646  1.00 360.75 ? 357  GLU C OE1   1 
ATOM   6349  O  OE2   . GLU C 2 357  ? 148.973 155.942 94.869  1.00 360.75 ? 357  GLU C OE2   1 
ATOM   6350  N  N     . ARG C 2 358  ? 145.133 157.976 93.403  1.00 340.01 ? 358  ARG C N     1 
ATOM   6351  C  CA    . ARG C 2 358  ? 145.364 157.765 91.979  1.00 340.01 ? 358  ARG C CA    1 
ATOM   6352  C  C     . ARG C 2 358  ? 145.085 159.025 91.177  1.00 340.01 ? 358  ARG C C     1 
ATOM   6353  O  O     . ARG C 2 358  ? 145.539 159.145 90.035  1.00 340.01 ? 358  ARG C O     1 
ATOM   6354  C  CB    . ARG C 2 358  ? 144.505 156.612 91.480  1.00 340.01 ? 358  ARG C CB    1 
ATOM   6355  C  CG    . ARG C 2 358  ? 144.997 155.276 91.976  1.00 340.01 ? 358  ARG C CG    1 
ATOM   6356  C  CD    . ARG C 2 358  ? 144.214 154.124 91.403  1.00 340.01 ? 358  ARG C CD    1 
ATOM   6357  N  NE    . ARG C 2 358  ? 142.883 153.994 91.984  1.00 340.01 ? 358  ARG C NE    1 
ATOM   6358  C  CZ    . ARG C 2 358  ? 142.060 152.994 91.696  1.00 340.01 ? 358  ARG C CZ    1 
ATOM   6359  N  NH1   . ARG C 2 358  ? 142.453 152.052 90.852  1.00 340.01 ? 358  ARG C NH1   1 
ATOM   6360  N  NH2   . ARG C 2 358  ? 140.864 152.921 92.259  1.00 340.01 ? 358  ARG C NH2   1 
ATOM   6361  N  N     . MET C 2 359  ? 144.348 159.976 91.760  1.00 373.91 ? 359  MET C N     1 
ATOM   6362  C  CA    . MET C 2 359  ? 144.254 161.319 91.205  1.00 373.91 ? 359  MET C CA    1 
ATOM   6363  C  C     . MET C 2 359  ? 145.581 162.053 91.247  1.00 373.91 ? 359  MET C C     1 
ATOM   6364  O  O     . MET C 2 359  ? 145.755 163.031 90.513  1.00 373.91 ? 359  MET C O     1 
ATOM   6365  C  CB    . MET C 2 359  ? 143.213 162.143 91.959  1.00 373.91 ? 359  MET C CB    1 
ATOM   6366  C  CG    . MET C 2 359  ? 141.781 161.811 91.604  1.00 373.91 ? 359  MET C CG    1 
ATOM   6367  S  SD    . MET C 2 359  ? 140.632 163.107 92.082  1.00 373.91 ? 359  MET C SD    1 
ATOM   6368  C  CE    . MET C 2 359  ? 140.443 163.944 90.514  1.00 373.91 ? 359  MET C CE    1 
ATOM   6369  N  N     . LEU C 2 360  ? 146.504 161.630 92.101  1.00 349.33 ? 360  LEU C N     1 
ATOM   6370  C  CA    . LEU C 2 360  ? 147.870 162.104 92.044  1.00 349.33 ? 360  LEU C CA    1 
ATOM   6371  C  C     . LEU C 2 360  ? 148.742 161.230 91.160  1.00 349.33 ? 360  LEU C C     1 
ATOM   6372  O  O     . LEU C 2 360  ? 149.866 161.625 90.835  1.00 349.33 ? 360  LEU C O     1 
ATOM   6373  C  CB    . LEU C 2 360  ? 148.458 162.157 93.452  1.00 349.33 ? 360  LEU C CB    1 
ATOM   6374  C  CG    . LEU C 2 360  ? 147.653 163.040 94.399  1.00 349.33 ? 360  LEU C CG    1 
ATOM   6375  C  CD1   . LEU C 2 360  ? 148.202 162.929 95.807  1.00 349.33 ? 360  LEU C CD1   1 
ATOM   6376  C  CD2   . LEU C 2 360  ? 147.651 164.484 93.921  1.00 349.33 ? 360  LEU C CD2   1 
ATOM   6377  N  N     . MET C 2 361  ? 148.249 160.064 90.758  1.00 365.61 ? 361  MET C N     1 
ATOM   6378  C  CA    . MET C 2 361  ? 149.032 159.127 89.973  1.00 365.61 ? 361  MET C CA    1 
ATOM   6379  C  C     . MET C 2 361  ? 148.773 159.333 88.490  1.00 365.61 ? 361  MET C C     1 
ATOM   6380  O  O     . MET C 2 361  ? 147.620 159.407 88.057  1.00 365.61 ? 361  MET C O     1 
ATOM   6381  C  CB    . MET C 2 361  ? 148.701 157.689 90.368  1.00 365.61 ? 361  MET C CB    1 
ATOM   6382  C  CG    . MET C 2 361  ? 149.027 157.382 91.805  1.00 365.61 ? 361  MET C CG    1 
ATOM   6383  S  SD    . MET C 2 361  ? 150.618 158.089 92.249  1.00 365.61 ? 361  MET C SD    1 
ATOM   6384  C  CE    . MET C 2 361  ? 150.220 158.853 93.816  1.00 365.61 ? 361  MET C CE    1 
ATOM   6385  N  N     . GLY C 2 362  ? 149.849 159.429 87.719  1.00 381.23 ? 362  GLY C N     1 
ATOM   6386  C  CA    . GLY C 2 362  ? 149.748 159.422 86.276  1.00 381.23 ? 362  GLY C CA    1 
ATOM   6387  C  C     . GLY C 2 362  ? 149.454 160.783 85.681  1.00 381.23 ? 362  GLY C C     1 
ATOM   6388  O  O     . GLY C 2 362  ? 149.272 161.790 86.368  1.00 381.23 ? 362  GLY C O     1 
ATOM   6389  N  N     . SER C 2 363  ? 149.416 160.801 84.352  1.00 393.34 ? 363  SER C N     1 
ATOM   6390  C  CA    . SER C 2 363  ? 149.081 161.991 83.582  1.00 393.34 ? 363  SER C CA    1 
ATOM   6391  C  C     . SER C 2 363  ? 147.609 161.893 83.211  1.00 393.34 ? 363  SER C C     1 
ATOM   6392  O  O     . SER C 2 363  ? 147.185 160.928 82.567  1.00 393.34 ? 363  SER C O     1 
ATOM   6393  C  CB    . SER C 2 363  ? 149.953 162.101 82.338  1.00 393.34 ? 363  SER C CB    1 
ATOM   6394  O  OG    . SER C 2 363  ? 149.567 161.129 81.381  1.00 393.34 ? 363  SER C OG    1 
ATOM   6395  N  N     . GLU C 2 364  ? 146.838 162.907 83.592  1.00 398.68 ? 364  GLU C N     1 
ATOM   6396  C  CA    . GLU C 2 364  ? 145.382 162.836 83.562  1.00 398.68 ? 364  GLU C CA    1 
ATOM   6397  C  C     . GLU C 2 364  ? 144.816 163.068 82.166  1.00 398.68 ? 364  GLU C C     1 
ATOM   6398  O  O     . GLU C 2 364  ? 143.596 163.042 81.972  1.00 398.68 ? 364  GLU C O     1 
ATOM   6399  C  CB    . GLU C 2 364  ? 144.799 163.845 84.552  1.00 398.68 ? 364  GLU C CB    1 
ATOM   6400  C  CG    . GLU C 2 364  ? 144.816 163.374 86.006  1.00 398.68 ? 364  GLU C CG    1 
ATOM   6401  C  CD    . GLU C 2 364  ? 146.193 163.444 86.647  1.00 398.68 ? 364  GLU C CD    1 
ATOM   6402  O  OE1   . GLU C 2 364  ? 147.064 164.164 86.119  1.00 398.68 ? 364  GLU C OE1   1 
ATOM   6403  O  OE2   . GLU C 2 364  ? 146.404 162.774 87.679  1.00 398.68 ? 364  GLU C OE2   1 
ATOM   6404  N  N     . ASP C 2 365  ? 145.692 163.312 81.194  1.00 396.33 ? 365  ASP C N     1 
ATOM   6405  C  CA    . ASP C 2 365  ? 145.260 163.390 79.806  1.00 396.33 ? 365  ASP C CA    1 
ATOM   6406  C  C     . ASP C 2 365  ? 144.837 162.020 79.290  1.00 396.33 ? 365  ASP C C     1 
ATOM   6407  O  O     . ASP C 2 365  ? 143.830 161.889 78.587  1.00 396.33 ? 365  ASP C O     1 
ATOM   6408  C  CB    . ASP C 2 365  ? 146.389 163.966 78.955  1.00 396.33 ? 365  ASP C CB    1 
ATOM   6409  C  CG    . ASP C 2 365  ? 147.723 163.274 79.205  1.00 396.33 ? 365  ASP C CG    1 
ATOM   6410  O  OD1   . ASP C 2 365  ? 147.763 162.320 80.007  1.00 396.33 ? 365  ASP C OD1   1 
ATOM   6411  O  OD2   . ASP C 2 365  ? 148.732 163.687 78.601  1.00 396.33 ? 365  ASP C OD2   1 
ATOM   6412  N  N     . SER C 2 366  ? 145.601 160.987 79.636  1.00 371.72 ? 366  SER C N     1 
ATOM   6413  C  CA    . SER C 2 366  ? 145.385 159.626 79.162  1.00 371.72 ? 366  SER C CA    1 
ATOM   6414  C  C     . SER C 2 366  ? 145.273 158.727 80.385  1.00 371.72 ? 366  SER C C     1 
ATOM   6415  O  O     . SER C 2 366  ? 146.245 158.082 80.783  1.00 371.72 ? 366  SER C O     1 
ATOM   6416  C  CB    . SER C 2 366  ? 146.520 159.189 78.245  1.00 371.72 ? 366  SER C CB    1 
ATOM   6417  O  OG    . SER C 2 366  ? 147.769 159.601 78.771  1.00 371.72 ? 366  SER C OG    1 
ATOM   6418  N  N     . LEU C 2 367  ? 144.069 158.671 80.956  1.00 350.76 ? 367  LEU C N     1 
ATOM   6419  C  CA    . LEU C 2 367  ? 143.798 157.821 82.111  1.00 350.76 ? 367  LEU C CA    1 
ATOM   6420  C  C     . LEU C 2 367  ? 142.316 157.457 82.067  1.00 350.76 ? 367  LEU C C     1 
ATOM   6421  O  O     . LEU C 2 367  ? 141.475 158.245 82.506  1.00 350.76 ? 367  LEU C O     1 
ATOM   6422  C  CB    . LEU C 2 367  ? 144.153 158.519 83.411  1.00 350.76 ? 367  LEU C CB    1 
ATOM   6423  C  CG    . LEU C 2 367  ? 145.562 158.310 83.955  1.00 350.76 ? 367  LEU C CG    1 
ATOM   6424  C  CD1   . LEU C 2 367  ? 145.752 159.062 85.256  1.00 350.76 ? 367  LEU C CD1   1 
ATOM   6425  C  CD2   . LEU C 2 367  ? 145.821 156.827 84.134  1.00 350.76 ? 367  LEU C CD2   1 
ATOM   6426  N  N     . THR C 2 368  ? 142.016 156.275 81.541  1.00 332.01 ? 368  THR C N     1 
ATOM   6427  C  CA    . THR C 2 368  ? 140.643 155.801 81.544  1.00 332.01 ? 368  THR C CA    1 
ATOM   6428  C  C     . THR C 2 368  ? 140.225 155.465 82.972  1.00 332.01 ? 368  THR C C     1 
ATOM   6429  O  O     . THR C 2 368  ? 141.076 155.137 83.805  1.00 332.01 ? 368  THR C O     1 
ATOM   6430  C  CB    . THR C 2 368  ? 140.476 154.564 80.650  1.00 332.01 ? 368  THR C CB    1 
ATOM   6431  O  OG1   . THR C 2 368  ? 141.078 153.426 81.277  1.00 332.01 ? 368  THR C OG1   1 
ATOM   6432  C  CG2   . THR C 2 368  ? 141.088 154.787 79.276  1.00 332.01 ? 368  THR C CG2   1 
ATOM   6433  N  N     . PRO C 2 369  ? 138.930 155.548 83.285  1.00 314.75 ? 369  PRO C N     1 
ATOM   6434  C  CA    . PRO C 2 369  ? 138.449 155.095 84.600  1.00 314.75 ? 369  PRO C CA    1 
ATOM   6435  C  C     . PRO C 2 369  ? 138.697 153.626 84.882  1.00 314.75 ? 369  PRO C C     1 
ATOM   6436  O  O     . PRO C 2 369  ? 138.700 153.222 86.051  1.00 314.75 ? 369  PRO C O     1 
ATOM   6437  C  CB    . PRO C 2 369  ? 136.949 155.393 84.532  1.00 314.75 ? 369  PRO C CB    1 
ATOM   6438  C  CG    . PRO C 2 369  ? 136.824 156.472 83.543  1.00 314.75 ? 369  PRO C CG    1 
ATOM   6439  C  CD    . PRO C 2 369  ? 137.899 156.297 82.546  1.00 314.75 ? 369  PRO C CD    1 
ATOM   6440  N  N     . ALA C 2 370  ? 138.905 152.813 83.843  1.00 327.12 ? 370  ALA C N     1 
ATOM   6441  C  CA    . ALA C 2 370  ? 139.296 151.423 84.039  1.00 327.12 ? 370  ALA C CA    1 
ATOM   6442  C  C     . ALA C 2 370  ? 140.670 151.315 84.687  1.00 327.12 ? 370  ALA C C     1 
ATOM   6443  O  O     . ALA C 2 370  ? 140.976 150.318 85.346  1.00 327.12 ? 370  ALA C O     1 
ATOM   6444  C  CB    . ALA C 2 370  ? 139.277 150.683 82.704  1.00 327.12 ? 370  ALA C CB    1 
ATOM   6445  N  N     . LYS C 2 371  ? 141.514 152.323 84.503  1.00 323.29 ? 371  LYS C N     1 
ATOM   6446  C  CA    . LYS C 2 371  ? 142.742 152.414 85.274  1.00 323.29 ? 371  LYS C CA    1 
ATOM   6447  C  C     . LYS C 2 371  ? 142.537 153.107 86.605  1.00 323.29 ? 371  LYS C C     1 
ATOM   6448  O  O     . LYS C 2 371  ? 143.490 153.230 87.378  1.00 323.29 ? 371  LYS C O     1 
ATOM   6449  C  CB    . LYS C 2 371  ? 143.816 153.153 84.482  1.00 323.29 ? 371  LYS C CB    1 
ATOM   6450  C  CG    . LYS C 2 371  ? 143.787 152.872 83.007  1.00 323.29 ? 371  LYS C CG    1 
ATOM   6451  C  CD    . LYS C 2 371  ? 144.787 153.738 82.277  1.00 323.29 ? 371  LYS C CD    1 
ATOM   6452  C  CE    . LYS C 2 371  ? 144.357 153.981 80.848  1.00 323.29 ? 371  LYS C CE    1 
ATOM   6453  N  NZ    . LYS C 2 371  ? 143.701 152.785 80.254  1.00 323.29 ? 371  LYS C NZ    1 
ATOM   6454  N  N     . LEU C 2 372  ? 141.326 153.567 86.889  1.00 313.51 ? 372  LEU C N     1 
ATOM   6455  C  CA    . LEU C 2 372  ? 141.041 154.345 88.086  1.00 313.51 ? 372  LEU C CA    1 
ATOM   6456  C  C     . LEU C 2 372  ? 139.974 153.660 88.918  1.00 313.51 ? 372  LEU C C     1 
ATOM   6457  O  O     . LEU C 2 372  ? 139.078 154.296 89.474  1.00 313.51 ? 372  LEU C O     1 
ATOM   6458  C  CB    . LEU C 2 372  ? 140.604 155.751 87.707  1.00 313.51 ? 372  LEU C CB    1 
ATOM   6459  C  CG    . LEU C 2 372  ? 141.574 156.489 86.790  1.00 313.51 ? 372  LEU C CG    1 
ATOM   6460  C  CD1   . LEU C 2 372  ? 140.867 157.594 86.024  1.00 313.51 ? 372  LEU C CD1   1 
ATOM   6461  C  CD2   . LEU C 2 372  ? 142.747 157.033 87.583  1.00 313.51 ? 372  LEU C CD2   1 
ATOM   6462  N  N     . VAL C 2 373  ? 140.060 152.336 89.020  1.00 312.80 ? 373  VAL C N     1 
ATOM   6463  C  CA    . VAL C 2 373  ? 139.059 151.565 89.743  1.00 312.80 ? 373  VAL C CA    1 
ATOM   6464  C  C     . VAL C 2 373  ? 139.768 150.430 90.467  1.00 312.80 ? 373  VAL C C     1 
ATOM   6465  O  O     . VAL C 2 373  ? 140.738 149.861 89.961  1.00 312.80 ? 373  VAL C O     1 
ATOM   6466  C  CB    . VAL C 2 373  ? 137.952 151.067 88.777  1.00 312.80 ? 373  VAL C CB    1 
ATOM   6467  C  CG1   . VAL C 2 373  ? 138.542 150.271 87.620  1.00 312.80 ? 373  VAL C CG1   1 
ATOM   6468  C  CG2   . VAL C 2 373  ? 136.871 150.274 89.507  1.00 312.80 ? 373  VAL C CG2   1 
ATOM   6469  N  N     . ASN C 2 374  ? 139.330 150.154 91.691  1.00 278.76 ? 374  ASN C N     1 
ATOM   6470  C  CA    . ASN C 2 374  ? 139.810 148.997 92.430  1.00 278.76 ? 374  ASN C CA    1 
ATOM   6471  C  C     . ASN C 2 374  ? 138.636 148.410 93.192  1.00 278.76 ? 374  ASN C C     1 
ATOM   6472  O  O     . ASN C 2 374  ? 138.121 149.041 94.113  1.00 278.76 ? 374  ASN C O     1 
ATOM   6473  C  CB    . ASN C 2 374  ? 140.939 149.381 93.388  1.00 278.76 ? 374  ASN C CB    1 
ATOM   6474  C  CG    . ASN C 2 374  ? 141.426 148.208 94.215  1.00 278.76 ? 374  ASN C CG    1 
ATOM   6475  O  OD1   . ASN C 2 374  ? 141.375 147.058 93.776  1.00 278.76 ? 374  ASN C OD1   1 
ATOM   6476  N  ND2   . ASN C 2 374  ? 141.921 148.494 95.411  1.00 278.76 ? 374  ASN C ND2   1 
ATOM   6477  N  N     . SER C 2 375  ? 138.214 147.211 92.807  1.00 261.65 ? 375  SER C N     1 
ATOM   6478  C  CA    . SER C 2 375  ? 137.051 146.594 93.424  1.00 261.65 ? 375  SER C CA    1 
ATOM   6479  C  C     . SER C 2 375  ? 137.386 145.813 94.682  1.00 261.65 ? 375  SER C C     1 
ATOM   6480  O  O     . SER C 2 375  ? 136.475 145.262 95.306  1.00 261.65 ? 375  SER C O     1 
ATOM   6481  C  CB    . SER C 2 375  ? 136.346 145.674 92.424  1.00 261.65 ? 375  SER C CB    1 
ATOM   6482  O  OG    . SER C 2 375  ? 135.495 146.417 91.570  1.00 261.65 ? 375  SER C OG    1 
ATOM   6483  N  N     . ARG C 2 376  ? 138.661 145.738 95.053  1.00 280.59 ? 376  ARG C N     1 
ATOM   6484  C  CA    . ARG C 2 376  ? 139.092 145.083 96.282  1.00 280.59 ? 376  ARG C CA    1 
ATOM   6485  C  C     . ARG C 2 376  ? 138.472 145.682 97.549  1.00 280.59 ? 376  ARG C C     1 
ATOM   6486  O  O     . ARG C 2 376  ? 137.762 144.946 98.242  1.00 280.59 ? 376  ARG C O     1 
ATOM   6487  C  CB    . ARG C 2 376  ? 140.624 145.076 96.385  1.00 280.59 ? 376  ARG C CB    1 
ATOM   6488  C  CG    . ARG C 2 376  ? 141.258 143.722 96.164  1.00 280.59 ? 376  ARG C CG    1 
ATOM   6489  C  CD    . ARG C 2 376  ? 141.107 142.865 97.409  1.00 280.59 ? 376  ARG C CD    1 
ATOM   6490  N  NE    . ARG C 2 376  ? 141.847 141.607 97.329  1.00 280.59 ? 376  ARG C NE    1 
ATOM   6491  C  CZ    . ARG C 2 376  ? 141.375 140.494 96.777  1.00 280.59 ? 376  ARG C CZ    1 
ATOM   6492  N  NH1   . ARG C 2 376  ? 140.164 140.485 96.243  1.00 280.59 ? 376  ARG C NH1   1 
ATOM   6493  N  NH2   . ARG C 2 376  ? 142.110 139.390 96.754  1.00 280.59 ? 376  ARG C NH2   1 
ATOM   6494  N  N     . PRO C 2 377  ? 138.667 146.973 97.894  1.00 266.96 ? 377  PRO C N     1 
ATOM   6495  C  CA    . PRO C 2 377  ? 138.305 147.391 99.262  1.00 266.96 ? 377  PRO C CA    1 
ATOM   6496  C  C     . PRO C 2 377  ? 136.811 147.480 99.506  1.00 266.96 ? 377  PRO C C     1 
ATOM   6497  O  O     . PRO C 2 377  ? 136.336 147.033 100.555 1.00 266.96 ? 377  PRO C O     1 
ATOM   6498  C  CB    . PRO C 2 377  ? 138.980 148.768 99.399  1.00 266.96 ? 377  PRO C CB    1 
ATOM   6499  C  CG    . PRO C 2 377  ? 139.751 148.979 98.137  1.00 266.96 ? 377  PRO C CG    1 
ATOM   6500  C  CD    . PRO C 2 377  ? 139.059 148.166 97.122  1.00 266.96 ? 377  PRO C CD    1 
ATOM   6501  N  N     . LEU C 2 378  ? 136.055 148.014 98.548  1.00 283.69 ? 378  LEU C N     1 
ATOM   6502  C  CA    . LEU C 2 378  ? 134.624 148.210 98.740  1.00 283.69 ? 378  LEU C CA    1 
ATOM   6503  C  C     . LEU C 2 378  ? 133.892 146.878 98.814  1.00 283.69 ? 378  LEU C C     1 
ATOM   6504  O  O     . LEU C 2 378  ? 133.145 146.615 99.767  1.00 283.69 ? 378  LEU C O     1 
ATOM   6505  C  CB    . LEU C 2 378  ? 134.072 149.071 97.608  1.00 283.69 ? 378  LEU C CB    1 
ATOM   6506  C  CG    . LEU C 2 378  ? 132.573 148.956 97.361  1.00 283.69 ? 378  LEU C CG    1 
ATOM   6507  C  CD1   . LEU C 2 378  ? 131.793 149.735 98.390  1.00 283.69 ? 378  LEU C CD1   1 
ATOM   6508  C  CD2   . LEU C 2 378  ? 132.244 149.422 95.963  1.00 283.69 ? 378  LEU C CD2   1 
ATOM   6509  N  N     . GLU C 2 379  ? 134.121 146.013 97.825  1.00 295.42 ? 379  GLU C N     1 
ATOM   6510  C  CA    . GLU C 2 379  ? 133.457 144.718 97.805  1.00 295.42 ? 379  GLU C CA    1 
ATOM   6511  C  C     . GLU C 2 379  ? 133.968 143.834 98.926  1.00 295.42 ? 379  GLU C C     1 
ATOM   6512  O  O     . GLU C 2 379  ? 133.212 143.032 99.490  1.00 295.42 ? 379  GLU C O     1 
ATOM   6513  C  CB    . GLU C 2 379  ? 133.666 144.052 96.447  1.00 295.42 ? 379  GLU C CB    1 
ATOM   6514  C  CG    . GLU C 2 379  ? 132.809 142.830 96.207  1.00 295.42 ? 379  GLU C CG    1 
ATOM   6515  C  CD    . GLU C 2 379  ? 131.325 143.128 96.264  1.00 295.42 ? 379  GLU C CD    1 
ATOM   6516  O  OE1   . GLU C 2 379  ? 130.905 144.215 95.818  1.00 295.42 ? 379  GLU C OE1   1 
ATOM   6517  O  OE2   . GLU C 2 379  ? 130.572 142.267 96.758  1.00 295.42 ? 379  GLU C OE2   1 
ATOM   6518  N  N     . ALA C 2 380  ? 135.234 144.017 99.301  1.00 294.68 ? 380  ALA C N     1 
ATOM   6519  C  CA    . ALA C 2 380  ? 135.803 143.271 100.411 1.00 294.68 ? 380  ALA C CA    1 
ATOM   6520  C  C     . ALA C 2 380  ? 135.140 143.654 101.724 1.00 294.68 ? 380  ALA C C     1 
ATOM   6521  O  O     . ALA C 2 380  ? 134.779 142.784 102.520 1.00 294.68 ? 380  ALA C O     1 
ATOM   6522  C  CB    . ALA C 2 380  ? 137.310 143.509 100.472 1.00 294.68 ? 380  ALA C CB    1 
ATOM   6523  N  N     . ALA C 2 381  ? 134.934 144.955 101.946 1.00 270.26 ? 381  ALA C N     1 
ATOM   6524  C  CA    . ALA C 2 381  ? 134.300 145.410 103.176 1.00 270.26 ? 381  ALA C CA    1 
ATOM   6525  C  C     . ALA C 2 381  ? 132.832 145.026 103.220 1.00 270.26 ? 381  ALA C C     1 
ATOM   6526  O  O     . ALA C 2 381  ? 132.302 144.710 104.293 1.00 270.26 ? 381  ALA C O     1 
ATOM   6527  C  CB    . ALA C 2 381  ? 134.453 146.924 103.312 1.00 270.26 ? 381  ALA C CB    1 
ATOM   6528  N  N     . ILE C 2 382  ? 132.172 145.029 102.066 1.00 257.18 ? 382  ILE C N     1 
ATOM   6529  C  CA    . ILE C 2 382  ? 130.773 144.629 102.012 1.00 257.18 ? 382  ILE C CA    1 
ATOM   6530  C  C     . ILE C 2 382  ? 130.629 143.150 102.332 1.00 257.18 ? 382  ILE C C     1 
ATOM   6531  O  O     . ILE C 2 382  ? 129.781 142.756 103.140 1.00 257.18 ? 382  ILE C O     1 
ATOM   6532  C  CB    . ILE C 2 382  ? 130.184 144.984 100.639 1.00 257.18 ? 382  ILE C CB    1 
ATOM   6533  C  CG1   . ILE C 2 382  ? 129.940 146.489 100.572 1.00 257.18 ? 382  ILE C CG1   1 
ATOM   6534  C  CG2   . ILE C 2 382  ? 128.908 144.216 100.372 1.00 257.18 ? 382  ILE C CG2   1 
ATOM   6535  C  CD1   . ILE C 2 382  ? 128.989 146.981 101.628 1.00 257.18 ? 382  ILE C CD1   1 
ATOM   6536  N  N     . ARG C 2 383  ? 131.486 142.322 101.737 1.00 276.04 ? 383  ARG C N     1 
ATOM   6537  C  CA    . ARG C 2 383  ? 131.482 140.899 102.040 1.00 276.04 ? 383  ARG C CA    1 
ATOM   6538  C  C     . ARG C 2 383  ? 131.884 140.649 103.486 1.00 276.04 ? 383  ARG C C     1 
ATOM   6539  O  O     . ARG C 2 383  ? 131.374 139.726 104.129 1.00 276.04 ? 383  ARG C O     1 
ATOM   6540  C  CB    . ARG C 2 383  ? 132.421 140.179 101.077 1.00 276.04 ? 383  ARG C CB    1 
ATOM   6541  C  CG    . ARG C 2 383  ? 132.594 138.698 101.331 1.00 276.04 ? 383  ARG C CG    1 
ATOM   6542  C  CD    . ARG C 2 383  ? 133.837 138.164 100.656 1.00 276.04 ? 383  ARG C CD    1 
ATOM   6543  N  NE    . ARG C 2 383  ? 135.050 138.732 101.229 1.00 276.04 ? 383  ARG C NE    1 
ATOM   6544  C  CZ    . ARG C 2 383  ? 135.809 139.630 100.614 1.00 276.04 ? 383  ARG C CZ    1 
ATOM   6545  N  NH1   . ARG C 2 383  ? 135.470 140.060 99.409  1.00 276.04 ? 383  ARG C NH1   1 
ATOM   6546  N  NH2   . ARG C 2 383  ? 136.895 140.099 101.206 1.00 276.04 ? 383  ARG C NH2   1 
ATOM   6547  N  N     . GLU C 2 384  ? 132.759 141.499 104.021 1.00 271.35 ? 384  GLU C N     1 
ATOM   6548  C  CA    . GLU C 2 384  ? 133.151 141.408 105.419 1.00 271.35 ? 384  GLU C CA    1 
ATOM   6549  C  C     . GLU C 2 384  ? 131.965 141.660 106.329 1.00 271.35 ? 384  GLU C C     1 
ATOM   6550  O  O     . GLU C 2 384  ? 131.760 140.946 107.315 1.00 271.35 ? 384  GLU C O     1 
ATOM   6551  C  CB    . GLU C 2 384  ? 134.274 142.403 105.701 1.00 271.35 ? 384  GLU C CB    1 
ATOM   6552  C  CG    . GLU C 2 384  ? 134.439 142.767 107.160 1.00 271.35 ? 384  GLU C CG    1 
ATOM   6553  C  CD    . GLU C 2 384  ? 134.767 141.566 108.020 1.00 271.35 ? 384  GLU C CD    1 
ATOM   6554  O  OE1   . GLU C 2 384  ? 135.587 140.733 107.589 1.00 271.35 ? 384  GLU C OE1   1 
ATOM   6555  O  OE2   . GLU C 2 384  ? 134.183 141.446 109.114 1.00 271.35 ? 384  GLU C OE2   1 
ATOM   6556  N  N     . PHE C 2 385  ? 131.169 142.669 106.000 1.00 260.32 ? 385  PHE C N     1 
ATOM   6557  C  CA    . PHE C 2 385  ? 129.973 142.947 106.778 1.00 260.32 ? 385  PHE C CA    1 
ATOM   6558  C  C     . PHE C 2 385  ? 128.963 141.825 106.629 1.00 260.32 ? 385  PHE C C     1 
ATOM   6559  O  O     . PHE C 2 385  ? 128.308 141.422 107.596 1.00 260.32 ? 385  PHE C O     1 
ATOM   6560  C  CB    . PHE C 2 385  ? 129.370 144.267 106.330 1.00 260.32 ? 385  PHE C CB    1 
ATOM   6561  C  CG    . PHE C 2 385  ? 127.937 144.421 106.704 1.00 260.32 ? 385  PHE C CG    1 
ATOM   6562  C  CD1   . PHE C 2 385  ? 127.567 144.550 108.032 1.00 260.32 ? 385  PHE C CD1   1 
ATOM   6563  C  CD2   . PHE C 2 385  ? 126.954 144.427 105.730 1.00 260.32 ? 385  PHE C CD2   1 
ATOM   6564  C  CE1   . PHE C 2 385  ? 126.246 144.682 108.381 1.00 260.32 ? 385  PHE C CE1   1 
ATOM   6565  C  CE2   . PHE C 2 385  ? 125.629 144.563 106.072 1.00 260.32 ? 385  PHE C CE2   1 
ATOM   6566  C  CZ    . PHE C 2 385  ? 125.274 144.692 107.399 1.00 260.32 ? 385  PHE C CZ    1 
ATOM   6567  N  N     . PHE C 2 386  ? 128.839 141.300 105.417 1.00 250.85 ? 386  PHE C N     1 
ATOM   6568  C  CA    . PHE C 2 386  ? 127.855 140.266 105.154 1.00 250.85 ? 386  PHE C CA    1 
ATOM   6569  C  C     . PHE C 2 386  ? 128.239 138.947 105.785 1.00 250.85 ? 386  PHE C C     1 
ATOM   6570  O  O     . PHE C 2 386  ? 127.379 138.090 106.007 1.00 250.85 ? 386  PHE C O     1 
ATOM   6571  C  CB    . PHE C 2 386  ? 127.689 140.093 103.657 1.00 250.85 ? 386  PHE C CB    1 
ATOM   6572  C  CG    . PHE C 2 386  ? 126.553 140.862 103.102 1.00 250.85 ? 386  PHE C CG    1 
ATOM   6573  C  CD1   . PHE C 2 386  ? 125.263 140.394 103.249 1.00 250.85 ? 386  PHE C CD1   1 
ATOM   6574  C  CD2   . PHE C 2 386  ? 126.764 142.061 102.455 1.00 250.85 ? 386  PHE C CD2   1 
ATOM   6575  C  CE1   . PHE C 2 386  ? 124.201 141.098 102.740 1.00 250.85 ? 386  PHE C CE1   1 
ATOM   6576  C  CE2   . PHE C 2 386  ? 125.709 142.774 101.945 1.00 250.85 ? 386  PHE C CE2   1 
ATOM   6577  C  CZ    . PHE C 2 386  ? 124.423 142.292 102.088 1.00 250.85 ? 386  PHE C CZ    1 
ATOM   6578  N  N     . SER C 2 387  ? 129.519 138.759 106.067 1.00 259.41 ? 387  SER C N     1 
ATOM   6579  C  CA    . SER C 2 387  ? 130.001 137.515 106.631 1.00 259.41 ? 387  SER C CA    1 
ATOM   6580  C  C     . SER C 2 387  ? 130.157 137.604 108.140 1.00 259.41 ? 387  SER C C     1 
ATOM   6581  O  O     . SER C 2 387  ? 129.518 136.856 108.884 1.00 259.41 ? 387  SER C O     1 
ATOM   6582  C  CB    . SER C 2 387  ? 131.335 137.163 105.979 1.00 259.41 ? 387  SER C CB    1 
ATOM   6583  O  OG    . SER C 2 387  ? 132.107 138.335 105.847 1.00 259.41 ? 387  SER C OG    1 
ATOM   6584  N  N     . ARG C 2 388  ? 130.971 138.541 108.605 1.00 284.83 ? 388  ARG C N     1 
ATOM   6585  C  CA    . ARG C 2 388  ? 131.510 138.483 109.948 1.00 284.83 ? 388  ARG C CA    1 
ATOM   6586  C  C     . ARG C 2 388  ? 131.058 139.610 110.855 1.00 284.83 ? 388  ARG C C     1 
ATOM   6587  O  O     . ARG C 2 388  ? 131.632 139.770 111.935 1.00 284.83 ? 388  ARG C O     1 
ATOM   6588  C  CB    . ARG C 2 388  ? 133.039 138.479 109.894 1.00 284.83 ? 388  ARG C CB    1 
ATOM   6589  C  CG    . ARG C 2 388  ? 133.617 137.291 109.175 1.00 284.83 ? 388  ARG C CG    1 
ATOM   6590  C  CD    . ARG C 2 388  ? 134.965 137.651 108.596 1.00 284.83 ? 388  ARG C CD    1 
ATOM   6591  N  NE    . ARG C 2 388  ? 134.844 138.394 107.344 1.00 284.83 ? 388  ARG C NE    1 
ATOM   6592  C  CZ    . ARG C 2 388  ? 135.149 137.890 106.154 1.00 284.83 ? 388  ARG C CZ    1 
ATOM   6593  N  NH1   . ARG C 2 388  ? 135.592 136.645 106.058 1.00 284.83 ? 388  ARG C NH1   1 
ATOM   6594  N  NH2   . ARG C 2 388  ? 135.014 138.626 105.061 1.00 284.83 ? 388  ARG C NH2   1 
ATOM   6595  N  N     . SER C 2 389  ? 130.069 140.401 110.461 1.00 278.49 ? 389  SER C N     1 
ATOM   6596  C  CA    . SER C 2 389  ? 129.479 141.299 111.436 1.00 278.49 ? 389  SER C CA    1 
ATOM   6597  C  C     . SER C 2 389  ? 128.618 140.495 112.399 1.00 278.49 ? 389  SER C C     1 
ATOM   6598  O  O     . SER C 2 389  ? 128.236 139.355 112.120 1.00 278.49 ? 389  SER C O     1 
ATOM   6599  C  CB    . SER C 2 389  ? 128.653 142.385 110.756 1.00 278.49 ? 389  SER C CB    1 
ATOM   6600  O  OG    . SER C 2 389  ? 127.754 141.832 109.819 1.00 278.49 ? 389  SER C OG    1 
ATOM   6601  N  N     . GLN C 2 390  ? 128.338 141.092 113.556 1.00 280.04 ? 390  GLN C N     1 
ATOM   6602  C  CA    . GLN C 2 390  ? 127.492 140.430 114.541 1.00 280.04 ? 390  GLN C CA    1 
ATOM   6603  C  C     . GLN C 2 390  ? 126.067 140.285 114.031 1.00 280.04 ? 390  GLN C C     1 
ATOM   6604  O  O     . GLN C 2 390  ? 125.377 139.316 114.364 1.00 280.04 ? 390  GLN C O     1 
ATOM   6605  C  CB    . GLN C 2 390  ? 127.524 141.216 115.849 1.00 280.04 ? 390  GLN C CB    1 
ATOM   6606  C  CG    . GLN C 2 390  ? 126.836 140.549 117.019 1.00 280.04 ? 390  GLN C CG    1 
ATOM   6607  C  CD    . GLN C 2 390  ? 126.795 141.447 118.235 1.00 280.04 ? 390  GLN C CD    1 
ATOM   6608  O  OE1   . GLN C 2 390  ? 127.573 142.393 118.344 1.00 280.04 ? 390  GLN C OE1   1 
ATOM   6609  N  NE2   . GLN C 2 390  ? 125.880 141.163 119.152 1.00 280.04 ? 390  GLN C NE2   1 
ATOM   6610  N  N     . LEU C 2 391  ? 125.628 141.214 113.194 1.00 270.13 ? 391  LEU C N     1 
ATOM   6611  C  CA    . LEU C 2 391  ? 124.301 141.132 112.615 1.00 270.13 ? 391  LEU C CA    1 
ATOM   6612  C  C     . LEU C 2 391  ? 124.249 140.169 111.444 1.00 270.13 ? 391  LEU C C     1 
ATOM   6613  O  O     . LEU C 2 391  ? 123.156 139.761 111.041 1.00 270.13 ? 391  LEU C O     1 
ATOM   6614  C  CB    . LEU C 2 391  ? 123.847 142.520 112.175 1.00 270.13 ? 391  LEU C CB    1 
ATOM   6615  C  CG    . LEU C 2 391  ? 123.098 143.356 113.215 1.00 270.13 ? 391  LEU C CG    1 
ATOM   6616  C  CD1   . LEU C 2 391  ? 123.986 143.829 114.366 1.00 270.13 ? 391  LEU C CD1   1 
ATOM   6617  C  CD2   . LEU C 2 391  ? 122.462 144.546 112.536 1.00 270.13 ? 391  LEU C CD2   1 
ATOM   6618  N  N     . SER C 2 392  ? 125.404 139.800 110.894 1.00 266.87 ? 392  SER C N     1 
ATOM   6619  C  CA    . SER C 2 392  ? 125.470 138.773 109.867 1.00 266.87 ? 392  SER C CA    1 
ATOM   6620  C  C     . SER C 2 392  ? 125.253 137.422 110.517 1.00 266.87 ? 392  SER C C     1 
ATOM   6621  O  O     . SER C 2 392  ? 126.211 136.682 110.753 1.00 266.87 ? 392  SER C O     1 
ATOM   6622  C  CB    . SER C 2 392  ? 126.814 138.805 109.143 1.00 266.87 ? 392  SER C CB    1 
ATOM   6623  O  OG    . SER C 2 392  ? 127.877 138.512 110.030 1.00 266.87 ? 392  SER C OG    1 
ATOM   6624  N  N     . GLN C 2 393  ? 124.006 137.093 110.810 1.00 247.78 ? 393  GLN C N     1 
ATOM   6625  C  CA    . GLN C 2 393  ? 123.702 135.954 111.653 1.00 247.78 ? 393  GLN C CA    1 
ATOM   6626  C  C     . GLN C 2 393  ? 123.360 134.734 110.819 1.00 247.78 ? 393  GLN C C     1 
ATOM   6627  O  O     . GLN C 2 393  ? 122.860 134.841 109.700 1.00 247.78 ? 393  GLN C O     1 
ATOM   6628  C  CB    . GLN C 2 393  ? 122.550 136.278 112.595 1.00 247.78 ? 393  GLN C CB    1 
ATOM   6629  C  CG    . GLN C 2 393  ? 122.794 137.540 113.368 1.00 247.78 ? 393  GLN C CG    1 
ATOM   6630  C  CD    . GLN C 2 393  ? 122.448 137.400 114.819 1.00 247.78 ? 393  GLN C CD    1 
ATOM   6631  O  OE1   . GLN C 2 393  ? 121.782 136.447 115.222 1.00 247.78 ? 393  GLN C OE1   1 
ATOM   6632  N  NE2   . GLN C 2 393  ? 122.913 138.344 115.627 1.00 247.78 ? 393  GLN C NE2   1 
ATOM   6633  N  N     . PHE C 2 394  ? 123.659 133.577 111.387 1.00 237.44 ? 394  PHE C N     1 
ATOM   6634  C  CA    . PHE C 2 394  ? 123.314 132.300 110.793 1.00 237.44 ? 394  PHE C CA    1 
ATOM   6635  C  C     . PHE C 2 394  ? 121.810 132.171 110.679 1.00 237.44 ? 394  PHE C C     1 
ATOM   6636  O  O     . PHE C 2 394  ? 121.092 132.352 111.665 1.00 237.44 ? 394  PHE C O     1 
ATOM   6637  C  CB    . PHE C 2 394  ? 123.877 131.194 111.669 1.00 237.44 ? 394  PHE C CB    1 
ATOM   6638  C  CG    . PHE C 2 394  ? 123.773 129.837 111.079 1.00 237.44 ? 394  PHE C CG    1 
ATOM   6639  C  CD1   . PHE C 2 394  ? 124.750 129.374 110.227 1.00 237.44 ? 394  PHE C CD1   1 
ATOM   6640  C  CD2   . PHE C 2 394  ? 122.715 129.007 111.400 1.00 237.44 ? 394  PHE C CD2   1 
ATOM   6641  C  CE1   . PHE C 2 394  ? 124.673 128.115 109.690 1.00 237.44 ? 394  PHE C CE1   1 
ATOM   6642  C  CE2   . PHE C 2 394  ? 122.633 127.745 110.870 1.00 237.44 ? 394  PHE C CE2   1 
ATOM   6643  C  CZ    . PHE C 2 394  ? 123.614 127.298 110.012 1.00 237.44 ? 394  PHE C CZ    1 
ATOM   6644  N  N     . LYS C 2 395  ? 121.331 131.872 109.480 1.00 253.25 ? 395  LYS C N     1 
ATOM   6645  C  CA    . LYS C 2 395  ? 119.902 131.697 109.298 1.00 253.25 ? 395  LYS C CA    1 
ATOM   6646  C  C     . LYS C 2 395  ? 119.458 130.384 109.918 1.00 253.25 ? 395  LYS C C     1 
ATOM   6647  O  O     . LYS C 2 395  ? 120.036 129.329 109.647 1.00 253.25 ? 395  LYS C O     1 
ATOM   6648  C  CB    . LYS C 2 395  ? 119.545 131.730 107.823 1.00 253.25 ? 395  LYS C CB    1 
ATOM   6649  C  CG    . LYS C 2 395  ? 118.118 131.370 107.523 1.00 253.25 ? 395  LYS C CG    1 
ATOM   6650  C  CD    . LYS C 2 395  ? 117.229 132.593 107.590 1.00 253.25 ? 395  LYS C CD    1 
ATOM   6651  C  CE    . LYS C 2 395  ? 115.901 132.268 108.248 1.00 253.25 ? 395  LYS C CE    1 
ATOM   6652  N  NZ    . LYS C 2 395  ? 116.041 132.003 109.703 1.00 253.25 ? 395  LYS C NZ    1 
ATOM   6653  N  N     . ASP C 2 396  ? 118.437 130.458 110.761 1.00 300.72 ? 396  ASP C N     1 
ATOM   6654  C  CA    . ASP C 2 396  ? 117.927 129.306 111.482 1.00 300.72 ? 396  ASP C CA    1 
ATOM   6655  C  C     . ASP C 2 396  ? 116.604 128.843 110.896 1.00 300.72 ? 396  ASP C C     1 
ATOM   6656  O  O     . ASP C 2 396  ? 115.707 129.647 110.631 1.00 300.72 ? 396  ASP C O     1 
ATOM   6657  C  CB    . ASP C 2 396  ? 117.740 129.631 112.958 1.00 300.72 ? 396  ASP C CB    1 
ATOM   6658  C  CG    . ASP C 2 396  ? 117.212 128.460 113.732 1.00 300.72 ? 396  ASP C CG    1 
ATOM   6659  O  OD1   . ASP C 2 396  ? 118.024 127.625 114.165 1.00 300.72 ? 396  ASP C OD1   1 
ATOM   6660  O  OD2   . ASP C 2 396  ? 115.984 128.362 113.896 1.00 300.72 ? 396  ASP C OD2   1 
ATOM   6661  N  N     . GLU C 2 397  ? 116.486 127.536 110.716 1.00 319.33 ? 397  GLU C N     1 
ATOM   6662  C  CA    . GLU C 2 397  ? 115.318 126.933 110.102 1.00 319.33 ? 397  GLU C CA    1 
ATOM   6663  C  C     . GLU C 2 397  ? 114.913 125.667 110.843 1.00 319.33 ? 397  GLU C C     1 
ATOM   6664  O  O     . GLU C 2 397  ? 114.723 124.605 110.243 1.00 319.33 ? 397  GLU C O     1 
ATOM   6665  C  CB    . GLU C 2 397  ? 115.574 126.704 108.612 1.00 319.33 ? 397  GLU C CB    1 
ATOM   6666  C  CG    . GLU C 2 397  ? 116.886 125.991 108.273 1.00 319.33 ? 397  GLU C CG    1 
ATOM   6667  C  CD    . GLU C 2 397  ? 117.229 126.086 106.792 1.00 319.33 ? 397  GLU C CD    1 
ATOM   6668  O  OE1   . GLU C 2 397  ? 116.463 126.753 106.057 1.00 319.33 ? 397  GLU C OE1   1 
ATOM   6669  O  OE2   . GLU C 2 397  ? 118.262 125.514 106.373 1.00 319.33 ? 397  GLU C OE2   1 
ATOM   6670  N  N     . THR C 2 398  ? 114.812 125.759 112.171 1.00 296.05 ? 398  THR C N     1 
ATOM   6671  C  CA    . THR C 2 398  ? 114.320 124.633 112.961 1.00 296.05 ? 398  THR C CA    1 
ATOM   6672  C  C     . THR C 2 398  ? 112.871 124.317 112.622 1.00 296.05 ? 398  THR C C     1 
ATOM   6673  O  O     . THR C 2 398  ? 112.476 123.148 112.556 1.00 296.05 ? 398  THR C O     1 
ATOM   6674  C  CB    . THR C 2 398  ? 114.462 124.941 114.445 1.00 296.05 ? 398  THR C CB    1 
ATOM   6675  O  OG1   . THR C 2 398  ? 115.766 125.478 114.687 1.00 296.05 ? 398  THR C OG1   1 
ATOM   6676  C  CG2   . THR C 2 398  ? 114.267 123.683 115.275 1.00 296.05 ? 398  THR C CG2   1 
ATOM   6677  N  N     . ASN C 2 399  ? 112.072 125.347 112.398 1.00 249.17 ? 399  ASN C N     1 
ATOM   6678  C  CA    . ASN C 2 399  ? 110.759 125.202 111.791 1.00 249.17 ? 399  ASN C CA    1 
ATOM   6679  C  C     . ASN C 2 399  ? 110.484 126.480 111.013 1.00 249.17 ? 399  ASN C C     1 
ATOM   6680  O  O     . ASN C 2 399  ? 111.302 127.410 111.050 1.00 249.17 ? 399  ASN C O     1 
ATOM   6681  C  CB    . ASN C 2 399  ? 109.688 124.910 112.860 1.00 249.17 ? 399  ASN C CB    1 
ATOM   6682  C  CG    . ASN C 2 399  ? 109.801 125.801 114.059 1.00 249.17 ? 399  ASN C CG    1 
ATOM   6683  O  OD1   . ASN C 2 399  ? 109.899 127.015 113.946 1.00 249.17 ? 399  ASN C OD1   1 
ATOM   6684  N  ND2   . ASN C 2 399  ? 109.825 125.194 115.230 1.00 249.17 ? 399  ASN C ND2   1 
ATOM   6685  N  N     . PRO C 2 400  ? 109.402 126.527 110.222 1.00 211.10 ? 400  PRO C N     1 
ATOM   6686  C  CA    . PRO C 2 400  ? 109.026 127.807 109.596 1.00 211.10 ? 400  PRO C CA    1 
ATOM   6687  C  C     . PRO C 2 400  ? 108.828 128.953 110.573 1.00 211.10 ? 400  PRO C C     1 
ATOM   6688  O  O     . PRO C 2 400  ? 109.170 130.101 110.261 1.00 211.10 ? 400  PRO C O     1 
ATOM   6689  C  CB    . PRO C 2 400  ? 107.727 127.448 108.875 1.00 211.10 ? 400  PRO C CB    1 
ATOM   6690  C  CG    . PRO C 2 400  ? 107.922 126.057 108.470 1.00 211.10 ? 400  PRO C CG    1 
ATOM   6691  C  CD    . PRO C 2 400  ? 108.800 125.397 109.487 1.00 211.10 ? 400  PRO C CD    1 
ATOM   6692  N  N     . LEU C 2 401  ? 108.313 128.656 111.764 1.00 225.41 ? 401  LEU C N     1 
ATOM   6693  C  CA    . LEU C 2 401  ? 108.179 129.677 112.793 1.00 225.41 ? 401  LEU C CA    1 
ATOM   6694  C  C     . LEU C 2 401  ? 109.539 130.170 113.259 1.00 225.41 ? 401  LEU C C     1 
ATOM   6695  O  O     . LEU C 2 401  ? 109.701 131.356 113.559 1.00 225.41 ? 401  LEU C O     1 
ATOM   6696  C  CB    . LEU C 2 401  ? 107.375 129.119 113.963 1.00 225.41 ? 401  LEU C CB    1 
ATOM   6697  C  CG    . LEU C 2 401  ? 107.384 129.898 115.274 1.00 225.41 ? 401  LEU C CG    1 
ATOM   6698  C  CD1   . LEU C 2 401  ? 106.686 131.227 115.092 1.00 225.41 ? 401  LEU C CD1   1 
ATOM   6699  C  CD2   . LEU C 2 401  ? 106.752 129.098 116.393 1.00 225.41 ? 401  LEU C CD2   1 
ATOM   6700  N  N     . SER C 2 402  ? 110.530 129.276 113.303 1.00 241.01 ? 402  SER C N     1 
ATOM   6701  C  CA    . SER C 2 402  ? 111.878 129.669 113.697 1.00 241.01 ? 402  SER C CA    1 
ATOM   6702  C  C     . SER C 2 402  ? 112.460 130.654 112.703 1.00 241.01 ? 402  SER C C     1 
ATOM   6703  O  O     . SER C 2 402  ? 113.012 131.690 113.090 1.00 241.01 ? 402  SER C O     1 
ATOM   6704  C  CB    . SER C 2 402  ? 112.775 128.440 113.803 1.00 241.01 ? 402  SER C CB    1 
ATOM   6705  O  OG    . SER C 2 402  ? 113.040 127.893 112.522 1.00 241.01 ? 402  SER C OG    1 
ATOM   6706  N  N     . SER C 2 403  ? 112.281 130.371 111.415 1.00 231.32 ? 403  SER C N     1 
ATOM   6707  C  CA    . SER C 2 403  ? 112.747 131.272 110.374 1.00 231.32 ? 403  SER C CA    1 
ATOM   6708  C  C     . SER C 2 403  ? 112.007 132.599 110.422 1.00 231.32 ? 403  SER C C     1 
ATOM   6709  O  O     . SER C 2 403  ? 112.621 133.666 110.303 1.00 231.32 ? 403  SER C O     1 
ATOM   6710  C  CB    . SER C 2 403  ? 112.570 130.608 109.014 1.00 231.32 ? 403  SER C CB    1 
ATOM   6711  O  OG    . SER C 2 403  ? 113.328 129.415 108.944 1.00 231.32 ? 403  SER C OG    1 
ATOM   6712  N  N     . LEU C 2 404  ? 110.697 132.550 110.654 1.00 218.37 ? 404  LEU C N     1 
ATOM   6713  C  CA    . LEU C 2 404  ? 109.896 133.765 110.660 1.00 218.37 ? 404  LEU C CA    1 
ATOM   6714  C  C     . LEU C 2 404  ? 110.252 134.653 111.839 1.00 218.37 ? 404  LEU C C     1 
ATOM   6715  O  O     . LEU C 2 404  ? 110.458 135.860 111.685 1.00 218.37 ? 404  LEU C O     1 
ATOM   6716  C  CB    . LEU C 2 404  ? 108.417 133.409 110.697 1.00 218.37 ? 404  LEU C CB    1 
ATOM   6717  C  CG    . LEU C 2 404  ? 107.518 134.625 110.891 1.00 218.37 ? 404  LEU C CG    1 
ATOM   6718  C  CD1   . LEU C 2 404  ? 107.639 135.577 109.710 1.00 218.37 ? 404  LEU C CD1   1 
ATOM   6719  C  CD2   . LEU C 2 404  ? 106.087 134.191 111.083 1.00 218.37 ? 404  LEU C CD2   1 
ATOM   6720  N  N     . ARG C 2 405  ? 110.334 134.061 113.025 1.00 217.25 ? 405  ARG C N     1 
ATOM   6721  C  CA    . ARG C 2 405  ? 110.668 134.809 114.224 1.00 217.25 ? 405  ARG C CA    1 
ATOM   6722  C  C     . ARG C 2 405  ? 112.093 135.326 114.151 1.00 217.25 ? 405  ARG C C     1 
ATOM   6723  O  O     . ARG C 2 405  ? 112.398 136.401 114.675 1.00 217.25 ? 405  ARG C O     1 
ATOM   6724  C  CB    . ARG C 2 405  ? 110.450 133.902 115.438 1.00 217.25 ? 405  ARG C CB    1 
ATOM   6725  C  CG    . ARG C 2 405  ? 110.522 134.518 116.840 1.00 217.25 ? 405  ARG C CG    1 
ATOM   6726  C  CD    . ARG C 2 405  ? 111.920 134.374 117.358 1.00 217.25 ? 405  ARG C CD    1 
ATOM   6727  N  NE    . ARG C 2 405  ? 112.367 133.020 117.089 1.00 217.25 ? 405  ARG C NE    1 
ATOM   6728  C  CZ    . ARG C 2 405  ? 113.606 132.708 116.740 1.00 217.25 ? 405  ARG C CZ    1 
ATOM   6729  N  NH1   . ARG C 2 405  ? 114.505 133.666 116.572 1.00 217.25 ? 405  ARG C NH1   1 
ATOM   6730  N  NH2   . ARG C 2 405  ? 113.927 131.443 116.504 1.00 217.25 ? 405  ARG C NH2   1 
ATOM   6731  N  N     . HIS C 2 406  ? 112.980 134.567 113.508 1.00 231.20 ? 406  HIS C N     1 
ATOM   6732  C  CA    . HIS C 2 406  ? 114.337 135.041 113.307 1.00 231.20 ? 406  HIS C CA    1 
ATOM   6733  C  C     . HIS C 2 406  ? 114.361 136.230 112.365 1.00 231.20 ? 406  HIS C C     1 
ATOM   6734  O  O     . HIS C 2 406  ? 115.201 137.124 112.503 1.00 231.20 ? 406  HIS C O     1 
ATOM   6735  C  CB    . HIS C 2 406  ? 115.202 133.914 112.761 1.00 231.20 ? 406  HIS C CB    1 
ATOM   6736  C  CG    . HIS C 2 406  ? 116.648 134.048 113.109 1.00 231.20 ? 406  HIS C CG    1 
ATOM   6737  N  ND1   . HIS C 2 406  ? 117.534 132.998 113.021 1.00 231.20 ? 406  HIS C ND1   1 
ATOM   6738  C  CD2   . HIS C 2 406  ? 117.363 135.109 113.548 1.00 231.20 ? 406  HIS C CD2   1 
ATOM   6739  C  CE1   . HIS C 2 406  ? 118.731 133.404 113.399 1.00 231.20 ? 406  HIS C CE1   1 
ATOM   6740  N  NE2   . HIS C 2 406  ? 118.656 134.683 113.720 1.00 231.20 ? 406  HIS C NE2   1 
ATOM   6741  N  N     . LYS C 2 407  ? 113.442 136.261 111.405 1.00 243.12 ? 407  LYS C N     1 
ATOM   6742  C  CA    . LYS C 2 407  ? 113.350 137.425 110.537 1.00 243.12 ? 407  LYS C CA    1 
ATOM   6743  C  C     . LYS C 2 407  ? 112.766 138.614 111.285 1.00 243.12 ? 407  LYS C C     1 
ATOM   6744  O  O     . LYS C 2 407  ? 113.258 139.741 111.177 1.00 243.12 ? 407  LYS C O     1 
ATOM   6745  C  CB    . LYS C 2 407  ? 112.522 137.086 109.304 1.00 243.12 ? 407  LYS C CB    1 
ATOM   6746  C  CG    . LYS C 2 407  ? 113.281 136.203 108.348 1.00 243.12 ? 407  LYS C CG    1 
ATOM   6747  C  CD    . LYS C 2 407  ? 112.652 136.143 106.973 1.00 243.12 ? 407  LYS C CD    1 
ATOM   6748  C  CE    . LYS C 2 407  ? 113.562 135.374 106.032 1.00 243.12 ? 407  LYS C CE    1 
ATOM   6749  N  NZ    . LYS C 2 407  ? 113.059 135.338 104.646 1.00 243.12 ? 407  LYS C NZ    1 
ATOM   6750  N  N     . ARG C 2 408  ? 111.733 138.371 112.080 1.00 233.80 ? 408  ARG C N     1 
ATOM   6751  C  CA    . ARG C 2 408  ? 111.058 139.443 112.793 1.00 233.80 ? 408  ARG C CA    1 
ATOM   6752  C  C     . ARG C 2 408  ? 111.750 139.818 114.086 1.00 233.80 ? 408  ARG C C     1 
ATOM   6753  O  O     . ARG C 2 408  ? 111.267 140.713 114.788 1.00 233.80 ? 408  ARG C O     1 
ATOM   6754  C  CB    . ARG C 2 408  ? 109.615 139.042 113.076 1.00 233.80 ? 408  ARG C CB    1 
ATOM   6755  C  CG    . ARG C 2 408  ? 108.617 139.695 112.154 1.00 233.80 ? 408  ARG C CG    1 
ATOM   6756  C  CD    . ARG C 2 408  ? 108.295 141.093 112.619 1.00 233.80 ? 408  ARG C CD    1 
ATOM   6757  N  NE    . ARG C 2 408  ? 107.547 141.078 113.869 1.00 233.80 ? 408  ARG C NE    1 
ATOM   6758  C  CZ    . ARG C 2 408  ? 106.220 141.040 113.947 1.00 233.80 ? 408  ARG C CZ    1 
ATOM   6759  N  NH1   . ARG C 2 408  ? 105.489 141.015 112.841 1.00 233.80 ? 408  ARG C NH1   1 
ATOM   6760  N  NH2   . ARG C 2 408  ? 105.626 141.036 115.132 1.00 233.80 ? 408  ARG C NH2   1 
ATOM   6761  N  N     . ARG C 2 409  ? 112.846 139.149 114.424 1.00 253.60 ? 409  ARG C N     1 
ATOM   6762  C  CA    . ARG C 2 409  ? 113.627 139.536 115.585 1.00 253.60 ? 409  ARG C CA    1 
ATOM   6763  C  C     . ARG C 2 409  ? 114.265 140.895 115.353 1.00 253.60 ? 409  ARG C C     1 
ATOM   6764  O  O     . ARG C 2 409  ? 114.749 141.189 114.259 1.00 253.60 ? 409  ARG C O     1 
ATOM   6765  C  CB    . ARG C 2 409  ? 114.705 138.491 115.851 1.00 253.60 ? 409  ARG C CB    1 
ATOM   6766  C  CG    . ARG C 2 409  ? 115.276 138.535 117.240 1.00 253.60 ? 409  ARG C CG    1 
ATOM   6767  C  CD    . ARG C 2 409  ? 114.223 138.174 118.268 1.00 253.60 ? 409  ARG C CD    1 
ATOM   6768  N  NE    . ARG C 2 409  ? 114.060 136.738 118.454 1.00 253.60 ? 409  ARG C NE    1 
ATOM   6769  C  CZ    . ARG C 2 409  ? 114.765 136.019 119.317 1.00 253.60 ? 409  ARG C CZ    1 
ATOM   6770  N  NH1   . ARG C 2 409  ? 114.554 134.717 119.433 1.00 253.60 ? 409  ARG C NH1   1 
ATOM   6771  N  NH2   . ARG C 2 409  ? 115.687 136.606 120.062 1.00 253.60 ? 409  ARG C NH2   1 
ATOM   6772  N  N     . ILE C 2 410  ? 114.227 141.746 116.372 1.00 236.26 ? 410  ILE C N     1 
ATOM   6773  C  CA    . ILE C 2 410  ? 114.939 143.015 116.332 1.00 236.26 ? 410  ILE C CA    1 
ATOM   6774  C  C     . ILE C 2 410  ? 115.859 143.085 117.537 1.00 236.26 ? 410  ILE C C     1 
ATOM   6775  O  O     . ILE C 2 410  ? 115.654 142.397 118.542 1.00 236.26 ? 410  ILE C O     1 
ATOM   6776  C  CB    . ILE C 2 410  ? 114.001 144.231 116.300 1.00 236.26 ? 410  ILE C CB    1 
ATOM   6777  C  CG1   . ILE C 2 410  ? 113.123 144.250 117.540 1.00 236.26 ? 410  ILE C CG1   1 
ATOM   6778  C  CG2   . ILE C 2 410  ? 113.161 144.205 115.055 1.00 236.26 ? 410  ILE C CG2   1 
ATOM   6779  C  CD1   . ILE C 2 410  ? 112.332 145.490 117.709 1.00 236.26 ? 410  ILE C CD1   1 
ATOM   6780  N  N     . SER C 2 411  ? 116.891 143.914 117.429 1.00 252.10 ? 411  SER C N     1 
ATOM   6781  C  CA    . SER C 2 411  ? 117.911 143.961 118.460 1.00 252.10 ? 411  SER C CA    1 
ATOM   6782  C  C     . SER C 2 411  ? 118.290 145.396 118.768 1.00 252.10 ? 411  SER C C     1 
ATOM   6783  O  O     . SER C 2 411  ? 117.949 146.332 118.042 1.00 252.10 ? 411  SER C O     1 
ATOM   6784  C  CB    . SER C 2 411  ? 119.166 143.189 118.059 1.00 252.10 ? 411  SER C CB    1 
ATOM   6785  O  OG    . SER C 2 411  ? 120.275 143.650 118.801 1.00 252.10 ? 411  SER C OG    1 
ATOM   6786  N  N     . ALA C 2 412  ? 119.033 145.544 119.859 1.00 255.84 ? 412  ALA C N     1 
ATOM   6787  C  CA    . ALA C 2 412  ? 119.530 146.829 120.305 1.00 255.84 ? 412  ALA C CA    1 
ATOM   6788  C  C     . ALA C 2 412  ? 121.048 146.895 120.374 1.00 255.84 ? 412  ALA C C     1 
ATOM   6789  O  O     . ALA C 2 412  ? 121.588 147.922 120.801 1.00 255.84 ? 412  ALA C O     1 
ATOM   6790  C  CB    . ALA C 2 412  ? 118.942 147.165 121.679 1.00 255.84 ? 412  ALA C CB    1 
ATOM   6791  N  N     . LEU C 2 413  ? 121.752 145.840 119.983 1.00 282.35 ? 413  LEU C N     1 
ATOM   6792  C  CA    . LEU C 2 413  ? 123.203 145.834 120.013 1.00 282.35 ? 413  LEU C CA    1 
ATOM   6793  C  C     . LEU C 2 413  ? 123.775 145.956 118.607 1.00 282.35 ? 413  LEU C C     1 
ATOM   6794  O  O     . LEU C 2 413  ? 123.051 146.125 117.623 1.00 282.35 ? 413  LEU C O     1 
ATOM   6795  C  CB    . LEU C 2 413  ? 123.722 144.573 120.690 1.00 282.35 ? 413  LEU C CB    1 
ATOM   6796  C  CG    . LEU C 2 413  ? 123.372 144.432 122.158 1.00 282.35 ? 413  LEU C CG    1 
ATOM   6797  C  CD1   . LEU C 2 413  ? 124.080 143.213 122.686 1.00 282.35 ? 413  LEU C CD1   1 
ATOM   6798  C  CD2   . LEU C 2 413  ? 123.772 145.680 122.919 1.00 282.35 ? 413  LEU C CD2   1 
ATOM   6799  N  N     . GLY C 2 414  ? 125.094 145.852 118.509 1.00 313.35 ? 414  GLY C N     1 
ATOM   6800  C  CA    . GLY C 2 414  ? 125.782 145.978 117.250 1.00 313.35 ? 414  GLY C CA    1 
ATOM   6801  C  C     . GLY C 2 414  ? 126.936 146.946 117.367 1.00 313.35 ? 414  GLY C C     1 
ATOM   6802  O  O     . GLY C 2 414  ? 127.129 147.590 118.402 1.00 313.35 ? 414  GLY C O     1 
ATOM   6803  N  N     . PRO C 2 415  ? 127.753 147.037 116.326 1.00 326.26 ? 415  PRO C N     1 
ATOM   6804  C  CA    . PRO C 2 415  ? 128.773 148.085 116.301 1.00 326.26 ? 415  PRO C CA    1 
ATOM   6805  C  C     . PRO C 2 415  ? 128.094 149.428 116.164 1.00 326.26 ? 415  PRO C C     1 
ATOM   6806  O  O     . PRO C 2 415  ? 127.589 149.784 115.096 1.00 326.26 ? 415  PRO C O     1 
ATOM   6807  C  CB    . PRO C 2 415  ? 129.618 147.733 115.073 1.00 326.26 ? 415  PRO C CB    1 
ATOM   6808  C  CG    . PRO C 2 415  ? 129.377 146.284 114.860 1.00 326.26 ? 415  PRO C CG    1 
ATOM   6809  C  CD    . PRO C 2 415  ? 127.948 146.063 115.243 1.00 326.26 ? 415  PRO C CD    1 
ATOM   6810  N  N     . GLY C 2 416  ? 128.075 150.175 117.257 1.00 355.32 ? 416  GLY C N     1 
ATOM   6811  C  CA    . GLY C 2 416  ? 127.167 151.285 117.401 1.00 355.32 ? 416  GLY C CA    1 
ATOM   6812  C  C     . GLY C 2 416  ? 125.959 150.976 118.250 1.00 355.32 ? 416  GLY C C     1 
ATOM   6813  O  O     . GLY C 2 416  ? 125.122 151.863 118.454 1.00 355.32 ? 416  GLY C O     1 
ATOM   6814  N  N     . GLY C 2 417  ? 125.838 149.750 118.749 1.00 327.31 ? 417  GLY C N     1 
ATOM   6815  C  CA    . GLY C 2 417  ? 124.799 149.435 119.705 1.00 327.31 ? 417  GLY C CA    1 
ATOM   6816  C  C     . GLY C 2 417  ? 125.267 149.773 121.102 1.00 327.31 ? 417  GLY C C     1 
ATOM   6817  O  O     . GLY C 2 417  ? 125.678 150.906 121.364 1.00 327.31 ? 417  GLY C O     1 
ATOM   6818  N  N     . LEU C 2 418  ? 125.209 148.815 122.018 1.00 305.20 ? 418  LEU C N     1 
ATOM   6819  C  CA    . LEU C 2 418  ? 125.696 149.055 123.364 1.00 305.20 ? 418  LEU C CA    1 
ATOM   6820  C  C     . LEU C 2 418  ? 126.539 147.874 123.811 1.00 305.20 ? 418  LEU C C     1 
ATOM   6821  O  O     . LEU C 2 418  ? 126.825 146.953 123.040 1.00 305.20 ? 418  LEU C O     1 
ATOM   6822  C  CB    . LEU C 2 418  ? 124.554 149.312 124.348 1.00 305.20 ? 418  LEU C CB    1 
ATOM   6823  C  CG    . LEU C 2 418  ? 124.003 150.737 124.358 1.00 305.20 ? 418  LEU C CG    1 
ATOM   6824  C  CD1   . LEU C 2 418  ? 122.858 150.897 123.376 1.00 305.20 ? 418  LEU C CD1   1 
ATOM   6825  C  CD2   . LEU C 2 418  ? 123.576 151.134 125.757 1.00 305.20 ? 418  LEU C CD2   1 
ATOM   6826  N  N     . THR C 2 419  ? 126.945 147.918 125.074 1.00 320.41 ? 419  THR C N     1 
ATOM   6827  C  CA    . THR C 2 419  ? 127.773 146.888 125.675 1.00 320.41 ? 419  THR C CA    1 
ATOM   6828  C  C     . THR C 2 419  ? 127.051 146.293 126.872 1.00 320.41 ? 419  THR C C     1 
ATOM   6829  O  O     . THR C 2 419  ? 126.103 146.884 127.398 1.00 320.41 ? 419  THR C O     1 
ATOM   6830  C  CB    . THR C 2 419  ? 129.132 147.446 126.106 1.00 320.41 ? 419  THR C CB    1 
ATOM   6831  O  OG1   . THR C 2 419  ? 129.953 146.378 126.585 1.00 320.41 ? 419  THR C OG1   1 
ATOM   6832  C  CG2   . THR C 2 419  ? 128.967 148.479 127.211 1.00 320.41 ? 419  THR C CG2   1 
ATOM   6833  N  N     . ARG C 2 420  ? 127.491 145.109 127.285 1.00 307.29 ? 420  ARG C N     1 
ATOM   6834  C  CA    . ARG C 2 420  ? 126.925 144.497 128.477 1.00 307.29 ? 420  ARG C CA    1 
ATOM   6835  C  C     . ARG C 2 420  ? 127.583 145.038 129.730 1.00 307.29 ? 420  ARG C C     1 
ATOM   6836  O  O     . ARG C 2 420  ? 127.052 144.876 130.834 1.00 307.29 ? 420  ARG C O     1 
ATOM   6837  C  CB    . ARG C 2 420  ? 127.098 142.989 128.410 1.00 307.29 ? 420  ARG C CB    1 
ATOM   6838  C  CG    . ARG C 2 420  ? 125.877 142.200 128.779 1.00 307.29 ? 420  ARG C CG    1 
ATOM   6839  C  CD    . ARG C 2 420  ? 126.112 140.730 128.507 1.00 307.29 ? 420  ARG C CD    1 
ATOM   6840  N  NE    . ARG C 2 420  ? 126.364 140.458 127.095 1.00 307.29 ? 420  ARG C NE    1 
ATOM   6841  C  CZ    . ARG C 2 420  ? 127.547 140.106 126.602 1.00 307.29 ? 420  ARG C CZ    1 
ATOM   6842  N  NH1   . ARG C 2 420  ? 128.593 140.010 127.409 1.00 307.29 ? 420  ARG C NH1   1 
ATOM   6843  N  NH2   . ARG C 2 420  ? 127.690 139.872 125.305 1.00 307.29 ? 420  ARG C NH2   1 
ATOM   6844  N  N     . GLU C 2 421  ? 128.742 145.673 129.568 1.00 330.99 ? 421  GLU C N     1 
ATOM   6845  C  CA    . GLU C 2 421  ? 129.533 146.133 130.700 1.00 330.99 ? 421  GLU C CA    1 
ATOM   6846  C  C     . GLU C 2 421  ? 128.827 147.257 131.440 1.00 330.99 ? 421  GLU C C     1 
ATOM   6847  O  O     . GLU C 2 421  ? 128.520 147.142 132.630 1.00 330.99 ? 421  GLU C O     1 
ATOM   6848  C  CB    . GLU C 2 421  ? 130.903 146.582 130.193 1.00 330.99 ? 421  GLU C CB    1 
ATOM   6849  C  CG    . GLU C 2 421  ? 131.899 145.446 129.992 1.00 330.99 ? 421  GLU C CG    1 
ATOM   6850  C  CD    . GLU C 2 421  ? 131.763 144.718 128.656 1.00 330.99 ? 421  GLU C CD    1 
ATOM   6851  O  OE1   . GLU C 2 421  ? 130.695 144.782 128.013 1.00 330.99 ? 421  GLU C OE1   1 
ATOM   6852  O  OE2   . GLU C 2 421  ? 132.749 144.069 128.246 1.00 330.99 ? 421  GLU C OE2   1 
ATOM   6853  N  N     . ARG C 2 422  ? 128.531 148.340 130.738 1.00 415.79 ? 422  ARG C N     1 
ATOM   6854  C  CA    . ARG C 2 422  ? 127.804 149.446 131.337 1.00 415.79 ? 422  ARG C CA    1 
ATOM   6855  C  C     . ARG C 2 422  ? 126.296 149.282 131.226 1.00 415.79 ? 422  ARG C C     1 
ATOM   6856  O  O     . ARG C 2 422  ? 125.570 150.262 131.420 1.00 415.79 ? 422  ARG C O     1 
ATOM   6857  C  CB    . ARG C 2 422  ? 128.242 150.758 130.687 1.00 415.79 ? 422  ARG C CB    1 
ATOM   6858  C  CG    . ARG C 2 422  ? 129.751 150.888 130.556 1.00 415.79 ? 422  ARG C CG    1 
ATOM   6859  C  CD    . ARG C 2 422  ? 130.136 151.556 129.249 1.00 415.79 ? 422  ARG C CD    1 
ATOM   6860  N  NE    . ARG C 2 422  ? 129.325 152.740 128.986 1.00 415.79 ? 422  ARG C NE    1 
ATOM   6861  C  CZ    . ARG C 2 422  ? 129.369 153.439 127.858 1.00 415.79 ? 422  ARG C CZ    1 
ATOM   6862  N  NH1   . ARG C 2 422  ? 128.595 154.502 127.704 1.00 415.79 ? 422  ARG C NH1   1 
ATOM   6863  N  NH2   . ARG C 2 422  ? 130.190 153.076 126.883 1.00 415.79 ? 422  ARG C NH2   1 
ATOM   6864  N  N     . ALA C 2 423  ? 125.815 148.078 130.922 1.00 357.05 ? 423  ALA C N     1 
ATOM   6865  C  CA    . ALA C 2 423  ? 124.392 147.854 130.705 1.00 357.05 ? 423  ALA C CA    1 
ATOM   6866  C  C     . ALA C 2 423  ? 123.625 147.945 132.014 1.00 357.05 ? 423  ALA C C     1 
ATOM   6867  O  O     . ALA C 2 423  ? 123.861 147.161 132.938 1.00 357.05 ? 423  ALA C O     1 
ATOM   6868  C  CB    . ALA C 2 423  ? 124.171 146.491 130.059 1.00 357.05 ? 423  ALA C CB    1 
ATOM   6869  N  N     . GLY C 2 424  ? 122.698 148.895 132.085 1.00 319.47 ? 424  GLY C N     1 
ATOM   6870  C  CA    . GLY C 2 424  ? 121.885 149.074 133.269 1.00 319.47 ? 424  GLY C CA    1 
ATOM   6871  C  C     . GLY C 2 424  ? 120.546 148.381 133.157 1.00 319.47 ? 424  GLY C C     1 
ATOM   6872  O  O     . GLY C 2 424  ? 120.481 147.184 132.870 1.00 319.47 ? 424  GLY C O     1 
ATOM   6873  N  N     . PHE C 2 425  ? 119.467 149.119 133.386 1.00 311.69 ? 425  PHE C N     1 
ATOM   6874  C  CA    . PHE C 2 425  ? 118.141 148.523 133.339 1.00 311.69 ? 425  PHE C CA    1 
ATOM   6875  C  C     . PHE C 2 425  ? 117.252 149.311 132.398 1.00 311.69 ? 425  PHE C C     1 
ATOM   6876  O  O     . PHE C 2 425  ? 116.179 148.847 132.003 1.00 311.69 ? 425  PHE C O     1 
ATOM   6877  C  CB    . PHE C 2 425  ? 117.538 148.466 134.735 1.00 311.69 ? 425  PHE C CB    1 
ATOM   6878  C  CG    . PHE C 2 425  ? 118.504 148.017 135.775 1.00 311.69 ? 425  PHE C CG    1 
ATOM   6879  C  CD1   . PHE C 2 425  ? 119.026 146.737 135.736 1.00 311.69 ? 425  PHE C CD1   1 
ATOM   6880  C  CD2   . PHE C 2 425  ? 118.902 148.872 136.783 1.00 311.69 ? 425  PHE C CD2   1 
ATOM   6881  C  CE1   . PHE C 2 425  ? 119.925 146.317 136.688 1.00 311.69 ? 425  PHE C CE1   1 
ATOM   6882  C  CE2   . PHE C 2 425  ? 119.798 148.457 137.743 1.00 311.69 ? 425  PHE C CE2   1 
ATOM   6883  C  CZ    . PHE C 2 425  ? 120.311 147.176 137.694 1.00 311.69 ? 425  PHE C CZ    1 
ATOM   6884  N  N     . ASP C 2 426  ? 117.701 150.515 132.050 1.00 332.79 ? 426  ASP C N     1 
ATOM   6885  C  CA    . ASP C 2 426  ? 117.015 151.320 131.048 1.00 332.79 ? 426  ASP C CA    1 
ATOM   6886  C  C     . ASP C 2 426  ? 117.060 150.650 129.687 1.00 332.79 ? 426  ASP C C     1 
ATOM   6887  O  O     . ASP C 2 426  ? 116.150 150.814 128.870 1.00 332.79 ? 426  ASP C O     1 
ATOM   6888  C  CB    . ASP C 2 426  ? 117.664 152.695 130.971 1.00 332.79 ? 426  ASP C CB    1 
ATOM   6889  C  CG    . ASP C 2 426  ? 119.170 152.607 130.899 1.00 332.79 ? 426  ASP C CG    1 
ATOM   6890  O  OD1   . ASP C 2 426  ? 119.730 151.646 131.471 1.00 332.79 ? 426  ASP C OD1   1 
ATOM   6891  O  OD2   . ASP C 2 426  ? 119.792 153.482 130.264 1.00 332.79 ? 426  ASP C OD2   1 
ATOM   6892  N  N     . VAL C 2 427  ? 118.115 149.883 129.431 1.00 325.40 ? 427  VAL C N     1 
ATOM   6893  C  CA    . VAL C 2 427  ? 118.232 149.097 128.214 1.00 325.40 ? 427  VAL C CA    1 
ATOM   6894  C  C     . VAL C 2 427  ? 117.644 147.720 128.468 1.00 325.40 ? 427  VAL C C     1 
ATOM   6895  O  O     . VAL C 2 427  ? 117.721 146.833 127.614 1.00 325.40 ? 427  VAL C O     1 
ATOM   6896  C  CB    . VAL C 2 427  ? 119.696 149.000 127.760 1.00 325.40 ? 427  VAL C CB    1 
ATOM   6897  C  CG1   . VAL C 2 427  ? 120.275 150.390 127.574 1.00 325.40 ? 427  VAL C CG1   1 
ATOM   6898  C  CG2   . VAL C 2 427  ? 120.508 148.218 128.778 1.00 325.40 ? 427  VAL C CG2   1 
ATOM   6899  N  N     . ARG C 2 428  ? 117.059 147.528 129.645 1.00 327.06 ? 428  ARG C N     1 
ATOM   6900  C  CA    . ARG C 2 428  ? 116.500 146.239 130.007 1.00 327.06 ? 428  ARG C CA    1 
ATOM   6901  C  C     . ARG C 2 428  ? 115.028 146.274 130.371 1.00 327.06 ? 428  ARG C C     1 
ATOM   6902  O  O     . ARG C 2 428  ? 114.340 145.279 130.128 1.00 327.06 ? 428  ARG C O     1 
ATOM   6903  C  CB    . ARG C 2 428  ? 117.282 145.632 131.177 1.00 327.06 ? 428  ARG C CB    1 
ATOM   6904  C  CG    . ARG C 2 428  ? 118.699 145.248 130.818 1.00 327.06 ? 428  ARG C CG    1 
ATOM   6905  C  CD    . ARG C 2 428  ? 119.249 144.251 131.813 1.00 327.06 ? 428  ARG C CD    1 
ATOM   6906  N  NE    . ARG C 2 428  ? 120.500 143.649 131.364 1.00 327.06 ? 428  ARG C NE    1 
ATOM   6907  C  CZ    . ARG C 2 428  ? 121.701 144.156 131.615 1.00 327.06 ? 428  ARG C CZ    1 
ATOM   6908  N  NH1   . ARG C 2 428  ? 121.818 145.280 132.303 1.00 327.06 ? 428  ARG C NH1   1 
ATOM   6909  N  NH2   . ARG C 2 428  ? 122.786 143.540 131.175 1.00 327.06 ? 428  ARG C NH2   1 
ATOM   6910  N  N     . ASP C 2 429  ? 114.515 147.362 130.928 1.00 300.34 ? 429  ASP C N     1 
ATOM   6911  C  CA    . ASP C 2 429  ? 113.111 147.421 131.296 1.00 300.34 ? 429  ASP C CA    1 
ATOM   6912  C  C     . ASP C 2 429  ? 112.263 147.770 130.076 1.00 300.34 ? 429  ASP C C     1 
ATOM   6913  O  O     . ASP C 2 429  ? 112.768 148.030 128.982 1.00 300.34 ? 429  ASP C O     1 
ATOM   6914  C  CB    . ASP C 2 429  ? 112.890 148.426 132.427 1.00 300.34 ? 429  ASP C CB    1 
ATOM   6915  C  CG    . ASP C 2 429  ? 111.727 148.043 133.328 1.00 300.34 ? 429  ASP C CG    1 
ATOM   6916  O  OD1   . ASP C 2 429  ? 110.665 147.653 132.796 1.00 300.34 ? 429  ASP C OD1   1 
ATOM   6917  O  OD2   . ASP C 2 429  ? 111.873 148.126 134.565 1.00 300.34 ? 429  ASP C OD2   1 
ATOM   6918  N  N     . VAL C 2 430  ? 110.951 147.778 130.277 1.00 266.21 ? 430  VAL C N     1 
ATOM   6919  C  CA    . VAL C 2 430  ? 109.983 148.073 129.233 1.00 266.21 ? 430  VAL C CA    1 
ATOM   6920  C  C     . VAL C 2 430  ? 109.341 149.420 129.551 1.00 266.21 ? 430  VAL C C     1 
ATOM   6921  O  O     . VAL C 2 430  ? 108.727 149.617 130.604 1.00 266.21 ? 430  VAL C O     1 
ATOM   6922  C  CB    . VAL C 2 430  ? 108.961 146.939 129.075 1.00 266.21 ? 430  VAL C CB    1 
ATOM   6923  C  CG1   . VAL C 2 430  ? 108.458 146.436 130.421 1.00 266.21 ? 430  VAL C CG1   1 
ATOM   6924  C  CG2   . VAL C 2 430  ? 107.799 147.399 128.238 1.00 266.21 ? 430  VAL C CG2   1 
ATOM   6925  N  N     . HIS C 2 431  ? 109.535 150.380 128.654 1.00 243.50 ? 431  HIS C N     1 
ATOM   6926  C  CA    . HIS C 2 431  ? 108.863 151.664 128.768 1.00 243.50 ? 431  HIS C CA    1 
ATOM   6927  C  C     . HIS C 2 431  ? 107.381 151.501 128.481 1.00 243.50 ? 431  HIS C C     1 
ATOM   6928  O  O     . HIS C 2 431  ? 106.959 150.550 127.822 1.00 243.50 ? 431  HIS C O     1 
ATOM   6929  C  CB    . HIS C 2 431  ? 109.473 152.663 127.792 1.00 243.50 ? 431  HIS C CB    1 
ATOM   6930  C  CG    . HIS C 2 431  ? 109.160 154.091 128.104 1.00 243.50 ? 431  HIS C CG    1 
ATOM   6931  N  ND1   . HIS C 2 431  ? 108.093 154.755 127.545 1.00 243.50 ? 431  HIS C ND1   1 
ATOM   6932  C  CD2   . HIS C 2 431  ? 109.770 154.983 128.916 1.00 243.50 ? 431  HIS C CD2   1 
ATOM   6933  C  CE1   . HIS C 2 431  ? 108.062 155.996 127.991 1.00 243.50 ? 431  HIS C CE1   1 
ATOM   6934  N  NE2   . HIS C 2 431  ? 109.070 156.160 128.826 1.00 243.50 ? 431  HIS C NE2   1 
ATOM   6935  N  N     . ARG C 2 432  ? 106.589 152.458 128.963 1.00 235.24 ? 432  ARG C N     1 
ATOM   6936  C  CA    . ARG C 2 432  ? 105.155 152.430 128.713 1.00 235.24 ? 432  ARG C CA    1 
ATOM   6937  C  C     . ARG C 2 432  ? 104.831 152.668 127.247 1.00 235.24 ? 432  ARG C C     1 
ATOM   6938  O  O     . ARG C 2 432  ? 103.749 152.301 126.778 1.00 235.24 ? 432  ARG C O     1 
ATOM   6939  C  CB    . ARG C 2 432  ? 104.469 153.479 129.573 1.00 235.24 ? 432  ARG C CB    1 
ATOM   6940  C  CG    . ARG C 2 432  ? 104.977 154.874 129.304 1.00 235.24 ? 432  ARG C CG    1 
ATOM   6941  C  CD    . ARG C 2 432  ? 104.065 155.918 129.907 1.00 235.24 ? 432  ARG C CD    1 
ATOM   6942  N  NE    . ARG C 2 432  ? 104.465 157.262 129.518 1.00 235.24 ? 432  ARG C NE    1 
ATOM   6943  C  CZ    . ARG C 2 432  ? 104.118 157.838 128.372 1.00 235.24 ? 432  ARG C CZ    1 
ATOM   6944  N  NH1   . ARG C 2 432  ? 103.359 157.190 127.500 1.00 235.24 ? 432  ARG C NH1   1 
ATOM   6945  N  NH2   . ARG C 2 432  ? 104.530 159.064 128.098 1.00 235.24 ? 432  ARG C NH2   1 
ATOM   6946  N  N     . THR C 2 433  ? 105.765 153.251 126.502 1.00 223.00 ? 433  THR C N     1 
ATOM   6947  C  CA    . THR C 2 433  ? 105.540 153.516 125.093 1.00 223.00 ? 433  THR C CA    1 
ATOM   6948  C  C     . THR C 2 433  ? 105.775 152.280 124.247 1.00 223.00 ? 433  THR C C     1 
ATOM   6949  O  O     . THR C 2 433  ? 105.629 152.339 123.028 1.00 223.00 ? 433  THR C O     1 
ATOM   6950  C  CB    . THR C 2 433  ? 106.446 154.649 124.633 1.00 223.00 ? 433  THR C CB    1 
ATOM   6951  O  OG1   . THR C 2 433  ? 107.753 154.456 125.186 1.00 223.00 ? 433  THR C OG1   1 
ATOM   6952  C  CG2   . THR C 2 433  ? 105.908 155.962 125.139 1.00 223.00 ? 433  THR C CG2   1 
ATOM   6953  N  N     . HIS C 2 434  ? 106.153 151.162 124.866 1.00 233.55 ? 434  HIS C N     1 
ATOM   6954  C  CA    . HIS C 2 434  ? 106.244 149.897 124.153 1.00 233.55 ? 434  HIS C CA    1 
ATOM   6955  C  C     . HIS C 2 434  ? 104.889 149.264 123.919 1.00 233.55 ? 434  HIS C C     1 
ATOM   6956  O  O     . HIS C 2 434  ? 104.808 148.256 123.208 1.00 233.55 ? 434  HIS C O     1 
ATOM   6957  C  CB    . HIS C 2 434  ? 107.095 148.920 124.936 1.00 233.55 ? 434  HIS C CB    1 
ATOM   6958  C  CG    . HIS C 2 434  ? 108.555 149.150 124.783 1.00 233.55 ? 434  HIS C CG    1 
ATOM   6959  N  ND1   . HIS C 2 434  ? 109.243 148.807 123.643 1.00 233.55 ? 434  HIS C ND1   1 
ATOM   6960  C  CD2   . HIS C 2 434  ? 109.458 149.706 125.620 1.00 233.55 ? 434  HIS C CD2   1 
ATOM   6961  C  CE1   . HIS C 2 434  ? 110.514 149.133 123.789 1.00 233.55 ? 434  HIS C CE1   1 
ATOM   6962  N  NE2   . HIS C 2 434  ? 110.671 149.679 124.981 1.00 233.55 ? 434  HIS C NE2   1 
ATOM   6963  N  N     . TYR C 2 435  ? 103.846 149.809 124.532 1.00 233.74 ? 435  TYR C N     1 
ATOM   6964  C  CA    . TYR C 2 435  ? 102.523 149.208 124.521 1.00 233.74 ? 435  TYR C CA    1 
ATOM   6965  C  C     . TYR C 2 435  ? 101.950 149.160 123.120 1.00 233.74 ? 435  TYR C C     1 
ATOM   6966  O  O     . TYR C 2 435  ? 101.666 150.197 122.517 1.00 233.74 ? 435  TYR C O     1 
ATOM   6967  C  CB    . TYR C 2 435  ? 101.606 150.006 125.441 1.00 233.74 ? 435  TYR C CB    1 
ATOM   6968  C  CG    . TYR C 2 435  ? 100.174 149.547 125.418 1.00 233.74 ? 435  TYR C CG    1 
ATOM   6969  C  CD1   . TYR C 2 435  ? 99.779  148.415 126.114 1.00 233.74 ? 435  TYR C CD1   1 
ATOM   6970  C  CD2   . TYR C 2 435  ? 99.208  150.256 124.712 1.00 233.74 ? 435  TYR C CD2   1 
ATOM   6971  C  CE1   . TYR C 2 435  ? 98.465  147.996 126.100 1.00 233.74 ? 435  TYR C CE1   1 
ATOM   6972  C  CE2   . TYR C 2 435  ? 97.902  149.839 124.683 1.00 233.74 ? 435  TYR C CE2   1 
ATOM   6973  C  CZ    . TYR C 2 435  ? 97.531  148.717 125.385 1.00 233.74 ? 435  TYR C CZ    1 
ATOM   6974  O  OH    . TYR C 2 435  ? 96.219  148.312 125.360 1.00 233.74 ? 435  TYR C OH    1 
ATOM   6975  N  N     . GLY C 2 436  ? 101.803 147.948 122.597 1.00 238.77 ? 436  GLY C N     1 
ATOM   6976  C  CA    . GLY C 2 436  ? 101.276 147.761 121.263 1.00 238.77 ? 436  GLY C CA    1 
ATOM   6977  C  C     . GLY C 2 436  ? 102.322 148.027 120.209 1.00 238.77 ? 436  GLY C C     1 
ATOM   6978  O  O     . GLY C 2 436  ? 102.026 148.088 119.014 1.00 238.77 ? 436  GLY C O     1 
ATOM   6979  N  N     . ARG C 2 437  ? 103.559 148.183 120.658 1.00 253.37 ? 437  ARG C N     1 
ATOM   6980  C  CA    . ARG C 2 437  ? 104.663 148.608 119.820 1.00 253.37 ? 437  ARG C CA    1 
ATOM   6981  C  C     . ARG C 2 437  ? 105.752 147.561 119.736 1.00 253.37 ? 437  ARG C C     1 
ATOM   6982  O  O     . ARG C 2 437  ? 106.283 147.303 118.655 1.00 253.37 ? 437  ARG C O     1 
ATOM   6983  C  CB    . ARG C 2 437  ? 105.241 149.915 120.361 1.00 253.37 ? 437  ARG C CB    1 
ATOM   6984  C  CG    . ARG C 2 437  ? 104.194 150.994 120.549 1.00 253.37 ? 437  ARG C CG    1 
ATOM   6985  C  CD    . ARG C 2 437  ? 103.525 151.278 119.246 1.00 253.37 ? 437  ARG C CD    1 
ATOM   6986  N  NE    . ARG C 2 437  ? 102.724 152.494 119.205 1.00 253.37 ? 437  ARG C NE    1 
ATOM   6987  C  CZ    . ARG C 2 437  ? 102.955 153.512 118.383 1.00 253.37 ? 437  ARG C CZ    1 
ATOM   6988  N  NH1   . ARG C 2 437  ? 103.972 153.473 117.533 1.00 253.37 ? 437  ARG C NH1   1 
ATOM   6989  N  NH2   . ARG C 2 437  ? 102.151 154.562 118.394 1.00 253.37 ? 437  ARG C NH2   1 
ATOM   6990  N  N     . ILE C 2 438  ? 106.078 146.943 120.861 1.00 247.77 ? 438  ILE C N     1 
ATOM   6991  C  CA    . ILE C 2 438  ? 107.023 145.842 120.915 1.00 247.77 ? 438  ILE C CA    1 
ATOM   6992  C  C     . ILE C 2 438  ? 106.461 144.825 121.890 1.00 247.77 ? 438  ILE C C     1 
ATOM   6993  O  O     . ILE C 2 438  ? 105.989 145.200 122.968 1.00 247.77 ? 438  ILE C O     1 
ATOM   6994  C  CB    . ILE C 2 438  ? 108.421 146.330 121.335 1.00 247.77 ? 438  ILE C CB    1 
ATOM   6995  C  CG1   . ILE C 2 438  ? 109.184 146.798 120.107 1.00 247.77 ? 438  ILE C CG1   1 
ATOM   6996  C  CG2   . ILE C 2 438  ? 109.210 145.257 122.046 1.00 247.77 ? 438  ILE C CG2   1 
ATOM   6997  C  CD1   . ILE C 2 438  ? 110.481 147.443 120.434 1.00 247.77 ? 438  ILE C CD1   1 
ATOM   6998  N  N     . CYS C 2 439  ? 106.444 143.555 121.481 1.00 265.07 ? 439  CYS C N     1 
ATOM   6999  C  CA    . CYS C 2 439  ? 106.031 142.461 122.343 1.00 265.07 ? 439  CYS C CA    1 
ATOM   7000  C  C     . CYS C 2 439  ? 106.913 142.403 123.575 1.00 265.07 ? 439  CYS C C     1 
ATOM   7001  O  O     . CYS C 2 439  ? 108.114 142.133 123.470 1.00 265.07 ? 439  CYS C O     1 
ATOM   7002  C  CB    . CYS C 2 439  ? 106.107 141.132 121.614 1.00 265.07 ? 439  CYS C CB    1 
ATOM   7003  S  SG    . CYS C 2 439  ? 105.225 139.817 122.469 1.00 265.07 ? 439  CYS C SG    1 
ATOM   7004  N  N     . PRO C 2 440  ? 106.365 142.654 124.735 1.00 264.14 ? 440  PRO C N     1 
ATOM   7005  C  CA    . PRO C 2 440  ? 107.201 142.770 125.930 1.00 264.14 ? 440  PRO C CA    1 
ATOM   7006  C  C     . PRO C 2 440  ? 107.621 141.429 126.492 1.00 264.14 ? 440  PRO C C     1 
ATOM   7007  O  O     . PRO C 2 440  ? 108.664 141.321 127.138 1.00 264.14 ? 440  PRO C O     1 
ATOM   7008  C  CB    . PRO C 2 440  ? 106.293 143.516 126.909 1.00 264.14 ? 440  PRO C CB    1 
ATOM   7009  C  CG    . PRO C 2 440  ? 104.919 143.110 126.505 1.00 264.14 ? 440  PRO C CG    1 
ATOM   7010  C  CD    . PRO C 2 440  ? 104.940 142.875 125.024 1.00 264.14 ? 440  PRO C CD    1 
ATOM   7011  N  N     . VAL C 2 441  ? 106.819 140.398 126.246 1.00 282.56 ? 441  VAL C N     1 
ATOM   7012  C  CA    . VAL C 2 441  ? 106.971 139.184 127.026 1.00 282.56 ? 441  VAL C CA    1 
ATOM   7013  C  C     . VAL C 2 441  ? 108.092 138.310 126.473 1.00 282.56 ? 441  VAL C C     1 
ATOM   7014  O  O     . VAL C 2 441  ? 108.774 137.617 127.235 1.00 282.56 ? 441  VAL C O     1 
ATOM   7015  C  CB    . VAL C 2 441  ? 105.611 138.461 127.111 1.00 282.56 ? 441  VAL C CB    1 
ATOM   7016  C  CG1   . VAL C 2 441  ? 105.108 138.058 125.747 1.00 282.56 ? 441  VAL C CG1   1 
ATOM   7017  C  CG2   . VAL C 2 441  ? 105.667 137.266 128.057 1.00 282.56 ? 441  VAL C CG2   1 
ATOM   7018  N  N     . GLU C 2 442  ? 108.339 138.346 125.169 1.00 317.01 ? 442  GLU C N     1 
ATOM   7019  C  CA    . GLU C 2 442  ? 109.264 137.405 124.556 1.00 317.01 ? 442  GLU C CA    1 
ATOM   7020  C  C     . GLU C 2 442  ? 110.598 138.069 124.236 1.00 317.01 ? 442  GLU C C     1 
ATOM   7021  O  O     . GLU C 2 442  ? 110.670 138.947 123.372 1.00 317.01 ? 442  GLU C O     1 
ATOM   7022  C  CB    . GLU C 2 442  ? 108.671 136.787 123.297 1.00 317.01 ? 442  GLU C CB    1 
ATOM   7023  C  CG    . GLU C 2 442  ? 109.573 135.726 122.712 1.00 317.01 ? 442  GLU C CG    1 
ATOM   7024  C  CD    . GLU C 2 442  ? 108.941 134.983 121.567 1.00 317.01 ? 442  GLU C CD    1 
ATOM   7025  O  OE1   . GLU C 2 442  ? 107.783 135.304 121.219 1.00 317.01 ? 442  GLU C OE1   1 
ATOM   7026  O  OE2   . GLU C 2 442  ? 109.603 134.070 121.022 1.00 317.01 ? 442  GLU C OE2   1 
ATOM   7027  N  N     . THR C 2 443  ? 111.641 137.642 124.944 1.00 334.74 ? 443  THR C N     1 
ATOM   7028  C  CA    . THR C 2 443  ? 113.049 137.960 124.747 1.00 334.74 ? 443  THR C CA    1 
ATOM   7029  C  C     . THR C 2 443  ? 113.873 136.920 125.498 1.00 334.74 ? 443  THR C C     1 
ATOM   7030  O  O     . THR C 2 443  ? 113.643 136.708 126.694 1.00 334.74 ? 443  THR C O     1 
ATOM   7031  C  CB    . THR C 2 443  ? 113.374 139.375 125.235 1.00 334.74 ? 443  THR C CB    1 
ATOM   7032  O  OG1   . THR C 2 443  ? 112.924 140.326 124.262 1.00 334.74 ? 443  THR C OG1   1 
ATOM   7033  C  CG2   . THR C 2 443  ? 114.868 139.552 125.481 1.00 334.74 ? 443  THR C CG2   1 
ATOM   7034  N  N     . PRO C 2 444  ? 114.829 136.252 124.843 1.00 329.93 ? 444  PRO C N     1 
ATOM   7035  C  CA    . PRO C 2 444  ? 115.521 135.127 125.485 1.00 329.93 ? 444  PRO C CA    1 
ATOM   7036  C  C     . PRO C 2 444  ? 116.440 135.562 126.606 1.00 329.93 ? 444  PRO C C     1 
ATOM   7037  O  O     . PRO C 2 444  ? 117.233 136.488 126.446 1.00 329.93 ? 444  PRO C O     1 
ATOM   7038  C  CB    . PRO C 2 444  ? 116.319 134.496 124.337 1.00 329.93 ? 444  PRO C CB    1 
ATOM   7039  C  CG    . PRO C 2 444  ? 115.765 135.093 123.094 1.00 329.93 ? 444  PRO C CG    1 
ATOM   7040  C  CD    . PRO C 2 444  ? 115.286 136.453 123.464 1.00 329.93 ? 444  PRO C CD    1 
ATOM   7041  N  N     . GLU C 2 445  ? 116.323 134.900 127.749 1.00 329.03 ? 445  GLU C N     1 
ATOM   7042  C  CA    . GLU C 2 445  ? 117.069 135.299 128.926 1.00 329.03 ? 445  GLU C CA    1 
ATOM   7043  C  C     . GLU C 2 445  ? 118.533 134.901 128.801 1.00 329.03 ? 445  GLU C C     1 
ATOM   7044  O  O     . GLU C 2 445  ? 118.899 133.980 128.068 1.00 329.03 ? 445  GLU C O     1 
ATOM   7045  C  CB    . GLU C 2 445  ? 116.453 134.673 130.172 1.00 329.03 ? 445  GLU C CB    1 
ATOM   7046  C  CG    . GLU C 2 445  ? 116.116 133.209 130.001 1.00 329.03 ? 445  GLU C CG    1 
ATOM   7047  C  CD    . GLU C 2 445  ? 117.277 132.312 130.341 1.00 329.03 ? 445  GLU C CD    1 
ATOM   7048  O  OE1   . GLU C 2 445  ? 118.181 132.773 131.068 1.00 329.03 ? 445  GLU C OE1   1 
ATOM   7049  O  OE2   . GLU C 2 445  ? 117.301 131.167 129.856 1.00 329.03 ? 445  GLU C OE2   1 
ATOM   7050  N  N     . GLY C 2 446  ? 119.360 135.577 129.575 1.00 309.98 ? 446  GLY C N     1 
ATOM   7051  C  CA    . GLY C 2 446  ? 120.791 135.454 129.494 1.00 309.98 ? 446  GLY C CA    1 
ATOM   7052  C  C     . GLY C 2 446  ? 121.428 136.787 129.171 1.00 309.98 ? 446  GLY C C     1 
ATOM   7053  O  O     . GLY C 2 446  ? 120.991 137.847 129.621 1.00 309.98 ? 446  GLY C O     1 
ATOM   7054  N  N     . ALA C 2 447  ? 122.480 136.727 128.356 1.00 322.78 ? 447  ALA C N     1 
ATOM   7055  C  CA    . ALA C 2 447  ? 123.068 137.954 127.831 1.00 322.78 ? 447  ALA C CA    1 
ATOM   7056  C  C     . ALA C 2 447  ? 122.123 138.620 126.848 1.00 322.78 ? 447  ALA C C     1 
ATOM   7057  O  O     . ALA C 2 447  ? 122.112 139.847 126.705 1.00 322.78 ? 447  ALA C O     1 
ATOM   7058  C  CB    . ALA C 2 447  ? 124.407 137.651 127.164 1.00 322.78 ? 447  ALA C CB    1 
ATOM   7059  N  N     . ASN C 2 448  ? 121.304 137.817 126.180 1.00 334.16 ? 448  ASN C N     1 
ATOM   7060  C  CA    . ASN C 2 448  ? 120.327 138.301 125.225 1.00 334.16 ? 448  ASN C CA    1 
ATOM   7061  C  C     . ASN C 2 448  ? 119.073 138.851 125.883 1.00 334.16 ? 448  ASN C C     1 
ATOM   7062  O  O     . ASN C 2 448  ? 118.154 139.259 125.164 1.00 334.16 ? 448  ASN C O     1 
ATOM   7063  C  CB    . ASN C 2 448  ? 119.976 137.150 124.289 1.00 334.16 ? 448  ASN C CB    1 
ATOM   7064  C  CG    . ASN C 2 448  ? 119.928 135.819 125.017 1.00 334.16 ? 448  ASN C CG    1 
ATOM   7065  O  OD1   . ASN C 2 448  ? 120.124 135.767 126.230 1.00 334.16 ? 448  ASN C OD1   1 
ATOM   7066  N  ND2   . ASN C 2 448  ? 119.690 134.739 124.282 1.00 334.16 ? 448  ASN C ND2   1 
ATOM   7067  N  N     . ILE C 2 449  ? 118.995 138.851 127.216 1.00 310.67 ? 449  ILE C N     1 
ATOM   7068  C  CA    . ILE C 2 449  ? 117.812 139.391 127.864 1.00 310.67 ? 449  ILE C CA    1 
ATOM   7069  C  C     . ILE C 2 449  ? 117.797 140.909 127.732 1.00 310.67 ? 449  ILE C C     1 
ATOM   7070  O  O     . ILE C 2 449  ? 118.833 141.574 127.607 1.00 310.67 ? 449  ILE C O     1 
ATOM   7071  C  CB    . ILE C 2 449  ? 117.721 138.945 129.334 1.00 310.67 ? 449  ILE C CB    1 
ATOM   7072  C  CG1   . ILE C 2 449  ? 116.260 138.852 129.765 1.00 310.67 ? 449  ILE C CG1   1 
ATOM   7073  C  CG2   . ILE C 2 449  ? 118.467 139.876 130.279 1.00 310.67 ? 449  ILE C CG2   1 
ATOM   7074  C  CD1   . ILE C 2 449  ? 116.082 138.276 131.141 1.00 310.67 ? 449  ILE C CD1   1 
ATOM   7075  N  N     . GLY C 2 450  ? 116.590 141.455 127.662 1.00 310.57 ? 450  GLY C N     1 
ATOM   7076  C  CA    . GLY C 2 450  ? 116.408 142.888 127.624 1.00 310.57 ? 450  GLY C CA    1 
ATOM   7077  C  C     . GLY C 2 450  ? 116.724 143.589 126.319 1.00 310.57 ? 450  GLY C C     1 
ATOM   7078  O  O     . GLY C 2 450  ? 116.337 144.744 126.143 1.00 310.57 ? 450  GLY C O     1 
ATOM   7079  N  N     . LEU C 2 451  ? 117.418 142.930 125.392 1.00 284.98 ? 451  LEU C N     1 
ATOM   7080  C  CA    . LEU C 2 451  ? 117.906 143.604 124.201 1.00 284.98 ? 451  LEU C CA    1 
ATOM   7081  C  C     . LEU C 2 451  ? 117.339 143.071 122.904 1.00 284.98 ? 451  LEU C C     1 
ATOM   7082  O  O     . LEU C 2 451  ? 117.298 143.816 121.920 1.00 284.98 ? 451  LEU C O     1 
ATOM   7083  C  CB    . LEU C 2 451  ? 119.433 143.500 124.116 1.00 284.98 ? 451  LEU C CB    1 
ATOM   7084  C  CG    . LEU C 2 451  ? 120.118 143.654 125.463 1.00 284.98 ? 451  LEU C CG    1 
ATOM   7085  C  CD1   . LEU C 2 451  ? 121.550 143.191 125.407 1.00 284.98 ? 451  LEU C CD1   1 
ATOM   7086  C  CD2   . LEU C 2 451  ? 120.017 145.087 125.926 1.00 284.98 ? 451  LEU C CD2   1 
ATOM   7087  N  N     . ILE C 2 452  ? 116.929 141.812 122.860 1.00 290.99 ? 452  ILE C N     1 
ATOM   7088  C  CA    . ILE C 2 452  ? 116.691 141.115 121.608 1.00 290.99 ? 452  ILE C CA    1 
ATOM   7089  C  C     . ILE C 2 452  ? 115.220 140.747 121.554 1.00 290.99 ? 452  ILE C C     1 
ATOM   7090  O  O     . ILE C 2 452  ? 114.792 139.803 122.224 1.00 290.99 ? 452  ILE C O     1 
ATOM   7091  C  CB    . ILE C 2 452  ? 117.561 139.854 121.498 1.00 290.99 ? 452  ILE C CB    1 
ATOM   7092  C  CG1   . ILE C 2 452  ? 118.995 140.145 121.945 1.00 290.99 ? 452  ILE C CG1   1 
ATOM   7093  C  CG2   . ILE C 2 452  ? 117.569 139.381 120.068 1.00 290.99 ? 452  ILE C CG2   1 
ATOM   7094  C  CD1   . ILE C 2 452  ? 119.728 141.168 121.096 1.00 290.99 ? 452  ILE C CD1   1 
ATOM   7095  N  N     . THR C 2 453  ? 114.457 141.455 120.734 1.00 252.12 ? 453  THR C N     1 
ATOM   7096  C  CA    . THR C 2 453  ? 113.007 141.381 120.830 1.00 252.12 ? 453  THR C CA    1 
ATOM   7097  C  C     . THR C 2 453  ? 112.400 141.424 119.435 1.00 252.12 ? 453  THR C C     1 
ATOM   7098  O  O     . THR C 2 453  ? 113.077 141.179 118.433 1.00 252.12 ? 453  THR C O     1 
ATOM   7099  C  CB    . THR C 2 453  ? 112.470 142.509 121.706 1.00 252.12 ? 453  THR C CB    1 
ATOM   7100  O  OG1   . THR C 2 453  ? 111.042 142.527 121.619 1.00 252.12 ? 453  THR C OG1   1 
ATOM   7101  C  CG2   . THR C 2 453  ? 113.027 143.828 121.239 1.00 252.12 ? 453  THR C CG2   1 
ATOM   7102  N  N     . SER C 2 454  ? 111.103 141.706 119.374 1.00 240.75 ? 454  SER C N     1 
ATOM   7103  C  CA    . SER C 2 454  ? 110.382 141.687 118.116 1.00 240.75 ? 454  SER C CA    1 
ATOM   7104  C  C     . SER C 2 454  ? 109.265 142.713 118.158 1.00 240.75 ? 454  SER C C     1 
ATOM   7105  O  O     . SER C 2 454  ? 108.956 143.291 119.203 1.00 240.75 ? 454  SER C O     1 
ATOM   7106  C  CB    . SER C 2 454  ? 109.805 140.304 117.834 1.00 240.75 ? 454  SER C CB    1 
ATOM   7107  O  OG    . SER C 2 454  ? 109.029 139.876 118.936 1.00 240.75 ? 454  SER C OG    1 
ATOM   7108  N  N     . LEU C 2 455  ? 108.650 142.912 116.999 1.00 244.53 ? 455  LEU C N     1 
ATOM   7109  C  CA    . LEU C 2 455  ? 107.542 143.833 116.848 1.00 244.53 ? 455  LEU C CA    1 
ATOM   7110  C  C     . LEU C 2 455  ? 106.296 143.288 117.543 1.00 244.53 ? 455  LEU C C     1 
ATOM   7111  O  O     . LEU C 2 455  ? 106.223 142.122 117.942 1.00 244.53 ? 455  LEU C O     1 
ATOM   7112  C  CB    . LEU C 2 455  ? 107.267 144.068 115.362 1.00 244.53 ? 455  LEU C CB    1 
ATOM   7113  C  CG    . LEU C 2 455  ? 106.445 145.239 114.818 1.00 244.53 ? 455  LEU C CG    1 
ATOM   7114  C  CD1   . LEU C 2 455  ? 107.277 146.484 114.644 1.00 244.53 ? 455  LEU C CD1   1 
ATOM   7115  C  CD2   . LEU C 2 455  ? 105.770 144.851 113.521 1.00 244.53 ? 455  LEU C CD2   1 
ATOM   7116  N  N     . ALA C 2 456  ? 105.305 144.161 117.688 1.00 250.38 ? 456  ALA C N     1 
ATOM   7117  C  CA    . ALA C 2 456  ? 103.941 143.761 117.991 1.00 250.38 ? 456  ALA C CA    1 
ATOM   7118  C  C     . ALA C 2 456  ? 103.280 143.237 116.718 1.00 250.38 ? 456  ALA C C     1 
ATOM   7119  O  O     . ALA C 2 456  ? 103.916 143.078 115.673 1.00 250.38 ? 456  ALA C O     1 
ATOM   7120  C  CB    . ALA C 2 456  ? 103.169 144.929 118.594 1.00 250.38 ? 456  ALA C CB    1 
ATOM   7121  N  N     . ALA C 2 457  ? 101.976 142.974 116.786 1.00 228.42 ? 457  ALA C N     1 
ATOM   7122  C  CA    . ALA C 2 457  ? 101.318 142.266 115.694 1.00 228.42 ? 457  ALA C CA    1 
ATOM   7123  C  C     . ALA C 2 457  ? 101.077 143.172 114.494 1.00 228.42 ? 457  ALA C C     1 
ATOM   7124  O  O     . ALA C 2 457  ? 101.663 142.979 113.424 1.00 228.42 ? 457  ALA C O     1 
ATOM   7125  C  CB    . ALA C 2 457  ? 99.999  141.674 116.180 1.00 228.42 ? 457  ALA C CB    1 
ATOM   7126  N  N     . TYR C 2 458  ? 100.236 144.181 114.657 1.00 208.12 ? 458  TYR C N     1 
ATOM   7127  C  CA    . TYR C 2 458  ? 99.759  144.937 113.514 1.00 208.12 ? 458  TYR C CA    1 
ATOM   7128  C  C     . TYR C 2 458  ? 100.563 146.194 113.288 1.00 208.12 ? 458  TYR C C     1 
ATOM   7129  O  O     . TYR C 2 458  ? 100.108 147.092 112.577 1.00 208.12 ? 458  TYR C O     1 
ATOM   7130  C  CB    . TYR C 2 458  ? 98.288  145.281 113.689 1.00 208.12 ? 458  TYR C CB    1 
ATOM   7131  C  CG    . TYR C 2 458  ? 97.351  144.209 113.191 1.00 208.12 ? 458  TYR C CG    1 
ATOM   7132  C  CD1   . TYR C 2 458  ? 97.699  142.865 113.246 1.00 208.12 ? 458  TYR C CD1   1 
ATOM   7133  C  CD2   . TYR C 2 458  ? 96.112  144.543 112.666 1.00 208.12 ? 458  TYR C CD2   1 
ATOM   7134  C  CE1   . TYR C 2 458  ? 96.839  141.890 112.799 1.00 208.12 ? 458  TYR C CE1   1 
ATOM   7135  C  CE2   . TYR C 2 458  ? 95.244  143.572 112.212 1.00 208.12 ? 458  TYR C CE2   1 
ATOM   7136  C  CZ    . TYR C 2 458  ? 95.612  142.249 112.280 1.00 208.12 ? 458  TYR C CZ    1 
ATOM   7137  O  OH    . TYR C 2 458  ? 94.740  141.289 111.830 1.00 208.12 ? 458  TYR C OH    1 
ATOM   7138  N  N     . ALA C 2 459  ? 101.746 146.278 113.874 1.00 229.76 ? 459  ALA C N     1 
ATOM   7139  C  CA    . ALA C 2 459  ? 102.524 147.491 113.765 1.00 229.76 ? 459  ALA C CA    1 
ATOM   7140  C  C     . ALA C 2 459  ? 103.225 147.564 112.417 1.00 229.76 ? 459  ALA C C     1 
ATOM   7141  O  O     . ALA C 2 459  ? 103.455 146.556 111.747 1.00 229.76 ? 459  ALA C O     1 
ATOM   7142  C  CB    . ALA C 2 459  ? 103.547 147.571 114.892 1.00 229.76 ? 459  ALA C CB    1 
ATOM   7143  N  N     . ARG C 2 460  ? 103.549 148.786 112.016 1.00 263.13 ? 460  ARG C N     1 
ATOM   7144  C  CA    . ARG C 2 460  ? 104.359 149.031 110.839 1.00 263.13 ? 460  ARG C CA    1 
ATOM   7145  C  C     . ARG C 2 460  ? 105.506 149.953 111.197 1.00 263.13 ? 460  ARG C C     1 
ATOM   7146  O  O     . ARG C 2 460  ? 105.563 150.523 112.288 1.00 263.13 ? 460  ARG C O     1 
ATOM   7147  C  CB    . ARG C 2 460  ? 103.571 149.670 109.696 1.00 263.13 ? 460  ARG C CB    1 
ATOM   7148  C  CG    . ARG C 2 460  ? 102.679 148.735 108.923 1.00 263.13 ? 460  ARG C CG    1 
ATOM   7149  C  CD    . ARG C 2 460  ? 102.155 149.427 107.672 1.00 263.13 ? 460  ARG C CD    1 
ATOM   7150  N  NE    . ARG C 2 460  ? 101.279 150.556 107.981 1.00 263.13 ? 460  ARG C NE    1 
ATOM   7151  C  CZ    . ARG C 2 460  ? 101.596 151.829 107.763 1.00 263.13 ? 460  ARG C CZ    1 
ATOM   7152  N  NH1   . ARG C 2 460  ? 102.774 152.136 107.241 1.00 263.13 ? 460  ARG C NH1   1 
ATOM   7153  N  NH2   . ARG C 2 460  ? 100.744 152.795 108.071 1.00 263.13 ? 460  ARG C NH2   1 
ATOM   7154  N  N     . VAL C 2 461  ? 106.412 150.089 110.255 1.00 275.17 ? 461  VAL C N     1 
ATOM   7155  C  CA    . VAL C 2 461  ? 107.414 151.129 110.309 1.00 275.17 ? 461  VAL C CA    1 
ATOM   7156  C  C     . VAL C 2 461  ? 106.920 152.277 109.438 1.00 275.17 ? 461  VAL C C     1 
ATOM   7157  O  O     . VAL C 2 461  ? 106.022 152.114 108.608 1.00 275.17 ? 461  VAL C O     1 
ATOM   7158  C  CB    . VAL C 2 461  ? 108.793 150.606 109.847 1.00 275.17 ? 461  VAL C CB    1 
ATOM   7159  C  CG1   . VAL C 2 461  ? 108.838 150.456 108.335 1.00 275.17 ? 461  VAL C CG1   1 
ATOM   7160  C  CG2   . VAL C 2 461  ? 109.955 151.457 110.387 1.00 275.17 ? 461  VAL C CG2   1 
ATOM   7161  N  N     . ASP C 2 462  ? 107.456 153.467 109.666 1.00 265.78 ? 462  ASP C N     1 
ATOM   7162  C  CA    . ASP C 2 462  ? 107.329 154.539 108.697 1.00 265.78 ? 462  ASP C CA    1 
ATOM   7163  C  C     . ASP C 2 462  ? 108.579 154.575 107.832 1.00 265.78 ? 462  ASP C C     1 
ATOM   7164  O  O     . ASP C 2 462  ? 109.473 153.734 107.948 1.00 265.78 ? 462  ASP C O     1 
ATOM   7165  C  CB    . ASP C 2 462  ? 107.110 155.887 109.385 1.00 265.78 ? 462  ASP C CB    1 
ATOM   7166  C  CG    . ASP C 2 462  ? 108.182 156.209 110.402 1.00 265.78 ? 462  ASP C CG    1 
ATOM   7167  O  OD1   . ASP C 2 462  ? 108.993 155.325 110.734 1.00 265.78 ? 462  ASP C OD1   1 
ATOM   7168  O  OD2   . ASP C 2 462  ? 108.209 157.358 110.878 1.00 265.78 ? 462  ASP C OD2   1 
ATOM   7169  N  N     . GLU C 2 463  ? 108.645 155.581 106.969 1.00 261.36 ? 463  GLU C N     1 
ATOM   7170  C  CA    . GLU C 2 463  ? 109.871 155.797 106.220 1.00 261.36 ? 463  GLU C CA    1 
ATOM   7171  C  C     . GLU C 2 463  ? 110.974 156.329 107.116 1.00 261.36 ? 463  GLU C C     1 
ATOM   7172  O  O     . GLU C 2 463  ? 112.158 156.110 106.844 1.00 261.36 ? 463  GLU C O     1 
ATOM   7173  C  CB    . GLU C 2 463  ? 109.612 156.763 105.077 1.00 261.36 ? 463  GLU C CB    1 
ATOM   7174  C  CG    . GLU C 2 463  ? 108.686 156.208 104.036 1.00 261.36 ? 463  GLU C CG    1 
ATOM   7175  C  CD    . GLU C 2 463  ? 108.408 157.206 102.940 1.00 261.36 ? 463  GLU C CD    1 
ATOM   7176  O  OE1   . GLU C 2 463  ? 108.821 158.376 103.085 1.00 261.36 ? 463  GLU C OE1   1 
ATOM   7177  O  OE2   . GLU C 2 463  ? 107.786 156.822 101.930 1.00 261.36 ? 463  GLU C OE2   1 
ATOM   7178  N  N     . LEU C 2 464  ? 110.607 157.017 108.190 1.00 250.40 ? 464  LEU C N     1 
ATOM   7179  C  CA    . LEU C 2 464  ? 111.590 157.608 109.079 1.00 250.40 ? 464  LEU C CA    1 
ATOM   7180  C  C     . LEU C 2 464  ? 112.164 156.611 110.072 1.00 250.40 ? 464  LEU C C     1 
ATOM   7181  O  O     . LEU C 2 464  ? 113.180 156.912 110.705 1.00 250.40 ? 464  LEU C O     1 
ATOM   7182  C  CB    . LEU C 2 464  ? 110.965 158.788 109.819 1.00 250.40 ? 464  LEU C CB    1 
ATOM   7183  C  CG    . LEU C 2 464  ? 110.799 160.096 109.040 1.00 250.40 ? 464  LEU C CG    1 
ATOM   7184  C  CD1   . LEU C 2 464  ? 110.533 161.252 109.986 1.00 250.40 ? 464  LEU C CD1   1 
ATOM   7185  C  CD2   . LEU C 2 464  ? 112.015 160.393 108.172 1.00 250.40 ? 464  LEU C CD2   1 
ATOM   7186  N  N     . GLY C 2 465  ? 111.555 155.440 110.220 1.00 247.59 ? 465  GLY C N     1 
ATOM   7187  C  CA    . GLY C 2 465  ? 112.111 154.433 111.099 1.00 247.59 ? 465  GLY C CA    1 
ATOM   7188  C  C     . GLY C 2 465  ? 111.544 154.503 112.498 1.00 247.59 ? 465  GLY C C     1 
ATOM   7189  O  O     . GLY C 2 465  ? 112.293 154.518 113.476 1.00 247.59 ? 465  GLY C O     1 
ATOM   7190  N  N     . PHE C 2 466  ? 110.220 154.571 112.603 1.00 262.86 ? 466  PHE C N     1 
ATOM   7191  C  CA    . PHE C 2 466  ? 109.525 154.529 113.880 1.00 262.86 ? 466  PHE C CA    1 
ATOM   7192  C  C     . PHE C 2 466  ? 108.307 153.639 113.739 1.00 262.86 ? 466  PHE C C     1 
ATOM   7193  O  O     . PHE C 2 466  ? 107.871 153.326 112.634 1.00 262.86 ? 466  PHE C O     1 
ATOM   7194  C  CB    . PHE C 2 466  ? 109.081 155.912 114.338 1.00 262.86 ? 466  PHE C CB    1 
ATOM   7195  C  CG    . PHE C 2 466  ? 110.172 156.914 114.336 1.00 262.86 ? 466  PHE C CG    1 
ATOM   7196  C  CD1   . PHE C 2 466  ? 110.212 157.902 113.374 1.00 262.86 ? 466  PHE C CD1   1 
ATOM   7197  C  CD2   . PHE C 2 466  ? 111.167 156.866 115.293 1.00 262.86 ? 466  PHE C CD2   1 
ATOM   7198  C  CE1   . PHE C 2 466  ? 111.224 158.832 113.369 1.00 262.86 ? 466  PHE C CE1   1 
ATOM   7199  C  CE2   . PHE C 2 466  ? 112.187 157.790 115.293 1.00 262.86 ? 466  PHE C CE2   1 
ATOM   7200  C  CZ    . PHE C 2 466  ? 112.215 158.776 114.328 1.00 262.86 ? 466  PHE C CZ    1 
ATOM   7201  N  N     . ILE C 2 467  ? 107.737 153.265 114.871 1.00 253.46 ? 467  ILE C N     1 
ATOM   7202  C  CA    . ILE C 2 467  ? 106.654 152.293 114.873 1.00 253.46 ? 467  ILE C CA    1 
ATOM   7203  C  C     . ILE C 2 467  ? 105.336 152.975 114.546 1.00 253.46 ? 467  ILE C C     1 
ATOM   7204  O  O     . ILE C 2 467  ? 104.838 153.801 115.317 1.00 253.46 ? 467  ILE C O     1 
ATOM   7205  C  CB    . ILE C 2 467  ? 106.575 151.576 116.220 1.00 253.46 ? 467  ILE C CB    1 
ATOM   7206  C  CG1   . ILE C 2 467  ? 107.895 150.871 116.499 1.00 253.46 ? 467  ILE C CG1   1 
ATOM   7207  C  CG2   . ILE C 2 467  ? 105.445 150.589 116.187 1.00 253.46 ? 467  ILE C CG2   1 
ATOM   7208  C  CD1   . ILE C 2 467  ? 107.907 150.080 117.776 1.00 253.46 ? 467  ILE C CD1   1 
ATOM   7209  N  N     . ARG C 2 468  ? 104.763 152.618 113.407 1.00 253.62 ? 468  ARG C N     1 
ATOM   7210  C  CA    . ARG C 2 468  ? 103.395 152.966 113.071 1.00 253.62 ? 468  ARG C CA    1 
ATOM   7211  C  C     . ARG C 2 468  ? 102.465 151.930 113.684 1.00 253.62 ? 468  ARG C C     1 
ATOM   7212  O  O     . ARG C 2 468  ? 102.749 150.734 113.649 1.00 253.62 ? 468  ARG C O     1 
ATOM   7213  C  CB    . ARG C 2 468  ? 103.205 153.009 111.556 1.00 253.62 ? 468  ARG C CB    1 
ATOM   7214  C  CG    . ARG C 2 468  ? 104.179 153.900 110.836 1.00 253.62 ? 468  ARG C CG    1 
ATOM   7215  C  CD    . ARG C 2 468  ? 103.845 155.332 111.095 1.00 253.62 ? 468  ARG C CD    1 
ATOM   7216  N  NE    . ARG C 2 468  ? 102.548 155.685 110.543 1.00 253.62 ? 468  ARG C NE    1 
ATOM   7217  C  CZ    . ARG C 2 468  ? 101.685 156.491 111.144 1.00 253.62 ? 468  ARG C CZ    1 
ATOM   7218  N  NH1   . ARG C 2 468  ? 101.972 157.007 112.327 1.00 253.62 ? 468  ARG C NH1   1 
ATOM   7219  N  NH2   . ARG C 2 468  ? 100.525 156.770 110.570 1.00 253.62 ? 468  ARG C NH2   1 
ATOM   7220  N  N     . THR C 2 469  ? 101.349 152.387 114.246 1.00 235.40 ? 469  THR C N     1 
ATOM   7221  C  CA    . THR C 2 469  ? 100.467 151.454 114.942 1.00 235.40 ? 469  THR C CA    1 
ATOM   7222  C  C     . THR C 2 469  ? 99.004  151.853 114.830 1.00 235.40 ? 469  THR C C     1 
ATOM   7223  O  O     . THR C 2 469  ? 98.622  152.959 115.224 1.00 235.40 ? 469  THR C O     1 
ATOM   7224  C  CB    . THR C 2 469  ? 100.897 151.336 116.401 1.00 235.40 ? 469  THR C CB    1 
ATOM   7225  O  OG1   . THR C 2 469  ? 102.143 150.641 116.447 1.00 235.40 ? 469  THR C OG1   1 
ATOM   7226  C  CG2   . THR C 2 469  ? 99.882  150.583 117.236 1.00 235.40 ? 469  THR C CG2   1 
ATOM   7227  N  N     . PRO C 2 470  ? 98.155  150.962 114.332 1.00 232.05 ? 470  PRO C N     1 
ATOM   7228  C  CA    . PRO C 2 470  ? 96.822  151.369 113.891 1.00 232.05 ? 470  PRO C CA    1 
ATOM   7229  C  C     . PRO C 2 470  ? 95.821  151.509 115.024 1.00 232.05 ? 470  PRO C C     1 
ATOM   7230  O  O     . PRO C 2 470  ? 95.847  150.771 116.010 1.00 232.05 ? 470  PRO C O     1 
ATOM   7231  C  CB    . PRO C 2 470  ? 96.426  150.236 112.942 1.00 232.05 ? 470  PRO C CB    1 
ATOM   7232  C  CG    . PRO C 2 470  ? 97.111  149.047 113.490 1.00 232.05 ? 470  PRO C CG    1 
ATOM   7233  C  CD    . PRO C 2 470  ? 98.382  149.521 114.128 1.00 232.05 ? 470  PRO C CD    1 
ATOM   7234  N  N     . TYR C 2 471  ? 94.921  152.479 114.856 1.00 229.34 ? 471  TYR C N     1 
ATOM   7235  C  CA    . TYR C 2 471  ? 93.860  152.746 115.817 1.00 229.34 ? 471  TYR C CA    1 
ATOM   7236  C  C     . TYR C 2 471  ? 92.644  153.305 115.102 1.00 229.34 ? 471  TYR C C     1 
ATOM   7237  O  O     . TYR C 2 471  ? 92.768  154.059 114.134 1.00 229.34 ? 471  TYR C O     1 
ATOM   7238  C  CB    . TYR C 2 471  ? 94.306  153.731 116.888 1.00 229.34 ? 471  TYR C CB    1 
ATOM   7239  C  CG    . TYR C 2 471  ? 95.152  153.080 117.924 1.00 229.34 ? 471  TYR C CG    1 
ATOM   7240  C  CD1   . TYR C 2 471  ? 96.531  153.209 117.900 1.00 229.34 ? 471  TYR C CD1   1 
ATOM   7241  C  CD2   . TYR C 2 471  ? 94.578  152.310 118.912 1.00 229.34 ? 471  TYR C CD2   1 
ATOM   7242  C  CE1   . TYR C 2 471  ? 97.312  152.597 118.845 1.00 229.34 ? 471  TYR C CE1   1 
ATOM   7243  C  CE2   . TYR C 2 471  ? 95.342  151.694 119.861 1.00 229.34 ? 471  TYR C CE2   1 
ATOM   7244  C  CZ    . TYR C 2 471  ? 96.709  151.839 119.826 1.00 229.34 ? 471  TYR C CZ    1 
ATOM   7245  O  OH    . TYR C 2 471  ? 97.472  151.219 120.784 1.00 229.34 ? 471  TYR C OH    1 
ATOM   7246  N  N     . ARG C 2 472  ? 91.466  152.943 115.602 1.00 208.08 ? 472  ARG C N     1 
ATOM   7247  C  CA    . ARG C 2 472  ? 90.203  153.354 115.003 1.00 208.08 ? 472  ARG C CA    1 
ATOM   7248  C  C     . ARG C 2 472  ? 89.611  154.481 115.827 1.00 208.08 ? 472  ARG C C     1 
ATOM   7249  O  O     . ARG C 2 472  ? 89.309  154.302 117.011 1.00 208.08 ? 472  ARG C O     1 
ATOM   7250  C  CB    . ARG C 2 472  ? 89.231  152.186 114.911 1.00 208.08 ? 472  ARG C CB    1 
ATOM   7251  C  CG    . ARG C 2 472  ? 89.823  150.987 114.226 1.00 208.08 ? 472  ARG C CG    1 
ATOM   7252  C  CD    . ARG C 2 472  ? 89.086  149.724 114.595 1.00 208.08 ? 472  ARG C CD    1 
ATOM   7253  N  NE    . ARG C 2 472  ? 89.161  149.432 116.021 1.00 208.08 ? 472  ARG C NE    1 
ATOM   7254  C  CZ    . ARG C 2 472  ? 88.112  149.435 116.834 1.00 208.08 ? 472  ARG C CZ    1 
ATOM   7255  N  NH1   . ARG C 2 472  ? 86.904  149.716 116.362 1.00 208.08 ? 472  ARG C NH1   1 
ATOM   7256  N  NH2   . ARG C 2 472  ? 88.273  149.151 118.116 1.00 208.08 ? 472  ARG C NH2   1 
ATOM   7257  N  N     . ARG C 2 473  ? 89.437  155.630 115.184 1.00 193.25 ? 473  ARG C N     1 
ATOM   7258  C  CA    . ARG C 2 473  ? 88.891  156.838 115.779 1.00 193.25 ? 473  ARG C CA    1 
ATOM   7259  C  C     . ARG C 2 473  ? 87.498  156.659 116.354 1.00 193.25 ? 473  ARG C C     1 
ATOM   7260  O  O     . ARG C 2 473  ? 86.717  155.837 115.876 1.00 193.25 ? 473  ARG C O     1 
ATOM   7261  C  CB    . ARG C 2 473  ? 88.855  157.948 114.741 1.00 193.25 ? 473  ARG C CB    1 
ATOM   7262  C  CG    . ARG C 2 473  ? 88.905  159.345 115.299 1.00 193.25 ? 473  ARG C CG    1 
ATOM   7263  C  CD    . ARG C 2 473  ? 88.774  160.353 114.184 1.00 193.25 ? 473  ARG C CD    1 
ATOM   7264  N  NE    . ARG C 2 473  ? 89.325  159.844 112.932 1.00 193.25 ? 473  ARG C NE    1 
ATOM   7265  C  CZ    . ARG C 2 473  ? 90.591  159.987 112.560 1.00 193.25 ? 473  ARG C CZ    1 
ATOM   7266  N  NH1   . ARG C 2 473  ? 91.442  160.624 113.350 1.00 193.25 ? 473  ARG C NH1   1 
ATOM   7267  N  NH2   . ARG C 2 473  ? 91.005  159.485 111.406 1.00 193.25 ? 473  ARG C NH2   1 
ATOM   7268  N  N     . VAL C 2 474  ? 87.182  157.418 117.389 1.00 189.67 ? 474  VAL C N     1 
ATOM   7269  C  CA    . VAL C 2 474  ? 85.847  157.442 117.950 1.00 189.67 ? 474  VAL C CA    1 
ATOM   7270  C  C     . VAL C 2 474  ? 85.290  158.826 117.701 1.00 189.67 ? 474  VAL C C     1 
ATOM   7271  O  O     . VAL C 2 474  ? 85.569  159.759 118.462 1.00 189.67 ? 474  VAL C O     1 
ATOM   7272  C  CB    . VAL C 2 474  ? 85.835  157.111 119.441 1.00 189.67 ? 474  VAL C CB    1 
ATOM   7273  C  CG1   . VAL C 2 474  ? 84.408  156.923 119.901 1.00 189.67 ? 474  VAL C CG1   1 
ATOM   7274  C  CG2   . VAL C 2 474  ? 86.661  155.873 119.705 1.00 189.67 ? 474  VAL C CG2   1 
ATOM   7275  N  N     . VAL C 2 475  ? 84.506  158.969 116.638 1.00 181.49 ? 475  VAL C N     1 
ATOM   7276  C  CA    . VAL C 2 475  ? 83.904  160.264 116.351 1.00 181.49 ? 475  VAL C CA    1 
ATOM   7277  C  C     . VAL C 2 475  ? 82.708  160.457 117.281 1.00 181.49 ? 475  VAL C C     1 
ATOM   7278  O  O     . VAL C 2 475  ? 81.695  159.759 117.187 1.00 181.49 ? 475  VAL C O     1 
ATOM   7279  C  CB    . VAL C 2 475  ? 83.533  160.405 114.870 1.00 181.49 ? 475  VAL C CB    1 
ATOM   7280  C  CG1   . VAL C 2 475  ? 84.787  160.662 114.082 1.00 181.49 ? 475  VAL C CG1   1 
ATOM   7281  C  CG2   . VAL C 2 475  ? 82.917  159.131 114.316 1.00 181.49 ? 475  VAL C CG2   1 
ATOM   7282  N  N     . GLY C 2 476  ? 82.843  161.402 118.204 1.00 195.82 ? 476  GLY C N     1 
ATOM   7283  C  CA    . GLY C 2 476  ? 81.932  161.504 119.322 1.00 195.82 ? 476  GLY C CA    1 
ATOM   7284  C  C     . GLY C 2 476  ? 82.076  160.276 120.190 1.00 195.82 ? 476  GLY C C     1 
ATOM   7285  O  O     . GLY C 2 476  ? 83.175  159.961 120.652 1.00 195.82 ? 476  GLY C O     1 
ATOM   7286  N  N     . GLY C 2 477  ? 80.978  159.562 120.398 1.00 224.20 ? 477  GLY C N     1 
ATOM   7287  C  CA    . GLY C 2 477  ? 81.013  158.248 120.993 1.00 224.20 ? 477  GLY C CA    1 
ATOM   7288  C  C     . GLY C 2 477  ? 80.801  157.145 119.991 1.00 224.20 ? 477  GLY C C     1 
ATOM   7289  O  O     . GLY C 2 477  ? 80.732  155.974 120.374 1.00 224.20 ? 477  GLY C O     1 
ATOM   7290  N  N     . VAL C 2 478  ? 80.668  157.487 118.717 1.00 216.49 ? 478  VAL C N     1 
ATOM   7291  C  CA    . VAL C 2 478  ? 80.626  156.505 117.645 1.00 216.49 ? 478  VAL C CA    1 
ATOM   7292  C  C     . VAL C 2 478  ? 82.062  156.230 117.224 1.00 216.49 ? 478  VAL C C     1 
ATOM   7293  O  O     . VAL C 2 478  ? 82.804  157.149 116.883 1.00 216.49 ? 478  VAL C O     1 
ATOM   7294  C  CB    . VAL C 2 478  ? 79.768  156.993 116.473 1.00 216.49 ? 478  VAL C CB    1 
ATOM   7295  C  CG1   . VAL C 2 478  ? 80.155  156.312 115.180 1.00 216.49 ? 478  VAL C CG1   1 
ATOM   7296  C  CG2   . VAL C 2 478  ? 78.316  156.710 116.761 1.00 216.49 ? 478  VAL C CG2   1 
ATOM   7297  N  N     . VAL C 2 479  ? 82.470  154.964 117.284 1.00 210.00 ? 479  VAL C N     1 
ATOM   7298  C  CA    . VAL C 2 479  ? 83.772  154.592 116.754 1.00 210.00 ? 479  VAL C CA    1 
ATOM   7299  C  C     . VAL C 2 479  ? 83.706  154.614 115.238 1.00 210.00 ? 479  VAL C C     1 
ATOM   7300  O  O     . VAL C 2 479  ? 82.700  154.221 114.638 1.00 210.00 ? 479  VAL C O     1 
ATOM   7301  C  CB    . VAL C 2 479  ? 84.185  153.210 117.283 1.00 210.00 ? 479  VAL C CB    1 
ATOM   7302  C  CG1   . VAL C 2 479  ? 85.633  152.891 116.927 1.00 210.00 ? 479  VAL C CG1   1 
ATOM   7303  C  CG2   . VAL C 2 479  ? 83.998  153.161 118.784 1.00 210.00 ? 479  VAL C CG2   1 
ATOM   7304  N  N     . THR C 2 480  ? 84.773  155.088 114.602 1.00 215.32 ? 480  THR C N     1 
ATOM   7305  C  CA    . THR C 2 480  ? 84.798  155.051 113.152 1.00 215.32 ? 480  THR C CA    1 
ATOM   7306  C  C     . THR C 2 480  ? 85.029  153.623 112.670 1.00 215.32 ? 480  THR C C     1 
ATOM   7307  O  O     . THR C 2 480  ? 85.316  152.703 113.442 1.00 215.32 ? 480  THR C O     1 
ATOM   7308  C  CB    . THR C 2 480  ? 85.882  155.966 112.593 1.00 215.32 ? 480  THR C CB    1 
ATOM   7309  O  OG1   . THR C 2 480  ? 85.653  156.150 111.193 1.00 215.32 ? 480  THR C OG1   1 
ATOM   7310  C  CG2   . THR C 2 480  ? 87.239  155.323 112.750 1.00 215.32 ? 480  THR C CG2   1 
ATOM   7311  N  N     . ASP C 2 481  ? 84.907  153.443 111.363 1.00 238.22 ? 481  ASP C N     1 
ATOM   7312  C  CA    . ASP C 2 481  ? 85.256  152.191 110.734 1.00 238.22 ? 481  ASP C CA    1 
ATOM   7313  C  C     . ASP C 2 481  ? 86.600  152.234 110.033 1.00 238.22 ? 481  ASP C C     1 
ATOM   7314  O  O     . ASP C 2 481  ? 87.120  151.173 109.674 1.00 238.22 ? 481  ASP C O     1 
ATOM   7315  C  CB    . ASP C 2 481  ? 84.165  151.800 109.738 1.00 238.22 ? 481  ASP C CB    1 
ATOM   7316  C  CG    . ASP C 2 481  ? 82.797  152.167 110.242 1.00 238.22 ? 481  ASP C CG    1 
ATOM   7317  O  OD1   . ASP C 2 481  ? 82.505  151.867 111.417 1.00 238.22 ? 481  ASP C OD1   1 
ATOM   7318  O  OD2   . ASP C 2 481  ? 82.029  152.789 109.482 1.00 238.22 ? 481  ASP C OD2   1 
ATOM   7319  N  N     . GLU C 2 482  ? 87.184  153.413 109.840 1.00 244.58 ? 482  GLU C N     1 
ATOM   7320  C  CA    . GLU C 2 482  ? 88.530  153.484 109.299 1.00 244.58 ? 482  GLU C CA    1 
ATOM   7321  C  C     . GLU C 2 482  ? 89.545  153.272 110.416 1.00 244.58 ? 482  GLU C C     1 
ATOM   7322  O  O     . GLU C 2 482  ? 89.204  152.963 111.561 1.00 244.58 ? 482  GLU C O     1 
ATOM   7323  C  CB    . GLU C 2 482  ? 88.765  154.816 108.589 1.00 244.58 ? 482  GLU C CB    1 
ATOM   7324  C  CG    . GLU C 2 482  ? 88.449  156.060 109.405 1.00 244.58 ? 482  GLU C CG    1 
ATOM   7325  C  CD    . GLU C 2 482  ? 89.623  156.535 110.251 1.00 244.58 ? 482  GLU C CD    1 
ATOM   7326  O  OE1   . GLU C 2 482  ? 90.767  156.139 109.946 1.00 244.58 ? 482  GLU C OE1   1 
ATOM   7327  O  OE2   . GLU C 2 482  ? 89.404  157.288 111.223 1.00 244.58 ? 482  GLU C OE2   1 
ATOM   7328  N  N     . VAL C 2 483  ? 90.816  153.478 110.082 1.00 243.11 ? 483  VAL C N     1 
ATOM   7329  C  CA    . VAL C 2 483  ? 91.893  153.207 111.019 1.00 243.11 ? 483  VAL C CA    1 
ATOM   7330  C  C     . VAL C 2 483  ? 93.082  154.065 110.618 1.00 243.11 ? 483  VAL C C     1 
ATOM   7331  O  O     . VAL C 2 483  ? 93.257  154.400 109.444 1.00 243.11 ? 483  VAL C O     1 
ATOM   7332  C  CB    . VAL C 2 483  ? 92.216  151.690 111.042 1.00 243.11 ? 483  VAL C CB    1 
ATOM   7333  C  CG1   . VAL C 2 483  ? 92.838  151.214 109.729 1.00 243.11 ? 483  VAL C CG1   1 
ATOM   7334  C  CG2   . VAL C 2 483  ? 93.046  151.322 112.235 1.00 243.11 ? 483  VAL C CG2   1 
ATOM   7335  N  N     . VAL C 2 484  ? 93.864  154.481 111.608 1.00 229.60 ? 484  VAL C N     1 
ATOM   7336  C  CA    . VAL C 2 484  ? 95.010  155.350 111.379 1.00 229.60 ? 484  VAL C CA    1 
ATOM   7337  C  C     . VAL C 2 484  ? 96.184  154.807 112.176 1.00 229.60 ? 484  VAL C C     1 
ATOM   7338  O  O     . VAL C 2 484  ? 96.074  154.598 113.388 1.00 229.60 ? 484  VAL C O     1 
ATOM   7339  C  CB    . VAL C 2 484  ? 94.714  156.810 111.779 1.00 229.60 ? 484  VAL C CB    1 
ATOM   7340  C  CG1   . VAL C 2 484  ? 95.990  157.621 111.834 1.00 229.60 ? 484  VAL C CG1   1 
ATOM   7341  C  CG2   . VAL C 2 484  ? 93.749  157.454 110.801 1.00 229.60 ? 484  VAL C CG2   1 
ATOM   7342  N  N     . TYR C 2 485  ? 97.299  154.567 111.496 1.00 244.49 ? 485  TYR C N     1 
ATOM   7343  C  CA    . TYR C 2 485  ? 98.501  154.145 112.189 1.00 244.49 ? 485  TYR C CA    1 
ATOM   7344  C  C     . TYR C 2 485  ? 99.079  155.293 112.998 1.00 244.49 ? 485  TYR C C     1 
ATOM   7345  O  O     . TYR C 2 485  ? 98.976  156.460 112.623 1.00 244.49 ? 485  TYR C O     1 
ATOM   7346  C  CB    . TYR C 2 485  ? 99.533  153.617 111.207 1.00 244.49 ? 485  TYR C CB    1 
ATOM   7347  C  CG    . TYR C 2 485  ? 99.315  152.176 110.851 1.00 244.49 ? 485  TYR C CG    1 
ATOM   7348  C  CD1   . TYR C 2 485  ? 98.263  151.795 110.035 1.00 244.49 ? 485  TYR C CD1   1 
ATOM   7349  C  CD2   . TYR C 2 485  ? 100.160 151.196 111.332 1.00 244.49 ? 485  TYR C CD2   1 
ATOM   7350  C  CE1   . TYR C 2 485  ? 98.068  150.473 109.706 1.00 244.49 ? 485  TYR C CE1   1 
ATOM   7351  C  CE2   . TYR C 2 485  ? 99.981  149.881 111.008 1.00 244.49 ? 485  TYR C CE2   1 
ATOM   7352  C  CZ    . TYR C 2 485  ? 98.931  149.519 110.202 1.00 244.49 ? 485  TYR C CZ    1 
ATOM   7353  O  OH    . TYR C 2 485  ? 98.751  148.193 109.887 1.00 244.49 ? 485  TYR C OH    1 
ATOM   7354  N  N     . MET C 2 486  ? 99.676  154.955 114.133 1.00 237.82 ? 486  MET C N     1 
ATOM   7355  C  CA    . MET C 2 486  ? 100.181 155.965 115.045 1.00 237.82 ? 486  MET C CA    1 
ATOM   7356  C  C     . MET C 2 486  ? 101.647 155.729 115.351 1.00 237.82 ? 486  MET C C     1 
ATOM   7357  O  O     . MET C 2 486  ? 102.054 154.597 115.621 1.00 237.82 ? 486  MET C O     1 
ATOM   7358  C  CB    . MET C 2 486  ? 99.396  155.987 116.356 1.00 237.82 ? 486  MET C CB    1 
ATOM   7359  C  CG    . MET C 2 486  ? 97.897  156.017 116.198 1.00 237.82 ? 486  MET C CG    1 
ATOM   7360  S  SD    . MET C 2 486  ? 97.298  157.427 115.264 1.00 237.82 ? 486  MET C SD    1 
ATOM   7361  C  CE    . MET C 2 486  ? 95.535  157.263 115.535 1.00 237.82 ? 486  MET C CE    1 
ATOM   7362  N  N     . THR C 2 487  ? 102.431 156.798 115.307 1.00 226.73 ? 487  THR C N     1 
ATOM   7363  C  CA    . THR C 2 487  ? 103.688 156.823 116.026 1.00 226.73 ? 487  THR C CA    1 
ATOM   7364  C  C     . THR C 2 487  ? 103.420 157.305 117.436 1.00 226.73 ? 487  THR C C     1 
ATOM   7365  O  O     . THR C 2 487  ? 102.520 158.115 117.665 1.00 226.73 ? 487  THR C O     1 
ATOM   7366  C  CB    . THR C 2 487  ? 104.695 157.751 115.363 1.00 226.73 ? 487  THR C CB    1 
ATOM   7367  O  OG1   . THR C 2 487  ? 104.172 159.081 115.358 1.00 226.73 ? 487  THR C OG1   1 
ATOM   7368  C  CG2   . THR C 2 487  ? 104.948 157.321 113.950 1.00 226.73 ? 487  THR C CG2   1 
ATOM   7369  N  N     . ALA C 2 488  ? 104.237 156.822 118.375 1.00 231.48 ? 488  ALA C N     1 
ATOM   7370  C  CA    . ALA C 2 488  ? 103.953 156.986 119.798 1.00 231.48 ? 488  ALA C CA    1 
ATOM   7371  C  C     . ALA C 2 488  ? 104.044 158.443 120.228 1.00 231.48 ? 488  ALA C C     1 
ATOM   7372  O  O     . ALA C 2 488  ? 103.356 158.871 121.160 1.00 231.48 ? 488  ALA C O     1 
ATOM   7373  C  CB    . ALA C 2 488  ? 104.903 156.116 120.618 1.00 231.48 ? 488  ALA C CB    1 
ATOM   7374  N  N     . THR C 2 489  ? 104.867 159.218 119.520 1.00 226.11 ? 489  THR C N     1 
ATOM   7375  C  CA    . THR C 2 489  ? 105.070 160.630 119.821 1.00 226.11 ? 489  THR C CA    1 
ATOM   7376  C  C     . THR C 2 489  ? 103.780 161.421 119.680 1.00 226.11 ? 489  THR C C     1 
ATOM   7377  O  O     . THR C 2 489  ? 103.342 162.100 120.613 1.00 226.11 ? 489  THR C O     1 
ATOM   7378  C  CB    . THR C 2 489  ? 106.126 161.199 118.884 1.00 226.11 ? 489  THR C CB    1 
ATOM   7379  O  OG1   . THR C 2 489  ? 105.542 161.383 117.591 1.00 226.11 ? 489  THR C OG1   1 
ATOM   7380  C  CG2   . THR C 2 489  ? 107.279 160.234 118.755 1.00 226.11 ? 489  THR C CG2   1 
ATOM   7381  N  N     . GLU C 2 490  ? 103.148 161.334 118.512 1.00 221.26 ? 490  GLU C N     1 
ATOM   7382  C  CA    . GLU C 2 490  ? 101.878 162.020 118.333 1.00 221.26 ? 490  GLU C CA    1 
ATOM   7383  C  C     . GLU C 2 490  ? 100.767 161.289 119.066 1.00 221.26 ? 490  GLU C C     1 
ATOM   7384  O  O     . GLU C 2 490  ? 99.746  161.883 119.425 1.00 221.26 ? 490  GLU C O     1 
ATOM   7385  C  CB    . GLU C 2 490  ? 101.560 162.180 116.848 1.00 221.26 ? 490  GLU C CB    1 
ATOM   7386  C  CG    . GLU C 2 490  ? 101.529 160.900 116.059 1.00 221.26 ? 490  GLU C CG    1 
ATOM   7387  C  CD    . GLU C 2 490  ? 100.158 160.290 115.999 1.00 221.26 ? 490  GLU C CD    1 
ATOM   7388  O  OE1   . GLU C 2 490  ? 99.187  160.955 116.409 1.00 221.26 ? 490  GLU C OE1   1 
ATOM   7389  O  OE2   . GLU C 2 490  ? 100.050 159.150 115.527 1.00 221.26 ? 490  GLU C OE2   1 
ATOM   7390  N  N     . GLU C 2 491  ? 100.968 159.995 119.320 1.00 241.74 ? 491  GLU C N     1 
ATOM   7391  C  CA    . GLU C 2 491  ? 100.008 159.212 120.088 1.00 241.74 ? 491  GLU C CA    1 
ATOM   7392  C  C     . GLU C 2 491  ? 99.948  159.663 121.538 1.00 241.74 ? 491  GLU C C     1 
ATOM   7393  O  O     . GLU C 2 491  ? 98.956  159.399 122.227 1.00 241.74 ? 491  GLU C O     1 
ATOM   7394  C  CB    . GLU C 2 491  ? 100.384 157.736 120.015 1.00 241.74 ? 491  GLU C CB    1 
ATOM   7395  C  CG    . GLU C 2 491  ? 99.335  156.740 120.433 1.00 241.74 ? 491  GLU C CG    1 
ATOM   7396  C  CD    . GLU C 2 491  ? 99.919  155.353 120.611 1.00 241.74 ? 491  GLU C CD    1 
ATOM   7397  O  OE1   . GLU C 2 491  ? 101.152 155.200 120.457 1.00 241.74 ? 491  GLU C OE1   1 
ATOM   7398  O  OE2   . GLU C 2 491  ? 99.150  154.418 120.914 1.00 241.74 ? 491  GLU C OE2   1 
ATOM   7399  N  N     . ASP C 2 492  ? 100.994 160.350 122.009 1.00 229.45 ? 492  ASP C N     1 
ATOM   7400  C  CA    . ASP C 2 492  ? 101.038 160.823 123.388 1.00 229.45 ? 492  ASP C CA    1 
ATOM   7401  C  C     . ASP C 2 492  ? 99.923  161.811 123.697 1.00 229.45 ? 492  ASP C C     1 
ATOM   7402  O  O     . ASP C 2 492  ? 99.476  161.903 124.842 1.00 229.45 ? 492  ASP C O     1 
ATOM   7403  C  CB    . ASP C 2 492  ? 102.387 161.476 123.667 1.00 229.45 ? 492  ASP C CB    1 
ATOM   7404  C  CG    . ASP C 2 492  ? 103.504 160.473 123.769 1.00 229.45 ? 492  ASP C CG    1 
ATOM   7405  O  OD1   . ASP C 2 492  ? 104.539 160.660 123.098 1.00 229.45 ? 492  ASP C OD1   1 
ATOM   7406  O  OD2   . ASP C 2 492  ? 103.344 159.485 124.512 1.00 229.45 ? 492  ASP C OD2   1 
ATOM   7407  N  N     . ARG C 2 493  ? 99.426  162.524 122.697 1.00 209.23 ? 493  ARG C N     1 
ATOM   7408  C  CA    . ARG C 2 493  ? 98.441  163.566 122.928 1.00 209.23 ? 493  ARG C CA    1 
ATOM   7409  C  C     . ARG C 2 493  ? 97.020  163.033 122.971 1.00 209.23 ? 493  ARG C C     1 
ATOM   7410  O  O     . ARG C 2 493  ? 96.076  163.806 122.787 1.00 209.23 ? 493  ARG C O     1 
ATOM   7411  C  CB    . ARG C 2 493  ? 98.553  164.643 121.853 1.00 209.23 ? 493  ARG C CB    1 
ATOM   7412  C  CG    . ARG C 2 493  ? 99.832  165.458 121.912 1.00 209.23 ? 493  ARG C CG    1 
ATOM   7413  C  CD    . ARG C 2 493  ? 100.844 164.906 120.938 1.00 209.23 ? 493  ARG C CD    1 
ATOM   7414  N  NE    . ARG C 2 493  ? 100.173 164.461 119.728 1.00 209.23 ? 493  ARG C NE    1 
ATOM   7415  C  CZ    . ARG C 2 493  ? 100.000 165.214 118.652 1.00 209.23 ? 493  ARG C CZ    1 
ATOM   7416  N  NH1   . ARG C 2 493  ? 100.466 166.451 118.631 1.00 209.23 ? 493  ARG C NH1   1 
ATOM   7417  N  NH2   . ARG C 2 493  ? 99.371  164.724 117.594 1.00 209.23 ? 493  ARG C NH2   1 
ATOM   7418  N  N     . TYR C 2 494  ? 96.838  161.737 123.199 1.00 199.88 ? 494  TYR C N     1 
ATOM   7419  C  CA    . TYR C 2 494  ? 95.524  161.133 123.096 1.00 199.88 ? 494  TYR C CA    1 
ATOM   7420  C  C     . TYR C 2 494  ? 95.289  160.189 124.260 1.00 199.88 ? 494  TYR C C     1 
ATOM   7421  O  O     . TYR C 2 494  ? 96.166  159.955 125.097 1.00 199.88 ? 494  TYR C O     1 
ATOM   7422  C  CB    . TYR C 2 494  ? 95.364  160.413 121.762 1.00 199.88 ? 494  TYR C CB    1 
ATOM   7423  C  CG    . TYR C 2 494  ? 95.490  161.355 120.614 1.00 199.88 ? 494  TYR C CG    1 
ATOM   7424  C  CD1   . TYR C 2 494  ? 94.524  162.318 120.389 1.00 199.88 ? 494  TYR C CD1   1 
ATOM   7425  C  CD2   . TYR C 2 494  ? 96.582  161.302 119.770 1.00 199.88 ? 494  TYR C CD2   1 
ATOM   7426  C  CE1   . TYR C 2 494  ? 94.632  163.192 119.344 1.00 199.88 ? 494  TYR C CE1   1 
ATOM   7427  C  CE2   . TYR C 2 494  ? 96.698  162.171 118.719 1.00 199.88 ? 494  TYR C CE2   1 
ATOM   7428  C  CZ    . TYR C 2 494  ? 95.723  163.115 118.513 1.00 199.88 ? 494  TYR C CZ    1 
ATOM   7429  O  OH    . TYR C 2 494  ? 95.841  163.987 117.463 1.00 199.88 ? 494  TYR C OH    1 
ATOM   7430  N  N     . THR C 2 495  ? 94.077  159.648 124.296 1.00 204.01 ? 495  THR C N     1 
ATOM   7431  C  CA    . THR C 2 495  ? 93.561  158.873 125.418 1.00 204.01 ? 495  THR C CA    1 
ATOM   7432  C  C     . THR C 2 495  ? 92.678  157.780 124.820 1.00 204.01 ? 495  THR C C     1 
ATOM   7433  O  O     . THR C 2 495  ? 91.492  157.993 124.569 1.00 204.01 ? 495  THR C O     1 
ATOM   7434  C  CB    . THR C 2 495  ? 92.778  159.744 126.383 1.00 204.01 ? 495  THR C CB    1 
ATOM   7435  O  OG1   . THR C 2 495  ? 93.528  160.924 126.690 1.00 204.01 ? 495  THR C OG1   1 
ATOM   7436  C  CG2   . THR C 2 495  ? 92.517  158.984 127.648 1.00 204.01 ? 495  THR C CG2   1 
ATOM   7437  N  N     . ILE C 2 496  ? 93.266  156.622 124.611 1.00 199.89 ? 496  ILE C N     1 
ATOM   7438  C  CA    . ILE C 2 496  ? 92.631  155.537 123.881 1.00 199.89 ? 496  ILE C CA    1 
ATOM   7439  C  C     . ILE C 2 496  ? 92.262  154.434 124.859 1.00 199.89 ? 496  ILE C C     1 
ATOM   7440  O  O     . ILE C 2 496  ? 93.072  154.044 125.707 1.00 199.89 ? 496  ILE C O     1 
ATOM   7441  C  CB    . ILE C 2 496  ? 93.575  155.039 122.774 1.00 199.89 ? 496  ILE C CB    1 
ATOM   7442  C  CG1   . ILE C 2 496  ? 93.787  156.150 121.756 1.00 199.89 ? 496  ILE C CG1   1 
ATOM   7443  C  CG2   . ILE C 2 496  ? 93.030  153.831 122.086 1.00 199.89 ? 496  ILE C CG2   1 
ATOM   7444  C  CD1   . ILE C 2 496  ? 94.907  155.871 120.810 1.00 199.89 ? 496  ILE C CD1   1 
ATOM   7445  N  N     . ALA C 2 497  ? 91.031  153.943 124.757 1.00 220.29 ? 497  ALA C N     1 
ATOM   7446  C  CA    . ALA C 2 497  ? 90.509  152.970 125.702 1.00 220.29 ? 497  ALA C CA    1 
ATOM   7447  C  C     . ALA C 2 497  ? 90.786  151.554 125.212 1.00 220.29 ? 497  ALA C C     1 
ATOM   7448  O  O     . ALA C 2 497  ? 91.550  151.335 124.272 1.00 220.29 ? 497  ALA C O     1 
ATOM   7449  C  CB    . ALA C 2 497  ? 89.022  153.207 125.936 1.00 220.29 ? 497  ALA C CB    1 
ATOM   7450  N  N     . GLN C 2 498  ? 90.153  150.574 125.850 1.00 232.85 ? 498  GLN C N     1 
ATOM   7451  C  CA    . GLN C 2 498  ? 90.482  149.183 125.606 1.00 232.85 ? 498  GLN C CA    1 
ATOM   7452  C  C     . GLN C 2 498  ? 89.805  148.686 124.326 1.00 232.85 ? 498  GLN C C     1 
ATOM   7453  O  O     . GLN C 2 498  ? 89.031  149.395 123.681 1.00 232.85 ? 498  GLN C O     1 
ATOM   7454  C  CB    . GLN C 2 498  ? 90.088  148.332 126.816 1.00 232.85 ? 498  GLN C CB    1 
ATOM   7455  C  CG    . GLN C 2 498  ? 90.978  147.111 127.087 1.00 232.85 ? 498  GLN C CG    1 
ATOM   7456  C  CD    . GLN C 2 498  ? 92.457  147.437 127.192 1.00 232.85 ? 498  GLN C CD    1 
ATOM   7457  O  OE1   . GLN C 2 498  ? 93.168  147.497 126.188 1.00 232.85 ? 498  GLN C OE1   1 
ATOM   7458  N  NE2   . GLN C 2 498  ? 92.940  147.595 128.419 1.00 232.85 ? 498  GLN C NE2   1 
ATOM   7459  N  N     . ALA C 2 499  ? 90.136  147.454 123.943 1.00 235.45 ? 499  ALA C N     1 
ATOM   7460  C  CA    . ALA C 2 499  ? 89.604  146.842 122.736 1.00 235.45 ? 499  ALA C CA    1 
ATOM   7461  C  C     . ALA C 2 499  ? 88.300  146.098 122.962 1.00 235.45 ? 499  ALA C C     1 
ATOM   7462  O  O     . ALA C 2 499  ? 87.456  146.069 122.061 1.00 235.45 ? 499  ALA C O     1 
ATOM   7463  C  CB    . ALA C 2 499  ? 90.620  145.859 122.147 1.00 235.45 ? 499  ALA C CB    1 
ATOM   7464  N  N     . ASN C 2 500  ? 88.115  145.497 124.129 1.00 242.65 ? 500  ASN C N     1 
ATOM   7465  C  CA    . ASN C 2 500  ? 86.984  144.620 124.385 1.00 242.65 ? 500  ASN C CA    1 
ATOM   7466  C  C     . ASN C 2 500  ? 85.781  145.355 124.941 1.00 242.65 ? 500  ASN C C     1 
ATOM   7467  O  O     . ASN C 2 500  ? 84.872  144.709 125.472 1.00 242.65 ? 500  ASN C O     1 
ATOM   7468  C  CB    . ASN C 2 500  ? 87.397  143.530 125.360 1.00 242.65 ? 500  ASN C CB    1 
ATOM   7469  C  CG    . ASN C 2 500  ? 88.143  144.085 126.542 1.00 242.65 ? 500  ASN C CG    1 
ATOM   7470  O  OD1   . ASN C 2 500  ? 88.322  145.295 126.659 1.00 242.65 ? 500  ASN C OD1   1 
ATOM   7471  N  ND2   . ASN C 2 500  ? 88.584  143.209 127.428 1.00 242.65 ? 500  ASN C ND2   1 
ATOM   7472  N  N     . THR C 2 501  ? 85.766  146.670 124.852 1.00 228.80 ? 501  THR C N     1 
ATOM   7473  C  CA    . THR C 2 501  ? 84.689  147.453 125.427 1.00 228.80 ? 501  THR C CA    1 
ATOM   7474  C  C     . THR C 2 501  ? 83.440  147.261 124.585 1.00 228.80 ? 501  THR C C     1 
ATOM   7475  O  O     . THR C 2 501  ? 83.539  147.259 123.352 1.00 228.80 ? 501  THR C O     1 
ATOM   7476  C  CB    . THR C 2 501  ? 85.072  148.911 125.463 1.00 228.80 ? 501  THR C CB    1 
ATOM   7477  O  OG1   . THR C 2 501  ? 84.864  149.471 124.167 1.00 228.80 ? 501  THR C OG1   1 
ATOM   7478  C  CG2   . THR C 2 501  ? 86.534  149.028 125.788 1.00 228.80 ? 501  THR C CG2   1 
ATOM   7479  N  N     . PRO C 2 502  ? 82.273  147.056 125.190 1.00 227.15 ? 502  PRO C N     1 
ATOM   7480  C  CA    . PRO C 2 502  ? 81.059  146.818 124.403 1.00 227.15 ? 502  PRO C CA    1 
ATOM   7481  C  C     . PRO C 2 502  ? 80.651  148.044 123.605 1.00 227.15 ? 502  PRO C C     1 
ATOM   7482  O  O     . PRO C 2 502  ? 80.671  149.172 124.099 1.00 227.15 ? 502  PRO C O     1 
ATOM   7483  C  CB    . PRO C 2 502  ? 80.014  146.464 125.464 1.00 227.15 ? 502  PRO C CB    1 
ATOM   7484  C  CG    . PRO C 2 502  ? 80.807  145.961 126.607 1.00 227.15 ? 502  PRO C CG    1 
ATOM   7485  C  CD    . PRO C 2 502  ? 82.062  146.777 126.617 1.00 227.15 ? 502  PRO C CD    1 
ATOM   7486  N  N     . LEU C 2 503  ? 80.318  147.804 122.341 1.00 237.96 ? 503  LEU C N     1 
ATOM   7487  C  CA    . LEU C 2 503  ? 79.979  148.857 121.399 1.00 237.96 ? 503  LEU C CA    1 
ATOM   7488  C  C     . LEU C 2 503  ? 78.609  148.568 120.818 1.00 237.96 ? 503  LEU C C     1 
ATOM   7489  O  O     . LEU C 2 503  ? 78.396  147.504 120.230 1.00 237.96 ? 503  LEU C O     1 
ATOM   7490  C  CB    . LEU C 2 503  ? 81.002  148.959 120.273 1.00 237.96 ? 503  LEU C CB    1 
ATOM   7491  C  CG    . LEU C 2 503  ? 82.478  148.998 120.640 1.00 237.96 ? 503  LEU C CG    1 
ATOM   7492  C  CD1   . LEU C 2 503  ? 83.287  149.198 119.371 1.00 237.96 ? 503  LEU C CD1   1 
ATOM   7493  C  CD2   . LEU C 2 503  ? 82.756  150.103 121.638 1.00 237.96 ? 503  LEU C CD2   1 
ATOM   7494  N  N     . GLU C 2 504  ? 77.690  149.512 120.972 1.00 236.03 ? 504  GLU C N     1 
ATOM   7495  C  CA    . GLU C 2 504  ? 76.383  149.402 120.336 1.00 236.03 ? 504  GLU C CA    1 
ATOM   7496  C  C     . GLU C 2 504  ? 76.576  149.777 118.876 1.00 236.03 ? 504  GLU C C     1 
ATOM   7497  O  O     . GLU C 2 504  ? 76.377  150.919 118.461 1.00 236.03 ? 504  GLU C O     1 
ATOM   7498  C  CB    . GLU C 2 504  ? 75.359  150.270 121.053 1.00 236.03 ? 504  GLU C CB    1 
ATOM   7499  C  CG    . GLU C 2 504  ? 75.913  151.565 121.578 1.00 236.03 ? 504  GLU C CG    1 
ATOM   7500  C  CD    . GLU C 2 504  ? 75.000  152.239 122.561 1.00 236.03 ? 504  GLU C CD    1 
ATOM   7501  O  OE1   . GLU C 2 504  ? 73.872  151.747 122.752 1.00 236.03 ? 504  GLU C OE1   1 
ATOM   7502  O  OE2   . GLU C 2 504  ? 75.412  153.251 123.159 1.00 236.03 ? 504  GLU C OE2   1 
ATOM   7503  N  N     . GLY C 2 505  ? 76.988  148.787 118.092 1.00 248.23 ? 505  GLY C N     1 
ATOM   7504  C  CA    . GLY C 2 505  ? 77.403  149.047 116.740 1.00 248.23 ? 505  GLY C CA    1 
ATOM   7505  C  C     . GLY C 2 505  ? 78.704  149.821 116.739 1.00 248.23 ? 505  GLY C C     1 
ATOM   7506  O  O     . GLY C 2 505  ? 79.727  149.389 117.275 1.00 248.23 ? 505  GLY C O     1 
ATOM   7507  N  N     . ASN C 2 506  ? 78.656  151.002 116.130 1.00 249.74 ? 506  ASN C N     1 
ATOM   7508  C  CA    . ASN C 2 506  ? 79.814  151.884 116.153 1.00 249.74 ? 506  ASN C CA    1 
ATOM   7509  C  C     . ASN C 2 506  ? 79.796  152.797 117.366 1.00 249.74 ? 506  ASN C C     1 
ATOM   7510  O  O     . ASN C 2 506  ? 80.854  153.230 117.829 1.00 249.74 ? 506  ASN C O     1 
ATOM   7511  C  CB    . ASN C 2 506  ? 79.868  152.692 114.867 1.00 249.74 ? 506  ASN C CB    1 
ATOM   7512  C  CG    . ASN C 2 506  ? 80.275  151.859 113.682 1.00 249.74 ? 506  ASN C CG    1 
ATOM   7513  O  OD1   . ASN C 2 506  ? 79.475  151.600 112.788 1.00 249.74 ? 506  ASN C OD1   1 
ATOM   7514  N  ND2   . ASN C 2 506  ? 81.535  151.443 113.659 1.00 249.74 ? 506  ASN C ND2   1 
ATOM   7515  N  N     . ARG C 2 507  ? 78.614  153.106 117.884 1.00 239.13 ? 507  ARG C N     1 
ATOM   7516  C  CA    . ARG C 2 507  ? 78.526  153.790 119.160 1.00 239.13 ? 507  ARG C CA    1 
ATOM   7517  C  C     . ARG C 2 507  ? 78.993  152.854 120.264 1.00 239.13 ? 507  ARG C C     1 
ATOM   7518  O  O     . ARG C 2 507  ? 78.818  151.639 120.189 1.00 239.13 ? 507  ARG C O     1 
ATOM   7519  C  CB    . ARG C 2 507  ? 77.093  154.261 119.404 1.00 239.13 ? 507  ARG C CB    1 
ATOM   7520  C  CG    . ARG C 2 507  ? 76.833  154.979 120.724 1.00 239.13 ? 507  ARG C CG    1 
ATOM   7521  C  CD    . ARG C 2 507  ? 77.419  156.367 120.753 1.00 239.13 ? 507  ARG C CD    1 
ATOM   7522  N  NE    . ARG C 2 507  ? 76.800  157.206 119.737 1.00 239.13 ? 507  ARG C NE    1 
ATOM   7523  C  CZ    . ARG C 2 507  ? 77.056  158.497 119.569 1.00 239.13 ? 507  ARG C CZ    1 
ATOM   7524  N  NH1   . ARG C 2 507  ? 77.897  159.121 120.373 1.00 239.13 ? 507  ARG C NH1   1 
ATOM   7525  N  NH2   . ARG C 2 507  ? 76.448  159.172 118.608 1.00 239.13 ? 507  ARG C NH2   1 
ATOM   7526  N  N     . ILE C 2 508  ? 79.655  153.426 121.263 1.00 232.82 ? 508  ILE C N     1 
ATOM   7527  C  CA    . ILE C 2 508  ? 80.147  152.664 122.402 1.00 232.82 ? 508  ILE C CA    1 
ATOM   7528  C  C     . ILE C 2 508  ? 78.968  152.334 123.306 1.00 232.82 ? 508  ILE C C     1 
ATOM   7529  O  O     . ILE C 2 508  ? 78.222  153.223 123.716 1.00 232.82 ? 508  ILE C O     1 
ATOM   7530  C  CB    . ILE C 2 508  ? 81.217  153.445 123.164 1.00 232.82 ? 508  ILE C CB    1 
ATOM   7531  C  CG1   . ILE C 2 508  ? 82.357  153.810 122.225 1.00 232.82 ? 508  ILE C CG1   1 
ATOM   7532  C  CG2   . ILE C 2 508  ? 81.736  152.634 124.317 1.00 232.82 ? 508  ILE C CG2   1 
ATOM   7533  C  CD1   . ILE C 2 508  ? 83.315  154.792 122.818 1.00 232.82 ? 508  ILE C CD1   1 
ATOM   7534  N  N     . ALA C 2 509  ? 78.805  151.053 123.626 1.00 248.13 ? 509  ALA C N     1 
ATOM   7535  C  CA    . ALA C 2 509  ? 77.765  150.661 124.566 1.00 248.13 ? 509  ALA C CA    1 
ATOM   7536  C  C     . ALA C 2 509  ? 78.245  150.761 125.999 1.00 248.13 ? 509  ALA C C     1 
ATOM   7537  O  O     . ALA C 2 509  ? 77.433  150.706 126.928 1.00 248.13 ? 509  ALA C O     1 
ATOM   7538  C  CB    . ALA C 2 509  ? 77.298  149.238 124.273 1.00 248.13 ? 509  ALA C CB    1 
ATOM   7539  N  N     . ALA C 2 510  ? 79.552  150.897 126.197 1.00 257.75 ? 510  ALA C N     1 
ATOM   7540  C  CA    . ALA C 2 510  ? 80.117  150.825 127.535 1.00 257.75 ? 510  ALA C CA    1 
ATOM   7541  C  C     . ALA C 2 510  ? 79.761  152.062 128.353 1.00 257.75 ? 510  ALA C C     1 
ATOM   7542  O  O     . ALA C 2 510  ? 79.422  153.119 127.816 1.00 257.75 ? 510  ALA C O     1 
ATOM   7543  C  CB    . ALA C 2 510  ? 81.631  150.654 127.460 1.00 257.75 ? 510  ALA C CB    1 
ATOM   7544  N  N     . GLU C 2 511  ? 79.837  151.907 129.674 1.00 266.74 ? 511  GLU C N     1 
ATOM   7545  C  CA    . GLU C 2 511  ? 79.372  152.937 130.594 1.00 266.74 ? 511  GLU C CA    1 
ATOM   7546  C  C     . GLU C 2 511  ? 80.349  154.101 130.674 1.00 266.74 ? 511  GLU C C     1 
ATOM   7547  O  O     . GLU C 2 511  ? 79.953  155.254 130.480 1.00 266.74 ? 511  GLU C O     1 
ATOM   7548  C  CB    . GLU C 2 511  ? 79.149  152.329 131.975 1.00 266.74 ? 511  GLU C CB    1 
ATOM   7549  C  CG    . GLU C 2 511  ? 78.457  153.253 132.947 1.00 266.74 ? 511  GLU C CG    1 
ATOM   7550  C  CD    . GLU C 2 511  ? 79.435  153.955 133.862 1.00 266.74 ? 511  GLU C CD    1 
ATOM   7551  O  OE1   . GLU C 2 511  ? 80.386  153.299 134.331 1.00 266.74 ? 511  GLU C OE1   1 
ATOM   7552  O  OE2   . GLU C 2 511  ? 79.260  155.166 134.098 1.00 266.74 ? 511  GLU C OE2   1 
ATOM   7553  N  N     . ARG C 2 512  ? 81.599  153.817 131.042 1.00 235.98 ? 512  ARG C N     1 
ATOM   7554  C  CA    . ARG C 2 512  ? 82.775  154.659 130.852 1.00 235.98 ? 512  ARG C CA    1 
ATOM   7555  C  C     . ARG C 2 512  ? 83.998  153.802 131.120 1.00 235.98 ? 512  ARG C C     1 
ATOM   7556  O  O     . ARG C 2 512  ? 84.013  153.014 132.068 1.00 235.98 ? 512  ARG C O     1 
ATOM   7557  C  CB    . ARG C 2 512  ? 82.797  155.902 131.752 1.00 235.98 ? 512  ARG C CB    1 
ATOM   7558  C  CG    . ARG C 2 512  ? 82.406  155.684 133.176 1.00 235.98 ? 512  ARG C CG    1 
ATOM   7559  C  CD    . ARG C 2 512  ? 82.288  157.015 133.889 1.00 235.98 ? 512  ARG C CD    1 
ATOM   7560  N  NE    . ARG C 2 512  ? 83.473  157.845 133.690 1.00 235.98 ? 512  ARG C NE    1 
ATOM   7561  C  CZ    . ARG C 2 512  ? 83.448  159.120 133.321 1.00 235.98 ? 512  ARG C CZ    1 
ATOM   7562  N  NH1   . ARG C 2 512  ? 82.292  159.729 133.114 1.00 235.98 ? 512  ARG C NH1   1 
ATOM   7563  N  NH2   . ARG C 2 512  ? 84.583  159.789 133.175 1.00 235.98 ? 512  ARG C NH2   1 
ATOM   7564  N  N     . VAL C 2 513  ? 85.012  153.955 130.281 1.00 211.61 ? 513  VAL C N     1 
ATOM   7565  C  CA    . VAL C 2 513  ? 86.088  152.981 130.197 1.00 211.61 ? 513  VAL C CA    1 
ATOM   7566  C  C     . VAL C 2 513  ? 87.374  153.609 130.706 1.00 211.61 ? 513  VAL C C     1 
ATOM   7567  O  O     . VAL C 2 513  ? 87.600  154.816 130.580 1.00 211.61 ? 513  VAL C O     1 
ATOM   7568  C  CB    . VAL C 2 513  ? 86.259  152.475 128.747 1.00 211.61 ? 513  VAL C CB    1 
ATOM   7569  C  CG1   . VAL C 2 513  ? 87.098  151.204 128.689 1.00 211.61 ? 513  VAL C CG1   1 
ATOM   7570  C  CG2   . VAL C 2 513  ? 84.912  152.248 128.107 1.00 211.61 ? 513  VAL C CG2   1 
ATOM   7571  N  N     . VAL C 2 514  ? 88.211  152.769 131.309 1.00 200.24 ? 514  VAL C N     1 
ATOM   7572  C  CA    . VAL C 2 514  ? 89.576  153.145 131.584 1.00 200.24 ? 514  VAL C CA    1 
ATOM   7573  C  C     . VAL C 2 514  ? 90.336  153.318 130.269 1.00 200.24 ? 514  VAL C C     1 
ATOM   7574  O  O     . VAL C 2 514  ? 90.051  152.670 129.254 1.00 200.24 ? 514  VAL C O     1 
ATOM   7575  C  CB    . VAL C 2 514  ? 90.225  152.091 132.498 1.00 200.24 ? 514  VAL C CB    1 
ATOM   7576  C  CG1   . VAL C 2 514  ? 90.319  150.727 131.811 1.00 200.24 ? 514  VAL C CG1   1 
ATOM   7577  C  CG2   . VAL C 2 514  ? 91.550  152.562 133.066 1.00 200.24 ? 514  VAL C CG2   1 
ATOM   7578  N  N     . ALA C 2 515  ? 91.282  154.252 130.273 1.00 204.82 ? 515  ALA C N     1 
ATOM   7579  C  CA    . ALA C 2 515  ? 92.048  154.543 129.075 1.00 204.82 ? 515  ALA C CA    1 
ATOM   7580  C  C     . ALA C 2 515  ? 93.396  155.107 129.477 1.00 204.82 ? 515  ALA C C     1 
ATOM   7581  O  O     . ALA C 2 515  ? 93.481  155.907 130.408 1.00 204.82 ? 515  ALA C O     1 
ATOM   7582  C  CB    . ALA C 2 515  ? 91.316  155.541 128.179 1.00 204.82 ? 515  ALA C CB    1 
ATOM   7583  N  N     . ARG C 2 516  ? 94.435  154.699 128.757 1.00 229.42 ? 516  ARG C N     1 
ATOM   7584  C  CA    . ARG C 2 516  ? 95.773  155.206 129.021 1.00 229.42 ? 516  ARG C CA    1 
ATOM   7585  C  C     . ARG C 2 516  ? 95.860  156.678 128.647 1.00 229.42 ? 516  ARG C C     1 
ATOM   7586  O  O     . ARG C 2 516  ? 95.294  157.111 127.640 1.00 229.42 ? 516  ARG C O     1 
ATOM   7587  C  CB    . ARG C 2 516  ? 96.807  154.384 128.254 1.00 229.42 ? 516  ARG C CB    1 
ATOM   7588  C  CG    . ARG C 2 516  ? 96.580  154.314 126.752 1.00 229.42 ? 516  ARG C CG    1 
ATOM   7589  C  CD    . ARG C 2 516  ? 97.062  152.999 126.180 1.00 229.42 ? 516  ARG C CD    1 
ATOM   7590  N  NE    . ARG C 2 516  ? 96.124  151.907 126.424 1.00 229.42 ? 516  ARG C NE    1 
ATOM   7591  C  CZ    . ARG C 2 516  ? 95.094  151.618 125.635 1.00 229.42 ? 516  ARG C CZ    1 
ATOM   7592  N  NH1   . ARG C 2 516  ? 94.863  152.346 124.554 1.00 229.42 ? 516  ARG C NH1   1 
ATOM   7593  N  NH2   . ARG C 2 516  ? 94.293  150.603 125.926 1.00 229.42 ? 516  ARG C NH2   1 
ATOM   7594  N  N     . ARG C 2 517  ? 96.525  157.457 129.485 1.00 225.28 ? 517  ARG C N     1 
ATOM   7595  C  CA    . ARG C 2 517  ? 96.664  158.891 129.271 1.00 225.28 ? 517  ARG C CA    1 
ATOM   7596  C  C     . ARG C 2 517  ? 98.142  159.217 129.422 1.00 225.28 ? 517  ARG C C     1 
ATOM   7597  O  O     . ARG C 2 517  ? 98.593  159.592 130.503 1.00 225.28 ? 517  ARG C O     1 
ATOM   7598  C  CB    . ARG C 2 517  ? 95.808  159.677 130.248 1.00 225.28 ? 517  ARG C CB    1 
ATOM   7599  C  CG    . ARG C 2 517  ? 95.753  161.161 129.956 1.00 225.28 ? 517  ARG C CG    1 
ATOM   7600  C  CD    . ARG C 2 517  ? 94.445  161.759 130.423 1.00 225.28 ? 517  ARG C CD    1 
ATOM   7601  N  NE    . ARG C 2 517  ? 93.456  161.838 129.353 1.00 225.28 ? 517  ARG C NE    1 
ATOM   7602  C  CZ    . ARG C 2 517  ? 92.147  161.930 129.560 1.00 225.28 ? 517  ARG C CZ    1 
ATOM   7603  N  NH1   . ARG C 2 517  ? 91.676  161.941 130.796 1.00 225.28 ? 517  ARG C NH1   1 
ATOM   7604  N  NH2   . ARG C 2 517  ? 91.308  162.004 128.535 1.00 225.28 ? 517  ARG C NH2   1 
ATOM   7605  N  N     . LYS C 2 518  ? 98.871  159.125 128.309 1.00 238.24 ? 518  LYS C N     1 
ATOM   7606  C  CA    . LYS C 2 518  ? 100.327 158.979 128.288 1.00 238.24 ? 518  LYS C CA    1 
ATOM   7607  C  C     . LYS C 2 518  ? 100.735 157.837 129.208 1.00 238.24 ? 518  LYS C C     1 
ATOM   7608  O  O     . LYS C 2 518  ? 101.516 157.991 130.145 1.00 238.24 ? 518  LYS C O     1 
ATOM   7609  C  CB    . LYS C 2 518  ? 101.054 160.276 128.654 1.00 238.24 ? 518  LYS C CB    1 
ATOM   7610  C  CG    . LYS C 2 518  ? 101.159 161.247 127.517 1.00 238.24 ? 518  LYS C CG    1 
ATOM   7611  C  CD    . LYS C 2 518  ? 101.766 162.551 127.962 1.00 238.24 ? 518  LYS C CD    1 
ATOM   7612  C  CE    . LYS C 2 518  ? 101.936 163.486 126.785 1.00 238.24 ? 518  LYS C CE    1 
ATOM   7613  N  NZ    . LYS C 2 518  ? 100.639 163.741 126.110 1.00 238.24 ? 518  LYS C NZ    1 
ATOM   7614  N  N     . GLY C 2 519  ? 100.150 156.678 128.930 1.00 230.96 ? 519  GLY C N     1 
ATOM   7615  C  CA    . GLY C 2 519  ? 100.378 155.510 129.742 1.00 230.96 ? 519  GLY C CA    1 
ATOM   7616  C  C     . GLY C 2 519  ? 99.670  155.516 131.070 1.00 230.96 ? 519  GLY C C     1 
ATOM   7617  O  O     . GLY C 2 519  ? 99.922  154.631 131.890 1.00 230.96 ? 519  GLY C O     1 
ATOM   7618  N  N     . GLU C 2 520  ? 98.801  156.483 131.322 1.00 237.75 ? 520  GLU C N     1 
ATOM   7619  C  CA    . GLU C 2 520  ? 98.138  156.525 132.615 1.00 237.75 ? 520  GLU C CA    1 
ATOM   7620  C  C     . GLU C 2 520  ? 96.706  156.056 132.460 1.00 237.75 ? 520  GLU C C     1 
ATOM   7621  O  O     . GLU C 2 520  ? 95.878  156.777 131.883 1.00 237.75 ? 520  GLU C O     1 
ATOM   7622  C  CB    . GLU C 2 520  ? 98.184  157.922 133.225 1.00 237.75 ? 520  GLU C CB    1 
ATOM   7623  C  CG    . GLU C 2 520  ? 99.589  158.483 133.371 1.00 237.75 ? 520  GLU C CG    1 
ATOM   7624  C  CD    . GLU C 2 520  ? 100.619 157.430 133.730 1.00 237.75 ? 520  GLU C CD    1 
ATOM   7625  O  OE1   . GLU C 2 520  ? 100.531 156.851 134.832 1.00 237.75 ? 520  GLU C OE1   1 
ATOM   7626  O  OE2   . GLU C 2 520  ? 101.524 157.188 132.906 1.00 237.75 ? 520  GLU C OE2   1 
ATOM   7627  N  N     . PRO C 2 521  ? 96.376  154.874 132.967 1.00 226.76 ? 521  PRO C N     1 
ATOM   7628  C  CA    . PRO C 2 521  ? 95.029  154.330 132.784 1.00 226.76 ? 521  PRO C CA    1 
ATOM   7629  C  C     . PRO C 2 521  ? 94.014  155.069 133.643 1.00 226.76 ? 521  PRO C C     1 
ATOM   7630  O  O     . PRO C 2 521  ? 94.117  155.099 134.869 1.00 226.76 ? 521  PRO C O     1 
ATOM   7631  C  CB    . PRO C 2 521  ? 95.186  152.869 133.214 1.00 226.76 ? 521  PRO C CB    1 
ATOM   7632  C  CG    . PRO C 2 521  ? 96.337  152.873 134.160 1.00 226.76 ? 521  PRO C CG    1 
ATOM   7633  C  CD    . PRO C 2 521  ? 97.256  153.965 133.722 1.00 226.76 ? 521  PRO C CD    1 
ATOM   7634  N  N     . VAL C 2 522  ? 93.025  155.675 132.992 1.00 209.61 ? 522  VAL C N     1 
ATOM   7635  C  CA    . VAL C 2 522  ? 92.057  156.508 133.696 1.00 209.61 ? 522  VAL C CA    1 
ATOM   7636  C  C     . VAL C 2 522  ? 90.666  156.284 133.115 1.00 209.61 ? 522  VAL C C     1 
ATOM   7637  O  O     . VAL C 2 522  ? 90.496  156.218 131.893 1.00 209.61 ? 522  VAL C O     1 
ATOM   7638  C  CB    . VAL C 2 522  ? 92.478  157.997 133.668 1.00 209.61 ? 522  VAL C CB    1 
ATOM   7639  C  CG1   . VAL C 2 522  ? 92.715  158.510 132.252 1.00 209.61 ? 522  VAL C CG1   1 
ATOM   7640  C  CG2   . VAL C 2 522  ? 91.460  158.871 134.390 1.00 209.61 ? 522  VAL C CG2   1 
ATOM   7641  N  N     . ILE C 2 523  ? 89.684  156.111 134.002 1.00 201.55 ? 523  ILE C N     1 
ATOM   7642  C  CA    . ILE C 2 523  ? 88.284  155.997 133.612 1.00 201.55 ? 523  ILE C CA    1 
ATOM   7643  C  C     . ILE C 2 523  ? 87.835  157.309 132.987 1.00 201.55 ? 523  ILE C C     1 
ATOM   7644  O  O     . ILE C 2 523  ? 87.789  158.350 133.651 1.00 201.55 ? 523  ILE C O     1 
ATOM   7645  C  CB    . ILE C 2 523  ? 87.405  155.640 134.814 1.00 201.55 ? 523  ILE C CB    1 
ATOM   7646  C  CG1   . ILE C 2 523  ? 87.750  154.252 135.349 1.00 201.55 ? 523  ILE C CG1   1 
ATOM   7647  C  CG2   . ILE C 2 523  ? 85.943  155.711 134.431 1.00 201.55 ? 523  ILE C CG2   1 
ATOM   7648  C  CD1   . ILE C 2 523  ? 87.226  153.115 134.503 1.00 201.55 ? 523  ILE C CD1   1 
ATOM   7649  N  N     . VAL C 2 524  ? 87.524  157.266 131.700 1.00 220.19 ? 524  VAL C N     1 
ATOM   7650  C  CA    . VAL C 2 524  ? 87.063  158.428 130.959 1.00 220.19 ? 524  VAL C CA    1 
ATOM   7651  C  C     . VAL C 2 524  ? 85.701  158.062 130.384 1.00 220.19 ? 524  VAL C C     1 
ATOM   7652  O  O     . VAL C 2 524  ? 85.437  156.893 130.083 1.00 220.19 ? 524  VAL C O     1 
ATOM   7653  C  CB    . VAL C 2 524  ? 88.085  158.822 129.855 1.00 220.19 ? 524  VAL C CB    1 
ATOM   7654  C  CG1   . VAL C 2 524  ? 87.697  160.082 129.118 1.00 220.19 ? 524  VAL C CG1   1 
ATOM   7655  C  CG2   . VAL C 2 524  ? 89.467  159.008 130.438 1.00 220.19 ? 524  VAL C CG2   1 
ATOM   7656  N  N     . SER C 2 525  ? 84.821  159.058 130.277 1.00 239.06 ? 525  SER C N     1 
ATOM   7657  C  CA    . SER C 2 525  ? 83.506  158.881 129.683 1.00 239.06 ? 525  SER C CA    1 
ATOM   7658  C  C     . SER C 2 525  ? 83.631  158.460 128.217 1.00 239.06 ? 525  SER C C     1 
ATOM   7659  O  O     . SER C 2 525  ? 84.627  158.767 127.558 1.00 239.06 ? 525  SER C O     1 
ATOM   7660  C  CB    . SER C 2 525  ? 82.709  160.181 129.813 1.00 239.06 ? 525  SER C CB    1 
ATOM   7661  O  OG    . SER C 2 525  ? 81.732  160.311 128.800 1.00 239.06 ? 525  SER C OG    1 
ATOM   7662  N  N     . PRO C 2 526  ? 82.626  157.754 127.667 1.00 242.13 ? 526  PRO C N     1 
ATOM   7663  C  CA    . PRO C 2 526  ? 82.753  157.227 126.299 1.00 242.13 ? 526  PRO C CA    1 
ATOM   7664  C  C     . PRO C 2 526  ? 82.619  158.250 125.183 1.00 242.13 ? 526  PRO C C     1 
ATOM   7665  O  O     . PRO C 2 526  ? 82.369  157.874 124.035 1.00 242.13 ? 526  PRO C O     1 
ATOM   7666  C  CB    . PRO C 2 526  ? 81.609  156.208 126.215 1.00 242.13 ? 526  PRO C CB    1 
ATOM   7667  C  CG    . PRO C 2 526  ? 81.326  155.849 127.597 1.00 242.13 ? 526  PRO C CG    1 
ATOM   7668  C  CD    . PRO C 2 526  ? 81.519  157.097 128.376 1.00 242.13 ? 526  PRO C CD    1 
ATOM   7669  N  N     . GLU C 2 527  ? 82.741  159.535 125.491 1.00 253.19 ? 527  GLU C N     1 
ATOM   7670  C  CA    . GLU C 2 527  ? 82.469  160.565 124.512 1.00 253.19 ? 527  GLU C CA    1 
ATOM   7671  C  C     . GLU C 2 527  ? 83.641  161.505 124.293 1.00 253.19 ? 527  GLU C C     1 
ATOM   7672  O  O     . GLU C 2 527  ? 83.580  162.342 123.388 1.00 253.19 ? 527  GLU C O     1 
ATOM   7673  C  CB    . GLU C 2 527  ? 81.223  161.354 124.931 1.00 253.19 ? 527  GLU C CB    1 
ATOM   7674  C  CG    . GLU C 2 527  ? 79.925  160.554 124.797 1.00 253.19 ? 527  GLU C CG    1 
ATOM   7675  C  CD    . GLU C 2 527  ? 79.687  159.604 125.959 1.00 253.19 ? 527  GLU C CD    1 
ATOM   7676  O  OE1   . GLU C 2 527  ? 80.334  159.792 127.008 1.00 253.19 ? 527  GLU C OE1   1 
ATOM   7677  O  OE2   . GLU C 2 527  ? 78.889  158.656 125.812 1.00 253.19 ? 527  GLU C OE2   1 
ATOM   7678  N  N     . GLU C 2 528  ? 84.705  161.381 125.078 1.00 249.30 ? 528  GLU C N     1 
ATOM   7679  C  CA    . GLU C 2 528  ? 85.912  162.161 124.864 1.00 249.30 ? 528  GLU C CA    1 
ATOM   7680  C  C     . GLU C 2 528  ? 87.057  161.318 124.335 1.00 249.30 ? 528  GLU C C     1 
ATOM   7681  O  O     . GLU C 2 528  ? 88.128  161.862 124.047 1.00 249.30 ? 528  GLU C O     1 
ATOM   7682  C  CB    . GLU C 2 528  ? 86.352  162.841 126.164 1.00 249.30 ? 528  GLU C CB    1 
ATOM   7683  C  CG    . GLU C 2 528  ? 85.247  163.577 126.890 1.00 249.30 ? 528  GLU C CG    1 
ATOM   7684  C  CD    . GLU C 2 528  ? 84.583  162.700 127.919 1.00 249.30 ? 528  GLU C CD    1 
ATOM   7685  O  OE1   . GLU C 2 528  ? 85.002  161.537 128.021 1.00 249.30 ? 528  GLU C OE1   1 
ATOM   7686  O  OE2   . GLU C 2 528  ? 83.652  163.156 128.610 1.00 249.30 ? 528  GLU C OE2   1 
ATOM   7687  N  N     . VAL C 2 529  ? 86.860  160.006 124.219 1.00 214.44 ? 529  VAL C N     1 
ATOM   7688  C  CA    . VAL C 2 529  ? 87.915  159.141 123.723 1.00 214.44 ? 529  VAL C CA    1 
ATOM   7689  C  C     . VAL C 2 529  ? 88.077  159.351 122.223 1.00 214.44 ? 529  VAL C C     1 
ATOM   7690  O  O     . VAL C 2 529  ? 87.101  159.448 121.469 1.00 214.44 ? 529  VAL C O     1 
ATOM   7691  C  CB    . VAL C 2 529  ? 87.600  157.685 124.104 1.00 214.44 ? 529  VAL C CB    1 
ATOM   7692  C  CG1   . VAL C 2 529  ? 86.196  157.297 123.677 1.00 214.44 ? 529  VAL C CG1   1 
ATOM   7693  C  CG2   . VAL C 2 529  ? 88.618  156.734 123.529 1.00 214.44 ? 529  VAL C CG2   1 
ATOM   7694  N  N     . GLU C 2 530  ? 89.325  159.484 121.790 1.00 197.65 ? 530  GLU C N     1 
ATOM   7695  C  CA    . GLU C 2 530  ? 89.601  159.843 120.406 1.00 197.65 ? 530  GLU C CA    1 
ATOM   7696  C  C     . GLU C 2 530  ? 89.632  158.609 119.520 1.00 197.65 ? 530  GLU C C     1 
ATOM   7697  O  O     . GLU C 2 530  ? 88.906  158.536 118.530 1.00 197.65 ? 530  GLU C O     1 
ATOM   7698  C  CB    . GLU C 2 530  ? 90.925  160.601 120.312 1.00 197.65 ? 530  GLU C CB    1 
ATOM   7699  C  CG    . GLU C 2 530  ? 91.125  161.601 121.424 1.00 197.65 ? 530  GLU C CG    1 
ATOM   7700  C  CD    . GLU C 2 530  ? 91.938  161.018 122.549 1.00 197.65 ? 530  GLU C CD    1 
ATOM   7701  O  OE1   . GLU C 2 530  ? 92.239  159.811 122.479 1.00 197.65 ? 530  GLU C OE1   1 
ATOM   7702  O  OE2   . GLU C 2 530  ? 92.269  161.739 123.510 1.00 197.65 ? 530  GLU C OE2   1 
ATOM   7703  N  N     . PHE C 2 531  ? 90.464  157.636 119.871 1.00 194.82 ? 531  PHE C N     1 
ATOM   7704  C  CA    . PHE C 2 531  ? 90.661  156.448 119.061 1.00 194.82 ? 531  PHE C CA    1 
ATOM   7705  C  C     . PHE C 2 531  ? 90.452  155.208 119.910 1.00 194.82 ? 531  PHE C C     1 
ATOM   7706  O  O     . PHE C 2 531  ? 90.279  155.282 121.125 1.00 194.82 ? 531  PHE C O     1 
ATOM   7707  C  CB    . PHE C 2 531  ? 92.052  156.429 118.434 1.00 194.82 ? 531  PHE C CB    1 
ATOM   7708  C  CG    . PHE C 2 531  ? 92.491  157.761 117.935 1.00 194.82 ? 531  PHE C CG    1 
ATOM   7709  C  CD1   . PHE C 2 531  ? 92.013  158.248 116.736 1.00 194.82 ? 531  PHE C CD1   1 
ATOM   7710  C  CD2   . PHE C 2 531  ? 93.365  158.537 118.670 1.00 194.82 ? 531  PHE C CD2   1 
ATOM   7711  C  CE1   . PHE C 2 531  ? 92.404  159.477 116.271 1.00 194.82 ? 531  PHE C CE1   1 
ATOM   7712  C  CE2   . PHE C 2 531  ? 93.760  159.766 118.207 1.00 194.82 ? 531  PHE C CE2   1 
ATOM   7713  C  CZ    . PHE C 2 531  ? 93.280  160.240 117.010 1.00 194.82 ? 531  PHE C CZ    1 
ATOM   7714  N  N     . MET C 2 532  ? 90.471  154.056 119.253 1.00 213.84 ? 532  MET C N     1 
ATOM   7715  C  CA    . MET C 2 532  ? 90.223  152.801 119.934 1.00 213.84 ? 532  MET C CA    1 
ATOM   7716  C  C     . MET C 2 532  ? 91.150  151.748 119.352 1.00 213.84 ? 532  MET C C     1 
ATOM   7717  O  O     . MET C 2 532  ? 91.552  151.838 118.189 1.00 213.84 ? 532  MET C O     1 
ATOM   7718  C  CB    . MET C 2 532  ? 88.757  152.384 119.797 1.00 213.84 ? 532  MET C CB    1 
ATOM   7719  C  CG    . MET C 2 532  ? 88.341  151.246 120.702 1.00 213.84 ? 532  MET C CG    1 
ATOM   7720  S  SD    . MET C 2 532  ? 86.652  150.709 120.444 1.00 213.84 ? 532  MET C SD    1 
ATOM   7721  C  CE    . MET C 2 532  ? 86.638  149.213 121.423 1.00 213.84 ? 532  MET C CE    1 
ATOM   7722  N  N     . ASP C 2 533  ? 91.491  150.762 120.185 1.00 239.71 ? 533  ASP C N     1 
ATOM   7723  C  CA    . ASP C 2 533  ? 92.352  149.656 119.791 1.00 239.71 ? 533  ASP C CA    1 
ATOM   7724  C  C     . ASP C 2 533  ? 91.760  148.865 118.639 1.00 239.71 ? 533  ASP C C     1 
ATOM   7725  O  O     . ASP C 2 533  ? 90.553  148.628 118.579 1.00 239.71 ? 533  ASP C O     1 
ATOM   7726  C  CB    . ASP C 2 533  ? 92.567  148.708 120.965 1.00 239.71 ? 533  ASP C CB    1 
ATOM   7727  C  CG    . ASP C 2 533  ? 92.934  149.424 122.232 1.00 239.71 ? 533  ASP C CG    1 
ATOM   7728  O  OD1   . ASP C 2 533  ? 93.352  150.590 122.146 1.00 239.71 ? 533  ASP C OD1   1 
ATOM   7729  O  OD2   . ASP C 2 533  ? 92.804  148.821 123.316 1.00 239.71 ? 533  ASP C OD2   1 
ATOM   7730  N  N     . VAL C 2 534  ? 92.635  148.454 117.724 1.00 221.23 ? 534  VAL C N     1 
ATOM   7731  C  CA    . VAL C 2 534  ? 92.238  147.543 116.658 1.00 221.23 ? 534  VAL C CA    1 
ATOM   7732  C  C     . VAL C 2 534  ? 91.861  146.192 117.243 1.00 221.23 ? 534  VAL C C     1 
ATOM   7733  O  O     . VAL C 2 534  ? 90.781  145.653 116.977 1.00 221.23 ? 534  VAL C O     1 
ATOM   7734  C  CB    . VAL C 2 534  ? 93.372  147.405 115.631 1.00 221.23 ? 534  VAL C CB    1 
ATOM   7735  C  CG1   . VAL C 2 534  ? 93.084  146.262 114.677 1.00 221.23 ? 534  VAL C CG1   1 
ATOM   7736  C  CG2   . VAL C 2 534  ? 93.556  148.703 114.882 1.00 221.23 ? 534  VAL C CG2   1 
ATOM   7737  N  N     . SER C 2 535  ? 92.736  145.642 118.067 1.00 216.60 ? 535  SER C N     1 
ATOM   7738  C  CA    . SER C 2 535  ? 92.557  144.292 118.570 1.00 216.60 ? 535  SER C CA    1 
ATOM   7739  C  C     . SER C 2 535  ? 93.264  144.138 119.905 1.00 216.60 ? 535  SER C C     1 
ATOM   7740  O  O     . SER C 2 535  ? 94.128  144.950 120.246 1.00 216.60 ? 535  SER C O     1 
ATOM   7741  C  CB    . SER C 2 535  ? 93.118  143.278 117.577 1.00 216.60 ? 535  SER C CB    1 
ATOM   7742  O  OG    . SER C 2 535  ? 94.483  143.036 117.865 1.00 216.60 ? 535  SER C OG    1 
ATOM   7743  N  N     . PRO C 2 536  ? 92.930  143.124 120.692 1.00 201.62 ? 536  PRO C N     1 
ATOM   7744  C  CA    . PRO C 2 536  ? 93.831  142.753 121.785 1.00 201.62 ? 536  PRO C CA    1 
ATOM   7745  C  C     . PRO C 2 536  ? 95.134  142.190 121.270 1.00 201.62 ? 536  PRO C C     1 
ATOM   7746  O  O     . PRO C 2 536  ? 96.179  142.350 121.908 1.00 201.62 ? 536  PRO C O     1 
ATOM   7747  C  CB    . PRO C 2 536  ? 93.025  141.706 122.560 1.00 201.62 ? 536  PRO C CB    1 
ATOM   7748  C  CG    . PRO C 2 536  ? 91.622  141.992 122.218 1.00 201.62 ? 536  PRO C CG    1 
ATOM   7749  C  CD    . PRO C 2 536  ? 91.637  142.436 120.796 1.00 201.62 ? 536  PRO C CD    1 
ATOM   7750  N  N     . LYS C 2 537  ? 95.097  141.557 120.100 1.00 205.03 ? 537  LYS C N     1 
ATOM   7751  C  CA    . LYS C 2 537  ? 96.264  140.871 119.573 1.00 205.03 ? 537  LYS C CA    1 
ATOM   7752  C  C     . LYS C 2 537  ? 97.360  141.823 119.147 1.00 205.03 ? 537  LYS C C     1 
ATOM   7753  O  O     . LYS C 2 537  ? 98.520  141.413 119.077 1.00 205.03 ? 537  LYS C O     1 
ATOM   7754  C  CB    . LYS C 2 537  ? 95.864  140.014 118.385 1.00 205.03 ? 537  LYS C CB    1 
ATOM   7755  C  CG    . LYS C 2 537  ? 94.554  139.301 118.571 1.00 205.03 ? 537  LYS C CG    1 
ATOM   7756  C  CD    . LYS C 2 537  ? 94.510  138.057 117.707 1.00 205.03 ? 537  LYS C CD    1 
ATOM   7757  C  CE    . LYS C 2 537  ? 93.198  137.308 117.880 1.00 205.03 ? 537  LYS C CE    1 
ATOM   7758  N  NZ    . LYS C 2 537  ? 92.843  137.123 119.313 1.00 205.03 ? 537  LYS C NZ    1 
ATOM   7759  N  N     . GLN C 2 538  ? 97.038  143.086 118.917 1.00 204.20 ? 538  GLN C N     1 
ATOM   7760  C  CA    . GLN C 2 538  ? 97.988  144.025 118.334 1.00 204.20 ? 538  GLN C CA    1 
ATOM   7761  C  C     . GLN C 2 538  ? 99.106  144.439 119.277 1.00 204.20 ? 538  GLN C C     1 
ATOM   7762  O  O     . GLN C 2 538  ? 99.913  145.296 118.909 1.00 204.20 ? 538  GLN C O     1 
ATOM   7763  C  CB    . GLN C 2 538  ? 97.241  145.259 117.834 1.00 204.20 ? 538  GLN C CB    1 
ATOM   7764  C  CG    . GLN C 2 538  ? 96.795  146.213 118.918 1.00 204.20 ? 538  GLN C CG    1 
ATOM   7765  C  CD    . GLN C 2 538  ? 95.851  147.271 118.390 1.00 204.20 ? 538  GLN C CD    1 
ATOM   7766  O  OE1   . GLN C 2 538  ? 94.717  147.391 118.846 1.00 204.20 ? 538  GLN C OE1   1 
ATOM   7767  N  NE2   . GLN C 2 538  ? 96.314  148.042 117.414 1.00 204.20 ? 538  GLN C NE2   1 
ATOM   7768  N  N     . VAL C 2 539  ? 99.221  143.864 120.467 1.00 218.42 ? 539  VAL C N     1 
ATOM   7769  C  CA    . VAL C 2 539  ? 100.257 144.244 121.412 1.00 218.42 ? 539  VAL C CA    1 
ATOM   7770  C  C     . VAL C 2 539  ? 101.425 143.274 121.296 1.00 218.42 ? 539  VAL C C     1 
ATOM   7771  O  O     . VAL C 2 539  ? 102.569 143.612 121.622 1.00 218.42 ? 539  VAL C O     1 
ATOM   7772  C  CB    . VAL C 2 539  ? 99.673  144.290 122.839 1.00 218.42 ? 539  VAL C CB    1 
ATOM   7773  C  CG1   . VAL C 2 539  ? 99.204  142.915 123.296 1.00 218.42 ? 539  VAL C CG1   1 
ATOM   7774  C  CG2   . VAL C 2 539  ? 100.645 144.913 123.832 1.00 218.42 ? 539  VAL C CG2   1 
ATOM   7775  N  N     . PHE C 2 540  ? 101.168 142.087 120.778 1.00 243.06 ? 540  PHE C N     1 
ATOM   7776  C  CA    . PHE C 2 540  ? 102.077 140.982 121.002 1.00 243.06 ? 540  PHE C CA    1 
ATOM   7777  C  C     . PHE C 2 540  ? 102.721 140.518 119.710 1.00 243.06 ? 540  PHE C C     1 
ATOM   7778  O  O     . PHE C 2 540  ? 102.332 140.907 118.609 1.00 243.06 ? 540  PHE C O     1 
ATOM   7779  C  CB    . PHE C 2 540  ? 101.349 139.826 121.673 1.00 243.06 ? 540  PHE C CB    1 
ATOM   7780  C  CG    . PHE C 2 540  ? 101.206 139.993 123.137 1.00 243.06 ? 540  PHE C CG    1 
ATOM   7781  C  CD1   . PHE C 2 540  ? 102.088 140.789 123.842 1.00 243.06 ? 540  PHE C CD1   1 
ATOM   7782  C  CD2   . PHE C 2 540  ? 100.185 139.362 123.814 1.00 243.06 ? 540  PHE C CD2   1 
ATOM   7783  C  CE1   . PHE C 2 540  ? 101.955 140.948 125.194 1.00 243.06 ? 540  PHE C CE1   1 
ATOM   7784  C  CE2   . PHE C 2 540  ? 100.047 139.516 125.169 1.00 243.06 ? 540  PHE C CE2   1 
ATOM   7785  C  CZ    . PHE C 2 540  ? 100.934 140.311 125.862 1.00 243.06 ? 540  PHE C CZ    1 
ATOM   7786  N  N     . SER C 2 541  ? 103.713 139.654 119.871 1.00 242.30 ? 541  SER C N     1 
ATOM   7787  C  CA    . SER C 2 541  ? 104.396 139.074 118.736 1.00 242.30 ? 541  SER C CA    1 
ATOM   7788  C  C     . SER C 2 541  ? 103.543 137.987 118.131 1.00 242.30 ? 541  SER C C     1 
ATOM   7789  O  O     . SER C 2 541  ? 102.564 137.520 118.714 1.00 242.30 ? 541  SER C O     1 
ATOM   7790  C  CB    . SER C 2 541  ? 105.734 138.469 119.128 1.00 242.30 ? 541  SER C CB    1 
ATOM   7791  O  OG    . SER C 2 541  ? 105.549 137.102 119.457 1.00 242.30 ? 541  SER C OG    1 
ATOM   7792  N  N     . VAL C 2 542  ? 103.969 137.550 116.952 1.00 241.68 ? 542  VAL C N     1 
ATOM   7793  C  CA    . VAL C 2 542  ? 103.244 136.506 116.249 1.00 241.68 ? 542  VAL C CA    1 
ATOM   7794  C  C     . VAL C 2 542  ? 103.432 135.173 116.954 1.00 241.68 ? 542  VAL C C     1 
ATOM   7795  O  O     . VAL C 2 542  ? 102.529 134.335 116.977 1.00 241.68 ? 542  VAL C O     1 
ATOM   7796  C  CB    . VAL C 2 542  ? 103.668 136.468 114.772 1.00 241.68 ? 542  VAL C CB    1 
ATOM   7797  C  CG1   . VAL C 2 542  ? 103.390 137.815 114.152 1.00 241.68 ? 542  VAL C CG1   1 
ATOM   7798  C  CG2   . VAL C 2 542  ? 105.151 136.185 114.625 1.00 241.68 ? 542  VAL C CG2   1 
ATOM   7799  N  N     . ASN C 2 543  ? 104.583 134.986 117.600 1.00 231.18 ? 543  ASN C N     1 
ATOM   7800  C  CA    . ASN C 2 543  ? 104.798 133.773 118.372 1.00 231.18 ? 543  ASN C CA    1 
ATOM   7801  C  C     . ASN C 2 543  ? 103.996 133.817 119.652 1.00 231.18 ? 543  ASN C C     1 
ATOM   7802  O  O     . ASN C 2 543  ? 103.537 132.788 120.157 1.00 231.18 ? 543  ASN C O     1 
ATOM   7803  C  CB    . ASN C 2 543  ? 106.274 133.598 118.691 1.00 231.18 ? 543  ASN C CB    1 
ATOM   7804  C  CG    . ASN C 2 543  ? 106.540 132.328 119.447 1.00 231.18 ? 543  ASN C CG    1 
ATOM   7805  O  OD1   . ASN C 2 543  ? 105.981 131.284 119.130 1.00 231.18 ? 543  ASN C OD1   1 
ATOM   7806  N  ND2   . ASN C 2 543  ? 107.374 132.409 120.467 1.00 231.18 ? 543  ASN C ND2   1 
ATOM   7807  N  N     . THR C 2 544  ? 103.825 135.019 120.191 1.00 231.54 ? 544  THR C N     1 
ATOM   7808  C  CA    . THR C 2 544  ? 103.018 135.197 121.383 1.00 231.54 ? 544  THR C CA    1 
ATOM   7809  C  C     . THR C 2 544  ? 101.562 134.886 121.102 1.00 231.54 ? 544  THR C C     1 
ATOM   7810  O  O     . THR C 2 544  ? 100.841 134.381 121.968 1.00 231.54 ? 544  THR C O     1 
ATOM   7811  C  CB    . THR C 2 544  ? 103.169 136.627 121.876 1.00 231.54 ? 544  THR C CB    1 
ATOM   7812  O  OG1   . THR C 2 544  ? 104.545 137.006 121.800 1.00 231.54 ? 544  THR C OG1   1 
ATOM   7813  C  CG2   . THR C 2 544  ? 102.692 136.742 123.297 1.00 231.54 ? 544  THR C CG2   1 
ATOM   7814  N  N     . ASN C 2 545  ? 101.131 135.114 119.878 1.00 237.56 ? 545  ASN C N     1 
ATOM   7815  C  CA    . ASN C 2 545  ? 99.738  134.951 119.523 1.00 237.56 ? 545  ASN C CA    1 
ATOM   7816  C  C     . ASN C 2 545  ? 99.381  133.524 119.145 1.00 237.56 ? 545  ASN C C     1 
ATOM   7817  O  O     . ASN C 2 545  ? 98.412  133.320 118.410 1.00 237.56 ? 545  ASN C O     1 
ATOM   7818  C  CB    . ASN C 2 545  ? 99.395  135.908 118.385 1.00 237.56 ? 545  ASN C CB    1 
ATOM   7819  C  CG    . ASN C 2 545  ? 99.208  137.328 118.866 1.00 237.56 ? 545  ASN C CG    1 
ATOM   7820  O  OD1   . ASN C 2 545  ? 98.092  137.749 119.156 1.00 237.56 ? 545  ASN C OD1   1 
ATOM   7821  N  ND2   . ASN C 2 545  ? 100.303 138.071 118.968 1.00 237.56 ? 545  ASN C ND2   1 
ATOM   7822  N  N     . LEU C 2 546  ? 100.123 132.529 119.621 1.00 226.64 ? 546  LEU C N     1 
ATOM   7823  C  CA    . LEU C 2 546  ? 99.855  131.143 119.273 1.00 226.64 ? 546  LEU C CA    1 
ATOM   7824  C  C     . LEU C 2 546  ? 99.318  130.337 120.439 1.00 226.64 ? 546  LEU C C     1 
ATOM   7825  O  O     . LEU C 2 546  ? 99.036  129.147 120.283 1.00 226.64 ? 546  LEU C O     1 
ATOM   7826  C  CB    . LEU C 2 546  ? 101.124 130.486 118.756 1.00 226.64 ? 546  LEU C CB    1 
ATOM   7827  C  CG    . LEU C 2 546  ? 101.796 131.294 117.667 1.00 226.64 ? 546  LEU C CG    1 
ATOM   7828  C  CD1   . LEU C 2 546  ? 103.086 130.641 117.244 1.00 226.64 ? 546  LEU C CD1   1 
ATOM   7829  C  CD2   . LEU C 2 546  ? 100.866 131.474 116.483 1.00 226.64 ? 546  LEU C CD2   1 
ATOM   7830  N  N     . ILE C 2 547  ? 99.160  130.953 121.599 1.00 222.97 ? 547  ILE C N     1 
ATOM   7831  C  CA    . ILE C 2 547  ? 98.928  130.183 122.809 1.00 222.97 ? 547  ILE C CA    1 
ATOM   7832  C  C     . ILE C 2 547  ? 97.593  130.595 123.405 1.00 222.97 ? 547  ILE C C     1 
ATOM   7833  O  O     . ILE C 2 547  ? 97.346  131.790 123.604 1.00 222.97 ? 547  ILE C O     1 
ATOM   7834  C  CB    . ILE C 2 547  ? 100.057 130.389 123.826 1.00 222.97 ? 547  ILE C CB    1 
ATOM   7835  C  CG1   . ILE C 2 547  ? 101.425 130.184 123.181 1.00 222.97 ? 547  ILE C CG1   1 
ATOM   7836  C  CG2   . ILE C 2 547  ? 99.881  129.449 124.996 1.00 222.97 ? 547  ILE C CG2   1 
ATOM   7837  C  CD1   . ILE C 2 547  ? 102.172 131.465 122.865 1.00 222.97 ? 547  ILE C CD1   1 
ATOM   7838  N  N     . PRO C 2 548  ? 96.712  129.656 123.705 1.00 223.69 ? 548  PRO C N     1 
ATOM   7839  C  CA    . PRO C 2 548  ? 95.455  129.995 124.366 1.00 223.69 ? 548  PRO C CA    1 
ATOM   7840  C  C     . PRO C 2 548  ? 95.668  130.312 125.841 1.00 223.69 ? 548  PRO C C     1 
ATOM   7841  O  O     . PRO C 2 548  ? 96.638  129.879 126.465 1.00 223.69 ? 548  PRO C O     1 
ATOM   7842  C  CB    . PRO C 2 548  ? 94.627  128.719 124.194 1.00 223.69 ? 548  PRO C CB    1 
ATOM   7843  C  CG    . PRO C 2 548  ? 95.632  127.644 124.076 1.00 223.69 ? 548  PRO C CG    1 
ATOM   7844  C  CD    . PRO C 2 548  ? 96.752  128.247 123.296 1.00 223.69 ? 548  PRO C CD    1 
ATOM   7845  N  N     . PHE C 2 549  ? 94.733  131.097 126.373 1.00 233.01 ? 549  PHE C N     1 
ATOM   7846  C  CA    . PHE C 2 549  ? 94.585  131.441 127.783 1.00 233.01 ? 549  PHE C CA    1 
ATOM   7847  C  C     . PHE C 2 549  ? 95.802  132.130 128.361 1.00 233.01 ? 549  PHE C C     1 
ATOM   7848  O  O     . PHE C 2 549  ? 96.296  131.716 129.406 1.00 233.01 ? 549  PHE C O     1 
ATOM   7849  C  CB    . PHE C 2 549  ? 94.261  130.221 128.632 1.00 233.01 ? 549  PHE C CB    1 
ATOM   7850  C  CG    . PHE C 2 549  ? 93.332  129.277 127.976 1.00 233.01 ? 549  PHE C CG    1 
ATOM   7851  C  CD1   . PHE C 2 549  ? 92.032  129.641 127.705 1.00 233.01 ? 549  PHE C CD1   1 
ATOM   7852  C  CD2   . PHE C 2 549  ? 93.768  128.025 127.604 1.00 233.01 ? 549  PHE C CD2   1 
ATOM   7853  C  CE1   . PHE C 2 549  ? 91.177  128.756 127.094 1.00 233.01 ? 549  PHE C CE1   1 
ATOM   7854  C  CE2   . PHE C 2 549  ? 92.923  127.131 126.999 1.00 233.01 ? 549  PHE C CE2   1 
ATOM   7855  C  CZ    . PHE C 2 549  ? 91.628  127.496 126.741 1.00 233.01 ? 549  PHE C CZ    1 
ATOM   7856  N  N     . LEU C 2 550  ? 96.295  133.182 127.714 1.00 248.74 ? 550  LEU C N     1 
ATOM   7857  C  CA    . LEU C 2 550  ? 97.406  133.947 128.271 1.00 248.74 ? 550  LEU C CA    1 
ATOM   7858  C  C     . LEU C 2 550  ? 96.997  134.662 129.546 1.00 248.74 ? 550  LEU C C     1 
ATOM   7859  O  O     . LEU C 2 550  ? 97.835  135.006 130.385 1.00 248.74 ? 550  LEU C O     1 
ATOM   7860  C  CB    . LEU C 2 550  ? 97.898  134.956 127.239 1.00 248.74 ? 550  LEU C CB    1 
ATOM   7861  C  CG    . LEU C 2 550  ? 99.112  134.602 126.389 1.00 248.74 ? 550  LEU C CG    1 
ATOM   7862  C  CD1   . LEU C 2 550  ? 99.134  133.140 126.040 1.00 248.74 ? 550  LEU C CD1   1 
ATOM   7863  C  CD2   . LEU C 2 550  ? 99.097  135.437 125.123 1.00 248.74 ? 550  LEU C CD2   1 
ATOM   7864  N  N     . GLU C 2 551  ? 95.698  134.861 129.711 1.00 244.24 ? 551  GLU C N     1 
ATOM   7865  C  CA    . GLU C 2 551  ? 95.073  135.540 130.824 1.00 244.24 ? 551  GLU C CA    1 
ATOM   7866  C  C     . GLU C 2 551  ? 95.135  134.730 132.101 1.00 244.24 ? 551  GLU C C     1 
ATOM   7867  O  O     . GLU C 2 551  ? 94.796  135.253 133.165 1.00 244.24 ? 551  GLU C O     1 
ATOM   7868  C  CB    . GLU C 2 551  ? 93.619  135.812 130.453 1.00 244.24 ? 551  GLU C CB    1 
ATOM   7869  C  CG    . GLU C 2 551  ? 93.452  136.532 129.124 1.00 244.24 ? 551  GLU C CG    1 
ATOM   7870  C  CD    . GLU C 2 551  ? 93.351  135.595 127.931 1.00 244.24 ? 551  GLU C CD    1 
ATOM   7871  O  OE1   . GLU C 2 551  ? 93.182  134.377 128.147 1.00 244.24 ? 551  GLU C OE1   1 
ATOM   7872  O  OE2   . GLU C 2 551  ? 93.533  136.069 126.799 1.00 244.24 ? 551  GLU C OE2   1 
ATOM   7873  N  N     . HIS C 2 552  ? 95.545  133.469 132.022 1.00 254.18 ? 552  HIS C N     1 
ATOM   7874  C  CA    . HIS C 2 552  ? 95.465  132.555 133.148 1.00 254.18 ? 552  HIS C CA    1 
ATOM   7875  C  C     . HIS C 2 552  ? 96.815  131.950 133.493 1.00 254.18 ? 552  HIS C C     1 
ATOM   7876  O  O     . HIS C 2 552  ? 96.890  131.042 134.325 1.00 254.18 ? 552  HIS C O     1 
ATOM   7877  C  CB    . HIS C 2 552  ? 94.456  131.459 132.830 1.00 254.18 ? 552  HIS C CB    1 
ATOM   7878  C  CG    . HIS C 2 552  ? 93.146  131.985 132.344 1.00 254.18 ? 552  HIS C CG    1 
ATOM   7879  N  ND1   . HIS C 2 552  ? 92.093  132.248 133.192 1.00 254.18 ? 552  HIS C ND1   1 
ATOM   7880  C  CD2   . HIS C 2 552  ? 92.719  132.304 131.101 1.00 254.18 ? 552  HIS C CD2   1 
ATOM   7881  C  CE1   . HIS C 2 552  ? 91.069  132.695 132.489 1.00 254.18 ? 552  HIS C CE1   1 
ATOM   7882  N  NE2   . HIS C 2 552  ? 91.425  132.745 131.219 1.00 254.18 ? 552  HIS C NE2   1 
ATOM   7883  N  N     . ASP C 2 553  ? 97.884  132.419 132.863 1.00 266.16 ? 553  ASP C N     1 
ATOM   7884  C  CA    . ASP C 2 553  ? 99.196  131.834 133.079 1.00 266.16 ? 553  ASP C CA    1 
ATOM   7885  C  C     . ASP C 2 553  ? 100.194 132.942 133.375 1.00 266.16 ? 553  ASP C C     1 
ATOM   7886  O  O     . ASP C 2 553  ? 99.997  134.096 132.988 1.00 266.16 ? 553  ASP C O     1 
ATOM   7887  C  CB    . ASP C 2 553  ? 99.656  131.018 131.865 1.00 266.16 ? 553  ASP C CB    1 
ATOM   7888  C  CG    . ASP C 2 553  ? 98.743  129.841 131.563 1.00 266.16 ? 553  ASP C CG    1 
ATOM   7889  O  OD1   . ASP C 2 553  ? 97.570  130.067 131.254 1.00 266.16 ? 553  ASP C OD1   1 
ATOM   7890  O  OD2   . ASP C 2 553  ? 99.201  128.683 131.562 1.00 266.16 ? 553  ASP C OD2   1 
ATOM   7891  N  N     . ASP C 2 554  ? 101.264 132.573 134.073 1.00 278.08 ? 554  ASP C N     1 
ATOM   7892  C  CA    . ASP C 2 554  ? 102.321 133.514 134.417 1.00 278.08 ? 554  ASP C CA    1 
ATOM   7893  C  C     . ASP C 2 554  ? 103.113 133.941 133.190 1.00 278.08 ? 554  ASP C C     1 
ATOM   7894  O  O     . ASP C 2 554  ? 103.386 133.138 132.297 1.00 278.08 ? 554  ASP C O     1 
ATOM   7895  C  CB    . ASP C 2 554  ? 103.263 132.885 135.437 1.00 278.08 ? 554  ASP C CB    1 
ATOM   7896  C  CG    . ASP C 2 554  ? 104.404 133.792 135.803 1.00 278.08 ? 554  ASP C CG    1 
ATOM   7897  O  OD1   . ASP C 2 554  ? 104.176 134.762 136.552 1.00 278.08 ? 554  ASP C OD1   1 
ATOM   7898  O  OD2   . ASP C 2 554  ? 105.525 133.547 135.310 1.00 278.08 ? 554  ASP C OD2   1 
ATOM   7899  N  N     . ALA C 2 555  ? 103.515 135.213 133.179 1.00 262.45 ? 555  ALA C N     1 
ATOM   7900  C  CA    . ALA C 2 555  ? 104.158 135.794 132.008 1.00 262.45 ? 555  ALA C CA    1 
ATOM   7901  C  C     . ALA C 2 555  ? 105.566 135.252 131.786 1.00 262.45 ? 555  ALA C C     1 
ATOM   7902  O  O     . ALA C 2 555  ? 106.015 135.149 130.641 1.00 262.45 ? 555  ALA C O     1 
ATOM   7903  C  CB    . ALA C 2 555  ? 104.185 137.312 132.143 1.00 262.45 ? 555  ALA C CB    1 
ATOM   7904  N  N     . ASN C 2 556  ? 106.291 134.925 132.858 1.00 260.61 ? 556  ASN C N     1 
ATOM   7905  C  CA    . ASN C 2 556  ? 107.653 134.424 132.691 1.00 260.61 ? 556  ASN C CA    1 
ATOM   7906  C  C     . ASN C 2 556  ? 107.644 133.027 132.097 1.00 260.61 ? 556  ASN C C     1 
ATOM   7907  O  O     . ASN C 2 556  ? 108.416 132.716 131.182 1.00 260.61 ? 556  ASN C O     1 
ATOM   7908  C  CB    . ASN C 2 556  ? 108.389 134.421 134.027 1.00 260.61 ? 556  ASN C CB    1 
ATOM   7909  C  CG    . ASN C 2 556  ? 108.230 135.713 134.777 1.00 260.61 ? 556  ASN C CG    1 
ATOM   7910  O  OD1   . ASN C 2 556  ? 109.028 136.632 134.622 1.00 260.61 ? 556  ASN C OD1   1 
ATOM   7911  N  ND2   . ASN C 2 556  ? 107.203 135.790 135.610 1.00 260.61 ? 556  ASN C ND2   1 
ATOM   7912  N  N     . ARG C 2 557  ? 106.757 132.175 132.597 1.00 257.86 ? 557  ARG C N     1 
ATOM   7913  C  CA    . ARG C 2 557  ? 106.608 130.861 131.999 1.00 257.86 ? 557  ARG C CA    1 
ATOM   7914  C  C     . ARG C 2 557  ? 106.011 130.969 130.607 1.00 257.86 ? 557  ARG C C     1 
ATOM   7915  O  O     . ARG C 2 557  ? 106.268 130.122 129.748 1.00 257.86 ? 557  ARG C O     1 
ATOM   7916  C  CB    . ARG C 2 557  ? 105.746 129.981 132.888 1.00 257.86 ? 557  ARG C CB    1 
ATOM   7917  C  CG    . ARG C 2 557  ? 105.963 128.517 132.646 1.00 257.86 ? 557  ARG C CG    1 
ATOM   7918  C  CD    . ARG C 2 557  ? 107.370 128.132 132.944 1.00 257.86 ? 557  ARG C CD    1 
ATOM   7919  N  NE    . ARG C 2 557  ? 107.742 128.580 134.275 1.00 257.86 ? 557  ARG C NE    1 
ATOM   7920  C  CZ    . ARG C 2 557  ? 108.715 128.041 134.993 1.00 257.86 ? 557  ARG C CZ    1 
ATOM   7921  N  NH1   . ARG C 2 557  ? 109.406 127.019 134.513 1.00 257.86 ? 557  ARG C NH1   1 
ATOM   7922  N  NH2   . ARG C 2 557  ? 108.982 128.516 136.199 1.00 257.86 ? 557  ARG C NH2   1 
ATOM   7923  N  N     . ALA C 2 558  ? 105.232 132.021 130.362 1.00 284.70 ? 558  ALA C N     1 
ATOM   7924  C  CA    . ALA C 2 558  ? 104.736 132.274 129.017 1.00 284.70 ? 558  ALA C CA    1 
ATOM   7925  C  C     . ALA C 2 558  ? 105.881 132.584 128.067 1.00 284.70 ? 558  ALA C C     1 
ATOM   7926  O  O     . ALA C 2 558  ? 105.910 132.094 126.934 1.00 284.70 ? 558  ALA C O     1 
ATOM   7927  C  CB    . ALA C 2 558  ? 103.732 133.422 129.039 1.00 284.70 ? 558  ALA C CB    1 
ATOM   7928  N  N     . LEU C 2 559  ? 106.831 133.399 128.525 1.00 278.81 ? 559  LEU C N     1 
ATOM   7929  C  CA    . LEU C 2 559  ? 108.072 133.632 127.798 1.00 278.81 ? 559  LEU C CA    1 
ATOM   7930  C  C     . LEU C 2 559  ? 108.809 132.336 127.519 1.00 278.81 ? 559  LEU C C     1 
ATOM   7931  O  O     . LEU C 2 559  ? 109.310 132.115 126.405 1.00 278.81 ? 559  LEU C O     1 
ATOM   7932  C  CB    . LEU C 2 559  ? 108.955 134.570 128.610 1.00 278.81 ? 559  LEU C CB    1 
ATOM   7933  C  CG    . LEU C 2 559  ? 110.452 134.575 128.310 1.00 278.81 ? 559  LEU C CG    1 
ATOM   7934  C  CD1   . LEU C 2 559  ? 110.805 135.069 126.925 1.00 278.81 ? 559  LEU C CD1   1 
ATOM   7935  C  CD2   . LEU C 2 559  ? 111.178 135.374 129.373 1.00 278.81 ? 559  LEU C CD2   1 
ATOM   7936  N  N     . MET C 2 560  ? 108.896 131.484 128.537 1.00 258.27 ? 560  MET C N     1 
ATOM   7937  C  CA    . MET C 2 560  ? 109.626 130.231 128.411 1.00 258.27 ? 560  MET C CA    1 
ATOM   7938  C  C     . MET C 2 560  ? 108.993 129.335 127.354 1.00 258.27 ? 560  MET C C     1 
ATOM   7939  O  O     . MET C 2 560  ? 109.679 128.819 126.465 1.00 258.27 ? 560  MET C O     1 
ATOM   7940  C  CB    . MET C 2 560  ? 109.679 129.545 129.771 1.00 258.27 ? 560  MET C CB    1 
ATOM   7941  C  CG    . MET C 2 560  ? 110.585 130.271 130.742 1.00 258.27 ? 560  MET C CG    1 
ATOM   7942  S  SD    . MET C 2 560  ? 110.678 129.510 132.367 1.00 258.27 ? 560  MET C SD    1 
ATOM   7943  C  CE    . MET C 2 560  ? 110.122 130.864 133.395 1.00 258.27 ? 560  MET C CE    1 
ATOM   7944  N  N     . GLY C 2 561  ? 107.669 129.210 127.393 1.00 259.91 ? 561  GLY C N     1 
ATOM   7945  C  CA    . GLY C 2 561  ? 106.975 128.464 126.362 1.00 259.91 ? 561  GLY C CA    1 
ATOM   7946  C  C     . GLY C 2 561  ? 107.081 129.099 124.996 1.00 259.91 ? 561  GLY C C     1 
ATOM   7947  O  O     . GLY C 2 561  ? 107.193 128.391 123.998 1.00 259.91 ? 561  GLY C O     1 
ATOM   7948  N  N     . SER C 2 562  ? 107.110 130.431 124.942 1.00 268.04 ? 562  SER C N     1 
ATOM   7949  C  CA    . SER C 2 562  ? 107.181 131.136 123.669 1.00 268.04 ? 562  SER C CA    1 
ATOM   7950  C  C     . SER C 2 562  ? 108.495 130.847 122.971 1.00 268.04 ? 562  SER C C     1 
ATOM   7951  O  O     . SER C 2 562  ? 108.533 130.577 121.766 1.00 268.04 ? 562  SER C O     1 
ATOM   7952  C  CB    . SER C 2 562  ? 107.037 132.633 123.899 1.00 268.04 ? 562  SER C CB    1 
ATOM   7953  O  OG    . SER C 2 562  ? 108.203 133.130 124.527 1.00 268.04 ? 562  SER C OG    1 
ATOM   7954  N  N     . ASN C 2 563  ? 109.583 130.873 123.728 1.00 289.07 ? 563  ASN C N     1 
ATOM   7955  C  CA    . ASN C 2 563  ? 110.865 130.529 123.135 1.00 289.07 ? 563  ASN C CA    1 
ATOM   7956  C  C     . ASN C 2 563  ? 110.970 129.035 122.880 1.00 289.07 ? 563  ASN C C     1 
ATOM   7957  O  O     . ASN C 2 563  ? 111.738 128.605 122.013 1.00 289.07 ? 563  ASN C O     1 
ATOM   7958  C  CB    . ASN C 2 563  ? 112.003 131.013 124.022 1.00 289.07 ? 563  ASN C CB    1 
ATOM   7959  C  CG    . ASN C 2 563  ? 112.410 132.427 123.700 1.00 289.07 ? 563  ASN C CG    1 
ATOM   7960  O  OD1   . ASN C 2 563  ? 112.402 132.832 122.541 1.00 289.07 ? 563  ASN C OD1   1 
ATOM   7961  N  ND2   . ASN C 2 563  ? 112.767 133.191 124.720 1.00 289.07 ? 563  ASN C ND2   1 
ATOM   7962  N  N     . MET C 2 564  ? 110.212 128.227 123.626 1.00 292.91 ? 564  MET C N     1 
ATOM   7963  C  CA    . MET C 2 564  ? 110.181 126.794 123.352 1.00 292.91 ? 564  MET C CA    1 
ATOM   7964  C  C     . MET C 2 564  ? 109.574 126.515 121.985 1.00 292.91 ? 564  MET C C     1 
ATOM   7965  O  O     . MET C 2 564  ? 110.024 125.620 121.260 1.00 292.91 ? 564  MET C O     1 
ATOM   7966  C  CB    . MET C 2 564  ? 109.381 126.070 124.433 1.00 292.91 ? 564  MET C CB    1 
ATOM   7967  C  CG    . MET C 2 564  ? 110.136 125.716 125.693 1.00 292.91 ? 564  MET C CG    1 
ATOM   7968  S  SD    . MET C 2 564  ? 108.991 125.376 127.046 1.00 292.91 ? 564  MET C SD    1 
ATOM   7969  C  CE    . MET C 2 564  ? 109.864 126.090 128.428 1.00 292.91 ? 564  MET C CE    1 
ATOM   7970  N  N     . GLN C 2 565  ? 108.566 127.307 121.613 1.00 261.71 ? 565  GLN C N     1 
ATOM   7971  C  CA    . GLN C 2 565  ? 107.797 127.079 120.393 1.00 261.71 ? 565  GLN C CA    1 
ATOM   7972  C  C     . GLN C 2 565  ? 108.617 127.219 119.125 1.00 261.71 ? 565  GLN C C     1 
ATOM   7973  O  O     . GLN C 2 565  ? 108.255 126.640 118.097 1.00 261.71 ? 565  GLN C O     1 
ATOM   7974  C  CB    . GLN C 2 565  ? 106.634 128.055 120.366 1.00 261.71 ? 565  GLN C CB    1 
ATOM   7975  C  CG    . GLN C 2 565  ? 105.602 127.677 121.361 1.00 261.71 ? 565  GLN C CG    1 
ATOM   7976  C  CD    . GLN C 2 565  ? 104.935 128.870 121.979 1.00 261.71 ? 565  GLN C CD    1 
ATOM   7977  O  OE1   . GLN C 2 565  ? 105.017 129.985 121.471 1.00 261.71 ? 565  GLN C OE1   1 
ATOM   7978  N  NE2   . GLN C 2 565  ? 104.354 128.660 123.148 1.00 261.71 ? 565  GLN C NE2   1 
ATOM   7979  N  N     . THR C 2 566  ? 109.721 127.953 119.178 1.00 247.65 ? 566  THR C N     1 
ATOM   7980  C  CA    . THR C 2 566  ? 110.547 128.126 117.996 1.00 247.65 ? 566  THR C CA    1 
ATOM   7981  C  C     . THR C 2 566  ? 111.289 126.853 117.634 1.00 247.65 ? 566  THR C C     1 
ATOM   7982  O  O     . THR C 2 566  ? 111.640 126.651 116.469 1.00 247.65 ? 566  THR C O     1 
ATOM   7983  C  CB    . THR C 2 566  ? 111.537 129.240 118.250 1.00 247.65 ? 566  THR C CB    1 
ATOM   7984  O  OG1   . THR C 2 566  ? 112.415 128.822 119.299 1.00 247.65 ? 566  THR C OG1   1 
ATOM   7985  C  CG2   . THR C 2 566  ? 110.798 130.473 118.695 1.00 247.65 ? 566  THR C CG2   1 
ATOM   7986  N  N     . GLN C 2 567  ? 111.544 125.989 118.612 1.00 256.11 ? 567  GLN C N     1 
ATOM   7987  C  CA    . GLN C 2 567  ? 112.355 124.803 118.387 1.00 256.11 ? 567  GLN C CA    1 
ATOM   7988  C  C     . GLN C 2 567  ? 111.540 123.528 118.289 1.00 256.11 ? 567  GLN C C     1 
ATOM   7989  O  O     . GLN C 2 567  ? 111.985 122.475 118.767 1.00 256.11 ? 567  GLN C O     1 
ATOM   7990  C  CB    . GLN C 2 567  ? 113.401 124.665 119.482 1.00 256.11 ? 567  GLN C CB    1 
ATOM   7991  C  CG    . GLN C 2 567  ? 114.560 125.594 119.326 1.00 256.11 ? 567  GLN C CG    1 
ATOM   7992  C  CD    . GLN C 2 567  ? 115.737 125.124 120.134 1.00 256.11 ? 567  GLN C CD    1 
ATOM   7993  O  OE1   . GLN C 2 567  ? 115.638 124.134 120.859 1.00 256.11 ? 567  GLN C OE1   1 
ATOM   7994  N  NE2   . GLN C 2 567  ? 116.864 125.813 120.009 1.00 256.11 ? 567  GLN C NE2   1 
ATOM   7995  N  N     . ALA C 2 568  ? 110.352 123.592 117.704 1.00 289.95 ? 568  ALA C N     1 
ATOM   7996  C  CA    . ALA C 2 568  ? 109.652 122.374 117.335 1.00 289.95 ? 568  ALA C CA    1 
ATOM   7997  C  C     . ALA C 2 568  ? 110.350 121.722 116.153 1.00 289.95 ? 568  ALA C C     1 
ATOM   7998  O  O     . ALA C 2 568  ? 111.035 122.383 115.369 1.00 289.95 ? 568  ALA C O     1 
ATOM   7999  C  CB    . ALA C 2 568  ? 108.199 122.677 116.983 1.00 289.95 ? 568  ALA C CB    1 
ATOM   8000  N  N     . VAL C 2 569  ? 110.168 120.415 116.024 1.00 272.60 ? 569  VAL C N     1 
ATOM   8001  C  CA    . VAL C 2 569  ? 110.878 119.658 115.003 1.00 272.60 ? 569  VAL C CA    1 
ATOM   8002  C  C     . VAL C 2 569  ? 109.906 119.276 113.895 1.00 272.60 ? 569  VAL C C     1 
ATOM   8003  O  O     . VAL C 2 569  ? 108.686 119.271 114.111 1.00 272.60 ? 569  VAL C O     1 
ATOM   8004  C  CB    . VAL C 2 569  ? 111.554 118.423 115.615 1.00 272.60 ? 569  VAL C CB    1 
ATOM   8005  C  CG1   . VAL C 2 569  ? 112.371 118.832 116.810 1.00 272.60 ? 569  VAL C CG1   1 
ATOM   8006  C  CG2   . VAL C 2 569  ? 110.528 117.386 116.014 1.00 272.60 ? 569  VAL C CG2   1 
ATOM   8007  N  N     . PRO C 2 570  ? 110.388 119.013 112.686 1.00 248.71 ? 570  PRO C N     1 
ATOM   8008  C  CA    . PRO C 2 570  ? 109.530 118.383 111.683 1.00 248.71 ? 570  PRO C CA    1 
ATOM   8009  C  C     . PRO C 2 570  ? 109.197 116.959 112.085 1.00 248.71 ? 570  PRO C C     1 
ATOM   8010  O  O     . PRO C 2 570  ? 110.019 116.240 112.656 1.00 248.71 ? 570  PRO C O     1 
ATOM   8011  C  CB    . PRO C 2 570  ? 110.380 118.422 110.411 1.00 248.71 ? 570  PRO C CB    1 
ATOM   8012  C  CG    . PRO C 2 570  ? 111.342 119.525 110.636 1.00 248.71 ? 570  PRO C CG    1 
ATOM   8013  C  CD    . PRO C 2 570  ? 111.641 119.515 112.098 1.00 248.71 ? 570  PRO C CD    1 
ATOM   8014  N  N     . LEU C 2 571  ? 107.970 116.554 111.787 1.00 222.59 ? 571  LEU C N     1 
ATOM   8015  C  CA    . LEU C 2 571  ? 107.528 115.219 112.151 1.00 222.59 ? 571  LEU C CA    1 
ATOM   8016  C  C     . LEU C 2 571  ? 106.991 114.467 110.949 1.00 222.59 ? 571  LEU C C     1 
ATOM   8017  O  O     . LEU C 2 571  ? 107.162 114.898 109.807 1.00 222.59 ? 571  LEU C O     1 
ATOM   8018  C  CB    . LEU C 2 571  ? 106.464 115.283 113.239 1.00 222.59 ? 571  LEU C CB    1 
ATOM   8019  C  CG    . LEU C 2 571  ? 106.999 115.528 114.644 1.00 222.59 ? 571  LEU C CG    1 
ATOM   8020  C  CD1   . LEU C 2 571  ? 105.891 115.308 115.648 1.00 222.59 ? 571  LEU C CD1   1 
ATOM   8021  C  CD2   . LEU C 2 571  ? 108.177 114.618 114.933 1.00 222.59 ? 571  LEU C CD2   1 
ATOM   8022  N  N     . ILE C 2 572  ? 106.360 113.326 111.204 1.00 198.20 ? 572  ILE C N     1 
ATOM   8023  C  CA    . ILE C 2 572  ? 105.794 112.493 110.160 1.00 198.20 ? 572  ILE C CA    1 
ATOM   8024  C  C     . ILE C 2 572  ? 104.290 112.316 110.319 1.00 198.20 ? 572  ILE C C     1 
ATOM   8025  O  O     . ILE C 2 572  ? 103.545 112.400 109.338 1.00 198.20 ? 572  ILE C O     1 
ATOM   8026  C  CB    . ILE C 2 572  ? 106.511 111.133 110.109 1.00 198.20 ? 572  ILE C CB    1 
ATOM   8027  C  CG1   . ILE C 2 572  ? 106.801 110.641 111.526 1.00 198.20 ? 572  ILE C CG1   1 
ATOM   8028  C  CG2   . ILE C 2 572  ? 107.807 111.269 109.356 1.00 198.20 ? 572  ILE C CG2   1 
ATOM   8029  C  CD1   . ILE C 2 572  ? 107.478 109.304 111.581 1.00 198.20 ? 572  ILE C CD1   1 
ATOM   8030  N  N     . ARG C 2 573  ? 103.817 112.095 111.541 1.00 200.02 ? 573  ARG C N     1 
ATOM   8031  C  CA    . ARG C 2 573  ? 102.392 111.925 111.778 1.00 200.02 ? 573  ARG C CA    1 
ATOM   8032  C  C     . ARG C 2 573  ? 101.893 112.973 112.757 1.00 200.02 ? 573  ARG C C     1 
ATOM   8033  O  O     . ARG C 2 573  ? 101.157 112.658 113.697 1.00 200.02 ? 573  ARG C O     1 
ATOM   8034  C  CB    . ARG C 2 573  ? 102.095 110.525 112.301 1.00 200.02 ? 573  ARG C CB    1 
ATOM   8035  C  CG    . ARG C 2 573  ? 101.947 109.512 111.206 1.00 200.02 ? 573  ARG C CG    1 
ATOM   8036  C  CD    . ARG C 2 573  ? 101.744 108.141 111.782 1.00 200.02 ? 573  ARG C CD    1 
ATOM   8037  N  NE    . ARG C 2 573  ? 100.645 108.118 112.737 1.00 200.02 ? 573  ARG C NE    1 
ATOM   8038  C  CZ    . ARG C 2 573  ? 100.182 107.012 113.306 1.00 200.02 ? 573  ARG C CZ    1 
ATOM   8039  N  NH1   . ARG C 2 573  ? 100.716 105.839 113.006 1.00 200.02 ? 573  ARG C NH1   1 
ATOM   8040  N  NH2   . ARG C 2 573  ? 99.175  107.076 114.163 1.00 200.02 ? 573  ARG C NH2   1 
ATOM   8041  N  N     . ALA C 2 574  ? 102.285 114.220 112.542 1.00 217.69 ? 574  ALA C N     1 
ATOM   8042  C  CA    . ALA C 2 574  ? 101.900 115.300 113.435 1.00 217.69 ? 574  ALA C CA    1 
ATOM   8043  C  C     . ALA C 2 574  ? 100.462 115.716 113.145 1.00 217.69 ? 574  ALA C C     1 
ATOM   8044  O  O     . ALA C 2 574  ? 99.786  115.179 112.266 1.00 217.69 ? 574  ALA C O     1 
ATOM   8045  C  CB    . ALA C 2 574  ? 102.868 116.467 113.296 1.00 217.69 ? 574  ALA C CB    1 
ATOM   8046  N  N     . GLN C 2 575  ? 99.984  116.698 113.896 1.00 231.46 ? 575  GLN C N     1 
ATOM   8047  C  CA    . GLN C 2 575  ? 98.637  117.208 113.718 1.00 231.46 ? 575  GLN C CA    1 
ATOM   8048  C  C     . GLN C 2 575  ? 98.599  118.617 114.268 1.00 231.46 ? 575  GLN C C     1 
ATOM   8049  O  O     . GLN C 2 575  ? 99.475  119.017 115.033 1.00 231.46 ? 575  GLN C O     1 
ATOM   8050  C  CB    . GLN C 2 575  ? 97.610  116.342 114.439 1.00 231.46 ? 575  GLN C CB    1 
ATOM   8051  C  CG    . GLN C 2 575  ? 97.982  116.095 115.875 1.00 231.46 ? 575  GLN C CG    1 
ATOM   8052  C  CD    . GLN C 2 575  ? 96.792  115.746 116.725 1.00 231.46 ? 575  GLN C CD    1 
ATOM   8053  O  OE1   . GLN C 2 575  ? 95.786  116.452 116.714 1.00 231.46 ? 575  GLN C OE1   1 
ATOM   8054  N  NE2   . GLN C 2 575  ? 96.898  114.660 117.478 1.00 231.46 ? 575  GLN C NE2   1 
ATOM   8055  N  N     . ALA C 2 576  ? 97.574  119.359 113.873 1.00 243.82 ? 576  ALA C N     1 
ATOM   8056  C  CA    . ALA C 2 576  ? 97.354  120.680 114.418 1.00 243.82 ? 576  ALA C CA    1 
ATOM   8057  C  C     . ALA C 2 576  ? 96.933  120.572 115.878 1.00 243.82 ? 576  ALA C C     1 
ATOM   8058  O  O     . ALA C 2 576  ? 96.490  119.513 116.324 1.00 243.82 ? 576  ALA C O     1 
ATOM   8059  C  CB    . ALA C 2 576  ? 96.281  121.404 113.614 1.00 243.82 ? 576  ALA C CB    1 
ATOM   8060  N  N     . PRO C 2 577  ? 97.090  121.639 116.654 1.00 251.62 ? 577  PRO C N     1 
ATOM   8061  C  CA    . PRO C 2 577  ? 96.475  121.656 117.979 1.00 251.62 ? 577  PRO C CA    1 
ATOM   8062  C  C     . PRO C 2 577  ? 94.966  121.653 117.868 1.00 251.62 ? 577  PRO C C     1 
ATOM   8063  O  O     . PRO C 2 577  ? 94.387  122.169 116.911 1.00 251.62 ? 577  PRO C O     1 
ATOM   8064  C  CB    . PRO C 2 577  ? 96.984  122.961 118.593 1.00 251.62 ? 577  PRO C CB    1 
ATOM   8065  C  CG    . PRO C 2 577  ? 97.409  123.776 117.446 1.00 251.62 ? 577  PRO C CG    1 
ATOM   8066  C  CD    . PRO C 2 577  ? 97.970  122.802 116.472 1.00 251.62 ? 577  PRO C CD    1 
ATOM   8067  N  N     . VAL C 2 578  ? 94.328  121.027 118.851 1.00 245.22 ? 578  VAL C N     1 
ATOM   8068  C  CA    . VAL C 2 578  ? 92.875  120.990 118.858 1.00 245.22 ? 578  VAL C CA    1 
ATOM   8069  C  C     . VAL C 2 578  ? 92.321  122.342 119.280 1.00 245.22 ? 578  VAL C C     1 
ATOM   8070  O  O     . VAL C 2 578  ? 91.313  122.817 118.742 1.00 245.22 ? 578  VAL C O     1 
ATOM   8071  C  CB    . VAL C 2 578  ? 92.383  119.826 119.741 1.00 245.22 ? 578  VAL C CB    1 
ATOM   8072  C  CG1   . VAL C 2 578  ? 92.995  119.873 121.136 1.00 245.22 ? 578  VAL C CG1   1 
ATOM   8073  C  CG2   . VAL C 2 578  ? 90.864  119.794 119.813 1.00 245.22 ? 578  VAL C CG2   1 
ATOM   8074  N  N     . VAL C 2 579  ? 92.998  123.010 120.192 1.00 232.56 ? 579  VAL C N     1 
ATOM   8075  C  CA    . VAL C 2 579  ? 92.679  124.383 120.528 1.00 232.56 ? 579  VAL C CA    1 
ATOM   8076  C  C     . VAL C 2 579  ? 93.562  125.294 119.689 1.00 232.56 ? 579  VAL C C     1 
ATOM   8077  O  O     . VAL C 2 579  ? 94.780  125.106 119.606 1.00 232.56 ? 579  VAL C O     1 
ATOM   8078  C  CB    . VAL C 2 579  ? 92.835  124.629 122.038 1.00 232.56 ? 579  VAL C CB    1 
ATOM   8079  C  CG1   . VAL C 2 579  ? 94.155  124.099 122.560 1.00 232.56 ? 579  VAL C CG1   1 
ATOM   8080  C  CG2   . VAL C 2 579  ? 92.717  126.100 122.340 1.00 232.56 ? 579  VAL C CG2   1 
ATOM   8081  N  N     . MET C 2 580  ? 92.942  126.241 119.005 1.00 226.77 ? 580  MET C N     1 
ATOM   8082  C  CA    . MET C 2 580  ? 93.672  127.048 118.049 1.00 226.77 ? 580  MET C CA    1 
ATOM   8083  C  C     . MET C 2 580  ? 93.303  128.506 118.231 1.00 226.77 ? 580  MET C C     1 
ATOM   8084  O  O     . MET C 2 580  ? 92.194  128.829 118.658 1.00 226.77 ? 580  MET C O     1 
ATOM   8085  C  CB    . MET C 2 580  ? 93.382  126.590 116.625 1.00 226.77 ? 580  MET C CB    1 
ATOM   8086  C  CG    . MET C 2 580  ? 94.205  125.390 116.225 1.00 226.77 ? 580  MET C CG    1 
ATOM   8087  S  SD    . MET C 2 580  ? 94.284  125.144 114.448 1.00 226.77 ? 580  MET C SD    1 
ATOM   8088  C  CE    . MET C 2 580  ? 92.587  125.477 113.998 1.00 226.77 ? 580  MET C CE    1 
ATOM   8089  N  N     . THR C 2 581  ? 94.256  129.382 117.941 1.00 239.45 ? 581  THR C N     1 
ATOM   8090  C  CA    . THR C 2 581  ? 93.963  130.804 117.987 1.00 239.45 ? 581  THR C CA    1 
ATOM   8091  C  C     . THR C 2 581  ? 93.213  131.239 116.745 1.00 239.45 ? 581  THR C C     1 
ATOM   8092  O  O     . THR C 2 581  ? 92.366  132.137 116.800 1.00 239.45 ? 581  THR C O     1 
ATOM   8093  C  CB    . THR C 2 581  ? 95.254  131.589 118.126 1.00 239.45 ? 581  THR C CB    1 
ATOM   8094  O  OG1   . THR C 2 581  ? 95.971  131.517 116.890 1.00 239.45 ? 581  THR C OG1   1 
ATOM   8095  C  CG2   . THR C 2 581  ? 96.089  130.989 119.226 1.00 239.45 ? 581  THR C CG2   1 
ATOM   8096  N  N     . GLY C 2 582  ? 93.507  130.606 115.616 1.00 253.40 ? 582  GLY C N     1 
ATOM   8097  C  CA    . GLY C 2 582  ? 93.014  131.047 114.329 1.00 253.40 ? 582  GLY C CA    1 
ATOM   8098  C  C     . GLY C 2 582  ? 94.076  131.672 113.459 1.00 253.40 ? 582  GLY C C     1 
ATOM   8099  O  O     . GLY C 2 582  ? 93.774  132.069 112.326 1.00 253.40 ? 582  GLY C O     1 
ATOM   8100  N  N     . LEU C 2 583  ? 95.311  131.778 113.930 1.00 249.26 ? 583  LEU C N     1 
ATOM   8101  C  CA    . LEU C 2 583  ? 96.361  132.425 113.166 1.00 249.26 ? 583  LEU C CA    1 
ATOM   8102  C  C     . LEU C 2 583  ? 97.207  131.427 112.400 1.00 249.26 ? 583  LEU C C     1 
ATOM   8103  O  O     . LEU C 2 583  ? 98.115  131.829 111.667 1.00 249.26 ? 583  LEU C O     1 
ATOM   8104  C  CB    . LEU C 2 583  ? 97.258  133.253 114.091 1.00 249.26 ? 583  LEU C CB    1 
ATOM   8105  C  CG    . LEU C 2 583  ? 96.727  134.618 114.542 1.00 249.26 ? 583  LEU C CG    1 
ATOM   8106  C  CD1   . LEU C 2 583  ? 96.265  135.398 113.336 1.00 249.26 ? 583  LEU C CD1   1 
ATOM   8107  C  CD2   . LEU C 2 583  ? 95.648  134.579 115.620 1.00 249.26 ? 583  LEU C CD2   1 
ATOM   8108  N  N     . GLU C 2 584  ? 96.898  130.144 112.541 1.00 245.27 ? 584  GLU C N     1 
ATOM   8109  C  CA    . GLU C 2 584  ? 97.726  129.052 112.065 1.00 245.27 ? 584  GLU C CA    1 
ATOM   8110  C  C     . GLU C 2 584  ? 97.754  128.961 110.550 1.00 245.27 ? 584  GLU C C     1 
ATOM   8111  O  O     . GLU C 2 584  ? 98.749  128.495 109.989 1.00 245.27 ? 584  GLU C O     1 
ATOM   8112  C  CB    . GLU C 2 584  ? 97.209  127.748 112.677 1.00 245.27 ? 584  GLU C CB    1 
ATOM   8113  C  CG    . GLU C 2 584  ? 97.120  127.767 114.214 1.00 245.27 ? 584  GLU C CG    1 
ATOM   8114  C  CD    . GLU C 2 584  ? 95.796  128.304 114.747 1.00 245.27 ? 584  GLU C CD    1 
ATOM   8115  O  OE1   . GLU C 2 584  ? 94.815  128.320 113.981 1.00 245.27 ? 584  GLU C OE1   1 
ATOM   8116  O  OE2   . GLU C 2 584  ? 95.745  128.738 115.917 1.00 245.27 ? 584  GLU C OE2   1 
ATOM   8117  N  N     . GLU C 2 585  ? 96.699  129.403 109.877 1.00 237.45 ? 585  GLU C N     1 
ATOM   8118  C  CA    . GLU C 2 585  ? 96.665  129.418 108.425 1.00 237.45 ? 585  GLU C CA    1 
ATOM   8119  C  C     . GLU C 2 585  ? 97.432  130.594 107.850 1.00 237.45 ? 585  GLU C C     1 
ATOM   8120  O  O     . GLU C 2 585  ? 98.095  130.460 106.821 1.00 237.45 ? 585  GLU C O     1 
ATOM   8121  C  CB    . GLU C 2 585  ? 95.217  129.456 107.945 1.00 237.45 ? 585  GLU C CB    1 
ATOM   8122  C  CG    . GLU C 2 585  ? 94.433  128.244 108.362 1.00 237.45 ? 585  GLU C CG    1 
ATOM   8123  C  CD    . GLU C 2 585  ? 92.982  128.554 108.619 1.00 237.45 ? 585  GLU C CD    1 
ATOM   8124  O  OE1   . GLU C 2 585  ? 92.708  129.493 109.393 1.00 237.45 ? 585  GLU C OE1   1 
ATOM   8125  O  OE2   . GLU C 2 585  ? 92.114  127.860 108.053 1.00 237.45 ? 585  GLU C OE2   1 
ATOM   8126  N  N     . ARG C 2 586  ? 97.359  131.745 108.514 1.00 223.96 ? 586  ARG C N     1 
ATOM   8127  C  CA    . ARG C 2 586  ? 98.041  132.932 108.021 1.00 223.96 ? 586  ARG C CA    1 
ATOM   8128  C  C     . ARG C 2 586  ? 99.551  132.781 108.099 1.00 223.96 ? 586  ARG C C     1 
ATOM   8129  O  O     . ARG C 2 586  ? 100.269 133.207 107.186 1.00 223.96 ? 586  ARG C O     1 
ATOM   8130  C  CB    . ARG C 2 586  ? 97.579  134.149 108.818 1.00 223.96 ? 586  ARG C CB    1 
ATOM   8131  C  CG    . ARG C 2 586  ? 98.294  135.439 108.480 1.00 223.96 ? 586  ARG C CG    1 
ATOM   8132  C  CD    . ARG C 2 586  ? 98.138  135.796 107.016 1.00 223.96 ? 586  ARG C CD    1 
ATOM   8133  N  NE    . ARG C 2 586  ? 99.011  136.903 106.650 1.00 223.96 ? 586  ARG C NE    1 
ATOM   8134  C  CZ    . ARG C 2 586  ? 98.590  138.144 106.449 1.00 223.96 ? 586  ARG C CZ    1 
ATOM   8135  N  NH1   . ARG C 2 586  ? 97.302  138.431 106.568 1.00 223.96 ? 586  ARG C NH1   1 
ATOM   8136  N  NH2   . ARG C 2 586  ? 99.451  139.092 106.120 1.00 223.96 ? 586  ARG C NH2   1 
ATOM   8137  N  N     . VAL C 2 587  ? 100.048 132.145 109.158 1.00 230.60 ? 587  VAL C N     1 
ATOM   8138  C  CA    . VAL C 2 587  ? 101.490 132.028 109.332 1.00 230.60 ? 587  VAL C CA    1 
ATOM   8139  C  C     . VAL C 2 587  ? 102.067 131.026 108.339 1.00 230.60 ? 587  VAL C C     1 
ATOM   8140  O  O     . VAL C 2 587  ? 103.148 131.236 107.779 1.00 230.60 ? 587  VAL C O     1 
ATOM   8141  C  CB    . VAL C 2 587  ? 101.824 131.686 110.798 1.00 230.60 ? 587  VAL C CB    1 
ATOM   8142  C  CG1   . VAL C 2 587  ? 101.112 130.430 111.274 1.00 230.60 ? 587  VAL C CG1   1 
ATOM   8143  C  CG2   . VAL C 2 587  ? 103.325 131.558 111.000 1.00 230.60 ? 587  VAL C CG2   1 
ATOM   8144  N  N     . VAL C 2 588  ? 101.323 129.961 108.044 1.00 240.07 ? 588  VAL C N     1 
ATOM   8145  C  CA    . VAL C 2 588  ? 101.821 129.012 107.061 1.00 240.07 ? 588  VAL C CA    1 
ATOM   8146  C  C     . VAL C 2 588  ? 101.618 129.570 105.660 1.00 240.07 ? 588  VAL C C     1 
ATOM   8147  O  O     . VAL C 2 588  ? 102.336 129.198 104.724 1.00 240.07 ? 588  VAL C O     1 
ATOM   8148  C  CB    . VAL C 2 588  ? 101.173 127.622 107.265 1.00 240.07 ? 588  VAL C CB    1 
ATOM   8149  C  CG1   . VAL C 2 588  ? 99.714  127.614 106.867 1.00 240.07 ? 588  VAL C CG1   1 
ATOM   8150  C  CG2   . VAL C 2 588  ? 101.946 126.532 106.522 1.00 240.07 ? 588  VAL C CG2   1 
ATOM   8151  N  N     . ARG C 2 589  ? 100.674 130.500 105.499 1.00 223.11 ? 589  ARG C N     1 
ATOM   8152  C  CA    . ARG C 2 589  ? 100.524 131.201 104.234 1.00 223.11 ? 589  ARG C CA    1 
ATOM   8153  C  C     . ARG C 2 589  ? 101.729 132.083 103.972 1.00 223.11 ? 589  ARG C C     1 
ATOM   8154  O  O     . ARG C 2 589  ? 102.339 132.037 102.900 1.00 223.11 ? 589  ARG C O     1 
ATOM   8155  C  CB    . ARG C 2 589  ? 99.248  132.034 104.255 1.00 223.11 ? 589  ARG C CB    1 
ATOM   8156  C  CG    . ARG C 2 589  ? 99.078  132.911 103.045 1.00 223.11 ? 589  ARG C CG    1 
ATOM   8157  C  CD    . ARG C 2 589  ? 98.721  132.069 101.845 1.00 223.11 ? 589  ARG C CD    1 
ATOM   8158  N  NE    . ARG C 2 589  ? 97.777  131.020 102.212 1.00 223.11 ? 589  ARG C NE    1 
ATOM   8159  C  CZ    . ARG C 2 589  ? 97.002  130.375 101.350 1.00 223.11 ? 589  ARG C CZ    1 
ATOM   8160  N  NH1   . ARG C 2 589  ? 97.040  130.680 100.060 1.00 223.11 ? 589  ARG C NH1   1 
ATOM   8161  N  NH2   . ARG C 2 589  ? 96.175  129.437 101.785 1.00 223.11 ? 589  ARG C NH2   1 
ATOM   8162  N  N     . ASP C 2 590  ? 102.109 132.866 104.969 1.00 229.78 ? 590  ASP C N     1 
ATOM   8163  C  CA    . ASP C 2 590  ? 103.251 133.749 104.819 1.00 229.78 ? 590  ASP C CA    1 
ATOM   8164  C  C     . ASP C 2 590  ? 104.570 133.024 104.983 1.00 229.78 ? 590  ASP C C     1 
ATOM   8165  O  O     . ASP C 2 590  ? 105.621 133.634 104.772 1.00 229.78 ? 590  ASP C O     1 
ATOM   8166  C  CB    . ASP C 2 590  ? 103.141 134.888 105.823 1.00 229.78 ? 590  ASP C CB    1 
ATOM   8167  C  CG    . ASP C 2 590  ? 101.811 135.600 105.730 1.00 229.78 ? 590  ASP C CG    1 
ATOM   8168  O  OD1   . ASP C 2 590  ? 101.159 135.494 104.671 1.00 229.78 ? 590  ASP C OD1   1 
ATOM   8169  O  OD2   . ASP C 2 590  ? 101.412 136.264 106.708 1.00 229.78 ? 590  ASP C OD2   1 
ATOM   8170  N  N     . SER C 2 591  ? 104.537 131.743 105.342 1.00 229.42 ? 591  SER C N     1 
ATOM   8171  C  CA    . SER C 2 591  ? 105.759 130.996 105.583 1.00 229.42 ? 591  SER C CA    1 
ATOM   8172  C  C     . SER C 2 591  ? 106.486 130.662 104.297 1.00 229.42 ? 591  SER C C     1 
ATOM   8173  O  O     . SER C 2 591  ? 107.716 130.551 104.300 1.00 229.42 ? 591  SER C O     1 
ATOM   8174  C  CB    . SER C 2 591  ? 105.440 129.683 106.279 1.00 229.42 ? 591  SER C CB    1 
ATOM   8175  O  OG    . SER C 2 591  ? 104.622 128.901 105.431 1.00 229.42 ? 591  SER C OG    1 
ATOM   8176  N  N     . LEU C 2 592  ? 105.733 130.474 103.213 1.00 232.05 ? 592  LEU C N     1 
ATOM   8177  C  CA    . LEU C 2 592  ? 106.148 129.842 101.963 1.00 232.05 ? 592  LEU C CA    1 
ATOM   8178  C  C     . LEU C 2 592  ? 106.700 128.439 102.168 1.00 232.05 ? 592  LEU C C     1 
ATOM   8179  O  O     . LEU C 2 592  ? 107.510 127.978 101.363 1.00 232.05 ? 592  LEU C O     1 
ATOM   8180  C  CB    . LEU C 2 592  ? 107.167 130.687 101.185 1.00 232.05 ? 592  LEU C CB    1 
ATOM   8181  C  CG    . LEU C 2 592  ? 106.910 132.188 101.155 1.00 232.05 ? 592  LEU C CG    1 
ATOM   8182  C  CD1   . LEU C 2 592  ? 108.057 132.890 100.467 1.00 232.05 ? 592  LEU C CD1   1 
ATOM   8183  C  CD2   . LEU C 2 592  ? 105.599 132.487 100.461 1.00 232.05 ? 592  LEU C CD2   1 
ATOM   8184  N  N     . ALA C 2 593  ? 106.284 127.742 103.225 1.00 247.56 ? 593  ALA C N     1 
ATOM   8185  C  CA    . ALA C 2 593  ? 106.729 126.368 103.416 1.00 247.56 ? 593  ALA C CA    1 
ATOM   8186  C  C     . ALA C 2 593  ? 105.837 125.405 102.650 1.00 247.56 ? 593  ALA C C     1 
ATOM   8187  O  O     . ALA C 2 593  ? 106.320 124.471 102.001 1.00 247.56 ? 593  ALA C O     1 
ATOM   8188  C  CB    . ALA C 2 593  ? 106.747 126.025 104.903 1.00 247.56 ? 593  ALA C CB    1 
ATOM   8189  N  N     . ALA C 2 594  ? 104.530 125.614 102.722 1.00 238.37 ? 594  ALA C N     1 
ATOM   8190  C  CA    . ALA C 2 594  ? 103.594 124.890 101.886 1.00 238.37 ? 594  ALA C CA    1 
ATOM   8191  C  C     . ALA C 2 594  ? 103.388 125.652 100.583 1.00 238.37 ? 594  ALA C C     1 
ATOM   8192  O  O     . ALA C 2 594  ? 103.921 126.745 100.381 1.00 238.37 ? 594  ALA C O     1 
ATOM   8193  C  CB    . ALA C 2 594  ? 102.275 124.685 102.623 1.00 238.37 ? 594  ALA C CB    1 
ATOM   8194  N  N     . LEU C 2 595  ? 102.604 125.079 99.682  1.00 199.72 ? 595  LEU C N     1 
ATOM   8195  C  CA    . LEU C 2 595  ? 102.313 125.767 98.441  1.00 199.72 ? 595  LEU C CA    1 
ATOM   8196  C  C     . LEU C 2 595  ? 100.843 125.628 98.104  1.00 199.72 ? 595  LEU C C     1 
ATOM   8197  O  O     . LEU C 2 595  ? 100.249 124.557 98.239  1.00 199.72 ? 595  LEU C O     1 
ATOM   8198  C  CB    . LEU C 2 595  ? 103.167 125.253 97.288  1.00 199.72 ? 595  LEU C CB    1 
ATOM   8199  C  CG    . LEU C 2 595  ? 103.274 126.224 96.110  1.00 199.72 ? 595  LEU C CG    1 
ATOM   8200  C  CD1   . LEU C 2 595  ? 103.428 127.668 96.572  1.00 199.72 ? 595  LEU C CD1   1 
ATOM   8201  C  CD2   . LEU C 2 595  ? 104.438 125.832 95.228  1.00 199.72 ? 595  LEU C CD2   1 
ATOM   8202  N  N     . TYR C 2 596  ? 100.275 126.727 97.634  1.00 204.88 ? 596  TYR C N     1 
ATOM   8203  C  CA    . TYR C 2 596  ? 98.851  126.839 97.402  1.00 204.88 ? 596  TYR C CA    1 
ATOM   8204  C  C     . TYR C 2 596  ? 98.582  127.051 95.926  1.00 204.88 ? 596  TYR C C     1 
ATOM   8205  O  O     . TYR C 2 596  ? 99.483  127.360 95.149  1.00 204.88 ? 596  TYR C O     1 
ATOM   8206  C  CB    . TYR C 2 596  ? 98.255  127.990 98.197  1.00 204.88 ? 596  TYR C CB    1 
ATOM   8207  C  CG    . TYR C 2 596  ? 98.734  128.009 99.614  1.00 204.88 ? 596  TYR C CG    1 
ATOM   8208  C  CD1   . TYR C 2 596  ? 98.158  127.180 100.555 1.00 204.88 ? 596  TYR C CD1   1 
ATOM   8209  C  CD2   . TYR C 2 596  ? 99.767  128.850 100.011 1.00 204.88 ? 596  TYR C CD2   1 
ATOM   8210  C  CE1   . TYR C 2 596  ? 98.584  127.188 101.849 1.00 204.88 ? 596  TYR C CE1   1 
ATOM   8211  C  CE2   . TYR C 2 596  ? 100.203 128.862 101.308 1.00 204.88 ? 596  TYR C CE2   1 
ATOM   8212  C  CZ    . TYR C 2 596  ? 99.604  128.030 102.221 1.00 204.88 ? 596  TYR C CZ    1 
ATOM   8213  O  OH    . TYR C 2 596  ? 100.026 128.025 103.521 1.00 204.88 ? 596  TYR C OH    1 
ATOM   8214  N  N     . ALA C 2 597  ? 97.331  126.860 95.541  1.00 223.07 ? 597  ALA C N     1 
ATOM   8215  C  CA    . ALA C 2 597  ? 96.943  127.147 94.169  1.00 223.07 ? 597  ALA C CA    1 
ATOM   8216  C  C     . ALA C 2 597  ? 96.713  128.640 94.034  1.00 223.07 ? 597  ALA C C     1 
ATOM   8217  O  O     . ALA C 2 597  ? 95.699  129.164 94.501  1.00 223.07 ? 597  ALA C O     1 
ATOM   8218  C  CB    . ALA C 2 597  ? 95.696  126.363 93.785  1.00 223.07 ? 597  ALA C CB    1 
ATOM   8219  N  N     . GLU C 2 598  ? 97.659  129.325 93.397  1.00 227.91 ? 598  GLU C N     1 
ATOM   8220  C  CA    . GLU C 2 598  ? 97.570  130.772 93.265  1.00 227.91 ? 598  GLU C CA    1 
ATOM   8221  C  C     . GLU C 2 598  ? 96.455  131.154 92.311  1.00 227.91 ? 598  GLU C C     1 
ATOM   8222  O  O     . GLU C 2 598  ? 95.708  132.105 92.549  1.00 227.91 ? 598  GLU C O     1 
ATOM   8223  C  CB    . GLU C 2 598  ? 98.906  131.327 92.780  1.00 227.91 ? 598  GLU C CB    1 
ATOM   8224  C  CG    . GLU C 2 598  ? 99.962  131.432 93.865  1.00 227.91 ? 598  GLU C CG    1 
ATOM   8225  C  CD    . GLU C 2 598  ? 100.558 130.091 94.232  1.00 227.91 ? 598  GLU C CD    1 
ATOM   8226  O  OE1   . GLU C 2 598  ? 100.703 129.243 93.325  1.00 227.91 ? 598  GLU C OE1   1 
ATOM   8227  O  OE2   . GLU C 2 598  ? 100.858 129.875 95.426  1.00 227.91 ? 598  GLU C OE2   1 
ATOM   8228  N  N     . GLU C 2 599  ? 96.308  130.396 91.241  1.00 242.37 ? 599  GLU C N     1 
ATOM   8229  C  CA    . GLU C 2 599  ? 95.274  130.636 90.257  1.00 242.37 ? 599  GLU C CA    1 
ATOM   8230  C  C     . GLU C 2 599  ? 94.298  129.473 90.308  1.00 242.37 ? 599  GLU C C     1 
ATOM   8231  O  O     . GLU C 2 599  ? 94.693  128.334 90.566  1.00 242.37 ? 599  GLU C O     1 
ATOM   8232  C  CB    . GLU C 2 599  ? 95.896  130.800 88.856  1.00 242.37 ? 599  GLU C CB    1 
ATOM   8233  C  CG    . GLU C 2 599  ? 94.936  130.761 87.685  1.00 242.37 ? 599  GLU C CG    1 
ATOM   8234  C  CD    . GLU C 2 599  ? 93.787  131.734 87.843  1.00 242.37 ? 599  GLU C CD    1 
ATOM   8235  O  OE1   . GLU C 2 599  ? 94.034  132.900 88.209  1.00 242.37 ? 599  GLU C OE1   1 
ATOM   8236  O  OE2   . GLU C 2 599  ? 92.626  131.315 87.653  1.00 242.37 ? 599  GLU C OE2   1 
ATOM   8237  N  N     . ASP C 2 600  ? 93.013  129.789 90.138  1.00 253.43 ? 600  ASP C N     1 
ATOM   8238  C  CA    . ASP C 2 600  ? 91.988  128.777 89.948  1.00 253.43 ? 600  ASP C CA    1 
ATOM   8239  C  C     . ASP C 2 600  ? 92.326  127.905 88.748  1.00 253.43 ? 600  ASP C C     1 
ATOM   8240  O  O     . ASP C 2 600  ? 92.717  128.396 87.686  1.00 253.43 ? 600  ASP C O     1 
ATOM   8241  C  CB    . ASP C 2 600  ? 90.637  129.444 89.721  1.00 253.43 ? 600  ASP C CB    1 
ATOM   8242  C  CG    . ASP C 2 600  ? 90.422  130.621 90.632  1.00 253.43 ? 600  ASP C CG    1 
ATOM   8243  O  OD1   . ASP C 2 600  ? 90.869  130.575 91.789  1.00 253.43 ? 600  ASP C OD1   1 
ATOM   8244  O  OD2   . ASP C 2 600  ? 89.813  131.606 90.177  1.00 253.43 ? 600  ASP C OD2   1 
ATOM   8245  N  N     . GLY C 2 601  ? 92.200  126.601 88.923  1.00 265.96 ? 601  GLY C N     1 
ATOM   8246  C  CA    . GLY C 2 601  ? 92.500  125.707 87.831  1.00 265.96 ? 601  GLY C CA    1 
ATOM   8247  C  C     . GLY C 2 601  ? 92.001  124.311 88.097  1.00 265.96 ? 601  GLY C C     1 
ATOM   8248  O  O     . GLY C 2 601  ? 91.063  124.102 88.867  1.00 265.96 ? 601  GLY C O     1 
ATOM   8249  N  N     . GLU C 2 602  ? 92.638  123.356 87.434  1.00 251.34 ? 602  GLU C N     1 
ATOM   8250  C  CA    . GLU C 2 602  ? 92.407  121.949 87.691  1.00 251.34 ? 602  GLU C CA    1 
ATOM   8251  C  C     . GLU C 2 602  ? 93.738  121.282 87.978  1.00 251.34 ? 602  GLU C C     1 
ATOM   8252  O  O     . GLU C 2 602  ? 94.787  121.731 87.522  1.00 251.34 ? 602  GLU C O     1 
ATOM   8253  C  CB    . GLU C 2 602  ? 91.732  121.259 86.515  1.00 251.34 ? 602  GLU C CB    1 
ATOM   8254  C  CG    . GLU C 2 602  ? 90.960  120.028 86.911  1.00 251.34 ? 602  GLU C CG    1 
ATOM   8255  C  CD    . GLU C 2 602  ? 90.634  119.172 85.728  1.00 251.34 ? 602  GLU C CD    1 
ATOM   8256  O  OE1   . GLU C 2 602  ? 91.130  119.480 84.626  1.00 251.34 ? 602  GLU C OE1   1 
ATOM   8257  O  OE2   . GLU C 2 602  ? 89.885  118.190 85.892  1.00 251.34 ? 602  GLU C OE2   1 
ATOM   8258  N  N     . VAL C 2 603  ? 93.706  120.202 88.736  1.00 243.75 ? 603  VAL C N     1 
ATOM   8259  C  CA    . VAL C 2 603  ? 94.928  119.447 88.948  1.00 243.75 ? 603  VAL C CA    1 
ATOM   8260  C  C     . VAL C 2 603  ? 95.241  118.667 87.686  1.00 243.75 ? 603  VAL C C     1 
ATOM   8261  O  O     . VAL C 2 603  ? 94.430  117.859 87.224  1.00 243.75 ? 603  VAL C O     1 
ATOM   8262  C  CB    . VAL C 2 603  ? 94.800  118.512 90.150  1.00 243.75 ? 603  VAL C CB    1 
ATOM   8263  C  CG1   . VAL C 2 603  ? 96.007  117.627 90.189  1.00 243.75 ? 603  VAL C CG1   1 
ATOM   8264  C  CG2   . VAL C 2 603  ? 94.721  119.315 91.416  1.00 243.75 ? 603  VAL C CG2   1 
ATOM   8265  N  N     . ALA C 2 604  ? 96.411  118.918 87.114  1.00 224.87 ? 604  ALA C N     1 
ATOM   8266  C  CA    . ALA C 2 604  ? 96.818  118.139 85.957  1.00 224.87 ? 604  ALA C CA    1 
ATOM   8267  C  C     . ALA C 2 604  ? 97.421  116.801 86.374  1.00 224.87 ? 604  ALA C C     1 
ATOM   8268  O  O     . ALA C 2 604  ? 96.854  115.744 86.086  1.00 224.87 ? 604  ALA C O     1 
ATOM   8269  C  CB    . ALA C 2 604  ? 97.801  118.946 85.106  1.00 224.87 ? 604  ALA C CB    1 
ATOM   8270  N  N     . LYS C 2 605  ? 98.559  116.828 87.064  1.00 228.39 ? 605  LYS C N     1 
ATOM   8271  C  CA    . LYS C 2 605  ? 99.274  115.599 87.380  1.00 228.39 ? 605  LYS C CA    1 
ATOM   8272  C  C     . LYS C 2 605  ? 99.886  115.693 88.766  1.00 228.39 ? 605  LYS C C     1 
ATOM   8273  O  O     . LYS C 2 605  ? 100.434 116.734 89.140  1.00 228.39 ? 605  LYS C O     1 
ATOM   8274  C  CB    . LYS C 2 605  ? 100.385 115.316 86.366  1.00 228.39 ? 605  LYS C CB    1 
ATOM   8275  C  CG    . LYS C 2 605  ? 99.908  114.841 85.019  1.00 228.39 ? 605  LYS C CG    1 
ATOM   8276  C  CD    . LYS C 2 605  ? 101.067 114.715 84.071  1.00 228.39 ? 605  LYS C CD    1 
ATOM   8277  C  CE    . LYS C 2 605  ? 101.744 113.379 84.253  1.00 228.39 ? 605  LYS C CE    1 
ATOM   8278  N  NZ    . LYS C 2 605  ? 102.945 113.267 83.391  1.00 228.39 ? 605  LYS C NZ    1 
ATOM   8279  N  N     . VAL C 2 606  ? 99.806  114.601 89.518  1.00 241.70 ? 606  VAL C N     1 
ATOM   8280  C  CA    . VAL C 2 606  ? 100.410 114.522 90.846  1.00 241.70 ? 606  VAL C CA    1 
ATOM   8281  C  C     . VAL C 2 606  ? 101.385 113.353 90.838  1.00 241.70 ? 606  VAL C C     1 
ATOM   8282  O  O     . VAL C 2 606  ? 101.012 112.190 91.011  1.00 241.70 ? 606  VAL C O     1 
ATOM   8283  C  CB    . VAL C 2 606  ? 99.381  114.372 91.968  1.00 241.70 ? 606  VAL C CB    1 
ATOM   8284  C  CG1   . VAL C 2 606  ? 100.085 114.329 93.302  1.00 241.70 ? 606  VAL C CG1   1 
ATOM   8285  C  CG2   . VAL C 2 606  ? 98.415  115.518 91.959  1.00 241.70 ? 606  VAL C CG2   1 
ATOM   8286  N  N     . ASP C 2 607  ? 102.654 113.663 90.641  1.00 260.86 ? 607  ASP C N     1 
ATOM   8287  C  CA    . ASP C 2 607  ? 103.736 112.768 91.001  1.00 260.86 ? 607  ASP C CA    1 
ATOM   8288  C  C     . ASP C 2 607  ? 104.357 113.302 92.279  1.00 260.86 ? 607  ASP C C     1 
ATOM   8289  O  O     . ASP C 2 607  ? 104.339 114.509 92.525  1.00 260.86 ? 607  ASP C O     1 
ATOM   8290  C  CB    . ASP C 2 607  ? 104.782 112.690 89.891  1.00 260.86 ? 607  ASP C CB    1 
ATOM   8291  C  CG    . ASP C 2 607  ? 105.859 111.669 90.170  1.00 260.86 ? 607  ASP C CG    1 
ATOM   8292  O  OD1   . ASP C 2 607  ? 105.644 110.801 91.043  1.00 260.86 ? 607  ASP C OD1   1 
ATOM   8293  O  OD2   . ASP C 2 607  ? 106.923 111.743 89.523  1.00 260.86 ? 607  ASP C OD2   1 
ATOM   8294  N  N     . GLY C 2 608  ? 104.940 112.411 93.076  1.00 259.79 ? 608  GLY C N     1 
ATOM   8295  C  CA    . GLY C 2 608  ? 105.541 112.814 94.333  1.00 259.79 ? 608  GLY C CA    1 
ATOM   8296  C  C     . GLY C 2 608  ? 106.820 113.621 94.228  1.00 259.79 ? 608  GLY C C     1 
ATOM   8297  O  O     . GLY C 2 608  ? 107.425 113.963 95.246  1.00 259.79 ? 608  GLY C O     1 
ATOM   8298  N  N     . ASN C 2 609  ? 107.249 113.933 93.009  1.00 241.76 ? 609  ASN C N     1 
ATOM   8299  C  CA    . ASN C 2 609  ? 108.485 114.649 92.779  1.00 241.76 ? 609  ASN C CA    1 
ATOM   8300  C  C     . ASN C 2 609  ? 108.287 115.987 92.091  1.00 241.76 ? 609  ASN C C     1 
ATOM   8301  O  O     . ASN C 2 609  ? 109.195 116.824 92.142  1.00 241.76 ? 609  ASN C O     1 
ATOM   8302  C  CB    . ASN C 2 609  ? 109.432 113.788 91.935  1.00 241.76 ? 609  ASN C CB    1 
ATOM   8303  C  CG    . ASN C 2 609  ? 109.476 112.350 92.408  1.00 241.76 ? 609  ASN C CG    1 
ATOM   8304  O  OD1   . ASN C 2 609  ? 109.392 112.081 93.600  1.00 241.76 ? 609  ASN C OD1   1 
ATOM   8305  N  ND2   . ASN C 2 609  ? 109.593 111.417 91.471  1.00 241.76 ? 609  ASN C ND2   1 
ATOM   8306  N  N     . ARG C 2 610  ? 107.132 116.211 91.469  1.00 255.79 ? 610  ARG C N     1 
ATOM   8307  C  CA    . ARG C 2 610  ? 106.841 117.394 90.673  1.00 255.79 ? 610  ARG C CA    1 
ATOM   8308  C  C     . ARG C 2 610  ? 105.348 117.384 90.362  1.00 255.79 ? 610  ARG C C     1 
ATOM   8309  O  O     . ARG C 2 610  ? 104.727 116.318 90.310  1.00 255.79 ? 610  ARG C O     1 
ATOM   8310  C  CB    . ARG C 2 610  ? 107.698 117.423 89.393  1.00 255.79 ? 610  ARG C CB    1 
ATOM   8311  C  CG    . ARG C 2 610  ? 107.109 116.759 88.170  1.00 255.79 ? 610  ARG C CG    1 
ATOM   8312  C  CD    . ARG C 2 610  ? 107.054 115.240 88.280  1.00 255.79 ? 610  ARG C CD    1 
ATOM   8313  N  NE    . ARG C 2 610  ? 106.384 114.654 87.129  1.00 255.79 ? 610  ARG C NE    1 
ATOM   8314  C  CZ    . ARG C 2 610  ? 105.068 114.659 86.936  1.00 255.79 ? 610  ARG C CZ    1 
ATOM   8315  N  NH1   . ARG C 2 610  ? 104.241 115.217 87.813  1.00 255.79 ? 610  ARG C NH1   1 
ATOM   8316  N  NH2   . ARG C 2 610  ? 104.575 114.095 85.851  1.00 255.79 ? 610  ARG C NH2   1 
ATOM   8317  N  N     . ILE C 2 611  ? 104.767 118.569 90.193  1.00 257.70 ? 611  ILE C N     1 
ATOM   8318  C  CA    . ILE C 2 611  ? 103.315 118.707 90.116  1.00 257.70 ? 611  ILE C CA    1 
ATOM   8319  C  C     . ILE C 2 611  ? 102.945 119.542 88.903  1.00 257.70 ? 611  ILE C C     1 
ATOM   8320  O  O     . ILE C 2 611  ? 103.237 120.741 88.864  1.00 257.70 ? 611  ILE C O     1 
ATOM   8321  C  CB    . ILE C 2 611  ? 102.726 119.359 91.374  1.00 257.70 ? 611  ILE C CB    1 
ATOM   8322  C  CG1   . ILE C 2 611  ? 102.985 118.505 92.604  1.00 257.70 ? 611  ILE C CG1   1 
ATOM   8323  C  CG2   . ILE C 2 611  ? 101.238 119.557 91.198  1.00 257.70 ? 611  ILE C CG2   1 
ATOM   8324  C  CD1   . ILE C 2 611  ? 102.383 117.158 92.515  1.00 257.70 ? 611  ILE C CD1   1 
ATOM   8325  N  N     . VAL C 2 612  ? 102.261 118.944 87.961  1.00 246.73 ? 612  VAL C N     1 
ATOM   8326  C  CA    . VAL C 2 612  ? 101.701 119.701 86.851  1.00 246.73 ? 612  VAL C CA    1 
ATOM   8327  C  C     . VAL C 2 612  ? 100.334 120.190 87.292  1.00 246.73 ? 612  VAL C C     1 
ATOM   8328  O  O     . VAL C 2 612  ? 99.577  119.451 87.927  1.00 246.73 ? 612  VAL C O     1 
ATOM   8329  C  CB    . VAL C 2 612  ? 101.583 118.846 85.573  1.00 246.73 ? 612  VAL C CB    1 
ATOM   8330  C  CG1   . VAL C 2 612  ? 101.330 119.733 84.374  1.00 246.73 ? 612  VAL C CG1   1 
ATOM   8331  C  CG2   . VAL C 2 612  ? 102.785 117.955 85.378  1.00 246.73 ? 612  VAL C CG2   1 
ATOM   8332  N  N     . VAL C 2 613  ? 99.991  121.430 86.963  1.00 242.22 ? 613  VAL C N     1 
ATOM   8333  C  CA    . VAL C 2 613  ? 98.666  121.943 87.282  1.00 242.22 ? 613  VAL C CA    1 
ATOM   8334  C  C     . VAL C 2 613  ? 98.050  122.553 86.029  1.00 242.22 ? 613  VAL C C     1 
ATOM   8335  O  O     . VAL C 2 613  ? 98.722  123.257 85.266  1.00 242.22 ? 613  VAL C O     1 
ATOM   8336  C  CB    . VAL C 2 613  ? 98.696  122.933 88.471  1.00 242.22 ? 613  VAL C CB    1 
ATOM   8337  C  CG1   . VAL C 2 613  ? 99.534  124.170 88.209  1.00 242.22 ? 613  VAL C CG1   1 
ATOM   8338  C  CG2   . VAL C 2 613  ? 97.292  123.334 88.876  1.00 242.22 ? 613  VAL C CG2   1 
ATOM   8339  N  N     . ARG C 2 614  ? 96.789  122.210 85.782  1.00 244.01 ? 614  ARG C N     1 
ATOM   8340  C  CA    . ARG C 2 614  ? 96.018  122.737 84.663  1.00 244.01 ? 614  ARG C CA    1 
ATOM   8341  C  C     . ARG C 2 614  ? 95.395  124.054 85.088  1.00 244.01 ? 614  ARG C C     1 
ATOM   8342  O  O     . ARG C 2 614  ? 94.590  124.099 86.015  1.00 244.01 ? 614  ARG C O     1 
ATOM   8343  C  CB    . ARG C 2 614  ? 94.937  121.746 84.242  1.00 244.01 ? 614  ARG C CB    1 
ATOM   8344  C  CG    . ARG C 2 614  ? 93.816  122.351 83.401  1.00 244.01 ? 614  ARG C CG    1 
ATOM   8345  C  CD    . ARG C 2 614  ? 94.147  122.310 81.930  1.00 244.01 ? 614  ARG C CD    1 
ATOM   8346  N  NE    . ARG C 2 614  ? 95.111  123.336 81.556  1.00 244.01 ? 614  ARG C NE    1 
ATOM   8347  C  CZ    . ARG C 2 614  ? 96.046  123.155 80.635  1.00 244.01 ? 614  ARG C CZ    1 
ATOM   8348  N  NH1   . ARG C 2 614  ? 96.901  124.117 80.357  1.00 244.01 ? 614  ARG C NH1   1 
ATOM   8349  N  NH2   . ARG C 2 614  ? 96.132  121.996 80.001  1.00 244.01 ? 614  ARG C NH2   1 
ATOM   8350  N  N     . TYR C 2 615  ? 95.767  125.143 84.434  1.00 245.19 ? 615  TYR C N     1 
ATOM   8351  C  CA    . TYR C 2 615  ? 95.072  126.382 84.728  1.00 245.19 ? 615  TYR C CA    1 
ATOM   8352  C  C     . TYR C 2 615  ? 93.859  126.560 83.831  1.00 245.19 ? 615  TYR C C     1 
ATOM   8353  O  O     . TYR C 2 615  ? 93.759  125.969 82.754  1.00 245.19 ? 615  TYR C O     1 
ATOM   8354  C  CB    . TYR C 2 615  ? 96.009  127.574 84.607  1.00 245.19 ? 615  TYR C CB    1 
ATOM   8355  C  CG    . TYR C 2 615  ? 96.845  127.777 85.843  1.00 245.19 ? 615  TYR C CG    1 
ATOM   8356  C  CD1   . TYR C 2 615  ? 96.523  127.133 87.032  1.00 245.19 ? 615  TYR C CD1   1 
ATOM   8357  C  CD2   . TYR C 2 615  ? 97.938  128.630 85.835  1.00 245.19 ? 615  TYR C CD2   1 
ATOM   8358  C  CE1   . TYR C 2 615  ? 97.275  127.321 88.169  1.00 245.19 ? 615  TYR C CE1   1 
ATOM   8359  C  CE2   . TYR C 2 615  ? 98.690  128.836 86.969  1.00 245.19 ? 615  TYR C CE2   1 
ATOM   8360  C  CZ    . TYR C 2 615  ? 98.355  128.177 88.132  1.00 245.19 ? 615  TYR C CZ    1 
ATOM   8361  O  OH    . TYR C 2 615  ? 99.115  128.372 89.261  1.00 245.19 ? 615  TYR C OH    1 
ATOM   8362  N  N     . GLU C 2 616  ? 92.925  127.384 84.310  1.00 282.03 ? 616  GLU C N     1 
ATOM   8363  C  CA    . GLU C 2 616  ? 91.702  127.652 83.564  1.00 282.03 ? 616  GLU C CA    1 
ATOM   8364  C  C     . GLU C 2 616  ? 91.991  128.469 82.318  1.00 282.03 ? 616  GLU C C     1 
ATOM   8365  O  O     . GLU C 2 616  ? 91.299  128.334 81.302  1.00 282.03 ? 616  GLU C O     1 
ATOM   8366  C  CB    . GLU C 2 616  ? 90.702  128.390 84.449  1.00 282.03 ? 616  GLU C CB    1 
ATOM   8367  C  CG    . GLU C 2 616  ? 90.271  127.629 85.676  1.00 282.03 ? 616  GLU C CG    1 
ATOM   8368  C  CD    . GLU C 2 616  ? 89.558  126.339 85.350  1.00 282.03 ? 616  GLU C CD    1 
ATOM   8369  O  OE1   . GLU C 2 616  ? 88.711  126.351 84.437  1.00 282.03 ? 616  GLU C OE1   1 
ATOM   8370  O  OE2   . GLU C 2 616  ? 89.829  125.316 86.010  1.00 282.03 ? 616  GLU C OE2   1 
ATOM   8371  N  N     . ASP C 2 617  ? 93.001  129.337 82.388  1.00 282.82 ? 617  ASP C N     1 
ATOM   8372  C  CA    . ASP C 2 617  ? 93.471  130.064 81.218  1.00 282.82 ? 617  ASP C CA    1 
ATOM   8373  C  C     . ASP C 2 617  ? 93.998  129.135 80.141  1.00 282.82 ? 617  ASP C C     1 
ATOM   8374  O  O     . ASP C 2 617  ? 93.846  129.424 78.950  1.00 282.82 ? 617  ASP C O     1 
ATOM   8375  C  CB    . ASP C 2 617  ? 94.565  131.048 81.629  1.00 282.82 ? 617  ASP C CB    1 
ATOM   8376  C  CG    . ASP C 2 617  ? 95.231  131.709 80.442  1.00 282.82 ? 617  ASP C CG    1 
ATOM   8377  O  OD1   . ASP C 2 617  ? 94.585  132.557 79.793  1.00 282.82 ? 617  ASP C OD1   1 
ATOM   8378  O  OD2   . ASP C 2 617  ? 96.397  131.371 80.153  1.00 282.82 ? 617  ASP C OD2   1 
ATOM   8379  N  N     . GLY C 2 618  ? 94.584  128.014 80.528  1.00 269.55 ? 618  GLY C N     1 
ATOM   8380  C  CA    . GLY C 2 618  ? 95.228  127.133 79.592  1.00 269.55 ? 618  GLY C CA    1 
ATOM   8381  C  C     . GLY C 2 618  ? 96.728  127.127 79.709  1.00 269.55 ? 618  GLY C C     1 
ATOM   8382  O  O     . GLY C 2 618  ? 97.380  126.304 79.057  1.00 269.55 ? 618  GLY C O     1 
ATOM   8383  N  N     . ARG C 2 619  ? 97.293  127.998 80.535  1.00 261.55 ? 619  ARG C N     1 
ATOM   8384  C  CA    . ARG C 2 619  ? 98.717  127.924 80.798  1.00 261.55 ? 619  ARG C CA    1 
ATOM   8385  C  C     . ARG C 2 619  ? 98.998  126.721 81.690  1.00 261.55 ? 619  ARG C C     1 
ATOM   8386  O  O     . ARG C 2 619  ? 98.683  126.710 82.884  1.00 261.55 ? 619  ARG C O     1 
ATOM   8387  C  CB    . ARG C 2 619  ? 99.217  129.240 81.398  1.00 261.55 ? 619  ARG C CB    1 
ATOM   8388  C  CG    . ARG C 2 619  ? 98.334  129.842 82.472  1.00 261.55 ? 619  ARG C CG    1 
ATOM   8389  C  CD    . ARG C 2 619  ? 98.814  131.223 82.840  1.00 261.55 ? 619  ARG C CD    1 
ATOM   8390  N  NE    . ARG C 2 619  ? 98.717  131.466 84.275  1.00 261.55 ? 619  ARG C NE    1 
ATOM   8391  C  CZ    . ARG C 2 619  ? 97.614  131.837 84.917  1.00 261.55 ? 619  ARG C CZ    1 
ATOM   8392  N  NH1   . ARG C 2 619  ? 97.658  132.022 86.227  1.00 261.55 ? 619  ARG C NH1   1 
ATOM   8393  N  NH2   . ARG C 2 619  ? 96.472  132.002 84.266  1.00 261.55 ? 619  ARG C NH2   1 
ATOM   8394  N  N     . LEU C 2 620  ? 99.542  125.673 81.091  1.00 250.77 ? 620  LEU C N     1 
ATOM   8395  C  CA    . LEU C 2 620  ? 99.906  124.496 81.859  1.00 250.77 ? 620  LEU C CA    1 
ATOM   8396  C  C     . LEU C 2 620  ? 101.138 124.796 82.696  1.00 250.77 ? 620  LEU C C     1 
ATOM   8397  O  O     . LEU C 2 620  ? 102.172 125.216 82.171  1.00 250.77 ? 620  LEU C O     1 
ATOM   8398  C  CB    . LEU C 2 620  ? 100.164 123.326 80.920  1.00 250.77 ? 620  LEU C CB    1 
ATOM   8399  C  CG    . LEU C 2 620  ? 100.164 121.954 81.578  1.00 250.77 ? 620  LEU C CG    1 
ATOM   8400  C  CD1   . LEU C 2 620  ? 98.868  121.734 82.336  1.00 250.77 ? 620  LEU C CD1   1 
ATOM   8401  C  CD2   . LEU C 2 620  ? 100.363 120.885 80.523  1.00 250.77 ? 620  LEU C CD2   1 
ATOM   8402  N  N     . VAL C 2 621  ? 101.021 124.606 84.006  1.00 242.52 ? 621  VAL C N     1 
ATOM   8403  C  CA    . VAL C 2 621  ? 102.063 125.023 84.930  1.00 242.52 ? 621  VAL C CA    1 
ATOM   8404  C  C     . VAL C 2 621  ? 102.551 123.814 85.718  1.00 242.52 ? 621  VAL C C     1 
ATOM   8405  O  O     . VAL C 2 621  ? 101.764 122.984 86.181  1.00 242.52 ? 621  VAL C O     1 
ATOM   8406  C  CB    . VAL C 2 621  ? 101.548 126.160 85.846  1.00 242.52 ? 621  VAL C CB    1 
ATOM   8407  C  CG1   . VAL C 2 621  ? 102.476 126.415 87.016  1.00 242.52 ? 621  VAL C CG1   1 
ATOM   8408  C  CG2   . VAL C 2 621  ? 101.375 127.427 85.038  1.00 242.52 ? 621  VAL C CG2   1 
ATOM   8409  N  N     . GLU C 2 622  ? 103.871 123.698 85.824  1.00 259.36 ? 622  GLU C N     1 
ATOM   8410  C  CA    . GLU C 2 622  ? 104.513 122.641 86.581  1.00 259.36 ? 622  GLU C CA    1 
ATOM   8411  C  C     . GLU C 2 622  ? 105.073 123.214 87.875  1.00 259.36 ? 622  GLU C C     1 
ATOM   8412  O  O     . GLU C 2 622  ? 105.765 124.234 87.871  1.00 259.36 ? 622  GLU C O     1 
ATOM   8413  C  CB    . GLU C 2 622  ? 105.629 121.986 85.767  1.00 259.36 ? 622  GLU C CB    1 
ATOM   8414  C  CG    . GLU C 2 622  ? 106.632 121.229 86.605  1.00 259.36 ? 622  GLU C CG    1 
ATOM   8415  C  CD    . GLU C 2 622  ? 106.022 120.014 87.245  1.00 259.36 ? 622  GLU C CD    1 
ATOM   8416  O  OE1   . GLU C 2 622  ? 105.553 119.132 86.512  1.00 259.36 ? 622  GLU C OE1   1 
ATOM   8417  O  OE2   . GLU C 2 622  ? 105.978 119.952 88.478  1.00 259.36 ? 622  GLU C OE2   1 
ATOM   8418  N  N     . TYR C 2 623  ? 104.768 122.553 88.984  1.00 259.84 ? 623  TYR C N     1 
ATOM   8419  C  CA    . TYR C 2 623  ? 105.302 122.935 90.289  1.00 259.84 ? 623  TYR C CA    1 
ATOM   8420  C  C     . TYR C 2 623  ? 106.239 121.849 90.789  1.00 259.84 ? 623  TYR C C     1 
ATOM   8421  O  O     . TYR C 2 623  ? 105.761 120.793 91.254  1.00 259.84 ? 623  TYR C O     1 
ATOM   8422  C  CB    . TYR C 2 623  ? 104.177 123.176 91.285  1.00 259.84 ? 623  TYR C CB    1 
ATOM   8423  C  CG    . TYR C 2 623  ? 103.572 124.547 91.177  1.00 259.84 ? 623  TYR C CG    1 
ATOM   8424  C  CD1   . TYR C 2 623  ? 104.266 125.666 91.618  1.00 259.84 ? 623  TYR C CD1   1 
ATOM   8425  C  CD2   . TYR C 2 623  ? 102.307 124.727 90.640  1.00 259.84 ? 623  TYR C CD2   1 
ATOM   8426  C  CE1   . TYR C 2 623  ? 103.715 126.928 91.527  1.00 259.84 ? 623  TYR C CE1   1 
ATOM   8427  C  CE2   . TYR C 2 623  ? 101.745 125.985 90.545  1.00 259.84 ? 623  TYR C CE2   1 
ATOM   8428  C  CZ    . TYR C 2 623  ? 102.454 127.081 90.991  1.00 259.84 ? 623  TYR C CZ    1 
ATOM   8429  O  OH    . TYR C 2 623  ? 101.898 128.335 90.896  1.00 259.84 ? 623  TYR C OH    1 
ATOM   8430  N  N     . PRO C 2 624  ? 107.550 122.036 90.684  1.00 262.95 ? 624  PRO C N     1 
ATOM   8431  C  CA    . PRO C 2 624  ? 108.485 121.009 91.149  1.00 262.95 ? 624  PRO C CA    1 
ATOM   8432  C  C     . PRO C 2 624  ? 108.499 120.924 92.664  1.00 262.95 ? 624  PRO C C     1 
ATOM   8433  O  O     . PRO C 2 624  ? 108.215 121.889 93.374  1.00 262.95 ? 624  PRO C O     1 
ATOM   8434  C  CB    . PRO C 2 624  ? 109.832 121.491 90.611  1.00 262.95 ? 624  PRO C CB    1 
ATOM   8435  C  CG    . PRO C 2 624  ? 109.675 122.968 90.523  1.00 262.95 ? 624  PRO C CG    1 
ATOM   8436  C  CD    . PRO C 2 624  ? 108.246 123.212 90.137  1.00 262.95 ? 624  PRO C CD    1 
ATOM   8437  N  N     . LEU C 2 625  ? 108.838 119.742 93.159  1.00 281.34 ? 625  LEU C N     1 
ATOM   8438  C  CA    . LEU C 2 625  ? 108.750 119.442 94.582  1.00 281.34 ? 625  LEU C CA    1 
ATOM   8439  C  C     . LEU C 2 625  ? 110.148 119.317 95.167  1.00 281.34 ? 625  LEU C C     1 
ATOM   8440  O  O     . LEU C 2 625  ? 110.902 118.413 94.796  1.00 281.34 ? 625  LEU C O     1 
ATOM   8441  C  CB    . LEU C 2 625  ? 107.957 118.163 94.811  1.00 281.34 ? 625  LEU C CB    1 
ATOM   8442  C  CG    . LEU C 2 625  ? 106.499 118.192 94.380  1.00 281.34 ? 625  LEU C CG    1 
ATOM   8443  C  CD1   . LEU C 2 625  ? 105.795 116.969 94.924  1.00 281.34 ? 625  LEU C CD1   1 
ATOM   8444  C  CD2   . LEU C 2 625  ? 105.828 119.461 94.868  1.00 281.34 ? 625  LEU C CD2   1 
ATOM   8445  N  N     . ARG C 2 626  ? 110.488 120.216 96.083  1.00 287.83 ? 626  ARG C N     1 
ATOM   8446  C  CA    . ARG C 2 626  ? 111.719 120.066 96.844  1.00 287.83 ? 626  ARG C CA    1 
ATOM   8447  C  C     . ARG C 2 626  ? 111.516 118.981 97.888  1.00 287.83 ? 626  ARG C C     1 
ATOM   8448  O  O     . ARG C 2 626  ? 110.680 119.121 98.784  1.00 287.83 ? 626  ARG C O     1 
ATOM   8449  C  CB    . ARG C 2 626  ? 112.117 121.380 97.499  1.00 287.83 ? 626  ARG C CB    1 
ATOM   8450  C  CG    . ARG C 2 626  ? 113.364 121.249 98.334  1.00 287.83 ? 626  ARG C CG    1 
ATOM   8451  C  CD    . ARG C 2 626  ? 114.522 120.783 97.473  1.00 287.83 ? 626  ARG C CD    1 
ATOM   8452  N  NE    . ARG C 2 626  ? 115.597 120.187 98.255  1.00 287.83 ? 626  ARG C NE    1 
ATOM   8453  C  CZ    . ARG C 2 626  ? 115.939 118.908 98.207  1.00 287.83 ? 626  ARG C CZ    1 
ATOM   8454  N  NH1   . ARG C 2 626  ? 115.284 118.078 97.414  1.00 287.83 ? 626  ARG C NH1   1 
ATOM   8455  N  NH2   . ARG C 2 626  ? 116.931 118.452 98.955  1.00 287.83 ? 626  ARG C NH2   1 
ATOM   8456  N  N     . ARG C 2 627  ? 112.271 117.897 97.771  1.00 288.54 ? 627  ARG C N     1 
ATOM   8457  C  CA    . ARG C 2 627  ? 112.089 116.715 98.599  1.00 288.54 ? 627  ARG C CA    1 
ATOM   8458  C  C     . ARG C 2 627  ? 113.251 116.547 99.558  1.00 288.54 ? 627  ARG C C     1 
ATOM   8459  O  O     . ARG C 2 627  ? 114.401 116.443 99.120  1.00 288.54 ? 627  ARG C O     1 
ATOM   8460  C  CB    . ARG C 2 627  ? 111.959 115.460 97.737  1.00 288.54 ? 627  ARG C CB    1 
ATOM   8461  C  CG    . ARG C 2 627  ? 110.625 115.301 97.059  1.00 288.54 ? 627  ARG C CG    1 
ATOM   8462  C  CD    . ARG C 2 627  ? 109.485 115.514 98.025  1.00 288.54 ? 627  ARG C CD    1 
ATOM   8463  N  NE    . ARG C 2 627  ? 108.851 116.799 97.773  1.00 288.54 ? 627  ARG C NE    1 
ATOM   8464  C  CZ    . ARG C 2 627  ? 107.740 117.210 98.360  1.00 288.54 ? 627  ARG C CZ    1 
ATOM   8465  N  NH1   . ARG C 2 627  ? 107.120 116.435 99.239  1.00 288.54 ? 627  ARG C NH1   1 
ATOM   8466  N  NH2   . ARG C 2 627  ? 107.244 118.397 98.057  1.00 288.54 ? 627  ARG C NH2   1 
ATOM   8467  N  N     . PHE C 2 628  ? 112.927 116.464 100.854 1.00 263.33 ? 628  PHE C N     1 
ATOM   8468  C  CA    . PHE C 2 628  ? 113.878 116.156 101.927 1.00 263.33 ? 628  PHE C CA    1 
ATOM   8469  C  C     . PHE C 2 628  ? 115.026 117.156 101.955 1.00 263.33 ? 628  PHE C C     1 
ATOM   8470  O  O     . PHE C 2 628  ? 116.198 116.781 101.997 1.00 263.33 ? 628  PHE C O     1 
ATOM   8471  C  CB    . PHE C 2 628  ? 114.401 114.723 101.817 1.00 263.33 ? 628  PHE C CB    1 
ATOM   8472  C  CG    . PHE C 2 628  ? 113.329 113.706 101.575 1.00 263.33 ? 628  PHE C CG    1 
ATOM   8473  C  CD1   . PHE C 2 628  ? 112.588 113.202 102.627 1.00 263.33 ? 628  PHE C CD1   1 
ATOM   8474  C  CD2   . PHE C 2 628  ? 113.070 113.242 100.299 1.00 263.33 ? 628  PHE C CD2   1 
ATOM   8475  C  CE1   . PHE C 2 628  ? 111.603 112.261 102.412 1.00 263.33 ? 628  PHE C CE1   1 
ATOM   8476  C  CE2   . PHE C 2 628  ? 112.080 112.311 100.073 1.00 263.33 ? 628  PHE C CE2   1 
ATOM   8477  C  CZ    . PHE C 2 628  ? 111.349 111.815 101.132 1.00 263.33 ? 628  PHE C CZ    1 
ATOM   8478  N  N     . TYR C 2 629  ? 114.677 118.436 101.880 1.00 290.57 ? 629  TYR C N     1 
ATOM   8479  C  CA    . TYR C 2 629  ? 115.674 119.495 101.912 1.00 290.57 ? 629  TYR C CA    1 
ATOM   8480  C  C     . TYR C 2 629  ? 116.356 119.521 103.268 1.00 290.57 ? 629  TYR C C     1 
ATOM   8481  O  O     . TYR C 2 629  ? 115.697 119.607 104.306 1.00 290.57 ? 629  TYR C O     1 
ATOM   8482  C  CB    . TYR C 2 629  ? 115.012 120.840 101.625 1.00 290.57 ? 629  TYR C CB    1 
ATOM   8483  C  CG    . TYR C 2 629  ? 115.965 122.004 101.562 1.00 290.57 ? 629  TYR C CG    1 
ATOM   8484  C  CD1   . TYR C 2 629  ? 116.701 122.261 100.417 1.00 290.57 ? 629  TYR C CD1   1 
ATOM   8485  C  CD2   . TYR C 2 629  ? 116.127 122.849 102.649 1.00 290.57 ? 629  TYR C CD2   1 
ATOM   8486  C  CE1   . TYR C 2 629  ? 117.570 123.324 100.351 1.00 290.57 ? 629  TYR C CE1   1 
ATOM   8487  C  CE2   . TYR C 2 629  ? 116.996 123.912 102.599 1.00 290.57 ? 629  TYR C CE2   1 
ATOM   8488  C  CZ    . TYR C 2 629  ? 117.715 124.146 101.447 1.00 290.57 ? 629  TYR C CZ    1 
ATOM   8489  O  OH    . TYR C 2 629  ? 118.581 125.211 101.389 1.00 290.57 ? 629  TYR C OH    1 
ATOM   8490  N  N     . ARG C 2 630  ? 117.676 119.415 103.256 1.00 276.21 ? 630  ARG C N     1 
ATOM   8491  C  CA    . ARG C 2 630  ? 118.418 119.468 104.502 1.00 276.21 ? 630  ARG C CA    1 
ATOM   8492  C  C     . ARG C 2 630  ? 118.400 120.878 105.055 1.00 276.21 ? 630  ARG C C     1 
ATOM   8493  O  O     . ARG C 2 630  ? 118.744 121.838 104.363 1.00 276.21 ? 630  ARG C O     1 
ATOM   8494  C  CB    . ARG C 2 630  ? 119.855 119.019 104.301 1.00 276.21 ? 630  ARG C CB    1 
ATOM   8495  C  CG    . ARG C 2 630  ? 120.595 118.913 105.609 1.00 276.21 ? 630  ARG C CG    1 
ATOM   8496  C  CD    . ARG C 2 630  ? 122.070 118.649 105.427 1.00 276.21 ? 630  ARG C CD    1 
ATOM   8497  N  NE    . ARG C 2 630  ? 122.636 118.088 106.646 1.00 276.21 ? 630  ARG C NE    1 
ATOM   8498  C  CZ    . ARG C 2 630  ? 123.028 118.808 107.689 1.00 276.21 ? 630  ARG C CZ    1 
ATOM   8499  N  NH1   . ARG C 2 630  ? 122.929 120.130 107.669 1.00 276.21 ? 630  ARG C NH1   1 
ATOM   8500  N  NH2   . ARG C 2 630  ? 123.512 118.203 108.762 1.00 276.21 ? 630  ARG C NH2   1 
ATOM   8501  N  N     . SER C 2 631  ? 117.997 121.002 106.309 1.00 305.98 ? 631  SER C N     1 
ATOM   8502  C  CA    . SER C 2 631  ? 117.977 122.298 106.954 1.00 305.98 ? 631  SER C CA    1 
ATOM   8503  C  C     . SER C 2 631  ? 119.382 122.710 107.348 1.00 305.98 ? 631  SER C C     1 
ATOM   8504  O  O     . SER C 2 631  ? 120.322 121.913 107.310 1.00 305.98 ? 631  SER C O     1 
ATOM   8505  C  CB    . SER C 2 631  ? 117.086 122.284 108.190 1.00 305.98 ? 631  SER C CB    1 
ATOM   8506  O  OG    . SER C 2 631  ? 117.703 121.579 109.249 1.00 305.98 ? 631  SER C OG    1 
ATOM   8507  N  N     . ASN C 2 632  ? 119.506 123.973 107.753 1.00 298.90 ? 632  ASN C N     1 
ATOM   8508  C  CA    . ASN C 2 632  ? 120.737 124.473 108.346 1.00 298.90 ? 632  ASN C CA    1 
ATOM   8509  C  C     . ASN C 2 632  ? 121.070 123.760 109.640 1.00 298.90 ? 632  ASN C C     1 
ATOM   8510  O  O     . ASN C 2 632  ? 122.239 123.711 110.028 1.00 298.90 ? 632  ASN C O     1 
ATOM   8511  C  CB    . ASN C 2 632  ? 120.608 125.966 108.618 1.00 298.90 ? 632  ASN C CB    1 
ATOM   8512  C  CG    . ASN C 2 632  ? 121.040 126.816 107.449 1.00 298.90 ? 632  ASN C CG    1 
ATOM   8513  O  OD1   . ASN C 2 632  ? 121.905 126.425 106.670 1.00 298.90 ? 632  ASN C OD1   1 
ATOM   8514  N  ND2   . ASN C 2 632  ? 120.449 127.999 107.329 1.00 298.90 ? 632  ASN C ND2   1 
ATOM   8515  N  N     . GLN C 2 633  ? 120.068 123.220 110.317 1.00 303.95 ? 633  GLN C N     1 
ATOM   8516  C  CA    . GLN C 2 633  ? 120.253 122.380 111.487 1.00 303.95 ? 633  GLN C CA    1 
ATOM   8517  C  C     . GLN C 2 633  ? 120.047 120.915 111.123 1.00 303.95 ? 633  GLN C C     1 
ATOM   8518  O  O     . GLN C 2 633  ? 119.919 120.052 111.989 1.00 303.95 ? 633  GLN C O     1 
ATOM   8519  C  CB    . GLN C 2 633  ? 119.317 122.810 112.608 1.00 303.95 ? 633  GLN C CB    1 
ATOM   8520  C  CG    . GLN C 2 633  ? 119.610 124.202 113.130 1.00 303.95 ? 633  GLN C CG    1 
ATOM   8521  C  CD    . GLN C 2 633  ? 118.901 125.281 112.340 1.00 303.95 ? 633  GLN C CD    1 
ATOM   8522  O  OE1   . GLN C 2 633  ? 117.685 125.247 112.172 1.00 303.95 ? 633  GLN C OE1   1 
ATOM   8523  N  NE2   . GLN C 2 633  ? 119.665 126.232 111.829 1.00 303.95 ? 633  GLN C NE2   1 
ATOM   8524  N  N     . GLY C 2 634  ? 119.999 120.629 109.827 1.00 292.55 ? 634  GLY C N     1 
ATOM   8525  C  CA    . GLY C 2 634  ? 120.034 119.251 109.369 1.00 292.55 ? 634  GLY C CA    1 
ATOM   8526  C  C     . GLY C 2 634  ? 118.758 118.472 109.578 1.00 292.55 ? 634  GLY C C     1 
ATOM   8527  O  O     . GLY C 2 634  ? 118.805 117.277 109.897 1.00 292.55 ? 634  GLY C O     1 
ATOM   8528  N  N     . THR C 2 635  ? 117.615 119.118 109.400 1.00 307.58 ? 635  THR C N     1 
ATOM   8529  C  CA    . THR C 2 635  ? 116.333 118.438 109.408 1.00 307.58 ? 635  THR C CA    1 
ATOM   8530  C  C     . THR C 2 635  ? 115.796 118.385 107.988 1.00 307.58 ? 635  THR C C     1 
ATOM   8531  O  O     . THR C 2 635  ? 116.018 119.306 107.197 1.00 307.58 ? 635  THR C O     1 
ATOM   8532  C  CB    . THR C 2 635  ? 115.339 119.147 110.314 1.00 307.58 ? 635  THR C CB    1 
ATOM   8533  O  OG1   . THR C 2 635  ? 114.925 120.366 109.697 1.00 307.58 ? 635  THR C OG1   1 
ATOM   8534  C  CG2   . THR C 2 635  ? 116.005 119.485 111.621 1.00 307.58 ? 635  THR C CG2   1 
ATOM   8535  N  N     . ALA C 2 636  ? 115.104 117.302 107.666 1.00 338.80 ? 636  ALA C N     1 
ATOM   8536  C  CA    . ALA C 2 636  ? 114.579 117.121 106.324 1.00 338.80 ? 636  ALA C CA    1 
ATOM   8537  C  C     . ALA C 2 636  ? 113.364 118.005 106.102 1.00 338.80 ? 636  ALA C C     1 
ATOM   8538  O  O     . ALA C 2 636  ? 112.547 118.212 107.003 1.00 338.80 ? 636  ALA C O     1 
ATOM   8539  C  CB    . ALA C 2 636  ? 114.206 115.662 106.087 1.00 338.80 ? 636  ALA C CB    1 
ATOM   8540  N  N     . LEU C 2 637  ? 113.259 118.546 104.891 1.00 326.58 ? 637  LEU C N     1 
ATOM   8541  C  CA    . LEU C 2 637  ? 112.165 119.446 104.553 1.00 326.58 ? 637  LEU C CA    1 
ATOM   8542  C  C     . LEU C 2 637  ? 111.588 119.067 103.200 1.00 326.58 ? 637  LEU C C     1 
ATOM   8543  O  O     . LEU C 2 637  ? 112.313 119.038 102.203 1.00 326.58 ? 637  LEU C O     1 
ATOM   8544  C  CB    . LEU C 2 637  ? 112.635 120.903 104.516 1.00 326.58 ? 637  LEU C CB    1 
ATOM   8545  C  CG    . LEU C 2 637  ? 113.297 121.463 105.772 1.00 326.58 ? 637  LEU C CG    1 
ATOM   8546  C  CD1   . LEU C 2 637  ? 113.908 122.818 105.507 1.00 326.58 ? 637  LEU C CD1   1 
ATOM   8547  C  CD2   . LEU C 2 637  ? 112.285 121.538 106.890 1.00 326.58 ? 637  LEU C CD2   1 
ATOM   8548  N  N     . ASP C 2 638  ? 110.289 118.796 103.164 1.00 311.21 ? 638  ASP C N     1 
ATOM   8549  C  CA    . ASP C 2 638  ? 109.591 118.683 101.892 1.00 311.21 ? 638  ASP C CA    1 
ATOM   8550  C  C     . ASP C 2 638  ? 108.154 119.134 102.091 1.00 311.21 ? 638  ASP C C     1 
ATOM   8551  O  O     . ASP C 2 638  ? 107.726 119.465 103.199 1.00 311.21 ? 638  ASP C O     1 
ATOM   8552  C  CB    . ASP C 2 638  ? 109.643 117.267 101.319 1.00 311.21 ? 638  ASP C CB    1 
ATOM   8553  C  CG    . ASP C 2 638  ? 108.716 116.314 102.027 1.00 311.21 ? 638  ASP C CG    1 
ATOM   8554  O  OD1   . ASP C 2 638  ? 108.657 116.348 103.273 1.00 311.21 ? 638  ASP C OD1   1 
ATOM   8555  O  OD2   . ASP C 2 638  ? 108.019 115.552 101.323 1.00 311.21 ? 638  ASP C OD2   1 
ATOM   8556  N  N     . GLN C 2 639  ? 107.406 119.124 100.998 1.00 294.16 ? 639  GLN C N     1 
ATOM   8557  C  CA    . GLN C 2 639  ? 106.077 119.712 100.934 1.00 294.16 ? 639  GLN C CA    1 
ATOM   8558  C  C     . GLN C 2 639  ? 105.125 118.624 100.463 1.00 294.16 ? 639  GLN C C     1 
ATOM   8559  O  O     . GLN C 2 639  ? 105.035 118.353 99.263  1.00 294.16 ? 639  GLN C O     1 
ATOM   8560  C  CB    . GLN C 2 639  ? 106.061 120.920 99.995  1.00 294.16 ? 639  GLN C CB    1 
ATOM   8561  C  CG    . GLN C 2 639  ? 107.278 121.842 100.105 1.00 294.16 ? 639  GLN C CG    1 
ATOM   8562  C  CD    . GLN C 2 639  ? 108.424 121.448 99.180  1.00 294.16 ? 639  GLN C CD    1 
ATOM   8563  O  OE1   . GLN C 2 639  ? 108.225 121.175 97.998  1.00 294.16 ? 639  GLN C OE1   1 
ATOM   8564  N  NE2   . GLN C 2 639  ? 109.626 121.386 99.733  1.00 294.16 ? 639  GLN C NE2   1 
ATOM   8565  N  N     . ARG C 2 640  ? 104.433 117.999 101.398 1.00 271.45 ? 640  ARG C N     1 
ATOM   8566  C  CA    . ARG C 2 640  ? 103.664 116.795 101.112 1.00 271.45 ? 640  ARG C CA    1 
ATOM   8567  C  C     . ARG C 2 640  ? 102.411 117.124 100.318 1.00 271.45 ? 640  ARG C C     1 
ATOM   8568  O  O     . ARG C 2 640  ? 101.574 117.900 100.784 1.00 271.45 ? 640  ARG C O     1 
ATOM   8569  C  CB    . ARG C 2 640  ? 103.294 116.088 102.411 1.00 271.45 ? 640  ARG C CB    1 
ATOM   8570  C  CG    . ARG C 2 640  ? 104.305 115.060 102.853 1.00 271.45 ? 640  ARG C CG    1 
ATOM   8571  C  CD    . ARG C 2 640  ? 105.477 115.711 103.558 1.00 271.45 ? 640  ARG C CD    1 
ATOM   8572  N  NE    . ARG C 2 640  ? 105.076 116.379 104.791 1.00 271.45 ? 640  ARG C NE    1 
ATOM   8573  C  CZ    . ARG C 2 640  ? 105.741 117.384 105.354 1.00 271.45 ? 640  ARG C CZ    1 
ATOM   8574  N  NH1   . ARG C 2 640  ? 106.844 117.861 104.795 1.00 271.45 ? 640  ARG C NH1   1 
ATOM   8575  N  NH2   . ARG C 2 640  ? 105.291 117.917 106.480 1.00 271.45 ? 640  ARG C NH2   1 
ATOM   8576  N  N     . PRO C 2 641  ? 102.238 116.538 99.137  1.00 242.28 ? 641  PRO C N     1 
ATOM   8577  C  CA    . PRO C 2 641  ? 101.110 116.913 98.282  1.00 242.28 ? 641  PRO C CA    1 
ATOM   8578  C  C     . PRO C 2 641  ? 99.788  116.445 98.862  1.00 242.28 ? 641  PRO C C     1 
ATOM   8579  O  O     . PRO C 2 641  ? 99.706  115.416 99.534  1.00 242.28 ? 641  PRO C O     1 
ATOM   8580  C  CB    . PRO C 2 641  ? 101.421 116.204 96.964  1.00 242.28 ? 641  PRO C CB    1 
ATOM   8581  C  CG    . PRO C 2 641  ? 102.198 115.014 97.379  1.00 242.28 ? 641  PRO C CG    1 
ATOM   8582  C  CD    . PRO C 2 641  ? 103.034 115.451 98.549  1.00 242.28 ? 641  PRO C CD    1 
ATOM   8583  N  N     . ARG C 2 642  ? 98.750  117.236 98.619  1.00 252.21 ? 642  ARG C N     1 
ATOM   8584  C  CA    . ARG C 2 642  ? 97.447  116.975 99.201  1.00 252.21 ? 642  ARG C CA    1 
ATOM   8585  C  C     . ARG C 2 642  ? 96.330  116.853 98.184  1.00 252.21 ? 642  ARG C C     1 
ATOM   8586  O  O     . ARG C 2 642  ? 95.284  116.285 98.513  1.00 252.21 ? 642  ARG C O     1 
ATOM   8587  C  CB    . ARG C 2 642  ? 97.080  118.079 100.200 1.00 252.21 ? 642  ARG C CB    1 
ATOM   8588  C  CG    . ARG C 2 642  ? 97.839  117.995 101.503 1.00 252.21 ? 642  ARG C CG    1 
ATOM   8589  C  CD    . ARG C 2 642  ? 97.524  116.695 102.216 1.00 252.21 ? 642  ARG C CD    1 
ATOM   8590  N  NE    . ARG C 2 642  ? 98.473  116.418 103.288 1.00 252.21 ? 642  ARG C NE    1 
ATOM   8591  C  CZ    . ARG C 2 642  ? 99.646  115.821 103.111 1.00 252.21 ? 642  ARG C CZ    1 
ATOM   8592  N  NH1   . ARG C 2 642  ? 100.022 115.434 101.900 1.00 252.21 ? 642  ARG C NH1   1 
ATOM   8593  N  NH2   . ARG C 2 642  ? 100.444 115.607 104.148 1.00 252.21 ? 642  ARG C NH2   1 
ATOM   8594  N  N     . VAL C 2 643  ? 96.513  117.344 96.972  1.00 234.52 ? 643  VAL C N     1 
ATOM   8595  C  CA    . VAL C 2 643  ? 95.426  117.366 96.012  1.00 234.52 ? 643  VAL C CA    1 
ATOM   8596  C  C     . VAL C 2 643  ? 95.282  115.998 95.355  1.00 234.52 ? 643  VAL C C     1 
ATOM   8597  O  O     . VAL C 2 643  ? 96.194  115.171 95.368  1.00 234.52 ? 643  VAL C O     1 
ATOM   8598  C  CB    . VAL C 2 643  ? 95.667  118.465 94.971  1.00 234.52 ? 643  VAL C CB    1 
ATOM   8599  C  CG1   . VAL C 2 643  ? 95.751  119.806 95.661  1.00 234.52 ? 643  VAL C CG1   1 
ATOM   8600  C  CG2   . VAL C 2 643  ? 96.948  118.186 94.230  1.00 234.52 ? 643  VAL C CG2   1 
ATOM   8601  N  N     . VAL C 2 644  ? 94.111  115.754 94.783  1.00 251.34 ? 644  VAL C N     1 
ATOM   8602  C  CA    . VAL C 2 644  ? 93.896  114.547 93.998  1.00 251.34 ? 644  VAL C CA    1 
ATOM   8603  C  C     . VAL C 2 644  ? 94.026  114.946 92.537  1.00 251.34 ? 644  VAL C C     1 
ATOM   8604  O  O     . VAL C 2 644  ? 93.909  116.124 92.191  1.00 251.34 ? 644  VAL C O     1 
ATOM   8605  C  CB    . VAL C 2 644  ? 92.532  113.884 94.294  1.00 251.34 ? 644  VAL C CB    1 
ATOM   8606  C  CG1   . VAL C 2 644  ? 91.402  114.547 93.529  1.00 251.34 ? 644  VAL C CG1   1 
ATOM   8607  C  CG2   . VAL C 2 644  ? 92.581  112.390 94.037  1.00 251.34 ? 644  VAL C CG2   1 
ATOM   8608  N  N     . VAL C 2 645  ? 94.308  113.968 91.675  1.00 250.99 ? 645  VAL C N     1 
ATOM   8609  C  CA    . VAL C 2 645  ? 94.520  114.267 90.267  1.00 250.99 ? 645  VAL C CA    1 
ATOM   8610  C  C     . VAL C 2 645  ? 93.181  114.583 89.622  1.00 250.99 ? 645  VAL C C     1 
ATOM   8611  O  O     . VAL C 2 645  ? 92.168  113.926 89.890  1.00 250.99 ? 645  VAL C O     1 
ATOM   8612  C  CB    . VAL C 2 645  ? 95.229  113.093 89.571  1.00 250.99 ? 645  VAL C CB    1 
ATOM   8613  C  CG1   . VAL C 2 645  ? 95.571  113.432 88.124  1.00 250.99 ? 645  VAL C CG1   1 
ATOM   8614  C  CG2   . VAL C 2 645  ? 96.476  112.697 90.333  1.00 250.99 ? 645  VAL C CG2   1 
ATOM   8615  N  N     . GLY C 2 646  ? 93.163  115.617 88.785  1.00 260.50 ? 646  GLY C N     1 
ATOM   8616  C  CA    . GLY C 2 646  ? 91.924  116.020 88.163  1.00 260.50 ? 646  GLY C CA    1 
ATOM   8617  C  C     . GLY C 2 646  ? 91.059  116.899 89.023  1.00 260.50 ? 646  GLY C C     1 
ATOM   8618  O  O     . GLY C 2 646  ? 89.935  117.219 88.628  1.00 260.50 ? 646  GLY C O     1 
ATOM   8619  N  N     . GLN C 2 647  ? 91.545  117.297 90.189  1.00 264.86 ? 647  GLN C N     1 
ATOM   8620  C  CA    . GLN C 2 647  ? 90.763  118.138 91.076  1.00 264.86 ? 647  GLN C CA    1 
ATOM   8621  C  C     . GLN C 2 647  ? 90.706  119.544 90.515  1.00 264.86 ? 647  GLN C C     1 
ATOM   8622  O  O     . GLN C 2 647  ? 91.742  120.186 90.335  1.00 264.86 ? 647  GLN C O     1 
ATOM   8623  C  CB    . GLN C 2 647  ? 91.391  118.150 92.460  1.00 264.86 ? 647  GLN C CB    1 
ATOM   8624  C  CG    . GLN C 2 647  ? 90.432  118.139 93.601  1.00 264.86 ? 647  GLN C CG    1 
ATOM   8625  C  CD    . GLN C 2 647  ? 91.130  117.758 94.879  1.00 264.86 ? 647  GLN C CD    1 
ATOM   8626  O  OE1   . GLN C 2 647  ? 92.322  117.455 94.875  1.00 264.86 ? 647  GLN C OE1   1 
ATOM   8627  N  NE2   . GLN C 2 647  ? 90.396  117.753 95.978  1.00 264.86 ? 647  GLN C NE2   1 
ATOM   8628  N  N     . ARG C 2 648  ? 89.504  120.007 90.203  1.00 269.68 ? 648  ARG C N     1 
ATOM   8629  C  CA    . ARG C 2 648  ? 89.318  121.416 89.911  1.00 269.68 ? 648  ARG C CA    1 
ATOM   8630  C  C     . ARG C 2 648  ? 89.576  122.215 91.176  1.00 269.68 ? 648  ARG C C     1 
ATOM   8631  O  O     . ARG C 2 648  ? 88.980  121.955 92.222  1.00 269.68 ? 648  ARG C O     1 
ATOM   8632  C  CB    . ARG C 2 648  ? 87.904  121.666 89.391  1.00 269.68 ? 648  ARG C CB    1 
ATOM   8633  C  CG    . ARG C 2 648  ? 87.751  122.949 88.599  1.00 269.68 ? 648  ARG C CG    1 
ATOM   8634  C  CD    . ARG C 2 648  ? 87.208  124.068 89.478  1.00 269.68 ? 648  ARG C CD    1 
ATOM   8635  N  NE    . ARG C 2 648  ? 87.047  125.337 88.776  1.00 269.68 ? 648  ARG C NE    1 
ATOM   8636  C  CZ    . ARG C 2 648  ? 88.035  126.189 88.521  1.00 269.68 ? 648  ARG C CZ    1 
ATOM   8637  N  NH1   . ARG C 2 648  ? 89.272  125.910 88.891  1.00 269.68 ? 648  ARG C NH1   1 
ATOM   8638  N  NH2   . ARG C 2 648  ? 87.781  127.323 87.888  1.00 269.68 ? 648  ARG C NH2   1 
ATOM   8639  N  N     . VAL C 2 649  ? 90.484  123.178 91.086  1.00 255.80 ? 649  VAL C N     1 
ATOM   8640  C  CA    . VAL C 2 649  ? 90.898  123.916 92.270  1.00 255.80 ? 649  VAL C CA    1 
ATOM   8641  C  C     . VAL C 2 649  ? 90.522  125.377 92.115  1.00 255.80 ? 649  VAL C C     1 
ATOM   8642  O  O     . VAL C 2 649  ? 89.928  125.778 91.111  1.00 255.80 ? 649  VAL C O     1 
ATOM   8643  C  CB    . VAL C 2 649  ? 92.405  123.769 92.522  1.00 255.80 ? 649  VAL C CB    1 
ATOM   8644  C  CG1   . VAL C 2 649  ? 92.776  122.306 92.648  1.00 255.80 ? 649  VAL C CG1   1 
ATOM   8645  C  CG2   . VAL C 2 649  ? 93.194  124.424 91.405  1.00 255.80 ? 649  VAL C CG2   1 
ATOM   8646  N  N     . ARG C 2 650  ? 90.861  126.180 93.112  1.00 240.98 ? 650  ARG C N     1 
ATOM   8647  C  CA    . ARG C 2 650  ? 90.539  127.588 93.099  1.00 240.98 ? 650  ARG C CA    1 
ATOM   8648  C  C     . ARG C 2 650  ? 91.702  128.321 93.760  1.00 240.98 ? 650  ARG C C     1 
ATOM   8649  O  O     . ARG C 2 650  ? 92.769  127.746 93.970  1.00 240.98 ? 650  ARG C O     1 
ATOM   8650  C  CB    . ARG C 2 650  ? 89.188  127.801 93.779  1.00 240.98 ? 650  ARG C CB    1 
ATOM   8651  C  CG    . ARG C 2 650  ? 88.391  128.958 93.235  1.00 240.98 ? 650  ARG C CG    1 
ATOM   8652  C  CD    . ARG C 2 650  ? 87.232  129.247 94.168  1.00 240.98 ? 650  ARG C CD    1 
ATOM   8653  N  NE    . ARG C 2 650  ? 87.637  129.115 95.568  1.00 240.98 ? 650  ARG C NE    1 
ATOM   8654  C  CZ    . ARG C 2 650  ? 88.308  130.032 96.261  1.00 240.98 ? 650  ARG C CZ    1 
ATOM   8655  N  NH1   . ARG C 2 650  ? 88.675  131.175 95.696  1.00 240.98 ? 650  ARG C NH1   1 
ATOM   8656  N  NH2   . ARG C 2 650  ? 88.631  129.790 97.522  1.00 240.98 ? 650  ARG C NH2   1 
ATOM   8657  N  N     . LYS C 2 651  ? 91.510  129.595 94.075  1.00 221.58 ? 651  LYS C N     1 
ATOM   8658  C  CA    . LYS C 2 651  ? 92.609  130.419 94.555  1.00 221.58 ? 651  LYS C CA    1 
ATOM   8659  C  C     . LYS C 2 651  ? 92.989  130.069 95.988  1.00 221.58 ? 651  LYS C C     1 
ATOM   8660  O  O     . LYS C 2 651  ? 92.128  129.876 96.848  1.00 221.58 ? 651  LYS C O     1 
ATOM   8661  C  CB    . LYS C 2 651  ? 92.229  131.889 94.464  1.00 221.58 ? 651  LYS C CB    1 
ATOM   8662  C  CG    . LYS C 2 651  ? 93.355  132.823 94.777  1.00 221.58 ? 651  LYS C CG    1 
ATOM   8663  C  CD    . LYS C 2 651  ? 93.034  134.209 94.310  1.00 221.58 ? 651  LYS C CD    1 
ATOM   8664  C  CE    . LYS C 2 651  ? 94.299  135.000 94.115  1.00 221.58 ? 651  LYS C CE    1 
ATOM   8665  N  NZ    . LYS C 2 651  ? 95.210  134.292 93.185  1.00 221.58 ? 651  LYS C NZ    1 
ATOM   8666  N  N     . GLY C 2 652  ? 94.296  129.991 96.242  1.00 219.72 ? 652  GLY C N     1 
ATOM   8667  C  CA    . GLY C 2 652  ? 94.813  129.757 97.571  1.00 219.72 ? 652  GLY C CA    1 
ATOM   8668  C  C     . GLY C 2 652  ? 94.721  128.332 98.052  1.00 219.72 ? 652  GLY C C     1 
ATOM   8669  O  O     . GLY C 2 652  ? 95.107  128.058 99.195  1.00 219.72 ? 652  GLY C O     1 
ATOM   8670  N  N     . ASP C 2 653  ? 94.229  127.417 97.226  1.00 225.29 ? 653  ASP C N     1 
ATOM   8671  C  CA    . ASP C 2 653  ? 94.000  126.055 97.675  1.00 225.29 ? 653  ASP C CA    1 
ATOM   8672  C  C     . ASP C 2 653  ? 95.322  125.322 97.803  1.00 225.29 ? 653  ASP C C     1 
ATOM   8673  O  O     . ASP C 2 653  ? 96.107  125.283 96.854  1.00 225.29 ? 653  ASP C O     1 
ATOM   8674  C  CB    . ASP C 2 653  ? 93.094  125.319 96.699  1.00 225.29 ? 653  ASP C CB    1 
ATOM   8675  C  CG    . ASP C 2 653  ? 91.800  126.045 96.451  1.00 225.29 ? 653  ASP C CG    1 
ATOM   8676  O  OD1   . ASP C 2 653  ? 91.522  127.031 97.161  1.00 225.29 ? 653  ASP C OD1   1 
ATOM   8677  O  OD2   . ASP C 2 653  ? 91.040  125.595 95.576  1.00 225.29 ? 653  ASP C OD2   1 
ATOM   8678  N  N     . LEU C 2 654  ? 95.544  124.727 98.972  1.00 209.66 ? 654  LEU C N     1 
ATOM   8679  C  CA    . LEU C 2 654  ? 96.801  124.065 99.282  1.00 209.66 ? 654  LEU C CA    1 
ATOM   8680  C  C     . LEU C 2 654  ? 97.066  122.896 98.350  1.00 209.66 ? 654  LEU C C     1 
ATOM   8681  O  O     . LEU C 2 654  ? 96.229  122.010 98.172  1.00 209.66 ? 654  LEU C O     1 
ATOM   8682  C  CB    . LEU C 2 654  ? 96.789  123.569 100.725 1.00 209.66 ? 654  LEU C CB    1 
ATOM   8683  C  CG    . LEU C 2 654  ? 97.887  122.558 101.070 1.00 209.66 ? 654  LEU C CG    1 
ATOM   8684  C  CD1   . LEU C 2 654  ? 99.264  123.196 101.055 1.00 209.66 ? 654  LEU C CD1   1 
ATOM   8685  C  CD2   . LEU C 2 654  ? 97.617  121.900 102.401 1.00 209.66 ? 654  LEU C CD2   1 
ATOM   8686  N  N     . LEU C 2 655  ? 98.249  122.914 97.751  1.00 212.20 ? 655  LEU C N     1 
ATOM   8687  C  CA    . LEU C 2 655  ? 98.712  121.840 96.894  1.00 212.20 ? 655  LEU C CA    1 
ATOM   8688  C  C     . LEU C 2 655  ? 99.586  120.863 97.662  1.00 212.20 ? 655  LEU C C     1 
ATOM   8689  O  O     . LEU C 2 655  ? 99.271  119.675 97.765  1.00 212.20 ? 655  LEU C O     1 
ATOM   8690  C  CB    . LEU C 2 655  ? 99.501  122.435 95.732  1.00 212.20 ? 655  LEU C CB    1 
ATOM   8691  C  CG    . LEU C 2 655  ? 98.825  123.641 95.106  1.00 212.20 ? 655  LEU C CG    1 
ATOM   8692  C  CD1   . LEU C 2 655  ? 99.742  124.252 94.073  1.00 212.20 ? 655  LEU C CD1   1 
ATOM   8693  C  CD2   . LEU C 2 655  ? 97.514  123.217 94.485  1.00 212.20 ? 655  LEU C CD2   1 
ATOM   8694  N  N     . ALA C 2 656  ? 100.676 121.364 98.229  1.00 230.46 ? 656  ALA C N     1 
ATOM   8695  C  CA    . ALA C 2 656  ? 101.702 120.534 98.830  1.00 230.46 ? 656  ALA C CA    1 
ATOM   8696  C  C     . ALA C 2 656  ? 101.931 121.013 100.249 1.00 230.46 ? 656  ALA C C     1 
ATOM   8697  O  O     . ALA C 2 656  ? 102.489 122.094 100.459 1.00 230.46 ? 656  ALA C O     1 
ATOM   8698  C  CB    . ALA C 2 656  ? 102.989 120.595 98.015  1.00 230.46 ? 656  ALA C CB    1 
ATOM   8699  N  N     . ASP C 2 657  ? 101.484 120.216 101.212 1.00 260.90 ? 657  ASP C N     1 
ATOM   8700  C  CA    . ASP C 2 657  ? 101.565 120.569 102.623 1.00 260.90 ? 657  ASP C CA    1 
ATOM   8701  C  C     . ASP C 2 657  ? 103.014 120.509 103.072 1.00 260.90 ? 657  ASP C C     1 
ATOM   8702  O  O     . ASP C 2 657  ? 103.617 119.434 103.096 1.00 260.90 ? 657  ASP C O     1 
ATOM   8703  C  CB    . ASP C 2 657  ? 100.702 119.613 103.437 1.00 260.90 ? 657  ASP C CB    1 
ATOM   8704  C  CG    . ASP C 2 657  ? 100.136 120.254 104.672 1.00 260.90 ? 657  ASP C CG    1 
ATOM   8705  O  OD1   . ASP C 2 657  ? 100.538 121.390 104.984 1.00 260.90 ? 657  ASP C OD1   1 
ATOM   8706  O  OD2   . ASP C 2 657  ? 99.282  119.624 105.325 1.00 260.90 ? 657  ASP C OD2   1 
ATOM   8707  N  N     . GLY C 2 658  ? 103.561 121.654 103.462 1.00 276.12 ? 658  GLY C N     1 
ATOM   8708  C  CA    . GLY C 2 658  ? 104.961 121.774 103.789 1.00 276.12 ? 658  GLY C CA    1 
ATOM   8709  C  C     . GLY C 2 658  ? 105.361 121.097 105.084 1.00 276.12 ? 658  GLY C C     1 
ATOM   8710  O  O     . GLY C 2 658  ? 104.612 120.304 105.663 1.00 276.12 ? 658  GLY C O     1 
ATOM   8711  N  N     . PRO C 2 659  ? 106.564 121.403 105.562 1.00 282.38 ? 659  PRO C N     1 
ATOM   8712  C  CA    . PRO C 2 659  ? 107.068 120.743 106.769 1.00 282.38 ? 659  PRO C CA    1 
ATOM   8713  C  C     . PRO C 2 659  ? 106.304 121.175 108.008 1.00 282.38 ? 659  PRO C C     1 
ATOM   8714  O  O     . PRO C 2 659  ? 106.037 122.362 108.210 1.00 282.38 ? 659  PRO C O     1 
ATOM   8715  C  CB    . PRO C 2 659  ? 108.533 121.186 106.829 1.00 282.38 ? 659  PRO C CB    1 
ATOM   8716  C  CG    . PRO C 2 659  ? 108.847 121.659 105.452 1.00 282.38 ? 659  PRO C CG    1 
ATOM   8717  C  CD    . PRO C 2 659  ? 107.584 122.266 104.953 1.00 282.38 ? 659  PRO C CD    1 
ATOM   8718  N  N     . ALA C 2 660  ? 105.931 120.173 108.812 1.00 281.33 ? 660  ALA C N     1 
ATOM   8719  C  CA    . ALA C 2 660  ? 105.259 120.331 110.108 1.00 281.33 ? 660  ALA C CA    1 
ATOM   8720  C  C     . ALA C 2 660  ? 103.937 121.080 109.994 1.00 281.33 ? 660  ALA C C     1 
ATOM   8721  O  O     . ALA C 2 660  ? 103.606 121.908 110.844 1.00 281.33 ? 660  ALA C O     1 
ATOM   8722  C  CB    . ALA C 2 660  ? 106.168 121.010 111.139 1.00 281.33 ? 660  ALA C CB    1 
ATOM   8723  N  N     . SER C 2 661  ? 103.168 120.793 108.951 1.00 268.01 ? 661  SER C N     1 
ATOM   8724  C  CA    . SER C 2 661  ? 101.905 121.467 108.717 1.00 268.01 ? 661  SER C CA    1 
ATOM   8725  C  C     . SER C 2 661  ? 100.854 120.450 108.306 1.00 268.01 ? 661  SER C C     1 
ATOM   8726  O  O     . SER C 2 661  ? 101.137 119.511 107.561 1.00 268.01 ? 661  SER C O     1 
ATOM   8727  C  CB    . SER C 2 661  ? 102.048 122.538 107.642 1.00 268.01 ? 661  SER C CB    1 
ATOM   8728  O  OG    . SER C 2 661  ? 102.769 122.036 106.531 1.00 268.01 ? 661  SER C OG    1 
ATOM   8729  N  N     . GLU C 2 662  ? 99.636  120.646 108.795 1.00 235.16 ? 662  GLU C N     1 
ATOM   8730  C  CA    . GLU C 2 662  ? 98.528  119.733 108.536 1.00 235.16 ? 662  GLU C CA    1 
ATOM   8731  C  C     . GLU C 2 662  ? 97.408  120.517 107.875 1.00 235.16 ? 662  GLU C C     1 
ATOM   8732  O  O     . GLU C 2 662  ? 96.615  121.156 108.572 1.00 235.16 ? 662  GLU C O     1 
ATOM   8733  C  CB    . GLU C 2 662  ? 98.038  119.080 109.819 1.00 235.16 ? 662  GLU C CB    1 
ATOM   8734  C  CG    . GLU C 2 662  ? 96.941  118.056 109.604 1.00 235.16 ? 662  GLU C CG    1 
ATOM   8735  C  CD    . GLU C 2 662  ? 96.097  117.846 110.842 1.00 235.16 ? 662  GLU C CD    1 
ATOM   8736  O  OE1   . GLU C 2 662  ? 96.208  118.653 111.787 1.00 235.16 ? 662  GLU C OE1   1 
ATOM   8737  O  OE2   . GLU C 2 662  ? 95.326  116.868 110.876 1.00 235.16 ? 662  GLU C OE2   1 
ATOM   8738  N  N     . ASN C 2 663  ? 97.370  120.468 106.542 1.00 225.37 ? 663  ASN C N     1 
ATOM   8739  C  CA    . ASN C 2 663  ? 96.259  120.948 105.720 1.00 225.37 ? 663  ASN C CA    1 
ATOM   8740  C  C     . ASN C 2 663  ? 95.983  122.428 105.957 1.00 225.37 ? 663  ASN C C     1 
ATOM   8741  O  O     . ASN C 2 663  ? 94.862  122.851 106.231 1.00 225.37 ? 663  ASN C O     1 
ATOM   8742  C  CB    . ASN C 2 663  ? 95.013  120.103 105.960 1.00 225.37 ? 663  ASN C CB    1 
ATOM   8743  C  CG    . ASN C 2 663  ? 95.304  118.632 105.867 1.00 225.37 ? 663  ASN C CG    1 
ATOM   8744  O  OD1   . ASN C 2 663  ? 95.901  118.167 104.898 1.00 225.37 ? 663  ASN C OD1   1 
ATOM   8745  N  ND2   . ASN C 2 663  ? 94.908  117.888 106.884 1.00 225.37 ? 663  ASN C ND2   1 
ATOM   8746  N  N     . GLY C 2 664  ? 97.049  123.209 105.874 1.00 235.02 ? 664  GLY C N     1 
ATOM   8747  C  CA    . GLY C 2 664  ? 96.963  124.619 106.153 1.00 235.02 ? 664  GLY C CA    1 
ATOM   8748  C  C     . GLY C 2 664  ? 97.018  124.974 107.616 1.00 235.02 ? 664  GLY C C     1 
ATOM   8749  O  O     . GLY C 2 664  ? 96.919  126.157 107.953 1.00 235.02 ? 664  GLY C O     1 
ATOM   8750  N  N     . PHE C 2 665  ? 97.169  123.999 108.498 1.00 233.82 ? 665  PHE C N     1 
ATOM   8751  C  CA    . PHE C 2 665  ? 97.303  124.263 109.918 1.00 233.82 ? 665  PHE C CA    1 
ATOM   8752  C  C     . PHE C 2 665  ? 98.642  123.727 110.384 1.00 233.82 ? 665  PHE C C     1 
ATOM   8753  O  O     . PHE C 2 665  ? 99.089  122.678 109.915 1.00 233.82 ? 665  PHE C O     1 
ATOM   8754  C  CB    . PHE C 2 665  ? 96.172  123.625 110.705 1.00 233.82 ? 665  PHE C CB    1 
ATOM   8755  C  CG    . PHE C 2 665  ? 94.828  123.909 110.144 1.00 233.82 ? 665  PHE C CG    1 
ATOM   8756  C  CD1   . PHE C 2 665  ? 94.209  125.115 110.396 1.00 233.82 ? 665  PHE C CD1   1 
ATOM   8757  C  CD2   . PHE C 2 665  ? 94.177  122.970 109.367 1.00 233.82 ? 665  PHE C CD2   1 
ATOM   8758  C  CE1   . PHE C 2 665  ? 92.962  125.379 109.883 1.00 233.82 ? 665  PHE C CE1   1 
ATOM   8759  C  CE2   . PHE C 2 665  ? 92.935  123.231 108.844 1.00 233.82 ? 665  PHE C CE2   1 
ATOM   8760  C  CZ    . PHE C 2 665  ? 92.326  124.440 109.102 1.00 233.82 ? 665  PHE C CZ    1 
ATOM   8761  N  N     . LEU C 2 666  ? 99.272  124.448 111.300 1.00 243.70 ? 666  LEU C N     1 
ATOM   8762  C  CA    . LEU C 2 666  ? 100.611 124.096 111.741 1.00 243.70 ? 666  LEU C CA    1 
ATOM   8763  C  C     . LEU C 2 666  ? 100.585 122.845 112.601 1.00 243.70 ? 666  LEU C C     1 
ATOM   8764  O  O     . LEU C 2 666  ? 99.893  122.793 113.621 1.00 243.70 ? 666  LEU C O     1 
ATOM   8765  C  CB    . LEU C 2 666  ? 101.217 125.257 112.513 1.00 243.70 ? 666  LEU C CB    1 
ATOM   8766  C  CG    . LEU C 2 666  ? 102.729 125.153 112.633 1.00 243.70 ? 666  LEU C CG    1 
ATOM   8767  C  CD1   . LEU C 2 666  ? 103.354 125.170 111.259 1.00 243.70 ? 666  LEU C CD1   1 
ATOM   8768  C  CD2   . LEU C 2 666  ? 103.253 126.295 113.467 1.00 243.70 ? 666  LEU C CD2   1 
ATOM   8769  N  N     . ALA C 2 667  ? 101.340 121.841 112.187 1.00 259.48 ? 667  ALA C N     1 
ATOM   8770  C  CA    . ALA C 2 667  ? 101.381 120.554 112.869 1.00 259.48 ? 667  ALA C CA    1 
ATOM   8771  C  C     . ALA C 2 667  ? 102.758 120.395 113.500 1.00 259.48 ? 667  ALA C C     1 
ATOM   8772  O  O     . ALA C 2 667  ? 103.647 119.766 112.930 1.00 259.48 ? 667  ALA C O     1 
ATOM   8773  C  CB    . ALA C 2 667  ? 101.088 119.429 111.897 1.00 259.48 ? 667  ALA C CB    1 
ATOM   8774  N  N     . LEU C 2 668  ? 102.927 120.953 114.695 1.00 281.30 ? 668  LEU C N     1 
ATOM   8775  C  CA    . LEU C 2 668  ? 104.221 120.877 115.361 1.00 281.30 ? 668  LEU C CA    1 
ATOM   8776  C  C     . LEU C 2 668  ? 104.388 119.575 116.134 1.00 281.30 ? 668  LEU C C     1 
ATOM   8777  O  O     . LEU C 2 668  ? 105.246 118.753 115.802 1.00 281.30 ? 668  LEU C O     1 
ATOM   8778  C  CB    . LEU C 2 668  ? 104.395 122.078 116.289 1.00 281.30 ? 668  LEU C CB    1 
ATOM   8779  C  CG    . LEU C 2 668  ? 104.457 123.397 115.528 1.00 281.30 ? 668  LEU C CG    1 
ATOM   8780  C  CD1   . LEU C 2 668  ? 104.741 124.538 116.478 1.00 281.30 ? 668  LEU C CD1   1 
ATOM   8781  C  CD2   . LEU C 2 668  ? 105.505 123.341 114.430 1.00 281.30 ? 668  LEU C CD2   1 
ATOM   8782  N  N     . GLY C 2 669  ? 103.571 119.377 117.158 1.00 238.95 ? 669  GLY C N     1 
ATOM   8783  C  CA    . GLY C 2 669  ? 103.593 118.152 117.923 1.00 238.95 ? 669  GLY C CA    1 
ATOM   8784  C  C     . GLY C 2 669  ? 102.340 117.350 117.675 1.00 238.95 ? 669  GLY C C     1 
ATOM   8785  O  O     . GLY C 2 669  ? 101.934 117.161 116.527 1.00 238.95 ? 669  GLY C O     1 
ATOM   8786  N  N     . GLN C 2 670  ? 101.702 116.895 118.743 1.00 216.62 ? 670  GLN C N     1 
ATOM   8787  C  CA    . GLN C 2 670  ? 100.495 116.105 118.593 1.00 216.62 ? 670  GLN C CA    1 
ATOM   8788  C  C     . GLN C 2 670  ? 99.570  116.365 119.764 1.00 216.62 ? 670  GLN C C     1 
ATOM   8789  O  O     . GLN C 2 670  ? 100.023 116.483 120.904 1.00 216.62 ? 670  GLN C O     1 
ATOM   8790  C  CB    . GLN C 2 670  ? 100.834 114.623 118.499 1.00 216.62 ? 670  GLN C CB    1 
ATOM   8791  C  CG    . GLN C 2 670  ? 100.926 114.116 117.088 1.00 216.62 ? 670  GLN C CG    1 
ATOM   8792  C  CD    . GLN C 2 670  ? 101.943 113.023 116.959 1.00 216.62 ? 670  GLN C CD    1 
ATOM   8793  O  OE1   . GLN C 2 670  ? 102.877 112.944 117.749 1.00 216.62 ? 670  GLN C OE1   1 
ATOM   8794  N  NE2   . GLN C 2 670  ? 101.758 112.150 115.981 1.00 216.62 ? 670  GLN C NE2   1 
ATOM   8795  N  N     . ASN C 2 671  ? 98.282  116.479 119.472 1.00 233.69 ? 671  ASN C N     1 
ATOM   8796  C  CA    . ASN C 2 671  ? 97.281  116.455 120.523 1.00 233.69 ? 671  ASN C CA    1 
ATOM   8797  C  C     . ASN C 2 671  ? 97.235  115.056 121.096 1.00 233.69 ? 671  ASN C C     1 
ATOM   8798  O  O     . ASN C 2 671  ? 96.816  114.115 120.418 1.00 233.69 ? 671  ASN C O     1 
ATOM   8799  C  CB    . ASN C 2 671  ? 95.917  116.858 119.989 1.00 233.69 ? 671  ASN C CB    1 
ATOM   8800  C  CG    . ASN C 2 671  ? 95.917  118.242 119.423 1.00 233.69 ? 671  ASN C CG    1 
ATOM   8801  O  OD1   . ASN C 2 671  ? 96.223  119.204 120.122 1.00 233.69 ? 671  ASN C OD1   1 
ATOM   8802  N  ND2   . ASN C 2 671  ? 95.582  118.359 118.150 1.00 233.69 ? 671  ASN C ND2   1 
ATOM   8803  N  N     . VAL C 2 672  ? 97.685  114.904 122.332 1.00 236.00 ? 672  VAL C N     1 
ATOM   8804  C  CA    . VAL C 2 672  ? 97.876  113.598 122.940 1.00 236.00 ? 672  VAL C CA    1 
ATOM   8805  C  C     . VAL C 2 672  ? 97.047  113.541 124.211 1.00 236.00 ? 672  VAL C C     1 
ATOM   8806  O  O     . VAL C 2 672  ? 97.049  114.493 124.997 1.00 236.00 ? 672  VAL C O     1 
ATOM   8807  C  CB    . VAL C 2 672  ? 99.366  113.344 123.230 1.00 236.00 ? 672  VAL C CB    1 
ATOM   8808  C  CG1   . VAL C 2 672  ? 99.562  112.069 123.993 1.00 236.00 ? 672  VAL C CG1   1 
ATOM   8809  C  CG2   . VAL C 2 672  ? 100.151 113.301 121.934 1.00 236.00 ? 672  VAL C CG2   1 
ATOM   8810  N  N     . LEU C 2 673  ? 96.310  112.447 124.387 1.00 238.90 ? 673  LEU C N     1 
ATOM   8811  C  CA    . LEU C 2 673  ? 95.546  112.226 125.606 1.00 238.90 ? 673  LEU C CA    1 
ATOM   8812  C  C     . LEU C 2 673  ? 96.466  112.101 126.813 1.00 238.90 ? 673  LEU C C     1 
ATOM   8813  O  O     . LEU C 2 673  ? 97.318  111.213 126.867 1.00 238.90 ? 673  LEU C O     1 
ATOM   8814  C  CB    . LEU C 2 673  ? 94.714  110.964 125.454 1.00 238.90 ? 673  LEU C CB    1 
ATOM   8815  C  CG    . LEU C 2 673  ? 93.985  110.585 126.729 1.00 238.90 ? 673  LEU C CG    1 
ATOM   8816  C  CD1   . LEU C 2 673  ? 92.833  111.537 126.932 1.00 238.90 ? 673  LEU C CD1   1 
ATOM   8817  C  CD2   . LEU C 2 673  ? 93.504  109.157 126.651 1.00 238.90 ? 673  LEU C CD2   1 
ATOM   8818  N  N     . VAL C 2 674  ? 96.275  112.976 127.798 1.00 264.46 ? 674  VAL C N     1 
ATOM   8819  C  CA    . VAL C 2 674  ? 97.276  113.178 128.840 1.00 264.46 ? 674  VAL C CA    1 
ATOM   8820  C  C     . VAL C 2 674  ? 96.589  113.325 130.196 1.00 264.46 ? 674  VAL C C     1 
ATOM   8821  O  O     . VAL C 2 674  ? 95.572  114.013 130.325 1.00 264.46 ? 674  VAL C O     1 
ATOM   8822  C  CB    . VAL C 2 674  ? 98.160  114.396 128.484 1.00 264.46 ? 674  VAL C CB    1 
ATOM   8823  C  CG1   . VAL C 2 674  ? 97.311  115.599 128.110 1.00 264.46 ? 674  VAL C CG1   1 
ATOM   8824  C  CG2   . VAL C 2 674  ? 99.102  114.751 129.612 1.00 264.46 ? 674  VAL C CG2   1 
ATOM   8825  N  N     . ALA C 2 675  ? 97.140  112.653 131.206 1.00 266.05 ? 675  ALA C N     1 
ATOM   8826  C  CA    . ALA C 2 675  ? 96.707  112.780 132.590 1.00 266.05 ? 675  ALA C CA    1 
ATOM   8827  C  C     . ALA C 2 675  ? 97.787  113.462 133.416 1.00 266.05 ? 675  ALA C C     1 
ATOM   8828  O  O     . ALA C 2 675  ? 98.921  113.653 132.971 1.00 266.05 ? 675  ALA C O     1 
ATOM   8829  C  CB    . ALA C 2 675  ? 96.386  111.415 133.202 1.00 266.05 ? 675  ALA C CB    1 
ATOM   8830  N  N     . ILE C 2 676  ? 97.427  113.815 134.646 1.00 240.06 ? 676  ILE C N     1 
ATOM   8831  C  CA    . ILE C 2 676  ? 98.363  114.494 135.530 1.00 240.06 ? 676  ILE C CA    1 
ATOM   8832  C  C     . ILE C 2 676  ? 98.163  114.116 136.992 1.00 240.06 ? 676  ILE C C     1 
ATOM   8833  O  O     . ILE C 2 676  ? 97.131  114.422 137.601 1.00 240.06 ? 676  ILE C O     1 
ATOM   8834  C  CB    . ILE C 2 676  ? 98.288  116.017 135.321 1.00 240.06 ? 676  ILE C CB    1 
ATOM   8835  C  CG1   . ILE C 2 676  ? 99.124  116.742 136.376 1.00 240.06 ? 676  ILE C CG1   1 
ATOM   8836  C  CG2   . ILE C 2 676  ? 96.845  116.508 135.190 1.00 240.06 ? 676  ILE C CG2   1 
ATOM   8837  C  CD1   . ILE C 2 676  ? 99.443  118.152 136.011 1.00 240.06 ? 676  ILE C CD1   1 
ATOM   8838  N  N     . MET C 2 677  ? 99.164  113.454 137.554 1.00 240.04 ? 677  MET C N     1 
ATOM   8839  C  CA    . MET C 2 677  ? 99.254  113.098 138.960 1.00 240.04 ? 677  MET C CA    1 
ATOM   8840  C  C     . MET C 2 677  ? 100.690 112.662 139.200 1.00 240.04 ? 677  MET C C     1 
ATOM   8841  O  O     . MET C 2 677  ? 101.324 112.135 138.283 1.00 240.04 ? 677  MET C O     1 
ATOM   8842  C  CB    . MET C 2 677  ? 98.245  112.003 139.329 1.00 240.04 ? 677  MET C CB    1 
ATOM   8843  C  CG    . MET C 2 677  ? 98.377  110.663 138.642 1.00 240.04 ? 677  MET C CG    1 
ATOM   8844  S  SD    . MET C 2 677  ? 99.502  109.550 139.500 1.00 240.04 ? 677  MET C SD    1 
ATOM   8845  C  CE    . MET C 2 677  ? 98.703  109.483 141.093 1.00 240.04 ? 677  MET C CE    1 
ATOM   8846  N  N     . PRO C 2 678  ? 101.238 112.834 140.389 1.00 236.91 ? 678  PRO C N     1 
ATOM   8847  C  CA    . PRO C 2 678  ? 102.614 112.387 140.624 1.00 236.91 ? 678  PRO C CA    1 
ATOM   8848  C  C     . PRO C 2 678  ? 102.639 110.879 140.795 1.00 236.91 ? 678  PRO C C     1 
ATOM   8849  O  O     . PRO C 2 678  ? 102.079 110.337 141.752 1.00 236.91 ? 678  PRO C O     1 
ATOM   8850  C  CB    . PRO C 2 678  ? 103.002 113.120 141.917 1.00 236.91 ? 678  PRO C CB    1 
ATOM   8851  C  CG    . PRO C 2 678  ? 101.815 113.970 142.285 1.00 236.91 ? 678  PRO C CG    1 
ATOM   8852  C  CD    . PRO C 2 678  ? 100.643 113.355 141.624 1.00 236.91 ? 678  PRO C CD    1 
ATOM   8853  N  N     . PHE C 2 679  ? 103.277 110.194 139.856 1.00 232.79 ? 679  PHE C N     1 
ATOM   8854  C  CA    . PHE C 2 679  ? 103.233 108.743 139.789 1.00 232.79 ? 679  PHE C CA    1 
ATOM   8855  C  C     . PHE C 2 679  ? 104.609 108.168 140.057 1.00 232.79 ? 679  PHE C C     1 
ATOM   8856  O  O     . PHE C 2 679  ? 105.586 108.579 139.425 1.00 232.79 ? 679  PHE C O     1 
ATOM   8857  C  CB    . PHE C 2 679  ? 102.729 108.279 138.426 1.00 232.79 ? 679  PHE C CB    1 
ATOM   8858  C  CG    . PHE C 2 679  ? 103.155 106.900 138.059 1.00 232.79 ? 679  PHE C CG    1 
ATOM   8859  C  CD1   . PHE C 2 679  ? 102.596 105.802 138.685 1.00 232.79 ? 679  PHE C CD1   1 
ATOM   8860  C  CD2   . PHE C 2 679  ? 104.094 106.699 137.063 1.00 232.79 ? 679  PHE C CD2   1 
ATOM   8861  C  CE1   . PHE C 2 679  ? 102.975 104.528 138.338 1.00 232.79 ? 679  PHE C CE1   1 
ATOM   8862  C  CE2   . PHE C 2 679  ? 104.481 105.431 136.713 1.00 232.79 ? 679  PHE C CE2   1 
ATOM   8863  C  CZ    . PHE C 2 679  ? 103.919 104.341 137.349 1.00 232.79 ? 679  PHE C CZ    1 
ATOM   8864  N  N     . ASP C 2 680  ? 104.680 107.260 141.037 1.00 227.92 ? 680  ASP C N     1 
ATOM   8865  C  CA    . ASP C 2 680  ? 105.804 106.348 141.264 1.00 227.92 ? 680  ASP C CA    1 
ATOM   8866  C  C     . ASP C 2 680  ? 107.094 107.076 141.645 1.00 227.92 ? 680  ASP C C     1 
ATOM   8867  O  O     . ASP C 2 680  ? 108.168 106.474 141.712 1.00 227.92 ? 680  ASP C O     1 
ATOM   8868  C  CB    . ASP C 2 680  ? 106.024 105.464 140.033 1.00 227.92 ? 680  ASP C CB    1 
ATOM   8869  C  CG    . ASP C 2 680  ? 106.722 104.169 140.356 1.00 227.92 ? 680  ASP C CG    1 
ATOM   8870  O  OD1   . ASP C 2 680  ? 107.157 103.476 139.413 1.00 227.92 ? 680  ASP C OD1   1 
ATOM   8871  O  OD2   . ASP C 2 680  ? 106.843 103.852 141.555 1.00 227.92 ? 680  ASP C OD2   1 
ATOM   8872  N  N     . GLY C 2 681  ? 107.020 108.378 141.890 1.00 221.46 ? 681  GLY C N     1 
ATOM   8873  C  CA    . GLY C 2 681  ? 108.204 109.200 141.930 1.00 221.46 ? 681  GLY C CA    1 
ATOM   8874  C  C     . GLY C 2 681  ? 108.750 109.502 140.554 1.00 221.46 ? 681  GLY C C     1 
ATOM   8875  O  O     . GLY C 2 681  ? 109.796 110.137 140.418 1.00 221.46 ? 681  GLY C O     1 
ATOM   8876  N  N     . TYR C 2 682  ? 108.052 109.055 139.522 1.00 209.10 ? 682  TYR C N     1 
ATOM   8877  C  CA    . TYR C 2 682  ? 108.543 109.248 138.177 1.00 209.10 ? 682  TYR C CA    1 
ATOM   8878  C  C     . TYR C 2 682  ? 108.082 110.561 137.590 1.00 209.10 ? 682  TYR C C     1 
ATOM   8879  O  O     . TYR C 2 682  ? 108.471 110.884 136.470 1.00 209.10 ? 682  TYR C O     1 
ATOM   8880  C  CB    . TYR C 2 682  ? 108.091 108.086 137.304 1.00 209.10 ? 682  TYR C CB    1 
ATOM   8881  C  CG    . TYR C 2 682  ? 108.955 106.852 137.374 1.00 209.10 ? 682  TYR C CG    1 
ATOM   8882  C  CD1   . TYR C 2 682  ? 109.594 106.378 136.245 1.00 209.10 ? 682  TYR C CD1   1 
ATOM   8883  C  CD2   . TYR C 2 682  ? 109.124 106.156 138.560 1.00 209.10 ? 682  TYR C CD2   1 
ATOM   8884  C  CE1   . TYR C 2 682  ? 110.374 105.243 136.284 1.00 209.10 ? 682  TYR C CE1   1 
ATOM   8885  C  CE2   . TYR C 2 682  ? 109.900 105.020 138.613 1.00 209.10 ? 682  TYR C CE2   1 
ATOM   8886  C  CZ    . TYR C 2 682  ? 110.524 104.571 137.472 1.00 209.10 ? 682  TYR C CZ    1 
ATOM   8887  O  OH    . TYR C 2 682  ? 111.304 103.444 137.522 1.00 209.10 ? 682  TYR C OH    1 
ATOM   8888  N  N     . ASN C 2 683  ? 107.254 111.314 138.306 1.00 251.33 ? 683  ASN C N     1 
ATOM   8889  C  CA    . ASN C 2 683  ? 106.917 112.673 137.918 1.00 251.33 ? 683  ASN C CA    1 
ATOM   8890  C  C     . ASN C 2 683  ? 107.785 113.702 138.610 1.00 251.33 ? 683  ASN C C     1 
ATOM   8891  O  O     . ASN C 2 683  ? 107.482 114.897 138.533 1.00 251.33 ? 683  ASN C O     1 
ATOM   8892  C  CB    . ASN C 2 683  ? 105.457 112.984 138.244 1.00 251.33 ? 683  ASN C CB    1 
ATOM   8893  C  CG    . ASN C 2 683  ? 104.504 112.227 137.377 1.00 251.33 ? 683  ASN C CG    1 
ATOM   8894  O  OD1   . ASN C 2 683  ? 103.989 111.196 137.774 1.00 251.33 ? 683  ASN C OD1   1 
ATOM   8895  N  ND2   . ASN C 2 683  ? 104.275 112.722 136.174 1.00 251.33 ? 683  ASN C ND2   1 
ATOM   8896  N  N     . PHE C 2 684  ? 108.836 113.262 139.288 1.00 248.80 ? 684  PHE C N     1 
ATOM   8897  C  CA    . PHE C 2 684  ? 109.573 114.130 140.189 1.00 248.80 ? 684  PHE C CA    1 
ATOM   8898  C  C     . PHE C 2 684  ? 110.383 115.154 139.418 1.00 248.80 ? 684  PHE C C     1 
ATOM   8899  O  O     . PHE C 2 684  ? 111.292 114.795 138.664 1.00 248.80 ? 684  PHE C O     1 
ATOM   8900  C  CB    . PHE C 2 684  ? 110.485 113.291 141.070 1.00 248.80 ? 684  PHE C CB    1 
ATOM   8901  C  CG    . PHE C 2 684  ? 110.991 114.015 142.266 1.00 248.80 ? 684  PHE C CG    1 
ATOM   8902  C  CD1   . PHE C 2 684  ? 110.109 114.565 143.180 1.00 248.80 ? 684  PHE C CD1   1 
ATOM   8903  C  CD2   . PHE C 2 684  ? 112.351 114.137 142.489 1.00 248.80 ? 684  PHE C CD2   1 
ATOM   8904  C  CE1   . PHE C 2 684  ? 110.571 115.232 144.298 1.00 248.80 ? 684  PHE C CE1   1 
ATOM   8905  C  CE2   . PHE C 2 684  ? 112.825 114.802 143.602 1.00 248.80 ? 684  PHE C CE2   1 
ATOM   8906  C  CZ    . PHE C 2 684  ? 111.931 115.352 144.509 1.00 248.80 ? 684  PHE C CZ    1 
ATOM   8907  N  N     . GLU C 2 685  ? 110.027 116.426 139.613 1.00 256.74 ? 685  GLU C N     1 
ATOM   8908  C  CA    . GLU C 2 685  ? 110.746 117.596 139.106 1.00 256.74 ? 685  GLU C CA    1 
ATOM   8909  C  C     . GLU C 2 685  ? 110.847 117.564 137.579 1.00 256.74 ? 685  GLU C C     1 
ATOM   8910  O  O     . GLU C 2 685  ? 111.919 117.424 136.998 1.00 256.74 ? 685  GLU C O     1 
ATOM   8911  C  CB    . GLU C 2 685  ? 112.127 117.719 139.759 1.00 256.74 ? 685  GLU C CB    1 
ATOM   8912  C  CG    . GLU C 2 685  ? 112.113 117.549 141.273 1.00 256.74 ? 685  GLU C CG    1 
ATOM   8913  C  CD    . GLU C 2 685  ? 110.992 118.319 141.951 1.00 256.74 ? 685  GLU C CD    1 
ATOM   8914  O  OE1   . GLU C 2 685  ? 111.110 119.552 142.092 1.00 256.74 ? 685  GLU C OE1   1 
ATOM   8915  O  OE2   . GLU C 2 685  ? 109.984 117.690 142.335 1.00 256.74 ? 685  GLU C OE2   1 
ATOM   8916  N  N     . ASP C 2 686  ? 109.674 117.675 136.958 1.00 275.89 ? 686  ASP C N     1 
ATOM   8917  C  CA    . ASP C 2 686  ? 109.412 117.765 135.521 1.00 275.89 ? 686  ASP C CA    1 
ATOM   8918  C  C     . ASP C 2 686  ? 109.787 116.492 134.788 1.00 275.89 ? 686  ASP C C     1 
ATOM   8919  O  O     . ASP C 2 686  ? 110.012 116.539 133.576 1.00 275.89 ? 686  ASP C O     1 
ATOM   8920  C  CB    . ASP C 2 686  ? 110.129 118.937 134.837 1.00 275.89 ? 686  ASP C CB    1 
ATOM   8921  C  CG    . ASP C 2 686  ? 110.182 120.161 135.705 1.00 275.89 ? 686  ASP C CG    1 
ATOM   8922  O  OD1   . ASP C 2 686  ? 109.116 120.591 136.188 1.00 275.89 ? 686  ASP C OD1   1 
ATOM   8923  O  OD2   . ASP C 2 686  ? 111.298 120.672 135.928 1.00 275.89 ? 686  ASP C OD2   1 
ATOM   8924  N  N     . ALA C 2 687  ? 109.867 115.362 135.467 1.00 261.13 ? 687  ALA C N     1 
ATOM   8925  C  CA    . ALA C 2 687  ? 110.113 114.115 134.771 1.00 261.13 ? 687  ALA C CA    1 
ATOM   8926  C  C     . ALA C 2 687  ? 108.812 113.615 134.157 1.00 261.13 ? 687  ALA C C     1 
ATOM   8927  O  O     . ALA C 2 687  ? 107.763 113.625 134.806 1.00 261.13 ? 687  ALA C O     1 
ATOM   8928  C  CB    . ALA C 2 687  ? 110.702 113.094 135.734 1.00 261.13 ? 687  ALA C CB    1 
ATOM   8929  N  N     . ILE C 2 688  ? 108.880 113.183 132.903 1.00 251.89 ? 688  ILE C N     1 
ATOM   8930  C  CA    . ILE C 2 688  ? 107.703 112.869 132.106 1.00 251.89 ? 688  ILE C CA    1 
ATOM   8931  C  C     . ILE C 2 688  ? 107.621 111.366 131.899 1.00 251.89 ? 688  ILE C C     1 
ATOM   8932  O  O     . ILE C 2 688  ? 108.609 110.731 131.516 1.00 251.89 ? 688  ILE C O     1 
ATOM   8933  C  CB    . ILE C 2 688  ? 107.761 113.611 130.759 1.00 251.89 ? 688  ILE C CB    1 
ATOM   8934  C  CG1   . ILE C 2 688  ? 107.828 115.118 131.000 1.00 251.89 ? 688  ILE C CG1   1 
ATOM   8935  C  CG2   . ILE C 2 688  ? 106.592 113.239 129.888 1.00 251.89 ? 688  ILE C CG2   1 
ATOM   8936  C  CD1   . ILE C 2 688  ? 107.803 115.936 129.732 1.00 251.89 ? 688  ILE C CD1   1 
ATOM   8937  N  N     . VAL C 2 689  ? 106.442 110.798 132.144 1.00 244.46 ? 689  VAL C N     1 
ATOM   8938  C  CA    . VAL C 2 689  ? 106.214 109.365 132.029 1.00 244.46 ? 689  VAL C CA    1 
ATOM   8939  C  C     . VAL C 2 689  ? 105.249 109.122 130.882 1.00 244.46 ? 689  VAL C C     1 
ATOM   8940  O  O     . VAL C 2 689  ? 104.215 109.791 130.784 1.00 244.46 ? 689  VAL C O     1 
ATOM   8941  C  CB    . VAL C 2 689  ? 105.640 108.781 133.331 1.00 244.46 ? 689  VAL C CB    1 
ATOM   8942  C  CG1   . VAL C 2 689  ? 105.880 107.284 133.390 1.00 244.46 ? 689  VAL C CG1   1 
ATOM   8943  C  CG2   . VAL C 2 689  ? 106.194 109.502 134.528 1.00 244.46 ? 689  VAL C CG2   1 
ATOM   8944  N  N     . ILE C 2 690  ? 105.582 108.162 130.013 1.00 223.43 ? 690  ILE C N     1 
ATOM   8945  C  CA    . ILE C 2 690  ? 104.801 107.898 128.809 1.00 223.43 ? 690  ILE C CA    1 
ATOM   8946  C  C     . ILE C 2 690  ? 104.669 106.403 128.585 1.00 223.43 ? 690  ILE C C     1 
ATOM   8947  O  O     . ILE C 2 690  ? 105.361 105.592 129.200 1.00 223.43 ? 690  ILE C O     1 
ATOM   8948  C  CB    . ILE C 2 690  ? 105.423 108.507 127.538 1.00 223.43 ? 690  ILE C CB    1 
ATOM   8949  C  CG1   . ILE C 2 690  ? 106.826 107.950 127.348 1.00 223.43 ? 690  ILE C CG1   1 
ATOM   8950  C  CG2   . ILE C 2 690  ? 105.406 110.023 127.576 1.00 223.43 ? 690  ILE C CG2   1 
ATOM   8951  C  CD1   . ILE C 2 690  ? 107.510 108.489 126.141 1.00 223.43 ? 690  ILE C CD1   1 
ATOM   8952  N  N     . SER C 2 691  ? 103.797 106.054 127.645 1.00 210.27 ? 691  SER C N     1 
ATOM   8953  C  CA    . SER C 2 691  ? 103.546 104.692 127.207 1.00 210.27 ? 691  SER C CA    1 
ATOM   8954  C  C     . SER C 2 691  ? 104.512 104.277 126.103 1.00 210.27 ? 691  SER C C     1 
ATOM   8955  O  O     . SER C 2 691  ? 105.411 105.023 125.710 1.00 210.27 ? 691  SER C O     1 
ATOM   8956  C  CB    . SER C 2 691  ? 102.115 104.571 126.704 1.00 210.27 ? 691  SER C CB    1 
ATOM   8957  O  OG    . SER C 2 691  ? 101.951 103.373 125.985 1.00 210.27 ? 691  SER C OG    1 
ATOM   8958  N  N     . GLU C 2 692  ? 104.312 103.070 125.579 1.00 232.94 ? 692  GLU C N     1 
ATOM   8959  C  CA    . GLU C 2 692  ? 105.000 102.618 124.382 1.00 232.94 ? 692  GLU C CA    1 
ATOM   8960  C  C     . GLU C 2 692  ? 104.079 102.612 123.172 1.00 232.94 ? 692  GLU C C     1 
ATOM   8961  O  O     . GLU C 2 692  ? 104.553 102.544 122.029 1.00 232.94 ? 692  GLU C O     1 
ATOM   8962  C  CB    . GLU C 2 692  ? 105.586 101.223 124.630 1.00 232.94 ? 692  GLU C CB    1 
ATOM   8963  C  CG    . GLU C 2 692  ? 106.707 100.793 123.680 1.00 232.94 ? 692  GLU C CG    1 
ATOM   8964  C  CD    . GLU C 2 692  ? 106.214 100.032 122.463 1.00 232.94 ? 692  GLU C CD    1 
ATOM   8965  O  OE1   . GLU C 2 692  ? 105.231 99.278  122.593 1.00 232.94 ? 692  GLU C OE1   1 
ATOM   8966  O  OE2   . GLU C 2 692  ? 106.800 100.200 121.374 1.00 232.94 ? 692  GLU C OE2   1 
ATOM   8967  N  N     . GLU C 2 693  ? 102.778 102.750 123.413 1.00 238.13 ? 693  GLU C N     1 
ATOM   8968  C  CA    . GLU C 2 693  ? 101.736 102.752 122.397 1.00 238.13 ? 693  GLU C CA    1 
ATOM   8969  C  C     . GLU C 2 693  ? 101.942 103.856 121.365 1.00 238.13 ? 693  GLU C C     1 
ATOM   8970  O  O     . GLU C 2 693  ? 101.613 103.693 120.184 1.00 238.13 ? 693  GLU C O     1 
ATOM   8971  C  CB    . GLU C 2 693  ? 100.386 102.869 123.107 1.00 238.13 ? 693  GLU C CB    1 
ATOM   8972  C  CG    . GLU C 2 693  ? 99.206  103.037 122.206 1.00 238.13 ? 693  GLU C CG    1 
ATOM   8973  C  CD    . GLU C 2 693  ? 99.017  101.886 121.248 1.00 238.13 ? 693  GLU C CD    1 
ATOM   8974  O  OE1   . GLU C 2 693  ? 99.239  100.724 121.636 1.00 238.13 ? 693  GLU C OE1   1 
ATOM   8975  O  OE2   . GLU C 2 693  ? 98.688  102.148 120.075 1.00 238.13 ? 693  GLU C OE2   1 
ATOM   8976  N  N     . LEU C 2 694  ? 102.544 104.959 121.806 1.00 211.52 ? 694  LEU C N     1 
ATOM   8977  C  CA    . LEU C 2 694  ? 102.950 106.020 120.895 1.00 211.52 ? 694  LEU C CA    1 
ATOM   8978  C  C     . LEU C 2 694  ? 104.021 105.533 119.935 1.00 211.52 ? 694  LEU C C     1 
ATOM   8979  O  O     . LEU C 2 694  ? 104.012 105.875 118.748 1.00 211.52 ? 694  LEU C O     1 
ATOM   8980  C  CB    . LEU C 2 694  ? 103.469 107.213 121.688 1.00 211.52 ? 694  LEU C CB    1 
ATOM   8981  C  CG    . LEU C 2 694  ? 102.678 107.641 122.921 1.00 211.52 ? 694  LEU C CG    1 
ATOM   8982  C  CD1   . LEU C 2 694  ? 103.293 107.105 124.216 1.00 211.52 ? 694  LEU C CD1   1 
ATOM   8983  C  CD2   . LEU C 2 694  ? 102.580 109.149 122.957 1.00 211.52 ? 694  LEU C CD2   1 
ATOM   8984  N  N     . LEU C 2 695  ? 104.955 104.725 120.432 1.00 222.30 ? 695  LEU C N     1 
ATOM   8985  C  CA    . LEU C 2 695  ? 105.943 104.124 119.553 1.00 222.30 ? 695  LEU C CA    1 
ATOM   8986  C  C     . LEU C 2 695  ? 105.371 102.980 118.749 1.00 222.30 ? 695  LEU C C     1 
ATOM   8987  O  O     . LEU C 2 695  ? 106.012 102.528 117.797 1.00 222.30 ? 695  LEU C O     1 
ATOM   8988  C  CB    . LEU C 2 695  ? 107.152 103.637 120.341 1.00 222.30 ? 695  LEU C CB    1 
ATOM   8989  C  CG    . LEU C 2 695  ? 107.869 104.708 121.162 1.00 222.30 ? 695  LEU C CG    1 
ATOM   8990  C  CD1   . LEU C 2 695  ? 107.475 104.703 122.627 1.00 222.30 ? 695  LEU C CD1   1 
ATOM   8991  C  CD2   . LEU C 2 695  ? 109.367 104.547 121.011 1.00 222.30 ? 695  LEU C CD2   1 
ATOM   8992  N  N     . LYS C 2 696  ? 104.196 102.500 119.112 1.00 228.76 ? 696  LYS C N     1 
ATOM   8993  C  CA    . LYS C 2 696  ? 103.461 101.617 118.230 1.00 228.76 ? 696  LYS C CA    1 
ATOM   8994  C  C     . LYS C 2 696  ? 102.649 102.369 117.188 1.00 228.76 ? 696  LYS C C     1 
ATOM   8995  O  O     . LYS C 2 696  ? 101.974 101.735 116.373 1.00 228.76 ? 696  LYS C O     1 
ATOM   8996  C  CB    . LYS C 2 696  ? 102.573 100.701 119.051 1.00 228.76 ? 696  LYS C CB    1 
ATOM   8997  C  CG    . LYS C 2 696  ? 103.419 99.841  119.930 1.00 228.76 ? 696  LYS C CG    1 
ATOM   8998  C  CD    . LYS C 2 696  ? 102.705 98.602  120.356 1.00 228.76 ? 696  LYS C CD    1 
ATOM   8999  C  CE    . LYS C 2 696  ? 101.955 98.915  121.613 1.00 228.76 ? 696  LYS C CE    1 
ATOM   9000  N  NZ    . LYS C 2 696  ? 102.887 99.545  122.581 1.00 228.76 ? 696  LYS C NZ    1 
ATOM   9001  N  N     . ARG C 2 697  ? 102.686 103.697 117.201 1.00 221.27 ? 697  ARG C N     1 
ATOM   9002  C  CA    . ARG C 2 697  ? 102.234 104.465 116.052 1.00 221.27 ? 697  ARG C CA    1 
ATOM   9003  C  C     . ARG C 2 697  ? 103.269 105.497 115.658 1.00 221.27 ? 697  ARG C C     1 
ATOM   9004  O  O     . ARG C 2 697  ? 102.922 106.513 115.044 1.00 221.27 ? 697  ARG C O     1 
ATOM   9005  C  CB    . ARG C 2 697  ? 100.923 105.175 116.316 1.00 221.27 ? 697  ARG C CB    1 
ATOM   9006  C  CG    . ARG C 2 697  ? 99.756  104.284 116.628 1.00 221.27 ? 697  ARG C CG    1 
ATOM   9007  C  CD    . ARG C 2 697  ? 98.603  105.124 117.142 1.00 221.27 ? 697  ARG C CD    1 
ATOM   9008  N  NE    . ARG C 2 697  ? 99.065  106.326 117.836 1.00 221.27 ? 697  ARG C NE    1 
ATOM   9009  C  CZ    . ARG C 2 697  ? 99.402  106.366 119.121 1.00 221.27 ? 697  ARG C CZ    1 
ATOM   9010  N  NH1   . ARG C 2 697  ? 99.355  105.267 119.846 1.00 221.27 ? 697  ARG C NH1   1 
ATOM   9011  N  NH2   . ARG C 2 697  ? 99.817  107.491 119.674 1.00 221.27 ? 697  ARG C NH2   1 
ATOM   9012  N  N     . ASP C 2 698  ? 104.542 105.223 115.998 1.00 232.32 ? 698  ASP C N     1 
ATOM   9013  C  CA    . ASP C 2 698  ? 105.738 106.059 115.755 1.00 232.32 ? 698  ASP C CA    1 
ATOM   9014  C  C     . ASP C 2 698  ? 105.497 107.545 116.001 1.00 232.32 ? 698  ASP C C     1 
ATOM   9015  O  O     . ASP C 2 698  ? 105.896 108.394 115.201 1.00 232.32 ? 698  ASP C O     1 
ATOM   9016  C  CB    . ASP C 2 698  ? 106.333 105.834 114.357 1.00 232.32 ? 698  ASP C CB    1 
ATOM   9017  C  CG    . ASP C 2 698  ? 105.330 106.009 113.239 1.00 232.32 ? 698  ASP C CG    1 
ATOM   9018  O  OD1   . ASP C 2 698  ? 105.155 107.144 112.751 1.00 232.32 ? 698  ASP C OD1   1 
ATOM   9019  O  OD2   . ASP C 2 698  ? 104.691 105.006 112.867 1.00 232.32 ? 698  ASP C OD2   1 
ATOM   9020  N  N     . PHE C 2 699  ? 104.835 107.861 117.108 1.00 212.07 ? 699  PHE C N     1 
ATOM   9021  C  CA    . PHE C 2 699  ? 104.548 109.249 117.412 1.00 212.07 ? 699  PHE C CA    1 
ATOM   9022  C  C     . PHE C 2 699  ? 105.826 109.994 117.748 1.00 212.07 ? 699  PHE C C     1 
ATOM   9023  O  O     . PHE C 2 699  ? 106.768 109.428 118.305 1.00 212.07 ? 699  PHE C O     1 
ATOM   9024  C  CB    . PHE C 2 699  ? 103.560 109.351 118.560 1.00 212.07 ? 699  PHE C CB    1 
ATOM   9025  C  CG    . PHE C 2 699  ? 102.156 109.493 118.109 1.00 212.07 ? 699  PHE C CG    1 
ATOM   9026  C  CD1   . PHE C 2 699  ? 101.726 108.856 116.964 1.00 212.07 ? 699  PHE C CD1   1 
ATOM   9027  C  CD2   . PHE C 2 699  ? 101.274 110.296 118.803 1.00 212.07 ? 699  PHE C CD2   1 
ATOM   9028  C  CE1   . PHE C 2 699  ? 100.441 108.994 116.536 1.00 212.07 ? 699  PHE C CE1   1 
ATOM   9029  C  CE2   . PHE C 2 699  ? 99.984  110.450 118.374 1.00 212.07 ? 699  PHE C CE2   1 
ATOM   9030  C  CZ    . PHE C 2 699  ? 99.563  109.793 117.245 1.00 212.07 ? 699  PHE C CZ    1 
ATOM   9031  N  N     . TYR C 2 700  ? 105.873 111.252 117.307 1.00 227.74 ? 700  TYR C N     1 
ATOM   9032  C  CA    . TYR C 2 700  ? 106.974 112.189 117.505 1.00 227.74 ? 700  TYR C CA    1 
ATOM   9033  C  C     . TYR C 2 700  ? 108.299 111.696 116.938 1.00 227.74 ? 700  TYR C C     1 
ATOM   9034  O  O     . TYR C 2 700  ? 109.361 112.189 117.326 1.00 227.74 ? 700  TYR C O     1 
ATOM   9035  C  CB    . TYR C 2 700  ? 107.138 112.518 118.988 1.00 227.74 ? 700  TYR C CB    1 
ATOM   9036  C  CG    . TYR C 2 700  ? 105.990 113.289 119.564 1.00 227.74 ? 700  TYR C CG    1 
ATOM   9037  C  CD1   . TYR C 2 700  ? 104.963 112.647 120.240 1.00 227.74 ? 700  TYR C CD1   1 
ATOM   9038  C  CD2   . TYR C 2 700  ? 105.929 114.664 119.426 1.00 227.74 ? 700  TYR C CD2   1 
ATOM   9039  C  CE1   . TYR C 2 700  ? 103.907 113.365 120.770 1.00 227.74 ? 700  TYR C CE1   1 
ATOM   9040  C  CE2   . TYR C 2 700  ? 104.886 115.384 119.943 1.00 227.74 ? 700  TYR C CE2   1 
ATOM   9041  C  CZ    . TYR C 2 700  ? 103.875 114.736 120.615 1.00 227.74 ? 700  TYR C CZ    1 
ATOM   9042  O  OH    . TYR C 2 700  ? 102.832 115.471 121.131 1.00 227.74 ? 700  TYR C OH    1 
ATOM   9043  N  N     . THR C 2 701  ? 108.257 110.749 116.013 1.00 214.07 ? 701  THR C N     1 
ATOM   9044  C  CA    . THR C 2 701  ? 109.488 110.195 115.486 1.00 214.07 ? 701  THR C CA    1 
ATOM   9045  C  C     . THR C 2 701  ? 110.078 111.126 114.444 1.00 214.07 ? 701  THR C C     1 
ATOM   9046  O  O     . THR C 2 701  ? 109.445 111.432 113.432 1.00 214.07 ? 701  THR C O     1 
ATOM   9047  C  CB    . THR C 2 701  ? 109.228 108.835 114.871 1.00 214.07 ? 701  THR C CB    1 
ATOM   9048  O  OG1   . THR C 2 701  ? 108.675 107.969 115.867 1.00 214.07 ? 701  THR C OG1   1 
ATOM   9049  C  CG2   . THR C 2 701  ? 110.517 108.262 114.345 1.00 214.07 ? 701  THR C CG2   1 
ATOM   9050  N  N     . SER C 2 702  ? 111.300 111.577 114.694 1.00 237.89 ? 702  SER C N     1 
ATOM   9051  C  CA    . SER C 2 702  ? 111.936 112.555 113.833 1.00 237.89 ? 702  SER C CA    1 
ATOM   9052  C  C     . SER C 2 702  ? 113.086 111.889 113.098 1.00 237.89 ? 702  SER C C     1 
ATOM   9053  O  O     . SER C 2 702  ? 113.560 110.816 113.479 1.00 237.89 ? 702  SER C O     1 
ATOM   9054  C  CB    . SER C 2 702  ? 112.417 113.764 114.632 1.00 237.89 ? 702  SER C CB    1 
ATOM   9055  O  OG    . SER C 2 702  ? 113.075 114.680 113.781 1.00 237.89 ? 702  SER C OG    1 
ATOM   9056  N  N     . ILE C 2 703  ? 113.510 112.520 112.000 1.00 238.07 ? 703  ILE C N     1 
ATOM   9057  C  CA    . ILE C 2 703  ? 114.602 112.029 111.169 1.00 238.07 ? 703  ILE C CA    1 
ATOM   9058  C  C     . ILE C 2 703  ? 115.495 113.207 110.803 1.00 238.07 ? 703  ILE C C     1 
ATOM   9059  O  O     . ILE C 2 703  ? 115.030 114.249 110.340 1.00 238.07 ? 703  ILE C O     1 
ATOM   9060  C  CB    . ILE C 2 703  ? 114.102 111.336 109.881 1.00 238.07 ? 703  ILE C CB    1 
ATOM   9061  C  CG1   . ILE C 2 703  ? 113.160 110.177 110.191 1.00 238.07 ? 703  ILE C CG1   1 
ATOM   9062  C  CG2   . ILE C 2 703  ? 115.261 110.801 109.081 1.00 238.07 ? 703  ILE C CG2   1 
ATOM   9063  C  CD1   . ILE C 2 703  ? 112.380 109.716 109.024 1.00 238.07 ? 703  ILE C CD1   1 
ATOM   9064  N  N     . HIS C 2 704  ? 116.795 113.027 110.999 1.00 266.86 ? 704  HIS C N     1 
ATOM   9065  C  CA    . HIS C 2 704  ? 117.739 114.097 110.736 1.00 266.86 ? 704  HIS C CA    1 
ATOM   9066  C  C     . HIS C 2 704  ? 118.687 113.747 109.612 1.00 266.86 ? 704  HIS C C     1 
ATOM   9067  O  O     . HIS C 2 704  ? 119.132 112.604 109.479 1.00 266.86 ? 704  HIS C O     1 
ATOM   9068  C  CB    . HIS C 2 704  ? 118.538 114.438 111.976 1.00 266.86 ? 704  HIS C CB    1 
ATOM   9069  C  CG    . HIS C 2 704  ? 117.746 115.203 112.978 1.00 266.86 ? 704  HIS C CG    1 
ATOM   9070  N  ND1   . HIS C 2 704  ? 117.584 116.566 112.904 1.00 266.86 ? 704  HIS C ND1   1 
ATOM   9071  C  CD2   . HIS C 2 704  ? 116.996 114.790 114.023 1.00 266.86 ? 704  HIS C CD2   1 
ATOM   9072  C  CE1   . HIS C 2 704  ? 116.822 116.967 113.904 1.00 266.86 ? 704  HIS C CE1   1 
ATOM   9073  N  NE2   . HIS C 2 704  ? 116.437 115.906 114.585 1.00 266.86 ? 704  HIS C NE2   1 
ATOM   9074  N  N     . ILE C 2 705  ? 119.003 114.757 108.830 1.00 272.61 ? 705  ILE C N     1 
ATOM   9075  C  CA    . ILE C 2 705  ? 120.019 114.658 107.801 1.00 272.61 ? 705  ILE C CA    1 
ATOM   9076  C  C     . ILE C 2 705  ? 121.324 115.153 108.384 1.00 272.61 ? 705  ILE C C     1 
ATOM   9077  O  O     . ILE C 2 705  ? 121.365 116.198 109.039 1.00 272.61 ? 705  ILE C O     1 
ATOM   9078  C  CB    . ILE C 2 705  ? 119.633 115.482 106.569 1.00 272.61 ? 705  ILE C CB    1 
ATOM   9079  C  CG1   . ILE C 2 705  ? 118.173 115.232 106.199 1.00 272.61 ? 705  ILE C CG1   1 
ATOM   9080  C  CG2   . ILE C 2 705  ? 120.585 115.178 105.417 1.00 272.61 ? 705  ILE C CG2   1 
ATOM   9081  C  CD1   . ILE C 2 705  ? 117.765 115.834 104.869 1.00 272.61 ? 705  ILE C CD1   1 
ATOM   9082  N  N     . GLU C 2 706  ? 122.391 114.413 108.143 1.00 267.61 ? 706  GLU C N     1 
ATOM   9083  C  CA    . GLU C 2 706  ? 123.713 114.796 108.607 1.00 267.61 ? 706  GLU C CA    1 
ATOM   9084  C  C     . GLU C 2 706  ? 124.624 115.034 107.414 1.00 267.61 ? 706  GLU C C     1 
ATOM   9085  O  O     . GLU C 2 706  ? 124.728 114.182 106.524 1.00 267.61 ? 706  GLU C O     1 
ATOM   9086  C  CB    . GLU C 2 706  ? 124.291 113.732 109.529 1.00 267.61 ? 706  GLU C CB    1 
ATOM   9087  C  CG    . GLU C 2 706  ? 125.729 113.984 109.859 1.00 267.61 ? 706  GLU C CG    1 
ATOM   9088  C  CD    . GLU C 2 706  ? 125.940 115.274 110.596 1.00 267.61 ? 706  GLU C CD    1 
ATOM   9089  O  OE1   . GLU C 2 706  ? 125.108 115.627 111.455 1.00 267.61 ? 706  GLU C OE1   1 
ATOM   9090  O  OE2   . GLU C 2 706  ? 126.937 115.953 110.295 1.00 267.61 ? 706  GLU C OE2   1 
ATOM   9091  N  N     . ARG C 2 707  ? 125.282 116.183 107.402 1.00 260.27 ? 707  ARG C N     1 
ATOM   9092  C  CA    . ARG C 2 707  ? 126.200 116.542 106.339 1.00 260.27 ? 707  ARG C CA    1 
ATOM   9093  C  C     . ARG C 2 707  ? 127.619 116.213 106.771 1.00 260.27 ? 707  ARG C C     1 
ATOM   9094  O  O     . ARG C 2 707  ? 128.093 116.703 107.799 1.00 260.27 ? 707  ARG C O     1 
ATOM   9095  C  CB    . ARG C 2 707  ? 126.086 118.023 105.988 1.00 260.27 ? 707  ARG C CB    1 
ATOM   9096  C  CG    . ARG C 2 707  ? 127.313 118.570 105.283 1.00 260.27 ? 707  ARG C CG    1 
ATOM   9097  C  CD    . ARG C 2 707  ? 127.072 119.966 104.796 1.00 260.27 ? 707  ARG C CD    1 
ATOM   9098  N  NE    . ARG C 2 707  ? 128.187 120.443 103.989 1.00 260.27 ? 707  ARG C NE    1 
ATOM   9099  C  CZ    . ARG C 2 707  ? 128.300 121.689 103.547 1.00 260.27 ? 707  ARG C CZ    1 
ATOM   9100  N  NH1   . ARG C 2 707  ? 127.365 122.581 103.837 1.00 260.27 ? 707  ARG C NH1   1 
ATOM   9101  N  NH2   . ARG C 2 707  ? 129.346 122.046 102.816 1.00 260.27 ? 707  ARG C NH2   1 
ATOM   9102  N  N     . TYR C 2 708  ? 128.285 115.381 105.997 1.00 262.75 ? 708  TYR C N     1 
ATOM   9103  C  CA    . TYR C 2 708  ? 129.722 115.248 106.107 1.00 262.75 ? 708  TYR C CA    1 
ATOM   9104  C  C     . TYR C 2 708  ? 130.365 115.887 104.897 1.00 262.75 ? 708  TYR C C     1 
ATOM   9105  O  O     . TYR C 2 708  ? 129.742 116.069 103.849 1.00 262.75 ? 708  TYR C O     1 
ATOM   9106  C  CB    . TYR C 2 708  ? 130.142 113.790 106.201 1.00 262.75 ? 708  TYR C CB    1 
ATOM   9107  C  CG    . TYR C 2 708  ? 129.436 113.033 107.271 1.00 262.75 ? 708  TYR C CG    1 
ATOM   9108  C  CD1   . TYR C 2 708  ? 128.292 112.306 106.985 1.00 262.75 ? 708  TYR C CD1   1 
ATOM   9109  C  CD2   . TYR C 2 708  ? 129.916 113.031 108.567 1.00 262.75 ? 708  TYR C CD2   1 
ATOM   9110  C  CE1   . TYR C 2 708  ? 127.642 111.603 107.960 1.00 262.75 ? 708  TYR C CE1   1 
ATOM   9111  C  CE2   . TYR C 2 708  ? 129.274 112.328 109.553 1.00 262.75 ? 708  TYR C CE2   1 
ATOM   9112  C  CZ    . TYR C 2 708  ? 128.140 111.609 109.241 1.00 262.75 ? 708  TYR C CZ    1 
ATOM   9113  O  OH    . TYR C 2 708  ? 127.479 110.908 110.216 1.00 262.75 ? 708  TYR C OH    1 
ATOM   9114  N  N     . GLU C 2 709  ? 131.637 116.222 105.052 1.00 288.22 ? 709  GLU C N     1 
ATOM   9115  C  CA    . GLU C 2 709  ? 132.384 116.809 103.956 1.00 288.22 ? 709  GLU C CA    1 
ATOM   9116  C  C     . GLU C 2 709  ? 133.853 116.502 104.158 1.00 288.22 ? 709  GLU C C     1 
ATOM   9117  O  O     . GLU C 2 709  ? 134.448 116.941 105.145 1.00 288.22 ? 709  GLU C O     1 
ATOM   9118  C  CB    . GLU C 2 709  ? 132.164 118.317 103.877 1.00 288.22 ? 709  GLU C CB    1 
ATOM   9119  C  CG    . GLU C 2 709  ? 132.670 118.921 102.590 1.00 288.22 ? 709  GLU C CG    1 
ATOM   9120  C  CD    . GLU C 2 709  ? 132.049 120.266 102.310 1.00 288.22 ? 709  GLU C CD    1 
ATOM   9121  O  OE1   . GLU C 2 709  ? 131.297 120.758 103.175 1.00 288.22 ? 709  GLU C OE1   1 
ATOM   9122  O  OE2   . GLU C 2 709  ? 132.289 120.818 101.214 1.00 288.22 ? 709  GLU C OE2   1 
ATOM   9123  N  N     . ILE C 2 710  ? 134.427 115.745 103.236 1.00 309.36 ? 710  ILE C N     1 
ATOM   9124  C  CA    . ILE C 2 710  ? 135.860 115.521 103.217 1.00 309.36 ? 710  ILE C CA    1 
ATOM   9125  C  C     . ILE C 2 710  ? 136.397 116.148 101.939 1.00 309.36 ? 710  ILE C C     1 
ATOM   9126  O  O     . ILE C 2 710  ? 135.675 116.319 100.951 1.00 309.36 ? 710  ILE C O     1 
ATOM   9127  C  CB    . ILE C 2 710  ? 136.220 114.018 103.321 1.00 309.36 ? 710  ILE C CB    1 
ATOM   9128  C  CG1   . ILE C 2 710  ? 137.680 113.828 103.751 1.00 309.36 ? 710  ILE C CG1   1 
ATOM   9129  C  CG2   . ILE C 2 710  ? 135.916 113.285 102.030 1.00 309.36 ? 710  ILE C CG2   1 
ATOM   9130  C  CD1   . ILE C 2 710  ? 138.160 112.406 103.743 1.00 309.36 ? 710  ILE C CD1   1 
ATOM   9131  N  N     . GLU C 2 711  ? 137.653 116.563 101.994 1.00 357.09 ? 711  GLU C N     1 
ATOM   9132  C  CA    . GLU C 2 711  ? 138.384 117.017 100.831 1.00 357.09 ? 711  GLU C CA    1 
ATOM   9133  C  C     . GLU C 2 711  ? 139.723 116.295 100.764 1.00 357.09 ? 711  GLU C C     1 
ATOM   9134  O  O     . GLU C 2 711  ? 140.212 115.746 101.756 1.00 357.09 ? 711  GLU C O     1 
ATOM   9135  C  CB    . GLU C 2 711  ? 138.599 118.535 100.873 1.00 357.09 ? 711  GLU C CB    1 
ATOM   9136  C  CG    . GLU C 2 711  ? 139.394 119.020 102.074 1.00 357.09 ? 711  GLU C CG    1 
ATOM   9137  C  CD    . GLU C 2 711  ? 140.862 119.198 101.757 1.00 357.09 ? 711  GLU C CD    1 
ATOM   9138  O  OE1   . GLU C 2 711  ? 141.204 119.133 100.563 1.00 357.09 ? 711  GLU C OE1   1 
ATOM   9139  O  OE2   . GLU C 2 711  ? 141.666 119.389 102.692 1.00 357.09 ? 711  GLU C OE2   1 
ATOM   9140  N  N     . ALA C 2 712  ? 140.312 116.302 99.576  1.00 363.39 ? 712  ALA C N     1 
ATOM   9141  C  CA    . ALA C 2 712  ? 141.705 115.939 99.391  1.00 363.39 ? 712  ALA C CA    1 
ATOM   9142  C  C     . ALA C 2 712  ? 142.360 117.058 98.608  1.00 363.39 ? 712  ALA C C     1 
ATOM   9143  O  O     . ALA C 2 712  ? 141.754 117.629 97.699  1.00 363.39 ? 712  ALA C O     1 
ATOM   9144  C  CB    . ALA C 2 712  ? 141.872 114.605 98.666  1.00 363.39 ? 712  ALA C CB    1 
ATOM   9145  N  N     . ARG C 2 713  ? 143.574 117.406 98.998  1.00 363.01 ? 713  ARG C N     1 
ATOM   9146  C  CA    . ARG C 2 713  ? 144.192 118.592 98.441  1.00 363.01 ? 713  ARG C CA    1 
ATOM   9147  C  C     . ARG C 2 713  ? 145.607 118.298 97.990  1.00 363.01 ? 713  ARG C C     1 
ATOM   9148  O  O     . ARG C 2 713  ? 146.025 117.137 97.934  1.00 363.01 ? 713  ARG C O     1 
ATOM   9149  C  CB    . ARG C 2 713  ? 144.198 119.709 99.473  1.00 363.01 ? 713  ARG C CB    1 
ATOM   9150  C  CG    . ARG C 2 713  ? 144.619 119.257 100.835 1.00 363.01 ? 713  ARG C CG    1 
ATOM   9151  C  CD    . ARG C 2 713  ? 144.678 120.436 101.769 1.00 363.01 ? 713  ARG C CD    1 
ATOM   9152  N  NE    . ARG C 2 713  ? 144.684 120.018 103.163 1.00 363.01 ? 713  ARG C NE    1 
ATOM   9153  C  CZ    . ARG C 2 713  ? 144.606 120.860 104.184 1.00 363.01 ? 713  ARG C CZ    1 
ATOM   9154  N  NH1   . ARG C 2 713  ? 144.513 122.162 103.959 1.00 363.01 ? 713  ARG C NH1   1 
ATOM   9155  N  NH2   . ARG C 2 713  ? 144.623 120.400 105.426 1.00 363.01 ? 713  ARG C NH2   1 
ATOM   9156  N  N     . ASP C 2 714  ? 146.349 119.348 97.673  1.00 397.45 ? 714  ASP C N     1 
ATOM   9157  C  CA    . ASP C 2 714  ? 147.739 119.191 97.294  1.00 397.45 ? 714  ASP C CA    1 
ATOM   9158  C  C     . ASP C 2 714  ? 148.618 119.180 98.534  1.00 397.45 ? 714  ASP C C     1 
ATOM   9159  O  O     . ASP C 2 714  ? 148.411 119.956 99.469  1.00 397.45 ? 714  ASP C O     1 
ATOM   9160  C  CB    . ASP C 2 714  ? 148.159 120.311 96.348  1.00 397.45 ? 714  ASP C CB    1 
ATOM   9161  C  CG    . ASP C 2 714  ? 147.325 120.335 95.093  1.00 397.45 ? 714  ASP C CG    1 
ATOM   9162  O  OD1   . ASP C 2 714  ? 146.851 119.254 94.688  1.00 397.45 ? 714  ASP C OD1   1 
ATOM   9163  O  OD2   . ASP C 2 714  ? 147.128 121.427 94.522  1.00 397.45 ? 714  ASP C OD2   1 
ATOM   9164  N  N     . THR C 2 715  ? 149.595 118.283 98.540  1.00 405.81 ? 715  THR C N     1 
ATOM   9165  C  CA    . THR C 2 715  ? 150.537 118.158 99.639  1.00 405.81 ? 715  THR C CA    1 
ATOM   9166  C  C     . THR C 2 715  ? 151.938 118.280 99.073  1.00 405.81 ? 715  THR C C     1 
ATOM   9167  O  O     . THR C 2 715  ? 152.257 117.649 98.060  1.00 405.81 ? 715  THR C O     1 
ATOM   9168  C  CB    . THR C 2 715  ? 150.368 116.822 100.359 1.00 405.81 ? 715  THR C CB    1 
ATOM   9169  O  OG1   . THR C 2 715  ? 149.008 116.677 100.781 1.00 405.81 ? 715  THR C OG1   1 
ATOM   9170  C  CG2   . THR C 2 715  ? 151.283 116.721 101.558 1.00 405.81 ? 715  THR C CG2   1 
ATOM   9171  N  N     . LYS C 2 716  ? 152.774 119.075 99.736  1.00 385.99 ? 716  LYS C N     1 
ATOM   9172  C  CA    . LYS C 2 716  ? 154.122 119.351 99.266  1.00 385.99 ? 716  LYS C CA    1 
ATOM   9173  C  C     . LYS C 2 716  ? 155.059 118.160 99.380  1.00 385.99 ? 716  LYS C C     1 
ATOM   9174  O  O     . LYS C 2 716  ? 156.185 118.238 98.883  1.00 385.99 ? 716  LYS C O     1 
ATOM   9175  C  CB    . LYS C 2 716  ? 154.677 120.545 100.031 1.00 385.99 ? 716  LYS C CB    1 
ATOM   9176  C  CG    . LYS C 2 716  ? 153.721 121.711 100.002 1.00 385.99 ? 716  LYS C CG    1 
ATOM   9177  C  CD    . LYS C 2 716  ? 154.436 123.025 100.185 1.00 385.99 ? 716  LYS C CD    1 
ATOM   9178  C  CE    . LYS C 2 716  ? 153.679 124.136 99.478  1.00 385.99 ? 716  LYS C CE    1 
ATOM   9179  N  NZ    . LYS C 2 716  ? 153.539 123.853 98.020  1.00 385.99 ? 716  LYS C NZ    1 
ATOM   9180  N  N     . LEU C 2 717  ? 154.642 117.072 100.023 1.00 387.95 ? 717  LEU C N     1 
ATOM   9181  C  CA    . LEU C 2 717  ? 155.337 115.797 99.920  1.00 387.95 ? 717  LEU C CA    1 
ATOM   9182  C  C     . LEU C 2 717  ? 154.535 114.791 99.107  1.00 387.95 ? 717  LEU C C     1 
ATOM   9183  O  O     . LEU C 2 717  ? 154.819 113.593 99.156  1.00 387.95 ? 717  LEU C O     1 
ATOM   9184  C  CB    . LEU C 2 717  ? 155.668 115.254 101.311 1.00 387.95 ? 717  LEU C CB    1 
ATOM   9185  C  CG    . LEU C 2 717  ? 154.568 115.122 102.370 1.00 387.95 ? 717  LEU C CG    1 
ATOM   9186  C  CD1   . LEU C 2 717  ? 153.849 113.787 102.361 1.00 387.95 ? 717  LEU C CD1   1 
ATOM   9187  C  CD2   . LEU C 2 717  ? 155.147 115.394 103.743 1.00 387.95 ? 717  LEU C CD2   1 
ATOM   9188  N  N     . GLY C 2 718  ? 153.540 115.259 98.361  1.00 401.13 ? 718  GLY C N     1 
ATOM   9189  C  CA    . GLY C 2 718  ? 152.756 114.398 97.515  1.00 401.13 ? 718  GLY C CA    1 
ATOM   9190  C  C     . GLY C 2 718  ? 151.299 114.373 97.920  1.00 401.13 ? 718  GLY C C     1 
ATOM   9191  O  O     . GLY C 2 718  ? 150.947 113.926 99.017  1.00 401.13 ? 718  GLY C O     1 
ATOM   9192  N  N     . PRO C 2 719  ? 150.423 114.826 97.017  1.00 409.52 ? 719  PRO C N     1 
ATOM   9193  C  CA    . PRO C 2 719  ? 149.022 115.082 97.381  1.00 409.52 ? 719  PRO C CA    1 
ATOM   9194  C  C     . PRO C 2 719  ? 148.227 113.826 97.699  1.00 409.52 ? 719  PRO C C     1 
ATOM   9195  O  O     . PRO C 2 719  ? 148.528 112.730 97.224  1.00 409.52 ? 719  PRO C O     1 
ATOM   9196  C  CB    . PRO C 2 719  ? 148.463 115.779 96.137  1.00 409.52 ? 719  PRO C CB    1 
ATOM   9197  C  CG    . PRO C 2 719  ? 149.652 116.352 95.460  1.00 409.52 ? 719  PRO C CG    1 
ATOM   9198  C  CD    . PRO C 2 719  ? 150.740 115.355 95.681  1.00 409.52 ? 719  PRO C CD    1 
ATOM   9199  N  N     . GLU C 2 720  ? 147.193 114.010 98.509  1.00 382.01 ? 720  GLU C N     1 
ATOM   9200  C  CA    . GLU C 2 720  ? 146.305 112.922 98.870  1.00 382.01 ? 720  GLU C CA    1 
ATOM   9201  C  C     . GLU C 2 720  ? 145.329 112.634 97.743  1.00 382.01 ? 720  GLU C C     1 
ATOM   9202  O  O     . GLU C 2 720  ? 144.752 113.541 97.141  1.00 382.01 ? 720  GLU C O     1 
ATOM   9203  C  CB    . GLU C 2 720  ? 145.536 113.273 100.135 1.00 382.01 ? 720  GLU C CB    1 
ATOM   9204  C  CG    . GLU C 2 720  ? 146.423 113.552 101.328 1.00 382.01 ? 720  GLU C CG    1 
ATOM   9205  C  CD    . GLU C 2 720  ? 145.639 113.671 102.618 1.00 382.01 ? 720  GLU C CD    1 
ATOM   9206  O  OE1   . GLU C 2 720  ? 144.420 113.925 102.554 1.00 382.01 ? 720  GLU C OE1   1 
ATOM   9207  O  OE2   . GLU C 2 720  ? 146.242 113.508 103.698 1.00 382.01 ? 720  GLU C OE2   1 
ATOM   9208  N  N     . ARG C 2 721  ? 145.152 111.354 97.454  1.00 343.96 ? 721  ARG C N     1 
ATOM   9209  C  CA    . ARG C 2 721  ? 144.192 110.915 96.461  1.00 343.96 ? 721  ARG C CA    1 
ATOM   9210  C  C     . ARG C 2 721  ? 143.090 110.139 97.156  1.00 343.96 ? 721  ARG C C     1 
ATOM   9211  O  O     . ARG C 2 721  ? 143.196 109.786 98.331  1.00 343.96 ? 721  ARG C O     1 
ATOM   9212  C  CB    . ARG C 2 721  ? 144.852 110.051 95.388  1.00 343.96 ? 721  ARG C CB    1 
ATOM   9213  C  CG    . ARG C 2 721  ? 146.238 110.501 95.022  1.00 343.96 ? 721  ARG C CG    1 
ATOM   9214  C  CD    . ARG C 2 721  ? 146.778 109.653 93.898  1.00 343.96 ? 721  ARG C CD    1 
ATOM   9215  N  NE    . ARG C 2 721  ? 148.078 110.123 93.442  1.00 343.96 ? 721  ARG C NE    1 
ATOM   9216  C  CZ    . ARG C 2 721  ? 149.236 109.672 93.908  1.00 343.96 ? 721  ARG C CZ    1 
ATOM   9217  N  NH1   . ARG C 2 721  ? 149.256 108.739 94.848  1.00 343.96 ? 721  ARG C NH1   1 
ATOM   9218  N  NH2   . ARG C 2 721  ? 150.373 110.154 93.431  1.00 343.96 ? 721  ARG C NH2   1 
ATOM   9219  N  N     . ILE C 2 722  ? 142.013 109.888 96.416  1.00 300.80 ? 722  ILE C N     1 
ATOM   9220  C  CA    . ILE C 2 722  ? 140.859 109.144 96.919  1.00 300.80 ? 722  ILE C CA    1 
ATOM   9221  C  C     . ILE C 2 722  ? 140.601 108.018 95.924  1.00 300.80 ? 722  ILE C C     1 
ATOM   9222  O  O     . ILE C 2 722  ? 139.959 108.211 94.887  1.00 300.80 ? 722  ILE C O     1 
ATOM   9223  C  CB    . ILE C 2 722  ? 139.619 110.020 97.098  1.00 300.80 ? 722  ILE C CB    1 
ATOM   9224  C  CG1   . ILE C 2 722  ? 139.918 111.160 98.067  1.00 300.80 ? 722  ILE C CG1   1 
ATOM   9225  C  CG2   . ILE C 2 722  ? 138.458 109.193 97.622  1.00 300.80 ? 722  ILE C CG2   1 
ATOM   9226  C  CD1   . ILE C 2 722  ? 138.837 112.190 98.136  1.00 300.80 ? 722  ILE C CD1   1 
ATOM   9227  N  N     . THR C 2 723  ? 141.108 106.841 96.230  1.00 302.22 ? 723  THR C N     1 
ATOM   9228  C  CA    . THR C 2 723  ? 140.950 105.671 95.394  1.00 302.22 ? 723  THR C CA    1 
ATOM   9229  C  C     . THR C 2 723  ? 140.182 104.609 96.161  1.00 302.22 ? 723  THR C C     1 
ATOM   9230  O  O     . THR C 2 723  ? 139.659 104.855 97.251  1.00 302.22 ? 723  THR C O     1 
ATOM   9231  C  CB    . THR C 2 723  ? 142.311 105.153 94.944  1.00 302.22 ? 723  THR C CB    1 
ATOM   9232  O  OG1   . THR C 2 723  ? 142.142 103.913 94.249  1.00 302.22 ? 723  THR C OG1   1 
ATOM   9233  C  CG2   . THR C 2 723  ? 143.198 104.927 96.145  1.00 302.22 ? 723  THR C CG2   1 
ATOM   9234  N  N     . ARG C 2 724  ? 140.107 103.414 95.582  1.00 314.56 ? 724  ARG C N     1 
ATOM   9235  C  CA    . ARG C 2 724  ? 139.422 102.295 96.211  1.00 314.56 ? 724  ARG C CA    1 
ATOM   9236  C  C     . ARG C 2 724  ? 140.358 101.408 97.020  1.00 314.56 ? 724  ARG C C     1 
ATOM   9237  O  O     . ARG C 2 724  ? 140.013 100.254 97.305  1.00 314.56 ? 724  ARG C O     1 
ATOM   9238  C  CB    . ARG C 2 724  ? 138.699 101.466 95.154  1.00 314.56 ? 724  ARG C CB    1 
ATOM   9239  C  CG    . ARG C 2 724  ? 137.325 101.019 95.566  1.00 314.56 ? 724  ARG C CG    1 
ATOM   9240  C  CD    . ARG C 2 724  ? 136.930 99.741  94.854  1.00 314.56 ? 724  ARG C CD    1 
ATOM   9241  N  NE    . ARG C 2 724  ? 135.519 99.435  95.060  1.00 314.56 ? 724  ARG C NE    1 
ATOM   9242  C  CZ    . ARG C 2 724  ? 135.056 98.707  96.071  1.00 314.56 ? 724  ARG C CZ    1 
ATOM   9243  N  NH1   . ARG C 2 724  ? 135.894 98.208  96.967  1.00 314.56 ? 724  ARG C NH1   1 
ATOM   9244  N  NH2   . ARG C 2 724  ? 133.755 98.482  96.187  1.00 314.56 ? 724  ARG C NH2   1 
ATOM   9245  N  N     . ASP C 2 725  ? 141.531 101.906 97.405  1.00 350.95 ? 725  ASP C N     1 
ATOM   9246  C  CA    . ASP C 2 725  ? 142.436 101.060 98.168  1.00 350.95 ? 725  ASP C CA    1 
ATOM   9247  C  C     . ASP C 2 725  ? 143.277 101.891 99.119  1.00 350.95 ? 725  ASP C C     1 
ATOM   9248  O  O     . ASP C 2 725  ? 143.756 102.974 98.777  1.00 350.95 ? 725  ASP C O     1 
ATOM   9249  C  CB    . ASP C 2 725  ? 143.343 100.235 97.262  1.00 350.95 ? 725  ASP C CB    1 
ATOM   9250  C  CG    . ASP C 2 725  ? 143.670 98.892  97.861  1.00 350.95 ? 725  ASP C CG    1 
ATOM   9251  O  OD1   . ASP C 2 725  ? 144.010 98.845  99.062  1.00 350.95 ? 725  ASP C OD1   1 
ATOM   9252  O  OD2   . ASP C 2 725  ? 143.567 97.882  97.139  1.00 350.95 ? 725  ASP C OD2   1 
ATOM   9253  N  N     . ILE C 2 726  ? 143.461 101.339 100.313 1.00 357.23 ? 726  ILE C N     1 
ATOM   9254  C  CA    . ILE C 2 726  ? 144.151 101.947 101.446 1.00 357.23 ? 726  ILE C CA    1 
ATOM   9255  C  C     . ILE C 2 726  ? 144.931 100.819 102.112 1.00 357.23 ? 726  ILE C C     1 
ATOM   9256  O  O     . ILE C 2 726  ? 144.481 99.666  102.041 1.00 357.23 ? 726  ILE C O     1 
ATOM   9257  C  CB    . ILE C 2 726  ? 143.145 102.655 102.377 1.00 357.23 ? 726  ILE C CB    1 
ATOM   9258  C  CG1   . ILE C 2 726  ? 142.723 104.000 101.779 1.00 357.23 ? 726  ILE C CG1   1 
ATOM   9259  C  CG2   . ILE C 2 726  ? 143.623 102.799 103.812 1.00 357.23 ? 726  ILE C CG2   1 
ATOM   9260  C  CD1   . ILE C 2 726  ? 143.894 104.903 101.505 1.00 357.23 ? 726  ILE C CD1   1 
ATOM   9261  N  N     . PRO C 2 727  ? 146.160 101.092 102.660 1.00 342.88 ? 727  PRO C N     1 
ATOM   9262  C  CA    . PRO C 2 727  ? 147.017 100.056 103.266 1.00 342.88 ? 727  PRO C CA    1 
ATOM   9263  C  C     . PRO C 2 727  ? 146.392 98.979  104.145 1.00 342.88 ? 727  PRO C C     1 
ATOM   9264  O  O     . PRO C 2 727  ? 145.669 99.270  105.102 1.00 342.88 ? 727  PRO C O     1 
ATOM   9265  C  CB    . PRO C 2 727  ? 147.992 100.902 104.088 1.00 342.88 ? 727  PRO C CB    1 
ATOM   9266  C  CG    . PRO C 2 727  ? 148.170 102.132 103.264 1.00 342.88 ? 727  PRO C CG    1 
ATOM   9267  C  CD    . PRO C 2 727  ? 146.922 102.337 102.442 1.00 342.88 ? 727  PRO C CD    1 
ATOM   9268  N  N     . HIS C 2 728  ? 146.673 97.724  103.763 1.00 343.31 ? 728  HIS C N     1 
ATOM   9269  C  CA    . HIS C 2 728  ? 146.393 96.510  104.543 1.00 343.31 ? 728  HIS C CA    1 
ATOM   9270  C  C     . HIS C 2 728  ? 144.904 96.325  104.810 1.00 343.31 ? 728  HIS C C     1 
ATOM   9271  O  O     . HIS C 2 728  ? 144.488 95.945  105.905 1.00 343.31 ? 728  HIS C O     1 
ATOM   9272  C  CB    . HIS C 2 728  ? 147.175 96.494  105.857 1.00 343.31 ? 728  HIS C CB    1 
ATOM   9273  C  CG    . HIS C 2 728  ? 148.554 97.056  105.745 1.00 343.31 ? 728  HIS C CG    1 
ATOM   9274  N  ND1   . HIS C 2 728  ? 148.856 98.352  106.099 1.00 343.31 ? 728  HIS C ND1   1 
ATOM   9275  C  CD2   . HIS C 2 728  ? 149.710 96.503  105.312 1.00 343.31 ? 728  HIS C CD2   1 
ATOM   9276  C  CE1   . HIS C 2 728  ? 150.141 98.574  105.889 1.00 343.31 ? 728  HIS C CE1   1 
ATOM   9277  N  NE2   . HIS C 2 728  ? 150.683 97.467  105.415 1.00 343.31 ? 728  HIS C NE2   1 
ATOM   9278  N  N     . LEU C 2 729  ? 144.094 96.583  103.797 1.00 343.52 ? 729  LEU C N     1 
ATOM   9279  C  CA    . LEU C 2 729  ? 142.653 96.477  103.941 1.00 343.52 ? 729  LEU C CA    1 
ATOM   9280  C  C     . LEU C 2 729  ? 142.138 95.359  103.050 1.00 343.52 ? 729  LEU C C     1 
ATOM   9281  O  O     . LEU C 2 729  ? 142.474 95.300  101.864 1.00 343.52 ? 729  LEU C O     1 
ATOM   9282  C  CB    . LEU C 2 729  ? 141.976 97.803  103.604 1.00 343.52 ? 729  LEU C CB    1 
ATOM   9283  C  CG    . LEU C 2 729  ? 142.320 99.000  104.494 1.00 343.52 ? 729  LEU C CG    1 
ATOM   9284  C  CD1   . LEU C 2 729  ? 141.238 100.034 104.339 1.00 343.52 ? 729  LEU C CD1   1 
ATOM   9285  C  CD2   . LEU C 2 729  ? 142.463 98.623  105.961 1.00 343.52 ? 729  LEU C CD2   1 
ATOM   9286  N  N     . SER C 2 730  ? 141.337 94.471  103.629 1.00 328.82 ? 730  SER C N     1 
ATOM   9287  C  CA    . SER C 2 730  ? 140.747 93.358  102.903 1.00 328.82 ? 730  SER C CA    1 
ATOM   9288  C  C     . SER C 2 730  ? 139.372 93.756  102.377 1.00 328.82 ? 730  SER C C     1 
ATOM   9289  O  O     . SER C 2 730  ? 138.994 94.929  102.374 1.00 328.82 ? 730  SER C O     1 
ATOM   9290  C  CB    . SER C 2 730  ? 140.640 92.132  103.799 1.00 328.82 ? 730  SER C CB    1 
ATOM   9291  O  OG    . SER C 2 730  ? 139.378 92.114  104.442 1.00 328.82 ? 730  SER C OG    1 
ATOM   9292  N  N     . GLU C 2 731  ? 138.603 92.763  101.930 1.00 309.66 ? 731  GLU C N     1 
ATOM   9293  C  CA    . GLU C 2 731  ? 137.225 93.008  101.532 1.00 309.66 ? 731  GLU C CA    1 
ATOM   9294  C  C     . GLU C 2 731  ? 136.337 93.316  102.729 1.00 309.66 ? 731  GLU C C     1 
ATOM   9295  O  O     . GLU C 2 731  ? 135.325 94.012  102.577 1.00 309.66 ? 731  GLU C O     1 
ATOM   9296  C  CB    . GLU C 2 731  ? 136.697 91.806  100.738 1.00 309.66 ? 731  GLU C CB    1 
ATOM   9297  C  CG    . GLU C 2 731  ? 135.302 91.979  100.156 1.00 309.66 ? 731  GLU C CG    1 
ATOM   9298  C  CD    . GLU C 2 731  ? 135.168 93.256  99.348  1.00 309.66 ? 731  GLU C CD    1 
ATOM   9299  O  OE1   . GLU C 2 731  ? 136.067 93.559  98.537  1.00 309.66 ? 731  GLU C OE1   1 
ATOM   9300  O  OE2   . GLU C 2 731  ? 134.175 93.983  99.548  1.00 309.66 ? 731  GLU C OE2   1 
ATOM   9301  N  N     . ALA C 2 732  ? 136.751 92.897  103.931 1.00 297.79 ? 732  ALA C N     1 
ATOM   9302  C  CA    . ALA C 2 732  ? 135.984 93.132  105.150 1.00 297.79 ? 732  ALA C CA    1 
ATOM   9303  C  C     . ALA C 2 732  ? 135.809 94.609  105.488 1.00 297.79 ? 732  ALA C C     1 
ATOM   9304  O  O     . ALA C 2 732  ? 134.973 94.944  106.333 1.00 297.79 ? 732  ALA C O     1 
ATOM   9305  C  CB    . ALA C 2 732  ? 136.649 92.418  106.325 1.00 297.79 ? 732  ALA C CB    1 
ATOM   9306  N  N     . ALA C 2 733  ? 136.572 95.500  104.859 1.00 292.34 ? 733  ALA C N     1 
ATOM   9307  C  CA    . ALA C 2 733  ? 136.319 96.930  104.939 1.00 292.34 ? 733  ALA C CA    1 
ATOM   9308  C  C     . ALA C 2 733  ? 135.589 97.463  103.714 1.00 292.34 ? 733  ALA C C     1 
ATOM   9309  O  O     . ALA C 2 733  ? 134.762 98.371  103.825 1.00 292.34 ? 733  ALA C O     1 
ATOM   9310  C  CB    . ALA C 2 733  ? 137.639 97.683  105.122 1.00 292.34 ? 733  ALA C CB    1 
ATOM   9311  N  N     . LEU C 2 734  ? 135.865 96.904  102.539 1.00 296.39 ? 734  LEU C N     1 
ATOM   9312  C  CA    . LEU C 2 734  ? 135.426 97.505  101.289 1.00 296.39 ? 734  LEU C CA    1 
ATOM   9313  C  C     . LEU C 2 734  ? 134.106 96.939  100.797 1.00 296.39 ? 734  LEU C C     1 
ATOM   9314  O  O     . LEU C 2 734  ? 133.853 96.938  99.587  1.00 296.39 ? 734  LEU C O     1 
ATOM   9315  C  CB    . LEU C 2 734  ? 136.502 97.324  100.221 1.00 296.39 ? 734  LEU C CB    1 
ATOM   9316  C  CG    . LEU C 2 734  ? 137.953 97.603  100.617 1.00 296.39 ? 734  LEU C CG    1 
ATOM   9317  C  CD1   . LEU C 2 734  ? 138.869 97.395  99.421  1.00 296.39 ? 734  LEU C CD1   1 
ATOM   9318  C  CD2   . LEU C 2 734  ? 138.142 98.987  101.201 1.00 296.39 ? 734  LEU C CD2   1 
ATOM   9319  N  N     . ARG C 2 735  ? 133.247 96.470  101.695 1.00 288.33 ? 735  ARG C N     1 
ATOM   9320  C  CA    . ARG C 2 735  ? 132.001 95.824  101.304 1.00 288.33 ? 735  ARG C CA    1 
ATOM   9321  C  C     . ARG C 2 735  ? 130.861 96.801  101.088 1.00 288.33 ? 735  ARG C C     1 
ATOM   9322  O  O     . ARG C 2 735  ? 129.692 96.410  101.170 1.00 288.33 ? 735  ARG C O     1 
ATOM   9323  C  CB    . ARG C 2 735  ? 131.599 94.798  102.357 1.00 288.33 ? 735  ARG C CB    1 
ATOM   9324  C  CG    . ARG C 2 735  ? 132.127 93.409  102.082 1.00 288.33 ? 735  ARG C CG    1 
ATOM   9325  C  CD    . ARG C 2 735  ? 131.895 92.476  103.251 1.00 288.33 ? 735  ARG C CD    1 
ATOM   9326  N  NE    . ARG C 2 735  ? 132.661 92.856  104.433 1.00 288.33 ? 735  ARG C NE    1 
ATOM   9327  C  CZ    . ARG C 2 735  ? 132.138 93.454  105.497 1.00 288.33 ? 735  ARG C CZ    1 
ATOM   9328  N  NH1   . ARG C 2 735  ? 130.848 93.754  105.515 1.00 288.33 ? 735  ARG C NH1   1 
ATOM   9329  N  NH2   . ARG C 2 735  ? 132.899 93.761  106.536 1.00 288.33 ? 735  ARG C NH2   1 
ATOM   9330  N  N     . ASP C 2 736  ? 131.175 98.063  100.829 1.00 295.20 ? 736  ASP C N     1 
ATOM   9331  C  CA    . ASP C 2 736  ? 130.186 99.126  100.775 1.00 295.20 ? 736  ASP C CA    1 
ATOM   9332  C  C     . ASP C 2 736  ? 130.437 100.093 99.630  1.00 295.20 ? 736  ASP C C     1 
ATOM   9333  O  O     . ASP C 2 736  ? 129.515 100.773 99.167  1.00 295.20 ? 736  ASP C O     1 
ATOM   9334  C  CB    . ASP C 2 736  ? 130.199 99.865  102.106 1.00 295.20 ? 736  ASP C CB    1 
ATOM   9335  C  CG    . ASP C 2 736  ? 131.610 100.118 102.601 1.00 295.20 ? 736  ASP C CG    1 
ATOM   9336  O  OD1   . ASP C 2 736  ? 132.559 99.546  102.017 1.00 295.20 ? 736  ASP C OD1   1 
ATOM   9337  O  OD2   . ASP C 2 736  ? 131.777 100.878 103.571 1.00 295.20 ? 736  ASP C OD2   1 
ATOM   9338  N  N     . LEU C 2 737  ? 131.677 100.148 99.162  1.00 318.41 ? 737  LEU C N     1 
ATOM   9339  C  CA    . LEU C 2 737  ? 132.107 101.263 98.341  1.00 318.41 ? 737  LEU C CA    1 
ATOM   9340  C  C     . LEU C 2 737  ? 131.707 101.082 96.883  1.00 318.41 ? 737  LEU C C     1 
ATOM   9341  O  O     . LEU C 2 737  ? 131.281 100.010 96.449  1.00 318.41 ? 737  LEU C O     1 
ATOM   9342  C  CB    . LEU C 2 737  ? 133.618 101.425 98.409  1.00 318.41 ? 737  LEU C CB    1 
ATOM   9343  C  CG    . LEU C 2 737  ? 134.278 101.230 99.767  1.00 318.41 ? 737  LEU C CG    1 
ATOM   9344  C  CD1   . LEU C 2 737  ? 135.769 101.318 99.596  1.00 318.41 ? 737  LEU C CD1   1 
ATOM   9345  C  CD2   . LEU C 2 737  ? 133.804 102.275 100.730 1.00 318.41 ? 737  LEU C CD2   1 
ATOM   9346  N  N     . ASP C 2 738  ? 131.859 102.163 96.126  1.00 344.92 ? 738  ASP C N     1 
ATOM   9347  C  CA    . ASP C 2 738  ? 131.858 102.094 94.673  1.00 344.92 ? 738  ASP C CA    1 
ATOM   9348  C  C     . ASP C 2 738  ? 133.281 101.805 94.217  1.00 344.92 ? 738  ASP C C     1 
ATOM   9349  O  O     . ASP C 2 738  ? 134.154 101.475 95.018  1.00 344.92 ? 738  ASP C O     1 
ATOM   9350  C  CB    . ASP C 2 738  ? 131.300 103.379 94.059  1.00 344.92 ? 738  ASP C CB    1 
ATOM   9351  C  CG    . ASP C 2 738  ? 132.249 104.585 94.179  1.00 344.92 ? 738  ASP C CG    1 
ATOM   9352  O  OD1   . ASP C 2 738  ? 133.116 104.654 95.079  1.00 344.92 ? 738  ASP C OD1   1 
ATOM   9353  O  OD2   . ASP C 2 738  ? 132.123 105.485 93.330  1.00 344.92 ? 738  ASP C OD2   1 
ATOM   9354  N  N     . GLU C 2 739  ? 133.546 101.974 92.933  1.00 353.73 ? 739  GLU C N     1 
ATOM   9355  C  CA    . GLU C 2 739  ? 134.904 101.800 92.451  1.00 353.73 ? 739  GLU C CA    1 
ATOM   9356  C  C     . GLU C 2 739  ? 135.793 102.991 92.766  1.00 353.73 ? 739  GLU C C     1 
ATOM   9357  O  O     . GLU C 2 739  ? 137.018 102.855 92.739  1.00 353.73 ? 739  GLU C O     1 
ATOM   9358  C  CB    . GLU C 2 739  ? 134.881 101.533 90.953  1.00 353.73 ? 739  GLU C CB    1 
ATOM   9359  C  CG    . GLU C 2 739  ? 134.395 100.138 90.611  1.00 353.73 ? 739  GLU C CG    1 
ATOM   9360  C  CD    . GLU C 2 739  ? 132.884 100.034 90.554  1.00 353.73 ? 739  GLU C CD    1 
ATOM   9361  O  OE1   . GLU C 2 739  ? 132.203 101.068 90.716  1.00 353.73 ? 739  GLU C OE1   1 
ATOM   9362  O  OE2   . GLU C 2 739  ? 132.376 98.914  90.352  1.00 353.73 ? 739  GLU C OE2   1 
ATOM   9363  N  N     . GLU C 2 740  ? 135.216 104.151 93.063  1.00 330.17 ? 740  GLU C N     1 
ATOM   9364  C  CA    . GLU C 2 740  ? 136.034 105.253 93.546  1.00 330.17 ? 740  GLU C CA    1 
ATOM   9365  C  C     . GLU C 2 740  ? 136.415 105.079 95.003  1.00 330.17 ? 740  GLU C C     1 
ATOM   9366  O  O     . GLU C 2 740  ? 137.371 105.712 95.462  1.00 330.17 ? 740  GLU C O     1 
ATOM   9367  C  CB    . GLU C 2 740  ? 135.298 106.575 93.389  1.00 330.17 ? 740  GLU C CB    1 
ATOM   9368  C  CG    . GLU C 2 740  ? 134.778 106.845 92.006  1.00 330.17 ? 740  GLU C CG    1 
ATOM   9369  C  CD    . GLU C 2 740  ? 133.757 107.954 92.011  1.00 330.17 ? 740  GLU C CD    1 
ATOM   9370  O  OE1   . GLU C 2 740  ? 133.401 108.421 93.114  1.00 330.17 ? 740  GLU C OE1   1 
ATOM   9371  O  OE2   . GLU C 2 740  ? 133.313 108.366 90.923  1.00 330.17 ? 740  GLU C OE2   1 
ATOM   9372  N  N     . GLY C 2 741  ? 135.683 104.253 95.738  1.00 328.92 ? 741  GLY C N     1 
ATOM   9373  C  CA    . GLY C 2 741  ? 135.851 104.153 97.166  1.00 328.92 ? 741  GLY C CA    1 
ATOM   9374  C  C     . GLY C 2 741  ? 134.791 104.865 97.972  1.00 328.92 ? 741  GLY C C     1 
ATOM   9375  O  O     . GLY C 2 741  ? 134.913 104.938 99.197  1.00 328.92 ? 741  GLY C O     1 
ATOM   9376  N  N     . VAL C 2 742  ? 133.780 105.402 97.332  1.00 315.49 ? 742  VAL C N     1 
ATOM   9377  C  CA    . VAL C 2 742  ? 132.671 106.042 98.021  1.00 315.49 ? 742  VAL C CA    1 
ATOM   9378  C  C     . VAL C 2 742  ? 131.561 105.019 98.163  1.00 315.49 ? 742  VAL C C     1 
ATOM   9379  O  O     . VAL C 2 742  ? 131.312 104.234 97.244  1.00 315.49 ? 742  VAL C O     1 
ATOM   9380  C  CB    . VAL C 2 742  ? 132.198 107.277 97.238  1.00 315.49 ? 742  VAL C CB    1 
ATOM   9381  C  CG1   . VAL C 2 742  ? 131.251 108.113 98.072  1.00 315.49 ? 742  VAL C CG1   1 
ATOM   9382  C  CG2   . VAL C 2 742  ? 133.389 108.086 96.792  1.00 315.49 ? 742  VAL C CG2   1 
ATOM   9383  N  N     . VAL C 2 743  ? 130.903 105.013 99.323  1.00 278.81 ? 743  VAL C N     1 
ATOM   9384  C  CA    . VAL C 2 743  ? 129.827 104.064 99.566  1.00 278.81 ? 743  VAL C CA    1 
ATOM   9385  C  C     . VAL C 2 743  ? 128.654 104.382 98.647  1.00 278.81 ? 743  VAL C C     1 
ATOM   9386  O  O     . VAL C 2 743  ? 128.387 105.548 98.331  1.00 278.81 ? 743  VAL C O     1 
ATOM   9387  C  CB    . VAL C 2 743  ? 129.437 104.109 101.054 1.00 278.81 ? 743  VAL C CB    1 
ATOM   9388  C  CG1   . VAL C 2 743  ? 128.277 103.184 101.381 1.00 278.81 ? 743  VAL C CG1   1 
ATOM   9389  C  CG2   . VAL C 2 743  ? 130.622 103.738 101.903 1.00 278.81 ? 743  VAL C CG2   1 
ATOM   9390  N  N     . ARG C 2 744  ? 128.006 103.329 98.150  1.00 227.19 ? 744  ARG C N     1 
ATOM   9391  C  CA    . ARG C 2 744  ? 126.812 103.471 97.335  1.00 227.19 ? 744  ARG C CA    1 
ATOM   9392  C  C     . ARG C 2 744  ? 125.700 104.157 98.119  1.00 227.19 ? 744  ARG C C     1 
ATOM   9393  O  O     . ARG C 2 744  ? 125.650 104.107 99.350  1.00 227.19 ? 744  ARG C O     1 
ATOM   9394  C  CB    . ARG C 2 744  ? 126.359 102.094 96.843  1.00 227.19 ? 744  ARG C CB    1 
ATOM   9395  C  CG    . ARG C 2 744  ? 125.968 101.099 97.934  1.00 227.19 ? 744  ARG C CG    1 
ATOM   9396  C  CD    . ARG C 2 744  ? 124.455 100.993 98.097  1.00 227.19 ? 744  ARG C CD    1 
ATOM   9397  N  NE    . ARG C 2 744  ? 124.070 99.998  99.087  1.00 227.19 ? 744  ARG C NE    1 
ATOM   9398  C  CZ    . ARG C 2 744  ? 122.821 99.804  99.498  1.00 227.19 ? 744  ARG C CZ    1 
ATOM   9399  N  NH1   . ARG C 2 744  ? 121.837 100.536 98.997  1.00 227.19 ? 744  ARG C NH1   1 
ATOM   9400  N  NH2   . ARG C 2 744  ? 122.557 98.881  100.410 1.00 227.19 ? 744  ARG C NH2   1 
ATOM   9401  N  N     . ILE C 2 745  ? 124.796 104.795 97.384  1.00 212.43 ? 745  ILE C N     1 
ATOM   9402  C  CA    . ILE C 2 745  ? 123.696 105.519 98.000  1.00 212.43 ? 745  ILE C CA    1 
ATOM   9403  C  C     . ILE C 2 745  ? 122.690 104.536 9